2EVCA

Crystal structure of e. coli. methionine amino peptidase in complex with 5-(2-(trifluoromethyl)phenyl)furan-2-carboxylic acid
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
259
Chain Sequence
b'SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural analysis of metalloform-selective inhibition of methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 85
structure length 259
sequence length 259
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2evcA00
4KM3A 2GGCA 1QXZA 3L7GA 4U6JA 1C23A 5D6FA 3PKCA 1YW9A 2BHAA 2OAZA 4IKUA 4R60A 2NQ7A 3FMRA 2BHDA 4OOKA 3MX6A 1XNZA 5D6EA 2BWTA 2BHBA 4U70A 1YVMA 1QZYA 2DFIA 1CHMA 1BOAA 4MATA 1XGSA 3IU7A 2G6PA 1KP0A 5CDVA 4FUKA 1B6AA 1KQ0A 2ADUA 1YJ3A 4RZZA 2V6CA 2BWWA 2Q92A 3IU9A 4Z7MA 2BN7A 1W2MA 4IU6A 4EGEA 4ZWOA 3S6BA 3TAVA 3MR1A 4FLJA 1QXYA 1WL6A 2OKNA 4B28A 4U76A 1PV9A 2GA2A 3PKAA 2GG5A 1KQ9A 1YW7A 3CTZA 2BWSA 4PNCA 5JI6A 1C22A 4U71A 1QXWA 2Q8KA 4U75A 1R58A 2EA4A 1C21A 4FKCA 3IG4A 2GU5A 5CNXA 3CB5A 2Q96A 2BB7A 2Q93A 4HXXA 2GTXA 4PV4A 2GG8A 2BWVA 2EVCA 1XGNA 1A16A 2GU7A 2GG9A 4ZWPA 2Q95A 3FM3A 4FO7A 3TB5A 5JHUA 3D27A 5CDLA 3FMQA 4ZWUA 1C24A 4FLLA 1BN5A 4S2TP 4ZNGA 2HOWA 1WKMA 2BWUA 3RORA 3CB6A 3BIQA 3PKBA 2B3HA 4A6VA 1JAWA 2BWYA 5JFRA 2BHCA 1MATA 2GG2A 2GU4A 1R5GA 4IF7A 4S01A 1W7VA 2B3LA 1B59A 4FLIA 4U1BA 3MATA 4RZYA 4IECA 4U6CA 5CDEA 4S00A 4QR8A 1WN1A 5FCFA 3Q6DA 4IKTA 3BIPA 4FO8A 1N51A 1M35A 2V3YA 1WLRA 2EVOA 4IDYA 3PKEA 2NQ6A 4FLKA 2P9AA 4IKSA 1C27A 4S2RP 4A6WA 1R5HA 1O0XA 1WL9A 2V3XA 3PKDA 2GG0A 4U69A 2V3ZA 2MATA 3IU8A 4JUQA 4U6ZA 5CLSA 2BWXA 3RVAA 4RGZ1 5E5BA 1YW8A 2P99A 2GG7A 2ZSGA 3BITA 2GG3A 1WY2A 4U6EA 2B3KA 2EA2A 2Q94A 1XGOA 5CE6A 4IPAA 1Y1NA 2GU6A 2EVMA 4IKRA 4U6WA 5CIKA 2IW2A 4U73A 1WBQA 1XGMA 2BH3A 2GZ5A 2P98A 5FCHA 2GGBA 3L24A
chains in the Genus database with same CATH superfamily
4KM3A 2GGCA 1QXZA 3L7GA 4U6JA 1C23A 5D6FA 3PKCA 1YW9A 2BHAA 2OAZA 4IKUA 4R60A 2NQ7A 3FMRA 2BHDA 4OOKA 3MX6A 1XNZA 5D6EA 2BWTA 2BHBA 4U70A 1YVMA 1QZYA 2DFIA 1CHMA 1BOAA 4MATA 1XGSA 3IU7A 2G6PA 1KP0A 5CDVA 4FUKA 1B6AA 1KQ0A 2ADUA 1YJ3A 4RZZA 2V6CA 2BWWA 2Q92A 3IU9A 4Z7MA 2BN7A 1W2MA 4IU6A 4EGEA 4ZWOA 3S6BA 3TAVA 3MR1A 4FLJA 1QXYA 1WL6A 2OKNA 4B28A 4U76A 1PV9A 2GA2A 3PKAA 2GG5A 1KQ9A 1YW7A 3CTZA 2BWSA 4PNCA 5JI6A 1C22A 4U71A 1QXWA 2Q8KA 4U75A 1R58A 2EA4A 1C21A 4FKCA 3IG4A 2GU5A 5CNXA 3CB5A 2Q96A 2BB7A 2Q93A 4HXXA 2GTXA 4PV4A 2GG8A 2BWVA 2EVCA 1XGNA 1A16A 2GU7A 2GG9A 4ZWPA 2Q95A 3FM3A 4FO7A 3TB5A 5JHUA 3D27A 5CDLA 3FMQA 4ZWUA 1C24A 4FLLA 1BN5A 4S2TP 4ZNGA 2HOWA 1WKMA 2BWUA 3RORA 3CB6A 3BIQA 3PKBA 2B3HA 4A6VA 1JAWA 2BWYA 5JFRA 2BHCA 1MATA 2GG2A 2GU4A 1R5GA 4IF7A 4S01A 1W7VA 2B3LA 1B59A 4FLIA 4U1BA 3MATA 4RZYA 4IECA 4U6CA 5CDEA 4S00A 4QR8A 1WN1A 5FCFA 3Q6DA 4IKTA 3BIPA 4FO8A 1N51A 1M35A 2V3YA 1WLRA 2EVOA 4IDYA 3PKEA 2NQ6A 4FLKA 2P9AA 4IKSA 1C27A 4S2RP 4A6WA 1R5HA 1O0XA 1WL9A 2V3XA 3PKDA 2GG0A 4U69A 2V3ZA 2MATA 3IU8A 4JUQA 4U6ZA 5CLSA 2BWXA 3RVAA 4RGZ1 5E5BA 1YW8A 2P99A 2GG7A 2ZSGA 3BITA 2GG3A 1WY2A 4U6EA 2B3KA 2EA2A 2Q94A 1XGOA 5CE6A 4IPAA 1Y1NA 2GU6A 2EVMA 4IKRA 4U6WA 5CIKA 2IW2A 4U73A 1WBQA 1XGMA 2BH3A 2GZ5A 2P98A 5FCHA 2GGBA 3L24A
chains in the Genus database with same CATH topology
4KM3A 2GGCA 1QXZA 3L7GA 4U6JA 1C23A 5D6FA 3PKCA 1YW9A 2BHAA 2OAZA 4IKUA 4R60A 2NQ7A 3FMRA 2BHDA 4OOKA 3MX6A 1XNZA 5D6EA 2BWTA 2BHBA 4U70A 1YVMA 1QZYA 2DFIA 1CHMA 1BOAA 4MATA 1XGSA 3IU7A 2G6PA 1KP0A 5CDVA 4FUKA 1B6AA 1KQ0A 2ADUA 1YJ3A 4RZZA 2V6CA 2BWWA 2Q92A 3IU9A 4Z7MA 2BN7A 1W2MA 4IU6A 4EGEA 4ZWOA 3S6BA 3TAVA 3MR1A 4FLJA 1QXYA 1WL6A 2OKNA 4B28A 4U76A 1PV9A 2GA2A 3PKAA 2GG5A 1KQ9A 1YW7A 3CTZA 2BWSA 4PNCA 5JI6A 1C22A 4U71A 1QXWA 2Q8KA 4U75A 1R58A 2EA4A 1C21A 4FKCA 3IG4A 2GU5A 5CNXA 3CB5A 2Q96A 2BB7A 2Q93A 4HXXA 2GTXA 4PV4A 2GG8A 2BWVA 2EVCA 1XGNA 1A16A 2GU7A 2GG9A 4ZWPA 2Q95A 3FM3A 4FO7A 3TB5A 5JHUA 3D27A 5CDLA 3FMQA 4ZWUA 1C24A 4FLLA 1BN5A 4S2TP 4ZNGA 2HOWA 1WKMA 2BWUA 3RORA 3CB6A 3BIQA 3PKBA 2B3HA 4A6VA 1JAWA 2BWYA 5JFRA 2BHCA 1MATA 2GG2A 2GU4A 1R5GA 4IF7A 4S01A 1W7VA 2B3LA 1B59A 4FLIA 4U1BA 3MATA 4RZYA 4IECA 4U6CA 5CDEA 4S00A 4QR8A 1WN1A 5FCFA 3Q6DA 4IKTA 3BIPA 4FO8A 1N51A 1M35A 2V3YA 1WLRA 2EVOA 4IDYA 3PKEA 2NQ6A 4FLKA 2P9AA 4IKSA 1C27A 4S2RP 4A6WA 1R5HA 1O0XA 1WL9A 2V3XA 3PKDA 2GG0A 4U69A 2V3ZA 2MATA 3IU8A 4JUQA 4U6ZA 5CLSA 2BWXA 3RVAA 4RGZ1 5E5BA 1YW8A 2P99A 2GG7A 2ZSGA 3BITA 2GG3A 1WY2A 4U6EA 2B3KA 2EA2A 2Q94A 1XGOA 5CE6A 4IPAA 1Y1NA 2GU6A 2EVMA 4IKRA 4U6WA 5CIKA 2IW2A 4U73A 1WBQA 1XGMA 2BH3A 2GZ5A 2P98A 5FCHA 2GGBA 3L24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KM3 A;  2GGC A;  1QXZ A;  3L7G A;  4U6J A;  1C23 A;  5D6F A;  3PKC A;  1YW9 A;  2BHA A;  2OAZ A;  4IKU A;  4R60 A;  2NQ7 A;  3FMR A;  2BHD A;  4OOK A;  3MX6 A;  1XNZ A;  5D6E A;  2BWT A;  2BHB A;  4U70 A;  1YVM A;  1QZY A;  2DFI A;  1CHM A;  1BOA A;  4MAT A;  1XGS A;  3IU7 A;  2G6P A;  1KP0 A;  5CDV A;  4FUK A;  1B6A A;  1KQ0 A;  2ADU A;  1YJ3 A;  4RZZ A;  2V6C A;  2BWW A;  2Q92 A;  3IU9 A;  4Z7M A;  2BN7 A;  1W2M A;  4IU6 A;  4EGE A;  4ZWO A;  3S6B A;  3TAV A;  3MR1 A;  4FLJ A;  1QXY A;  1WL6 A;  2OKN A;  4B28 A;  4U76 A;  1PV9 A;  2GA2 A;  3PKA A;  2GG5 A;  1KQ9 A;  1YW7 A;  3CTZ A;  2BWS A;  4PNC A;  5JI6 A;  1C22 A;  4U71 A;  1QXW A;  2Q8K A;  4U75 A;  1R58 A;  2EA4 A;  1C21 A;  4FKC A;  3IG4 A;  2GU5 A;  5CNX A;  3CB5 A;  2Q96 A;  2BB7 A;  2Q93 A;  4HXX A;  2GTX A;  4PV4 A;  2GG8 A;  2BWV A;  2EVC A;  1XGN A;  1A16 A;  2GU7 A;  2GG9 A;  4ZWP A;  2Q95 A;  3FM3 A;  4FO7 A;  3TB5 A;  5JHU A;  3D27 A;  5CDL A;  3FMQ A;  4ZWU A;  1C24 A;  4FLL A;  1BN5 A;  4S2T P;  4ZNG A;  2HOW A;  1WKM A;  2BWU A;  3ROR A;  3CB6 A;  3BIQ A;  3PKB A;  2B3H A;  4A6V A;  1JAW A;  2BWY A;  5JFR A;  2BHC A;  1MAT A;  2GG2 A;  2GU4 A;  1R5G A;  4IF7 A;  4S01 A;  1W7V A;  2B3L A;  1B59 A;  4FLI A;  4U1B A;  3MAT A;  4RZY A;  4IEC A;  4U6C A;  5CDE A;  4S00 A;  4QR8 A;  1WN1 A;  5FCF A;  3Q6D A;  4IKT A;  3BIP A;  4FO8 A;  1N51 A;  1M35 A;  2V3Y A;  1WLR A;  2EVO A;  4IDY A;  3PKE A;  2NQ6 A;  4FLK A;  2P9A A;  4IKS A;  1C27 A;  4S2R P;  4A6W A;  1R5H A;  1O0X A;  1WL9 A;  2V3X A;  3PKD A;  2GG0 A;  4U69 A;  2V3Z A;  2MAT A;  3IU8 A;  4JUQ A;  4U6Z A;  5CLS A;  2BWX A;  3RVA A;  4RGZ 1;  5E5B A;  1YW8 A;  2P99 A;  2GG7 A;  2ZSG A;  3BIT A;  2GG3 A;  1WY2 A;  4U6E A;  2B3K A;  2EA2 A;  2Q94 A;  1XGO A;  5CE6 A;  4IPA A;  1Y1N A;  2GU6 A;  2EVM A;  4IKR A;  4U6W A;  5CIK A;  2IW2 A;  4U73 A;  1WBQ A;  1XGM A;  2BH3 A;  2GZ5 A;  2P98 A;  5FCH A;  2GGB A;  3L24 A; 
#chains in the Genus database with same CATH topology
 4KM3 A;  2GGC A;  1QXZ A;  3L7G A;  4U6J A;  1C23 A;  5D6F A;  3PKC A;  1YW9 A;  2BHA A;  2OAZ A;  4IKU A;  4R60 A;  2NQ7 A;  3FMR A;  2BHD A;  4OOK A;  3MX6 A;  1XNZ A;  5D6E A;  2BWT A;  2BHB A;  4U70 A;  1YVM A;  1QZY A;  2DFI A;  1CHM A;  1BOA A;  4MAT A;  1XGS A;  3IU7 A;  2G6P A;  1KP0 A;  5CDV A;  4FUK A;  1B6A A;  1KQ0 A;  2ADU A;  1YJ3 A;  4RZZ A;  2V6C A;  2BWW A;  2Q92 A;  3IU9 A;  4Z7M A;  2BN7 A;  1W2M A;  4IU6 A;  4EGE A;  4ZWO A;  3S6B A;  3TAV A;  3MR1 A;  4FLJ A;  1QXY A;  1WL6 A;  2OKN A;  4B28 A;  4U76 A;  1PV9 A;  2GA2 A;  3PKA A;  2GG5 A;  1KQ9 A;  1YW7 A;  3CTZ A;  2BWS A;  4PNC A;  5JI6 A;  1C22 A;  4U71 A;  1QXW A;  2Q8K A;  4U75 A;  1R58 A;  2EA4 A;  1C21 A;  4FKC A;  3IG4 A;  2GU5 A;  5CNX A;  3CB5 A;  2Q96 A;  2BB7 A;  2Q93 A;  4HXX A;  2GTX A;  4PV4 A;  2GG8 A;  2BWV A;  2EVC A;  1XGN A;  1A16 A;  2GU7 A;  2GG9 A;  4ZWP A;  2Q95 A;  3FM3 A;  4FO7 A;  3TB5 A;  5JHU A;  3D27 A;  5CDL A;  3FMQ A;  4ZWU A;  1C24 A;  4FLL A;  1BN5 A;  4S2T P;  4ZNG A;  2HOW A;  1WKM A;  2BWU A;  3ROR A;  3CB6 A;  3BIQ A;  3PKB A;  2B3H A;  4A6V A;  1JAW A;  2BWY A;  5JFR A;  2BHC A;  1MAT A;  2GG2 A;  2GU4 A;  1R5G A;  4IF7 A;  4S01 A;  1W7V A;  2B3L A;  1B59 A;  4FLI A;  4U1B A;  3MAT A;  4RZY A;  4IEC A;  4U6C A;  5CDE A;  4S00 A;  4QR8 A;  1WN1 A;  5FCF A;  3Q6D A;  4IKT A;  3BIP A;  4FO8 A;  1N51 A;  1M35 A;  2V3Y A;  1WLR A;  2EVO A;  4IDY A;  3PKE A;  2NQ6 A;  4FLK A;  2P9A A;  4IKS A;  1C27 A;  4S2R P;  4A6W A;  1R5H A;  1O0X A;  1WL9 A;  2V3X A;  3PKD A;  2GG0 A;  4U69 A;  2V3Z A;  2MAT A;  3IU8 A;  4JUQ A;  4U6Z A;  5CLS A;  2BWX A;  3RVA A;  4RGZ 1;  5E5B A;  1YW8 A;  2P99 A;  2GG7 A;  2ZSG A;  3BIT A;  2GG3 A;  1WY2 A;  4U6E A;  2B3K A;  2EA2 A;  2Q94 A;  1XGO A;  5CE6 A;  4IPA A;  1Y1N A;  2GU6 A;  2EVM A;  4IKR A;  4U6W A;  5CIK A;  2IW2 A;  4U73 A;  1WBQ A;  1XGM A;  2BH3 A;  2GZ5 A;  2P98 A;  5FCH A;  2GGB A;  3L24 A; 
#chains in the Genus database with same CATH homology
 4KM3 A;  2GGC A;  1QXZ A;  3L7G A;  4U6J A;  1C23 A;  5D6F A;  3PKC A;  1YW9 A;  2BHA A;  2OAZ A;  4IKU A;  4R60 A;  2NQ7 A;  3FMR A;  2BHD A;  4OOK A;  3MX6 A;  1XNZ A;  5D6E A;  2BWT A;  2BHB A;  4U70 A;  1YVM A;  1QZY A;  2DFI A;  1CHM A;  1BOA A;  4MAT A;  1XGS A;  3IU7 A;  2G6P A;  1KP0 A;  5CDV A;  4FUK A;  1B6A A;  1KQ0 A;  2ADU A;  1YJ3 A;  4RZZ A;  2V6C A;  2BWW A;  2Q92 A;  3IU9 A;  4Z7M A;  2BN7 A;  1W2M A;  4IU6 A;  4EGE A;  4ZWO A;  3S6B A;  3TAV A;  3MR1 A;  4FLJ A;  1QXY A;  1WL6 A;  2OKN A;  4B28 A;  4U76 A;  1PV9 A;  2GA2 A;  3PKA A;  2GG5 A;  1KQ9 A;  1YW7 A;  3CTZ A;  2BWS A;  4PNC A;  5JI6 A;  1C22 A;  4U71 A;  1QXW A;  2Q8K A;  4U75 A;  1R58 A;  2EA4 A;  1C21 A;  4FKC A;  3IG4 A;  2GU5 A;  5CNX A;  3CB5 A;  2Q96 A;  2BB7 A;  2Q93 A;  4HXX A;  2GTX A;  4PV4 A;  2GG8 A;  2BWV A;  2EVC A;  1XGN A;  1A16 A;  2GU7 A;  2GG9 A;  4ZWP A;  2Q95 A;  3FM3 A;  4FO7 A;  3TB5 A;  5JHU A;  3D27 A;  5CDL A;  3FMQ A;  4ZWU A;  1C24 A;  4FLL A;  1BN5 A;  4S2T P;  4ZNG A;  2HOW A;  1WKM A;  2BWU A;  3ROR A;  3CB6 A;  3BIQ A;  3PKB A;  2B3H A;  4A6V A;  1JAW A;  2BWY A;  5JFR A;  2BHC A;  1MAT A;  2GG2 A;  2GU4 A;  1R5G A;  4IF7 A;  4S01 A;  1W7V A;  2B3L A;  1B59 A;  4FLI A;  4U1B A;  3MAT A;  4RZY A;  4IEC A;  4U6C A;  5CDE A;  4S00 A;  4QR8 A;  1WN1 A;  5FCF A;  3Q6D A;  4IKT A;  3BIP A;  4FO8 A;  1N51 A;  1M35 A;  2V3Y A;  1WLR A;  2EVO A;  4IDY A;  3PKE A;  2NQ6 A;  4FLK A;  2P9A A;  4IKS A;  1C27 A;  4S2R P;  4A6W A;  1R5H A;  1O0X A;  1WL9 A;  2V3X A;  3PKD A;  2GG0 A;  4U69 A;  2V3Z A;  2MAT A;  3IU8 A;  4JUQ A;  4U6Z A;  5CLS A;  2BWX A;  3RVA A;  4RGZ 1;  5E5B A;  1YW8 A;  2P99 A;  2GG7 A;  2ZSG A;  3BIT A;  2GG3 A;  1WY2 A;  4U6E A;  2B3K A;  2EA2 A;  2Q94 A;  1XGO A;  5CE6 A;  4IPA A;  1Y1N A;  2GU6 A;  2EVM A;  4IKR A;  4U6W A;  5CIK A;  2IW2 A;  4U73 A;  1WBQ A;  1XGM A;  2BH3 A;  2GZ5 A;  2P98 A;  5FCH A;  2GGB A;  3L24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...