2EVCA

Crystal structure of e. coli. methionine amino peptidase in complex with 5-(2-(trifluoromethyl)phenyl)furan-2-carboxylic acid
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
259
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural analysis of metalloform-selective inhibition of methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 85
structure length 259
sequence length 259
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2evcA00
2GZ5A 2EVMA 2ADUA 3IU8A 4U70A 4IKTA 1R5GA 4U76A 2GU5A 3MATA 4B28A 4IKUA 4ZWPA 2GG9A 1M35A 5FCFA 4U6EA 2BH3A 3IU7A 3IG4A 4RGZ1 3BIPA 3FMRA 3BITA 1MATA 1C21A 1C23A 2Q96A 2V6CA 4S2RP 4U71A 5D6FA 4A6WA 1XGOA 2BWWA 4U1BA 2BWVA 5FCHA 3CTZA 2BWYA 4FLLA 4QR8A 4U73A 1YW7A 4MATA 4ZNGA 4KM3A 4S01A 2GG2A 2NQ6A 4FO8A 2HOWA 5D6EA 1O0XA 2GA2A 2GG8A 3PKAA 1WL6A 3FM3A 2GU6A 4PV4A 1N51A 5E5BA 1WBQA 1C24A 4U6WA 4EGEA 4IU6A 4U69A 3PKBA 3BIQA 2Q92A 4U6CA 4A6VA 2GG3A 1R5HA 3CB5A 4FO7A 1WKMA 2GGBA 1KQ0A 1QXWA 5CNXA 5CDEA 2G6PA 2Q8KA 2EA2A 2IW2A 3CB6A 1YW9A 4FLKA 4ZWOA 5JI6A 2BHDA 3IU9A 3FMQA 3RVAA 5JFRA 2NQ7A 1BN5A 2EA4A 2GGCA 4S2TP 2GU7A 2EVCA 1YW8A 1BOAA 2OAZA 2P9AA 2Q95A 2EVOA 2GTXA 5CLSA 2DFIA 4Z7MA 2BWSA 3D27A 3Q6DA 5CDLA 1XGSA 2GG0A 4R60A 4RZZA 2BHCA 5CE6A 1JAWA 4HXXA 1B59A 3TB5A 2BWUA 1C22A 1QXZA 3TAVA 4IPAA 2OKNA 1YJ3A 4PNCA 3PKCA 2BHBA 3MR1A 2BWTA 4IDYA 2BB7A 2V3ZA 4FLIA 1XGMA 2BWXA 2Q93A 3RORA 4RZYA 2V3YA 4FLJA 1W2MA 4IECA 4U75A 2P99A 4IKSA 2BHAA 5CIKA 2Q94A 1Y1NA 2GU4A 4S00A 3PKDA 4IKRA 4ZWUA 1KP0A 4IF7A 5JHUA 2B3HA 1QZYA 1WY2A 2ZSGA 2B3LA 1XGNA 2GG7A 4JUQA 1C27A 4FUKA 1PV9A 1YVMA 2V3XA 3PKEA 4U6ZA 4FKCA 2P98A 2MATA 1WL9A 2GG5A 1A16A 3L24A 1CHMA 4OOKA 1WN1A 3L7GA 2B3KA 5CDVA 1KQ9A 1R58A 2BN7A 1XNZA 1WLRA 3MX6A 1B6AA 4U6JA 1W7VA 1QXYA 3S6BA
chains in the Genus database with same CATH superfamily
2GZ5A 2EVMA 2ADUA 3IU8A 4U70A 4IKTA 1R5GA 4U76A 2GU5A 3MATA 4B28A 4IKUA 4ZWPA 2GG9A 1M35A 5FCFA 4U6EA 2BH3A 3IU7A 3IG4A 4RGZ1 3BIPA 3FMRA 3BITA 1MATA 1C21A 1C23A 2Q96A 2V6CA 4S2RP 4U71A 5D6FA 4A6WA 1XGOA 2BWWA 4U1BA 2BWVA 5FCHA 3CTZA 2BWYA 4FLLA 4QR8A 4U73A 1YW7A 4MATA 4ZNGA 4KM3A 4S01A 2GG2A 2NQ6A 4FO8A 2HOWA 5D6EA 1O0XA 2GA2A 2GG8A 3PKAA 1WL6A 3FM3A 2GU6A 4PV4A 1N51A 5E5BA 1WBQA 1C24A 4U6WA 4EGEA 4IU6A 4U69A 3PKBA 3BIQA 2Q92A 4U6CA 4A6VA 2GG3A 1R5HA 3CB5A 4FO7A 1WKMA 2GGBA 1KQ0A 1QXWA 5CNXA 5CDEA 2G6PA 2Q8KA 2EA2A 2IW2A 3CB6A 1YW9A 4FLKA 4ZWOA 5JI6A 2BHDA 3IU9A 3FMQA 3RVAA 5JFRA 2NQ7A 1BN5A 2EA4A 2GGCA 4S2TP 2GU7A 2EVCA 1YW8A 1BOAA 2OAZA 2P9AA 2Q95A 2EVOA 2GTXA 5CLSA 2DFIA 4Z7MA 2BWSA 3D27A 3Q6DA 5CDLA 1XGSA 2GG0A 4R60A 4RZZA 2BHCA 5CE6A 1JAWA 4HXXA 1B59A 3TB5A 2BWUA 1C22A 1QXZA 3TAVA 4IPAA 2OKNA 1YJ3A 4PNCA 3PKCA 2BHBA 3MR1A 2BWTA 4IDYA 2BB7A 2V3ZA 4FLIA 1XGMA 2BWXA 2Q93A 3RORA 4RZYA 2V3YA 4FLJA 1W2MA 4IECA 4U75A 2P99A 4IKSA 2BHAA 5CIKA 2Q94A 1Y1NA 2GU4A 4S00A 3PKDA 4IKRA 4ZWUA 1KP0A 4IF7A 5JHUA 2B3HA 1QZYA 1WY2A 2ZSGA 2B3LA 1XGNA 2GG7A 4JUQA 1C27A 4FUKA 1PV9A 1YVMA 2V3XA 3PKEA 4U6ZA 4FKCA 2P98A 2MATA 1WL9A 2GG5A 1A16A 3L24A 1CHMA 4OOKA 1WN1A 3L7GA 2B3KA 5CDVA 1KQ9A 1R58A 2BN7A 1XNZA 1WLRA 3MX6A 1B6AA 4U6JA 1W7VA 1QXYA 3S6BA
chains in the Genus database with same CATH topology
2GZ5A 2EVMA 2ADUA 3IU8A 4U70A 4IKTA 1R5GA 4U76A 2GU5A 3MATA 4B28A 4IKUA 4ZWPA 2GG9A 1M35A 5FCFA 4U6EA 2BH3A 3IU7A 3IG4A 4RGZ1 3BIPA 3FMRA 3BITA 1MATA 1C21A 1C23A 2Q96A 2V6CA 4S2RP 4U71A 5D6FA 4A6WA 1XGOA 2BWWA 4U1BA 2BWVA 5FCHA 3CTZA 2BWYA 4FLLA 4QR8A 4U73A 1YW7A 4MATA 4ZNGA 4KM3A 4S01A 2GG2A 2NQ6A 4FO8A 2HOWA 5D6EA 1O0XA 2GA2A 2GG8A 3PKAA 1WL6A 3FM3A 2GU6A 4PV4A 1N51A 5E5BA 1WBQA 1C24A 4U6WA 4EGEA 4IU6A 4U69A 3PKBA 3BIQA 2Q92A 4U6CA 4A6VA 2GG3A 1R5HA 3CB5A 4FO7A 1WKMA 2GGBA 1KQ0A 1QXWA 5CNXA 5CDEA 2G6PA 2Q8KA 2EA2A 2IW2A 3CB6A 1YW9A 4FLKA 4ZWOA 5JI6A 2BHDA 3IU9A 3FMQA 3RVAA 5JFRA 2NQ7A 1BN5A 2EA4A 2GGCA 4S2TP 2GU7A 2EVCA 1YW8A 1BOAA 2OAZA 2P9AA 2Q95A 2EVOA 2GTXA 5CLSA 2DFIA 4Z7MA 2BWSA 3D27A 3Q6DA 5CDLA 1XGSA 2GG0A 4R60A 4RZZA 2BHCA 5CE6A 1JAWA 4HXXA 1B59A 3TB5A 2BWUA 1C22A 1QXZA 3TAVA 4IPAA 2OKNA 1YJ3A 4PNCA 3PKCA 2BHBA 3MR1A 2BWTA 4IDYA 2BB7A 2V3ZA 4FLIA 1XGMA 2BWXA 2Q93A 3RORA 4RZYA 2V3YA 4FLJA 1W2MA 4IECA 4U75A 2P99A 4IKSA 2BHAA 5CIKA 2Q94A 1Y1NA 2GU4A 4S00A 3PKDA 4IKRA 4ZWUA 1KP0A 4IF7A 5JHUA 2B3HA 1QZYA 1WY2A 2ZSGA 2B3LA 1XGNA 2GG7A 4JUQA 1C27A 4FUKA 1PV9A 1YVMA 2V3XA 3PKEA 4U6ZA 4FKCA 2P98A 2MATA 1WL9A 2GG5A 1A16A 3L24A 1CHMA 4OOKA 1WN1A 3L7GA 2B3KA 5CDVA 1KQ9A 1R58A 2BN7A 1XNZA 1WLRA 3MX6A 1B6AA 4U6JA 1W7VA 1QXYA 3S6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GZ5 A;  2EVM A;  2ADU A;  3IU8 A;  4U70 A;  4IKT A;  1R5G A;  4U76 A;  2GU5 A;  3MAT A;  4B28 A;  4IKU A;  4ZWP A;  2GG9 A;  1M35 A;  5FCF A;  4U6E A;  2BH3 A;  3IU7 A;  3IG4 A;  4RGZ 1;  3BIP A;  3FMR A;  3BIT A;  1MAT A;  1C21 A;  1C23 A;  2Q96 A;  2V6C A;  4S2R P;  4U71 A;  5D6F A;  4A6W A;  1XGO A;  2BWW A;  4U1B A;  2BWV A;  5FCH A;  3CTZ A;  2BWY A;  4FLL A;  4QR8 A;  4U73 A;  1YW7 A;  4MAT A;  4ZNG A;  4KM3 A;  4S01 A;  2GG2 A;  2NQ6 A;  4FO8 A;  2HOW A;  5D6E A;  1O0X A;  2GA2 A;  2GG8 A;  3PKA A;  1WL6 A;  3FM3 A;  2GU6 A;  4PV4 A;  1N51 A;  5E5B A;  1WBQ A;  1C24 A;  4U6W A;  4EGE A;  4IU6 A;  4U69 A;  3PKB A;  3BIQ A;  2Q92 A;  4U6C A;  4A6V A;  2GG3 A;  1R5H A;  3CB5 A;  4FO7 A;  1WKM A;  2GGB A;  1KQ0 A;  1QXW A;  5CNX A;  5CDE A;  2G6P A;  2Q8K A;  2EA2 A;  2IW2 A;  3CB6 A;  1YW9 A;  4FLK A;  4ZWO A;  5JI6 A;  2BHD A;  3IU9 A;  3FMQ A;  3RVA A;  5JFR A;  2NQ7 A;  1BN5 A;  2EA4 A;  2GGC A;  4S2T P;  2GU7 A;  2EVC A;  1YW8 A;  1BOA A;  2OAZ A;  2P9A A;  2Q95 A;  2EVO A;  2GTX A;  5CLS A;  2DFI A;  4Z7M A;  2BWS A;  3D27 A;  3Q6D A;  5CDL A;  1XGS A;  2GG0 A;  4R60 A;  4RZZ A;  2BHC A;  5CE6 A;  1JAW A;  4HXX A;  1B59 A;  3TB5 A;  2BWU A;  1C22 A;  1QXZ A;  3TAV A;  4IPA A;  2OKN A;  1YJ3 A;  4PNC A;  3PKC A;  2BHB A;  3MR1 A;  2BWT A;  4IDY A;  2BB7 A;  2V3Z A;  4FLI A;  1XGM A;  2BWX A;  2Q93 A;  3ROR A;  4RZY A;  2V3Y A;  4FLJ A;  1W2M A;  4IEC A;  4U75 A;  2P99 A;  4IKS A;  2BHA A;  5CIK A;  2Q94 A;  1Y1N A;  2GU4 A;  4S00 A;  3PKD A;  4IKR A;  4ZWU A;  1KP0 A;  4IF7 A;  5JHU A;  2B3H A;  1QZY A;  1WY2 A;  2ZSG A;  2B3L A;  1XGN A;  2GG7 A;  4JUQ A;  1C27 A;  4FUK A;  1PV9 A;  1YVM A;  2V3X A;  3PKE A;  4U6Z A;  4FKC A;  2P98 A;  2MAT A;  1WL9 A;  2GG5 A;  1A16 A;  3L24 A;  1CHM A;  4OOK A;  1WN1 A;  3L7G A;  2B3K A;  5CDV A;  1KQ9 A;  1R58 A;  2BN7 A;  1XNZ A;  1WLR A;  3MX6 A;  1B6A A;  4U6J A;  1W7V A;  1QXY A;  3S6B A; 
#chains in the Genus database with same CATH topology
 2GZ5 A;  2EVM A;  2ADU A;  3IU8 A;  4U70 A;  4IKT A;  1R5G A;  4U76 A;  2GU5 A;  3MAT A;  4B28 A;  4IKU A;  4ZWP A;  2GG9 A;  1M35 A;  5FCF A;  4U6E A;  2BH3 A;  3IU7 A;  3IG4 A;  4RGZ 1;  3BIP A;  3FMR A;  3BIT A;  1MAT A;  1C21 A;  1C23 A;  2Q96 A;  2V6C A;  4S2R P;  4U71 A;  5D6F A;  4A6W A;  1XGO A;  2BWW A;  4U1B A;  2BWV A;  5FCH A;  3CTZ A;  2BWY A;  4FLL A;  4QR8 A;  4U73 A;  1YW7 A;  4MAT A;  4ZNG A;  4KM3 A;  4S01 A;  2GG2 A;  2NQ6 A;  4FO8 A;  2HOW A;  5D6E A;  1O0X A;  2GA2 A;  2GG8 A;  3PKA A;  1WL6 A;  3FM3 A;  2GU6 A;  4PV4 A;  1N51 A;  5E5B A;  1WBQ A;  1C24 A;  4U6W A;  4EGE A;  4IU6 A;  4U69 A;  3PKB A;  3BIQ A;  2Q92 A;  4U6C A;  4A6V A;  2GG3 A;  1R5H A;  3CB5 A;  4FO7 A;  1WKM A;  2GGB A;  1KQ0 A;  1QXW A;  5CNX A;  5CDE A;  2G6P A;  2Q8K A;  2EA2 A;  2IW2 A;  3CB6 A;  1YW9 A;  4FLK A;  4ZWO A;  5JI6 A;  2BHD A;  3IU9 A;  3FMQ A;  3RVA A;  5JFR A;  2NQ7 A;  1BN5 A;  2EA4 A;  2GGC A;  4S2T P;  2GU7 A;  2EVC A;  1YW8 A;  1BOA A;  2OAZ A;  2P9A A;  2Q95 A;  2EVO A;  2GTX A;  5CLS A;  2DFI A;  4Z7M A;  2BWS A;  3D27 A;  3Q6D A;  5CDL A;  1XGS A;  2GG0 A;  4R60 A;  4RZZ A;  2BHC A;  5CE6 A;  1JAW A;  4HXX A;  1B59 A;  3TB5 A;  2BWU A;  1C22 A;  1QXZ A;  3TAV A;  4IPA A;  2OKN A;  1YJ3 A;  4PNC A;  3PKC A;  2BHB A;  3MR1 A;  2BWT A;  4IDY A;  2BB7 A;  2V3Z A;  4FLI A;  1XGM A;  2BWX A;  2Q93 A;  3ROR A;  4RZY A;  2V3Y A;  4FLJ A;  1W2M A;  4IEC A;  4U75 A;  2P99 A;  4IKS A;  2BHA A;  5CIK A;  2Q94 A;  1Y1N A;  2GU4 A;  4S00 A;  3PKD A;  4IKR A;  4ZWU A;  1KP0 A;  4IF7 A;  5JHU A;  2B3H A;  1QZY A;  1WY2 A;  2ZSG A;  2B3L A;  1XGN A;  2GG7 A;  4JUQ A;  1C27 A;  4FUK A;  1PV9 A;  1YVM A;  2V3X A;  3PKE A;  4U6Z A;  4FKC A;  2P98 A;  2MAT A;  1WL9 A;  2GG5 A;  1A16 A;  3L24 A;  1CHM A;  4OOK A;  1WN1 A;  3L7G A;  2B3K A;  5CDV A;  1KQ9 A;  1R58 A;  2BN7 A;  1XNZ A;  1WLR A;  3MX6 A;  1B6A A;  4U6J A;  1W7V A;  1QXY A;  3S6B A; 
#chains in the Genus database with same CATH homology
 2GZ5 A;  2EVM A;  2ADU A;  3IU8 A;  4U70 A;  4IKT A;  1R5G A;  4U76 A;  2GU5 A;  3MAT A;  4B28 A;  4IKU A;  4ZWP A;  2GG9 A;  1M35 A;  5FCF A;  4U6E A;  2BH3 A;  3IU7 A;  3IG4 A;  4RGZ 1;  3BIP A;  3FMR A;  3BIT A;  1MAT A;  1C21 A;  1C23 A;  2Q96 A;  2V6C A;  4S2R P;  4U71 A;  5D6F A;  4A6W A;  1XGO A;  2BWW A;  4U1B A;  2BWV A;  5FCH A;  3CTZ A;  2BWY A;  4FLL A;  4QR8 A;  4U73 A;  1YW7 A;  4MAT A;  4ZNG A;  4KM3 A;  4S01 A;  2GG2 A;  2NQ6 A;  4FO8 A;  2HOW A;  5D6E A;  1O0X A;  2GA2 A;  2GG8 A;  3PKA A;  1WL6 A;  3FM3 A;  2GU6 A;  4PV4 A;  1N51 A;  5E5B A;  1WBQ A;  1C24 A;  4U6W A;  4EGE A;  4IU6 A;  4U69 A;  3PKB A;  3BIQ A;  2Q92 A;  4U6C A;  4A6V A;  2GG3 A;  1R5H A;  3CB5 A;  4FO7 A;  1WKM A;  2GGB A;  1KQ0 A;  1QXW A;  5CNX A;  5CDE A;  2G6P A;  2Q8K A;  2EA2 A;  2IW2 A;  3CB6 A;  1YW9 A;  4FLK A;  4ZWO A;  5JI6 A;  2BHD A;  3IU9 A;  3FMQ A;  3RVA A;  5JFR A;  2NQ7 A;  1BN5 A;  2EA4 A;  2GGC A;  4S2T P;  2GU7 A;  2EVC A;  1YW8 A;  1BOA A;  2OAZ A;  2P9A A;  2Q95 A;  2EVO A;  2GTX A;  5CLS A;  2DFI A;  4Z7M A;  2BWS A;  3D27 A;  3Q6D A;  5CDL A;  1XGS A;  2GG0 A;  4R60 A;  4RZZ A;  2BHC A;  5CE6 A;  1JAW A;  4HXX A;  1B59 A;  3TB5 A;  2BWU A;  1C22 A;  1QXZ A;  3TAV A;  4IPA A;  2OKN A;  1YJ3 A;  4PNC A;  3PKC A;  2BHB A;  3MR1 A;  2BWT A;  4IDY A;  2BB7 A;  2V3Z A;  4FLI A;  1XGM A;  2BWX A;  2Q93 A;  3ROR A;  4RZY A;  2V3Y A;  4FLJ A;  1W2M A;  4IEC A;  4U75 A;  2P99 A;  4IKS A;  2BHA A;  5CIK A;  2Q94 A;  1Y1N A;  2GU4 A;  4S00 A;  3PKD A;  4IKR A;  4ZWU A;  1KP0 A;  4IF7 A;  5JHU A;  2B3H A;  1QZY A;  1WY2 A;  2ZSG A;  2B3L A;  1XGN A;  2GG7 A;  4JUQ A;  1C27 A;  4FUK A;  1PV9 A;  1YVM A;  2V3X A;  3PKE A;  4U6Z A;  4FKC A;  2P98 A;  2MAT A;  1WL9 A;  2GG5 A;  1A16 A;  3L24 A;  1CHM A;  4OOK A;  1WN1 A;  3L7G A;  2B3K A;  5CDV A;  1KQ9 A;  1R58 A;  2BN7 A;  1XNZ A;  1WLR A;  3MX6 A;  1B6A A;  4U6J A;  1W7V A;  1QXY A;  3S6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...