2EVHA

Structure of a ndt80-dna complex (mse mutant ma7g)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
303
structure length
290
Chain Sequence
b'VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*GP*CP*GP*AP*CP*AP*CP*AP*GP*AP*AP*AP*C)-3'
publication title Principles of Protein-DNA Recognition Revealed in the Structural Analysis of Ndt80-MSE DNA Complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle/dna
total genus 83
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 2evhA00
2EVIA 1MNNA 1M7UA 1M6UA 2EVHA 2ETWA 2EVJA 2EVGA 2EUXA 2EVFA 1MN4A 2EUZA 2EUVA 2EUWA
chains in the Genus database with same CATH superfamily
2ZOKA 4R7LA 2YGOA 1R0AL 5L8KB 1ZIAA 3APCA 2ZQKA 3KLDA 3N91A 4MJ4A 2XXFA 1G87A 4UQEA 3KWUA 3IDMB 4DW2H 4YDLC 3KJ4B 3TZVA 1NC4B 3K0WA 1TU2A 4J4PD 1NDMA 2J20A 2NLJB 1NGZB 3DXAE 4Q52A 2EEXA 3VXSA 2NX5E 3GZKA 4HKBB 3IMSA 1KGXA 3NJGA 5MEPA 2VW6A 1IVTA 1N5YH 4KVPA 1HWWA 4NS0A 4X5XA 3SQOH 4UTBA 1DBAH 2KDYA 2PTTA 4L2LA 4RVBA 3II1A 4UINL 4BXVA 1MNUH 4S1QL 3H2PA 3Q0HA 5HHQA 4JZNB 2HFTA 3IVKB 5D2LE 1N2RB 3NZSA 2VXSH 2OJ1A 3T6XA 3NPSB 5KJRH 4H1LA 3B2UD 1WBYA 1P5UA 2ADGB 4U0QB 4NZRH 3P0VH 1UA6L 5CCKL 4XH2A 3KD4A 3PJSA 1OP9A 1G7MB 4Z7OF 4WEEA 3L7FB 4UTBL 2Y7QA 3QISA 1HCZA 2PP7A 5CJQH 3DV4B 4YUEH 4JLRA 2ENJA 2A9AA 3LMJH 4YSDA 3HC3H 5EZJB 1ET5A 1I8MB 4MA8L 4I2XE 1SYVA 1N59A 3MJ7B 5BJTB 4OZFA 3MACL 3WDHA 1SVZA 1CGXA 3CPLA 2CK2A 3BN3B 3MYJB 4U1HA 5EMYA 1ODAA 1FNFA 1W6WA 5DO2D 4B0MM 1MQKL 2FBRA 4RCAA 4OM1L 3IBOA 2YAQA 3L08A 1QFWM 3B2MA 3FFCE 3FSOA 5C0AB 4EZLA 5IF0B 1AHKA 3CC1A 5HDBB 1MCFA 2NR6D 4RETB 1JG9A 2Y24A 3EJRA 3RQ3A 4DVBA 1A14H 1Y1DA 3QCTH 5HI3D 3TPUA 1JVLA 1A5FL 2D2OA 2ZKMX 2IDSA 4HJ1A 1TR7A 2I9TB 2B4CL 2VLRA 1NCWH 1AD0A 2OMYB 4XNZC 5MENA 1UKSA 2OXHA 4R0LC 3GGWA 3WAKA 3DPDA 4NZUH 1MFUA 3F04A 4XMKH 4AQ1C 3CSGA 3ULAB 4PJIA 2F8VA 4JQIA 5F44A 5TQ0L 3VFVA 4D8PB 4NEHB 4OGYH 2R7EB 3QIUD 3PUUA 3HB3B 4WZ9A 3X12A 5BXFA 3FQXA 1NCAL 1A6UL 3RFZB 2DAVA 3HNSH 4BH8A 9PCYA 2ITFA 3OR7B 3TNMA 4F5CA 1LK3H 3M7FB 2CLZB 3G6JF 4NZFA 1TJHH 3RVXC 1JXJA 2LT9A 1NPNA 2OL3B 1J18A 4J2QA 1LO2L 3T1FA 2H8PB 3BH4A 2DQUH 5LDSA 3ARDC 3D69B 1FVEB 1G7QA 2B59A 1YZZA 1BP3B 3BFQG 2VC2L 4JQIL 1U8HA 4UBDD 3FULA 4NRYB 3LRLA 3CGTA 1S7XB 5KYYA 1P1ZA 2PN5A 2PYFB 1F3DH 3RJQB 4BA0A 1KG0A 2EDMA 1PJ9A 2C34A 5DK0B 1RY7B 4ATWA 1RZKC 5J3HD 1E4HA 1S9VB 3BE1H 1W0VB 5E9DD 4Z23A 4AE1A 4LHQB 3ULVE 3TT3L 3VXNA 2X89A 1EX0A 5AB0A 4GAGL 4RZCA 1SEBB 3S36L 1FG2B 4AG4H 3CZFB 2APSA 4QRPA 4DJMA 1RJLA 3VD1A 4Z7VF 4GPVA 2FQEA 5I15H 2J6EA 4IK6A 2PXYD 2DQGL 5IJCC 3ZE1E 4PP1D 2VAAB 2WWMD 3SDXE 3RRQA 2AQ1A 1QUNA 2J43A 4I3GA 5CP7B 4DGYL 2WQUA 3O2VL 4EUPH 3D18A 3OKLB 5CBAA 3FAXA 4MJHA 2N01B 3GXDA 4AIZB 3V9EA 3ZE0F 1JPGA 2F5BL 1O9WA 4X8XA 2VN6A 4JZJB 3CHRA 3LRSA 4NBYB 3U0TA 1OB0A 3MV8A 1MW2A 3VRIA 4ZXBD 1U8NA 5D2NE 5KVGL 3TPKA 4RMBA 1JERA 2H0EA 1GY1A 1UH4A 2MNWA 4GBXD 3MLSL 1EHKB 4K9EL 1DBBL 2NUPA 3APMA 3STLB 3ME0B 1R3LB 3QPQD 1VDGA 1Y18A 4JFUA 3JTBA 4QT5A 1XGTA 3SGDI 1H3TA 3VFSA 2UZIL 3E6FB 1BFOA 3BSZA 1HXMA 2W65B 3C2AL 4LPCA 5HGAB 4ZFQA 5CGMA 5K33A 4R7XA 2R0LH 3D5OF 4KROD 4RIRB 1QA9B 3H9SD 2IO5A 2J8OA 1D5BB 2WLIA 3DV6A 3FUFA 4LCUB 5MHSD 2P8LA 1DQLL 4Y2DD 2BZDA 4LOFA 2X4NB 3MRDB 4ISVA 1MCWW 1WT5A 4H88H 4F7MA 4YSSA 4OB5H 1G1CA 4NM8H 2PWFA 1XTMA 4OAWB 5JIQA 4G1EB 5FGRA 3AG1B 3BSZL 2Z91A 5TK2A 4M6OL 5I5MA 1NFDA 3TS8A 1JCVA 3BCFA 1S78C 1KF9B 2IAMC 2QR0B 4NO2A 5E23A 5FA4B 1ETZA 1ET8A 5BW7C 3VQ1C 2WWOA 3KYMA 5EOCL 3WE6A 4Y8AA 1HJBC 2HRPH 4K8RC 4ZW8A 5CCGE 2FLMA 4XNQA 5A2IH 3V52L 2Z4QA 1OB1A 4M7KH 4UIKH 4AENA 4JCMA 4QLWA 3K80A 2IEPA 3VXRB 1ITBB 4HKXB 4YK4C 4JFOA 4LASL 1VFUA 3L95B 5DUJA 1RULH 3FH5A 5AZEL 4QHPA 1OOAA 3QQDA 4XRCB 3BT2H 5J1TC 1KIUB 3WYRA 1RUML 3N44B 2C3VB 3I74A 5FYKD 1KB9K 3VQ2C 1BVOA 2ARWA 3DX7B 3P9LA 3BZ5A 3D51A 4MMYB 3FKUS 2OMTB 5GGUB 3UOAB 5B3SB 1YNLL 3QQXA 2F9BT 2GKIA 3QEUB 5FUOH 4FTVA 1TZAA 1GZQA 2H47C 4CMMB 1LO0L 2EH8H 4HU2A 3MO1B 3AY4A 1I7UB 5E2WH 3OKOA 1CXHA 2AQQA 3VGGA 4TOYL 1CLCA 4L37A 1MCCA 4Q89A 3JT0A 2FH6A 4OCYH 1HZLA 3MBWB 4H2AA 3UTTB 3DBXB 1GS8A 1NFAA 2IFGA 5I6MA 1X5YA 2FIRT 5E5UB 5IVXA 1OK0A 1U3HA 5DWUL 4NKDA 1AQHA 3BH8B 3QR0A 1UWFA 2YSSA 3T0EC 1UZ6E 2BVUA 5EIIA 3CN2A 3QG6B 2ATPA 4HOXA 5KYWB 4BFEA 3ZKND 2WXKA 2Z9TA 3AWEA 1CLVA 4OLXH 1H3VA 1HOCA 4PJBB 1KYOK 3BN9C 4M5YH 4YNYB 1LEKA 3UGUA 4AKPA 5AZ2H 3OF6D 1OTUC 3L3KA 1DQQB 3HN5A 4OLUL 1JZ5A 4TVPL 3UPRA 2P80D 2DIEA 4RMVA 5IVOA 1LMIA 1K4DA 1I1AD 3IKCA 4G5ZH 3ZDXB 2Q7YA 4APQD 1VB9A 2EC9T 1YY9D 1IV8A 2W0KA 1Q9LB 1BJ1J 4M62H 3RWJA 3MREA 1AR1D 3R19A 4BQBA 2J57A 3KPNA 1HKFA 3GBLA 4YFEA 4QXTA 1DQDL 2TRHA 2OTPA 2W9EH 4FX5A 5E8EA 3CFBB 4XCEB 5TH2A 3U6RA 4OM0L 1NJ9A 2A0LC 2L4OA 2XI9A 3V6ZA 1AO7D 5IFJA 2JH2A 4W9EC 1SOSA 1YEFL 1IFHH 4JHBA 5JPMC 1IBFA 2HKFH 4Y9GA 5GXBB 1MAKA 1XB8A 3GB7A 3OZ9L 5IB4A 4XO9A 3CN4A 3OMZA 4N20A 4WNJA 1NGXA 1I7RB 5KUKA 2CBMA 3GXIA 4UQBA 43CAB 3UP1A 3OKMA 3U1PA 1OQOA 4W9HC 4JO3L 4WDIB 3SGDH 4HUNB 3BVNB 1EXHA 4DEWA 1BLIA 3D39D 5AB9A 3BLKA 3IXAB 4AI7A 4KRPB 1ZVHA 2YEVB 2YPLB 4I0KA 5EFIB 3H3PL 5LGJB 1WFTA 4N2IA 2B7DT 5DJYB 2ZWNA 3D3VD 3P9MB 1LD9B 4JFXB 2BNQE 1S9KC 3B8YA 1X9LA 5DVMA 4OZGE 2QADD 2WKLA 5KSUB 2EKJA 3N43B 2G0KA 4O51B 2D7MA 4O4YL 4PJ5A 5EB9A 2HJLA 4LKXA 2E6PA 4WWOA 5DQ9A 5AVZB 1KTJA 1EDQA 4H0LC 3B7TA 4OF0A 3NFNA 3IGUA 2P49B 2MNUA 2W60B 2XTSA 4MJ5B 4XNUL 4PUBH 1GMIA 2L7QA 3BHBB 3BWAA 1IO4C 2HJKA 2MQGA 4DCQA 3GUTB 2YD7A 3TV3H 4D3CL 1GAFL 2KS0A 4JFVA 2ZWYA 2D4FA 1D6EA 2EJ1A 2XV3A 3P3YA 4KRMB 1A8JH 3B5TA 3QUMH 4ZPTA 1EERB 3F05A 3HZKA 3PGDA 3DOSA 4P4KD 5KJ4A 5ID1B 5DJ0A 1ZTXL 6FABL 2P43B 4R0LB 3CBRA 3DIFA 3IE9A 3QZWA 1J8HA 1ZLWK 1LEIB 1A47A 1ZLSH 2ODHA 3VXOA 3C08H 3CCHA 1A7RH 1CLZH 2KPWA 4NQCD 4QGTA 3BESR 5BRZD 4OCSL 4XC3L 1Z5LB 3OC8A 1DVFD 1NFIA 1FQ9C 2NNCA 3KPMA 4HZ1A 4F9LC 1MCLA 2G5UA 2FUQA 4H40A 4QRTB 5B4MC 3HVDA 4XZUA 4LHUD 5I18H 2MJWA 4E2OA 4NPYA 3WGVB 5AWNH 3IDUA 3LEYL 2V17H 4YSOA 1M2OA 1T1YA 5AAMC 2DN7A 3MBEC 1R6VA 1T3FB 3ARDB 3P30L 4U7MA 2EH7H 1DQIA 1D2PA 4LCWD 1G7PA 3ARBD 1SOKA 4IMKA 4DP5X 2WC7A 2VMEA 4ONFH 4UU9A 3ZDZE 2CZNA 5DFAA 3VYOA 5HJGA 3TBWA 4Q4IA 4B50A 4PJGF 5KYUB 4KXBA 3VWJD 4PBDA 4Q9CA 2EIDA 1HCVA 4HX1A 4RMSA 1FRGL 4HCGA 4N9GA 3N1QC 4N0CD 1CI5A 3DSFH 1GC1C 4GMTL 5C6WH 4CNIB 2CDFA 4G1MB 5AG9A 1ZIBA 5H94B 5E7FA 5I1EH 4X5WB 2DDQL 4AL8C 3HBPA 2QZQA 3WHE0 5ENWB 2AHIA 4AQOA 2P5PA 4A39A 1U3NA 3CX5J 1V7NL 1KELL 1O6TA 3DK2A 3NMEA 3TVMC 3X14B 2VDQL 4GSXA 4JUTA 1GTFA 1B3JA 1G1YA 4JG0L 2DWSA 4JVUA 5D7LA 3G5XA 3AFLA 3LB6C 3G5WA 3V0VB 4M7ZC 5FO9A 1QTSA 3DBSA 5A3ID 1WC7A 3ILQD 3RFRA 3FU9A 4GY4A 1WBZB 2E27L 3AT0A 4F7EB 4LOUC 1G9NL 5GS3A 2R23B 4FGMA 3WTYA 4U1IA 1YUKB 1KGCE 1RMFL 5E9DA 3I6KB 3MSPA 1MFVA 4GUPB 2WVSA 5HJ3B 3QHTC 5HDQH 1WD9A 5DYOA 3LRMA 4N25A 4LDEB 1E9OB 1ZSDA 1HH9A 2Z35A 5CEZD 3JTTA 1CE6A 1K5WA 3E3QC 4OLYH 1VFAB 3FSZA 3JUYA 1RK0A 4HWEH 3IMRA 4UOJA 1P7QD 4PCSA 4G8AC 1LO3H 2AK1H 2IH3B 3HS0A 2LAAA 4NKMB 2JIXB 2BERA 2MCAA 1U8JB 1WIOA 2WO3B 5H2BA 2PETA 4FMKA 1GIGL 1W8EA 2UXFA 3BD5A 2Z65C 3IFNL 4JBSA 4YHYC 5FAAA 1T80A 4IMLB 3DROA 4JM2F 3CQPA 2VM3A 1QSED 4L4VD 2ZUUA 4GBXA 4JHZA 2LLGA 2HFGL 2I25N 1E42A 1SM3H 4KBPA 2CLVB 1FE8L 4RA0C 3IPFA 1MSPA 2UY6B 5E2VL 4B5ZA 2PW2A 4KZDH 1TMQA 4Y5XA 1CICC 1J88A 4HP5A 4XNYL 1C5CH 2G2PA 1P7HL 2IAMB 2Z8RA 1TETH 2MPVA 4H5SA 3GSUA 3VM7A 3H56A 3O6ML 2K6ZA 1A3RH 1O75A 1CVRA 32C2A 4LOEA 2HT2C 3H9SA 2CR0A 4NI6A 5CZXD 3KYAA 3GDBA 1JD9A 1MJJB 1N5AB 1NANI 1GCYA 3ARPA 1NGWB 1CVSC 4ZMTA 4YK4B 4YXHH 3QK0A 5F1NB 3K2MC 2XBDA 1QATA 4YHKL 4JFZH 5JIPA 1L0YA 3DUHA 5IW6A 2Y5QA 3ET9F 2APWA 1F4XH 3NCBB 3GEWB 3DNKA 4GMSH 1AY1L 4J3OH 1F18A 3S8WA 1YN7A 1A65A 4MZ3A 3V0EA 3VFPB 3VFGH 3VSVA 4E9WA 3L5WB 1NBZA 4PWIA 3L4TA 12E8H 3RWIB 4HPOL 1E2VA 3D9AL 2YMOA 1HT6A 3FQ2A 1KACB 4L1DA 4LCCA 4NIKB 4QAMB 1O9VA 5DVLA 1Q1PA 5JA9A 1AGCA 3H3BC 3QFJD 4PVLA 1BW8A 3K6OA 4K5OA 2Y5TB 2ZOKB 3L9YA 1JVKA 3PXJA 4WLCA 1RJCA 3TFBA 3MOAH 4L3ED 3T0EB 2YZ1A 1OAZL 2FQDA 4GFTB 7FABH 2JELL 3HRZA 4GB9A 4QPEA 2CCWA 5ESQA 4NP4L 4M9PA 3I6GA 3TZVB 1S7VA 5F89A 1NDMB 1AGEA 5K9QG 3CX2A 5I9QC 5C6PB 3NK4A 2R2BA 5LBSA 3VXMD 1IKOP 2BNRE 2CWRA 3IE4A 3RVWD 3VD5A 2OMVA 5K69A 3MLZL 1TQSA 5MEPB 3QWNA 5FYKL 1FLTX 3EGXA 2O72A 1SLXA 3HUJA 4X5XB 3D4ZA 3Q8AA 3U4BH 3QI9C 4X6CE 3SCMC 3ASNB 4O02A 3ZY7A 5JQ6H 4TSCL 3S35H 1Z6JT 2YAHA 1JD7A 4OV6F 2WXIA 4M1DH 2P24A 5J6HA 8FABA 4GQQA 4AZ8A 4TUJA 4XVTH 1MHPH 3RKPA 2PYEA 4J4PC 4PVMA 5LBSL 1AXIB 1S3KL 15C8H 1B0RA 1D6VL 1N12A 1WBYB 3OF6A 3GJFH 2FIKB 5JQHC 3VXUE 4GXVL 4XH2B 3PJSB 4PJAE 2P80A 3ETBJ 5JPMB 2K78A 1ZT4A 1FDLH 2VR5A 2Y7QB 2ZCKH 4MD0B 3T0VA 5HPOA 2PNDA 3FW6A 3HIZA 3X3FH 2PWEA 4AEFA 4JLRB 4APQA 2DQTH 2GUYA 1NLBH 3FB5B 4HZAA 4YX2L 1V3JA 4WI6A 2CE6A 4H0GA 4Z7WF 1QLRA 1N59B 4KZCA 1CDCA 3M07A 1AC0A 1WFIA 1R19A 3CPLB 4JHVA 3KBHE 1EO5A 4U1HB 1TTBA 5EZLA 5CXPA 3B2UC 5GGSA 1WZKA 5C09A 1XMEB 3IU3A 3BPOC 1LM8V 3TP4A 1AO7A 5EU4A 5JIHA 1AZRA 2J21A 3LVTA 3U83A 3B7UX 4XX1E 5GS0D 1KYDA 2KPNA 4K3EL 1CWVA 4JGJA 3S36X 4OW6A 1ZLVH 1QTYT 3T3ME 3V6OA 1HNYA 2ZONA 1ZHNB 4DVBB 2KDGA 2CUAA 4GRWB 1HZKA 2ZUWA 4ZMOA 3TPUB 2CQVA 4BE6A 4N1CA 1BYOA 2AVGA 2GK2A 2VLRB 4KNQA 5DD6B 1AD0B 2R29A 5EC1A 5MENB 4P59H 2D7QA 3RGBA 3U1QA 2OXHB 4CSPA 3GGWB 1KFGA 5DO2C 1RHHB 5TDOA 4XVJL 4E36A 2V5RA 2J44A 2WY3B 1BZ9B 3N9GH 1GRWA 4PJIB 2VC2B 1G5GA 1UUNA 4OGQC 3VFVB 3TIEA 1NANH 4L29A 3HLAA 3KNBA 3Q5YA 1FL6A 4DP4X 2BSDA 5BXFB 5F6HJ 2WVTA 3FQXB 2AEQL 3K2KA 3VVWA 2NR6C 3DC0A 3MNWA 4D7BA 3UC2A 2RR3A 3BGMA 5TPWL 3WEXA 4BH8B 5HI3C 4V1DB 2C4FT 4LBAA 1EMTH 1I3GL 3QUZD 3BIKA 4LLUA 3T0DA 2R29L 5CZKA 4QF1B 1KPVB 4UDUA 3U4EB 4KTGA 1HTYA 5T1KA 4AVIA 2AXWA 4NM4H 4UYPA 3ARYA 3P3TA 3RG1C 1G7QB 1MDTA 1Y6KR 2B59B 2RB8A 4K3DH 4KJWC 3PP4H 2Y2TA 3B9DA 4G6AD 4JRYB 4MXWL 1U8HB 1RZQA 3SJVE 4RX4D 2DJ4A 2H1XA 4OD1L 2R39A 2YGPA 3ULUF 4U6XB 3MBEB 4XOCA 2YC1B 3Q8BA 3QIUC 2O6PA 5KYYB 5D1XE 1C5DA 1P1ZB 4LRNH 5GGSY 1Q9KB 1KG0B 5K9OA 3KYKH 1RH8A 4PW4A 3D0VA 1YPZE 2V8MA 4XCYB 1V10A 2V2XB 2ZJSL 5DURB 4S0HA 5DFWH 1AANA 4PD4J 4LHUA 4UBDC 1QNZH 4I9XA 4KI1A 3BH9A 2L7JA 4QRPB 3NIFE 1RJLB 2OSXA 4IBLT 1WFUA 3QA3B 1I3RA 1MFCH 1MWOA 3GNML 1SHSA 2VLJD 4QHMA 3U30B 4IBUA 4XP4L 2EXSA 9CGTA 5M95B 1F86A 2ENPA 3TVMB 1FAIH 3U9PL 4GKOA 5CSBA 4PJDE 4QRRE 1AIFA 3U2SB 3VNYA 4ZX4A 5J3HC 4XP1L 1QUNB 2YPKA 2E9GA 2IPUK 4X6DE 4CU8A 4M7ZB 2AQRA 1TTAA 4KI5F 3D18B 1P1VA 2HJFA 2YO3A 3T8XA 5CBAB 5FDWA 2DKMA 4LESA 2ZPKL 2NT1A 1YY8A 1JPGB 4P9HH 4PSRA 4FKEA 1RHFA 2R2HA 3B9VA 3LRSB 2VJ0A 3UBGA 4UMSA 1II4E 2PXYC 3VRIB 4DPRA 1TDQA 1U8NB 2VUKA 5EIIG 1TZ8A 1HNGA 4V2CB 4PP1C 1TZGL 4LSTL 1EJFA 2NUPB 1Y0LA 2WWMC 1O6SA 2NY2B 3D50A 4C54A 1I8KB 1F4YL 1Y18B 4QT5B 1XGTB 3VFSB 2CHXA 3MRJA 3QNFA 1ZPUA 3BKCH 3O45B 3L3IB 2DH2A 1U6AL 3VSQA 2I5YL 1B0IA 3BKJH 3QDMD 3P2TA 2DF3A 4NWUL 1XT5A 4L9LA 5GZOD 3RBGA 3W9DA 2HVJB 4R7NB 4CVWA 4EN3D 2FT6A 2WLIB 3CXHJ 2Y7SA 2YSTA 5E2JA 3EO0B 3L3JB 4LE8A 5FYJD 4CJ0A 4ZXBC 4EI6B 4U4IA 4ISVB 3QZNA 4Z5RB 4GBXC 1PSKL 1JNHB 1QSVA 4F7MB 2BIIA 2BWIA 3QPQC 1HAUA 4BDVA 2O61B 4YHYB 1R3JA 1ZHKA 3EH3B 4GS7C 3O3EA 4W9LC 1XBDA 3BCDA 4WENB 2OM5A 5I6NA 4JR9H 1OPGL 4NO2B 5CEYA 1ETZB 2JKXA 4KOBA 4XPHH 3CHPA 4KROC 3LQAH 5JDSA 4XPGH 3WE6B 1CICB 2JKSA 3RIAF 1K5NA 4XNQB 4Y2DC 2Z4QB 5EUKA 3PNWA 2WINA 4K5LA 3D08A 5J11B 2XVKA 1KLFA 1KFAH 1X5MA 3LH9A 1T6WA 4JFOB 2WIIA 5FLVA 2K7PA 1P5VB 4NXKA 4L4TE 3QQDB 3LYRA 3B9AA 1DFBH 3N04A 3NN8A 1QSEA 3P9LB 4GNKB 5DK3A 4DKFL 4MBRA 3LEXA 4QTIH 4JREB 1NMBL 1NUNB 1GZQB 3E9TA 2A4EA 2A38A 2WBJA 3BP6A 3FC8A 4I3SH 5TE4L 1FZMB 1BJ8A 4KKRA 5AW2B 1EEYA 1QSZA 4KK6D 5ISZD 1E5AA 5HJDA 2AJ3A 2BIOA 3SE3C 4LCCC 1KB3A 2LLLA 5EBWB 3TL5A 1U2CA 3IDJA 1BAFL 1GOGA 2BHZA 4Y1TA 1K4CA 4HUUA 3ECBA 1JVOA 5IVXB 4NKQB 3GMRA 4H8PA 4HJSA 2BWDA 2BLFA 4NKDB 4A6YB 4ZMYA 1Z9SB 1A9BA 2YSSB 4ZFFA 2WBXA 3LD8C 5EIIB 3W0WD 5LVEA 2ATPB 3TEYA 3Q6GH 3MGTA 3V0DA 3QZWG 3L1OH 1TLMA 3OC5A 3PIQB 4XBGB 4PI2A 1LEKB 3WKYA 1FH5L 5KS9A 4OZIB 4MMXC 4M03A 2OJZH 1CFBA 3X1FA 3L3KB 4G70B 2E9JA 4DN3H 5KVFL 4KRLB 2JK5B 3RJOA 4LPTA 4LSRL 2Q7AA 2Q10A 3RNKA 4JM4H 2QPUA 1PKOA 4AOFA 2BRRH 5HBBA 2APFA 3PWPA 3UO1H 5I9QB 4WIQA 3I84A 5LO7A 5L4FA 3HZYB 3MREB 5MP6H 2BDNH 2YEZA 3QUXD 5I24A 3TT1H 2NYKA 4EBQL 3ZKNC 3LHAA 1A6TA 1PPIA 4G6JH 5E8DH 3QI9B 2F5AH 1CGWA 4ZTOL 4HJEA 3BKYL 1WH0A 1FNGA 3CXFA 1NJ9B 5L9DL 4XOAA 3T2NL 4TS6A 3V6ZB 2VRQA 1FL5A 5FCSH 5IFJB 3BAJA 1OF0A 4JKWA 2Q0ZX 2GT9B 1I1AC 4RSYA 5IB4B 1S7SA 4APQC 1EJOH 3LCYA 1YY9C 4R3SB 3JVGA 1NGXB 3TCLB 1WSST 3VXMA 1QPXA 2WVVA 3QC5X 4HH8A 1AR1C 3OKMB 4PBVC 5F1KC 4CC4C 1T1XA 3VSUA 3QFDA 3S5YA 3G04A 1ECZA 4MNQE 3TYGL 1Z0MA 4NKIH 4EDWL 2R9HD 3T5WA 1Q0XH 1NIFA 1FGVL 1GHFL 4JFHD 3QHZH 5AYUH 3WEOA 2WOBA 2IXQB 1CC3A 4RDQF 2A2QT 5IUCA 1QFHA 4U1SA 1UWGL 4WHYH 1IBZA 4HMDA 4RWYH 2CO4A 4U3XA 1CURA 4S0SD 5IT2H 1VHPA 1E90A 1T6VN 5DLML 2IAAC 4X9HA 5DQ9B 3HAEH 1JF6A 4P5TD 4DKEH 1FYTD 1OK8A 1NM9A 3BQUA 3NFNB 3VX0A 3L3DB 2QQLL 4WO4C 3NDYE 1DJZA 1UACL 3BWAB 4Q4EA 4GAYA 2HJKB 5EEXA 4K94L 2QSTA 4R4ND 4DCQB 4XP5H 3NCYP 1GGIH 1D6EB 2XWXA 3QO0B 3ZUNC 1XGUB 2PTVA 1NLDL 3GM0A 3HZKB 3JV5A 3ZHLA 4JEGB 2QADC 3DOSB 4HIHA 5DJ0B 3KPRA 1CXIA 5BO0D 3OAUH 3QZWB 2FVNA 1A4JA 4H13C 5LB1A 1B0WA 5E6RB 4N90D 1SHXA 1CLOL 2XVBA 1KCUL 1IGCL 3CCHB 1YQVH 3I9IA 3ES6A 1Y6MR 1KTKE 1D2OA 3W2DH 2PCFB 5D7JA 2Q2EB 5F7HA 1H8LA 2DQFA 1NFIB 1QABA 5ICZA 3KPMB 1ODUA 5TE7L 1W0WB 5A40E 1ILSA 5I1CH 5IM7A 1R3HB 2HG5A 5KWYC 1CTNA 3IGAA 2X6CA 3VNZA 1TQBC 3SGEH 1T1YB 3DARA 4GJTB 3AQXA 1M56B 3B8SA 1UD2A 4P4KC 5IGXH 4RGNB 5DT1H 5E0QA 1G7PB 2YXMA 4FI7A 2CIIA 3LIZA 2FD6L 4UU9B 4N2MA 5GS0L 4XN9A 4X4KA 3FQNA 3GRWH 1IC5H 4KHXL 3N41F 3FCUB 3V4UH 1QPPA 3I3BA 3UZQB 3OLGA 4HX1B 5FV2A 2IDFA 3OXSA 1A4KB 2VDQB 3QIUB 4TQEL 2NUTA 1DVFC 4N9GB 2A9NL 4G71B 4K3GA 1T03H 2XACC 4HIJA 4Q6IC 2ESVA 2WUBH 5JW5A 2CDFB 5E6YA 4GLRI 1FH2A 3TV8A 3NEEA 4JY6B 3FT0A 1DZ0A 4IS6B 3LIZL 4K73A 5D9SA 3SODB 2Z1PA 3LTVA 2IWEA 2FEEL 5L2KA 3ARBC 5F96L 2FRGP 1XH2A 2OXGB 3N44F 1RUAL 5FW8A 2X87A 2X38A 4KVCH 3VWJC 1ZEAH 1BG9A 2Y5EA 3FCBA 5D7LB 4KVNH 4JFSA 3RWCB 4N0CC 5TF1L 1TT6A 3OHXA 5C7XH 1E5BA 1S7QA 5FO9B 3NPZB 1IAOB 2IJ0C 1BZDA 2O6FA 4AMKL 1WC7B 3T2LA 1FNHA 2IDCA 3C8DA 3ZYJA 3NCJH 5ANMA 2XNAA 5HGDA 3CVDA 5D7SL 5I2IA 3MXWL 1RLBA 1TQCC 4U1IB 3MODL 5ANHA 5E9DB 3SYOA 2EUVA 5FS5A 1AH1A 2P46B 4QO1B 4YXKL 2QBWA 3VGEA 3BEVA 2WJ5A 2QEJA 3BPNC 2LVEA 5HDRA 1NSNH 4N85A 2CO3A 5AW8B 3F65A 2YRLA 2G5RA 5IB5A 4U7SA 3EYVA 4GI8A 3DXAD 3MA9L 2ZWZA 2NX5D 1ZSDB 1HH9B 3LKQA 2PXYB 2RQ8A 1CE6B 2WANA 4PJBF 3QJFB 1E8XA 1K72A 1WZAA 4LXFA 5A3IC 1RK0B 4X9YA 4L9LC 5LGHL 2D7TH 1A6WL 2AJUH 3ILQC 2K9UA 1BWMA 3DJTA 1I85C 1F8TH 4EO5A 5JHLA 2QVTA 5EEZA 4KQ0A 4KO9A 4GKNA 2WXFA 3NAAH 2BIMA 1HS6A 4R9HA 2Y72A 4A7UA 4BBWA 4LAQL 1ACCA 5F70A 1PLGL 2UYLB 4L1SA 4PWKA 1WZ1L 5IJVA 3HC4H 1UB6A 4BZ1H 4NJ9H 4NQVB 4WI9A 3WXVH 1TJGL 1RQ5A 1B4JH 1Q0YH 4AC2A 3KVQA 3DROB 4PI0A 4PJXA 4GBXB 4Q6YA 1O6VA 1XZ0A 2B9BA 2V0AA 3LY6A 1KXTA 1N3NB 2B1OA 5JHLL 3NBNA 3C5ZD 4XHQA 1WHPA 2P1YA 3HMWL 5I6XC 4AIXA 4GS7B 1TZHA 1SQMA 4B6ZA 1T83C 4MA7H 4N0UA 3FMGH 4PJ7B 1KB5H 1IBHA 4DP1X 5AW6B 1FL3B 4XBPA 1TJMA 3NOIA 1KXQE 3OWRA 4Q7DA 4H5SB 3GSUB 2CIKA 2AJXL 4KROB 1NBVL 32C2B 4KNUA 4EN3A 3H9SB 2DJUA 2IBZY 2X4QB 1CU4H 4ZPVB 3RAJH 3TU6A 4EI0A 3FT2B 4XMZA 2HVKA 1QW9A 4UM8A 3UTPE 4KUZH 1CE1H 4I18A 5HHVH 2ADJA 3GTVA 4KNSA 2YGVA 4YL9A 1GJUA 3O9WA 4NC2B 4OFPA 2CXGA 4D9QD 1KENL 3N43F 2DBLL 2W0PA 2F7QA 4LEBA 4YLQT 5K1JA 3VFRB 1YN7B 5CZXC 5FYJL 3VRJA 3S7GA 1A4CA 2K70A 5FO2A 2X10A 1UM5H 2XSKA 1BFVL 1NBZB 1F4WL 3GBNL 4YZWA 1ZLWH 3QJTB 4XXCA 4A7TA 3MV9E 4HXAL 4N8VA 3S4SA 4LCCB 5JUEL 2WVUA 4TQPA 3WHXA 5DTFA 1AGCB 4AM0Q 2VSKB 4U6TA 3M8OH 3ATDA 2P8MA 3FO9A 3JWDH 5IR1A 1OF2A 4GLRH 2VDRH 3PDOA 4FNUA 2ZXGA 5ESQB 1ASOA 2CMRL 4JRXE 5EOQH 5CU5A 1ZHLA 2N59A 3I6GB 1EHNA 1S7VB 4IKLA 4TRPL 5F89B 5TK4A 2ITDA 3PREA 4MMXB 4HPYL 3GDCA 3KZ8A 3F12A 2R2BB 2X4TA 4OLZH 4LVNB 3F85A 4ODVH 2F7PA 4OZHA 1WPCA 3V7AE 3EGXB 3WCYA 2H32A 4PJ8D 2Z92A 3AABA 3U1SH 2OZNA 4NZTL 1GGCL 3U9UA 4NQTA 4OLVL 5E08L 1INQA 3TFKC 2D7OA 4MHHG 2ZF9A 3ZN6A 3W0WA 3ZBMA 2P24B 5J6HB 3ULVD 4Z3TA 2CHZA 3H42L 8FABB 4HSAC 4G7VH 3W9EA 1LO4H 2YUWA 4TUJB 2CGRH 5F7EH 4F9PA 2X3AA 2YEQA 2JXMA 1B0RB 1TQVA 3HPLA 1BMZA 1TNNA 1CDYA 4Q14A 1QEWA 2B20A 1RURL 4IBVA 5IFHL 5DO8A 4OF7A 2MOQA 2ZCLL 1CZ8H 5CNHA 1ZT4B 3QBTB 2KC0A 1JZ6A 1L0QA 3AQDA 3HFML 4JDVA 4LHUG 4X4MA 3C8HA 1D7FA 4APQB 4DEUA 2WNXA 1OWWA 2ATAA 1NZRA 1RIHL 4G8EB 1ZANL 3U7YL 3VG0H 1AR1B 5EUOB 5AVVB 2FYYB 2VDNL 1CCZA 1XH1A 1ZA6A 1XO8A 4NDMA 3LH8A 4QI3A 4FFYA 5EZLB 3V79C 4PP2A 5GGSB 1A7NL 1M9WA 3DJSA 2FX9H 4V2BA 4RMWA 5C09B 3D0LA 4HT1H 4X8CA 1AO7B 5EU4B 5CJOL 4FFZA 3EDKA 1XX9C 4NPKA 3N3EA 1T2JA 4PEEA 1MPAL 2P28B 3BUIA 4Z0BH 2J1YA 3N1MC 2BP3A 3TM6A 2ROYA 3L54A 5GIRB 3QWOA 1DJIA 1XCQB 3FZUD 1JI1A 4NXSA 1GW6A 5LAPA 1SBSH 4FNTA 1YEHL 3K4DA 5JMOC 1EV2E 4FFYL 3FT4B 5EC1B 2E4TA 1PKQB 1ZDQA 5FM5O 4GKZB 1CB4A 3B5HA 5TDOB 4Z7QB 4X7TB 2ENYA 2XKSA 1B4TA 5E4IA 2N56A 2Y2WA 4QUOA 3GMNA 2BSBA 1UJ3C 2Q8AH 3WTVA 4HLZH 1D5XA 2QADB 2OQJA 1NGQH 3HLAB 4L29B 5GSRA 1A1OB 1IAII 4CGUB 5I8KH 4UM9A 1WA1X 2NY0D 2X2JA 1F6FB 3BGMB 4M7LL 3WEXB 5ILTH 2DQHH 1I1CA 1N68A 3FRPA 35C8H 4MJIE 4P5TA 3BUQA 4UB0H 1BXAA 3SDCA 5CINL 4UDUB 2FBOJ 5T1KB 2E7MA 2BMKA 1BF2A 3VW3H 1AACA 4EE2A 4HIXL 4N8CH 4NHCH 4PHZA 3O6LL 4C4KO 1N7ML 4Z6AT 2VABA 3I02B 2HFFA 1TQBB 4PG2A 3REWB 2H26A 4AMXA 4RZKA 4Z76A 1IQDA 3DRQA 2VR6A 4JQXC 4ODXB 1PQZA 3BVDB 4QOKE 5K9OB 3CVHA 2ODIA 3QUZC 4PYGA 1J1PL 1Y7VA 2BSED 3D0VB 3D25A 3F7RA 1LTXA 1LQBC 3BISA 5BRZB 4UT6H 1S9WB 1ACXA 2X9YA 4G9FE 4U6VL 2YMXH 2BY3A 1JUFB 2H0FA 4N0YH 2FB4L 1OPOA 4Q6IB 4PJEA 1CT8A 4G6AC 1ROWA 5DHVA 2J88L 4LHUB 4WNQA 5SX4H 2JTYA 3BVXA 3BH9B 3E38A 2XICA 1KEGH 3BAEL 4G80A 1ACZA 1C12A 4IIQA 1UD5A 4IU2B 5EG6C 1IVLA 5IHLB 4QHMB 3CVHL 3DOHA 3MV7E 4PGDA 3EO1A 5HHMB 1RU9L 3VQLA 1X4ZA 3GZQA 4AEHH 2DI7A 2D8KA 4WCYL 1AXSA 4WRLA 1B4LA 1DE4A 1ORSA 4BGLA 3FPXA 2ARJA 5KAQG 4MNGA 4JAMA 5FUZH 3VWJB 2N4IA 1WUNT 2PUQT 2YPKB 3JSSA 1RIVH 3RY6A 1DDHB 3QNZA 5C0GA 3GS4A 4XWGH 3SY0A 3T8XB 2BC4A 1TCRA 5IESL 4UAOB 2HTKD 2VDKL 2BK8A 4YDKL 2AMUA 3CZLA 1ESOA 4CADA 2R2HB 1W15A 3NRQA 1QSFE 3RL1B 4XN2A 2MOVA 3OPZH 5FIEA 3RNQA 3GEFA 1TQCB 1X4YA 3VMOA 1OO2A 3SOBH 4Z3HA 2XQBL 4DZBA 1BG1A 3WKPA 1MJ7H 2HLFD 1TJIH 1ITCA 2ZKWA 1E8WA 1GH7A 1Y0LB 1SJVA 2B1AH 4OSUL 1O6SB 1PZBA 5CP3A 1CYWA 2IWKA 3CZKA 1AE6L 2ERJC 3NSJA 4Y1AA 1JK9A 5C0JA 3I50H 2WWKO 3ZQWA 1J0JA 2HYMA 4PRIA 4G83A 3S0PA 4Y2NA 4XMLL 5AW1B 4M02A 1I1RA 2A4CA 2J4WL 3CDZA 3HE6D 4L9LB 4UAHA 3W9DB 1J5OL 4K3HA 5AB1A 1NOFA 5KYXA 1E5CA 2RCSH 1KT2A 1JWMB 5GJSH 4APXA 5BZWA 2AQTA 4A04A 3R0NA 2KT6A 1MFDH 1F97A 4KO5A 1T66D 1ZHKB 2CBPA 4LFHD 3RX9A 3QHFL 1L6ZA 2DQCL 3HG0A 4AL8H 1AYOA 4J12A 4J7RA 3IDIA 4YJZL 2YD4A 5CIPA 2QGDA 2WQ8A 1MAJA 5GZOC 5GRZA 3KH4A 4F92B 5B7EA 3G9AB 3HI1B 4UNUA 2LQRA 5H35A 3UAJA 2OR9H 1BIHA 1YJDH 2BNQD 2WINB 4IRZA 1SRDA 5D2LA 4G8IA 4PVNA 3EH5B 5DQDH 1OM3L 5GRJL 1KJ2B 2J8HA 2PPEA 1GXEA 3MV11 4WW1A 4ZDHA 3NQIA 2XJLA 1IAIH 3EJSA 3NJIA 4KTDH 4NOBA 3GXFA 3HN3A 4TLSA 4UQAA 2C9PA 1E6JL 2Y1AA 1HHHB 4J28A 3NN8B 4ZS7H 1H5BC 1QSEB 4L4VB 2HX9A 1F3RB 5JHDA 3D7PA 5ALCL 4ZBJA 3S98A 3TBCA 1RVFL 1NKRA 4YO0A 1FZJA 4WTWA 4IRZL 2DQDL 3BP6B 1JGUL 1D7BA 2ADFH 4FADA 1EEYB 1T5WA 4TM9A 3TN0D 5CLWA 4YDMA 4MCMA 3MKKA 4XXCC 2CJUH 3OAWA 4GRWF 2QVFB 2MQ0A 3IDJB 1TEGA 4ZW6A 1FPTH 2VH5H 3NK3A 4KXDA 1AHWC 3GMRB 3FFCA 1MG3C 4PY8J 4I5BA 1XBRA 4HC1A 3E8UH 2GJRA 3QORD 2E3VA 4NQXB 4YE0A 2VISB 1E28A 3DVFA 1HSBB 3FUNA 2NXYD 5KS9B 1W72A 5EN2A 3ZZ1A 3D52A 4LPWA 3BFWA 4P46D 2BCKB 3O0RH 2QSVA 1OAKL 3KYOA 4DK3A 4DAGH 5IB2A 3RNKB 3MRGB 1IM9D 1ZE3C 2Y7LA 4KDTC 3AW5A 4Z95L 1VENA 4HC1L 4M5ZL 2ISDA 1I1YA 1PY9A 3WIHA 2A5UA 4N22A 4R90H 4JJ5A 3JV4A 5DDHA 1QO3A 2HA1A 2VZUA 5DRWA 1W2KT 1BBJB 1A6TB 1W72L 3DIDA 3V5HA 2FHFA 5IVZA 5D5ME 3WD5L 2WNGA 3SDAC 4BSVB 3EZ8A 5GGTA 1FNGB 3HR5A 2CRIA 2JI2A 3V8CA 5CM1A 4L3EB 1FORL 1DSWA 4G8GA 3D34A 3MRLB 2UVFA 1INEL 3OKNB 5IQOA 4PGZA 2OMUA 4M6NL 4Y19A 3GSRA 5GS1C 3WIHL 4RFNB 3WLBA 3ROOA 4AGOA 3O3AA 1WIPA 5D71H 5DS8A 2OW6A 4G2AA 5FKAB 3VXMB 1JWSA 2WVVB 3QUXC 3TURA 1T1XB 3SO5A 1X5KA 4PJ8A 2DKSA 4ABVA 3V5DB 3QFDB 4P2QD 4BELD 3G04B 3WN5A 2P5EE 5GGTL 3AWFA 4PPTA 5FW7A 3FTZA 4Z77A 4YDZA 3GXMA 1RJZA 5I74C 1WGVA 2CDGB 2R4SL 3G7TA 3WUWA 2J5WA 3POHA 3KLLA 5G4OA 4JK0D 1KGCD 2JKNA 2XZCH 4HIQA 4EOWL 2XZZA 4FQJH 1BIIA 1SNRA 2YK1L 5L4IA 1VKXB 2OMNA 3DGDA 4B3VA 1KIQA 5DA4A 1OAQL 4FF9A 2JB6A 5I1HL 3ZT7A 5F7UA 4RDBA 3N1FC 5EU5A 3T3PE 2O93L 3WLWD 4QJ5B 2LU4A 4FYQA 5HYSA 1CIUA 4HCRA 2WD0A 3MR9A 3T6VA 4GAYB 3T6ZA 2R9HC 1GGTA 3HZ3A 4P2RD 2CJSA 3ULVL 5F9DC 4X80L 5IMMB 2AF2A 3KGUA 4GQ9L 1NCCL 2EILB 1U21A 4HIIA 5HPMA 3P73B 1UCBL 1L5GA 3KPRB 2D2CC 3A4DA 1HYSD 4UWQB 5IKCA 4KKLD 1A4JB 1UXWA 4FQQB 5FLUA 4P5TC 5D2NA 4HCRL 1UJ3B 3ES6B 1JGIA 2FQFA 2E7LA 4W6WB 1OAXL 4DGIL 3O3DA 4GI6A 4P07A 3CBJB 4WEBH 1FIGL 4NBZB 2YMTA 2F2HA 3WJLA 2MHAA 4R4NC 1WBXA 3UBXG 4GRLD 4AYFA 3PFUA 4PWEA 4Z8FH 3IDXL 1ORQA 2HG5B 3TXAA 5C0BE 3IGAB 2P45B 1G1OA 2IBZX 2Z31D 2GYSA 1DO5A 3Q01A 5D1ZA 4FI8A 3P77B 4GP5B 1T4KB 4ZW3A 2V5YA 4MRCA 3OB0K 3BVWA 1V3KA 3OXSB 2NUTB 4ONGL 1TEYA 4M1GL 3V2AR 4DGWC 1GYAA 4UTAH 1F2QA 3K1DA 4HIJB 2F53D 3QUZB 2ESVB 2CJ3A 4JG5A 5JW5B 5EU6E 1GZPB 2JNZA 4JQVC 3RILA 4R2GD 5J9PA 2K8MA 3I2CH 1U42A 5L2KB 3A6BL 2VXVH 1E4XL 3E80A 4XNXL 2QPDB 4IDJL 4I8DA 3CU1A 5TFSH 3VD9A 5DJZA 4XPTL 2GAZA 2MCPL 1QFWI 2VDLB 5ADOL 1CFSA 3OHXB 3RX5A 1S7QB 2NSMA 1V3MA 5BOPA 3LX9A 5FW6A 3MCKB 1YEKL 2BHFA 3T4AA 5ANMB 3QDJE 1AZCA 2XNAB 5HGDB 1SHMA 3RVUC 3W56A 4RGMB 4J5VA 2AEPH 1A1MA 1QBML 2QV2A 4JJHA 1MREH 1CFVL 1NM4A 5ERWA 2IADA 3FO0H 1YO4A 3VXQA 4BYHA 3S4SG 3VI4E 2CR6A 2VDOL 4DQOH 3BEVB 4BINA 3CZUB 2OSLA 1UWYA 1QQDA 3B5GA 3EYVB 1F3DJ 3QDAA 3CFEA 2GY7B 3E1F1 3JYBA 3VMNA 4BFBD 5I0DA 1QFUH 2BNRD 3HLKA 1N18A 1NIBA 1KBVA 3EDFA 5CHNA 1ZS2A 2GSGA 3SE4A 5BO1H 5TE6L 2GJ6E 2BZCA 2WCGA 2DTMH 2VWEE 1XHHA 5CD5C 4OZIF 4XBEH 3S3PA 3HMXA 3LEVH 2ERJB 5L8LB 2GTQA 1Z0NA 4PLOB 1A1NB 1JDCA 3PWLA 5SX5H 2A9ML 5FHBH 4AH2B 1BYNA 4FG2A 4NQEA 1JE6A 3DVIA 5FXCH 3MBXH 3BP4A 1B6DA 1ZWIA 2W0FA 5DJXA 4B7IA 5DD0L 3HS8A 4J8RB 4M56A 2G9HB 5IJVB 2XZQL 2WO2B 4U1MA 2JI1A 3VXUD 2Y36L 4X99B 5ITBH 4Z18A 2LABA 2QGEA 2ZSVA 3ARGD 3QEGH 2EICA 1XZ0B 3I6SA 1M42A 3HMXL 3QXVA 1IT9H 2P52A 1MCSA 4F27A 1XMWA 2R0ZL 5E7BA 4WY7L 2HTLD 1TZHB 2CLRA 4FN0A 5IG7B 3V5KA 1XF3A 1UURA 4AGNA 4I85A 1MFMA 4N0UB 2YUVA 1MRDH 3EW3B 4RISH 2FZ3A 1GOFA 3EYSH 3TBVA 4EDXA 3QDGE 1PBYA 3B9KA 3APDA 2AJYL 3G6AA 4S1DD 3GMMA 4IOSA 1BJ1H 1U8OA 2P5WA 3GKWL 4B9IA 4EN3B 5JW4N 3TX4A 2QTEA 2I07A 4N8PA 3RUGE 3DX1A 2B3IA 5I1KH 1YYML 1G1KA 4HEME 4EI5A 5FHAH 1N5YL 3QS3A 5LXGL 2A4ZA 4FZ8H 2I26N 2A99A 2HVKB 3UACA 4UM8B 1OP5K 1DBAL 5DVPA 1PLAA 4I18B 5B22A 3C5ZC 2OX5A 2AK4D 4YSQA 4HOZA 2EO7A 4PB9H 3ESMA 3UYPB 1PU0A 1MNUL 3DRTB 3GIZH 1JPSL 1FLRH 3MDJA 3O9WB 3MJ9A 3NIDB 4HZLA 2VXSL 4R5XA 1FNSH 3L5HA 3ZGIA 2B16A 3E3QE 2XN9D 1UM4H 3IM1A 3VRJB 4NZRL 3P0VL 3V55A 1Q0EA 4MYWB 3OKKB 4G11A 4R4BA 3ALPA 2VITB 3HZMA 3KBPA 4BGDA 2KZBA 5T3ZH 4OZGA 4BUHA 3HC2A 3NP3A 5CJQL 3PAVA 3KL0A 4CVXB 3PP3H 1CLYL 3FN0H 3DX3A 4N8VB 3S4SB 4N2FA 3HC3L 4XVSH 1IZJA 3HG1E 2XQYA 4NAJA 2IH1A 4F7CA 4HEPA 3UTQA 3MJ9L 1AHWB 4NP9A 3EKCA 2P8MB 4IHBA 4H8QA 1MZYA 3W82A 2ZCHL 5IR1B 1MUJB 3CFIC 1AZZC 4XP6L 4H26A 3PDOB 4D94A 4HMCA 4DO4A 5AENA 4X5RA 1LNUB 5FYKU 3SJVD 1ZHLB 1XXDC 2QQNH 5C9JA 4ECNA 4LQFH 4MJ6A 3FRPG 2CG9X 3OLIA 5KBDA 3PWNB 2ITDB 2R69H 2W9DH 3CNKA 4AY0A 3TN0A 5DZNA 3SPJA 3F12B 5ISZB 1LP9E 1AS7A 1VPOL 2X4TB 1M2VA 4R83A 5D1XD 5HYJE 1A14L 4OZHB 5IEKA 1FZOB 3NJXA 4TLTA 4AQAA 2H32B 1M3JA 1IFGA 2Z92B 4W81A 3QQNA 1QFWH 1K6QH 3MLRH 4HOMA 3M1BA 1KTBA 1BVKB 2DMKA 3U9UB 4RFOL 1NCWL 4FDWA 1INQB 2E7HA 2OJEA 4AYSA 4K55A 3W0WB 1KXVA 1R24B 4B9FA 3CLWA 3BPLB 3QCUL 4IJ3C 1QZNA 3LQMA 1QRKA 2VE6A 2VDNB 4JO8A 4OGYL 2W8CA 2GTZA 1MCJA 4W4OC 3B1TA 4S2SB 2AQPA 3TA3A 1QEWB 2D7PA 3HNSL 2J5LC 5ES4B 2N7BA 1LK3L 4FULA 4QXUH 5DF0A 3SPVA 3T0WA 2X1OA 3RHWK 3WN5C 1E4KC 5GS1B 2YPVH 4JDVB 4MHHI 3S2AA 3JV0A 6PAZA 1LEGA 2DQUL 3O4LA 1TNMA 4UIMA 1HI6A 5IWLA 4ZUVB 3EZJB 3VI3F 1D5IL 2EE9A 1RSFA 2Z6FA 3ULVC 3EOBA 3HA0A 1V7MH 3N0PB 2RAMA 1H9VA 1ZA6B 1PNCA 4PMFA 5I16A 4NDMB 1QI5A 1HHJA 1RZFH 4PP2B 5I74B 5L88H 3D0LB 5GGRA 4H8WC 2CHWA 3N0AA 4PJHF 4MQXD 4QYAA 5GRWA 3D33A 4OFVA 4WW2A 5HHPB 3N42F 4JFPA 2A6IB 4ANKA 3US9A 1MLBB 4OJDH 2Y07H 4AWJC 4WU7B 2CK0H 5KW9H 3ESUF 5D7IE 2Y4SA 4O5LL 4PRPE 3V6FA 3NFSL 4TSAL 1YDPA 5F8QC 5EULV 4EUPA 4BHUI 4HBCH 1LGVA 3N5AA 1XIWD 4QRFA 4ZD3L 2Q8BL 3FCSA 1P7KA 3ARED 4JN2A 2E8YA 3C6SA 2CHDA 1YG9A 3IF1A 2XC8A 4M43H 5ID0B 3GMNB 5JHAA 3CFCH 2FATH 4C57C 2FSDA 2OQJB 4Z3IA 5EEWA 2E7LC 3GSWA 2YIHA 3K8KA 3QH3A 2YRZA 5JOPD 5CZVH 4F2MB 5F3BA 5AYQA 3LN5B 2B77A 3FRPB 3WJLC 4N2EA 1FSKB 4OFYD 4P5TB 3CH1A 3SDCB 3UJJH 1KTRL 3P11H 3WU1A 1HEZA 2BMKB 2VXUH 5FKPA 4NUMA 5A6LA 3E9UA 5IROA 4LBEA 4WKXA 2Q7NA 4HJIA 4A7GA 3ECUA 2AAAA 3CXDL 3SKUD 3DKHA 4L23A 3KJ6L 4JCWA 1LK2A 2VABB 2HFFB 2CA3A 1NAKL 1Z2KA 2R56H 2H26B 3QR1A 3PPEA 1ULVA 4Z76B 1XH3A 1IQDB 1W6LA 2V3DA 3DRQB 3FQYA 4QNPE 1K85A 2YBGA 1PQZB 2NY0C 4L4TD 4L8BA 3WFBL 4RQQA 3CVHB 1B2WH 3GI9H 4PJ7F 2ADYA 1L0XA 4HK3N 4PREB 1YLBB 1YNTA 3K5SA 1NFKA 3UADA 5F6IC 5BOJA 3CFKB 3MLYL 3D25B 2H1PH 2R0LL 3FU6A 3K5RA 5L7XL 4B53A 3KBEA 4FJ6A 1CF8L 2FX7H 2HRGA 4ZOAA 3BUPA 5INCA 5I6KA 4NQDE 4PWHA 4GRLA 2YAOA 1CT8B 2GQHA 2RGSA 4PJEB 5DHVB 1J5IA 2A77H 5DLLA 3NFPA 4OUUA 5E51A 1GYUA 1MLCA 2VDKB 3UZEA 5AB2A 2OCJA 2X2UA 1X6LA 4H88L 4OB5L 1C12B 1IGTA 3EXJA 5SWZE 2OL3H 3RTLA 4PGDB 1XR9A 5DEFA 1N8ZB 4HH9B 3CC5A 3D8MA 4HS6A 1DE4B 1ORSB 4JDZA 2ARJB 4XNMA 4JAMB 1RZ7H 2MTPA 1U8CA 5I0ZA 1S5HB 3IWUA 3KLAA 3G5YB 3POCA 1U30A 4QKXB 1TIUA 3QNZB 4NSKB 5C0GB 3NVQA 2Z4TA 2BC4B 1MIML 2HRPL 4Y8DC 1PZ3A 1Q9WA 2C1PA 4OCNC 4K0OA 3WXWH 4UIKL 2BFGA 4CADB 2IBBA 1CBVH 3RNQB 3W39A 4PR5A 1RULL 1G5AA 3BT2L 4XR8C 1F00I 3ATAA 4IKKA 4EXKA 2WTRA 4IK7A 3QIBD 3V6BR 2ZUSA 5EN3A 4P57A 3D0AA 5FUOL 4BA8A 2GUOA 2XTLA 1JK9B 5GQBA 2EH8L 4PRIB 5E2WL 3OB8A 1KTDA 2HTKC 5CSZA 3CDZB 2DJMA 4OCYL 2B08A 3ZDYF 1X9RA 3ILDA 3FSWA 5F9WC 1WWWX 1URZA 4PJGA 5KYXB 3K74B 1KT2B 1GY2A 3IN0A 5BZWB 3FTSA 5B1JC 3WS6C 3LZQA 5LAXA 1IFRA 3L3OC 5EZIH 2WLJA 4POZD 2HLFC 1D9KA 4FG0A 5E5MA 4LP4A 3DXAB 2NX5B 1MWAH 4WFGD 2QLYA 2DOCA 4OLXL 4XMPH 1JDAA 4B9ZA 5I6LA 1BFSA 2ETWA 5CIPB 4MNQD 4X6CA 4N2OA 1G6RA 3HE6C 4WV1C 4PJHE 2XV6B 2EYTA 4PGCA 1UH2A 1A6ZA 1ZY9A 5H35B 5J56B 2ZSWB 2O5YH 5EA0H 5C0CE 3EJUA 4E9SA 5D2LB 2Y25A 4CU6A 1BEXA 4MS8D 5FM4A 4J3VA 3SKJH 4YXLL 2NNAA 4P0DA 4PGBB 4WW1B 1JPEA 3AM8C 1T66C 5C70A 1NCJA 3WUWG 5EUOF 4KXZI 1G6RL 3NSYA 4PY7B 5CJ5A 2ICEC 1QVOA 2VMFA 2NY6D 1RP8A 1S5IH 2W9EL 3F5WA 4MCZA 4CN6A 1WVZA 1E40A 1WV7T 3NH7L 4TNWK 3EYQD 1J0IA 4YO0B 1FZJB 1KV3A 2F19L 2ICWA 1CDHA 3QRGH 4I0PA 4I2XB 5LCVA 1OP3K 3SKOA 1SDDB 3RDTA 5IUSA 5CLTA 1IFHL 4MAYC 4OKVA 2QLVB 2V33A 1CUOA 2HKFL 2J71A 5L2JA 4LPXA 3ZSTA 5T3ZE 1JS4A 3PGFH 2KQNA 5HYSG 3VQMA 4C83A 1G43A 4R8WH 3TC9A 1NKGA 4NB7A 2IDQA 3FFCB 3NCXA 3MZTA 2LVCA 3D48R 3LKNB 4ICXA 4LF3A 4I5BB 1HN1A 2K45A 1VF5C 2CUMA 5DQJB 1LLAA 4FG6D 4P5KA 4UQ2A 5CAYB 4MSWB 4Z7QF 2Y7MA 5LCVL 2RQEA 3SBWC 4NZ8A 3RVTD 5E6ID 1HAWA 4TQIA 3L3GA 4Z3FA 3B9EA 5FGBA 3FTGA 1L0PA 3CWGA 5AG8A 5CN3A 1W72B 5EN2B 4W70A 3CHSA 3HPJA 3KYOB 2X42A 5IB2B 2GPZA 2XIBA 1DFXA 2EAEA 3ATFA 3PABB 4PUBL 1SY6H 1G0YR 1I1YB 2JJWA 1G4RA 4HWNA 2QL1A 2WJ7A 3ESPA 2DQJL 3QORC 2VTFA 3JV4B 4JJ5B 4NJAH 4XMXA 5DDHB 1DVXA 2DPKA 3S3JA 1B6UA 1YC7A 5DRWB 4DP7X 3LZRA 3V5HB 2V2TA 3J07A 1KYUA 2NXYC 5IVZB 4RH4A 2WZPD 5ALBL 2D0FA 3HR5B 4ZODA 3Q1SH 4P46C 4QMEA 4LEEA 4J39A 3TBYA 2IWGA 4N2GA 1N6QH 1ZLSL 5TJWK 3FOMB 1NMCB 2ITCB 1CLZL 4GEIA 1I9RH 1V3LA 3MQIA 3BRFA 3GSRB 3ROOB 3T65A 5B3JE 3T2PA 2BSTA 3HG3A 5DS8B 1XL6A 4C56E 1HHGA 5D1XA 5EBLA 1HINH 4Z3JA 2Q76B 3X11A 2WHVA 1WCQA 2ZICA 3CLEH 4PJ8B 3LZLA 3VRLE 5I18L 3WN5B 3RVVD 2JKLA 3OAZK 3P54A 4Z77B 2GBVA 2V17L 1RJZB 3AQYA 3P1VA 2GC7C 1EJ6A 2YXVA 3WUWB 3LKPA 3MLUH 2F58L 4ONFL 4HGMA 5IMKA 3GFUA 4OF5A 1QRNA 1BIIB 3BDBA 4LSUL 4WW2C 5E94A 1KIQB 2UWEE 3GZOA 2ENSA 2YZ8A 4TUUA 3GLZA 3P0YH 3ALWA 2JB6B 2VZTA 3ETTA 5LDUA 4G6FD 4QHUA 4BSWA 2K3HA 3AGWA 3DSFL 4WWKD 3LXUX 5EU5B 1UD4A 2CRYA 3ZE1B 5FECB 1CFTA 3D06A 5HYSB 5JMRA 1FFOB 1XVSA 4ZT1A 3MR9B 5I1EL 4QRRA 5DGQA 4ANUA 3MLVH 4IBYA 2CRZA 4W6YB 4PV9A 1VA9A 4X6DA 3VG9B 1XF2A 4HIIB 2V9RA 1XF5B 4ZO6A 4XNDA 5BS0E 1T7WA 1KGUA 1MFAL 1L5GB 5GISH 3ETBF 4LVHB 3GMQA 3PWJB 4X9GA 4W1TA 5DZ9A 3WN6A 5D2NB 5CLYA 1SOXA 4POYA 1SDYA 4QLRA 2HPOA 2VRAA 4F37K 1BBDH 1R3IH 4KY1H 5G5DA 3WLWC 2NW3B 4KXZH 3AU1B 4KTEH 1GR7A 1AG6A 5I1GH 2PTUA 5IHUH 4AYFB 2MHAB 4G72B 4KJYA 1AKJD 2ZWLT 1MZZA 5HDBE 1A02N 3CN3A 3F62A 2XG5B 4ZTPL 4MX7B 2VDPL 5J12B 5HDQL 3GKZA 5AVRB 4ZAKA 2D9QB 3AREA 3AADB 3DYMA 1HYSC 4KKLC 4LGSB 4RGOL 3P40A 3L16A 3UCQA 3VU1A 3RKDD 1AP2A 1GW0A 4X9FA 4Y16A 5FFOA 4YPJA 4OLYL 1ZGLA 1T0NA 5JORA 4LLYA 4HWEL 4Z7WA 3UTPD 2H9GA 4OGXH 1UJTA 1EO8L 2VSDA 1LO3L 3IDGA 5ESVA 4R7VA 2HG0A 3FBQA 4GRLC 4OFYA 4XE0A 3LKSA 5F6IB 2G3MA 1H9DA 5LG1A 5JXED 3HI6L 3MRQB 4QJ4B 2EDKA 2Z31C 4Q8BA 1KCLA 2QJDA 4F15B 4KX8A 1CDIA 2WYHA 2E46A 3RGVA 4LFHG 3KPSA 4P2OD 1NPUA 5T1LA 3SN6N 3WS3A 2A83A 1EHLH 1OQXA 3Q48A 1U3ZA 4TV3A 1MW3A 2EXYD 4AMWA 5DJZB 4NKOA 3MV9D 4ZUSB 1SM3L 2GAZB 3D3VE 1IEAB 4YGVA 1CFSB 4L4TA 1L7TL 4KZDL 5KAQF 4BQ8A 3A4EA 2OKMA 4L3CA 2BY2A 4R2GC 3T4AB 4Y4KD 1TETL 2YD6A 1A22B 3A67L 4HIPA 4HK0A 5KJ7E 1A3RL 4Y4FD 2H0JA 2IADB 3U79A 2VN4A 4JRXD 2Z7WA 5AVWB 1CDJA 2OSLB 1QFPA 4CUCA 4DH2A 3N1PC 3UDWA 4ZMNA 1QQDB 3NRPA 2LU5A 2WXJA 4XCNA 4YXHL 4YHPB 5JHMA 3C9NA 5CHNB 1L9RA 2GSGB 3QNXA 4ODUA 5KSAA 1RAMA 4JFQA 5KS9F 1B90A 4PB0L 3KMDA 3OSKA 4HFWB 4BFIB 1F4XL 3PNRB 2MKWA 2NY5H 3DGGA 4MASA 4ZW5A 1BF8A 3X1EA 1TTCA 4GMSL 4LL9A 3N40F 4NQCE 3VFMB 4QD2E 3RWFA 4HS8H 2J73A 3KR3H 2C5DC 1S9YA 4HUCA 4Y88A 3VFGL 2O5ZH 3RTQD 3BP4B 1OW0A 5EF3A 2W0FB 2YAPA 12E8L 4JO4H 4GG6E 5ECGA 4U1MB 5F9WB 3EOAA 1YECH 2QSCH 1AVAA 1RPQA 4J6RL 2VT0A 3KLQA 2ZSVB 3QS2A 3C6EA 3T08A 5F1IB 4LCWE 5F1OB 4LU5L 4YZFF 3OGCA 2C8NA 4BFNA 2OP4L 2Q3AA 2CLRB 2FWLB 7FABL 2BFVH 1CGSH 1NBCA 1FCGA 4IKJA 1TJXA 5DD1H 5M94B 2FZ3B 4GW4B 4EDXB 4HJ0D 3TBVB 2V5SA 3NEXA 1IILE 2FQGA 3HE6B 1QW8A 3G6AB 1KY7A 2O1AA 3GMMB 3T09A 4NHUA 2I07B 3ISWA 5KVDL 1JBJA 2EDXA 3QUGA 2AC0A 4DKTA 5ABDE 2QKIC 4LEOB 3ARGC 1X6NA 2FHCA 4XAKE 2VO8A 3D07A 4LVOC 4P9MH 3BZEB 1WEJH 3OKYA 5D1QE 5GHWL 4GSUA 5CILH 2Z8SA 5B21A 2FSEA 1JN6A 2HTLC 5FYJU 5LN4A 3ARRA 2J12B 3EG9A 4M1DL 4HZLB 2FO4A 3DVNA 5TF0A 3U0PA 1MHPL 2HZHA 4S1DC 4LLWA 1A0QH 25C8H 3GSXA 3KE0A 4K23L 5HI4D 1NAMH 4Y4HD 5C0ND 3WTUA 3HI5H 3HZMB 1UATA 2BNQB 2FDBP 1FDLL 4OZGB 3OX8A 3I6LD 3X3FL 3T1WA 5BRQA 4H25A 3V4VH 1MFEH 3IDMA 4FXKA 2DMCA 2DYPD 1NLBL 2PCYA 1I53A 5KN5B 3PXLA 3IMVA 5JXAH 2K1MA 1DJWA 3NA9H 3UTQB 1WUZA 4MJID 1G9MH 3MLXH 4OCRL 3CSTA 4FEIA 1XAUA 1ML0A 1KBBA 2BY1A 2FNWA 2YN5A 2AMGA 4HKBA 4MAZA 1UT2A 3NP4A 4H26B 3HG2A 5CEZE 2N3JA 3FXIC 3S5ZA 4HALA 5E56A 3WE1A 5BZDA 3LZPA 4HJTA 1T5KA 4QXGL 5F3HA 4ELME 4Y2OA 4ORGA 5I5RA 4KJPD 4MJ6B 5SV4A 4FL4C 3TN0B 5GJTH 4M7LT 5F7LB 2VM9A 4AGLA 2P48B 3P4MA 4JZNA 4QOKD 4IHOB 1N2RA 3ABZA 2MKLC 3ZHDA 3ATBA 4AQAB 1WAPA 5D70L 2C7UA 1R0AH 4UV7L 3M1BB 3FCTA 2H2PD 5CF3A 1U93B 2X7LA 4P59L 2OJEB 2QHRL 1A3LH 4G9FD 5LNGA 2ZNWA 4HW6A 3L7FA 3B43A 1E2WA 2JJUA 1EXGA 1YAIA 3DV4A 1SVBA 5JOEA 2YFNA 3N9GL 3VACA 5JW3L 2VE6B 3IMBA 2GTZB 5CJXC 4Q2ZA 4N0FA 1ANUA 4P46B 3MJ7A 2ZOUA 4AEEA 4N6QA 5D1XC 3UJTH 3ZDZB 3ZK0A 3CZSA 1EMTL 1IM9B 1JGLL 2DMHA 4P3DA 2GBUA 1YNKH 2ZKYA 5E24E 4AM0B 2ZF8A 1AD9B 4UINH 3WY1A 4NM4L 1I1FB 4MD4A 4PGEA 1HI6B 5D7KD 2WK2A 3SOTA 5I6OA 3LPPA 3NG5A 5IF0A 1THAA 2E0PA 3EOBB 3C6LD 4B9GA 2CALA 2PR9A 1CFQA 5I16B 1HHIA 1I82A 1SZNA 5JZ7D 1IRAY 2AVFA 5CCKH 1QSFD 4EIBA 3K6SB 5GGRB 2EVFA 2X0VA 4YL4A 2ZYIA 1E27A 4O2FB 1RZJL 4O9HH 4L5FH 1CTMA 4KKAD 4WW2B 5GZNA 4JFPB 2DD8L 5HP5A 3KWXA 2MPAH 4MA8H 4AQ8C 3LH2L 4JO5A 3MACH 5L6YL 1EEUA 1M05A 2YQBA 3IN2A 5EPMB 3QWRD 5HHNB 5HHOE 4H1LH 5FV1L 5G4NA 3CFJA 4D9RE 5IBTL 4QGYA 2R7EA 1YDPB 1IQWH 2IGLA 4TVSa 4EUPB 1QNZL 4OM1H 4GW1B 1AQMA 3FCSB 3OR7A 4JN2B 2CLZA 1AQKH 3UBFA 4DP6X 2QPFA 3IF1B 4X7CC 1UWEL 3BZDA 1UXMA 4MQXC 2BH0A 2H8PA 2E6QA 4NO5B 1CXLA 2BS71 1FAIL 5CMAB 1FVEA 4JVWA 1KGWA 2X1QA 1N0LB 1UZ8B 3QH3B 4MNHB 4OZFH 4LLMA 2QDVA 1A5FH 3CG8A 5F3BB 3MI6A 3MKGA 3NDZE 3K3QA 1X5GA 4WWKA 3IS0X 3CH1B 3NZ8A 3LAFA 4OD2B 1JPTH 2X4UA 1S7XA 2IWFA 5HDOA 1XIWC 5FKPB 3IPBA 3FUEA 4FYSA 3BI9X 4AW7A 2D31A 3GK8H 3DLQR 1GYWA 2NNRA 4HXBH 4CRPA 1LK2B 3O3UN 4PJ9D 1NCAH 1A6UH 2UXGA 1W0VA 1N4XH 1XH3B 3JWOL 4N1EA 4A66A 1YVLA 1SEBA 1Q72H 1ZSHA 3QYNA 3BKCL 3CZFA 1YNTB 1OP5H 5AOZA 1AZUA 1PZ5A 4OD3H 3UERA 2X9WA 3RBSA 1U4EA 1BF5A 4JQIH 1J5CA 1A7PL 2VAAA 3O81A 5SWQB 5INCB 3LZFL 1SJHA 1IC4L 4GRLB 3ZQ9A 2BIHA 4J6IA 5HYQA 4FLQA 3NFPB 1MLCB 2DV6A 1KXQA 3O8XA 5CP7A 4XXWC 1YEIL 3ZTDC 2NYZA 2Z31B 5GGQL 1IGTB 4ABQA 5IP4A 1AGDA 3OKLA 4LK4A 4M93C 1KV7A 1XR9B 5DEFB 4AIZA 3JZYA 3U82B 3PFQA 4HS6B 1T2XA 4JDZB 3NIDF 4FC3E 1JSYA 1U8CB 2BPBA 2EO1A 2FEDD 3CV5A 1K8IB 5LN8A 2GJPA 3LQAL 4ADGA 2HPTA 4CU7A 1NCUA 1UVQA 4XPGL 1DQML 1NCNA 3SE6A 3STLA 4QRBA 2EVHA 3G9VA 3B2XA 1Q9WB 1RERA 2C1PB 4I3RL 2YD1A 4U3CA 2CA4A 1YMME 3S2CA 4R2GB 7TAAA 1J8RA 4XX1G 2PCXA 3ESOA 3FNKA 5JXEA 2XDHA 5T8IA 3W39B 4ORZC 5HGAA 3W81A 2C9QA 4NN6C 5CJ8A 1DFBL 2C3XA 4FI6A 1KOAA 4JG9A 2WTRB 3Q9PA 4JFFE 2F08A 4ZFGH 1DBKH 1IGJA 3H6AA 4DGYH 4QTIL 1KB9J 4LCUA 2YGNA 2GUOB 4ZMXA 4DVRH 2X4NA 1MFBL 2F5BH 1ID5I 2ZP0T 2L7UA 1KTDB 2J6EH 4I3SL 4OJAA 1PEWA 5CSZB 4GSQA 3OVUB 4G1EA 3LDBB 4Y4KA 4MCNA 4AT6B 1HK6A 5KVGH 1SFDA 1UADC 5D93C 3MLSH 4E41A 4JFYB 4YGAB 1AXTH 1DBBH 1EA9C 1WJ3A 2QR0A 5FA4A 4BFFA 5LAXB 5K5YA 4YDVA 1HL8A 3QIBC 2C7FA 5ABZA 4FQXA 2UZIH 2JTDA 3C2AH 3VH8G 2BNRB 1CR9L 1E6OH 3FTVA 4S0TD 4B5EA 3L1OL 4XPAL 3LZOA 4HKXA 4NQQA 4PN6A 3FHQA 2P5ED 4AVHA 4X6CB 1G6RB 3D4YA 4GP4B 1EFQA 1Z7JA 2EYTB 4POUB 1KYOJ 2OJZL 2RBLA 4XRCA 3BP5A 4DN3L 1DQLH 1ES0B 1T20A 2C3VA 3OMNB 3DX7A 4MVBD 2VKWA 2YD0A 3WMPA 2OMTA 5INDB 4JM4L 4LL1A 5DZAA 4POZC 2BRRL 4A38A 4ALAC 5I1IH 3UO1L 2NNAB 4CMMA 4FNQA 5KZCD 4TKWA 2WXNA 1F2XK 1YEJL 3LNIA 3MO1A 3BN9D 5MP6L 3OSVA 1J1XL 5DC4B 3VXUB 4LNRA 1L9NA 3I9AA 3TT1L 4C59B 4M6MH 2OMZA 3GHBH 3H6JA 4PJAB 3NGBC 4DUWA 1OTUD 1CI3M 4G6JL 3ARGB 3FUDA 1BV8A 5EOCH 3F01A 4LVOB 1B0GA 2H41A 1OTSD 3UTTA 3DBXA 4MCZB 4NNPH 2CO6B 1PDKA 3V52H 2JB5L 4I0PB 2FLBT 3BH8A 3GINA 3F7VA 4LASH 1GYVA 2RJMA 5L2JB 2L04A 3HKZA 1AC6A 3UTSE 4YEEA 5KYWA 2NW2A 4Q56A 1J10A 4B9PA 4ZMWA 1F13A 4YEFA 4G7YL 2AJVH 1BM7A 2C9SA 1IUZA 1JOIA 4ZFZA 3BQVA 3IU4L 4EIGB 1YNLH 2R0KL 5JYLA 3MCLH 2CHNA 4GO8A 1YUHA 4LCYA 2NY6C 4NKIL 3T3MB 1LO0H 4P5KB 5E9NA 4KC3B 1WD8A 1E7UA 3Q06A 4J3UA 4AJ0A 4XOEA 3X3GH 4TOYH 3EYQC 2FJUB 4XGZA 4FKKA 3L3GB 3TJHD 1IMHC 3QHZL 3D85D 5C0BD 1CXKA 4CMHC 4TYUA 3QUMB 3PQYE 1DL7H 1RXLA 1T22A 1UM6H 2GBAA 3I3DA 4FYTA 4HUMB 4KUCD 2WPGA 3ZW3A 5IT2L 3HPJB 3QDME 1A64A 4KMTH 4P99A 2XRAH 2A6DA 4Y4HA 4F80A 3VGDA 4DKEL 1HKLL 1T21B 2XYBA 3CFBA 2IG2L 4XCEA 4FL4B 1DVZA 3DURB 3DK0A 4GAFB 5AVUB 4ZMAT 4FG6C 5DA0B 4XP5L 5E6IC 3RVTC 1GGIL 2V2TB 5EU6D 1U8MA 3D30A 4NRZA 3RIKA 1JGDA 1B9ZA 1PIFA 1I7RA 1BXUA 3VH8B 1B4RA 3H7LA 4OLUH 43CAA 2AAVA 4TVPH 2Y2YA 3MV01 1SF3A 4WDIA 3TBYB 3S8GB 3BVNA 2EIZA 1ZTMA 2EIBA 4YSPA 3UROR 3RYMA 5F0MB 1MHCA 1YQVL 3IXAA 3K8LA 4IBTA 4U0RC 1JFQH 2JKJA 1IIIA 2BSTB 3GSOA 5LGJA 1S8DB 1HHGB 1GA2A 5D1XB 3MRMA 5EBLB 4DPBX 5C0FA 3L4ZA 3P0GB 1ECYA 4QOKA 3X11B 5CBEB 1AFVH 3NQKA 4PJEF 4PG9B 5AFAA 2WZ0A 5C08D 1EEZA 4NZDA 3VXSE 3C5SB 4HF5H 3QDJD 1WF5A 1DEDA 1YPZB 4UV4L 4S11A 4WHDA 5IGXL 5DT1L 1XR8B 3KW7A 2AABH 2R0WL 3LKPB 4G9FA 3UBHA 2CUIA 2R27A 3RWGB 3VD4A 3GRWL 3OZ9H 3BHBA 5E94B 4IEFB 1DHKA 4L5FE 1KPUB 3DUSB 3OMAB 4HHWA 2I32A 3NIFB 2Y6TE 3GUTA 3SPCA 5F0PB 2Y06H 3S9DB 4QHUB 4B7LA 4BSWB 2Y1ZA 3MV7A 3CQFA 1YEDB 4A2MA 1CFTB 1V05A 2GJ6D 2WUBL 3TWCH 4R0LA 2ZKHL 4J3OG 3RVVC 1DJXA 1KC5L 3H3PH 3K2UH 4PJDB 4QRRB 4ZSOE 4PV8A 2FX8L 4AQ1A 4KGLA 4P9HC 2QQKH 4DTGH 4X6DB 3KPQA 3F7YA 4ZOBA 4Y7OC 4OQ1A 5AUMB 2W9LA 3SYQA 1CPUA 1OAUL 1XF2B 4MB3A 1OCRB 4O4YH 5T5FH 4WFEE 3L8QA 4KVCL 2WQVA 1XTLA 1ZEAL 5GPRA 3GMQB 1MFNA 1G0DA 4YSUA 3C8KA 4XNUH 4WWKC 5C7XL 2VYRE 2XJKA 1U8IB 3EFOB 2AEOA 2QELA 3CMOL 1EZUA 1T3FA 3ARDA 5G5DB 3L5XH 3UYRH 4D3CH 1SVCP 1PAZA 3EAKA 4FXGC 5A2LH 3WKML 4MDIB 4JGNA 4GAJL 4ILDA 4BFRA 2JJSC 3M7OA 4KJYB 1F42A 2K9FB 1TVHA 4E9QA 3FUKA 2ZUQC 1ZTXH 4A63A 6FABH 3GXPA 5ACZA 3QDGD 5KVEH 1NSNL 3TTSA 1DANT 1Q9OA 2DM4A 5LHDA 2QHLA 1UZGA 4YC2C 4ZAKB 3AREB 1CG9B 1JL8A 2KZ1B 1R46A 2XXCB 4OR1A 1ONQB 4G1MA 4ZFOA 3WEAA 2X41A 3NSDA 1AP2B 3CZNA 2VERA 1EUTA 1NGPH 4K5PA 4Y16B 4BCXA 1ZGLB 3HN8A 4JX0A 5JORB 4LLYB 5ENWA 4Z7WB 1UASA 4PTUB 3T77B 5HYEA 5DC9B 1F8TL 3IDGB 4PJIE 3HE7D 4AE0A 2H4EA 5ESVB 1H3UA 3K6DA 4MGXA 1KTLB 3WY4A 2PR4L 4H8WH 1GJWA 2BIQA 5D2LF 5LBVA 1JNLH 1ZPLA 3GQFA 1N70A 2EECA 3V0VA 2YWYA 4F5CE 1RL1A 2HN7A 1OP3H 4ZFOL 2HUHA 4NJ9L 3WXVL 4F58H 3WNMA 1UEYA 2X70A 4HGWA 1XB3A 1Q0YL 2IV9A 3RGVB 2PLTA 1WBZA 3GXUB 4WU5B 2A83B 3QJHA 1UFGA 2AEIT 2WCSA 1FRGH 3WS3B 4E0RA 2ZWSA 3AG3B 4F7EA 4J27A 4NKOB 4M93B 4YGVB 2OYPA 1E67A 5CR1A 3AJ7A 2Z7ZA 4L4TB 1JPST 3R4DA 3ARUA 5HJ3A 4LRIC 3FMGL 1GSMA 3BGFC 2DDQH 2X6AA 4ODTL 2AQ2A 3H85A 4RLDA 2R59A 5JXEC 3AMKA 4Q9RH 4AYDC 3DYPA 4P3WA 1V7NH 1VFAA 4Z7UE 1VEPA 1IJNA 3FO1B 2VDQH 4N9OB 1CU4L 4P2OC 4IRSD 3CDGA 2YN3A 1EUUA 3SPGA 1FFQA 4BZYA 2EXYC 3HMXH 3FU5A 3ML9A 4XCNB 5E6UB 3S37L 4KUZL 1FZKA 1CE1L 3MUJA 5HHVL 2MQ3A 3C9NB 4L9DA 1QYGL 2CCLA 3QNXB 4FLSA 3QXWA 1OGAE 4JFQB 1EVUA 4ZZKA 2O5XL 2OYMA 4QEGA 5A2BA 1G9NH 1E50A 3DMMD 3TIDA 4Y4KC 3DGGB 3QCVH 1DANU 2UZXA 1HU8A 4Y4FC 5DUBA 1MJUH 3RWFB 2A74C 5KVGE 2AANA 1R5IA 1JXGA 1GKEA 1S9YB 2V5TA 4NN7B 5F9OL 5H8DA 4DO6A 2Z8VC 2XWCA 2IPKA 4NZJA 2CLVA 1DLHA 1PD6A 2VAJA 4GUOA 3EOAB 3T6WA 1MI5D 4NGHH 2IAMA 1Y6NR 1BQLL 2IOMA 3M8OL 5BW7A 5L0QC 3LPWA 2YQ2A 2IMMA 3QIBB 5EC2B 1MY7A 2YD8A 3MV8E 1HILB 3NT0A 1KGYE 3FSAA 3OGCB 1N5AA 4HFUL 4WI3A 3ZIYA 3QIWC 3KVPA 4DETA 3US0A 1BQRA 4RSVA 1GTNA 3LHPL 4PBXA 1GIGH 3WELA 4J1UA 3QQ4B 3IFNH 3II3A 3JZ7A 4QRAA 3RTQC 4JFED 3UIYA 4BZ2A 2X12A 1C08B 4Y5YC 4IOFC 1F0LA 2GG1A 1H6EA 3WTWA 4RRPM 3AS1A 4OLZL 3TCTA 2YHGA 3GJFB 1JTTA 4YR6A 5AAPA 5HVWA 2CUHA 4XNAA 1FE8H 1F45A 5E2VH 1ET7A 1WTGT 3FU0A 5DJ8B 2CKNA 2PO6D 5BUAA 3VFPA 1GJIA 2FSEB 1JN6B 4KPHH 1PD1A 5D4JA 3ULVF 1CGVA 3F7QA 3NGBB 3DVNB 3FQWB 3LNDA 3O6MH 5FC9A 4HJ0C 3GPEA 4BZ2L 4DK5A 1QR4A 2P5EA 4MNQB 5F7EL 3U0PB 1X44A 5JW4Q 1TVBB 4IKNA 5DEGB 3NSXA 3GSXB 1LYQA 1NFDE 4F1ZA 4EZMA 4N2KA 1T6BX 4QRQA 5DZJA 5EORL 5J13C 4ERSL 2ZYHA 3ZE1F 1CZ8L 3OZLA 2J56A 3MU3A 3OX8B 3UABA 3T0EA 3OPUA 3F64A 4H25B 3SDXF 1HZHH 2APXA 2B5IC 4FXKB 1OD9A 3BMVA 2R4RH 4OIBA 4PJCE 3VG0L 2A9BA 3WIFA 5JIDA 3GTTA 2LV4A 2NY6B 3EBGA 1W8NA 1BSIA 5DRXA 5BZDB 2EEBA 5F3HB 5HI4C 3FU3A 4JW3A 4MD5A 4Y4HC 4Y2OB 5MI0B 4ORGB 5C0NC 5A2AA 1AZNA 4HPOH 3KWWA 4Y5VC 4YHOL 2Y69B 2I9LA 4FTVE 3D2UA 3NESA 3WNKA 1T4WA 3H1ZA 3QUYD 2BSCA 3P4MB 5CGYD 1OAJA 1M71B 1EHXA 4KRNA 1H19A 1M7IB 1SBSL 2C7UB 3SBRA 1JYXA 1QPKA 8PAZA 5ETUB 1DVQA 4FABH 3FCTB 1OAZH 2FIKA 2X7LB 4WFFE 1JP5A 4NP4H 3BXNA 3QJQB 5JPMA 2EE0A 4TVPE 4MD0A 3WO4C 4WEUD 1MEXH 4NQDD 4WAFA 2IBGA 3HNVH 5I8OH 4KJPC 2BIPA 4XI5D 3FB5A 3D85A 1NGQL 1I8LC 4Q2ZB 4N0FB 1MELA 3MLZH 1XGPA 5SWZD 2VKXA 4L05A 2GJZB 5ILTL 3L1FA 2DQHL 1MQ8A 35C8L 4TSCH 4P3DB 2E7BA 4WWPA 4U0RB 4Q9QL 2H2PC 2JF1A 1W80A 3R4RA 4MD4B 4PGEB 3VW3L 1WTLA 5PAZA 4UT6A 2BOCB 1VGKA 4N8CL 4NHCL 3II2A 4PMEA 2R51A 2O6CA 3EJPA 3GI8L 5LBSH 1S3KH 1CN4A 1CFQB 1D6VH 1Z3GL 1HHIB 3G5ZA 4P5RA 5D96C 1ZHNA 5DR5H 2ZG1A 4J23A 2M2DA 3DX6A 3EOYG 1RK1A 2XN0A 2YBRB 4O02H 4W4NA 1F90L 2I7SA 1E27B 4D9QE 5AW3B 5DD6A 1FIEA 3QQ3A 1BVZA 2FJHA 2ZAHA 1RHHA 4KJWD 3SKMB 5DZPA 4UT6L 2Y6SD 3ZLQC 1BZ9A 1M05B 5IZ7A 1F6AA 5IMLA 2YMXL 3KYNA 2W95A 1IIKA 4N0YL 3CFJB 2WBKA 4K3JL 3ZX1A 1PG7H 2XV2A 3C6LC 3TO4D 4E9XA 2HLAA 3FUMA 1DQTA 4Y7MA 5JZ7C 1KEGL 4V1DA 2C3WA 3WL9A 4F8OA 3GMOA 3Q8FA 4K3EH 1TYRA 3VB9A 3U4EA 4QF1A 1KPVA 3VI4A 4AEHL 1YEEH 3LKRA 1BDYA 3NCCB 3P2BA 1P4LA 4FQLH 2XHNA 3BSHA 3P02A 4KKAC 4LCIH 4JANB 4F9LA 3H53A 1VIWA 5FUZL 3SB3A 4FNLH 5I0YA 1BOYA 1YYCA 4LLMB 3CE1A 5J5EA 1UD6A 4JRYA 1KN2L 1SHWA 4G6FB 1UZ6F 2LGNA 3ZIMA 4WWKB 4XWGL 1C8PA 3NZ8B 5AAMA 2X05A 4AEIH 4U6XA 3MBEA 1Z3RA 2X4UB 2YC1A 4PJ5E 1ZTXE 1RFDL 2VL5A 3DSNA 5KVEE 3ML8A 1Q9KA 1MCOL 5IW1A 1OL0A 2G60L 3OPZL 3DHPA 2D31B 3L4WA 5J6SA 2VQTA 4HQQL 2V9QA 1T0MA 1PGRB 1SXSA 5C0CD 4PBWD 3V7AG 4EPSA 1TJIL 2Q87A 1BQSA 1OD7A 3BVTA 4XCYA 3OLEA 5TPWH 2B1AL 2V2XA 4YC2B 1I3GH 1TLKA 4NAMA 3G08A 4FTDA 1ZXQA 1U8LA 3IXTB 2R29H 3WJJC 4YDIH 1BECA 2OR7A 4OJYA 4G7RB 4TLKA 1PZ5B 1KZYA 1J05A 1ZVYA 2JCCE 2ZX8A 1J8HE 3QA3A 1YC8A 4JPIA 3SDDD 1A8ZA 4G43A 4RA3A 3Q2WA 4FA6A 3TVMA 4OD1H 1SJHB 3ULUD 2EC8A 3U2SA 5HYQB 1MCRA 5GJSL 4G3YL 3VFNA 2QKSA 5JW4M 1GC1L 4PJ9C 3O8XB 5T3ZD 1KLGA 3FUIA 5KBPA 1MFDL 1FC1A 1HWGB 1PF3A 2YOAA 1AGDB 5G4MA 4DP2X