2EVHA

Structure of a ndt80-dna complex (mse mutant ma7g)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
303
structure length
290
Chain Sequence
VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Principles of Protein-DNA Recognition Revealed in the Structural Analysis of Ndt80-MSE DNA Complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle/dna
molecule keywords 5'-D(*TP*GP*CP*GP*AP*CP*AP*CP*AP*GP*AP*AP*AP*C)-3'
total genus 83
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 2evhA00
1M7UA 1MNNA 2EVIA 2EVHA 2EVFA 1M6UA 2EUXA 2EUVA 2EVGA 2ETWA 2EUWA 2EVJA 1MN4A 2EUZA
chains in the Genus database with same CATH superfamily
1QSZA 3GSOB 2GCYA 1EMTL 4IEFB 4OZFA 4FQ1H 4BELD 3BZ4A 4DP2X 5H94B 2FJUB 2H7WA 4GKNB 5HGHB 1XH2A 3Q5OA 4LCIH 4BQCA 1PBYA 2P43B 2CQVA 4YHLH 3ZUNC 1VGKB 4WKXA 2GIYA 3D2UB 3AITA 1ZVSA 4PJDE 1Q90A 5D4QA 1JXGA 1G43A 1YA5A 3GXNA 4DP0X 4HXBH 2V7NB 4MMYB 4MCZA 5SWQA 3ZDZF 1J9RA 3V2AR 2FR4A 4QDGA 3MRFA 2OJEB 1I9IL 1LEIA 3LNDA 1PEWA 3ARBA 3FUDA 4JCLA 2ICWJ 4GUCA 2CBTA 2OW6A 4L3EA 4UNTA 5KBLA 4PBWD 4LAQH 5A2CA 4AGOA 1BIIA 1ZS8B 5G55A 5FHAH 1OGAD 1FHGA 2VLRA 4YMPA 2X4RA 3ATEA 1NBVH 2RQEA 1S9VB 1DBAL 3QYCA 4L37B 4ALAL 5DCCA 1E9QA 5IW6A 4KNQA 1NFIB 3A6CL 3ES6A 3K8LA 2B3RA 4LSQH 1M3IA 2DKSA 2J2ZA 4N5EC 5EN3A 3ZPDA 3C8HA 2VAAB 1EV2E 2AQRA 4JG0H 5TGBB 4K7PH 5F0PB 1IFHL 5BVJB 2PO6C 3KPMB 4W9DC 1P4IH 1CFSB 3SGJA 5E5MA 2P8LB 5D6DC 5DA0B 2EUVA 1KELL 4XR8C 2FX7H 2HLAA 1EHXA 3DSNB 1A7RH 1AQKH 3BPCB 1EIBA 1E9PB 3ARXA 3SDCD 3CH8A 5AB2A 3G9AB 1D5BA 4AG4L 3NOIA 3FULA 2LU5A 1N64H 2HRLA 3EYSL 2FDBP 4XZ4A 5GGTL 3NZHH 3SQBA 1T0NA 2R69L 4G82A 2IFFH 5CIPA 3QUYD 3S88H 2OMXA 4P46C 3LKPB 3O41B 4DP7X 5HI5D 4MSWA 1NMBH 1ET8A 4Q9RH 1G5AA 1ZEAH 4QD2E 3WUWB 3ZQ9A 2Q76B 2AMGA 2BFVL 3NZHL 1BD2B 1DJYA 2F5BH 2NY2C 2VR6A 4M56A 2BINA 2V3DA 4B53A 4NQCD 1HWWA 2APBA 5DF0A 4PCSA 1O6SA 5T5NG 3FCBA 2H4EA 4S10A 1H0DB 2DN7A 1Y18A 3B5TA 3QIBB 4NQVA 4P5KA 5GGVH 4DETA 3CFEB 3QJHB 5F1KC 4XOAA 5EZJB 2NX5B 4YWGL 25C8L 3BOVA 2AV1B 5A7EA 4AZ8B 1L9SA 4L05A 2AK4E 4AK1A 1MNNA 1V27A 4O4YL 4MQ7A 43CAA 1N5AB 4PYGA 5MI0C 4M62H 2ADFH 3BN3B 1JWSB 2NCMA 1I3RB 3KJ4B 2WP3O 4M1DH 4BSJA 2VW7A 4GW5B 5GRYA 3CC5B 1SUHA 3G6JA 5DUJA 1BFVH 5EOQH 3QWRD 1JZ4A 3PHOA 4LMQE 3QNYA 5I28A 2IMNA 4UI2A 4GI9A 1JWMA 4PJXF 5JA9A 1T1WA 4PS4H 4WFED 3GUTA 4RH4A 1MIEH 1H6UA 2B1AH 2FZ3B 4Y0GA 5EUOB 2YSSB 2CXKA 1NDMA 4XAWL 1XF4A 1FSKC 3WO4C 2J2ZB 3V5HA 5SWSE 1P1VA 3O4OC 1ZHKB 1XGYH 3E9TA 4MJIA 5EU3A 3WJMB 3GWJA 4GB9A 4PCYA 4X9GA 5CSGA 4ZYKB 4R7DB 1ZIBA 2BC4B 4HG4J 2NY4B 2G5RA 4ZBJA 1T7XA 2A77L 2EDJA 15C8H 5DD5H 4TUJB 1F97A 2PETA 1XCXA 4YBQD 2E9IA 3RFRA 3LMJH 1KF9B 2BFVH 4Z7QF 4DWHA 3GNML 1WIUA 5I1HH 2RBLA 3FFCA 4UT7H 4XVOA 2JSFA 2V5TA 1J10A 2AERT 3IDNA 3MQIA 4HMCA 5E8OB 2XQYG 4OKVB 5ICUA 1EMTH 3X3FH 1MPAL 1SHXA 2IAAC 5JIDA 2R2EA 2X4OB 3HB3B 1NLDL 1XVSA 2IWKA 4Q6IC 1TENA 2V2WB 4HJUA 4ENZA 1CF8L 2CZNA 3BUBA 4XCCH 4I3RH 4YC2C 3MX0A 4AQ1A 5I8CB 1A7NH 1T20B 4P0DA 3D39D 4F7EB 4B7IA 4JY6B 5IOKA 2WKOF 4AGQA 1J0IA 3RZCD 4Z3TA 5GIRB 2BP3A 3D4GA 4AMKL 3F01A 1Q9LB 3V4PA 3C6LB 2WIMA 2WZ0A 4D9QE 1S9XB 5E23A 5GS2D 1ZGLA 3RNQB 5JOEA 1XGRA 2E9BA 3V0WL 3VG0L 3LKOB 1OALA 4RSVA 1AMYA 2AV1A 2EUWA 4N2EA 4X0KB 4NOFA 4ZOAA 2HT3C 3U79A 4BKSC 1AO7E 3U4EA 1NAMH 3UACA 1L3WA 4Z3IA 2CAKA 4KJYB 1YY9D 5CBEB 1FJ1A 2VXTH 4KJPC 1XGUB 4MA3B 3CFKB 4YXHL 1FL6B 5CEZE 4PR5B 1A65A 3SD5A 1A5FL 3A21A 4W6YB 4IBLT 1BZ9A 2V4LA 2Q8BH 4D8OA 4MQXD 4E42A 4ZPVA 4G6ML 2FX8H 3PP3H 2CBMA 3QIUC 1F4WL 4DP4X 1JPTL 5IESL 1DTUA 4Y5XB 5SX4H 1AZRA 5I1LA 1MFDH 1MXGA 1NUNB 4JQXA 4N6RA 4P2OC 1L6ZA 4H13C 2QVKA 1IT9H 1TYJA 4IK6A 4P9HH 2VM4A 5F21B 5BRZE 1S5HB 4H8QA 4HXBL 3QFDA 1JGEA 3IRPX 4HAGA 4QHLA 3T2QA 2YEZB 3B1UA 4MDRA 1JPSH 4FERA 4UB0H 3MV7A 4X9YA 5DDHB 2LGNA 4ZNCD 1FGVH 4OD2B 3HC0B 3LQAL 4OUUA 2GEEA 3FN0H 3IMRA 1MWAB 4KAQL 1TU2B 4ZTPH 4OAWB 3LEYH 1T0MA 5AVUB 3MV8E 4QKTA 1T5KA 4CVXB 4CA4A 2RH0A 2RCSL 1KV3A 4GRMB 2VDMH 3QJZA 1WAAE 4N5ED 5FW7A 3VXTA 3RI5F 3DUUA 2VDRL 4QXWA 2MMXA 3VXRE 3UIYA 1QFWM 3BP5B 4LCWD 2Q76A 3FRUB 4I2XA 3RDTD 2UY7A 5J6GB 4HFWA 2FJGB 3WXWL 4Y4FD 4OF3A 2X4QB 4KKNA 4KZDH 3K74B 3UDWC 1UA6H 4HCRA 4R7NB 2WQAA 3CAFA 3LKQB 3ZSSA 2ENQA 3APFA 4XVUC 3D2TA 4QTHB 1X9UA 2FATL 3P9WB 4H5SB 2JMRA 3U2IA 4XGZB 1G1CA 1OTSD 3FF7A 3TXAA 1DE4A 3QDMB 1AXTH 1BWWA 2CSPA 3NQKA 1JK8A 2WO2B 5FYJD 1R1CA 4X6CA 1OL0A 1H6TA 4F9LA 2XBZA 1WEJL 4X0NA 4UAHA 5DC2A 3TN0C 1NC4D 1BM7A 2CIIA 4PEEA 5L0QC 2ZXDA 4X0KA 4Y7MA 5EUKB 7TAAA 3MRJA 3NCYP 2XWCA 1SOQA 3DV6A 2WYIA 2HCZX 4FNLH 1LTXA 4K5OA 5D2LE 5F0LB 3GUFA 3KLHC 1XZ0A 6FABL 2YD5A 3MLYH 1HHHB 2QPSA 5GRWA 1JE6A 5FV1L 4GUQA 2J72A 3VWJD 2IG2H 1E65A 4XPTL 2EILB 1S2EA 1HKFA 3HG5A 4UWQB 5EIIG 3FU6A 4HCRL 4OGZA 3C5XA 3PXJA 2Z8VC 3X3FL 2JELL 3WFZA 2FLBT 1R46A 3GSUB 3MLYL 4M8QB 3B56A 2I26N 3QEHB 3IJEA 5HVHB 4ZD3L 2DLFL 4RGMC 5E8NA 1ITBB 1WBYB 2AJ3A 3FSOA 3SBRA 3AT8A 2WAQA 3WTSA 4P23C 1CVRA 5IROA 4HIJA 3CU1A 2A77H 5C3IA 3D18B 3ZE2E 3MRCB 4OZ4B 5JUEL 4FABL 4JRWA 2FR4B 4OD1L 2WV3A 2Z92A 1WUZA 1HWGB 3ECUA 4MMXB 2XN2A 4IOSD 4FADA 3HC0A 4AYDC 3QAZB 3B7TA 2H6PB 3FK3A 3ILQC 3TBYB 4JMXA 3O81A 3TBCA 4MCMA 1A6ZB 1AS7A 3U4BL 1F1AA 3LN5A 4WEBH 4P99A 3POHA 5JPNC 2CXGA 1AS6A 1IIIA 4QHNA 5K9KA 1WTLA 3VXNA 1JV2B 4LEOB 1T20A 3QZWG 3GSOA 1N19A 4AEHL 4HC1L 5DMGC 5AUMA 4OFPA 4I2XB 3HC3L 5CNHA 5FOBB 1JXDA 2VDML 1DANT 2IBGA 3R0NA 4YDLB 4L3ED 1PYWA 1SBSH 1WP6A 2R59A 2VLRE 2F53E 4M1DL 4Y8AA 3V4PB 4N0RA 3DMMC 4N24A 5LN4A 4TQEH 4U1GB 3WLBA 3K2KA 1KFGA 3HPJB 3QQ4B 4FYRA 1MIMH 3Q8CA 1RIUH 1D6EA 4MB3A 4UUJA 1Z9SB 4RDBA 4JHWL 1B0GA 2QR0B 1R5VB 5BO1H 3B2PA 4FG6C 2C4FT 1HOCB 1L7TH 3IGLA 3I84A 2DJUA 2AEOA 4I77L 2Y2WA 1JF5A 3LB6D 3LNGA 3O0RH 1Q9WB 4N2OA 4WU7A 3DVIA 4IOFC 4XPTH 4HKZB 3SBWA 4YDJA 2XWZA 4Z7VF 1VERA 2QPDB 3TPUA 3WEMA 5JPMA 1VACA 1N6QH 4Z0BL 2ZZUT 6FABH 1FVEB 4FQPA 4ES8A 4KGLA 2OCJA 5C3LD 4H1LG 3MZTA 3NGBB 1GZHC 4F92B 1MF2H 4OD3H 5SWSB 5F0JB 4JGJA 3MRIA 3SOBH 3SYAA 1RZIB 4YBLC 4HOXA 3DROA 3VGDA 1NBQA 3LTVA 2AJZA 4W9IC 3N1GC 4RFOL 3ZDYE 3B9AA 3NCJH 3NUKA 4QRRD 3ABZA 1R3LA 2XKUA 3QIUD 4MB1A 3ZDZE 3BIKB 4KQ3H 1BAWA 4ZW6A 4ZFFA 4JO8A 1S9KC 1EGJH 3O11A 1NGPH 2ZICA 2NZIA 3V4UH 1V5JA 4LSQL 3VXTB 4JFFB 2E6QA 1M56B 3PWPA 5LXGH 4EN3C 1GY1A 3RIAK 2XCMC 2B39A 1CGWA 4AYBA 1OHQA 4JW3A 3CK0H 3AZUA 1KYAA 3LZNA 4Q8BA 3CVIL 1T1WB 3KYNA 4KHXH 5GS3A 1HXKA 2DJMA 3EJUA 4PRHE 3WUWA 4GH7B 3LHPL 2ZJSL 4YHOH 1CCZA 3ASOB 2HJLA 5EOCL 2D7QA 2H47C 3DK2A 5AWNH 5DQDH 4E41D 4E36A 2Z93A 1RUMH 4LLWA 3Q3GA 3S5LA 3N0AA 3WNOA 3NSXA 5B39A 1M1XA 2DQ6A 1L9PA 5DJYB 5IHLB 4FOMA 2XG4B 5GS0D 3WTVA 3VSUA 1C12B 1RVFH 1FNAA 4FL4C 1IC7L 2XTJD 1QSED 3BEVA 5IP4A 4WFFD 3NCEB 3UPAA 3DUSB 5DK2B 5AQ0A 3PP4L 5LGJA 4G7VH 2CCLA 1N8ZA 3ARFC 4I5BA 4XNDA 3QUZD 3QCUL 2HJKA 4B9CA 2EIBA 4B60A 1UT9A 1TITA 4QHMB 5HJ3A 3KGRA 1OIOA 4P2AA 1ORSA 4KWUA 4R2GC 3EOYG 1U8KA 2EYSB 3KYAA 3LV3B 3MRBB 3TEYA 2YMTA 4FQ1L 2XZZA 5FGCE 5I8KH 2L8AA 5HGAA 2YD1A 1UYWL 3C5SB 4HLZG 4W4OC 5JW5B 1V3KA 1MI5A 4ONFL 4XBGB 5DS1A 1UCBL 2E76C 1JTTA 3UZEC 3RGHA 5C0EB 3K71B 2EO9A 4M6NL 4EI6A 5CSZB 5HVWA 1YUKB 3HE6D 3RWIB 2O61B 1KCLA 4L2LA 5HYIA 3DJ9A 5C0DA 3ULUF 3PHQA 5JQHC 1GGYA 4JFEE 2DM7A 3NVQA 1BZ8A 5ESQB 5AZUA 4B3VA 4YS4A 2R15A 2AHIA 2V5YA 4KDWA 4GFXA 3LKNB 4U1JB 4Y4FB 4PJAA 3ESNA 1X9QA 3RL2B 3ARGB 5ITFA 5F89B 1U8CA 2BP8A 3JYBA 5IVXF 1NCTA 3EDEA 1MRFL 4HG4K 1JMXA 2X9YA 1G1KA 2QKIA 2Z35A 3TO4D 4FG4A 3VYPA 3P77A 3L1OL 3QG7H 2R2CA 3S35L 2OP4L 3B6SA 1L5GB 3P69A 1AFVL 1EZSA 4H8PA 1ZEAL 2P49B 3Q8AA 2J8HA 2WLJA 3ELAT 3BE1H 4X7SH 4HK3N 1SXNA 3D6GA 2Z91A 3JWNG 3S3DB 2WN2A 4N6RB 5I1HL 3C5ZD 3LS5H 1BGXL 2C1PA 3FUNA 4YHML 2WGXA 4F7EA 5KVGH 3BGAA 3GK8L 3FT4B 1PLCA 4UU9A 2GTWA 4MWFB 2NRDA 3SPJA 5MENE 3O2VH 4XE0A 3IGAB 4GI6A 3DI3B 2AW2A 2VW6A 3MNZB 1Q94B 1ED3A 4KVCL 1A7RL 4PN6A 3SODB 2KYIA 3KLQA 1YYLL 3NIGE 5IK3B 3TO4C 3BSZL 1G6RA 3R8QA 4R0LC 1AZBA 1I1FB 4GS7C 3FU9A 3IMBA 1IO4C 3U4EB 3ZTNH 5IHWA 2GT9B 1NCUA 4I9WE 4F93B 1T2XA 2WVSA 3HBZA 3QC5X 2AVFA 2N0MA 2OTWA 3TEXA 4XE5B 1VFUA 2G60H 3EJPA 5EUOE 4HPHA 2A83A 2QFRA 4IOIA 2CLZB 4N2KA 1W72H 1A9EB 1I75A 1YJDC 3EBGA 4PJ9B 4DGVH 5D7LE 3QAZC 4TMPA 3ZE0B 4JFFE 5TQ0L 2LFGA 5IFJB 3U30C 3V4VB 2EP6A 5E0QA 3ULUD 3CXDH 2O5YL 4G9FD 4Q89A 4AJ0A 3QEQE 4XN1A 5B1KA 2D4DA 3I50H 3L13A 3WN5B 1LXMA 4QYOB 3AT0A 1TLMA 5F9DC 2F7RA 1DQQA 1KCWA 4RDQF 3MLUH 3HE7D 3UJIL 3SJVA 1XSKA 1MAML 4WKZA 1EDHA 4JFQA 1MEXL 1C8PA 1TTCA 3QJTB 3HBGA 3K81A 4JZJB 4DGWC 2V3EA 4OR1A 4OCRH 3KH3A 1BF8A 5KVGL 4TNVK 4NFCA 1PJ9A 1FLRH 4PWKA 4S11A 4XMKH 1PD6A 4OZGF 4NRYB 2MCG1 3RWJA 3QYNA 4QRFA 5GS2H 5EO1A 3NIDB 1GYAA 4GSUA 1JS4A 1OTTD 3TA3B 1QLRA 4UTAL 3N9GH 3LD8B 3SDAC 4IKLA 1JERA 2B9AA 2FYYB 1NUDA 5HVHC 1RJYB 3FT4A 4F8OA 3OMIB 2DQTH 3V6ZA 4JG1L 4DAGH 4F24A 1XGPB 3NCWA 3RFZB 5L2KA 4L3FA 1AXIB 1CDHA 3RDTC 4XHJC 5KZCD 3MLRL 1I7TA 3TZVA 3U36B 2EVGA 5KG9B 1F90L 3FQ1A 4P2RE 3S6CA 4NI6A 2I27N 4J3VA 5CN2A 3I85A 4BUHA 1WH0A 1E6OL 1ZV2A 1RH8A 2HUEA 3P3UA 4IBQA 5DEGA 4UT6L 3ULVD 2B9BA 5E2WH 2FECI 1M42A 3HR5A 3RWGA 4FNQA 4RGNE 4HK0A 3EJCA 1A64A 4QR7A 3SOTA 4AQAA 5GPRA 3HMXH 1SY6H 5IBTL 4OM0H 4QTIL 3SE6A 3CNKA 3L3DB 4DQAA 5T33L 4JRXD 5C0DB 4YDLC 3V4VA 1ZXQA 2BY1A 4OIIL 4RMVA 1U92A 2C9VA 1WFOA 5BQDA 1ACYL 4JQVA 2BCKA 4FLSA 5CLYA 3D39E 1AGFA 1FZOB 2F53A 4UOQA 2YBRA 1IEAB 3HI6L 1W0YT 4P3CH 3N44F 4JFOB 1ETZB 1WWCA 1M6OA 5DD0L 2ZF8A 3P9MA 4DKEH 3GKWH 4WV1B 2DQFB 5KYXA 3QIUB 4MAUL 3EZ8A 3EO1B 4NUQA 1F1GA 1P7BA 5EOCJ 3Q06A 3SQBB 3QAQA 1UWEL 4RMSA 3EO0A 4APXA 3FUHA 3V55A 4FQXD 1BOYA 3GGWA 2DBLH 3ZHNA 5ID1B 5L4MA 4FQLL 4QHKI 3B3IB 1S9WA 2AQTA 3C08L 2H45A 4PJ5A 4Q2ZA 4YSSA 5HYJB 2A9NL 4A6YH 5I5IA 4DPBX 2FWLB 3UTOA 4AYFB 4NZUL 4M5SA 4MWFA 4Y9CA 5GHWL 3EG9A 2W0PA 4HETA 2JCCE 4JQIA 5C0GA 5I6NA 3CH1A 4M3JA 3AJ7A 3TCXA 4NXSA 3FSZA 2OZ4L 4L0PB 3IYLW 3GZKA 4RGNB 2Y3NA 3GRBA 1WCQA 2V0AA 3D09A 3FUMA 5DJ2A 1R5IA 5EU4B 4F7PA 3VD0A 4UUJB 1TQBC 4JLRB 3LRHA 2KLSA 2FQGA 2Y5EA 4K8RC 1MI5E 1CFTA 3MTRA 4UOJA 4CN1A 5CEYB 1AYRA 1IKFL 2YN3A 1QLFA 3KNBB 3HE6B 1YEJL 2R7EB 4KV5F 4H20H 1DQJB 4U1IB 2I25N 4ZMPA 5AVYB 3VWKB 3RGVD 3KPLB 3GMNA 4NGHH 5C9KA 4M6MH 2Z7YA 4U49A 1CB4A 3T0EB 1A9VA 2CKBB 1KBPA 4KO5A 2V5SA 5CCJA 1S5IL 1H3TA 4HWBH 4TUOA 1UB5A 1X5AA 5I8EB 5JHLA 2R1YB 2VDMB 4PI2A 4BRJA 3EJSA 3FB7A 4BJLA 5C7XL 1A25A 1FHNA 2RB8A 1RZ7H 2F15A 3VD5A 4Y5YC 2B0SH 4GMSH 4DERA 3UPRA 4HFUL 3TO2B 4KKBD 2DM3A 1MN4A 4KXBA 2BVOB 1ET5A 3RWEB 4B9ZA 3IJYA 3SDCC 5IJKC 1AXSA 5BW7A 3SJVB 4ABVA 1FSKB 1GYCA 1KCSH 1HHKA 1MFAL 3CN3A 4M3HA 1XGUA 1ZPLA 1AGCB 1U58B 5J6HA 3NSYA 4H2AA 1SQ2N 5FO9B 1YN7A 2F5AL 2O72A 4W9KC 4N86A 4NO0A 2YZ1A 3U0TA 3TCTA 4UQAA 4AEHH 1FZMA 5FUOL 3VYNA 4QHUB 4XMUA 4IBUA 1J9TA 3BDBA 1E3ZA 3KS0H 1CL7L 3O4OB 4PJHB 4XT1C 2DYRB 3V6FA 1IVTA 2FECL 4HKBA 3NQIA 2O61A 4XB8A 1IGFL 5JOPD 4HFWB 1LO0H 1R0AH 4ORGA 4K5LA 4ZO8A 3FB8A 3EG9B 2VDLL 5I0VA 4UT9A 4BIKA 1DQDL 1LE9B 1MFVA 3U46B 3FW6A 2GFBB 4ODHH 5CGTA 2DLEA 2Y1VA 4MAZA 4OT1L 4PJAB 5F3HB 5CHNB 2B1HH 3H42L 4YBLB 4C56A 1OB1A 1VFAB 3BLBA 4JDTH 4HLEA 4H26B 1WK0A 1P7QA 3SKNB 1UD5A 2CPCA 3MREA 1VADB 4GINA 4L8SC 2YGPA 1K2DB 3VXUD 5KYUB 1Q0YL 2EDLA 5AOKA 3O3DB 3ZRFC 5JXEC 1EAPB 2V17L 4WSKA 1GAFH 2IGLA 5HDQH 4G8GA 2NYYC 1B6DA 3TESA 1J18A 1JFQH 2IAMA 4MCYA 3ZKSD 5C7XH 3VX1A 3ZKQD 5HGAB 3U83A 1RULH 1FFNA 5DXWA 3G6AA 3TVMB 3BP4B 4M93C 3T6VA 4ANKA 3P2BA 3CDZA 1B4TA 1KYFA 4K3EH 3BZEA 1N5YL 2GBAA 2WNWA 3CUPA 1VENA 3AY2A 2FBOJ 4MA8H 1WDAA 5D7JD 4BM7A 2V9QA 1QFWH 5E7BA 4F9PC 1D5XB 1ACCA 4TNFA 4HOWA 4F91B 3UC0H 2AKRA 4I88A 3HB3C 5DRNB 1G6RB 2B4CH 3MV7B 1KBWA 5IROC 1S4IA 4PVMA 4GG6E 1HH9B 3G5VB 1NM9A 3GMLA 3HHSA 2C34A 3KPOA 2W60A 1G94A 2ZUWA 1C16A 1JK9B 5JHLL 3H9HB 2MWCA 3D25A 4JFXB 1U8IA 1X4XA 4G70B 1WFNA 2N0KA 4LCUB 5I16B 2A9NH 1A9EA 1MG3C 2WLIA 3MUJA 2GJRA 2Y7OA 1LDPL 1E67A 4XN4A 5L4IA 4OF7A 3WS6C 2GTQA 5DZLA 3G3LA 3FAXA 3HG4A 4BKLB 1X7QB 3VFSA 3KR3L 5KOVC 2F1AA 3PQYD 3OF6D 1SYSA 1URLA 4G7VL 3BISA 1RL1A 4FA6A 4TLKA 5KUKA 3RVVD 2DLTA 4JUTA 4EI0A 3K46A 4LVHC 3BH9B 4ETYA 4TQPA 2G5UA 4OZ4A 4PRIB 1J5IA 2N1TE 4UM9A 5GRVK 2R0KL 3ATBA 3FDWA 1YAZA 3QDMA 1WIOA 3ARVA 1SYVA 2G5BB 4ZMAT 5T1LD 1G7LA 3H9SB 4OGAC 3K0YA 3ULVH 4M1GH 5SWZE 3RY5A 5JLZB 2RGSA 2Y7QA 3EDFA 2K3HA 5D7IE 4Q56A 1WZLA 4M7LT 1N5AA 3PAZA 5H2BB 1RZ8B 2G0LA 4FJYA 1SXBA 2O6CA 1BQHA 4ZMLA 3MXVH 3WV0A 2JLPA 2YK1H 3LZLA 3MRDA 5DD3H 4X83A 5L8KB 1KLUA 1ACZA 4EZKA 2YIHA 1T5WB 3HCVB 3SJVD 1NCGA 3AQYA 1TJGL 2V2XA 3ILQD 3RPKA 3IAQA 1PTZA 3P2DA 3UJTL 1RK0B 1SPDA 3JWOC 4C57C 4FC3E 2K6ZA 4KRPB 4ZXBB 4UT6H 3V0EA 2XZAL 3ZOAA 1GYUA 3CFJA 2BVOA 4FFVD 1MZYA 5G2NA 3QRGL 3RWEA 4DF9A 1QZ1A 1QWHA 2PR9A 5AZ2L 3WGUB 3NCBB 4KI1A 2BNQD 1HXMA 1G7MA 1PIGA 5KG9A 3BH8A 4APQB 3AY4C 4MJIB 3WJMA 2A9DA 3DJSA 2P8PB 3QUMA 5KJ7E 2AP2A 1TZIA 4AYGA 3MO1A 3UGUA 5AAPA 2GTZB 5DJ8B 1JHKL 4KDVA 5IQNA 4BQ9A 2BNRA 4GAJH 4Q14A 5CILL 4GG8A 1CD1A 3PDOA 3MLPA 3F5WA 5CP7B 3VXRB 5FIEA 5H4YA 2L04A 5FFOA 4QRTA 2VN5A 2X9ZA 1I1AA 4NM8L 2P4AB 4JX0A 4PJXA 2YD4A 3ZQWA 4LBEA 3C5JB 1F58L 5F93C 1J86A 3U6XS 1KT2B 1EDQA 1U93A 2CRYA 4MXWL 1S7XA 4PJFA 2VZVA 3E6HB 3LN4B 5AOJA 5BOZG 4J7RA 1U92B 1S7SB 2WOBA 4JRFA 4IBTA 5E6IA 4DEUA 5C70A 4JDTL 5DD5L 1E4KA 4KU1A 2H2SC 3BH9A 3MKKA 1C08A 1QO3B 3GINA 2KQMA 1UFUA 2KZBA 4KKLD 1BF2A 1HCYA 1DVQA 4GPVA 5BW7C 3RBGA 2VMEA 4BXVA 3REWB 3DHMA 3CLFH 3NJIA 2LQRA 1SXAA 4JRXA 1R0AL 1JPFB 3C09C 2XI9A 3MUY1 5CBEA 2VTFA 4APXB 4EQ3A 4OF6A 5E1GA 3HZYA 1J0HA 4IHBA 3KPNA 3UAJC 1PJWA 3V6OC 2FHBA 1FNEA 2EH8L 5DTFA 2NW2B 2P26A 4UILL 5JPMB 1SJHB 4NCDA 1BFVL 1CVSC 2WWMD 2VR5A 3CDZB 3J8F7 1X4YA 1AJ7L 1P7KA 2I7SA 3M86A 3QIWC 1LK2A 1ADQH 4I18C 1LK3L 1JVKA 4EPSA 2M1KA 4TPRH 5D55A 3WE6B 4ALAC 2BSDA 2HFTA 4NNPL 2XXCB 1OWRM 3FU3A 4OLZH 3MI6A 1KCSL 1QFPA 1JVOA 4WZ9A 2VIRA 3UMNA 2VDLB 4GG6A 3FO1A 5DS8B 1IJ9A 1XMWA 3TBSB 2HFEA 3KPOB 3KPSE 2PW1A 3BVWA 3M1OA 1NMAL 3M88A 1SUJA 3H6AA 2X4NB 1CGSH 3QFJA 3O2DA 3QQDA 2JELH 1J8HA 4HUVB 3ECWA 2OMTB 1RZKL 1DBJL 9PCYA 5AVRB 2P24B 4LCCB 4EUPA 2Z7UA 2NPLX 5C08A 1QA9B 1XFPA 3KYMB 2VR9A 4MKMA 5L6YL 1OKEA 2J8UE 2UY6A 4LLYA 4U1NB 2OMVA 1RSFA 4JRYB 4JR9H 1GOFA 1N26A 2ZUXA 5FHBL 4LP5A 4XNZB 4Z5RA 1LLAA 5C0AE 4YHZL 3STLA 2O1AA 1YEGH 2HRHA 1B90A 1VCAA 2VUOA 2WBWB 5JNYA 2EE0A 4OSUH 1EAOA 4HW6A 1TTAA 4CNIB 1S8DB 3L2LA 4MZRA 5BVPL 3KJ6H 2FATH 3FTXA 4EDXB 1JZ6A 4N0UB 2HVJB 5T1JA 2J4WL 3QPQD 3CZEA 5T1DH 4TXVB 4PCTA 2CE6A 1JSYA 2XQBL 5IEHB 1DEEB 1WICA 1JNNH 3VJ6B 1I7UB 1KWKA 2HN7A 3HA0A 1FZMB 3CC1A 2YXMA 1R5WA 4V33A 2CPUA 1CLVA 4K94C 2X2JA 3D69B 4HQQL 2BWQA 5I6XB 3QEQB 1Q9KA 3SPGA 4NRZB 2H8PB 2XRAH 1QEWA 3D4ZA 4G6AD 4MA7H 4PJ7A 5J5EA 4IBVA 1UYWH 2J25A 3ZHFA 2YJLA 3OKNB 5L7XL 2FB4H 3COOA 3EXJA 2HT4C 4ZTOH 3CSPA 5DVLA 3VCLB 1FNGB 5DMGD 5MI0B 1HZLA 3Q9QA 2E7BA 3K4AA 4KHTH 4JPVL 4XP5L 4E2OA 3IGAA 3WD5H 5JZ7D 3QZMA 1MFEL 3F7RA 2GFBA 4UQ9A 4QAMB 1NCCH 3UBHA 3X12B 4DP9X 1F6AB 5D1ZD 1E2ZA 1BZQK 3WSQH 5D7HA 1VJSA 3OAYH 5B39G 2G2NA 4AE0A 1BECA 1LEGA 3PGFH 2BSCA 4G7YH 1AO7A 1T4WA 1QRNE 1ERNA 2MQCA 3JWDL 4ZUVB 3IDYC 3VI3F 4DEWA 4E41B 1HNFA 4KV5E 4X42A 2GC7C 2OMYB 5IESH 4J4PC 2X3CA 4EXKA 5KN5B 2IAMB 1GGCL 1JPGB 1KB5B 3C6LD 2WXNA 3U7WH 4N6QA 4AENA 1ZE3H 2DQGH 1YMHB 2YXFA 3DPBA 4YEEA 3Q5TA 4UNUA 4P5RA 1B3IA 4M03A 5AALA 3CFDB 4XO9A 4JFFD 2W0FB 5D93C 4J4PA 3PL6C 4L1SA 1FVDB 2G75B 1NDMB 3GZOA 4LOEA 4YSRA 1I8LA 1QRNA 5BS0A 4KTDL 1LWJA 4PRIE 1IGTA 1NGPL 3QISA 4FQCL 3ZKXB 2XG5B 3AS2A 4CMHC 3UTSD 4NAQA 2WSKA 2AMUA 3F12B 2A6KB 4N3UA 2YA0A 3VI3B 3CFTA 4KRNA 4E5XA 2BWIA 2GSGA 4KTDH 3MOAH 1KGCE 4NZ8A 5KVEL 3BDXA 3B8YA 2VZ1A 4PSPA 4OLVH 3ARTA 4H88H 4XPFL 2MKLC 1N59B 4XPBH 3QE5A 2YR3A 2R29L 2QGCA 3T3PE 1UOKA 2GYSA 3QZBA 1CBVH 3HI1A 5HVFB 4BGLA 2ATKB 3NDYE 3MBEC 1XF3B 2HFFB 3NCYS 4O9HH 1AYOA 4PGCB 4MRBA 3SCMC 3V0HA 4CN4A 1BJMA 1NEPA 2OXGA 3NJXA 1NOFA 1QBLL 2VR4A 1ROWA 4S1SL 3E8UH 3GLDA 3HHMA 4FXGA 4OGXL 2G3NA 4L0ZA 4PVBA 5AW5B 4G7YL 3QSKB 3BSHA 3DWTA 3HMWH 5EEUA 4D0BA 4IRZH 4XZUA 3MODL 1XSOA 2DOCA 3ARRA 2ROXA 3IU3A 1RZKC 4BFJA 3TV3H 1RIVH 1PU0A 3QPXL 3FKUS 1MFEH 1INQB 2X4PB 4M1CC 5AOZA 4WKZB 4WW2C 2A1WL 4RGOH 4HUVA 4RAVA 4F7KA 3BFWA 2NOYA 4WUKL 1FL6A 1HSAB 4XO5A 4FMVA 3U82B 4YQXL 1NM4A 3GM8A 1FCGA 3UABA 1QBMH 3D08A 4B0MB 1USQA 2NY6B 1OWWA 3HCVA 3P4MA 5E2VH 5I16A 3TP4A 2DPKA 4EO5A 2X2HA 2F61A 5DSCB 3P0YL 1UWGH 3L45A 4GOSA 4GSRA 2YUZA 1TKWB 3E2HC 4U3XA 5EU6E 4PJAE 5HHOD 3MV7D 3S4SB 5LWYH 1WJ3A 1SJVA 1JGEB 2WVTA 5DO2C 5JHLH 2YEVB 2H3XC 1NGXB 4UQDA 5JXEA 4Y19A 3HE6C 3CBKB 1AVAA 2CIKA 2NT0A 4HJTA 3CH1B 2YAFA 4UM9B 5IMLA 3WY2A 4JO1H 1NPUA 1ZT7B 2CALA 3HN3A 5GGVL 2WINA 4B9GA 4CKVX 3S34H 1FORH 4JPSA 3Q05A 1L0PA 3WS3A 4FA7B 4AQZA 2NXYD 1M57B 3C09B 4PJEF 3SYQA 1RUAH 1UTDA 1AQDB 1XHHA 5J56B 5CEYA 3U48A 3H3PL 3TURA 1F42A 2D7PA 3L2MA 2H3NB 4Q9RL 3AU1B 3KHQA 2D31B 2A9ML 5F6HI 3T5WA 3SN6N 1MFUA 2C9RA 3MRDB 5EOTA 1N3NB 4HUNB 2HTKD 2E86A 5F9AC 2WLLB 3JV4B 3PWLB 2QLYA 3S35H 4JY5H 1UG9A 4HK3J 1J9SA 3RQ3A 3GXMA 3BWZA 2FO4A 2XY1A 2NR6D 1MNUL 2PUQT 1VPOL 1BZ7B 1KGWA 1URZA 1XD0A 2GSIB 4XVTH 1RPKA 4KDTA 4O5LL 3SKOB 5FDWA 2F1EA 2FQDA 5F7UA 2J6EA 1QKZH 3GBNL 3GSNB 1PY4A 4QEGA 5J12C 12E8L 2Y7SA 2R0ZL 4X8JB 5SWQB 2AQNA 3ORJA 3OGOE 3VFNA 5IF0A 4I87A 4U1IA 3L54A 4FFYH 1DJWA 4TPRL 5FV2A 2DQEH 2CJUH 2K8MA 3MO1B 4Q7DA 5E6ID 3FQXB 3GLZA 1AQ8A 1UA6L 1W15A 4ODXA 3ULVF 5DR5H 4YAQA 2C7UA 3ZTEA 2VR8A 2APVA 4QO1A 1MREH 4H8WL 3TOPA 3QI9D 1SJHA 2DQHH 4ZFQA 1EZUA 4YHIB 4WI8A 4Z6AT 1NGYA 3QQ3A 1MVYA 1NFDA 4EOWH 4I2XE 5BS0B 4PS8A 3DMMA 3SE8H 2O93L 1MCQA 3S4SA 5LDSA 3N85H 1O7DC 1T3FA 5TGBA 3PL6A 4LSSH 2ED6A 4WW2F 1F3DH 1MLBB 4XNMB 2HT2D 5GS0L 1WFMA 3AXLB 2HLAB 2YD7A 4OM1H 2GK0B 1QHOA 1B4JH 3O8XD 5JPNA 3E3QC 4EDWH 2R51A 1DJGA 4UB0L 1CDUA 4G8GE 1EEQA 2R7EA 2JIXA 2ODIA 4FDWA 1JPFA 2CKNA 2XJKA 1SVZA 4JFYA 3SY6A 5IW1A 1RZ7L 4KXAA 4YSPA 5IB1A 4LL4A 1YNLH 5D7SH 3CG8A 5T3ZL 3I3BA 3X17A 2QZ5A 3F7YB 5JPMC 4OZFG 4EZLA 4OZGE 2BFGA 1C5BH 3KYOB 1BM3L 1GGIL 4EUPH 2HG5B 1M05B 1G9NL 1IFRA 3ILPB 1PZ5B 3B2DC 4JL1A 1RURH 4K7FB 5F97E 1YZZA 3JTSB 3GB7B 1H0DA 3LQZB 4KQ3L 3GMMA 3RWCA 3U0WL 2GSIA 4QRRE 4ZOCA 3F64A 2WSPA 1AXSB 5KVEH 5EF3A 2MPAH 4FEMA 2OM5A 3OAWA 2Z31A 2P3YA 1UXSB 2AQSA 1QYGL 5LQBH 3LH9A 3O6LL 2V9TA 3DA0A 4NFDA 3U0WH 1EAPA 1WITA 1OAQH 1YJDL 3FH7A 4FG2A 1OSZA 3B7SA 1I7UA 4NP9A 3QZWB 1MHCB 1O9VA 3BPNB 4N2MA 5GHWH 3GM0A 3FQXA 4J8RA 2DYPA 4CSZA 4UDTA 2NZ9D 2J57A 2CK0H 5FW6A 1Z32X 2N7BA 1FF5A 1BSIA 3QULA 5K59E 2DWEB 3MLVL 4HBCH 3EF7A 4X5WB 3IRZA 4X80H 2XOTA 1GRWA 3RL1B 1FVEA 4P05A 2AXGA 4NM4L 3ALPA 3CUPB 3E7JA 5ICXA 2FH8A 4TNEA 2ORBL 4WWKA 5AUMB 2JQAA 1J0JA 4Y2DC 3U7WL 5B7MA 3QUML 4O00A 5DD0H 4DKEL 1T3FB 1A6TB 2CDEA 1A21A 5CD5C 4R0LB 1HH9A 5F44A 1HDMB 4HGWA 4APQC 1SLUA 3T2NH 1VF5C 1HQ4A 3O6FD 5FYLE 3RWDA 1MJ7H 4N0UA 5B1BB 4HIEB 4IOFD 4AZ8A 2WLZA 4Y9FA 4JO3L 3H9HA 2OMYA 2BIMA 1NCCL 3QNXA 4N87A 5EH1A 4F2MB 3AU1A 1OF2A 1FNLA 1Q1JH 3MV9E 3FBQA 5GZND 1UWXH 2GJPA 5KVEE 3IFNL 1HKLL 4JM2A 5IVXB 4F1ZA 2WUCL 4N8CL 2HG0A 1KTLA 3CVCA 3NIFF 2WNKA 5TDNA 5J1AA 5AYQA 1E8ZA 3QS3A 3FTSA 1JGLH 1H8SA 2FD6H 2CG9X 4L4JA 4O51B 5IMKA 3MX0B 5TK2A 4AQ1B 5I8CA 1A4AA 3SDYL 2TAAA 3T0ED 3TFKC 2SODB 4ODSH 4WWOA 3BT2H 1QSEA 5TPWH 1A6WL 3UG5A 2F7PA 2DJ4A 3C6LA 4KK5C 1DQTA 3KHOA 4GKSB 4CU7A 5J1TC 1CD9B 1H5BB 4DGYH 4KY1L 4FQQB 2D3JA 4AL8L 5D1XD 2YFOA 1KENH 2P5WB 1PKQA 2Z4QA 1BF5A 3B4NA 2YAPA 4ZUSA 3DNKA 1SDYA 2ZOKA 2E75C 3QNZA 3GSWB 1MHEB 2HJFA 2Z31B 4Z77B 4HDIB 2PCFA 1PQZB 4XNQB 4Z7OB 1TTBA 3GXPA 3K4ZA 1OD7A 2VZTA 1NGWA 2XC8A 2AI0H 1WTGT 4FF9A 4HCRH 2I07A 2X2IA 1RHHB 1TEFA 1XSIA 3I9IA 2YQGA 3T4YB 2NMSA 3NAAH 4GW1B 1E40A 2CO1A 4O2FA 1CICC 4X9BA 5C0BB 5E99L 3S88L 4FNLL 3K71A 1U4FA 3AROA 3G04B 1TQTA 3NIGB 2XX1A 3N55A 4OIFA 1R3JA 1ID5I 4XZUB 5ISZD 2RACA 2YXVA 2NY4D 1E5UI 1MEXH 3LX9A 2XN9A 1FORL 1KCKA 3IAGC 2BIPA 1NFKA 5IBUB 1TDQA 1OGPA 4YHKL 3B9KA 4MS6A 2OR9H 3DX8B 1NMAH 1BBDH 2MJWA 3TO4A 4KQ0A 4F5CA 2JCCB 2IAMC 3CFCL 4ZFZA 3TH2T 3W0WE 1O5PA 2ZYHA 3DTDA 3MLSL 4DUXA 4LU5L 2X3AA 2Y06H 3FT0A 3MBXH 2BM3A 1KMGA 3QXAB 3GI9H 1EBAA 2BY3A 3O45A 3FTGB 3CFKA 4WUUB 4Y5YB 1NWOA 5H37G 4ZNEA 2ISDA 2A4CA 2HRPH 1RJLB 3NIGF 2FIRT 3FT2A 2R4SH 5H94A 4ZG1A 1AGBB 4XVJH 4KO9A 1KJMB 4EBQH 3BQUA 2X4RB 1NA8A 3PPSA 2XIDA 1JZIA 1XO8A 4N2CA 1XR9B 4KTEL 3NESA 1F4XL 2HUHA 4J6IA 3KDPB 2VR7A 5I1EH 2VSMB 5J06A 4KC3B 3TV3L 3BQUC 1QEXA 3GBML 3QGVA 2ZWZA 3T09A 5IB5A 1VIWA 2VRAA 1KCVH 5IJDC 2P8PA 4C4KT 1ZK5A 3GBEA 3PDGA 5EUKA 4NN6B 1CGXA 1LP9F 4WFHD 3ARGA 3KXFD 3T77A 4UQ2B 3CHOA 5J9PA 3RZCB 1HSAA 4FLQA 4Y88A 1Z7JA 3HUJA 4OGYH 1MDTA 4CKQA 3SGKA 1TYEB 3ZMEA 1SHWA 4GIPD 4KJWC 3PIQB 1C9SA 2BXYA 4IBYA 4Y2OA 5IEKB 1RU9H 3C2AH 5GGRY 3GJEB 5BV7H 1VEPA 1F11B 2CHNA 2BY2A 3LPWA 4MJ5B 1USZA 1SXCA 1A7OH 1YDPA 5DUML 4KI5F 3GSNA 4LPCA 1JHKH 4A2LA 5G4OA 4CJ1A 1C5CH 1F1DA 5E2TH 3MZGB 2OTPA 1OCOB 1OSPL 3WHXB 5D5MF 1VGEH 3ULSB 3AB0C 4ZAKA 2GPZA 3GBLA 1OP5K 4WW1A 3MLTA 2VXQH 3KVPA 2HX8A 4QLWA 5DEZA 4JZJA 2OL3A 4A68A 1XH3B 4GAYA 3RHWK 1SQMA 5IVOA 3K8MA 3U7YH 4IIZA 4QO1B 4AUYA 4KK8D 3HG1A 1CDBA 3MGOA 4KKBC 4JDEA 4ONFH 1U3YA 4WUUA 1F3RB 1OANA 2R56L 4TV3A 3PGCB 1FP5A 2WCSA 4BK8A 4ZX5A 5IGXH 1I8UA 3IKCB 5K1VA 3S3BB 2M8XA 2BLFA 4GT0A 3TYGH 1PYWB 5IMMA 3H54A 5AB9A 3SO5A 5DJDA 3GMOA 1EAQA 2YQ2A 1KV7A 1QNZL 3TJHD 1T66C 2MOGA 2QGEA 4P3CL 4X6DA 3VXQB 2ZWKA 3NEOA 3TZVD 4OCYL 5FO7B 4P5SA 3LKRB 3SKOA 1PKQB 1JP5A 4O2CA 3STZA 1QMUA 1A1OA 1ACYH 2GHZA 3ULAB 3T0EE 2MEJB 3CSGA 3W39A 4KZEL 5AVTB 4I0KA 1F4YL 1KPUA 2H9GA 2GG1A 4U0QB 5ES4B 5T1MA 3WTTA 5IWLC 4NQEB 3SKUD 3AU0A 2WK2A 1R5WB 3UGEA 2WZPA 4MDJA 4LHJB 2ZJSH 4YHOL 4WI9A 2QMJA 1D5MB 3CMOH 2BSTB 3ZW3A 3BKJL 4HQQH 4S2SA 4GJTB 4V1DD 3D50A 4OB5L 1CICD 5AL8A 2ZSWB 3H0TA 5EN2A 3IK2A 5HP5A 1R3JB 1JNNL 5FOBA 2A7BA 4OW6A 4CU6A 5HI4D 5HYJE 1QACA 1TPXC 1XQ4A 4UQCA 3HHRB 1UT1A 4AKOA 3EJTA 4MJ4A 2WZAA 3B9KB 5AEAA 1SBBA 4POYA 4GNKB 4HSCX 4ELMB 1KYOJ 4EIGB 4YSCA 3CVBA 3MLSH 1OT4A 1X7TA 4YWGH 3TTYA 1I9JH 4IKIA 3RUGA 3EDKA 1PY9A 2C5DC 4WFGD 2UXTA 1T2QH 3PV7A 1M1SA 2V33A 2A74A 5C0JA 1ZA6B 2PXYC 5ADPH 3ZLQC 2VJ8A 2Z7WA 4UNIA 4L3CA 4O2EA 1DFBH 3NABH 4MA1C 2CO6B 2NY5L 2CGYA 2ZCLH 2CA3A 2CO7A 3UYPA 1G9MH 3QUZC 5L6YH 5SV4A 4EXPX 4RRPA 3VRIA 3RAJH 4EI5B 2OSXA 3SSGA 2X6MA 1SLWA 1WC7A 2C3HA 3HFML 3OR6B 3QDJA 5FC9A 2BIHA 4P5TB 2VWEE 1AACA 3GIVB 3X13B 3CTTA 4XPHL 3VGAC 1U91A 4HCGA 5LB1A 1PVHA 5GS0C 2AC0A 1VGKA 1JHLL 2WNGA 3DYOA 1C12A 2OL3L 2D3NA 1S5HA 3FH5A 3STZB 4PS7A 3RDTB 3MBED 1IM9A 4ATWA 1AR2A 4X6EB 4JM2C 1TMCB 4J3WA 2CO3A 3HS9A 3MRFB 5DWPA 3HG0A 32C2A 4IDLA 2CCWA 1OD9A 5HDBF 1VFOA 1HL5A 3VWKA 1WG3A 1GZHA 4OFYD 2F19L 2FHFA 2EDHA 1BZ9B 4ADIA 2ZIDA 4N28A 2NXZD 4PIRF 3IMSA 1NBVL 3HAEG 2BO0A 5D2NE 3SDAB 4Y5XC 4G6JH 1FIEA 43C9B 4N2GA 5B1JC 4BDVA 4ENED 5DHYB 1A3RL 2ZP8A 4UTAA 4PY8I 1HFUA 2Y25A 5INCB 2VN7A 3SGEH 4I0CC 3BYTA 1BCIA 4W4NA 3BUYA 4BKTC 2VDOB 4Z7UB 1H3UA 4M8QA 2FEEL 4OZFB 2D0FA 3QWNA 5J6GA 4J6RH 4K8RD 3E8VA 2HJLB 3ESVF 2PCPB 1UJTA 3HI5H 3MRQA 1JTPA 1UD6A 1HESA 1XX9C 2E5EA 3PPEA 4R4FL 3DC0A 1QP1A 1YEHL 3WHXA 2XYBA 4HIJB 1XSJA 3A3YB 4ELMA 3LRSA 5HDBB 4QXVA 3TT3L 4OCYH 1B4LA 2FWOB 3EO9H 1OQXA 4W6WB 2PP9A 1FH5L 4NQDA 1B3JA 3T0WA 4DZBB 1EZVX 4H8VA 1E5BA 2VRQA 4GRWB 1KGXA 1QQDA 2CUAA 2K6YA 1NOAA 1C8QA 3H8NA 3AC0A 3JQOB 4MBRA 1SGKA 2L7JA 3DJTA 1QG3A 4UZUA 3QXWA 3ARBD 4Q6IB 2IWEA 2EEBA 3L3GB 2YRLA 3DX9B 5E4EB 5LXGL 1V54B 3NPSB 3PWLA 4H2CA 4JRLA 1QI3A 1IL1B 5B1AB 4EEEA 1ZANL 2WP3T 5D1XC 1JIBA 4ZS7H 4BHUI 4NQDE 1J1OH 5CZVH 1PX8A 1A7PL 1GVIA 4KBPA 5EBWA 3L5HA 4ABUA 4FHJA 4GW4B 4ZO7A 3N44B 4XRCA 4PTUA 5FDWB 1YAIA 4G9FB 3MRHA 1SOKA 4XCYB 1BXVA 2Q3ZA 2WLMA 3Q0HA 4NB7A 3MRJB 3HJEA 5DMIL 5EORH 3TBSA 4ZZFA 5FO2A 4UTCA 3JT0A 3VFMB 3RZCC 2F58L 3ZHDA 2X6AA 3V5KB 2FLRT 3C87A 4DKDC 2XKNA 2YPLE 2NQCA 1HWHB 3MR9A 3TJHC 5E6SB 3WDIA 4A6YL 4PJ5E 4GW1A 1OCZB 3UL4A 2V8MA 1HEZA 43C9A 5D7JA 5CBAA 2JVUA 3LNEA 5GJSH 2YAOA 4X5RA 4G8FB 5A2BA 3BP6A 4Y16B 3GUTB 2XWJA 3WFEL 2DWXA 1IAMA 1UKQA 1T1YB 3QUYA 1RFDH 4FGMA 2VLKE 5ALBH 5AW8B 3MCLL 3JV0A 5DJ6A 2XFXB 4G5AA 4EDWL 4LEBA 5EBMA 5ESVA 1Q94A 5MEOB 2NNRA 3LRSB 4JAMA 1BZOA 4AVJA 3MCLH 2GAZA 3T0DA 2CHZA 2G2RB 1ZS2A 2CJ3A 3LQAC 2IC2A 4N68A 4MQ7B 1BQRA 3B7RL 4W9FC 2P5PA 5E4EC 3PV6A 1OCWH 3O3DA 5I5MA 4JRYD 1RZJH 1B0WA 2VDNH 3T8XA 2HN7B 2PTVA 3NGBC 2R1WB 4G8IA 5FCSH 3LNIA 5I9QB 2X6VA 1ZLVH 1FGNH 5EIIA 2P7TB 4BKLA 5CUSH 1ZAGA 1Q0EA 1WAEA 4J3OH 2GSMB 3DMMB 5FFLA 4K07A 2ZYRA 4B9IA 3BDYL 3U4BH 3OKNA 4F7TA 1R3KB 4OFQA 2A73A 1BW8A 1XR9A 2HG5A 3CDFA 1P6WA 2QZQA 2GJZA 2YPLB 2EVJA 1EFXA 2AQ2A 4WHYH 4M1CD 4RZCB 1R5VA 1U3HC 2VGLM 5M94B 1I7TB 3TZVB 2YC1A 1OTUD 4KOCA 1OPOA 4AOFA 4BA0A 4GIAA 4Y8DC 3PJNA 4XC3L 3P4LA 2YBGA 1MF2L 4P5MB 2RA1A 3MNDA 4DOHE 5J9PB 3DETC 4L4VE 5IT2H 4P2RB 2NQDA 4G71B 2WC7A 1UACL 3IDXH 4ELMF 4UTBL 3LKSA 2KLRA 3D2UD 3OD3A 3Q48A 1R3HB 4KKRA 4PRHA 4BFIB 2PABA 3C6SB 5HYEA 1VACB 5E8OA 2VLKD 1KOAA 5DRXA 4I7ZC 1H6EA 3IDXL 1DSYA 3LS4H 5B22A 3CFDA 1FLRL 3DPDA 4WU5A 3LZRA 2FX9L 3WFBH 2NX5E 4KMTH 5AKVA 4B9YA 2O5XH 1WA2X 1KIPB 3CV5A 3HG1D 1JJUA 4LL1A 2N1KA 3BLKA 3GSNL 3DHUA 4MHHG 3S37L 3HB3D 5CSBA 2L4OA 1P84K 4YJZL 3NJMA 3L3HB 4QCIA 1ZLWK 4MDIA 5I76B 3ZK0A 3Q2NA 1U8NA 2QLVB 4G8EB 3LZFL 1HHIB 2EXYD 4MASA 5DT1H 1I1AD 5BUAA 2BS71 2FT8A 4YX2H 2JKXA 2CR0A 1TOXA 4I5BB 3QO1B 4LGPB 4DH2A 4LOUD 5F6HJ 1ODUA 2WBKA 5ANMB 5JZ7C 1FGNL 5T1KA 2KUTA 3OKDB 1EVTC 4JM2B 5IVXA 4HS3B 3VGEA 4EJ1C 1B2YA 1YC7A 3BCDA 2EDEA 4JJOA 3UZQA 1RJCA 2LW3A 1BQLL 3CFNA 4IYKA 4B7LA 1AKJD 4M02A 2XPZA 4EZJA 3JWNH 4F7CA 2YLHA 2BOLA 3D34A 4KAQH 4LF3B 4PFEA 4X6DB 1TNMA 1DL7H 5IVZB 2XU9A 3VXQA 5GRUL 3SPIA 3A4DA 3ARDB 5LKNA 2CBQA 5J13C 3L08A 1T04B 2R2HB 3OAZK 4JB9L 4ZFGH 1DDHA 1KYOK 1JK8B 1FFRA 3C5ZB 1UADC 5CLZA 1A14H 2BRQA 1D5IH 3HS0A 4TNWF 1AR1C 1PW3A 2AEQL 5C0ND 2OULB 2X0UA 1FIGH 1PQZA 4JQIH 3MR9B 3HZYB 4Z3FA 5LLIC 2YHGA 4JM2F 2HTLC 2ALAA 2ZOWA 4K3DL 2Q87A 3QHZL 1NMBL 1BXXA 1KPVB 2E4TA 2VISB 4NUGH 3B83A 3BE1L 3DUUB 4UQIM 4Z95H 5KWYC 1LK2B 2LAAA 1ZK9A 4HCFA 4NGHL 1DZ0A 3LXAA 2IANE 1F86A 2PYEB 2YKLL 5DHMC 3VVWA 3W9EB 1F8TL 4DESA 1IGML 3L1OH 3QT2A 3RJQB 2ATPA 1FL3A 2QHRH 4PJDB 2C1PB 3KL0A 1O75A 3BWSA 1KJVB 5DMIH 1VKXB 3KPRE 4NRXB 1SDDB 1X5MA 1BMWA 3ARSA 2DIBA 2QPEB 1KB9K 3V0WH 1QR1B 4AUUA 4BH7B 4NKMA 3L6FB 3T08A 5JIIA 3N04A 4MZ3A 1A6AA 2C1OB 1GPOL 2OZ4H 5JW4M 5IFAL 1YMMB 3ABGA 3KXFE 1FC1A 3V4LA 1MCCA 2Z35B 4TVPE 3HS8A 2CCVA 3DYPA 2ERJB 4N20A 1G9NH 4PUBL 4AMKH 2CIIB 1MCBA 4ZAKC 3HVNA 4AW7A 4PMFA 3DVGA 4EAEA 2MQ0A 5IJVA 4Y16C 4LSRL 1Z0NA 3O0LA 2ED8A 4QHNB 2F54D 2RCSH 3UADA 2IOOA 5I17A 2NSMA 1PL3A 4B9KC 4U6XB 1BBJB 4CJ0A 2A83B 3VXMB 3HRPA 3P73B 3P3TA 1PPIA 3LH2L 1NKRA 1S7WB 2G4GA 2WQWA 4ZO9A 2PYFB 1RJYA 3UEQA 2OQJA 4W81A 2C7FA 2VQ4A 1JPSL 5T3ZD 1BA9A 4JM4L 2FWOA 5JIKA 2R23B 1UM4H 4WO4D 5FUZL 4LFHD 1Z9PA 4LHUG 4R4FH 3IFLL 1ZVYA 5TTRA 5FECB 5I73B 3LZQA 1XCQB 3D5OF 1HSBB 5E2JA 4GAGL 1IC5H 1OCCB 2Y69B 1RZJC 1G1OA 1M7DA 2QQLL 3QDME 5JW3H 3OMAB 4NO0B 3PNWB 4QI3A 5CZXC 4OIAA 4PVNA 5DZOA 2JF1A 4M43L 3SDCA 1KB5L 4IRSA 5IQOA 3DURA 4UDUA 2IGFL 5EEWA 4JVPA 2WWOA 5DHYA 2R4SL 2YRBA 1P0SE 1JWUA 1JV5A 4RNRB 5F7MC 3TA3A 2CJUL 2YSSA 5LG1A 3T6QC 3BN9D 3L3KA 5E51A 1E2WA 3MRIB 5D7IF 1NFDB 3ULUH 1MCRA 2XQBH 4M00A 4XMZA 2H3KA 4RFNB 4AV4A 2QPFA 2BDNL 3M1BB 4K23H 2JKJA 4AM0A 4P8QA 4QOKA 4ENEC 1BX2B 3RY6A 3N1MC 1J5DA 5E2TL 3CFCH 3LRKA 4JFQB 4K7PY 5I76A 1T03H 2A99A 2BOBB 2NXZB 2YGOA 4JE4B 4E41A 3NACH 1GS6X 5ILTL 2V5MA 1ASQA 3O11B 5HDBE 3WO4B 1UOLA 3NFNB 5JXAL 2WLYA 4J3OD 5E8DL 2UWEE 5DD6A 3DVGB 5DGRA 1KCRH 2NDGA 3GXDA 4HEMA 4KFMA 5H8DA 4RESB 2A9MH 4LEXH 3LPGA 4YGVA 5BS0D 5DO8A 3QIBC 3W5NA 4H4NA 2FSEB 3VXUB 1NFDF 3TPUB 2VL5A 4JZNA 3KE0A 4N2LA 4OCRL 1AP2B 4U6VL 1FIGL 3ARPA 1BDYA 3ILPA 2WIIB 3SD2A 3S34L 3GMRA 4TL4A 4Y19E 1KXQE 5TFSL 2WXRA 4KK8C 3L1EA 4F27A 3KCWA 3Q2LA 1D5IL 1FYTA 2E8YA 5K39A 4AEFA 3DTXB 1A14L 3MLUL 3ME0B 4WAFA 1QZNA 3TEUA 1SMAA 2Y24A 3EDJA 4G5ZH 1JF1B 1HH6B 3OKLB 4IKJA 4LVOB 4OIBA 5JLZA 3B2XA 2YA1A 1IBBA 2G0KA 2IPKA 1QW9A 4TVUA 3MUUA 4LGSB 3TEWA 3RGVC 1QHQA 5CMAB 3SB3A 1EWHA 2AS5M 1BAFH 1ZV9A 2WLNA 1KIQA 4OCSL 5TPWL 4URKA 1PKOA 2X1OA 1U8PB 3RLSA 2ATKA 5GRVL 2GB2A 3NPZB 3QIUA 4ZPVB 3PNWA 2ATAA 4WI0A 5K1JA 4G8FA 3DYMA 5AW6B 2UUDK 4JJ5A 4QWWC 5IQ9A 3FFDA 2J3SA 4XXWC 4Z78A 2CJSA 1UVQA 2C3VB 5CEXB 1F00I 4WI4A 5L88H 2Q0ZX 3MJ8A 3WG7B 2I60H 3CZGA 5AG8A 1OT1A 1J05B 2VERA 4MTMA 2ADIB 1LO2L 3MV7E 1N0XH 2XFXA 3CZFB 3HBQA 1G4MA 3OL2A 2KMWA 1YYLH 4KMQA 4PRIA 1BBDL 4ILDA 3DXAD 2AQPA 1EERB 3EW3B 2IAND 1UEYA 1CFSA 4MHHI 3PWJA 3S36L 2BOBA 2PO6B 2VDQH 3NZUA 1G6VK 1NAMA 4OAWA 5T3XH 1EFXD 2NQ3A 2VDPB 4OLWL 3UERA 2TRYA 3HZ3A 4XI5D 3BEWB 1U2HA 1TQWA 2C4XA 4XAKE 4F2MA 4GLRI 4O9HL 3M8OL 4KXZI 3EUUA 4LEXL 4UIKH 4UV4H 3K1KC 5D1QD 4IIQC 3CD4A 3EH1A 3EYVB 3KPSA 5H37A 2XZCL 1X5HA 1BVNT 4E9TA 2R29H 3SKMA 3L9BA 3NCFB 4Y19D 5EBLB 2JV6A 1MFCH 3E6HA 3V6FB 2NYKA 4I4WB 4CILA 3MOBL 1HNGA 2LHAA 2GTWB 4GSDL 3BCFA 5D2LA 3JV6A 3V0VB 5HHXH 2M2DA 1NCNA 5C71A 4OFKA 1KG0A 1K6QL 1G7QA 4MJHA 5C0FB 3SDXB 3DIDA 1NSNL 4FI8A 4KY1H 4AL8H 2X53A 1IILE 3L8QA 4YFEA 3IE4A 2WANA 3MREB 2ESVA 2VSKB 1A7QH 2ZX7A 3MUHL 4QXGL 2N56A 3FCUB 3D87B 2P5WE 4WTZA 3KBPA 4M6NH 1CYWA 2ZXQA 4RCAA 5AW4B 2N7AA 2CKBA 3RX9A 1AY1L 2BNQB 3O6KH 1O7SA 2WXIA 3NN8A 2E7LA 1MDAA 2OA9A 3V5DB 1YUHA 1QLEL 2NR6A 4RMTA 5D4HA 4Y5VC 2EVFA 4DT2A 1AE6L 1JZDC 5C0AD 3NCXA 3GIVA 4YHPA 3MV11 5HPOA 4W9JC 3OC5A 3UBXG 1NGQL 3MJ9A 3DOSB 4FQHB 2NNXA 4A7QA 2V3FA 4LLUA 5C8JB 3R0MA 5GJTH 5TE6L 5IVXE 3W56A 2LU3A 1JGDB 3L2NA 4OGQC 1IGIL 3X1EA 1Z6JT 2EYRA 3LEYL 5FUZH 5IB3A 4BFFA 4AM0B 3GPEA 1N6VA 1QAWA 4WVRA 1TETL 3AAZA 2FT6A 3UOAB 5IR1B 4DCQB 3B9KC 3LJ3A 2A74B 5DQJA 3W2DH 3ARED 4UMSA 1P4UA 3QI9A 2EKJA 1RUML 4KXCA 4I9XA 1IAKA 3K6FA 3QQXA 3T4AB 1RFDL 4JNXA 3LHPH 4TSBL 4FG0A 2BP5M 3FQRB 2OFQA 4NNXB 3SE8L 2UY6B 1V55B 3GLAA 4I3GA 3UAFA 1N3NA 4LKXB 4Z0XB 2CA4A 1EEZB 5E70A 2UZIH 1L7IH 3L4TA 3FTZA 1E27A 1MVUB 4CSSA 2ZP0T 5C6TH 5IKCB 3APCA 2JQMA 1KEML 2XLLA 3O6FB 4DPCX 2BNUB 4RFEA 3ULUC 4UQ3A 4ODTH 4LGRB 1OAQL 3AREC 4I89A 3TIDB 1CDYA 3UMTA 2WQXA 4GO9A 4XCEB 2MPAL 3F62A 5FDYA 5E5LA 1G5GA 2YZ8A 1SNRA 2BSRA 3ABLB 4YUEH 1HOCA 4P4RA 2L3BA 4XBPB 2ICWI 4R4ND 5CMAA 3VI4B 3CZKA 1PX3A 4ZJ9A 4NFBA 3BD5A 2UYLB 4JFPA 1A3LL 1Y6NR 3CFBB 4IK7A 5EU7E 2XDHA 3T0XA 1E6JL 2WMPB 1I1RA 2F53D 2OBGA 4PWEA 1CURA 2GBUA 1U8IB 3KGSA 4XMVA 1AD9A 3NAAL 5C0IB 3P4NB 3O4LB 4DK6A 2VO5A 2XZQL 4ZSOA 3ZKMC 5KAQF 2HLFC 2AABH 3NP4A 5C07E 4HJGA 2A6JA 3ASNB 3STLB 2XSKA 1J12A 3GRWA 5JOFB 3JWNE 3Q8EA 5ACLA 3MRLA 5IBLD 1YDPB 3OBAA 4I18B 2DM4A 2P5EA 5FKPA 4PRPE 4JB9H 4AV0A 3T2OA 1HXMB 2B1HL 4NZRL 5BQ7B 4PJ5D 5CAYB 2YN5A 1ZLEA 3JTTB 1QUNA 2UX6A 4OLZL 3EH2A 1QFUH 4FI6A 1E28A 1V10A 3K2MC 3OKKA 4JM0A 5DVPA 1HXYB 1BYOA 1E5ZA 1IAKB 3V7AE 1UB6A 4G80B 4WCYL 2Y72A 2UV3A 1Y1DA 3KL3A 5B8CC 5LWYL 3HZMA 5FM4A 4DUWA 5H35B 5KSVA 1CFVL 1MHPH 3W1ZA 1UUNA 5F7FA 5CEZD 3T8XB 5A3ID 2IQAA 1WLHA 2J6EH 1W9XA 1AIFB 3I3DA 4WCYH 1EXUA 5EOQL 3OKOA 4TSAL 5KSBE 1M71A 3LZFH 2ZXBA 1QBML 1RD6A 2NLJB 3QP3A 4WI2A 3O6FA 4HIHB 4L5FE 4QHPA 2VDQB 2FJSA 2YSTA 1KJ2H 3AS3A 3NDZE 3AVEA 4PWFA 5DZJA 7CGTA 1QX1A 1MJJA 1RP9A 2AXFA 1TCRB 1CK0H 1BX2A 5D7JC 1EO8H 1OP3H 5FO7A 4D9LL 2A38A 1C08B 1GW0A 1QO3A 2O6EA 4O4YH 3MRMB 2BJMH 3LNFA 3L7FA 3GBNH 2J44A 2EXWD 1PAMA 3GEWB 4KMTL 1EEYA 2X6UA 1RUKH 5BZWB 5AAMC 5JOPE 1DQJA 2PTTA 4QRSB 1OF0A 4WTXA 2BIIA 4GMSL 5B3JE 3HNVH 5HHPA 2C9XA 3M7FB 1D5ZA 4QRRA 3OLEA 4DKAA 4D0DA 1GC1H 2VSCA 5M7QA 4PGCA 1JHTB 4ACPA 4PRHB 2AJSL 3N2JA 3QIWD 5MHSD 4AQ8A 4F7TB 2JWYA 1WSST 3UAAA 2P8MA 1KPRA 3T8MA 2H1PL 4LCWE 5I8OH 5CN3A 1KFAL 5LGHL 4AZUA 1ZSHA 1I4FA 3ES6B 4YC2B 1KT2A 4GKSA 3VNYA 4L9LC 1X9RA 1W0VA 4P07A 4PG2C 1NZRA 1QYGH 4B27A 4JVWA 1NLBH 2B8OT 4HHWA 4DP1X 5IR1A 3IS0X 5I1JH 1DVFC 5C1MB 2G30A 3F12A 2OS7A 1M53A 1SFDA 1HE7A 2LE9A 2F74B 3Q6GH 4U3CA 2GAZB 4WNSA 1T83A 4OV5B 1D9KC 3HUJF 3FFOA 2BDNH 1RV6X 3EHBD 3KNBA 2QKSA 4K7PL 1D5BB 3WNLA 3IDJB 4JPKL 3P77B 5F7NC 4PGZA 1AS8A 4TNWK 2UZIL 4WDIB 3BSGA 2LVEA 1EEZA 1P4BH 1HC1A 4ZS6C 1P7QD 1N12A 3G5ZA 4N0UE 2XTLA 4LCYA 4MNGE 3GS4A 1NAKL 4UM8B 1HCVA 2EADA 3I9PA 4MAYA 3W3BA 3B9KD 4ANUA 2HFGL 3P54A 2QVTA 1IAIH 3KCPB 1LO5A 2VDKB 5AVSB 4YDMA 1TJIL 5FYKU 4B50A 5DS2A 2LLGA 1KTDB 4IJ3C 4YSEA 4B97A 3PWUB 3FQWB 3QO0B 5F8QC 5C0AB 3JWDH 2COVD 2X4TB 1O6TA 3F8UB 4OI9A 3MODH 1IBFA 3L7FB 5TF0A 1MHEA 1LO3L 3BX7C 3QJUB 4PB9H 1HHKB 2JQZA 5CJQH 4MD4B 5F7EL 1MFDL 3OWEA 3QRFM 4PJGE 1XL6A 2ZAGA 1I3RA 4GQRA 4X6FB 4BE6A 2OZ4A 1NGQH 2K4AA 1JPTH 4RWYH 5DZPA 4JPWL 4NRZA 3N1PC 5C08B 3P1VA 5DSCA 3P4OA 2OMXB 1O9ZA 4L8BB 5HYSG 1AY1H 1E4XI 4WK0B 4DP5X 2AJVH 3J7HA 1YEFL 3U0PB 2W94A 2ZG2A 4D3CH 4P2YA 4NBZB 4HUWB 5TQ2H 2XN9B 3Q1SL 2MPVA 3KXFA 5I75C 1UZ6F 4JFEB 5LAXA 3HBPA 4QIRA 3WJLC 2B4CC 2IFGA 3IN2A 4BINA 3OF6A 3I6LD 3RBSA 3K3QA 1F18A 1R3LB 2ZWYA 1ZLUK 5TDOA 3QDGE 1JK9A 3V9FA 4N85A 4G80A 3VXPA 1T22A 2UUDH 4YAQB 2NY7H 3LN5B 1D7DA 3ZE1F 1IKOP 2H6OA 2MTPA 4XCCL 4YZFE 3VFGH 4AEIH 3O4LE 3BZDA 2VISA 3MFFB 5EUOF 4G9FE 3AG4B 5T1KB 4JHVA 3MKGA 4M6AA 2Y5QA 4TM9A 2ADJA 5F0MB 5FGBA 2LAGB 2H0JA 3OQ3B 1AGBA 1JNLL 2JTDA 1SHMA 2FYYA 1INEH 2H0EA 1BFOB 3BPNC 4X9HA 4OCXH 1NTDA 3RU8H 3VAEA 4FKHA 3BZEB 1MLBA 1G7HB 3MGAA 4ZAKD 2TSAA 5GIRA 4LZKA 5ANHA 1FCCA 5FYJL 2XN0A 2Z8RA 2NDFA 1P5UC 4NKOA 4EDXA 3TEZA 2IWFA 4R5VA 3UTZB 4ECNA 2VLKB 2D9QB 3DRTA 4PWJA 3L95A 3B2UD 2ZUYA 3V79C 1YNTA 4EZMA 5I1EL 5FW8A 5KVDL 5AW0B 3WD5L 4PJHF 4KHTL 2UZYB 2XTJC 4OKDA 3DBXA 3MA7A 4ONHB 4TULH 5IB1B 2QTVA 4MZ2A 1C16B 1T89C 4GKLA 1LQBC 4C83B 5DI8B 5KVFE 2O5ZL 1N0LB 4PPTA 5ICYA 3SKJL 4O02H 4LCCC 1OLZA 4MYWB 4P3DB 3SPVB 4LOFA 1E27B 2Z8WC 2K6WA 5J6SA 3CDCA 3SDCB 3LRMA 2J12B 3T0BA 1AZNA 3NMEA 4W9GC 5E00B 3N06B 4L8BA 2BVTA 35C8H 3TC9A 2NUPB 1Z5LB 3V6OE 2DQDL 3BP6B 2ATPB 1ZHBA 1Z3GL 1DBKH 5K9JH 1TQSA 3E0GA 4KX8A 3ZBMA 4BFGA 4X4YA 5E0FA 4XNZC 4LU5H 1TZOA 3PHQB 3S96B 5EO0A 5C3TA 5C92A 4N90E 4Y9GA 4YK4C 4CSPA 2ICWA 3JWOL 1V7ML 3R7QA 4AW4A 4MCNA 3WIFB 3CSBA 4YHKH 1J1PH 3U4AA 3MCG1 1IARB 4Z76A 1DFXA 1CT8A 2JJTC 3EJZC 3OJDB 4ZTEA 3EOTH 4RMRA 2O5XL 3KPPB 4XNUH 4ZW3A 3HC4L 1IZKA 1F13A 3Q1EA 3SDDA 1J8RA 4YFDB 4CRPA 1WGVA 1LEKB 2CHWA 5J89A 2E7HA 2K0RA 2R1WA 4YK4B 5IJKA 4Y1AE 1VCBC 4M7JL 3ETBJ 2VLMD 2O30A 2WM0A 5D7KE 4PV1C 2WXGA 3HLAB 1NQBA 3QDAA 1CLOH 3F7QA 3W37A 3MNWA 2NY6D 3U7AA 1NGXA 2QT6A 3GSVA 4X4MA 5A2AA 1HILA 3QIWB 4EIBA 1DP0A 3WUZA 2GJ6B 5C0NC 1UD4A 3T6WA 3ZE2F 5C0RL 4LBAA 3QQNA 3BPCA 4P46A 2YD0A 3IU3B 1P7HL 5CGYD 3ULUL 1BAGA 3UTTA 4NZUH 1OO2A 5FECA 3A24A 1CMOA 3K1DA 3QRGH 4X6FA 4ZT1A 1KZQA 3LZPA 4FFZA 4OCNC 4C4BA 4NBXB 2DL9A 3W57A 4UDTB 2VYRE 1A66A 3AQXA 3ZUCA 3PFQA 1KB5H 5HJBA 1JYWA 3D12B 3QG6B 1TJGH 5HGBB 1RAMA 4X7TB 1UKTA 3OZ9H 5D7EA 3ZMNA 1HU8A 4HVBA 2WXFA 4HWZA 3HE7B 2WQRA 4M61B 3DRQA 4FYTA 1WVZA 3A5VA 2IDUA 1AZZC 3ZT7A 3VA2C 2HPTA 3VWKD 1WBXB 5BXFB 1Q1PA 2VXVH 1GGUA 2YOAA 3WNJA 1FFOB 3PXHA 4MMXA 1YQVH 5DJAB 3IVKB 3CQPA 1LQSR 3VD7A 3WUWG 1CXLA 1GC1C 3FB5B 3W9DA 3W11C 4WUUE 3NFNA 3MMEB 4M93B 3WEOA 2XWEA 4POZC 5JIPA 1Q4NX 1T21A 3UJJL 1NAKH 3WFEH 3IDUA 1HYSD 1A4BA 1NDTA 2E9WA 2I69A 4GS7B 4QHUA 4M29A 4NLHA 3E3QE 5IQ9B 4ZFOB 3NH7H 4DW2L 5BZDA 2EDOA 1W0WB 5B7EA 1QTSA 1NEZB 2N4IA 3IPEA 4U1KA 4CL7A 4LARL 1SJMA 3KW8A 1XB6A 4PUBH 1OAUH 1IQDB 1XTLA 2P1YA 3JSSA 4XHQA 3V4VH 1FBIH 3WYRA 5DVNA 2VB5A 3MUGB 5D8JH 2IDTA 3BD3A 2JNZA 4Y2NA 3MAWA 2MIZA 4KOBA 4NQVB 5HGDA 3IXAB 4QWWD 1O7VA 3DDFA 2KL6A 1HYRC 5LQBL 2IH1B 5IQMA 1WBYA 2AJ3B 3HOGA 3ZDYF 1K3ZA 2O6FA 3MCKA 4HAKA 2R2HA 1MXDA 5KVFL 1XEDA 3Q2CA 3QXAA 4BA8A 4YSTA 4OZHB 3LVEA 3KWUA 3SDXA 3VXSE 4DZBA 1E7VA 5C0CE 5GGSA 5IHZB 3C75A 5CZXD 2R39A 5F7KC 5FFGA 4OKVA 1HL8A 1SDAB 3GIZL 5EOTB 5ICYB 1BWMA 5AW1B 3UROR 1PD0A 1ACXA 2WVUA 3KYKL 2JJWA 3DTUB 3S5LG 1AOZA 4WI6A 4Y4FC 4MXQD 4XNUL 3UTPE 1J8HD 4U1NA 4Z7QB 2NUPA 2P8MB 4F2EA 4HP5A 4M48H 4L1DA 5CF3A 4AIZB 2IEPA 4IS6B 1ZY9A 2P52A 3VA6A 5C08D 1GIGL 3L3DA 4PY8J 1MAMH 2E8ZA 2ZWLT 1THCA 1J48A 1Q0YH 3JWOH 4QUOA 1SEQL 2IV9A 5CFHA 3DO3A 3ARUA 3GBMH 1KJ2A 2HKHL 1ROCA 4FKEA 3CBJB 5E7FA 5IM7B 3RVUC 3MLZL 2GIMA 3LQMA 4DEPB 4ZUWB 4YEFA 5HD8D 4U3HA 3H9SE 1LJMA 4TKWA 3F7VA 2ZUQB 3BGFC 1L3NA 1JDAA 2OYKA 4F1SA 4P2QA 2QHLA 1O9WA 1FA4A 4S0HA 4NC1E 1AOHA 1N2RA 4X5XA 2HKFH 4N9GB 5DC0A 3V5DA 4MS8C 1OXYA 3LPOA 1KGIA 4PRAB 1VZGA 3BVVA 5DQ9A 3VJ6A 3RWJB 5GSRB 4MQSB 1JOIA 5LBSA 5DYOB 1ZLWH 2E6JA 3QUXA 3VFUB 3RTQC 3FRPG 4W93A 1DEDA 1GYVA 3BP7B 4HAFA 4RGND 4XMPL 4ODUA 1L9NA 2UXFA 1M9WA 1IL1A 1CPUA 2WXJA 3EDDA 3QUXC 1MCSA 3ULUE 5HGGS 5CO1A 2EDXA 3PP3K 3FFCD 2APXA 4U4BA 4B9FA 5FF6A 1H15B 1N68A 4J3UA 1LNUB 3OAUH 5KYYB 1R5IB 4F7PB 1IGYA 4QF1B 4E9SA 3UC0L 5F6IB 3GO1L 5KS9B 4FTVE 1XF2A 3TF4A 1P2CA 1FH2A 2EUZA 5A1AA 1KXQA 3RU8L 2R0LH 1IBZA 4GAYB 4QHKJ 4O5LH 4YL4A 4LEEA 1A0QH 2CUMA 3IPFA 1OVZA 3MTXA 3RHWF 3N40F 2CDGB 3MFFA 1FFQA 2QQNL 1EUTA 5F9OL 1F0LA 2K9FB 1DVTA 2AJSH 3LB6C 4XPHH 1NKOA 4GQQA 5HDOA 3ZIMA 2K1MA 4N25A 4NM8H 1AO7D 1XZ0B 2RMNA 5EIIB 1MH5A 2C26A 2X6BA 5HHMD 4FTDA 3RI5K 2X2YA 3KGTA 3HRZB 1WPCA 1S46A 2KDYA 2IALB 2DQMA 3DURB 3FH8A 2R29A 4Y9EA 2ZKYA 1KBVA 3BVXA 2WB1A 3QPQC 5AYTA 3ZVVA 5KVGE 4Z18A 2PTUA 4DHLA 2NY5H 1JMZA 3VFVA 4EI6B 2EEXA 1WE5A 4AJVA 4WSGA 2J88L 2D7NA 5IB3B 3QUZA 2XXGA 4PV9B 3M17A 1J5HA 4XO3A 3QFGA 3TIEA 3PQYA 3FO9A 1ICTA 2YPVL 1INQA 2X4PA 3G9VA 5EU5A 1OSZB 1WFTA 4D3CL 5DQJB 4R2GB 1XR8B 4QLRA 4E5XB 3BT2L 1QPKA 3W9DB 1EH9A 4P2QB 2BSED 4YHYB 2Y6TE 2IANB 4XO4A 2JK5B 1NIBA 3W11D 1OTSC 1E90A 3MROA 4NQEE 2QDVA 3QULB 2DKUA 4JPWH 3F00A 2QGBA 4LPUA 1XB3A 3B6SB 4JG9A 2X28A 5C86A 4M6OL 1UFGA 3QJVB 4N9OB 3RTLA 4LVEA 3MXVL 3DHPA 4TNGA 3VWKC 4L9LB 3IMWA 2DWYA 2UXGA 4M7ZB 4ZUTA 4HH8A 4MRCA 5FYKE 4JQXC 1YNKH 2W65B 3VGHA 4U1GC 4JRXE 3H4FA 1DDTA 1HEHC 5D71L 3DOIA 4H5SA 1RK1B 3GMRB 5E4IA 4W4OA 3VACA 5I2IB 4TLUA 2WBXA 4P9HC 1CFQA 4R9HA 4HKJA 1U8QA 4P4RB 5CHNA 5FB8A 2H6PA 3QUMH 1JDDA 2OJEA 1DJIA 1XH1A 1TTUA 4U05A 4HIIA 4PVLA 2HRGA 4PTTA 5I6PA 1A4JA 2BHFA 4C55A 1GIGH 1S78C 4KO6A 1CGYA 2DEYX 2YD9A 1U8CB 4HV8B 1AKPA 5TDNB 3L9YA 3LIZH 1AKJA 3PWNA 1WT5C 4C56E 4AMXA 3CX5J 5L9DL 1RJLA 3UH8A 1DJXA 1LD9A 4KVNH 3AREB 2NY1D 2XPGB 1QSEB 3HLAA 3GSUA 3ALXA 1UH4A 4Z7QE 3VFTA 5B8CA 5EB9A 4BFKA 4AJYV 4UINH 3PRZA 4RFOH 3O3EA 2XWBB 3TNNA 4N2FA 2VXQL 3TL5A 3NIFE 3QA3B 1BXAA 2X40A 4R3SA 2CLVA 2Q2LA 4FP8L 3MNZA 4I3SH 4QRSA 4ZRGA 1NFAA 4K3GA 1FZJA 3PWJB 3FO2A 4ZS7L 2K7PA 5DHVB 4OTXH 3SIKA 2V2TA 1L0QA 1Y1UA 3VD4A 4I0PC 3VDBA 3BIAX 4AT6B 4L29A 1RHFA 3D25B 2P24A 4LCCA 2YUXA 3GYRA 5MEPB 4IMKC 4DP6X 4EUPB 4AJWA 2ZAHA 3Q7JA 2W59A 3D9AH 4RA0C 4CC4C 1D5RA 2B5IB 4MMZA 3UO1H 1OE1A 3VRIB 4TSCH 5JYMA 4EIUA 1A2YB 4NCC2 5L8JB 3ARDC 3VDCA 3MJ9H 1TZHA 4S1RL 1JYVA 3HE7A 4J3SA 3SEPA 2F2HA 4IOSA 3HC4H 3ULVE 2OJ1A 4YDZA 1KJMA 1C5DA 4LNRB 2ZSVA 2CLRB 2W9EL 3BC9A 5EF1A 1YSOA 1L9MA 3CFEA 1CG9A 3TO4B 1LNUA 4XPAH 4GI8A 3MNVA 1Q9LA 4QRQB 4R96B 3T65B 5ACZB 3S7GA 1S7RB 4D9LH 3RFZA 5CWSA 4J2QA 2YARA 1BP3B 1Y0LA 3WN5A 1DQDH 3WEBA 3HZKA 1K85A 1SBSL 1EEYB 1E42A 1X7SA 4GO8A 1E4WH 5K69A 5I1IL 2KPNA 1D6VL 2GY5A 4XAWH 2FEEI 3TNMB 3LD8C 4CVZB 1ZIAA 2FWUA 1F02I 3TV8A 2YAQA 1FE8L 3KWTA 5TQ0H 4FCHA 4ICXA 4HKZA 3NN8B 1CFVH 2DRUA 5IIEB 1MREL 4H8WH 1IAIM 2FK9A 3ZL4H 1OPGL 5F1OB 2FIKB 1RQ5A 3AG2B 2EYSA 3MRBA 4JREB 5L2KD 4JY4B 3MNMA 4PWGA 1G1YA 5GISL 4HLJA 2Z93B 2IJ0C 1OOWA 2G60L 1I8KB 4ZNEE 5I1LB 2DMHA 2DYPD 1I82A 1E8XA 1F5WA 4N8VB 1NC2A 5E94A 1F90H 2RR3A 3FQNA 3AGWA 3GMQA 4QRPB 1BVOA 2CBOA 4YSOA 5G4MA 1ZVNA 3W39B 3QA3A 5DFAA 4PRBB 3FONB 3QUMB 3D0LA 3SDAD 1FVCB 4JANA 4LASH 2QKIC 1WZKA 5IY5B 3WTUA 5ABAA 3QEUA 4LNVA 2J1XA 4HPYL 4OLYL 3OKYA 2YAEA 4GSQA 1DHKA 2YD6A 4NWUH 1QD0A 4Q4IA 4S1QL 3NFPA 1WZ1H 5L0QB 5JO5B 1KLFB 3L5WA 3C9NB 3TZVC 3D4CA 2E7CA 2EIZB 4UIKL 3BUQA 4BGDA 3DX1A 3MLXL 3FCTA 4ZQTA 1JWUB 2ZCLL 3QR2A 3FPXA 5FA3A 4S1QH 5K9QI 3QJSB 2W80C 3C6LC 3KCPA 1E4HA 5ADOH 5D2LF 3IDIA 3VTMA 3L5IA 3ARFB 2WN3A 3NG5A 2X4QA 5DJDB 4QJ4B 2CLRA 1BQHG 2B3IA 3EIFA 1PEZA 4L4TE 2XVKA 1A6VH 4XGZA 3UAJD 2WXOA 1KY6A 2BCKB 4K23L 4Y1TA 3IXTB 2N59A 4WHDA 4LQ1A 4LVNC 1BVZA 4XBPA 3ARBB 3DECA 3J27A 1KBKA 3KPLA 5FS5A 4DVBB 3CMGA 1N8OE 2XX0A 1SJEA 1FRGH 4WV1A 4ZFOL 3APMA 1EZLA 4F8PA 3SDYH 4YQXH 2KH2B 2DTSA 1D5MA 3J07A 5CGMA 4P2QD 3O8XC 5D7KD 1GL4B 1FYTD 2E9JA 4FXKA 2EXYC 3D30A 3U0PA 4KNUA 5CCKH 1MCOL 1MRDH 2OMZA 2A1WH 2LU7A 4YPGA 3RWIA 1T1YA 3QUYB 3P3YA 3V0FA 5DRWB 1Q1JL 5IFJA 2HZHA 5K39B 2OSLA 1X5IA 2Y1YA 1DQIA 2Z4QB 3QUXD 1UA3A 5KS9A 1XCTB 2DWTA 2GHWB 5DJ0A 3QZPA 1BLIA 4QXTB 1KJ3L 5T5NF 2X4UB 2AK1H 4IM8A 4EN3A 4C47A 5FKAA 3VH8A 5TDOB 3WHE0 5JQ6H 2OTWB 4HUKB 2X9XA 2G9HB 4NKDA 4S1SH 3KBHE 3RWFA 3F58L 1E7UA 4QTIH 3IJHA 5JDJA 4MXWH 4DN4H 4G6MH 4RA3A 3O8XB 4KH9A 4X7SL 5DD6B 4B3EA 3L7EB 5K59F 1DQMH 1HQRA 1TLKA 4N90D 2ZX9A 3IJ7A 5KSBB 4AITA 2VH5H 4GY4A 1SXSA 1T0PB 1FO0H 2C3VA 2VKXA 5CEXA 2Q7NA 1RPUA 4YDNA 4JM2D 1GTNA 2W88A 3ARBC 5ISZE 1WD8A 1T6VN 3VSTA 2CM5A 1XMEB 4GT7A 5IFAH 3ATFA 3VFOA 1KIUB 1VGEL 1MJJB 1E43A 4WFFE 5KSAB 3Q6GL 2JCCA 1BJ1J 1U8NB 1UQSA 4XVSL 3I6KA 2JI1A 1AQDA 5E1AB 2R27A 1CQKA 1HL4A 2IPKB 4HD9A 2NTFA 2VM3A </