2EVCA

Crystal structure of e. coli. methionine amino peptidase in complex with 5-(2-(trifluoromethyl)phenyl)furan-2-carboxylic acid
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
259
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of metalloform-selective inhibition of methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 85
structure length 259
sequence length 259
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2evcA00
2G6PA 2OAZA 2ZSGA 4FUKA 3Q6DA 1WL6A 1C21A 2BH3A 3BIQA 4FO7A 3PKDA 1BOAA 1MATA 1XGNA 1R5HA 2P99A 5D6EA 2BHBA 3L24A 5FCHA 2GGBA 2BN7A 1KQ9A 3CB5A 2BWXA 1B6AA 3PKCA 3TB5A 2B3HA 4IKRA 4FLKA 2BWYA 2EA4A 1WL9A 4EGEA 2BWUA 2GG3A 4IKUA 1C27A 3RVAA 1QXWA 3RORA 2GG7A 2OKNA 2GA2A 3IU9A 4OOKA 3MX6A 4U6ZA 1WBQA 2BHDA 2EVOA 4IDYA 1M35A 4FO8A 2GU6A 1XGSA 2BHAA 4HXXA 3IG4A 3MR1A 5CDEA 4PNCA 1O0XA 3CTZA 4ZWPA 1XNZA 4QR8A 3L7GA 2BB7A 2GGCA 4U1BA 4ZWUA 5CDVA 2EA2A 1W7VA 3IU7A 2Q8KA 2EVMA 1KP0A 2MATA 2EVCA 4KM3A 5CE6A 2GU5A 1YW8A 1R5GA 2GG9A 2Q96A 4U76A 5CLSA 3D27A 1XGOA 1R58A 2V3XA 2V3YA 2GG5A 4RZZA 4IKSA 1YW7A 4R60A 5JHUA 4B28A 4FKCA 2V3ZA 2P9AA 4IU6A 1A16A 2Q93A 3MATA 5D6FA 1BN5A 4U73A 3S6BA 2NQ7A 5CIKA 1WN1A 1WLRA 2GG8A 2V6CA 5JI6A 4IF7A 3TAVA 4S01A 2B3LA 1C22A 1C23A 2GU7A 4U6CA 4A6WA 2P98A 1KQ0A 1QZYA 4FLJA 2HOWA 2B3KA 1YW9A 1QXYA 2GG2A 3FMQA 4ZNGA 2Q94A 3PKBA 5CNXA 4U75A 2ADUA 4U71A 4U6JA 2Q95A 2IW2A 4IECA 1QXZA 2Q92A 4U6EA 1YVMA 1WY2A 4U69A 4RZYA 4U70A 5FCFA 2BWSA 1N51A 2GTXA 3CB6A 4S00A 2BWWA 1YJ3A 5E5BA 2DFIA 3PKAA 3IU8A 4IKTA 2GG0A 4PV4A 2BHCA 5CDLA 4S2RP 3BITA 4MATA 4FLLA 1JAWA 4ZWOA 1C24A 1W2MA 3FMRA 3PKEA 2BWTA 5JFRA 1XGMA 3FM3A 4FLIA 4A6VA 1B59A 4RGZ1 1CHMA 1WKMA 4JUQA 1PV9A 2GU4A 2NQ6A 4Z7MA 4IPAA 3BIPA 2GZ5A 4U6WA 2BWVA 1Y1NA 4S2TP
chains in the Genus database with same CATH superfamily
2G6PA 2OAZA 2ZSGA 4FUKA 3Q6DA 1WL6A 1C21A 2BH3A 3BIQA 4FO7A 3PKDA 1BOAA 1MATA 1XGNA 1R5HA 2P99A 5D6EA 2BHBA 3L24A 5FCHA 2GGBA 2BN7A 1KQ9A 3CB5A 2BWXA 1B6AA 3PKCA 3TB5A 2B3HA 4IKRA 4FLKA 2BWYA 2EA4A 1WL9A 4EGEA 2BWUA 2GG3A 4IKUA 1C27A 3RVAA 1QXWA 3RORA 2GG7A 2OKNA 2GA2A 3IU9A 4OOKA 3MX6A 4U6ZA 1WBQA 2BHDA 2EVOA 4IDYA 1M35A 4FO8A 2GU6A 1XGSA 2BHAA 4HXXA 3IG4A 3MR1A 5CDEA 4PNCA 1O0XA 3CTZA 4ZWPA 1XNZA 4QR8A 3L7GA 2BB7A 2GGCA 4U1BA 4ZWUA 5CDVA 2EA2A 1W7VA 3IU7A 2Q8KA 2EVMA 1KP0A 2MATA 2EVCA 4KM3A 5CE6A 2GU5A 1YW8A 1R5GA 2GG9A 2Q96A 4U76A 5CLSA 3D27A 1XGOA 1R58A 2V3XA 2V3YA 2GG5A 4RZZA 4IKSA 1YW7A 4R60A 5JHUA 4B28A 4FKCA 2V3ZA 2P9AA 4IU6A 1A16A 2Q93A 3MATA 5D6FA 1BN5A 4U73A 3S6BA 2NQ7A 5CIKA 1WN1A 1WLRA 2GG8A 2V6CA 5JI6A 4IF7A 3TAVA 4S01A 2B3LA 1C22A 1C23A 2GU7A 4U6CA 4A6WA 2P98A 1KQ0A 1QZYA 4FLJA 2HOWA 2B3KA 1YW9A 1QXYA 2GG2A 3FMQA 4ZNGA 2Q94A 3PKBA 5CNXA 4U75A 2ADUA 4U71A 4U6JA 2Q95A 2IW2A 4IECA 1QXZA 2Q92A 4U6EA 1YVMA 1WY2A 4U69A 4RZYA 4U70A 5FCFA 2BWSA 1N51A 2GTXA 3CB6A 4S00A 2BWWA 1YJ3A 5E5BA 2DFIA 3PKAA 3IU8A 4IKTA 2GG0A 4PV4A 2BHCA 5CDLA 4S2RP 3BITA 4MATA 4FLLA 1JAWA 4ZWOA 1C24A 1W2MA 3FMRA 3PKEA 2BWTA 5JFRA 1XGMA 3FM3A 4FLIA 4A6VA 1B59A 4RGZ1 1CHMA 1WKMA 4JUQA 1PV9A 2GU4A 2NQ6A 4Z7MA 4IPAA 3BIPA 2GZ5A 4U6WA 2BWVA 1Y1NA 4S2TP
chains in the Genus database with same CATH topology
2G6PA 2OAZA 2ZSGA 4FUKA 3Q6DA 1WL6A 1C21A 2BH3A 3BIQA 4FO7A 3PKDA 1BOAA 1MATA 1XGNA 1R5HA 2P99A 5D6EA 2BHBA 3L24A 5FCHA 2GGBA 2BN7A 1KQ9A 3CB5A 2BWXA 1B6AA 3PKCA 3TB5A 2B3HA 4IKRA 4FLKA 2BWYA 2EA4A 1WL9A 4EGEA 2BWUA 2GG3A 4IKUA 1C27A 3RVAA 1QXWA 3RORA 2GG7A 2OKNA 2GA2A 3IU9A 4OOKA 3MX6A 4U6ZA 1WBQA 2BHDA 2EVOA 4IDYA 1M35A 4FO8A 2GU6A 1XGSA 2BHAA 4HXXA 3IG4A 3MR1A 5CDEA 4PNCA 1O0XA 3CTZA 4ZWPA 1XNZA 4QR8A 3L7GA 2BB7A 2GGCA 4U1BA 4ZWUA 5CDVA 2EA2A 1W7VA 3IU7A 2Q8KA 2EVMA 1KP0A 2MATA 2EVCA 4KM3A 5CE6A 2GU5A 1YW8A 1R5GA 2GG9A 2Q96A 4U76A 5CLSA 3D27A 1XGOA 1R58A 2V3XA 2V3YA 2GG5A 4RZZA 4IKSA 1YW7A 4R60A 5JHUA 4B28A 4FKCA 2V3ZA 2P9AA 4IU6A 1A16A 2Q93A 3MATA 5D6FA 1BN5A 4U73A 3S6BA 2NQ7A 5CIKA 1WN1A 1WLRA 2GG8A 2V6CA 5JI6A 4IF7A 3TAVA 4S01A 2B3LA 1C22A 1C23A 2GU7A 4U6CA 4A6WA 2P98A 1KQ0A 1QZYA 4FLJA 2HOWA 2B3KA 1YW9A 1QXYA 2GG2A 3FMQA 4ZNGA 2Q94A 3PKBA 5CNXA 4U75A 2ADUA 4U71A 4U6JA 2Q95A 2IW2A 4IECA 1QXZA 2Q92A 4U6EA 1YVMA 1WY2A 4U69A 4RZYA 4U70A 5FCFA 2BWSA 1N51A 2GTXA 3CB6A 4S00A 2BWWA 1YJ3A 5E5BA 2DFIA 3PKAA 3IU8A 4IKTA 2GG0A 4PV4A 2BHCA 5CDLA 4S2RP 3BITA 4MATA 4FLLA 1JAWA 4ZWOA 1C24A 1W2MA 3FMRA 3PKEA 2BWTA 5JFRA 1XGMA 3FM3A 4FLIA 4A6VA 1B59A 4RGZ1 1CHMA 1WKMA 4JUQA 1PV9A 2GU4A 2NQ6A 4Z7MA 4IPAA 3BIPA 2GZ5A 4U6WA 2BWVA 1Y1NA 4S2TP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G6P A;  2OAZ A;  2ZSG A;  4FUK A;  3Q6D A;  1WL6 A;  1C21 A;  2BH3 A;  3BIQ A;  4FO7 A;  3PKD A;  1BOA A;  1MAT A;  1XGN A;  1R5H A;  2P99 A;  5D6E A;  2BHB A;  3L24 A;  5FCH A;  2GGB A;  2BN7 A;  1KQ9 A;  3CB5 A;  2BWX A;  1B6A A;  3PKC A;  3TB5 A;  2B3H A;  4IKR A;  4FLK A;  2BWY A;  2EA4 A;  1WL9 A;  4EGE A;  2BWU A;  2GG3 A;  4IKU A;  1C27 A;  3RVA A;  1QXW A;  3ROR A;  2GG7 A;  2OKN A;  2GA2 A;  3IU9 A;  4OOK A;  3MX6 A;  4U6Z A;  1WBQ A;  2BHD A;  2EVO A;  4IDY A;  1M35 A;  4FO8 A;  2GU6 A;  1XGS A;  2BHA A;  4HXX A;  3IG4 A;  3MR1 A;  5CDE A;  4PNC A;  1O0X A;  3CTZ A;  4ZWP A;  1XNZ A;  4QR8 A;  3L7G A;  2BB7 A;  2GGC A;  4U1B A;  4ZWU A;  5CDV A;  2EA2 A;  1W7V A;  3IU7 A;  2Q8K A;  2EVM A;  1KP0 A;  2MAT A;  2EVC A;  4KM3 A;  5CE6 A;  2GU5 A;  1YW8 A;  1R5G A;  2GG9 A;  2Q96 A;  4U76 A;  5CLS A;  3D27 A;  1XGO A;  1R58 A;  2V3X A;  2V3Y A;  2GG5 A;  4RZZ A;  4IKS A;  1YW7 A;  4R60 A;  5JHU A;  4B28 A;  4FKC A;  2V3Z A;  2P9A A;  4IU6 A;  1A16 A;  2Q93 A;  3MAT A;  5D6F A;  1BN5 A;  4U73 A;  3S6B A;  2NQ7 A;  5CIK A;  1WN1 A;  1WLR A;  2GG8 A;  2V6C A;  5JI6 A;  4IF7 A;  3TAV A;  4S01 A;  2B3L A;  1C22 A;  1C23 A;  2GU7 A;  4U6C A;  4A6W A;  2P98 A;  1KQ0 A;  1QZY A;  4FLJ A;  2HOW A;  2B3K A;  1YW9 A;  1QXY A;  2GG2 A;  3FMQ A;  4ZNG A;  2Q94 A;  3PKB A;  5CNX A;  4U75 A;  2ADU A;  4U71 A;  4U6J A;  2Q95 A;  2IW2 A;  4IEC A;  1QXZ A;  2Q92 A;  4U6E A;  1YVM A;  1WY2 A;  4U69 A;  4RZY A;  4U70 A;  5FCF A;  2BWS A;  1N51 A;  2GTX A;  3CB6 A;  4S00 A;  2BWW A;  1YJ3 A;  5E5B A;  2DFI A;  3PKA A;  3IU8 A;  4IKT A;  2GG0 A;  4PV4 A;  2BHC A;  5CDL A;  4S2R P;  3BIT A;  4MAT A;  4FLL A;  1JAW A;  4ZWO A;  1C24 A;  1W2M A;  3FMR A;  3PKE A;  2BWT A;  5JFR A;  1XGM A;  3FM3 A;  4FLI A;  4A6V A;  1B59 A;  4RGZ 1;  1CHM A;  1WKM A;  4JUQ A;  1PV9 A;  2GU4 A;  2NQ6 A;  4Z7M A;  4IPA A;  3BIP A;  2GZ5 A;  4U6W A;  2BWV A;  1Y1N A;  4S2T P; 
#chains in the Genus database with same CATH topology
 2G6P A;  2OAZ A;  2ZSG A;  4FUK A;  3Q6D A;  1WL6 A;  1C21 A;  2BH3 A;  3BIQ A;  4FO7 A;  3PKD A;  1BOA A;  1MAT A;  1XGN A;  1R5H A;  2P99 A;  5D6E A;  2BHB A;  3L24 A;  5FCH A;  2GGB A;  2BN7 A;  1KQ9 A;  3CB5 A;  2BWX A;  1B6A A;  3PKC A;  3TB5 A;  2B3H A;  4IKR A;  4FLK A;  2BWY A;  2EA4 A;  1WL9 A;  4EGE A;  2BWU A;  2GG3 A;  4IKU A;  1C27 A;  3RVA A;  1QXW A;  3ROR A;  2GG7 A;  2OKN A;  2GA2 A;  3IU9 A;  4OOK A;  3MX6 A;  4U6Z A;  1WBQ A;  2BHD A;  2EVO A;  4IDY A;  1M35 A;  4FO8 A;  2GU6 A;  1XGS A;  2BHA A;  4HXX A;  3IG4 A;  3MR1 A;  5CDE A;  4PNC A;  1O0X A;  3CTZ A;  4ZWP A;  1XNZ A;  4QR8 A;  3L7G A;  2BB7 A;  2GGC A;  4U1B A;  4ZWU A;  5CDV A;  2EA2 A;  1W7V A;  3IU7 A;  2Q8K A;  2EVM A;  1KP0 A;  2MAT A;  2EVC A;  4KM3 A;  5CE6 A;  2GU5 A;  1YW8 A;  1R5G A;  2GG9 A;  2Q96 A;  4U76 A;  5CLS A;  3D27 A;  1XGO A;  1R58 A;  2V3X A;  2V3Y A;  2GG5 A;  4RZZ A;  4IKS A;  1YW7 A;  4R60 A;  5JHU A;  4B28 A;  4FKC A;  2V3Z A;  2P9A A;  4IU6 A;  1A16 A;  2Q93 A;  3MAT A;  5D6F A;  1BN5 A;  4U73 A;  3S6B A;  2NQ7 A;  5CIK A;  1WN1 A;  1WLR A;  2GG8 A;  2V6C A;  5JI6 A;  4IF7 A;  3TAV A;  4S01 A;  2B3L A;  1C22 A;  1C23 A;  2GU7 A;  4U6C A;  4A6W A;  2P98 A;  1KQ0 A;  1QZY A;  4FLJ A;  2HOW A;  2B3K A;  1YW9 A;  1QXY A;  2GG2 A;  3FMQ A;  4ZNG A;  2Q94 A;  3PKB A;  5CNX A;  4U75 A;  2ADU A;  4U71 A;  4U6J A;  2Q95 A;  2IW2 A;  4IEC A;  1QXZ A;  2Q92 A;  4U6E A;  1YVM A;  1WY2 A;  4U69 A;  4RZY A;  4U70 A;  5FCF A;  2BWS A;  1N51 A;  2GTX A;  3CB6 A;  4S00 A;  2BWW A;  1YJ3 A;  5E5B A;  2DFI A;  3PKA A;  3IU8 A;  4IKT A;  2GG0 A;  4PV4 A;  2BHC A;  5CDL A;  4S2R P;  3BIT A;  4MAT A;  4FLL A;  1JAW A;  4ZWO A;  1C24 A;  1W2M A;  3FMR A;  3PKE A;  2BWT A;  5JFR A;  1XGM A;  3FM3 A;  4FLI A;  4A6V A;  1B59 A;  4RGZ 1;  1CHM A;  1WKM A;  4JUQ A;  1PV9 A;  2GU4 A;  2NQ6 A;  4Z7M A;  4IPA A;  3BIP A;  2GZ5 A;  4U6W A;  2BWV A;  1Y1N A;  4S2T P; 
#chains in the Genus database with same CATH homology
 2G6P A;  2OAZ A;  2ZSG A;  4FUK A;  3Q6D A;  1WL6 A;  1C21 A;  2BH3 A;  3BIQ A;  4FO7 A;  3PKD A;  1BOA A;  1MAT A;  1XGN A;  1R5H A;  2P99 A;  5D6E A;  2BHB A;  3L24 A;  5FCH A;  2GGB A;  2BN7 A;  1KQ9 A;  3CB5 A;  2BWX A;  1B6A A;  3PKC A;  3TB5 A;  2B3H A;  4IKR A;  4FLK A;  2BWY A;  2EA4 A;  1WL9 A;  4EGE A;  2BWU A;  2GG3 A;  4IKU A;  1C27 A;  3RVA A;  1QXW A;  3ROR A;  2GG7 A;  2OKN A;  2GA2 A;  3IU9 A;  4OOK A;  3MX6 A;  4U6Z A;  1WBQ A;  2BHD A;  2EVO A;  4IDY A;  1M35 A;  4FO8 A;  2GU6 A;  1XGS A;  2BHA A;  4HXX A;  3IG4 A;  3MR1 A;  5CDE A;  4PNC A;  1O0X A;  3CTZ A;  4ZWP A;  1XNZ A;  4QR8 A;  3L7G A;  2BB7 A;  2GGC A;  4U1B A;  4ZWU A;  5CDV A;  2EA2 A;  1W7V A;  3IU7 A;  2Q8K A;  2EVM A;  1KP0 A;  2MAT A;  2EVC A;  4KM3 A;  5CE6 A;  2GU5 A;  1YW8 A;  1R5G A;  2GG9 A;  2Q96 A;  4U76 A;  5CLS A;  3D27 A;  1XGO A;  1R58 A;  2V3X A;  2V3Y A;  2GG5 A;  4RZZ A;  4IKS A;  1YW7 A;  4R60 A;  5JHU A;  4B28 A;  4FKC A;  2V3Z A;  2P9A A;  4IU6 A;  1A16 A;  2Q93 A;  3MAT A;  5D6F A;  1BN5 A;  4U73 A;  3S6B A;  2NQ7 A;  5CIK A;  1WN1 A;  1WLR A;  2GG8 A;  2V6C A;  5JI6 A;  4IF7 A;  3TAV A;  4S01 A;  2B3L A;  1C22 A;  1C23 A;  2GU7 A;  4U6C A;  4A6W A;  2P98 A;  1KQ0 A;  1QZY A;  4FLJ A;  2HOW A;  2B3K A;  1YW9 A;  1QXY A;  2GG2 A;  3FMQ A;  4ZNG A;  2Q94 A;  3PKB A;  5CNX A;  4U75 A;  2ADU A;  4U71 A;  4U6J A;  2Q95 A;  2IW2 A;  4IEC A;  1QXZ A;  2Q92 A;  4U6E A;  1YVM A;  1WY2 A;  4U69 A;  4RZY A;  4U70 A;  5FCF A;  2BWS A;  1N51 A;  2GTX A;  3CB6 A;  4S00 A;  2BWW A;  1YJ3 A;  5E5B A;  2DFI A;  3PKA A;  3IU8 A;  4IKT A;  2GG0 A;  4PV4 A;  2BHC A;  5CDL A;  4S2R P;  3BIT A;  4MAT A;  4FLL A;  1JAW A;  4ZWO A;  1C24 A;  1W2M A;  3FMR A;  3PKE A;  2BWT A;  5JFR A;  1XGM A;  3FM3 A;  4FLI A;  4A6V A;  1B59 A;  4RGZ 1;  1CHM A;  1WKM A;  4JUQ A;  1PV9 A;  2GU4 A;  2NQ6 A;  4Z7M A;  4IPA A;  3BIP A;  2GZ5 A;  4U6W A;  2BWV A;  1Y1N A;  4S2T P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...