2EVMA

Crystal structure of methionine aminopeptidase in complex with 5-(2,5-dichlorophenyl)furan-2-carboxylic acid
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
259
structure length
259
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of metalloform-selective inhibition of methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 86
structure length 259
sequence length 259
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2evmA00
1WBQA 3IU7A 2GGBA 2MATA 3CTZA 2Q96A 1BOAA 3TAVA 2GG9A 1QXZA 2V3ZA 4S2TP 2GZ5A 3MX6A 5CIKA 4A6VA 5JI6A 3D27A 3FMRA 3FM3A 4FUKA 2Q92A 1JAWA 2GGCA 2EVCA 1C21A 4Z7MA 3PKAA 3Q6DA 5D6FA 2GA2A 4U70A 1KQ9A 1B6AA 3CB6A 4U6ZA 2EA4A 5E5BA 3RORA 2BH3A 4ZWPA 3PKCA 3PKDA 4PV4A 2GU5A 1XGOA 4U69A 4U6CA 4U75A 5CDLA 1M35A 4FKCA 1WLRA 4IF7A 2BWVA 3FMQA 2BHDA 4FLKA 2Q93A 2B3LA 2GU6A 2V3YA 1WL6A 3IU9A 4IDYA 2GTXA 2NQ7A 2BHBA 4B28A 2Q94A 1O0XA 1YW9A 4IPAA 4S01A 1KQ0A 5CDVA 5JHUA 3PKEA 2B3HA 2BWXA 3IG4A 4U6JA 4IECA 1Y1NA 5JFRA 4IKRA 1QZYA 4U1BA 1N51A 2DFIA 1YW8A 1XNZA 2GU4A 1YVMA 4MATA 1XGSA 2GG3A 2IW2A 3IU8A 4S00A 4U6EA 4OOKA 4ZWUA 4R60A 4HXXA 1W2MA 1WY2A 3BITA 2G6PA 2GG8A 4KM3A 1BN5A 2OKNA 5CLSA 2B3KA 2ZSGA 4JUQA 3PKBA 2V6CA 1C22A 4IKSA 3TB5A 2BWWA 2P98A 1QXWA 1PV9A 2EVMA 4A6WA 4RGZ1 1WL9A 2Q95A 4IKTA 4U71A 5CNXA 2EVOA 2BWYA 1YJ3A 4QR8A 4U6WA 1MATA 1C24A 1XGMA 2V3XA 4RZZA 3CB5A 1WN1A 2HOWA 2GG5A 4ZWOA 1C23A 4IKUA 2GG2A 3L24A 4FO7A 1C27A 2GU7A 2OAZA 1R5HA 1CHMA 2BHAA 4IU6A 1XGNA 1YW7A 1QXYA 2BWSA 2EA2A 2BB7A 3RVAA 1WKMA 1KP0A 2Q8KA 5FCHA 2ADUA 3MR1A 1R5GA 1A16A 2BN7A 3MATA 4FLJA 5FCFA 2GG0A 2BWTA 3S6BA 4PNCA 3BIPA 2P99A 5CDEA 5CE6A 4FLLA 2BHCA 2P9AA 5D6EA 4U76A 3BIQA 4ZNGA 4U73A 4FLIA 4FO8A 4EGEA 3L7GA 2BWUA 2NQ6A 1W7VA 2GG7A 1B59A 4RZYA 1R58A 4S2RP
chains in the Genus database with same CATH superfamily
1WBQA 3IU7A 2GGBA 2MATA 3CTZA 2Q96A 1BOAA 3TAVA 2GG9A 1QXZA 2V3ZA 4S2TP 2GZ5A 3MX6A 5CIKA 4A6VA 5JI6A 3D27A 3FMRA 3FM3A 4FUKA 2Q92A 1JAWA 2GGCA 2EVCA 1C21A 4Z7MA 3PKAA 3Q6DA 5D6FA 2GA2A 4U70A 1KQ9A 1B6AA 3CB6A 4U6ZA 2EA4A 5E5BA 3RORA 2BH3A 4ZWPA 3PKCA 3PKDA 4PV4A 2GU5A 1XGOA 4U69A 4U6CA 4U75A 5CDLA 1M35A 4FKCA 1WLRA 4IF7A 2BWVA 3FMQA 2BHDA 4FLKA 2Q93A 2B3LA 2GU6A 2V3YA 1WL6A 3IU9A 4IDYA 2GTXA 2NQ7A 2BHBA 4B28A 2Q94A 1O0XA 1YW9A 4IPAA 4S01A 1KQ0A 5CDVA 5JHUA 3PKEA 2B3HA 2BWXA 3IG4A 4U6JA 4IECA 1Y1NA 5JFRA 4IKRA 1QZYA 4U1BA 1N51A 2DFIA 1YW8A 1XNZA 2GU4A 1YVMA 4MATA 1XGSA 2GG3A 2IW2A 3IU8A 4S00A 4U6EA 4OOKA 4ZWUA 4R60A 4HXXA 1W2MA 1WY2A 3BITA 2G6PA 2GG8A 4KM3A 1BN5A 2OKNA 5CLSA 2B3KA 2ZSGA 4JUQA 3PKBA 2V6CA 1C22A 4IKSA 3TB5A 2BWWA 2P98A 1QXWA 1PV9A 2EVMA 4A6WA 4RGZ1 1WL9A 2Q95A 4IKTA 4U71A 5CNXA 2EVOA 2BWYA 1YJ3A 4QR8A 4U6WA 1MATA 1C24A 1XGMA 2V3XA 4RZZA 3CB5A 1WN1A 2HOWA 2GG5A 4ZWOA 1C23A 4IKUA 2GG2A 3L24A 4FO7A 1C27A 2GU7A 2OAZA 1R5HA 1CHMA 2BHAA 4IU6A 1XGNA 1YW7A 1QXYA 2BWSA 2EA2A 2BB7A 3RVAA 1WKMA 1KP0A 2Q8KA 5FCHA 2ADUA 3MR1A 1R5GA 1A16A 2BN7A 3MATA 4FLJA 5FCFA 2GG0A 2BWTA 3S6BA 4PNCA 3BIPA 2P99A 5CDEA 5CE6A 4FLLA 2BHCA 2P9AA 5D6EA 4U76A 3BIQA 4ZNGA 4U73A 4FLIA 4FO8A 4EGEA 3L7GA 2BWUA 2NQ6A 1W7VA 2GG7A 1B59A 4RZYA 1R58A 4S2RP
chains in the Genus database with same CATH topology
1WBQA 3IU7A 2GGBA 2MATA 3CTZA 2Q96A 1BOAA 3TAVA 2GG9A 1QXZA 2V3ZA 4S2TP 2GZ5A 3MX6A 5CIKA 4A6VA 5JI6A 3D27A 3FMRA 3FM3A 4FUKA 2Q92A 1JAWA 2GGCA 2EVCA 1C21A 4Z7MA 3PKAA 3Q6DA 5D6FA 2GA2A 4U70A 1KQ9A 1B6AA 3CB6A 4U6ZA 2EA4A 5E5BA 3RORA 2BH3A 4ZWPA 3PKCA 3PKDA 4PV4A 2GU5A 1XGOA 4U69A 4U6CA 4U75A 5CDLA 1M35A 4FKCA 1WLRA 4IF7A 2BWVA 3FMQA 2BHDA 4FLKA 2Q93A 2B3LA 2GU6A 2V3YA 1WL6A 3IU9A 4IDYA 2GTXA 2NQ7A 2BHBA 4B28A 2Q94A 1O0XA 1YW9A 4IPAA 4S01A 1KQ0A 5CDVA 5JHUA 3PKEA 2B3HA 2BWXA 3IG4A 4U6JA 4IECA 1Y1NA 5JFRA 4IKRA 1QZYA 4U1BA 1N51A 2DFIA 1YW8A 1XNZA 2GU4A 1YVMA 4MATA 1XGSA 2GG3A 2IW2A 3IU8A 4S00A 4U6EA 4OOKA 4ZWUA 4R60A 4HXXA 1W2MA 1WY2A 3BITA 2G6PA 2GG8A 4KM3A 1BN5A 2OKNA 5CLSA 2B3KA 2ZSGA 4JUQA 3PKBA 2V6CA 1C22A 4IKSA 3TB5A 2BWWA 2P98A 1QXWA 1PV9A 2EVMA 4A6WA 4RGZ1 1WL9A 2Q95A 4IKTA 4U71A 5CNXA 2EVOA 2BWYA 1YJ3A 4QR8A 4U6WA 1MATA 1C24A 1XGMA 2V3XA 4RZZA 3CB5A 1WN1A 2HOWA 2GG5A 4ZWOA 1C23A 4IKUA 2GG2A 3L24A 4FO7A 1C27A 2GU7A 2OAZA 1R5HA 1CHMA 2BHAA 4IU6A 1XGNA 1YW7A 1QXYA 2BWSA 2EA2A 2BB7A 3RVAA 1WKMA 1KP0A 2Q8KA 5FCHA 2ADUA 3MR1A 1R5GA 1A16A 2BN7A 3MATA 4FLJA 5FCFA 2GG0A 2BWTA 3S6BA 4PNCA 3BIPA 2P99A 5CDEA 5CE6A 4FLLA 2BHCA 2P9AA 5D6EA 4U76A 3BIQA 4ZNGA 4U73A 4FLIA 4FO8A 4EGEA 3L7GA 2BWUA 2NQ6A 1W7VA 2GG7A 1B59A 4RZYA 1R58A 4S2RP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WBQ A;  3IU7 A;  2GGB A;  2MAT A;  3CTZ A;  2Q96 A;  1BOA A;  3TAV A;  2GG9 A;  1QXZ A;  2V3Z A;  4S2T P;  2GZ5 A;  3MX6 A;  5CIK A;  4A6V A;  5JI6 A;  3D27 A;  3FMR A;  3FM3 A;  4FUK A;  2Q92 A;  1JAW A;  2GGC A;  2EVC A;  1C21 A;  4Z7M A;  3PKA A;  3Q6D A;  5D6F A;  2GA2 A;  4U70 A;  1KQ9 A;  1B6A A;  3CB6 A;  4U6Z A;  2EA4 A;  5E5B A;  3ROR A;  2BH3 A;  4ZWP A;  3PKC A;  3PKD A;  4PV4 A;  2GU5 A;  1XGO A;  4U69 A;  4U6C A;  4U75 A;  5CDL A;  1M35 A;  4FKC A;  1WLR A;  4IF7 A;  2BWV A;  3FMQ A;  2BHD A;  4FLK A;  2Q93 A;  2B3L A;  2GU6 A;  2V3Y A;  1WL6 A;  3IU9 A;  4IDY A;  2GTX A;  2NQ7 A;  2BHB A;  4B28 A;  2Q94 A;  1O0X A;  1YW9 A;  4IPA A;  4S01 A;  1KQ0 A;  5CDV A;  5JHU A;  3PKE A;  2B3H A;  2BWX A;  3IG4 A;  4U6J A;  4IEC A;  1Y1N A;  5JFR A;  4IKR A;  1QZY A;  4U1B A;  1N51 A;  2DFI A;  1YW8 A;  1XNZ A;  2GU4 A;  1YVM A;  4MAT A;  1XGS A;  2GG3 A;  2IW2 A;  3IU8 A;  4S00 A;  4U6E A;  4OOK A;  4ZWU A;  4R60 A;  4HXX A;  1W2M A;  1WY2 A;  3BIT A;  2G6P A;  2GG8 A;  4KM3 A;  1BN5 A;  2OKN A;  5CLS A;  2B3K A;  2ZSG A;  4JUQ A;  3PKB A;  2V6C A;  1C22 A;  4IKS A;  3TB5 A;  2BWW A;  2P98 A;  1QXW A;  1PV9 A;  2EVM A;  4A6W A;  4RGZ 1;  1WL9 A;  2Q95 A;  4IKT A;  4U71 A;  5CNX A;  2EVO A;  2BWY A;  1YJ3 A;  4QR8 A;  4U6W A;  1MAT A;  1C24 A;  1XGM A;  2V3X A;  4RZZ A;  3CB5 A;  1WN1 A;  2HOW A;  2GG5 A;  4ZWO A;  1C23 A;  4IKU A;  2GG2 A;  3L24 A;  4FO7 A;  1C27 A;  2GU7 A;  2OAZ A;  1R5H A;  1CHM A;  2BHA A;  4IU6 A;  1XGN A;  1YW7 A;  1QXY A;  2BWS A;  2EA2 A;  2BB7 A;  3RVA A;  1WKM A;  1KP0 A;  2Q8K A;  5FCH A;  2ADU A;  3MR1 A;  1R5G A;  1A16 A;  2BN7 A;  3MAT A;  4FLJ A;  5FCF A;  2GG0 A;  2BWT A;  3S6B A;  4PNC A;  3BIP A;  2P99 A;  5CDE A;  5CE6 A;  4FLL A;  2BHC A;  2P9A A;  5D6E A;  4U76 A;  3BIQ A;  4ZNG A;  4U73 A;  4FLI A;  4FO8 A;  4EGE A;  3L7G A;  2BWU A;  2NQ6 A;  1W7V A;  2GG7 A;  1B59 A;  4RZY A;  1R58 A;  4S2R P; 
#chains in the Genus database with same CATH topology
 1WBQ A;  3IU7 A;  2GGB A;  2MAT A;  3CTZ A;  2Q96 A;  1BOA A;  3TAV A;  2GG9 A;  1QXZ A;  2V3Z A;  4S2T P;  2GZ5 A;  3MX6 A;  5CIK A;  4A6V A;  5JI6 A;  3D27 A;  3FMR A;  3FM3 A;  4FUK A;  2Q92 A;  1JAW A;  2GGC A;  2EVC A;  1C21 A;  4Z7M A;  3PKA A;  3Q6D A;  5D6F A;  2GA2 A;  4U70 A;  1KQ9 A;  1B6A A;  3CB6 A;  4U6Z A;  2EA4 A;  5E5B A;  3ROR A;  2BH3 A;  4ZWP A;  3PKC A;  3PKD A;  4PV4 A;  2GU5 A;  1XGO A;  4U69 A;  4U6C A;  4U75 A;  5CDL A;  1M35 A;  4FKC A;  1WLR A;  4IF7 A;  2BWV A;  3FMQ A;  2BHD A;  4FLK A;  2Q93 A;  2B3L A;  2GU6 A;  2V3Y A;  1WL6 A;  3IU9 A;  4IDY A;  2GTX A;  2NQ7 A;  2BHB A;  4B28 A;  2Q94 A;  1O0X A;  1YW9 A;  4IPA A;  4S01 A;  1KQ0 A;  5CDV A;  5JHU A;  3PKE A;  2B3H A;  2BWX A;  3IG4 A;  4U6J A;  4IEC A;  1Y1N A;  5JFR A;  4IKR A;  1QZY A;  4U1B A;  1N51 A;  2DFI A;  1YW8 A;  1XNZ A;  2GU4 A;  1YVM A;  4MAT A;  1XGS A;  2GG3 A;  2IW2 A;  3IU8 A;  4S00 A;  4U6E A;  4OOK A;  4ZWU A;  4R60 A;  4HXX A;  1W2M A;  1WY2 A;  3BIT A;  2G6P A;  2GG8 A;  4KM3 A;  1BN5 A;  2OKN A;  5CLS A;  2B3K A;  2ZSG A;  4JUQ A;  3PKB A;  2V6C A;  1C22 A;  4IKS A;  3TB5 A;  2BWW A;  2P98 A;  1QXW A;  1PV9 A;  2EVM A;  4A6W A;  4RGZ 1;  1WL9 A;  2Q95 A;  4IKT A;  4U71 A;  5CNX A;  2EVO A;  2BWY A;  1YJ3 A;  4QR8 A;  4U6W A;  1MAT A;  1C24 A;  1XGM A;  2V3X A;  4RZZ A;  3CB5 A;  1WN1 A;  2HOW A;  2GG5 A;  4ZWO A;  1C23 A;  4IKU A;  2GG2 A;  3L24 A;  4FO7 A;  1C27 A;  2GU7 A;  2OAZ A;  1R5H A;  1CHM A;  2BHA A;  4IU6 A;  1XGN A;  1YW7 A;  1QXY A;  2BWS A;  2EA2 A;  2BB7 A;  3RVA A;  1WKM A;  1KP0 A;  2Q8K A;  5FCH A;  2ADU A;  3MR1 A;  1R5G A;  1A16 A;  2BN7 A;  3MAT A;  4FLJ A;  5FCF A;  2GG0 A;  2BWT A;  3S6B A;  4PNC A;  3BIP A;  2P99 A;  5CDE A;  5CE6 A;  4FLL A;  2BHC A;  2P9A A;  5D6E A;  4U76 A;  3BIQ A;  4ZNG A;  4U73 A;  4FLI A;  4FO8 A;  4EGE A;  3L7G A;  2BWU A;  2NQ6 A;  1W7V A;  2GG7 A;  1B59 A;  4RZY A;  1R58 A;  4S2R P; 
#chains in the Genus database with same CATH homology
 1WBQ A;  3IU7 A;  2GGB A;  2MAT A;  3CTZ A;  2Q96 A;  1BOA A;  3TAV A;  2GG9 A;  1QXZ A;  2V3Z A;  4S2T P;  2GZ5 A;  3MX6 A;  5CIK A;  4A6V A;  5JI6 A;  3D27 A;  3FMR A;  3FM3 A;  4FUK A;  2Q92 A;  1JAW A;  2GGC A;  2EVC A;  1C21 A;  4Z7M A;  3PKA A;  3Q6D A;  5D6F A;  2GA2 A;  4U70 A;  1KQ9 A;  1B6A A;  3CB6 A;  4U6Z A;  2EA4 A;  5E5B A;  3ROR A;  2BH3 A;  4ZWP A;  3PKC A;  3PKD A;  4PV4 A;  2GU5 A;  1XGO A;  4U69 A;  4U6C A;  4U75 A;  5CDL A;  1M35 A;  4FKC A;  1WLR A;  4IF7 A;  2BWV A;  3FMQ A;  2BHD A;  4FLK A;  2Q93 A;  2B3L A;  2GU6 A;  2V3Y A;  1WL6 A;  3IU9 A;  4IDY A;  2GTX A;  2NQ7 A;  2BHB A;  4B28 A;  2Q94 A;  1O0X A;  1YW9 A;  4IPA A;  4S01 A;  1KQ0 A;  5CDV A;  5JHU A;  3PKE A;  2B3H A;  2BWX A;  3IG4 A;  4U6J A;  4IEC A;  1Y1N A;  5JFR A;  4IKR A;  1QZY A;  4U1B A;  1N51 A;  2DFI A;  1YW8 A;  1XNZ A;  2GU4 A;  1YVM A;  4MAT A;  1XGS A;  2GG3 A;  2IW2 A;  3IU8 A;  4S00 A;  4U6E A;  4OOK A;  4ZWU A;  4R60 A;  4HXX A;  1W2M A;  1WY2 A;  3BIT A;  2G6P A;  2GG8 A;  4KM3 A;  1BN5 A;  2OKN A;  5CLS A;  2B3K A;  2ZSG A;  4JUQ A;  3PKB A;  2V6C A;  1C22 A;  4IKS A;  3TB5 A;  2BWW A;  2P98 A;  1QXW A;  1PV9 A;  2EVM A;  4A6W A;  4RGZ 1;  1WL9 A;  2Q95 A;  4IKT A;  4U71 A;  5CNX A;  2EVO A;  2BWY A;  1YJ3 A;  4QR8 A;  4U6W A;  1MAT A;  1C24 A;  1XGM A;  2V3X A;  4RZZ A;  3CB5 A;  1WN1 A;  2HOW A;  2GG5 A;  4ZWO A;  1C23 A;  4IKU A;  2GG2 A;  3L24 A;  4FO7 A;  1C27 A;  2GU7 A;  2OAZ A;  1R5H A;  1CHM A;  2BHA A;  4IU6 A;  1XGN A;  1YW7 A;  1QXY A;  2BWS A;  2EA2 A;  2BB7 A;  3RVA A;  1WKM A;  1KP0 A;  2Q8K A;  5FCH A;  2ADU A;  3MR1 A;  1R5G A;  1A16 A;  2BN7 A;  3MAT A;  4FLJ A;  5FCF A;  2GG0 A;  2BWT A;  3S6B A;  4PNC A;  3BIP A;  2P99 A;  5CDE A;  5CE6 A;  4FLL A;  2BHC A;  2P9A A;  5D6E A;  4U76 A;  3BIQ A;  4ZNG A;  4U73 A;  4FLI A;  4FO8 A;  4EGE A;  3L7G A;  2BWU A;  2NQ6 A;  1W7V A;  2GG7 A;  1B59 A;  4RZY A;  1R58 A;  4S2R P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...