2EVMA

Crystal structure of methionine aminopeptidase in complex with 5-(2,5-dichlorophenyl)furan-2-carboxylic acid
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
259
structure length
259
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural analysis of metalloform-selective inhibition of methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 86
structure length 259
sequence length 259
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2evmA00
2V3YA 4U73A 3S6BA 2GG3A 4U70A 3PKDA 2DFIA 1Y1NA 2EVCA 4IKSA 1QZYA 4PV4A 2MATA 2BWVA 3CTZA 1WN1A 4RZZA 4U69A 4IF7A 4FLLA 5E5BA 4S01A 2Q95A 4RGZ1 3IU9A 1QXZA 1BN5A 2BHAA 2V6CA 2ZSGA 3MATA 4FO7A 5CIKA 3TAVA 5CNXA 2ADUA 2B3LA 1WL6A 4OOKA 4HXXA 2GZ5A 4IU6A 1WKMA 4FO8A 3PKCA 3FMQA 4IKRA 1W2MA 5CDLA 1C21A 1C24A 1JAWA 1R5GA 1R58A 4PNCA 1WL9A 3MX6A 2BWWA 3FMRA 2Q8KA 5JFRA 4U6JA 2GA2A 4Z7MA 2EVOA 2NQ7A 2EA4A 2Q92A 1KQ9A 1XGMA 1B59A 2G6PA 2BWUA 2BWTA 3IU7A 1YW8A 4FLJA 2GU4A 2OAZA 1N51A 4R60A 4U6ZA 2HOWA 1M35A 4B28A 5JI6A 3PKBA 1QXYA 4U6EA 1YVMA 3L7GA 4FLKA 4U75A 4A6WA 2B3KA 4IPAA 2GG8A 5CDVA 4ZNGA 5JHUA 1XGNA 4U6CA 5D6FA 4FLIA 4ZWUA 2GU5A 4FUKA 2V3XA 2V3ZA 4S2RP 4MATA 1WY2A 3BITA 1O0XA 2BHBA 3IU8A 5FCFA 5CE6A 1CHMA 1BOAA 2Q94A 2P9AA 1C27A 3Q6DA 4U76A 3L24A 5D6EA 4ZWPA 1B6AA 3BIPA 2BWYA 3MR1A 4U6WA 4FKCA 2GU7A 3RORA 3D27A 2GG2A 3FM3A 4QR8A 4IKTA 2BH3A 2BWSA 3CB5A 4U1BA 3RVAA 1QXWA 4JUQA 4EGEA 1W7VA 1XNZA 3TB5A 1YW9A 1XGOA 1XGSA 3CB6A 2NQ6A 2P99A 1C23A 5CLSA 3BIQA 4IDYA 1PV9A 4RZYA 2GG7A 1R5HA 1WLRA 2P98A 2EVMA 2GG5A 3PKAA 2Q93A 4IECA 2GG0A 4KM3A 3PKEA 2GU6A 1YJ3A 2BHCA 1KP0A 2Q96A 2IW2A 4U71A 4S00A 1KQ0A 2EA2A 2OKNA 5FCHA 2BHDA 1MATA 2GTXA 2BWXA 4A6VA 2BB7A 2GGCA 3IG4A 2GG9A 1C22A 1A16A 2GGBA 1WBQA 4IKUA 2BN7A 4S2TP 4ZWOA 2B3HA 5CDEA 1YW7A
chains in the Genus database with same CATH superfamily
2V3YA 4U73A 3S6BA 2GG3A 4U70A 3PKDA 2DFIA 1Y1NA 2EVCA 4IKSA 1QZYA 4PV4A 2MATA 2BWVA 3CTZA 1WN1A 4RZZA 4U69A 4IF7A 4FLLA 5E5BA 4S01A 2Q95A 4RGZ1 3IU9A 1QXZA 1BN5A 2BHAA 2V6CA 2ZSGA 3MATA 4FO7A 5CIKA 3TAVA 5CNXA 2ADUA 2B3LA 1WL6A 4OOKA 4HXXA 2GZ5A 4IU6A 1WKMA 4FO8A 3PKCA 3FMQA 4IKRA 1W2MA 5CDLA 1C21A 1C24A 1JAWA 1R5GA 1R58A 4PNCA 1WL9A 3MX6A 2BWWA 3FMRA 2Q8KA 5JFRA 4U6JA 2GA2A 4Z7MA 2EVOA 2NQ7A 2EA4A 2Q92A 1KQ9A 1XGMA 1B59A 2G6PA 2BWUA 2BWTA 3IU7A 1YW8A 4FLJA 2GU4A 2OAZA 1N51A 4R60A 4U6ZA 2HOWA 1M35A 4B28A 5JI6A 3PKBA 1QXYA 4U6EA 1YVMA 3L7GA 4FLKA 4U75A 4A6WA 2B3KA 4IPAA 2GG8A 5CDVA 4ZNGA 5JHUA 1XGNA 4U6CA 5D6FA 4FLIA 4ZWUA 2GU5A 4FUKA 2V3XA 2V3ZA 4S2RP 4MATA 1WY2A 3BITA 1O0XA 2BHBA 3IU8A 5FCFA 5CE6A 1CHMA 1BOAA 2Q94A 2P9AA 1C27A 3Q6DA 4U76A 3L24A 5D6EA 4ZWPA 1B6AA 3BIPA 2BWYA 3MR1A 4U6WA 4FKCA 2GU7A 3RORA 3D27A 2GG2A 3FM3A 4QR8A 4IKTA 2BH3A 2BWSA 3CB5A 4U1BA 3RVAA 1QXWA 4JUQA 4EGEA 1W7VA 1XNZA 3TB5A 1YW9A 1XGOA 1XGSA 3CB6A 2NQ6A 2P99A 1C23A 5CLSA 3BIQA 4IDYA 1PV9A 4RZYA 2GG7A 1R5HA 1WLRA 2P98A 2EVMA 2GG5A 3PKAA 2Q93A 4IECA 2GG0A 4KM3A 3PKEA 2GU6A 1YJ3A 2BHCA 1KP0A 2Q96A 2IW2A 4U71A 4S00A 1KQ0A 2EA2A 2OKNA 5FCHA 2BHDA 1MATA 2GTXA 2BWXA 4A6VA 2BB7A 2GGCA 3IG4A 2GG9A 1C22A 1A16A 2GGBA 1WBQA 4IKUA 2BN7A 4S2TP 4ZWOA 2B3HA 5CDEA 1YW7A
chains in the Genus database with same CATH topology
2V3YA 4U73A 3S6BA 2GG3A 4U70A 3PKDA 2DFIA 1Y1NA 2EVCA 4IKSA 1QZYA 4PV4A 2MATA 2BWVA 3CTZA 1WN1A 4RZZA 4U69A 4IF7A 4FLLA 5E5BA 4S01A 2Q95A 4RGZ1 3IU9A 1QXZA 1BN5A 2BHAA 2V6CA 2ZSGA 3MATA 4FO7A 5CIKA 3TAVA 5CNXA 2ADUA 2B3LA 1WL6A 4OOKA 4HXXA 2GZ5A 4IU6A 1WKMA 4FO8A 3PKCA 3FMQA 4IKRA 1W2MA 5CDLA 1C21A 1C24A 1JAWA 1R5GA 1R58A 4PNCA 1WL9A 3MX6A 2BWWA 3FMRA 2Q8KA 5JFRA 4U6JA 2GA2A 4Z7MA 2EVOA 2NQ7A 2EA4A 2Q92A 1KQ9A 1XGMA 1B59A 2G6PA 2BWUA 2BWTA 3IU7A 1YW8A 4FLJA 2GU4A 2OAZA 1N51A 4R60A 4U6ZA 2HOWA 1M35A 4B28A 5JI6A 3PKBA 1QXYA 4U6EA 1YVMA 3L7GA 4FLKA 4U75A 4A6WA 2B3KA 4IPAA 2GG8A 5CDVA 4ZNGA 5JHUA 1XGNA 4U6CA 5D6FA 4FLIA 4ZWUA 2GU5A 4FUKA 2V3XA 2V3ZA 4S2RP 4MATA 1WY2A 3BITA 1O0XA 2BHBA 3IU8A 5FCFA 5CE6A 1CHMA 1BOAA 2Q94A 2P9AA 1C27A 3Q6DA 4U76A 3L24A 5D6EA 4ZWPA 1B6AA 3BIPA 2BWYA 3MR1A 4U6WA 4FKCA 2GU7A 3RORA 3D27A 2GG2A 3FM3A 4QR8A 4IKTA 2BH3A 2BWSA 3CB5A 4U1BA 3RVAA 1QXWA 4JUQA 4EGEA 1W7VA 1XNZA 3TB5A 1YW9A 1XGOA 1XGSA 3CB6A 2NQ6A 2P99A 1C23A 5CLSA 3BIQA 4IDYA 1PV9A 4RZYA 2GG7A 1R5HA 1WLRA 2P98A 2EVMA 2GG5A 3PKAA 2Q93A 4IECA 2GG0A 4KM3A 3PKEA 2GU6A 1YJ3A 2BHCA 1KP0A 2Q96A 2IW2A 4U71A 4S00A 1KQ0A 2EA2A 2OKNA 5FCHA 2BHDA 1MATA 2GTXA 2BWXA 4A6VA 2BB7A 2GGCA 3IG4A 2GG9A 1C22A 1A16A 2GGBA 1WBQA 4IKUA 2BN7A 4S2TP 4ZWOA 2B3HA 5CDEA 1YW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V3Y A;  4U73 A;  3S6B A;  2GG3 A;  4U70 A;  3PKD A;  2DFI A;  1Y1N A;  2EVC A;  4IKS A;  1QZY A;  4PV4 A;  2MAT A;  2BWV A;  3CTZ A;  1WN1 A;  4RZZ A;  4U69 A;  4IF7 A;  4FLL A;  5E5B A;  4S01 A;  2Q95 A;  4RGZ 1;  3IU9 A;  1QXZ A;  1BN5 A;  2BHA A;  2V6C A;  2ZSG A;  3MAT A;  4FO7 A;  5CIK A;  3TAV A;  5CNX A;  2ADU A;  2B3L A;  1WL6 A;  4OOK A;  4HXX A;  2GZ5 A;  4IU6 A;  1WKM A;  4FO8 A;  3PKC A;  3FMQ A;  4IKR A;  1W2M A;  5CDL A;  1C21 A;  1C24 A;  1JAW A;  1R5G A;  1R58 A;  4PNC A;  1WL9 A;  3MX6 A;  2BWW A;  3FMR A;  2Q8K A;  5JFR A;  4U6J A;  2GA2 A;  4Z7M A;  2EVO A;  2NQ7 A;  2EA4 A;  2Q92 A;  1KQ9 A;  1XGM A;  1B59 A;  2G6P A;  2BWU A;  2BWT A;  3IU7 A;  1YW8 A;  4FLJ A;  2GU4 A;  2OAZ A;  1N51 A;  4R60 A;  4U6Z A;  2HOW A;  1M35 A;  4B28 A;  5JI6 A;  3PKB A;  1QXY A;  4U6E A;  1YVM A;  3L7G A;  4FLK A;  4U75 A;  4A6W A;  2B3K A;  4IPA A;  2GG8 A;  5CDV A;  4ZNG A;  5JHU A;  1XGN A;  4U6C A;  5D6F A;  4FLI A;  4ZWU A;  2GU5 A;  4FUK A;  2V3X A;  2V3Z A;  4S2R P;  4MAT A;  1WY2 A;  3BIT A;  1O0X A;  2BHB A;  3IU8 A;  5FCF A;  5CE6 A;  1CHM A;  1BOA A;  2Q94 A;  2P9A A;  1C27 A;  3Q6D A;  4U76 A;  3L24 A;  5D6E A;  4ZWP A;  1B6A A;  3BIP A;  2BWY A;  3MR1 A;  4U6W A;  4FKC A;  2GU7 A;  3ROR A;  3D27 A;  2GG2 A;  3FM3 A;  4QR8 A;  4IKT A;  2BH3 A;  2BWS A;  3CB5 A;  4U1B A;  3RVA A;  1QXW A;  4JUQ A;  4EGE A;  1W7V A;  1XNZ A;  3TB5 A;  1YW9 A;  1XGO A;  1XGS A;  3CB6 A;  2NQ6 A;  2P99 A;  1C23 A;  5CLS A;  3BIQ A;  4IDY A;  1PV9 A;  4RZY A;  2GG7 A;  1R5H A;  1WLR A;  2P98 A;  2EVM A;  2GG5 A;  3PKA A;  2Q93 A;  4IEC A;  2GG0 A;  4KM3 A;  3PKE A;  2GU6 A;  1YJ3 A;  2BHC A;  1KP0 A;  2Q96 A;  2IW2 A;  4U71 A;  4S00 A;  1KQ0 A;  2EA2 A;  2OKN A;  5FCH A;  2BHD A;  1MAT A;  2GTX A;  2BWX A;  4A6V A;  2BB7 A;  2GGC A;  3IG4 A;  2GG9 A;  1C22 A;  1A16 A;  2GGB A;  1WBQ A;  4IKU A;  2BN7 A;  4S2T P;  4ZWO A;  2B3H A;  5CDE A;  1YW7 A; 
#chains in the Genus database with same CATH topology
 2V3Y A;  4U73 A;  3S6B A;  2GG3 A;  4U70 A;  3PKD A;  2DFI A;  1Y1N A;  2EVC A;  4IKS A;  1QZY A;  4PV4 A;  2MAT A;  2BWV A;  3CTZ A;  1WN1 A;  4RZZ A;  4U69 A;  4IF7 A;  4FLL A;  5E5B A;  4S01 A;  2Q95 A;  4RGZ 1;  3IU9 A;  1QXZ A;  1BN5 A;  2BHA A;  2V6C A;  2ZSG A;  3MAT A;  4FO7 A;  5CIK A;  3TAV A;  5CNX A;  2ADU A;  2B3L A;  1WL6 A;  4OOK A;  4HXX A;  2GZ5 A;  4IU6 A;  1WKM A;  4FO8 A;  3PKC A;  3FMQ A;  4IKR A;  1W2M A;  5CDL A;  1C21 A;  1C24 A;  1JAW A;  1R5G A;  1R58 A;  4PNC A;  1WL9 A;  3MX6 A;  2BWW A;  3FMR A;  2Q8K A;  5JFR A;  4U6J A;  2GA2 A;  4Z7M A;  2EVO A;  2NQ7 A;  2EA4 A;  2Q92 A;  1KQ9 A;  1XGM A;  1B59 A;  2G6P A;  2BWU A;  2BWT A;  3IU7 A;  1YW8 A;  4FLJ A;  2GU4 A;  2OAZ A;  1N51 A;  4R60 A;  4U6Z A;  2HOW A;  1M35 A;  4B28 A;  5JI6 A;  3PKB A;  1QXY A;  4U6E A;  1YVM A;  3L7G A;  4FLK A;  4U75 A;  4A6W A;  2B3K A;  4IPA A;  2GG8 A;  5CDV A;  4ZNG A;  5JHU A;  1XGN A;  4U6C A;  5D6F A;  4FLI A;  4ZWU A;  2GU5 A;  4FUK A;  2V3X A;  2V3Z A;  4S2R P;  4MAT A;  1WY2 A;  3BIT A;  1O0X A;  2BHB A;  3IU8 A;  5FCF A;  5CE6 A;  1CHM A;  1BOA A;  2Q94 A;  2P9A A;  1C27 A;  3Q6D A;  4U76 A;  3L24 A;  5D6E A;  4ZWP A;  1B6A A;  3BIP A;  2BWY A;  3MR1 A;  4U6W A;  4FKC A;  2GU7 A;  3ROR A;  3D27 A;  2GG2 A;  3FM3 A;  4QR8 A;  4IKT A;  2BH3 A;  2BWS A;  3CB5 A;  4U1B A;  3RVA A;  1QXW A;  4JUQ A;  4EGE A;  1W7V A;  1XNZ A;  3TB5 A;  1YW9 A;  1XGO A;  1XGS A;  3CB6 A;  2NQ6 A;  2P99 A;  1C23 A;  5CLS A;  3BIQ A;  4IDY A;  1PV9 A;  4RZY A;  2GG7 A;  1R5H A;  1WLR A;  2P98 A;  2EVM A;  2GG5 A;  3PKA A;  2Q93 A;  4IEC A;  2GG0 A;  4KM3 A;  3PKE A;  2GU6 A;  1YJ3 A;  2BHC A;  1KP0 A;  2Q96 A;  2IW2 A;  4U71 A;  4S00 A;  1KQ0 A;  2EA2 A;  2OKN A;  5FCH A;  2BHD A;  1MAT A;  2GTX A;  2BWX A;  4A6V A;  2BB7 A;  2GGC A;  3IG4 A;  2GG9 A;  1C22 A;  1A16 A;  2GGB A;  1WBQ A;  4IKU A;  2BN7 A;  4S2T P;  4ZWO A;  2B3H A;  5CDE A;  1YW7 A; 
#chains in the Genus database with same CATH homology
 2V3Y A;  4U73 A;  3S6B A;  2GG3 A;  4U70 A;  3PKD A;  2DFI A;  1Y1N A;  2EVC A;  4IKS A;  1QZY A;  4PV4 A;  2MAT A;  2BWV A;  3CTZ A;  1WN1 A;  4RZZ A;  4U69 A;  4IF7 A;  4FLL A;  5E5B A;  4S01 A;  2Q95 A;  4RGZ 1;  3IU9 A;  1QXZ A;  1BN5 A;  2BHA A;  2V6C A;  2ZSG A;  3MAT A;  4FO7 A;  5CIK A;  3TAV A;  5CNX A;  2ADU A;  2B3L A;  1WL6 A;  4OOK A;  4HXX A;  2GZ5 A;  4IU6 A;  1WKM A;  4FO8 A;  3PKC A;  3FMQ A;  4IKR A;  1W2M A;  5CDL A;  1C21 A;  1C24 A;  1JAW A;  1R5G A;  1R58 A;  4PNC A;  1WL9 A;  3MX6 A;  2BWW A;  3FMR A;  2Q8K A;  5JFR A;  4U6J A;  2GA2 A;  4Z7M A;  2EVO A;  2NQ7 A;  2EA4 A;  2Q92 A;  1KQ9 A;  1XGM A;  1B59 A;  2G6P A;  2BWU A;  2BWT A;  3IU7 A;  1YW8 A;  4FLJ A;  2GU4 A;  2OAZ A;  1N51 A;  4R60 A;  4U6Z A;  2HOW A;  1M35 A;  4B28 A;  5JI6 A;  3PKB A;  1QXY A;  4U6E A;  1YVM A;  3L7G A;  4FLK A;  4U75 A;  4A6W A;  2B3K A;  4IPA A;  2GG8 A;  5CDV A;  4ZNG A;  5JHU A;  1XGN A;  4U6C A;  5D6F A;  4FLI A;  4ZWU A;  2GU5 A;  4FUK A;  2V3X A;  2V3Z A;  4S2R P;  4MAT A;  1WY2 A;  3BIT A;  1O0X A;  2BHB A;  3IU8 A;  5FCF A;  5CE6 A;  1CHM A;  1BOA A;  2Q94 A;  2P9A A;  1C27 A;  3Q6D A;  4U76 A;  3L24 A;  5D6E A;  4ZWP A;  1B6A A;  3BIP A;  2BWY A;  3MR1 A;  4U6W A;  4FKC A;  2GU7 A;  3ROR A;  3D27 A;  2GG2 A;  3FM3 A;  4QR8 A;  4IKT A;  2BH3 A;  2BWS A;  3CB5 A;  4U1B A;  3RVA A;  1QXW A;  4JUQ A;  4EGE A;  1W7V A;  1XNZ A;  3TB5 A;  1YW9 A;  1XGO A;  1XGS A;  3CB6 A;  2NQ6 A;  2P99 A;  1C23 A;  5CLS A;  3BIQ A;  4IDY A;  1PV9 A;  4RZY A;  2GG7 A;  1R5H A;  1WLR A;  2P98 A;  2EVM A;  2GG5 A;  3PKA A;  2Q93 A;  4IEC A;  2GG0 A;  4KM3 A;  3PKE A;  2GU6 A;  1YJ3 A;  2BHC A;  1KP0 A;  2Q96 A;  2IW2 A;  4U71 A;  4S00 A;  1KQ0 A;  2EA2 A;  2OKN A;  5FCH A;  2BHD A;  1MAT A;  2GTX A;  2BWX A;  4A6V A;  2BB7 A;  2GGC A;  3IG4 A;  2GG9 A;  1C22 A;  1A16 A;  2GGB A;  1WBQ A;  4IKU A;  2BN7 A;  4S2T P;  4ZWO A;  2B3H A;  5CDE A;  1YW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...