2EVMA

Crystal structure of methionine aminopeptidase in complex with 5-(2,5-dichlorophenyl)furan-2-carboxylic acid
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
259
structure length
259
Chain Sequence
SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural analysis of metalloform-selective inhibition of methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 86
structure length 259
sequence length 259
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2evmA00
2Q92A 4RZYA 4IKUA 4ZWUA 1KP0A 3PKAA 1R5HA 3IU9A 2GA2A 4ZNGA 2EA2A 4IU6A 2DFIA 1C24A 2IW2A 4JUQA 4B28A 2V3ZA 5CLSA 3TB5A 2BWUA 2BHDA 3MX6A 4S2TP 4HXXA 4OOKA 1YW9A 3PKBA 1WBQA 3FMQA 3MATA 3PKEA 4RGZ1 4U73A 4IPAA 4U6WA 1A16A 4U6JA 1QXWA 4A6VA 2OKNA 1BOAA 2BN7A 2OAZA 4KM3A 2Q8KA 2GTXA 2NQ7A 2Q93A 1CHMA 3FMRA 1QXZA 1QXYA 4IF7A 1WLRA 2MATA 4IKTA 5JFRA 5CNXA 1YJ3A 1O0XA 2Q94A 3PKDA 4QR8A 2GU5A 4U71A 2BB7A 4U76A 2BWTA 5CE6A 1W2MA 2BHCA 3CB6A 1C21A 1BN5A 4U70A 1XGSA 1XNZA 4S01A 4S2RP 2V6CA 1WL6A 3MR1A 4IKSA 2GU7A 4U6ZA 1B6AA 5CDVA 1XGNA 2BHBA 2NQ6A 3FM3A 2GG3A 1W7VA 5E5BA 4Z7MA 2GZ5A 2GG9A 2ZSGA 1WY2A 2GG5A 3CTZA 5FCHA 3IU8A 4FLJA 2G6PA 1C23A 1YW8A 5CDEA 4IKRA 1YVMA 2B3HA 1QZYA 4EGEA 1MATA 1YW7A 2GGBA 4U6CA 4U1BA 5JI6A 4ZWPA 4FLKA 4FO8A 3D27A 3BITA 3IG4A 4IDYA 2P9AA 5FCFA 4ZWOA 3Q6DA 2EVMA 3CB5A 2BWSA 3L24A 1WKMA 2BH3A 4U75A 4PNCA 2BWWA 2EA4A 2GGCA 5CDLA 5D6FA 3IU7A 3BIPA 2EVOA 1Y1NA 2P98A 4FO7A 3TAVA 2Q96A 3S6BA 1B59A 3RORA 2GU6A 2P99A 4PV4A 3RVAA 1PV9A 2GG2A 2EVCA 4FLLA 3L7GA 4A6WA 2Q95A 2V3YA 4U6EA 4U69A 1WN1A 2BHAA 1JAWA 1XGMA 5D6EA 5CIKA 1R58A 4R60A 2GG7A 2HOWA 4RZZA 5JHUA 2B3KA 2GG8A 1KQ9A 1M35A 1KQ0A 1N51A 2ADUA 2BWVA 2BWXA 1R5GA 2B3LA 2GU4A 2BWYA 1C27A 4MATA 4IECA 3PKCA 2GG0A 1WL9A 2V3XA 4FKCA 4FLIA 4FUKA 3BIQA 4S00A 1XGOA 1C22A
chains in the Genus database with same CATH superfamily
2Q92A 4RZYA 4IKUA 4ZWUA 1KP0A 3PKAA 1R5HA 3IU9A 2GA2A 4ZNGA 2EA2A 4IU6A 2DFIA 1C24A 2IW2A 4JUQA 4B28A 2V3ZA 5CLSA 3TB5A 2BWUA 2BHDA 3MX6A 4S2TP 4HXXA 4OOKA 1YW9A 3PKBA 1WBQA 3FMQA 3MATA 3PKEA 4RGZ1 4U73A 4IPAA 4U6WA 1A16A 4U6JA 1QXWA 4A6VA 2OKNA 1BOAA 2BN7A 2OAZA 4KM3A 2Q8KA 2GTXA 2NQ7A 2Q93A 1CHMA 3FMRA 1QXZA 1QXYA 4IF7A 1WLRA 2MATA 4IKTA 5JFRA 5CNXA 1YJ3A 1O0XA 2Q94A 3PKDA 4QR8A 2GU5A 4U71A 2BB7A 4U76A 2BWTA 5CE6A 1W2MA 2BHCA 3CB6A 1C21A 1BN5A 4U70A 1XGSA 1XNZA 4S01A 4S2RP 2V6CA 1WL6A 3MR1A 4IKSA 2GU7A 4U6ZA 1B6AA 5CDVA 1XGNA 2BHBA 2NQ6A 3FM3A 2GG3A 1W7VA 5E5BA 4Z7MA 2GZ5A 2GG9A 2ZSGA 1WY2A 2GG5A 3CTZA 5FCHA 3IU8A 4FLJA 2G6PA 1C23A 1YW8A 5CDEA 4IKRA 1YVMA 2B3HA 1QZYA 4EGEA 1MATA 1YW7A 2GGBA 4U6CA 4U1BA 5JI6A 4ZWPA 4FLKA 4FO8A 3D27A 3BITA 3IG4A 4IDYA 2P9AA 5FCFA 4ZWOA 3Q6DA 2EVMA 3CB5A 2BWSA 3L24A 1WKMA 2BH3A 4U75A 4PNCA 2BWWA 2EA4A 2GGCA 5CDLA 5D6FA 3IU7A 3BIPA 2EVOA 1Y1NA 2P98A 4FO7A 3TAVA 2Q96A 3S6BA 1B59A 3RORA 2GU6A 2P99A 4PV4A 3RVAA 1PV9A 2GG2A 2EVCA 4FLLA 3L7GA 4A6WA 2Q95A 2V3YA 4U6EA 4U69A 1WN1A 2BHAA 1JAWA 1XGMA 5D6EA 5CIKA 1R58A 4R60A 2GG7A 2HOWA 4RZZA 5JHUA 2B3KA 2GG8A 1KQ9A 1M35A 1KQ0A 1N51A 2ADUA 2BWVA 2BWXA 1R5GA 2B3LA 2GU4A 2BWYA 1C27A 4MATA 4IECA 3PKCA 2GG0A 1WL9A 2V3XA 4FKCA 4FLIA 4FUKA 3BIQA 4S00A 1XGOA 1C22A
chains in the Genus database with same CATH topology
2Q92A 4RZYA 4IKUA 4ZWUA 1KP0A 3PKAA 1R5HA 3IU9A 2GA2A 4ZNGA 2EA2A 4IU6A 2DFIA 1C24A 2IW2A 4JUQA 4B28A 2V3ZA 5CLSA 3TB5A 2BWUA 2BHDA 3MX6A 4S2TP 4HXXA 4OOKA 1YW9A 3PKBA 1WBQA 3FMQA 3MATA 3PKEA 4RGZ1 4U73A 4IPAA 4U6WA 1A16A 4U6JA 1QXWA 4A6VA 2OKNA 1BOAA 2BN7A 2OAZA 4KM3A 2Q8KA 2GTXA 2NQ7A 2Q93A 1CHMA 3FMRA 1QXZA 1QXYA 4IF7A 1WLRA 2MATA 4IKTA 5JFRA 5CNXA 1YJ3A 1O0XA 2Q94A 3PKDA 4QR8A 2GU5A 4U71A 2BB7A 4U76A 2BWTA 5CE6A 1W2MA 2BHCA 3CB6A 1C21A 1BN5A 4U70A 1XGSA 1XNZA 4S01A 4S2RP 2V6CA 1WL6A 3MR1A 4IKSA 2GU7A 4U6ZA 1B6AA 5CDVA 1XGNA 2BHBA 2NQ6A 3FM3A 2GG3A 1W7VA 5E5BA 4Z7MA 2GZ5A 2GG9A 2ZSGA 1WY2A 2GG5A 3CTZA 5FCHA 3IU8A 4FLJA 2G6PA 1C23A 1YW8A 5CDEA 4IKRA 1YVMA 2B3HA 1QZYA 4EGEA 1MATA 1YW7A 2GGBA 4U6CA 4U1BA 5JI6A 4ZWPA 4FLKA 4FO8A 3D27A 3BITA 3IG4A 4IDYA 2P9AA 5FCFA 4ZWOA 3Q6DA 2EVMA 3CB5A 2BWSA 3L24A 1WKMA 2BH3A 4U75A 4PNCA 2BWWA 2EA4A 2GGCA 5CDLA 5D6FA 3IU7A 3BIPA 2EVOA 1Y1NA 2P98A 4FO7A 3TAVA 2Q96A 3S6BA 1B59A 3RORA 2GU6A 2P99A 4PV4A 3RVAA 1PV9A 2GG2A 2EVCA 4FLLA 3L7GA 4A6WA 2Q95A 2V3YA 4U6EA 4U69A 1WN1A 2BHAA 1JAWA 1XGMA 5D6EA 5CIKA 1R58A 4R60A 2GG7A 2HOWA 4RZZA 5JHUA 2B3KA 2GG8A 1KQ9A 1M35A 1KQ0A 1N51A 2ADUA 2BWVA 2BWXA 1R5GA 2B3LA 2GU4A 2BWYA 1C27A 4MATA 4IECA 3PKCA 2GG0A 1WL9A 2V3XA 4FKCA 4FLIA 4FUKA 3BIQA 4S00A 1XGOA 1C22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q92 A;  4RZY A;  4IKU A;  4ZWU A;  1KP0 A;  3PKA A;  1R5H A;  3IU9 A;  2GA2 A;  4ZNG A;  2EA2 A;  4IU6 A;  2DFI A;  1C24 A;  2IW2 A;  4JUQ A;  4B28 A;  2V3Z A;  5CLS A;  3TB5 A;  2BWU A;  2BHD A;  3MX6 A;  4S2T P;  4HXX A;  4OOK A;  1YW9 A;  3PKB A;  1WBQ A;  3FMQ A;  3MAT A;  3PKE A;  4RGZ 1;  4U73 A;  4IPA A;  4U6W A;  1A16 A;  4U6J A;  1QXW A;  4A6V A;  2OKN A;  1BOA A;  2BN7 A;  2OAZ A;  4KM3 A;  2Q8K A;  2GTX A;  2NQ7 A;  2Q93 A;  1CHM A;  3FMR A;  1QXZ A;  1QXY A;  4IF7 A;  1WLR A;  2MAT A;  4IKT A;  5JFR A;  5CNX A;  1YJ3 A;  1O0X A;  2Q94 A;  3PKD A;  4QR8 A;  2GU5 A;  4U71 A;  2BB7 A;  4U76 A;  2BWT A;  5CE6 A;  1W2M A;  2BHC A;  3CB6 A;  1C21 A;  1BN5 A;  4U70 A;  1XGS A;  1XNZ A;  4S01 A;  4S2R P;  2V6C A;  1WL6 A;  3MR1 A;  4IKS A;  2GU7 A;  4U6Z A;  1B6A A;  5CDV A;  1XGN A;  2BHB A;  2NQ6 A;  3FM3 A;  2GG3 A;  1W7V A;  5E5B A;  4Z7M A;  2GZ5 A;  2GG9 A;  2ZSG A;  1WY2 A;  2GG5 A;  3CTZ A;  5FCH A;  3IU8 A;  4FLJ A;  2G6P A;  1C23 A;  1YW8 A;  5CDE A;  4IKR A;  1YVM A;  2B3H A;  1QZY A;  4EGE A;  1MAT A;  1YW7 A;  2GGB A;  4U6C A;  4U1B A;  5JI6 A;  4ZWP A;  4FLK A;  4FO8 A;  3D27 A;  3BIT A;  3IG4 A;  4IDY A;  2P9A A;  5FCF A;  4ZWO A;  3Q6D A;  2EVM A;  3CB5 A;  2BWS A;  3L24 A;  1WKM A;  2BH3 A;  4U75 A;  4PNC A;  2BWW A;  2EA4 A;  2GGC A;  5CDL A;  5D6F A;  3IU7 A;  3BIP A;  2EVO A;  1Y1N A;  2P98 A;  4FO7 A;  3TAV A;  2Q96 A;  3S6B A;  1B59 A;  3ROR A;  2GU6 A;  2P99 A;  4PV4 A;  3RVA A;  1PV9 A;  2GG2 A;  2EVC A;  4FLL A;  3L7G A;  4A6W A;  2Q95 A;  2V3Y A;  4U6E A;  4U69 A;  1WN1 A;  2BHA A;  1JAW A;  1XGM A;  5D6E A;  5CIK A;  1R58 A;  4R60 A;  2GG7 A;  2HOW A;  4RZZ A;  5JHU A;  2B3K A;  2GG8 A;  1KQ9 A;  1M35 A;  1KQ0 A;  1N51 A;  2ADU A;  2BWV A;  2BWX A;  1R5G A;  2B3L A;  2GU4 A;  2BWY A;  1C27 A;  4MAT A;  4IEC A;  3PKC A;  2GG0 A;  1WL9 A;  2V3X A;  4FKC A;  4FLI A;  4FUK A;  3BIQ A;  4S00 A;  1XGO A;  1C22 A; 
#chains in the Genus database with same CATH topology
 2Q92 A;  4RZY A;  4IKU A;  4ZWU A;  1KP0 A;  3PKA A;  1R5H A;  3IU9 A;  2GA2 A;  4ZNG A;  2EA2 A;  4IU6 A;  2DFI A;  1C24 A;  2IW2 A;  4JUQ A;  4B28 A;  2V3Z A;  5CLS A;  3TB5 A;  2BWU A;  2BHD A;  3MX6 A;  4S2T P;  4HXX A;  4OOK A;  1YW9 A;  3PKB A;  1WBQ A;  3FMQ A;  3MAT A;  3PKE A;  4RGZ 1;  4U73 A;  4IPA A;  4U6W A;  1A16 A;  4U6J A;  1QXW A;  4A6V A;  2OKN A;  1BOA A;  2BN7 A;  2OAZ A;  4KM3 A;  2Q8K A;  2GTX A;  2NQ7 A;  2Q93 A;  1CHM A;  3FMR A;  1QXZ A;  1QXY A;  4IF7 A;  1WLR A;  2MAT A;  4IKT A;  5JFR A;  5CNX A;  1YJ3 A;  1O0X A;  2Q94 A;  3PKD A;  4QR8 A;  2GU5 A;  4U71 A;  2BB7 A;  4U76 A;  2BWT A;  5CE6 A;  1W2M A;  2BHC A;  3CB6 A;  1C21 A;  1BN5 A;  4U70 A;  1XGS A;  1XNZ A;  4S01 A;  4S2R P;  2V6C A;  1WL6 A;  3MR1 A;  4IKS A;  2GU7 A;  4U6Z A;  1B6A A;  5CDV A;  1XGN A;  2BHB A;  2NQ6 A;  3FM3 A;  2GG3 A;  1W7V A;  5E5B A;  4Z7M A;  2GZ5 A;  2GG9 A;  2ZSG A;  1WY2 A;  2GG5 A;  3CTZ A;  5FCH A;  3IU8 A;  4FLJ A;  2G6P A;  1C23 A;  1YW8 A;  5CDE A;  4IKR A;  1YVM A;  2B3H A;  1QZY A;  4EGE A;  1MAT A;  1YW7 A;  2GGB A;  4U6C A;  4U1B A;  5JI6 A;  4ZWP A;  4FLK A;  4FO8 A;  3D27 A;  3BIT A;  3IG4 A;  4IDY A;  2P9A A;  5FCF A;  4ZWO A;  3Q6D A;  2EVM A;  3CB5 A;  2BWS A;  3L24 A;  1WKM A;  2BH3 A;  4U75 A;  4PNC A;  2BWW A;  2EA4 A;  2GGC A;  5CDL A;  5D6F A;  3IU7 A;  3BIP A;  2EVO A;  1Y1N A;  2P98 A;  4FO7 A;  3TAV A;  2Q96 A;  3S6B A;  1B59 A;  3ROR A;  2GU6 A;  2P99 A;  4PV4 A;  3RVA A;  1PV9 A;  2GG2 A;  2EVC A;  4FLL A;  3L7G A;  4A6W A;  2Q95 A;  2V3Y A;  4U6E A;  4U69 A;  1WN1 A;  2BHA A;  1JAW A;  1XGM A;  5D6E A;  5CIK A;  1R58 A;  4R60 A;  2GG7 A;  2HOW A;  4RZZ A;  5JHU A;  2B3K A;  2GG8 A;  1KQ9 A;  1M35 A;  1KQ0 A;  1N51 A;  2ADU A;  2BWV A;  2BWX A;  1R5G A;  2B3L A;  2GU4 A;  2BWY A;  1C27 A;  4MAT A;  4IEC A;  3PKC A;  2GG0 A;  1WL9 A;  2V3X A;  4FKC A;  4FLI A;  4FUK A;  3BIQ A;  4S00 A;  1XGO A;  1C22 A; 
#chains in the Genus database with same CATH homology
 2Q92 A;  4RZY A;  4IKU A;  4ZWU A;  1KP0 A;  3PKA A;  1R5H A;  3IU9 A;  2GA2 A;  4ZNG A;  2EA2 A;  4IU6 A;  2DFI A;  1C24 A;  2IW2 A;  4JUQ A;  4B28 A;  2V3Z A;  5CLS A;  3TB5 A;  2BWU A;  2BHD A;  3MX6 A;  4S2T P;  4HXX A;  4OOK A;  1YW9 A;  3PKB A;  1WBQ A;  3FMQ A;  3MAT A;  3PKE A;  4RGZ 1;  4U73 A;  4IPA A;  4U6W A;  1A16 A;  4U6J A;  1QXW A;  4A6V A;  2OKN A;  1BOA A;  2BN7 A;  2OAZ A;  4KM3 A;  2Q8K A;  2GTX A;  2NQ7 A;  2Q93 A;  1CHM A;  3FMR A;  1QXZ A;  1QXY A;  4IF7 A;  1WLR A;  2MAT A;  4IKT A;  5JFR A;  5CNX A;  1YJ3 A;  1O0X A;  2Q94 A;  3PKD A;  4QR8 A;  2GU5 A;  4U71 A;  2BB7 A;  4U76 A;  2BWT A;  5CE6 A;  1W2M A;  2BHC A;  3CB6 A;  1C21 A;  1BN5 A;  4U70 A;  1XGS A;  1XNZ A;  4S01 A;  4S2R P;  2V6C A;  1WL6 A;  3MR1 A;  4IKS A;  2GU7 A;  4U6Z A;  1B6A A;  5CDV A;  1XGN A;  2BHB A;  2NQ6 A;  3FM3 A;  2GG3 A;  1W7V A;  5E5B A;  4Z7M A;  2GZ5 A;  2GG9 A;  2ZSG A;  1WY2 A;  2GG5 A;  3CTZ A;  5FCH A;  3IU8 A;  4FLJ A;  2G6P A;  1C23 A;  1YW8 A;  5CDE A;  4IKR A;  1YVM A;  2B3H A;  1QZY A;  4EGE A;  1MAT A;  1YW7 A;  2GGB A;  4U6C A;  4U1B A;  5JI6 A;  4ZWP A;  4FLK A;  4FO8 A;  3D27 A;  3BIT A;  3IG4 A;  4IDY A;  2P9A A;  5FCF A;  4ZWO A;  3Q6D A;  2EVM A;  3CB5 A;  2BWS A;  3L24 A;  1WKM A;  2BH3 A;  4U75 A;  4PNC A;  2BWW A;  2EA4 A;  2GGC A;  5CDL A;  5D6F A;  3IU7 A;  3BIP A;  2EVO A;  1Y1N A;  2P98 A;  4FO7 A;  3TAV A;  2Q96 A;  3S6B A;  1B59 A;  3ROR A;  2GU6 A;  2P99 A;  4PV4 A;  3RVA A;  1PV9 A;  2GG2 A;  2EVC A;  4FLL A;  3L7G A;  4A6W A;  2Q95 A;  2V3Y A;  4U6E A;  4U69 A;  1WN1 A;  2BHA A;  1JAW A;  1XGM A;  5D6E A;  5CIK A;  1R58 A;  4R60 A;  2GG7 A;  2HOW A;  4RZZ A;  5JHU A;  2B3K A;  2GG8 A;  1KQ9 A;  1M35 A;  1KQ0 A;  1N51 A;  2ADU A;  2BWV A;  2BWX A;  1R5G A;  2B3L A;  2GU4 A;  2BWY A;  1C27 A;  4MAT A;  4IEC A;  3PKC A;  2GG0 A;  1WL9 A;  2V3X A;  4FKC A;  4FLI A;  4FUK A;  3BIQ A;  4S00 A;  1XGO A;  1C22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...