2EVHA

Structure of a ndt80-dna complex (mse mutant ma7g)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
303
structure length
290
Chain Sequence
VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*GP*CP*GP*AP*CP*AP*CP*AP*GP*AP*AP*AP*C)-3'
publication title Principles of Protein-DNA Recognition Revealed in the Structural Analysis of Ndt80-MSE DNA Complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle/dna
total genus 83
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 2evhA00
2EUWA 1M6UA 2ETWA 2EVFA 2EUXA 1M7UA 1MN4A 2EUVA 2EUZA 1MNNA 2EVGA 2EVIA 2EVHA 2EVJA
chains in the Genus database with same CATH superfamily
3RL2B 5TDOB 4HEPA 5LBSA 1A9EB 1MDAA 1P4IL 5DZ9A 5DJZB 3US0A 2WBKA 2IJ0C 4IGBB 3QCVL 2VAAB 4CN4A 3VRIB 2YAEA 3S6CA 5FA3A 4XCCL 2L0DA 3JVGC 2OXHB 1QA9A 2DKMA 5LO7A 4NO2A 4PJ7B 5B38G 4FERA 1U8NB 4L4VD 3QDME 3NJLA 2OTPA 3BE1L 4TLTA 5DCCA 1AGBB 1PEWA 2R9HD 3ELAT 3OKDA 3NMEA 4IBQA 4X5WB 3QORD 3LQMA 3KG5A 3LRHA 3U0PA 4OFPA 2W92A 1XGRB 3T4YB 4HKJA 3BYYA 5CEZE 3LEYL 3ZZSA 1NPUA 1I7TA 3LQAC 5KS9F 2NNRA 2YZ8A 1MUJB 1J0YA 1FRGL 3CN4A 3KZ8A 1GR7A 5I15H 2G4EA 1GVIA 5ISZD 3U9PL 1WS7A 2AJXL 1F56A 3CHXA 1JWSB 4JQXC 5AUMB 1WCQA 4XMKL 4UB0L 1AR1C 2AQPA 1OXYA 2NQDA 1GY1A 2PKDA 5HHOA 3TYGH 5E1IA 1HH6B 4Y9EA 5FM8A 2NW2A 2K6WA 1OP3H 3LIZA 4MZ2A 1NKRA 5CAYB 3A24A 1Z66A 1U0QA 3VGEA 4ZFOA 5KVGL 4AGOA 3AS3A 5GJSH 3RVTD 5E1AA 3FYEB 4BFJA 5T1LD 4PRBB 1UZ6E 4ZFGL 1I8LA 2CBMA 3NJGA 3GZOA 1Q0XL 4LLMB 2VSKB 2XACC 1RZ8A 5B39B 3B5HA 3UTSB 3O0RH 4PSRA 2PABA 3FT3B 2JKRM 1P5VB 4BKSC 5GGSA 2VDPH 4JLRB 2DQUL 3AS2A 1Y1DA 5E2UL 1M05A 1QTYT 3REVB 4UDTB 1BF2A 4YWGL 4GG8B 4C56B 2XU9A 3WTWA 1IM9D 1BLNB 2LLLA 3DNKA 3RX7A 3B8YA 5KVEE 2EADA 2C3GA 3O6LL 3QW9A 2WOBA 1NAMH 5IJCC 3W0WD 1FVDB 5L2KE 2W5PA 3JV6B 3V0GA 2FJFB 2VDPB 1U6AH 2IQAA 3AU1B 2B1AL 3UAJA 1CLZH 1YEGL 4K7PL 2R1XA 1IBFA 3TIEB 1HK6A 3DYOA 3QE5A 2DMCA 3DETC 4N85A 4X6CF 3S3JA 2D4DA 4AQEB 1NAMB 4X9GA 3IXAB 4LIQE 4IIQA 4YSEA 1PBYA 2XY2A 4LVHC 5AG8A 2EQDA 1W72H 5EN3A 5T1MB 3W1ZA 2J88H 1AG6A 4M03A 1XR9B 5H37A 3JT2A 3FTGA 5KSBB 1XB6A 2A83B 3RVUC 1L4IA 1M7XA 2M83A 1G9MC 1TQCC 1IBBA 3R1GL 4XN8A 1ADQL 3MLWL 1W72B 1L9RA 3KR3L 1YEJH 1MRCH 5I6XB 1HWHB 1Q9OB 3N9GL 1XSIA 1EAJA 4YO0B 3OAYH 4AZUA 4S1RH 4M1DL 1NGZA 4JQXA 4I77H 1PFCA 5FWQA 1ASPA 2Y72A 1JWMA 3B2PA 5T3ZE 1AC6A 1X7QA 5M7QA 2OAAA 3TCTA 4G9FA 4EIZC 2OZNA 2XN2A 1H3WM 3ULVE 1J9SA 5F0MB 4L37A 2YAPA 1OO2A 2CUHA 2VW6A 6CGTA 2IIJA 2X4UB 4LZKA 5GSVA 4PRNA 4YAQA 4M7LT 5AZUA 1AMXA 2GJ6B 3QUZA 4F7EB 5H4ZA 4JRXA 1UFGA 3D85B 2A73A 3MJ9H 7PCYA 1SQMA 4Q6IB 4KK9C 2BNUA 5E99L 3CXDH 4F8OA 5EC1B 3E6HB 2I07A 3PGDB 3MOAH 4LU5L 5EZJA 4G1EA 2HT4D 4ZOCA 1DBJL 1PNCA 1HINH 1OGAD 3V4UL 5KBKA 1J12A 1WICA 2ZXGA 3IJHA 4GSDL 3U6XA 4GW5A 2ERJB 3NESA 4LKCA 1RSFA 4H26A 4BK4A 1PQZA 3RE0A 1I3VA 3BWAB 4CC0A 2VIRA 4PR5A 1CI5A 4O2FB 5CCGE 5GQBA 5I28A 5I0WA 1DJGA 2XWTA 4NC1C 2QMKA 5CHNA 3GXNA 2QV2A 4Y5XB 3UGXA 1XF4B 2J4WL 3U48A 4N25A 4J8QA 4DP4X 1KGCE 3NJKA 1SDDB 5IV2B 2X6UA 1J18A 4K9JA 4XX1E 4JGNA 1WFIA 1KENL 4KROD 4XZUB 2GFBB 5AVUB 4ZYKA 4JUSA 1XIWB 3FU5A 4JKNA 3CCHA 2DLHA 1F41A 3OAYK 4KUZH 5I17B 4HT1L 2NY3D 2BOCA 1Y7VA 3WE6A 2FR4B 3HN5A 1E27A 3PE9A 4M7KH 2EO7A 2IG2L 2CHNA 3BT2H 3PWPA 4KBPA 4PRPA 5MHSD 5EEXA 2HFGL 3OZKA 5KOMC 4KJYB 2RFXA 4FQ1L 5GZNA 5F7UA 4HIXL 4QDGA 5INDB 4XB3A 1FG2B 1BBDH 2BSTA 3MRIB 1YEWA 3TJEH 4AW4A 2BVTA 3L4XA 3PDOA 4A7VA 1B0RA 3D3VA 3FCTB 2P5ED 1ET8A 4NS0A 3VD1A 2B9BA 3QJHA 2B2XH 3AJ7A 4AV0A 1J88A 4RGMB 4KOBA 2QFPA 1M1SA 4ZXBB 1J1PL 2NX5B 3QJUB 4ODVL 1BP3B 2AW2A 1CWVA 4LAJH 5TK4A 3DHUA 3VYPA 5DJDB 4AJ0A 2MOVA 3MV9E 3LS4L 4LCWA 1BD2A 2ZX7A 1MH5B 3GRWH 5E9DE 1Q8MA 3QZNA 4OZGB 2B4CC 5SWZE 1B9KA 1M9WA 3NUKA 3KJ4C 3MMEB 1B0GB 1A7BA 1N7MH 1K4DB 5IHLB 4JDZA 4NIKB 1NGXB 3FTWA 4WCYL 1FCGA 1HIML 3BZ5A 3WFCL 4KI5D 5DJ8A 2DBLH 2E7DA 1AXIB 2J2ZA 4JFVA 4MRBA 4JANB 3IJ7A 5JHDE 1PY9A 1TTUA 3WFHA 2APWA 3C87A 4NFBA 5JUEL 3VFNA 5I9QC 5JXAH 4EN3D 2BSRB 3WY2A 4W4OC 1HQ4B 4JCLA 1H3XA 5FOBA 4NQUA 3RX9A 1T22A 3C2AL 2NY2C 3B4NA 3FCSB 3FH5A 1BEYL 1OGSA 4OR1A 2F1EA 4P2AA 2VQ1B 3PV7A 1CFNB 5FDYA 1MFCL 1XGQB 4LSVH 4D0DA 1ZANL 2VDNH 3FFCD 1DE4B 3INUH 3SKNB 4YE0A 5DURB 3IN2A 1UA6H 5E6SB 5I8EB 5HDWA 2ZXDA 1BVOA 2EECA 3QXUA 3QZPA 3HLAB 2IAMA 4BZ1A 4WWNA 4Z3FA 2JKIS 3ILQC 4HHGA 1FFPB 1K2DB 2COVD 2JI2A 3N1FC 1X9UA 4W81A 2X9WA 2IQ9L 3UTPD 3KYKH 4IKJA 2I85A 5BRZE 1E8WA 3O2DA 5C0BA 4UT6H 4LCUB 2AQ3A 3U6RA 1I85A 3U6XS 3ELQA 2P49B 3A5VA 3MLYL 4M56A 5F7HA 5IESL 1WIPA 5C07A 2X4SB 4N1CA 1F4WL 2Y5EA 4OLEA 2F2HA 3VXUB 4BHUA 3QIUB 1EHKB 1CVSC 1W0VB 4ETYA 1U33A 3PHQA 3MI6A 2W88A 3MRKB 4E9VA 2Y69B 1ETJA 5FHAL 2Y07H 1S7QA 4K9EL 2C8NA 1Y6MR 4PV1C 4UWQB 3N41B 3AITA 5J1TC 3STLB 4XMPL 1QR1B 1QQDA 4IK7A 4O9HL 2VXQA 2Y7MA 3GWJA 4JM0A 3V55A 4LL4A 2R4SL 2X4PB 4YDMA 1FNEB 4Z7UF 1L7TL 2X4OB 1HAWA 3O3EB 1G7JA 2NCEA 4Q56A 3WL9A 1EZVY 1UJ3C 2ORBH 2VLLB 3RWJB 4DZ8A 4OZHA 2M8XA 1UGNA 2HTLD 1HNYA 1NEZB 3QNZA 3O9WD 5LWYH 4YSDA 1NDGB 3B7RL 4P5MA 4BQ9A 4FADA 3IKCA 2RJMA 5DUML 1WT5C 3Q9PA 3AWGA 3I2CL 4YDLB 1C08A 4P2RD 2WP3T 2XWXA 4WWPA 1YN7A 2GVYA 3M88A 4A2FA 2PLTA 3EYVA 3HI1A 3MNMA 5MEPB 1I3GH 1KC5L 3Q1SL 3FK3A 4PEEA 4OTXL 3VFGH 3TT3L 2YZ1A 3GMLA 1KEGH 1RI8A 4R4FH 5A2BA 1DCLA 4DVBA 3GO1L 3C09B 5D2NC 5I16B 1KLGB 1THCA 4MSWB 1HHIA 2EYRB 2YXWA 3EO0A 5JPMA 3Q2LA 4TSCH 1FPTL 3UC0H 3MLUH 3K6NA 3ZTJH 3CZSA 5L7XH 5EDXA 2H0JA 1IZJA 4HD9A 1L9QA 4V1DA 2AABH 1FFQA 1GYAA 1KCLA 3LQAH 1QASA 1YMHA 2EEBA 1F2QA 2PO6A 5CD5C 5E4EC 4H20H 4FYQA 4ZFQA 5DK2A 4C8XA 4G1MB 1KUMA 2YQGA 5E2VH 5FO8A 3NRFA 3FUNA 4XNXL 5FFOA 3FN3A 1OAXL 2GB2A 1TUPA 4GUOA 5HI4C 3P0YL 3VTAA 2F54A 1T7XA 4H1LA 2DYPB 5C1MB 5KVDL 1MRDH 1XWVA 1A6ZA 3QZMA 4CNIB 2IWKA 3HC3H 1YMME 4GAYB 3CE1A 4Y4KC 1LMIA 5DA4A 2IWGA 3F12A 3V0HA 1OV8A 3IGAA 4MHHG 5TF1L 2ZPKL 4X80L 5HHQA 2FE0A 2FJGB 3DUSA 3ZKQD 5CU9A 3GMQB 4NZUL 1Y0LA 3HA0A 2YSSA 2OMXB 5D93B 2K4AA 5KYYB 4RFOH 2G4GA 2WVUA 4HFUL 4Z3IA 2X2YA 5CJBA 2ZG1A 4FTVA 4ZOBA 3UBFA 1NBZB 4N3UA 5D2LF 4XCEA 2D3LA 3P73A 1SM3H 3CQPA 1NBCA 3HR5A 3MRHA 4HXAL 1IEBA 4JZNB 4R0LC 4X6EB 1MW0A 1CG9A 2CNYA 1EAQA 4L3ED 1SRDA 1QEXA 2NXYD 3LD8C 4KNUA 2XY1A 4APQC 4NAMA 3GBLA 4UOW1 5A3ID 3ETSA 4OV5B 3EO1B 4JFWA 4XH2A 2O61B 3L3DB 1ZMYA 1R5WB 1XH2A 4FLHA 4LDLB 1PYWB 2HMIC 2XX1A 3K1KC 2KLSA 1OCWL 4KJPD 3ML8A 4HKXA 1DQKA 3OG6B 3Q8CA 3MROB 4GKSA 5B1KA 4CMMA 1RK0B 1ODUA 2A74B 2ZTBA 3K2MC 2XWDA 4GKNB 1UADC 1HHJB 5TE4H 5AALA 1NJ9B 2FSDA 3EG9A 2ICEC 3V5DA 3VI3B 1YNLL 4HD5A 4Y7MA 1DUYB 2VM3A 4XVTH 1CD1B 1Q1JL 1NIEA 2O30A 1NUNB 1ZLSL 5EBWB 3TBSB 3O8XB 1A0QH 3JZ7A 2J56A 1JYWA 3GS4A 3RWDA 5EZOH 3DVGA 1A6WL 5T8IA 4PP2A 1LO2L 5KANI 3O0LA 2WSDA 2VDRL 3SD2A 3O4LB 4BFNA 1KTCA 1BX2A 3CLFL 2NY4B 3VXSD 5KZCD 5TGBB 2Z93A 3SE4A 4B96A 2ZX5A 5GGVL 1QLEL 3DMMD 3HRZC 5BRPA 1ED3B 5FDWB 2XWCA 3BDYH 2JKXA 3PL6B 4U6VL 3Q1EA 3I50L 1JFQH 2FX9H 3QUYC 3OHXC 4PIRF 1T0PB 2VN5A 3KEDA 3FQ4A 4AMWA 3KPSD 2AXHA 4Y16D 4PCKA 2Z65C 3NJIA 1I9IL 4DT2A 2CU9A 5F7FA 2X3BA 4UANA 3S3PA 2ODIA 3SYQA 5EUOF 5A16A 1EFXA 1ZEAH 5FYLL 3K2UH 1S7XA 3RNKA 5BV7C 2LGNA 3PLYA 4KKZA 4XN5A 5JO5A 3BO8B 1DJWA 4MXWL 5D7HA 3NEXA 5M94B 3G6AB 3MRDB 3STZA 3D4GA 4M6OH 2F5AL 5AYTA 3QQ4A 4NZTH 3BFQG 2B59B 3DRQB 3A22A 3NCJH 5FB8B 2RA1A 5HPMB 2EVJA 1JK8B 2WW8A 2X70A 1JHTA 3VWKA 5LXGH 3WXWL 1P7QB 2PYEE 4P5KA 5E70A 4R9HA 4RSYA 4UV4L 5IMOB 4LAQL 2V17L 1QFHA 1BCIA 1SXZA 4Z7WE 5B39G 1WD9A 4ODWA 1E6JL 4MMXA 4AQZA 4IKIA 5KN5B 4UT7H 1UD4A 4AMXA 1FFTB 3V6FA 1BQHB 1RKRA 3A23A 2K8QA 2BZDA 2DW5A 3RX8A 1E4WL 1M7DA 3L5XL 5CLYA 4PJ9D 3GMMA 2WXRA 2NNAA 4HIJB 4XPFH 4XNBA 1RIVL 2J88L 2PNDA 4LFHD 4PRDA 3RPIB 2F08A 2XZAL 5CWSA 5BQ7A 3GKZA 1SOKA 2GC7C 4I88A 4FG6C 3PWLB 1TMCB 2GY5A 4LSDA 4G8GD 4XMVA 1ZT4B 3K6SA 5FOJA 1DVUA 1E4HA 1MRCL 1YEJL 3DX9A 4Y9CA 4Q2ZB 2QVTA 3IDUA 2YD4A 3L3HB 5CLZA 1RJYB 4Y2DA 1PIGA 4YFEA 1EJFA 1ANUA 3BN9C 4I77L 3C60C 5T3XL 3SPIA 3C5ZA 3V6BR 4KRPD 4W6XB 5E6YA 1HSBB 2NR6C 1V05A 1B9ZA 3FFOA 1G7PA 5C0CA 4NKMA 4HFWA 1MQKL 3IXTB 2XI9A 5AVZB 2I60L 5E56A 4G8EA 3WTYA 2BXZA 2FQDA 4I0PC 3P2TA 1WWAX 4KQ3H 3EFOA 1XSOA 3OKYA 5IB2A 2DH2A 3N06B 1HHKB 2H1PH 1FYTA 5FCSH 3BEWB 4YMPA 1I4FA 2YEQA 4HF5L 5D9SA 3RKDC 3SZKC 4AYDC 1R6VA 2EDFA 2VZOA 3V0AC 3CXDL 3ZIYA 1DBAL 4C4KO 5I6KA 2OSYA 4JFFA 1NLBH 4ABUA 3VFUB 1HINL 4JRLA 3UERA 3G5YA 1DDHB 5ICUA 5TDPA 4YXHL 4QXUL 5IOKA 1XF2A 4OKDA 4NQSB 4M1GH 2NY7L 2MCPL 5DJ6A 3VD3A 4Q9CA 4FXKB 4DP5X 1DVFB 1EEZB 1QOKA 1J48A 3D9AH 5LNGA 2M2DA 1YQVH 1S46A 4GNKB 3KHQA 4PJFA 5JIPA 3LKQA 3RIFK 2JI1A 4N3TA 1KB5H 1UB5A 3OMIB 4Z95H 2IPKB 3BHBB 1QX1A 3H9SB 4K3GA 4TLSA 3KYAA 1LWJA 3PY9A 5E94A 4N6RB 1JS4A 2ZF9A 3DHPA 3F7YA 4NI6A 5CN1A 3LKOB 1WLHA 2Y6TE 3I3DA 2VDKH 3BWZA 3O2VH 2DQHL 2OMUA 3EH2A 4XXDA 3X3GH 3AC0A 3HE6A 2ZOLB 3MRFB 3MYJB 3VG0H 1AD9A 1KB5B 2EDLA 2IWFA 4XNYL 4AM0Q 3M86A 4PJEA 3QNYA 2FYYB 2WXGA 3NCBB 1CICB 3K3QA 3MTXA 4MD0A 4LLYB 2V8MA 2VXUH 1DQJB 2YPKA 3WHE1 4CVZB 1H3TA 3TFBA 2AP2A 5IY5B 4Z18A 4XVJH 3PWUA 4HDIA 4NO0B 3IFPA 4X8CA 1X6NA 3C60A 1KTLA 5LN8A 1QTSA 3HC4H 2DQIH 43CAA 3OR7B 3NEOA 2OK0H 2LU4A 1KGUA 4GRLC 2BRRH 2PR4H 2WZPA 5JQHC 4FJZA 3QEHB 1RZFH 1UCBH 5CEXB 2Q0ZX 1IBGH 1ZE3C 4AEHL 1YY9C 3DSNB 3V9EA 5GS0L 2NY0B 1JXKA 4JKPH 2R0LL 4P59H 2ICES 3HBZA 3MA7A 1D5RA 2NT0A 3QXAB 3ARQA 4LLAA 2W59A 1LEKB 4J12A 2OMWB 3WD5H 4KJWC 2CJUH 1YZZA 1T20B 1PGRB 2FNWA 4FQXC 4A2DA 2E75C 4PJDF 4OD1L 2W07B 4LLDB 4WKZB 3FT1A 3MRGA 1R3HA 2VOTA 1RZQA 5EF3A 4XBPA 3WKMH 4XRCB 4DKEL 4Y5YA 4LF3B 1N6QH 2JJTC 2LABA 1SEBA 3FQUA 1ZTXH 1M2VB 1P9MA 1HXMA 2GBTA 3QZBA 1QUPA 4Q6YA 2GSMB 4ZTOH 4NCDA 5LBSL 2B1OA 4LMQE 4N2IA 1T83C 1AHWA 1DR9A 4YIQA 4P4KC 4GAGH 1UJ3B 2PWFA 2ZKYA 3MV8D 3EBHA 4D9QE 2I9TB 4LQ1A 3T3MB 4DESA 4C58B 2O6DA 3CH1B 3L3JB 4X2UA 5GRVL 1Z3RA 5DEJA 3WMQA 4HBCH 1UVQA 5MI0B 4IKNA 1SF3A 4P8QA 5IW1A 2E7HA 1SOSA 3MA9L 4QAWA 2FWSA 2DDQH 2W60B 3RWIA 5AG9A 4GSQA 3HMWH 3RA7L 5K1JA 3OG4B 1VIWA 1LD9A 3MLSL 1YO4A 4XMLH 1IM3D 1NTDA 2BS71 1EJOL 1I82A 2R7EB 2M26A 4WEBL 1QW9A 3LZFH 5DSCA 3GSNA 4R3SA 4AGMA 1GTFA 2XSKA 4JVPA 1KBWA 3LYRA 3EYQC 3LPGA 1GMEA 4OQTH 2CJ3A 4JPVL 2NYKA 1EHAA 3FQWA 5D1QE 2VN6A 2XCMC 3U7WL 4HUVA 3DJRA 4W9KC 2R1YB 3CZKA 3FYIB 3ILDA 1FJ1B 2Q7AA 4QHNA 3WOVA 4HCRH 3U83A 1DLHA 3LIZL 4NFCA 3UG5A 2DJ4A 3ESMA 4PWHA 3JQOB 1XXDC 3NH7L 4ICWA 2BCMA 1QSEB 4HAKA 4ZFOL 5JIKA 2NY1C 5GXBB 5I75B 5SX4I 4JQVC 2HKFL 3P4NA 1RXLA 1Z2KA 1U92A 4AWJC 2FGWL 2X40A 1SUHA 1YPZA 3VGDA 3GGWA 3X3FH 2EXWC 5FYJU 1E9OA 2UWEF 2YPLA 4OCXH 4ORGB 5DRZA 2WQWA 1N18A 2ORBL 3QFJA 1N59A 4BQCA 4HIHA 3GIZH 4ECNA 2QVKA 1JV2A 4B9CA 1MFDH 2DD8H 1ONQA 3NZ8B 1P53A 4PBVC 1OF2B 3BPLC 2AGJL 4R0LB 3SJVA 3D2UD 3WKNA 4KTEH 2H32H 4N0FB 3LD8B 1UOWA 2D0FA 4JG0L 2CQVA 5DHEA 2PTTB 2O72A 4YHIA 2QMJA 1GZQB 1NEZG 4TXVB 1JJUA 4R4FL 3B7TA 5K9KB 3ARDC 5EDSA 5FYLD 3TZVC 3HHMA 3QJFB 3ATFA 2H32B 3HUJA 4A7SA 5FR3A 5GGTA 5E8EA 1R3LB 1WZAA 4JO5A 1OY3B 4ZRGA 5GHWH 2OXGA 1C1EH 2W80C 1AGCA 3DSFL 1S7UA 2FLBT 2HRPL 4ALAH 1SY6L 3EXJA 2ZWZA 3L2LA 1HYRC 1A3QA 4JK0D 5DD1L 4XNAA 5BPPA 4XP6L 2R69H 2GSGA 4LSTH 3SKMB 4PWFA 4ESKA 4HWZB 4XZ4A 3MFFB 4QRTB 3S4SB 1CDJA 3DK2A 5E2VL 1RP8A 1FVEB 2BSED 2PPEA 3S34H 1F4YH 3GK8H 3K8KA 4GJTB 1UD3A 3I6GB 3FONA 3VRLE 3WJJA 5LAXB 4AGLA 1Y18A 4QRBA 3F7QA 3QT2A 2P1YA 2PP8A 2Z31B 3H85A 4IBSA 1EGJA 5D1XA 2CBPA 3ZDWA 5G2NA 1DQDH 1TZHB 1Z5LB 2P5WB 1EJ8A 3F7KA 4YE4L 5IG7B 1ADWA 1KCRH 4XBGA 2GPZA 1FE8H 1CFSA 1G7QB 1XAKA 3OHXB 4TSBH 5DO2D 4LCVA 1CIDA 5BV7H 1T0MB 3O81A 1ZJAA 4K8RH 1F6AA 1QBML 2JTDA 3RNQB 3LNFA 2DQDL 1XHHA 2WTRA 3RVXD 2EAEA 1QWHA 5F8RC 1SM3L 2ARJA 4H0HB 1IC5L 3F7VA 2HUEA 3QC6X 5EN2A 4OZFA 5DD6B 3G04A 3OX8B 1A6AB 4N2CA 1SBSH 3CVHH 3QCUL 3WFBH 2VZTA 2V2TA 1W16A 2VDQH 1E2WA 4JFTA 4A2EA 3O6FC 4H2AA 1HZHH 4UOW0 2KLTA 3WLBB 2GIMA 5IQ7L 2KUTA 2GY7B 5K1NA 5KS9B 5T3XD 2VWEC 4DKAA 3ZKXC 3LX9A 1JPSL 2DWEA 1JI1A 5BXFB 1XEDA 4AQ1B 2VDQB 4N0UE 4E9LA 3MCKA 4P3CL 1BFVH 1K3IA 3ENEA 5D6CB 1INQB 5TQ0L 4NKDA 1MXDA 3RBGA 4WUKH 5FEBA 3X1BA 4AENA 1WHOA 4BH8A 5CM1A 5IFAH 3FQTB 3MLRL 3SGEI 3MRMB 4H8PA 1A0QL 4NNPH 3D39D 1MAKA 1H3PL 5EZOL 1AZBA 1MFMA 3MV7A 2CRZA 3SYOA 5JLZA 1CXIA 1G9ML 1DVQA 5I5JA 1KXTA 2C5DC 1CFVH 5LGKA 1L3WA 4K23L 4UOZA 3CSTA 3GS7A 2VW7A 3PAUA 2CO2A 2F53E 4PLKC 4D9LH 4Z7NE 1BXXA 5ELIA 4DTGH 2XN9A 5K59F 4PJ5A 4GPVA 2FQGA 4UMGA 3LZOA 3INOA 4PFEA 4X4YA 4AVJA 1OWRM 4K73A 3LEVL 1B4JH 5G55A 1CJYA 4HLZH 4A6YH 3GEWB 5C0NC 5EEZA 1F3RB 4K71C 3BXNB 4XO9A 1LEGA 3HNSL 2X28A 4LHUA 4MCZA 4OCRL 1PDKB 4G6AD 3S0PA 4XP5H 2EDNA 4DF9A 4A6YB 4Q9BA 2GKIA 4KXZI 2E56A 3QCTL 3QNXA 3VI4F 4XOCA 4KKPA 4LK4A 2WXQA 4I7ZC 1WF5A 1J0ZA 1MI5D 1KLFB 4QYOB 4HK3N 3CFJA 1JAEA 3P2BA 2LU5A 3JUYA 4A7QA 1DLFH 3IPFA 1DQLH 3OAWA 4FFYA 5JNYA 4Z5RB 5ICYA 1TO4A 3IJEA 3QO1B 5F7EH 5A7EA 1FDLL 1J0HA 1INEH 4N90D 1AIFA 2MCAA 3K71B 4V33A 1EQWA 3OKOA 2H6OA 3D0VA 4UT9A 1I1FA 4FQIL 1P5UB 3P2DA 4IOSD 1LM8V 5I1HL 3IMTA 5LAPA 1L0QA 5IBLD 3WIFA 3SGKA 5GS0D 2FATL 1DJYA 5TPWL 3Q8FA 5I19H 3PWNA 3FT0A 2GUOA 4G8FA 7CGTA 3DXAB 4YNYA 1N2RA 1HOCB 4XPFL 4PJCA 4RFEB 3R7QA 4PYGA 4Z7VA 5ICZA 3HZKA 4UQ3B 1OP5H 2W38A 1KFAL 1BQHG 4I2XB 3FU7A 5DJAB 1BQLH 2XWBA 4FLSA 5EU6E 5HI5D 2F8IA 4PG9B 4RCAA 4MJIB 4A37A 1LO0H 4PJIF 1A6UL 1LK2B 1D6VH 2DQCH 3EAKA 1FORH 5M95B 4NQXA 1S6NA 4PMFA 3T1FB 3RURA 3IDNB 5J3HC 2DAVA 4M02A 4DGVL 5ADOL 2C7FA 4S11A 2A6KA 4JY4A 1TR7A 5CBAB 3RWFB 2BJMH 4J3OF 3WV0A 5DVMA 4Y4HA 1KXVC 1UYWH 4C83A 4F80A 4KHXL 4FQLH 1QRNA 3EHBD 4PVNA 1NICA 3OKEA 1GZHA 3WIAA 3EYSL 3FS9A 4J7RA 8FABA 3FSAA 1MW2A 4ISVA 4WJG3 4XWOD 3IMUA 4GRLB 2B7DT 1CZ8L 1M9SA 3QDJE 2WVTA 4DP1X 3KS0H 4WW2A 2DQMA 2VXQL 1S3KL 3M45A 4XWGH 4K5LA 2ZWLT 1RZIA 4YL4A 5CU5A 2ATPB 4B9FA 1MG3C 1JNNL 2B4CL 5SWQA 1CGSL 2Z7WA 5FLVA 5DWPA 3MRBA 4KMTL 1CLCA 5BUAA 3Q6FB 4M4RA 2AQ2A 1JOIA 2Y5TA 2KQNA 3QRGL 3ZT6A 2UY7B 2NYYC 2YAQA 3WNOA 1JSYA 4A66A 4HIPA 2EP6A 4OCSL 4U3CA 1MIMH 2F8XC 1U8LA 3QI9A 2R0ZH 3TPUB 2L04A 1B0WA 3LRKA 4OF8A 4ELMA 4Z7OE 2UV3A 5FHBL 5HHOD 3Q8AA 2X12A 3T3PE 2ZCZA 3HG1A 5L8JB 4QF1A 3ARGC 2Z3FA 3BLBA 2J43A 1NOFA 3D18A 3EGDA 4NZ8A 5KYXB 1YRKA 3OF6D 1WZKA 3GTVA 4HKBB 4LPTA 3AVEA 4NT6A 4JN1H 2Y3AA 5CMAA 2GYSA 4NKOB 4JFHE 2JXMA 1AY1L 4WFEE 3L3GB 4YDJB 4DUVA 3K80A 5KBMA 3BAXA 3QZWB 4MS6A 1JD7A 4QLRA 2CUAA 5JA9A 1OTSD 2XIDA 4WI3A 2CGZA 1I7UB 2OMVB 3NACL 2ZP8A 4GQZA 4WNJA 4UQ2A 4X8JB 4CRPA 3B1UA 4ZS6C 4P9HL 3PV6B 3RTQC 4DPRA 3WHE0 1T4KB 3MX0B 1BQSA 4OLXL 4QTIH 3AQDA 1FO0H 2DQIL 4JO2H 3KPQA 4WO4A 5FW8A 5INCA 1MVUA 2H0FA 3ARVA 3BIBX 1CDHA 1RZFL 5KW9H 5DTFB 1CMOA 1F8TL 2YPVH 1EFQA 1PLCA 5ENWA 3JTSB 2ICWI 3SPJA 2Q8AH 5FUOH 3DK0A 2NY6C 1J7VR 5EO9B 1MLCB 3APCA 2UYLB 5F96H 3UXFA 2AK1H 1XH1A 4GKLA 1WBZB 5F7BA 3P54A 2YRLA 5C0EA 2F61A 3OKNB 3DJSA 3ZPDA 1E42A 5GIRB 2QSTA 4OLYL 1JNJA 1FN4A 1EZLA 2GIXA 3QPQD 5FO7A 5I5IA 1I1RA 3UGEA 2W0LA 2XXMB 1VFBB 5D7LD 2EIZB 3K1DA 2W9DH 4NPKA 2XICA 1WSST 3LMJH 5J12C 4EI5B 4OT1H 1FUNA 3K6IA 4H8WH 3ZBMA 4FZ8H 1OT1A 1UTDA 1D5XB 2JCCF 4XN1A 3L9EA 5SV4A 4F57L 3LEXA 5T33L 1AR1D 3T4AC 1RUAH 3QUXC 1UXSA 5CSZB 4GAFB 4RH4A 3UCQA 3RJDA 3ZYOA 2J25A 2TAAA 3TX4A 4M7ZC 3ARGA 1BJ1J 2CR3A 3LV3A 2Q3AA 2WKGA 1L6PA 1S7TB 3ISWA 4HBCL 2XJLA 1J9TA 4DIXA 1M7UA 1TENA 2CXGA 2OJEB 4ZS7L 3WEAA 4QWWC 4JRXD 1GCYA 2QVFB 3GF8A 1R0AH 4P46C 5E8PA 1NCCH 4PRHB 4HIEB 4MDIB 1HKFA 3WDIA 1CL7L 2BIOA 3CZNA 2YHGA 4PCTA 3AM8C 2GJZB 3RUGB 4TSAL 5LXVA 3CZJA 4Z7UB 3TJPA 2G9HB 4JB9L 1BFTA 1BM3L 3GJFK 1CD8A 5IFHH 4RQQB 4HS8H 4TNFA 4XE5B 5HTSA 1JP5A 1FNGB 3T6VA 5E00A 2DQTH 3RU8L 4LLQA 3WAKA 2PW1B 3MRRB 4B9GA 1QTPA 1AR2A 5I66A 1LHZA 2DJMA 2W8CA 4PJXB 1NBYA 1MJJB 1NCDL 3CBKB 1P4LB 1J8HA 5DI8A 3HBGA 1S9YA 3BP5B 4CL7A 2DBJA 3AXLA 2GK0A 4YHOL 4XN7A 3JTTB 4ZMWA 2IV8A 5EORL 1OSPH 2KYIA 3KM2A 1EXHA 4W9ZA 3TJHC 1EEYA 4MNGE 1VRSA 2X42A 2Z92B 1LILA 4NB7A 4QRUA 1U8JA 5CKGA 1E28A 4Q89A 5D6DA 1HL9A 1R19A 4NZDA 4TUKL 4OH2A 4HWEL 4WVRA 3ATBA 5I74C 5LGHL 3KWVA 2UY6A 2X4NB 3CLEL 3RVUD 3HNVH 4NX0A 4MJ5B 1FGVH 3PWPD 4NQCB 5HJ3A 2WLLA 5FYKU 4KZDL 3BPOB 2ZUQB 4WHYG 3P30H 3V0VB 3T0AA 4RISL 2BIHA 3HS0B 2OBGA 4WW1A 1JPTH 5D7SL 3EFFA 5CJQH 3SE6A 2XDHA 4AC2A 3GMPA 5HJBA 5IVOA 4OLVH 4KTEL 2QTVA 4JL1A 4JFDB 1KB9J 5HVHC 2AKRB 4JKMA 4G80A 2F74A 2ZCLH 3D3VD 3EYFA 4NRXB 5KVFH 2WZ5A 5LG6A 1UH3A 1F2XK 2FBJL 4DSYA 1RIUL 3KLAB 4ZODA 5IB1B 3RIAF 1BZ7A 1ZT1B 1B4TA 2EE6A 3AQYA 3ARSA 3II2A 5KSUA 3RGHA 5BS0D 5I23A 5HHMD 4FP8H 1OAQH 2LW3A 1AO7D 3RVVC 4CADA 1E5ZA 3CHPA 1WFTA 3NCYP 4PD4J 1F58H 3TT1H 3BEVA 1S7WB 3MRLA 1XH3A 5BO0D 4MTMA 4J8RB 4QMEA 3OZLA 1WQVT 3TBVA 4LCWD 3V0IA 4P46A 4HGWB 4BYHA 4DCQA 1E9QA 3F5WA 2E9BA 5C7XL 3S36H 4LSTL 5EIIB 1J86A 4MWFB 3RB5A 4HEME 3WU1A 1M2OA 5AWNH 3VXQB 5JHMA 3CAFA 4XB7A 1KPUA 5EO1B 4QRPD 5A2FA 5D2LB 3PDDA 1MY5A 1XSJA 4TNVK 3VAEA 2EYTA 2Z91A 2NSMA 3I74A 5CR8A 1KZQA 5FGBC 4ZFFA 3D69A 4FQCH 2VUKA 4KVNL 4XP4H 5HDBE 4JFPB 2BOBA 4LSUL 2YD8A 4R4BA 1JL8A 3OVUB 4FNLH 5DVLA 3ZE0E 3KLSA 4LPXA 4O02B 3EYOA 4YGVA 2D8KA 3UTQB 3S4SG 3ZE1B 2WLIA 1LDPH 1WYJA 2MTPA 2VUYA 4XC3H 3SPCA 1G7HA 5IJVA 3C5JB 4L18A 4PJGE 5DU7A 3R19A 4HHAB 2AV1B 1CLYH 1Z1WA 3CV5A 1BBJB 2CO1A 2XRAL 1OM3H 3DPBB 2RB8A 5BV7L 5JPNA 2XZQL 2Q5BA 5ANME 5EU4B 1YEHH 1QPPA 5LNEA 2VDLL 3P9WB 5E2TH 1XMEB 3LVEA 3BH4A 4K71B 4HLEA 2EDJA 2YD7A 3R8BB 2BSBA 1D6EA 5DJYB 2CCLA 2XBTA 2PXYA 5F21B 3S3DB 4G7VH 3TFKC 1R46A 2QHRL 1SBSL 4HMEA 2Z8RA 4AI7A 4JFQB 4JGUA 4IS6A 5JR1L 5C0BD 2BH0A 1ZVYA 5E9DA 3GIVA 5C9JB 5FECA 1G7IB 3SY6A 4S1QH 2EXSA 2VITA 4R26L 1D9KC 4GBXC 2IANB 1E5BA 3I6KA 4MA3A 3H6AA 5B8CC 1PZDA 2ITCA 3JWOL 1MW3A 5DWUH 2AXFB 3IPBA 4TS6A 5IQMA 1ILSA 4TRPL 3CFDA 1OAUH 5JQ6H 3B2XA 4ZTEA 3BISA 5E6IC 4WJ5B 5HYJB 1B3JA 4U1MA 4WUKL 5EBLA 3BZ4A 1R3JA 1QG3A 3VCLA 3UTZA 2I7SA 4Z3JA 5IFAL 4DP9X 3BKCH 3L16A 1QLRB 4M62L 3W9EA 3F7LA 4KVPA 1T2XA 1SLVA 4P2OA 5EUOB 4F7PA 3ROOA 1DQQB 4O58L 1JUFB 1AXSA 3M7OA 4ZPTB 4LMQI 2ZSWB 3K5SA 3MGOA 2BNQA 3E6FA 2HTKC 2H1LM 4GQ9H 5D96C 3T0EE 2OTUA 3ZRFC 5C0JB 5IMLB 2CWRA 4OZIA 4FMKA 4FYTA 3ZDYF 4RGOH 1DBMH 1NZRA 2DTSA 4B9YA 1BYNA 1ETZB 4Z76B 4Y9FA 1LP9F 4NQQA 3FN0H 1NKOA 3LN5B 3CDGB 1IT9L 2X09A 4NQED 4NJAL 3AACA 4AIZA 1KJ2A 5CEZH 4O4YH 5BO1L 2VLKB 1JWUB 3CTTA 5BRZA 3WEXA 4JRYA 2NDFA 4AJVA 2WBJA 3D30A 1A47A 3WS3A 3K7UA 2NY2D 2C7UB 3C6LA 3W2DH 2CGRL 3K5RA 3H2PA 4I18C 2EH8H 5MP6L 3GMOA 4I3SL 2PW2A 1ZHBB 1SLXA 1U91B 1J05B 3UIYA 3D25A 2VJXA 4YSTA 3AROA 2BSSB 1T5XA 3SDCC 4R97B 4GXFA 3DGGA 4P2QA 3ILQD 3F6JA 4IOFC 4V1DD 3U82B 3WIHH 1C8PA 4YXKH 3OJDB 1DSFL 4LL9A 3W57A 1FIEA 2AJSH 4ODBD 4HLZG 4QXTB 1M7IA 3BVWA 4N2OA 1VFAB 2OSXA 1U3HC 4KDVA 1IAIH 5EOQL 1VCBC 3SDDA 2VABB 1OL0A 2WINB 4NJ9L 1BFOB 2F0CA 2WAHA 2MH4A 3A6OA 3QHTC 1ROCA 1TKWA 1HS6A 3OKKA 4U6XA 5E0QA 2YGVA 2EEFA 4BXVA 1NFDA 3I6LE 4Z7NF 2CALA 4ONGL 3VE0B 5AB2A 3HI5H 4FQQA 2CRYA 4QHPA 4BK8A 1EVTC 3VFTB 3NFPB 5KBPA 1FCCA 1QR4A 5CBEB 2XTJE 4A7GF 4PS3A 2B5IB 4LIQH 2ESVB 5GJTH 1PZ5A 4HJGA 4RSVA 2Q6WB 3VW3H 4UQ9A 4I9XA 2VCOA 4M9OA 1G1KA 3HR6A 4GQRA 1GKEA 4JY5H 4EBQH 3GSNL 4CW1A 2GK2A 4YHLL 3CSPA 3GKWL 1TZGH 4LL1A 4QTFA 1PZAA 4ZAKC 3IFLL 1UT9A 1JGEB 5MENB 5MERA 1J0KA 2OLDA 4OGXL 4YHPA 3F2LA 3BMVA 3DIDA 3TN0C 4XTRC 3L1OL 1LTXA 5DQJB 1IGIH 5FA3B 4OSUH 2DY2A 3BP7A 4X8GA 3QQ9D 3S37X 1AJ7H 5AFAA 2QSQA 1ZV2A 2WXPA 4BCXA 5IVXF 3DX7A 3V4VA 1MQ8A 1A1NB 4B5EA 2NY6B 3TPKA 4LSPL 5AD0A 3IGKA 2C3VA 4K0OA 3JBG7 4HKJB 3VQLA 3M07A 2WSPA 4C4KT 4ZQTA 5CD5D 4NFDA 3ZTCC 2AEQH 4XPBH 4HIQA 3QYMA 4BWWA 3FN9A 5C70A 2HAZA 5D5ME 1H5BA 1A4KB 1KB9K 1TTAA 4F8NA 1K6QL 5CFHA 2R0ZL 4XVUD 1HCVA 4HSQA 4J3OC 5DEGA 3WBDA 5HDRA 3CIQA 1AGEA 5CCKH 3CDZA 4NZFA 4S1DD 5F3BA 1HDMA 4G6KL 2MNUA 1TOXA 2HJLA 4Y4KD 4XN9A 5C0RL 1C7TA 1PZ3A 4PD4K 4B7IA 2I5YL 1PIFA 3NZHL 1C12B 4GS7C 1XD1A 4X4KA 4YK4B 1EFXD 1KLUA 3T4AB 4JFEB 3QUXB 4PGZA 5IKCA 3BZDA 4PJ8C 2XA8H 1NWOA 3TASA 4OLUH 2NZ9C 3EKCA 2J73A 1GC1C 4WGWB 3QIWA 3QXWA 1ZXQA 1RZ8B 3OKMA 4P57A 2A9BA 5AYUH 1X4YA 2CKBA 1LNUB 3B3IA 4Y1AA 4F15C 5AENA 5GGSB 4Y7OC 2GW5A 5GRVK 5HBBA 1D5BA 1M05B 4H25B 5DRXA 4PJDB 4XCNA 3VWKD 4APQD 3VM5A 2GT9A 4UDUA 3SBWC 2ENJA 3CPLB 3QZWG 1NC4A 1T6WA 4WWKC 1OVZA 3LHPH 4E0RB 2HMID 4WI5A 1TVBA 3B7YA 5F9WB 5I1JL 4KTDL 2IQAB 1G9NH 1PY0A 5CKAA 4G6FB 1EGJL 3RP1A 1A7RH 3V6ZB 3Q2NA 1M1XB 1N0LB 1QFOA 1KJMA 3PP4L 4HSAC 2APVA 2VLME 3S35X 4PSPA 1ZLWH 5D70L 3IU4H 4OM0H 5CF3A 5E0FA 2G5BB 1Q9WA 4Z7OF 1IGTA 3HNTL 1NUDA 5E9NA 1IE4A 4BINA 1WBXB 3LKSB 5DRNA 2OI9B 4HPYL 4Z3HA 3T3PF 1BZQK 3FB6A 5FV1L 3FTGB 4KU1A 4IM8A 1RZKL 4OJFH 3V8CA 1A7PL 4LP8A 3VXRE 4QRQA 1ZLUH 4LPCA 5I1EH 1AQKL 3COOA 1YNKL 3Q2VA 4Y2DD 5DUPL 3TV3L 3U4EA 5I74B 3AQZA 2HRLA 4JN2B 2QPSA 1JPST 3RY6A 3WLWD 4EE2A 3P1VA 3QUYD 3IETA 3DBXA 1TEFA 3T1WA 1BZ8A 2LFGA 2JKJA 3ZDZE 4JO1H 3VXTA 3NAAL 4Q9RL 4D0BB 1KBPA 3OQ3B 4G9FB 1I9RL 4FMFA 4OF7A 3SGEH 4L37B 1N0XL 5D7IA 3BWSA 4WU7A 4WF7A 4QOKE 4HJUA 4P07A 5HVHB 1K4CA 2G0LA 1IC1A 4L9DA 3NCEB 3QUZB 1UM4H 1L7IL 4OW6A 1HL8A 1X9RA 3TWCL 3DX8B 3LNHA 1I8KA 1S5IL 2A73B 3MBEC 4FF9A 1CGXA 3LB6C 5F1NA 2Q8BL 3QC5X 2P26A 5AVYB 4L8CA 1Z0MA 5AZ2H 3IK2A 4DW2H 1XBRA 4JFFD 3H53A 1A3LH 4E41D 2UWEB 3S97C 1GGCL 4F58H 4PGJA 3VX0A 4BH7B 2J7LA 1CVRA 3D2TA 1ZGLA 1INDH 2BNRB 1PQZB 3MFGB 4N8VB 3SN6N 2VL4A 4AMKH 3ASWA 4NLHA 2VIRB 4PR5B 3KAAA 2BVQB 3FQRA 2XWTB 4FNSA 1CF8H 5CHNB 5L88L 4FLQA 3HG5A 4R84A 2J57A 4IBZA 2WUCL 3KPMB 4MQXC 4WFGD 1T21B 4YPGB 1XSKA 4X99A 2EVHA 2V5TA 4HUUA 1KN2H 3RGBA 2RR3A 4PJ7E 4ODTH 5D4QA 3MODH 1ZLUK 4B5ZA 5IEHA 4MMZC 3FUDA 5ICXB 2GTWA 3MJ7B 5J6HA 1NOLA 4OB5H 1F45A 5CIPA 5F89B 2A9NL 2ZICA 4U3SA 3S3BB 4E68A 4J2XA 3GINA 1KBGL 4N2LA 1E27B 2EC9U 5F1OB 4PRPB 4HIIA 2RFXB 4FFYL 3KYOA 1IVLA 2WMPB 2MCMA 3UBXI 1YJDC 4LGRB 1NMBH 1O6SA 1VPOH 3MXVL 4UYPA 3ML9A 3BN9D 1ZLVK 1TITA 2YUZA 3C60D 4Z3EA 4BFIA 2E4FA 3MUZ1 2BSTB 2JQZA 3CQQA 1JN6A 4WY7L 4L5FL 2WZPD 4G72B 1UWEH 4UT9L 4F9LA 2Y06H 1NUGA 3E8UL 2YK1L 1B0RB 3B9AA 2D7NA 2OX5A 1YSOA 3L6FB 4DGIH 3QJHB 1DBBL 4I0PD 5FKPA 3DIVA 5KSAC 4FP8L 1OAQL 2YKLL 2EDTA 4TVUA 4JGMA 3HZ3A 3GRGA 4JM2A 1EPFA 2CMRL 3ARPA 1BD2B 1JRHI 1WUZA 3FUKA 1AFVL 3RKDD 3OAUH 2CIIA 5JOPE 1QYGH 3JXAA 3Q0HA 4HH9A 4XPTL 5L9DL 1IQWH 2C4FU 4F7TA 5L4IA 3BAIA 1MREH 1WZ1L 4XCYA 3UTSE 4OGAC 1J10A 1AZRA 2J2ZB 3P69A 5D1ZI 5LLIC 5D96B 1X7TA 3WDJA 3SE9H 5I30H 2CO6A 3RI5K 4Q8BA 4AT6B 3TF7C 3VFNB 4B7LA 4C56E 1GH7A 5E2WL 2PYFA 4D0CA 4EAEA 4HOZA 5EIIG 3NJMA 5E4OA 4FL4C 3FF7A 1KDJA 1QHQA 3BX7C 2FO1A 3APMA 2KZKA 3TIDA 1RK7A 4AG4H 3KWUA 2R2HA 5HD8D 3WNPA 3M46A 4U1NA 1T22B 1X9QA 4LCCB 1MCPH 4CU8A 2G5UA 5D1QC 3VFSA 4ZK8A 4PCSA 4D0DB 4AYBA 3AXIA 2D2CC 4LLUA 1G84A 2OTWA 4U6HA 1MHPL 4L8SC 2PTUA 5IQOA 5H4YA 1SYVB 3KYMB 1IV8A 3FRUB 3QDGA 4UBDC 1TZAA 4NDMB 3VXMD 1Q0YL 4I18B 1TFHA 2IAMB 2VE6B 4AYEC 4LCIL 3GUTB 2ZG2A 4GINA 1AXTL 1IFGA 1MNUH 2E76C 2X38A 4KO5A 2D4FA 4DN3H 4ZMOA 4JM4H 2MFNA 5FCUL 3T9WA 3RWGB 5KSBE 3SDCB 4ZUWA 4AL8C 2Y2WA 2N1KA 3H0TA 4X6DF 5JW4R 4E5XA 4QRRB 4OD3H 5C07B 3ECBA 3REWA 2WVVB 3EZJB 4OUUA 3ZTNH 3BVXA 2WNXA 4U7MA 4NYLA 3PHQB 1U3HB 4ONOA 5LBVA 3H42L 1OTTD 4X6FA 1CXHA 4EIUA 5DO8A 1S7QB 4KHTL 5I1LA 1E7VA 5HDBF 1QKZH 1Z3GL 2FHFA 3BKCL 2CDFA 5E4IA 3PJNA 1J9QA 3JYBA 3ZE0F 1FQ9C 4KJWD 3STBA 3QIBC 5JW3L 1VZIA 1Q72H 4FQXD 4UV7L 3V4PA 5A43C 2VL5B 4OJYA 2GJ6E 1IGCL 2BY0A 3KWXA 3LS5L 4EZMA 4BJLA 4N6QA 4Y5VA 2D03H 4JAMA 3WCYA 4QAMB 3VI4B 2YEVB 4DZ8B 1GHFL 2ARWA 4IU2B 3FN0L 4OZHB 5CD3B 2WGXA 4KZEH 4OI9A 4JR9L 4XOBA 1C5CH 5F9JB 4OGZA 2K70A 4PY7A 5CEZL 1KGJA 1MRFH 3CK0H 1FL6A 1P4BL 1C08B 3MKGA 4WWID 1RULH 3ZY7A 4P4KD 4E9YA 4BZ2L 1UA3A 4BQ8A 4R5TA 3EYVB 1WBYA 2G0KA 3ATDA 3HI1B 4S1SH 3VQ1C 4IMKC 1OAKH 1YEFL 4FX5A 3GMLB 3NABL 3F64A 2IEPA 4ZAKB 5D71L 3PGFH 4U0RB 4N9GA 2WYTA 2XTSA 5JPMB 3TN0B 2A9MH 4CVWA 1HEJC 5DZAA 4MXVE 4RIRA 1RUQL 3LRLA 4NUJB 1WA2X 1B2WL 4PB9L 4ZMTA 1KPVA 5ID1A 1I1AA 4PV9A 1XAUA 2CK0L 1GW6A 3QHZH 2XQBH 4AKQA 3BAEH 5EU7E 1A02N 3TA3A 4KH9A 2OCFD 2PO6B 3ZTDC 4ELDA 5T1DL 1V27A 3FB8A 3IDYB 5FO8B 1FSKC 4FG0A 3B2VH 2XZZA 1JGVH 1AKJD 1UT2A 3EYQD 4PJIB 1GYWA 4JHWL 5AZEL 2F54B 4GG6F 4H1LB 4DN4L 3LXAA 1WWCA 1A6ZB 2E9JA 2JIXD 3IF1A 4Z0BH 4BFKA 5C6PB 2VZ3A 3G5ZB 5KVEL 4YDIH 3ZX1A 3QEUA 2M1KA 1C8QA 4UIMA 1AHKA 4Q14A 1ROWA 1BPLB 2NY1D 5HHQB 5E1HB 1FBIH 2UXVA 3SCMC 2EXYC 1G7LA 2FHCA 3J27A 5F70A 5HYSB 1EERB 4OF0A 3P4OB 4G43B 2NX5E 4A2GA 4ODSL 4F1ZA 1FL5A 2EXWD 4FTVB 4IRSA 2A6JA 1SYSA 2F7PA 1JV5A 2VDOH 3P73B 2OR9H 3KPNA 4GS7B 1XGPA 4RVBA 4XCEB 1X44A 3HR5B 2GCYA 4KKNA 1IEBB 5C6TL 1CG9B 4OZGE 3VD9A 2HPTA 3ESVF 2VXSL 4Y89A 3OJVC 4N2FA 3L9RA 5K9QG 2VDOB 3QJRB 4XH2B 4ANKA 3ATEA 3CZFA 3QWOB 4Y1TA 4J5VA 2JQMA 5B7FA 3GMNA 1NGPH 1FV1A 2DLIA 2EYSB 3O6MH 3LKNA 1MOEA 4GMSL 1LWRA 4RAUA 2VC2L 3T65A 2XV6B 5CJXA 4NN6C 4GKSB 1LE5A 4WWKB 1KIQA 5DMYA 1WVZA 1X4ZA 3ARDD 4JG1L 4HZLB 3NGBB 4HEPG 4HX1B 3TZVD 5T3ZL 4RAHA 3CZGA 4RNRA 3V0WH 3C9NA 2XT1B 5IT2L 3EG9B 1VCAA 3ULVL 4OFYA 2LLNA 2XVGA 1KN4H 1RZGA 2HKHL 1S2EA 3WS6C 4X0NA 3RWDB 1PAZA 1WAAE 1N68A 4D8PB 4W9EC 1O6TA 3GHBL 4O2EB 1UOLA 4KUCD 1RFDH 1UD8A 3BPCA 3GMRA 3KXFD 3QR1A 2Z93B 3FAXA 2AQRA 4LEXL 4JQIA 2L7JA 1DJZA 3IEAA 1MN4A 2ICCA 2ZAIA 2XIIA 3MNWA 3DA0A 3FU0A 5E2JA 1FLTX 4N0YL 4KO6A 5ESQA 3HZMA 3LHAA 4EIBA 3U4AA 4NUPA 1OCZB 3VXUE 1OK8A 1A1OA 3KWWB 1OOWA 3P4MA 4NUQA 3QPKA 2F9BT 3ZDXF 4F7MA 4TULH 1UWXK 3MR9A 4RBPH 4LHUD 5A16B 4KK6D 1XD0A 2J8UF 2UZXA 5D7JC 1CD9B 3MRQB 1ACYH 4MB1A 3QISA 1A3RL 2DQEL 3EDJA 4N0UA 3ES6B 4LSQL 4OLUL 3O6KL 1E0OB 3BQUC 3EIFA 1JNLL 2MOQA 3AWEA 1C16A 1YLBB 1T04B 4YDVA 4Z7QF 1QBAA 4ETQB 4X7TB 3PYCA 4MMYA 1E67A 1YQ2A 4L48A 2P28B 3CFTA 1UA7A 1THAA 4EDXB 3NIFB 1JHTB 3MLXH 3O6FD 3TP4A 2QJDA 4P5KB 1UH4A 5I26A 1WA0X 3OZ9H 1MJ8H 1EK3A 5GSRA 4ODWB 1NMAH 4RETB 2JE8A 4MMXB 1RPQA 5GRJH 2JCCB 3EJZC 2F53A 1A7NH 3HB3B 4P5TC 4X4XA 1S9KC 2BWQA 2AJUH 2GBAA 3V6FB 4JHZA 1KB3A 1I9JH 1N10A 3KPRB 3QQDB 1HE8A 1DVTA 1DVXA 4UZGA 4F5CE 2ZXEB 3NBNA 1Q94A 4YL9A 3QEQB 1E5YA 3QORA 1JF5A 4ZOAA 2WCGA 1PPIA 2NNAB 1D5ZA 3QH3A 5I73B 3S37H 4XXCC 5JHLA 2W91A 1MHEB 2BP0B 2ILLA 4TVSa 2PPCA 2RCSH 5LN4A 4XHJC 4OLWL 3WIIL 3RVWC 2ZE0A 5CWSB 2AF2A 5BQ7B 3BJLA 4DUXA 5ISZA 4ICXA 5JOEA 12E8H 3DROA 3GB7A 3ESUF 3BSZA 3VSTA 3K6SB 1TNMA 3DX9B 3SOBH 2YN3A 4A7TA 5I1EL 3GZKA 4PLKD 3Q8EA 4MKMA 4MMZB 4F8PA 1YJDH 3UPCA 1HNGA 1QEWA 3MNVA 4WKXA 3U9WA 3LNIA 1UZ8B 2JB6A 4HS6B 1OE1A 4RBPK 4UM9A 3C5ZB 2ZCHL 3QFDB 1BGXL 4QNPE 2ZKHH 3F7PC 4O00A 1G7PB 1WWWX 4Y4HD 3KJ6L 5C0CB 5K39A 5C0ND 2H0PA 5J6GA 5CILL 1QRND 3S96A 4TMPA 4QD2E 3PRZA 1I31A 2P8LB 3H4HA 5E8NA 1DYZA 2DTMH 4TKWA 1U3NA 3EFOB 5IB2B 1AOHA 1F86A 5ES4B 2FSEA 1TTCA 3O41A 2PP7A 3ZGIA 1FYTB 3T2NL 4DOHB 2K4WA 4PAZA 3LQZB 1I4FB 1RPUA 5D9SB 1IM9A 4PYHA 4H4NA 2DYSB 2JK5A 4KXDA 2AHIA 2NXZB 3ZKMC 1FHGA 3W0WA 2UX7A 2JVUA 3LXCA 4YHKL 3X14A 2EO1A 4J1UA 1FAIL 3CMOL 3G5YB 3O4OC 2OV0A 2HPOA 3S5LB 3QI9D 1YCSA 4Q9QH 4AMKL 4RRPG 4L8BA 3GXUB 4YDNA 1P7HL 1V3KA 3N1PC 3RFZC 1P1VA 4PBXA 3HG1D 1CF8L 3CPUA 5TE7L 1FF5A 3ZL4H 5FYJH 1LO3L 5K9JH 4Z78A 4M5SA 4HG4J 3LKQB 3S35H 4N8VG 3JWDH 3TVMC 3WFDL 1C5DA 4M6ML 1UACL 4XXCA 2PPFA 3F7YB 4B9KC 4LSSH 1FZOB 1XCTA 3UBXA 2JWYA 4XXDB 5J06A 3VI3E 3HE6B 3QDJA 3E80A 3QDMD 4GRWF 4MBRA 4PTTA 1DVSA 1NGQH 4IKKA 4C47A 1HCZA 1OGTA 4Z3TA 5I8KH 5ILTH 3QNYB 1PKOA 3IDXH 4MD0B 4PH8A 2R2BA 3UFIA 2YPKB 1J5OH 1HHGA 1OW0C 3O4LE 1IBYA 2F19H 3PWUB 4HDIB 2FZ3A 4TUUA 4WUUB 3ZO0A 2X44D 4K7FB 3SGDH 5CEZD 1KTLB 43CAB 1HXKA 1P7BA 3V79C 3VGAC 2OJZH 2XQYA 4FE9A 1V3MA 4RAVA 3RG1C 5FX3A 1A5FH 5B4MC 1SXBA 4PREA 3B2UC 1NCWH 5CGTA 1U8CB 3F62A 5J9PB 4KNTA 4EDWH 3Q6GL 1YUHB 1NGWA 1QAWA 1KCUL 2QQNL 2XJKA 1BA9A 1CR9L 2QKIC 2BIIA 4UINH 4PGCA 1QD0A 1D5IH 1XCXA 4ZZFA 4M8QA 5F44A 5D1ZA 1OB1A 2BZ7A 2Z1PA 5CUSH 3SE8H 5AVWB 1R3HB 2PCPB 3L3OA 4XBPB 4I4WB 3DX6A 2NYYD 3DPDA 4Y5YB 1GYUA 4Z77A 1Q9KB 1SEBB 2YMXL 4PJ7F 4FNRA 1TLKA 1IAKA 2YRBA 3HI6H 3G5VA 5HGBA 3MAWA 4Q58C 1P1ZB 4HUXA 4A39A 1AHWB 4KAQL 1I8MA 4TUOB 2ZJSH 5F88A 3ZL1A 5KSVA 3SGJA 3C08H 1ASQA 3V52H 4PLJC 4X9BA 3ARGD 5L2KD 3ILPB 3RL1A 3P9MB 1UKTA 1E5AA 3CC1A 3VSUA 1U95A 4RMRA 2I9LA 3NSXA 1UVQB 4I5BA 3V4VL 5GRZA 3UROR 4I1PA 4DK3A 3ZXAC 3FT2A 2JELH 2HVJB 5EPMA 1IGJA 1TJGL 2QL1A 1QP1A 4MAYC 1O9VA 4PU2A 3BDXA 3G7TA 5I1CL 2CE6A 1V7NH 2HFEA 4M3JA 3W9DA 4LRNH 1X9LA 4ZS6D 2ZCKH 3RTQD 1TTBA 2NUPA 1ZRUA 2Z34A 3W11C 3UDWC 2OSLA 4KXCA 1MF2H 3GSNB 3BP4B 1PL3A 4R3SB 4ONFH 3H56A 3ZDYB 2HWZL 1EBPA 4OD3L 2P5EA 3ULAB 1T7YA 2F1AA 4KNSA 1ZVSA 5HDQH 3L3KB 1LP9B 1FA4A 1IAIM 4HUVB 1XCQA 4KRNA 5CP3H 5ECGA 4MA7H 4B0MB 1OPGL 1FSKB 2G3XA 2VLJB 4IDLA 4OCMC 5SWSB 3RJQB 1MWAA 3ARBC 4H5SB 1DLHB 1JIBA 4OCWH 3LDBC 2E27L 4OFKA 1ORSA 4K3JL 4K55A 3QDHA 4NUGH 3RGVC 5JOFA 1MLBA 5DHDA 5T3ZD 3FT4B 1MCKA 3I9IA 2WV3A 4AZ8B 3PJLA 2IDUA 2JKNA 3WUWA 3ULVD 5IR1A 5BZDA 3FJTA 1VF5C 4J6RH 1FLRH 3LH8A 4MCNA 3FQNB 1YPZB 3GGWB 5IWLC 3I3EA 1CGYA 4ZZKA 2CKBL 1U8KA 2YPLB 3BESR 5DJ2B 5DRZB 4MHHI 5G5DA 1E8XA 1WO2A 3AAZA 3QFJB 4N5EC 1N59B 4EN3A 4HIHB 5DMIH 3UABA 3SDAC 1WITA 1JV2B 4CDHA 4LASL 2H2PC 4I3RL 2HJKB 1B90A 1Z9LA 2PMZA 3SJVB 5D8JL 5FM5O 1R17A 1BXVA 4HK0A 5GGTH 1NANH 2EDDA 2E8YA 5F3HA 5KTEL 5AL0A 2WXKA 1LK3H 3FFCA 2X6BA 3P3RA 4YHIB 1HI6B 4XT1C 1NDMA 1NCIA 2WWOA 4LCYA 3GI9L 3P77A 3ZU8A 1OIOA 3V0JA 2BVOA 1E50A 2V2XA 4ZNEA 3HUJB 3SQRA 5DQ9B 5AW4B 5E8EB 3KDMA 1AGCB 2P24A 4NN6B 1S7UB 4P46D 1CU4H 3H9SE 1KGCD 3LPOA 3T0DA 3P3SA 3BAEL 1EEUA 1KYAA 2Q86B 4ZMLA 4BWTA 4PJBA 4MNGA 3BGAA 3WN5B 1KTDA 4JZJA 5K1VA 5JIIA 1Q90A 2SEBB 5DDHA 1JGUH 4XC1H 4Y2NA 2FDBP 3VH8A 1NFAA 4DKFL 1YEIL 3FONB 1HAUA 1DSYA 1IKNC 3VFWA 4M1CC 4W9IC 1U58B 5DR5H 5HXMA 4BK5C 4BCYA 1YNTA 3CWGA 5D1XB 1MEXH 1V7ML 1E7UA 6FABH 1S7SA 3ZUCA 1OCCB 2G3ZA 4UNTA 4MLSA 3F6LA 1KGIA 1RPKA 2V9RA 3UYPA 4XBGB 1CFSB 1JNHA 4H1LG 3ASOB 3TJHD 5KG9A 2V9QA 5IB5A 2HN7A 5FIEA 5F7NC 1F6AB 4ABVA 4HU8A 1GC1L 5DQDH 4HPOH 1KCVH 2FUTA 4FN0A 2WTRB 1IJ9A 3QUMH 3DDFA 4HC1H 4A1RA 3JV5A 3UTTB 2ARJB 5EN2B 4XE0A 3WJMA 5D7JB 5IVXB 4N8CH 4X7SL 2B8OT 4YHMH 1F5WA 1T66C 3G04B 2DWSA 4BUQA 2ADIA 2BHUA 3MV9D 2ITDB 4P2RA 4BA8A 4YX2H 4L2YA 5B3JE 5E9DD 2V2TB 4MXQD 4TNWF 4MXVF 1NIFA 1F1GA 5ESVA 5AW9B 5SWZD 5HYSG 1TSRA 1NCGA 3T0EC 1WA1X 3L7FB 4WV1C 3VTMA 1XR8A 1T3FB 3PREA 1FNSL 3AREA 1G6RH 4I89A 2DWEB 1CTOA 1ND0A 2XYCA 1MCOH 3FSWA 1VGEL 5JHDD 4HG4K 2AJZA 4K7PY 4DPCX 3H54A 1KXHA 4NKDB 2MEJB 5DFWH 1PLAA 5DMGD 2A5UA 4BH8B 5CSBA 3RVVD 1AQHA 1PSKH 3T3ME 5CP7A 5A2AA 4U1IA 2YBRA 2Y36H 2P5PA 1UXLA 3PFUA 4PJGA 3GSUB 2OL3H 5J4MA 2ZAHA 3M6DA 1R3KA 2WXNA 3MV7B 5JLZB 1JK9B 1ORQA 4ZUTA 1KT2B 1A7QH 3DWTA 3QHFL 2CO4A 3VG9C 3AB0C 2Z4TA 4ATTA 1E4KC 2WQAA 1HSAA 1OPOA 3RPKA 4V2BA 1UASA 3EDDA 3IB4A 4OM1L 2XN9B 2ZYHA 4PJ5B 1KXQE 4JE0A 4PBDA 5BRZD 4X4YB 2Y1ZA 5EFIB 4FI7A 3DO7B 1EX0A 2WBJD 4RMBA 1XEUA 3W82A 1UM5H 4PY8I 5F6IC 5FKAB 1O7DC 1CI3M 3L95A 1ZSDB 6TAAA 1NPNA 3RWCA 1GMIA 1TJXA 1JRHH 1F6FB 1U30A 1VEPA 4AK1A 2PWEA 1FH5L 4AXWB 4DKTA 5EB9A 3MJ6A 2YFOA 1QSEE 4L3EA 4RRPM 5TH2A 1NCTA 3L5IA 5F1SA 1F1DA 2ADFL 2LHAA 2IFFH 2YOAA 1L0XA 4GIAA 4B3VA 3TFKD 1USZA 4HZ1A 5IEKB 1T03L 2IAAC 2YD5A 1ZJBA 3FO0H 3CFJB 3IFNH 4KX8A 3DX3A 2B16A 2W0FA 3MLXL 3TO4A 2HB0A 4XBEH 1D9KD 3NP3A 4GBXD 3SDDD 2FD6L 3DX0A 2C9XA 3P11H 4NZRL 1AIFB 1BWWA 1WAAF 2XWRA 3DVFA 3N42B 3O45A 4U6TA 2CM5A 4DUWA 1K3ZA 3F65A 5FM4A 3IRPX 1W8OA 1WP6A 5E6ID 2WYIA 5E1GA 4IRJC 3ZR5A 4PM1A 4FGMA 3HKFA 3PWNB 1OARL 1DN0B 1RP9A 1ZA6A 2GUOB 1IJNA 3N43F 4G8FB 1N2RB 4XO8A 4YNYB 5AKSA 5EBMB 3S37L 3GPEA 4PJCB 4Z7VB 3RFZB 1N5YH 4AGPA 1UT1A 3HZKB 5JXEC 2NQCA 2CR0A 1GIGL 2QDVA 2HTKD 4NC2B 5A2LH 1PD1A 1LE9A 4G5ZH 4OFQA 1GRWA 2G2PA 1WC7B 2WP3O 3SOBL 1E4KA 4NPJA 4D9RE 5C9KA 4LGPB 4DGUA 5HYQA 3TU6A 4NQXB 1T1ZB 4CILA 1ZCRA 2VKWA 4QKTA 1JGDA 3T8MA 3ARXA 3M8OL 2FVNA 4TPRL 3DJTA 2Y7LA 4AQAA 5EEYA 4GRMA 4JY4B 5IF0A 2WQUA 1QLFB 3EF7A 2E4TA 4L29A 2QPEB 3UJJH 1OKEA 4C83B 4JPIA 4X50A 4N0RA 5F7DA 3OKEB 2J20A 3NQKA 3RZCC 1MCCA 1RZJL 2CIKB 2K1MA 8FABB 4ISVB 5ABDE 1I7ZA 2FLMA 2P5WE 4TVPL 3ETBJ 4RWHA 3W39B 1AHMA 2WWNA 4WW2B 3NPSB 4RA0C 1YMMD 4N22A 2AANA 4YHZH 2ZKWA 4EIGB 3LRMA 1RZIB 4UQCA 3HE7C 4IOFD 3BGFC 2NQ3A 5GRUH 2P80D 1ZV9A 3U4BH 4M4RB 2QKIB 1F4HA 1MCQA 3FCGA 2Y5TB 1YEEL 1BVLB 3GSQA 1ETB1 4TTDC 5DS8B 3L45A 5LCVH 5G4MA 3VFOA 1U8LB 4M3KB 2DM3A 2XPGA 3NA9H 5FUZH 4Q9QL 2AZUA 1CXFA 1G1OA 2FNBA 4GI8A 2XWJA 4DH2A 4ELMB 1PAMA 5GS1A 2WN3A 2AJVL 3EJRA 1SHWA 5GRYA 5KS9E 2EDEA 2GSIB 2ZYIA 1MKFA 5DRWB 3OSKA 5D4IA 1JF6A 4W9CC 5TFSH 4BFBD 3EH4B 3S5LG 3NJJA 2VN3A 2UZIH 1KEML 5I0DA 2J72A 3B7UX 4NT6B 4MRCA 1BOYA 4QNPF 3P9LA 5CMAB 5FYKH 2JXMB 4G8GA 4B95C 2RBLA 2ZONA 2QFRA 3AG2B 1BVNT 3MC0A 5IB3A 3QIWD 25C8H 2XN0A 4AVHA 2V4LA 2AAVA 1T6BX 4BDVA 5I8KL 2NDGA 4MJHA 2WXHA 2FGZA 2IH1B 1IGML 4H0GA 3U0WL 3FMGL 1FFNB 4DO6A 3TWYA 4YR6A 4ACTA 5C2BL 3NIGB 4AL8L 3JTBA 2EZ0D 2HX7A 5EO0B 2CLRA 5KJ7E 4OI7A 3CHRA 1NC4D 2YR3A 1N67A 3EBAA 4U7KA 4IRZA 2YXMA 1AS6A 4WO4B 5INCB 1MVUB 5DVOA 5IBUB 3CSFA 1NKGA 4N8PA 5EOTA 4O2CA 2FEDC 3P3UA 5GZOC 4ZMVA 4TQEL 4W9HC 5ENWB 5D5MA 4BRJA 5TDNA 5HHXH 4U3HA 4Y8AA 1TU2A 3ULUL 1RCYA 4M5ZL 4G2AA 2YD9A 1MIEH 1QSFB 3MKKA 5F9OH 4RWYL 3VXNA 1A2YA 1EAPB 1D5IL 2BFVH 1FN4B 2YD1A 3LDBB 5HGGS 2P47B 5EIQA 1NAKL 1IIKA 2R29H 4DETA 4NBZB 2DKUA 4BXSV 5DHVH 1CBVH 3TH3T 4OJAA 3MBXL 2B3IA 2DB8A 4U6YA 3HI6L 3BZFA 4J3OD 3LEXB 5EZPA 1V54B 2PWDA 5IQNA 3UIZA 3VI3F 4AEIH 1F11A 5DMJB 2Y5QA 3S5YA 2H1XA 5DHVB 2PYED 3B6SB 4X6DB 1AIZA 3V52L 4APXA 4JCMA 2APFA 3HFFA 3OC5A 4KK5C 2C1OA 4DP6X 4O5LL 3IRCA 2D31A 2IPTH 2GITB 3LV3B 4WHTA 5JW4Q 2L8AA 4YSCA 1GAFH 3F01A 3OR6A 5C0DA 1PZBA 5E6RB 4PJ8D 4KTYA 3N2JA 3CVIH 2NZ9D 3IYLW 4F37K 1DUZB 3HVNA 3IN0A 2YAMA 2C4XA 3IDMB 5ALBL 3HHSB 3DXAE 4IGBC 4OCYL 4YOKA 1O5DT 2CLVB 4R90L 4GKOA 4GKZA 4MD4B 2YWZA 4I2XE 2AITA 5MEQA 3CFMA 5DYOA 3ARFC 3UZEC 4IIZA 3EOAA 4MJIE 2ADJA 3PDGA 4N0CD 4A2LA 4JQIL 5ADPH 1RUML 4LLQB 4LVNB 1N12A 4NM8H 4QHMB 5J1AA 1UHVA 4FZEH 4RDQG 4ZBJA 5ITBL 1GGIL 3FB5A 4MA7L 3RDTA 4XNQB 1NBYB 4G70B 2DLFL 5HVWA 3P0VH 1J8HB 5HHVL 1JZEA 2F5BL 1S9YB 3LOWA 1W6LA 3AXLB 5LKNA 2QHLA 3IE4A 1Y07A 3EFDH 5GRWA 4JO4L 2HVKB 1E9PA 4PGDB 1JZ5A 1E28B 5H35A 4UILH 3NK4A 4B53A 1JI2A 5KEZA 1H6EA 2E3VA 1IC4L 4QOKA 5F9AC 2B14A 4PWJA 2E9IA 4LE8A 2X1QA 3DI2B 3G08B 4Y19B 1GY2A 4NERA 4P3DA 3RILA 3SSGA 1NCNA 5DMIL 4ZTPH 2WLLB 1F4XL 4R5XA 1U3YA 2SODB 2VQTA 1JZ3A 1QO3B 2R27A 3PQYB 3MV8A 4WW1B 5I6LA 2F6AA 3EFFB 3EO9L 2Y24A 4I0KA 3NSCA 5IHUH 1I8AA 4MA1C 1S78C 2WB7A 2HP4A 2X4RA 3U9UA 4ELKA 3QO0A 4G80B 3WELA 2F74B 4BFGA 2E7LC 1LK3L 1OAZH 2K6YA 2O5XH 3MLVL 4GG6B 4LEBA 4IBLT 2YSTA 4MBOA 1BZ7B 5GISH 1W15A 3PU7A 4WTZG 5TDOA 4UTBA 4CADB 2R0KL 2P48B 1WEJL 3BEVB 3MRLB 1XH3B 3DUHA 3QULB 3UOAB 5I8OL 5JHLL 2FEJA 3RIFF 4TTGA 5DJZA 1IM3A 3MBED 2VAAA 2ENSA 3VRIA 4DCQB 3CBJB 1SDAB 2DQGL 5HGHA 5EOCH 4BBWA 1RY7B 3BSZL 5F93C 1OB0A 2HRHA 3FH7A 3MXWH 1U8NA 2E6PA 1UM6L 4GUPA 4DFHA 2K3HA 5JIMA 2EYTB 2Z91B 2WLKA 1AGBA 4TOYL 3D69B 5GGVY 4A04A 1MCWM 5BZWB 5CGYC 2QGCA 2W9EH 4R4BB 4P23C 2H9GA 3OB8A 1XGRA 3EYOB 4LESA 3A6BH 4BSVB 3FT9A 1OAYH 3KLKA 5DYFA 4Z8FH 1R3IH 4FD0A 1SJXA 1MJ7H 1G7HB 3VMPA 1MUJA 1VDGA 1M6OB 2VXVL 4IBYA 1TQTA 2QVIA 5JPNB 2F15A 4FA8A 4LNVA 2QQLL 1JWSA 2FEEI 3GNML 1KIRB 5HGAA 1PU0A 5DHYB 1FNAA 5F6IB 1R34A 2MRYA 5I71B 2A7BA 1D5MB 4LSRL 5J11B 1D6EB 4FFVD 1EO7A 1T2QL 2PXYB 4HKZA 5IGXL 1N8ZA 2MQ3A 4YX2L 5IQ9B 4IS6B 3KM1A 3CHOA 5I18H 2OMBA 3ALPA 3D2UA 1QSVA 1FH2A 2D3JA 3ARWA 4MCYA 4PRBA 5FECB 3U79A 2VITB 4TNEA 3I6KB 1MCIA 1G6RL 2ZXBA 1DBKL 1JHKH 2ITCB 4LARH 4OZFG 5B39A 5D72H 2XXFA 4Q6IC 4DAGL 3BAJA 1J0IA 3FT3A 1P5VA 4JLRA 1UCTA 4JPKL 1GPOH 4NC0B 3REVA 3PUCA 4UDTA 4PGBA 4U1MB 1NLDH 4GG8A 4PRAB 5KSAD 5F97E 3BZ4B 5C86A 1ECZA 3UTZB 2ZWNA 1FVDA 1JZFA 1YECL 3LNDA 2PUQT 3MZGB 4KJQD 3ZDXB 1CPUA 3ZZQA 1SJEB 4CC4A 4D9QD 4P2OB 3GI8L 2OL3L 4F7PB 3ROOB 5IBTL 2J8UB 4IRJB 3RAJH 5A6LA 1AXSB 4MB3A 4YJZL 3S98A 3MGOB 2BNQB 3E6FB 2FO4A 5DLML 4OZIB 2OTUB 1SLUA 1KJ2H 4KZCA 2I25N 2VLRB 3LKRB 1NAMA 4L4TB 3X1NA 2AJYH 4HUKB 4PRHE 2CGYA 4OAWB 3IXAA 3HPJA 3GSRA 2WKOA 4OGAD 4Y4FC 4Z7QB 2IADB 1S7RB 2P8MB 3RUGE 2X0VA 4CMHC 1VADA 3GFUA 1QMUA 1F90L 4LQFH 1KJ2B 1M4KA 1TQUA 4KPHL 3HG2A 1IAMA 2DEYX 2WWKT 4NM4L 5DEFA 5EU7C 3D5OF 4A68A 2FX7H 1T1WB 2DS4A 4UZSA 4JRYB 3SKJH 5KSBA 2K6ZA 1KCSL 4KDTC 5IW3A 4GSRA 3SDXF 1FC2D 3BJ91 5B3JF 2KI6A 1W72A 1KULA 1CDUA 2O5ZH 3C6LB 3MSPA 1JRHL 5D1QD 4XI5C 1Q9OA 3HZVB 4OD2A 4YO0A 4PJXE 2WLJA 4NQDB 15C8L 3KLLA 2DQJL 2RIKA 3DO3A 5I8CA 2EIJB 3LNGA 4JJ5A 1IILE 4UBDD 4B41A 2X4QA 4MDRA 3O11B 1I1AD 4N28A 2YLKA 4L0ZA 1T80A 4P2QB 3E0GA 1AS7A 4PWIA 4DGYH 4LHUG 2R56H 1OSZB 4RGMC 2CHZA 2YC1A 2IDFA 4ZXBC 3DUUB 4IMLB 4NGHH 3KCPA 4R83A 1KBKA 3MTRA 4NQCE 4F7EA 3HE7B 4QXGH 1UWGH 2IGTA 3D85A 5BUGA 1KJVB 3GD1C 4KKQA 5ACZB 4JFZL 1TKWB 5B1AB 3FO1B 5FO2A 4PV8A 1A7OL 3OKKB 4U6XB 1NSNH 5E7BA 1X4XA 2A6IB 1NFDB 1G0YR 1X3DA 4JFDE 4XPGL 2B0SH 3SDYL 4FXGA 3D39A 3QAQA 4JKLA 5I76A 5BZZA 4DQOH 3QYCA 4OVVA 4FABH 4FQQB 3QIBD 2WD0A 4KKCC 3BWAA 2C9SA 4HJJH 4IRSD 4O2FA 4ONHA 2WUBL 1NFIB 4WQOA 3UAEA 2QADC 4LGSB 4Y5XA 4AV5A 4F8LA 1XF4A 2ADYA 2ISDA 1I3RA 3B9KC 4HJGB 5E1QA 5BVJB 5F8QC 3CX2A 5IV2A 1V5JA 3G5XB 4BFOA 3FCUB 3KBPA 1ES0B 5MEOB 2WXFA 4CW1B 5DZJA 2E9GA 3QPXL 1LGVA 1XIWA 2AQSA 5D2LE 1O7VA 3L9BA 5PCYA 1RMFL 2V5SA 5MERB 1VAHA 1WIOA 4UM8A 4YHPB 1ZT7B 4MD5A 3W37A 4KJYA 1Y6NR 2B1HH 3ZE1E 3QR2A 2XWEA 1W0WA 4G82A 3BP7B 4P9ML 3ZRSA 1XF5A 1BEXA 2DQFB 2B77A 4DZBB 5L8LB 3OPZL 3T0WA 2OW6A 4OFYD 3DX7B 4HV8A 1M42A 3F58H 3LH2L 3QIUC 5AD0B 4GRWH 3KLQA 4K2UH 1GL4B 2C3VB 3MOQA 4YLBA 4NAJA 4PTUB 1GSMA 4N1EA 3C8KA 4HCFA 3VWJC 2XVBA 4X5RA 1JHLL 3A67L 3A6CL 5LCVL 3NK3A 1HVXA 1BF5A 4GRWB 5C3LD 1H5BB 4IOSA 2KZBA 2XG5A 5FUZL 3SE3C 1MH5A 1WDAA 1AGEB 4OZGA 5CZKA 5F3BB 4U31A 1PMYA 1CLOH 2IANE 1Z9PA 1F1AA 3OM3B 2FBRA 4JJHA 2WVSA 2NY5C 3WSQH 4UTAH 3L4CA 2A2QT 2CNZA 4X98B 2ZSVA 5AW0B 1J5HA 5IJBC 1RJCA 3WJLA 4PW9A 5AQ0A 1KLUB 4NKIH 5HYJE 3Q44A 1IGYB 1KGWA 3TBYA 4EVNB 3SCMD 1IKFH 2JJSC 2ZOOA 2H47C 5AAMA 2JKSA 2BSRA 3GM8A 2TRHA 1HQ4A 1EZUA 2ED8A 5I1GL 5DXWA 3BPNB 4PP1C 2FECI 1QFPA 2WQ8A 2CKBB 2YN5A 3B3IB 2QZ5A 5EUOE 1N64L 4KX9A 4Y1AB 2EILB 3N5AA 4F8TA 1TYEB 1XF1A 3FHAA 2VQ1A 1MPAL 1CFNA 2ZUUA 2Q76A 5DRXB 3C09C 1XGQA 2NNXA 3MCLL 3AY2A 5EA0L 4YH6A 2GT9B 3KLDA 4E36A 2HFFA 3CZLA 3U1SL 5B7EA 5F7MC 4B0MM 3VMOA 1J8RA 3V0EA 3WO4B 5T1KB 4KMLB 3HHRB 2F53D 2YRPA 1K2DA 3ARFB 4AQ8A 2VLKE 2H2SC 2R8SL 5AW1B 2BP8A 1OD7A 5C09B 4KQ4L 3HS9A 1MIEL 5IBUG 4F20A 1ZDSA 3KNBA 1NINA 4WDIA 3VXUA 5BW7C 3QIUA 5DRNB 4UT6A 1W0VA 4BUHA 2ZUXA 4PRIB 2J5WA 2UZYB 3UEZA 2WZ6A 1Q9LA 1MY7A 1MAJA 3NN8B 3V6OE 1VESA 4NHUB 1YYLL 5AKRA 5GGSY 3STLA 1GOFA 1QR1A 4G59C 2J21A 4MA8H 4UQEA 1EO8H 2RQ8A 1CDYA 1HC1A 5D93C 2ZQKA 4AEIL 1XGTA 1FNEA 4UM9D 5CINH 1W91A 2X4OA 1JYXA 3Q06A 2XFXA 4JY6A 3OF6A 3N0AA 5ABAA 2DN7A 2H7WA 2V7NB 4ANVA 2VLLA 1FFRA 3UGUA 1J11A 3RWJA 2IPTL 3ZMEA 4DP8X 5D7IB 4FULA 4OGQC 1IFHL 1NEZA 3PAYA 1NDGA 2ZYRA 4MA1B 3OLDA 5IVZA 1J8KA 4JNXA 4YFLF 1K4CB 3CVIL 5ESAA 5IJDC 2VISA 3BQUD 4DO5A 1U8MA 4F5CA 4L1LA 2L7QA 4PLOB 1JXGA 1H3UA 1I8KB 1PLGL 2WIIA 3P4LA 3WHXA 2YXFA 1L0YA 2P8PA 1YYMH 5I24A 2A74C 4GO8A 3ZN6A 3UMTA 1LJMA 2F7RA 4X9YA 4P4RA 2CHDA 2EYRA 4MSWA 2ESVE 5EU6D 2GEQA 4PJHE 3WFZA 4R7NA 4XPHH 3J7HA 4EEEA 3JVGA 3KYNB 1E90A 1ZGLB 3O8XC 4KY1H 3LXUX 2F1BA 1CD0A 5L2JA 5IHBA 3EJZD 4P5TD 2ZZUT 1SJVA 4MNQB 1GKOA 3HMXH 3O3DB 5MENE 2IDTA 2NY4C 4G1MA 3G6JA 2ZOKA 2WYHA 2HKAA 5CIPH 1SY6A 4P23B 5C0AB 1A14H 3PL6C 4X99B 2DYPA 2CO7A 5D7LA 5KYUA 2MQ0A 3L5HA 3BKML 3K8LA 4EXPX 4XHJD 3BUYB 4QGTA 3RVWD 1JBJA 2GTWB 4QY8B 2AAAA 5J6HB 3QDJD 4GAYA 4N2GA 5CIPB 1NDTA 1A6VH 4U3SB 4FLOA 1O9WA 3BKJH 3GBMH 4UYQA 1EJ6A 1YEDA 4HIIB 1MAMH 2AEPL 1QFUH 4G6MH 4XN2A 1O6SB 5I1IL 2OMXA 5GGQL 4C4UA 4BFIB 3SO3B 4GAJH 1JN6B 1L5GA 2AK4B 3MOBH 3OBAA 3O3AB 2B3RA 1DQML 3PWJA 4X6EA 4JZNA 2OX5B 4DP2X 3EJCA 3ECUA 4RDBA 1DJHA 5GISL 2VKXA 5FKPB 3EDFA 1J1OH 4NCC2 2O61A 3L3DA 1JXFA 5HDLA 1PYWA 4JM2B 4CSSA 1Z6JT 2ITFA 3IU3A 5HY9A 2AZAA 2YGQA 3HFMH 2FB4H 3N40F 2ATKB 4FKEA 1EXUB 5DT1L 4JFEE 3B7SA 1KTRL 5D1ZD 2CIIB 2J6WA 1IAOA 4HH9B 4Q74A 1RK0A 2VXTL 4JFHD 3ZKMD 4WFED 4GP8B 1V3JA 4F7TB 2J1YA 4H88L 1HHJA 4WFFE 3EJYC 4OZ4B 3PHSA 4OY9A 2AI0L 2OP4L 3SHSA 3UACA 1ZKAA 3D1MC 3TBSA 4PJDE 4M7LH 2RHEA 2PYFB 2E9WA 4TF4A 5E8DH 4MS8C 3A6BL 4EF3A 4F33A 4Y4FB 3VXPB 3TIDB 1AYOA 1NC2B 3O4LA 1OZTG 3QWRA 4U1NB 4W93A 4CMHB 5TGBA 3BUIA 4JW3A 4X5LA 1JZ4A 3FHEA 4ODHH 3VFSB 5FDWA 3QGVA 2BY3A 3LN4A 2QPFA 3TVMD 2QQKL 4H8VA 3CSBA 2CZNA 2EEAA 2OTWB 3PGCB 4WTWA 1WGVA 2A77H 1SOQA 3IMSA 3QDGB 2XBDA 2GTZB 3U25A 5DMKA 3NCCB 4BD4A 5DD3H 4HOXA 1DL7H 3BLPX 3I9GH 4OFIA 2FJSA 3RLSA 3TNNA 5F1IA 3TC9A 3LJ3A 1BVKA 4KKLC 3U7YH 3BO8A 1UKSA 4P06A 3TCXA 4GW1B 3G6AA 3MRDA 3REWB 2XWZA 3WXVH 3G6DH 5T1JA 1E6OH 4OUUB 3DRQA 3A0OA 4KKBC 3H7LA 5BS0A 1CDBA 3EH1A 4M6NH 1QPXA 5AB9A 1AO7A 4MDJB 1GPOL 2IDCA 5HPMA 5C71A 4FQHA 4NLAA 1JERA 4X6FB 4E9RA 4PS4L 4K4KA 3V4PH 1MFEL 3Q7JA 4JREC 1P7QA 3TF4A 4G9FE 4LKXA 3W5NA 4NRZB 3JV4A 2Q20A 2QSCH 3UJIH 3LAFA 3NTCH 4QRFA 4TNWK 3SODB 1A6TB 1LDSA 3V4PB 4FXKC 4QRPA 2APTA 1DVFC 4HWUA 3K46A 2DF3A 4NOFA 1M3IA 4Y5VB 3ATAA 3QR0A 5HGDA 1D3CA 5BVPL 1J1XL 5IIEA 1RURH 3GBDA 5K5YA 1MFNA 3GQFA 2EICA 1TDQA