2EVMA

Crystal structure of methionine aminopeptidase in complex with 5-(2,5-dichlorophenyl)furan-2-carboxylic acid
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
259
structure length
259
Chain Sequence
b'SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Structural analysis of metalloform-selective inhibition of methionine aminopeptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 86
structure length 259
sequence length 259
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2evmA00
2EA4A 4R60A 4U6ZA 1JAWA 2B3HA 2BWYA 2Q8KA 5E5BA 5CIKA 1YW9A 5D6EA 2EVCA 3PKEA 2GU4A 5CLSA 2BWXA 4IKTA 3D27A 4ZWOA 2DFIA 2Q96A 2V3XA 2GG0A 4FLKA 2NQ6A 2BWSA 4S00A 1XGOA 1MATA 1C21A 3FMRA 1QXZA 4JUQA 5CDEA 2BHAA 3CTZA 2GTXA 4FUKA 1C22A 4IPAA 2GGBA 3TB5A 3CB5A 3RORA 2EA2A 4FKCA 3PKBA 2BN7A 2P99A 1XNZA 1M35A 4PNCA 2V6CA 4MATA 1WLRA 4U70A 1PV9A 2Q93A 1QZYA 2Q95A 4FLLA 5JHUA 2BB7A 2BHBA 2OAZA 4U71A 4U1BA 4A6WA 2B3LA 1QXWA 1YVMA 2P9AA 1BOAA 2EVOA 1BN5A 4HXXA 3IU9A 4FLIA 4B28A 3PKCA 1XGMA 2IW2A 3Q6DA 2EVMA 4FO7A 4U6JA 1R58A 4A6VA 3IG4A 2GU5A 1XGSA 4S2RP 2Q92A 2BWUA 1XGNA 4KM3A 4QR8A 3RVAA 1KQ9A 2GG5A 2GG9A 3PKDA 2BWTA 3FM3A 4U76A 3MR1A 4OOKA 4RZYA 2GU6A 1WL6A 3BIPA 1C27A 1A16A 1B6AA 5CNXA 4IDYA 4IKRA 1CHMA 1YJ3A 2B3KA 2GG8A 2V3ZA 4IF7A 5FCFA 5CE6A 2GGCA 3BIQA 2BWVA 3L24A 4IKSA 1QXYA 1O0XA 2GG3A 1YW8A 2OKNA 1WY2A 4FLJA 2BWWA 2BH3A 4EGEA 1WBQA 4ZNGA 2GZ5A 1W2MA 3BITA 2P98A 3FMQA 4IKUA 1WN1A 4ZWPA 4ZWUA 4IECA 5CDLA 1C24A 3CB6A 2ADUA 3MX6A 3TAVA 2HOWA 2V3YA 4U6EA 2NQ7A 4RZZA 1YW7A 4U73A 1C23A 4U6CA 4IU6A 2GU7A 4U6WA 3IU8A 1WKMA 2G6PA 2ZSGA 4FO8A 4U69A 3L7GA 3IU7A 4Z7MA 2BHDA 5FCHA 2MATA 1R5HA 4PV4A 1R5GA 2GG7A 1B59A 1WL9A 5JI6A 3S6BA 1KQ0A 3PKAA 1Y1NA 1KP0A 1W7VA 4U75A 2GA2A 5CDVA 1N51A 5D6FA 2GG2A 3MATA 4RGZ1 4S01A 4S2TP 5JFRA 2Q94A 2BHCA
chains in the Genus database with same CATH superfamily
2EA4A 4R60A 4U6ZA 1JAWA 2B3HA 2BWYA 2Q8KA 5E5BA 5CIKA 1YW9A 5D6EA 2EVCA 3PKEA 2GU4A 5CLSA 2BWXA 4IKTA 3D27A 4ZWOA 2DFIA 2Q96A 2V3XA 2GG0A 4FLKA 2NQ6A 2BWSA 4S00A 1XGOA 1MATA 1C21A 3FMRA 1QXZA 4JUQA 5CDEA 2BHAA 3CTZA 2GTXA 4FUKA 1C22A 4IPAA 2GGBA 3TB5A 3CB5A 3RORA 2EA2A 4FKCA 3PKBA 2BN7A 2P99A 1XNZA 1M35A 4PNCA 2V6CA 4MATA 1WLRA 4U70A 1PV9A 2Q93A 1QZYA 2Q95A 4FLLA 5JHUA 2BB7A 2BHBA 2OAZA 4U71A 4U1BA 4A6WA 2B3LA 1QXWA 1YVMA 2P9AA 1BOAA 2EVOA 1BN5A 4HXXA 3IU9A 4FLIA 4B28A 3PKCA 1XGMA 2IW2A 3Q6DA 2EVMA 4FO7A 4U6JA 1R58A 4A6VA 3IG4A 2GU5A 1XGSA 4S2RP 2Q92A 2BWUA 1XGNA 4KM3A 4QR8A 3RVAA 1KQ9A 2GG5A 2GG9A 3PKDA 2BWTA 3FM3A 4U76A 3MR1A 4OOKA 4RZYA 2GU6A 1WL6A 3BIPA 1C27A 1A16A 1B6AA 5CNXA 4IDYA 4IKRA 1CHMA 1YJ3A 2B3KA 2GG8A 2V3ZA 4IF7A 5FCFA 5CE6A 2GGCA 3BIQA 2BWVA 3L24A 4IKSA 1QXYA 1O0XA 2GG3A 1YW8A 2OKNA 1WY2A 4FLJA 2BWWA 2BH3A 4EGEA 1WBQA 4ZNGA 2GZ5A 1W2MA 3BITA 2P98A 3FMQA 4IKUA 1WN1A 4ZWPA 4ZWUA 4IECA 5CDLA 1C24A 3CB6A 2ADUA 3MX6A 3TAVA 2HOWA 2V3YA 4U6EA 2NQ7A 4RZZA 1YW7A 4U73A 1C23A 4U6CA 4IU6A 2GU7A 4U6WA 3IU8A 1WKMA 2G6PA 2ZSGA 4FO8A 4U69A 3L7GA 3IU7A 4Z7MA 2BHDA 5FCHA 2MATA 1R5HA 4PV4A 1R5GA 2GG7A 1B59A 1WL9A 5JI6A 3S6BA 1KQ0A 3PKAA 1Y1NA 1KP0A 1W7VA 4U75A 2GA2A 5CDVA 1N51A 5D6FA 2GG2A 3MATA 4RGZ1 4S01A 4S2TP 5JFRA 2Q94A 2BHCA
chains in the Genus database with same CATH topology
2EA4A 4R60A 4U6ZA 1JAWA 2B3HA 2BWYA 2Q8KA 5E5BA 5CIKA 1YW9A 5D6EA 2EVCA 3PKEA 2GU4A 5CLSA 2BWXA 4IKTA 3D27A 4ZWOA 2DFIA 2Q96A 2V3XA 2GG0A 4FLKA 2NQ6A 2BWSA 4S00A 1XGOA 1MATA 1C21A 3FMRA 1QXZA 4JUQA 5CDEA 2BHAA 3CTZA 2GTXA 4FUKA 1C22A 4IPAA 2GGBA 3TB5A 3CB5A 3RORA 2EA2A 4FKCA 3PKBA 2BN7A 2P99A 1XNZA 1M35A 4PNCA 2V6CA 4MATA 1WLRA 4U70A 1PV9A 2Q93A 1QZYA 2Q95A 4FLLA 5JHUA 2BB7A 2BHBA 2OAZA 4U71A 4U1BA 4A6WA 2B3LA 1QXWA 1YVMA 2P9AA 1BOAA 2EVOA 1BN5A 4HXXA 3IU9A 4FLIA 4B28A 3PKCA 1XGMA 2IW2A 3Q6DA 2EVMA 4FO7A 4U6JA 1R58A 4A6VA 3IG4A 2GU5A 1XGSA 4S2RP 2Q92A 2BWUA 1XGNA 4KM3A 4QR8A 3RVAA 1KQ9A 2GG5A 2GG9A 3PKDA 2BWTA 3FM3A 4U76A 3MR1A 4OOKA 4RZYA 2GU6A 1WL6A 3BIPA 1C27A 1A16A 1B6AA 5CNXA 4IDYA 4IKRA 1CHMA 1YJ3A 2B3KA 2GG8A 2V3ZA 4IF7A 5FCFA 5CE6A 2GGCA 3BIQA 2BWVA 3L24A 4IKSA 1QXYA 1O0XA 2GG3A 1YW8A 2OKNA 1WY2A 4FLJA 2BWWA 2BH3A 4EGEA 1WBQA 4ZNGA 2GZ5A 1W2MA 3BITA 2P98A 3FMQA 4IKUA 1WN1A 4ZWPA 4ZWUA 4IECA 5CDLA 1C24A 3CB6A 2ADUA 3MX6A 3TAVA 2HOWA 2V3YA 4U6EA 2NQ7A 4RZZA 1YW7A 4U73A 1C23A 4U6CA 4IU6A 2GU7A 4U6WA 3IU8A 1WKMA 2G6PA 2ZSGA 4FO8A 4U69A 3L7GA 3IU7A 4Z7MA 2BHDA 5FCHA 2MATA 1R5HA 4PV4A 1R5GA 2GG7A 1B59A 1WL9A 5JI6A 3S6BA 1KQ0A 3PKAA 1Y1NA 1KP0A 1W7VA 4U75A 2GA2A 5CDVA 1N51A 5D6FA 2GG2A 3MATA 4RGZ1 4S01A 4S2TP 5JFRA 2Q94A 2BHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EA4 A;  4R60 A;  4U6Z A;  1JAW A;  2B3H A;  2BWY A;  2Q8K A;  5E5B A;  5CIK A;  1YW9 A;  5D6E A;  2EVC A;  3PKE A;  2GU4 A;  5CLS A;  2BWX A;  4IKT A;  3D27 A;  4ZWO A;  2DFI A;  2Q96 A;  2V3X A;  2GG0 A;  4FLK A;  2NQ6 A;  2BWS A;  4S00 A;  1XGO A;  1MAT A;  1C21 A;  3FMR A;  1QXZ A;  4JUQ A;  5CDE A;  2BHA A;  3CTZ A;  2GTX A;  4FUK A;  1C22 A;  4IPA A;  2GGB A;  3TB5 A;  3CB5 A;  3ROR A;  2EA2 A;  4FKC A;  3PKB A;  2BN7 A;  2P99 A;  1XNZ A;  1M35 A;  4PNC A;  2V6C A;  4MAT A;  1WLR A;  4U70 A;  1PV9 A;  2Q93 A;  1QZY A;  2Q95 A;  4FLL A;  5JHU A;  2BB7 A;  2BHB A;  2OAZ A;  4U71 A;  4U1B A;  4A6W A;  2B3L A;  1QXW A;  1YVM A;  2P9A A;  1BOA A;  2EVO A;  1BN5 A;  4HXX A;  3IU9 A;  4FLI A;  4B28 A;  3PKC A;  1XGM A;  2IW2 A;  3Q6D A;  2EVM A;  4FO7 A;  4U6J A;  1R58 A;  4A6V A;  3IG4 A;  2GU5 A;  1XGS A;  4S2R P;  2Q92 A;  2BWU A;  1XGN A;  4KM3 A;  4QR8 A;  3RVA A;  1KQ9 A;  2GG5 A;  2GG9 A;  3PKD A;  2BWT A;  3FM3 A;  4U76 A;  3MR1 A;  4OOK A;  4RZY A;  2GU6 A;  1WL6 A;  3BIP A;  1C27 A;  1A16 A;  1B6A A;  5CNX A;  4IDY A;  4IKR A;  1CHM A;  1YJ3 A;  2B3K A;  2GG8 A;  2V3Z A;  4IF7 A;  5FCF A;  5CE6 A;  2GGC A;  3BIQ A;  2BWV A;  3L24 A;  4IKS A;  1QXY A;  1O0X A;  2GG3 A;  1YW8 A;  2OKN A;  1WY2 A;  4FLJ A;  2BWW A;  2BH3 A;  4EGE A;  1WBQ A;  4ZNG A;  2GZ5 A;  1W2M A;  3BIT A;  2P98 A;  3FMQ A;  4IKU A;  1WN1 A;  4ZWP A;  4ZWU A;  4IEC A;  5CDL A;  1C24 A;  3CB6 A;  2ADU A;  3MX6 A;  3TAV A;  2HOW A;  2V3Y A;  4U6E A;  2NQ7 A;  4RZZ A;  1YW7 A;  4U73 A;  1C23 A;  4U6C A;  4IU6 A;  2GU7 A;  4U6W A;  3IU8 A;  1WKM A;  2G6P A;  2ZSG A;  4FO8 A;  4U69 A;  3L7G A;  3IU7 A;  4Z7M A;  2BHD A;  5FCH A;  2MAT A;  1R5H A;  4PV4 A;  1R5G A;  2GG7 A;  1B59 A;  1WL9 A;  5JI6 A;  3S6B A;  1KQ0 A;  3PKA A;  1Y1N A;  1KP0 A;  1W7V A;  4U75 A;  2GA2 A;  5CDV A;  1N51 A;  5D6F A;  2GG2 A;  3MAT A;  4RGZ 1;  4S01 A;  4S2T P;  5JFR A;  2Q94 A;  2BHC A; 
#chains in the Genus database with same CATH topology
 2EA4 A;  4R60 A;  4U6Z A;  1JAW A;  2B3H A;  2BWY A;  2Q8K A;  5E5B A;  5CIK A;  1YW9 A;  5D6E A;  2EVC A;  3PKE A;  2GU4 A;  5CLS A;  2BWX A;  4IKT A;  3D27 A;  4ZWO A;  2DFI A;  2Q96 A;  2V3X A;  2GG0 A;  4FLK A;  2NQ6 A;  2BWS A;  4S00 A;  1XGO A;  1MAT A;  1C21 A;  3FMR A;  1QXZ A;  4JUQ A;  5CDE A;  2BHA A;  3CTZ A;  2GTX A;  4FUK A;  1C22 A;  4IPA A;  2GGB A;  3TB5 A;  3CB5 A;  3ROR A;  2EA2 A;  4FKC A;  3PKB A;  2BN7 A;  2P99 A;  1XNZ A;  1M35 A;  4PNC A;  2V6C A;  4MAT A;  1WLR A;  4U70 A;  1PV9 A;  2Q93 A;  1QZY A;  2Q95 A;  4FLL A;  5JHU A;  2BB7 A;  2BHB A;  2OAZ A;  4U71 A;  4U1B A;  4A6W A;  2B3L A;  1QXW A;  1YVM A;  2P9A A;  1BOA A;  2EVO A;  1BN5 A;  4HXX A;  3IU9 A;  4FLI A;  4B28 A;  3PKC A;  1XGM A;  2IW2 A;  3Q6D A;  2EVM A;  4FO7 A;  4U6J A;  1R58 A;  4A6V A;  3IG4 A;  2GU5 A;  1XGS A;  4S2R P;  2Q92 A;  2BWU A;  1XGN A;  4KM3 A;  4QR8 A;  3RVA A;  1KQ9 A;  2GG5 A;  2GG9 A;  3PKD A;  2BWT A;  3FM3 A;  4U76 A;  3MR1 A;  4OOK A;  4RZY A;  2GU6 A;  1WL6 A;  3BIP A;  1C27 A;  1A16 A;  1B6A A;  5CNX A;  4IDY A;  4IKR A;  1CHM A;  1YJ3 A;  2B3K A;  2GG8 A;  2V3Z A;  4IF7 A;  5FCF A;  5CE6 A;  2GGC A;  3BIQ A;  2BWV A;  3L24 A;  4IKS A;  1QXY A;  1O0X A;  2GG3 A;  1YW8 A;  2OKN A;  1WY2 A;  4FLJ A;  2BWW A;  2BH3 A;  4EGE A;  1WBQ A;  4ZNG A;  2GZ5 A;  1W2M A;  3BIT A;  2P98 A;  3FMQ A;  4IKU A;  1WN1 A;  4ZWP A;  4ZWU A;  4IEC A;  5CDL A;  1C24 A;  3CB6 A;  2ADU A;  3MX6 A;  3TAV A;  2HOW A;  2V3Y A;  4U6E A;  2NQ7 A;  4RZZ A;  1YW7 A;  4U73 A;  1C23 A;  4U6C A;  4IU6 A;  2GU7 A;  4U6W A;  3IU8 A;  1WKM A;  2G6P A;  2ZSG A;  4FO8 A;  4U69 A;  3L7G A;  3IU7 A;  4Z7M A;  2BHD A;  5FCH A;  2MAT A;  1R5H A;  4PV4 A;  1R5G A;  2GG7 A;  1B59 A;  1WL9 A;  5JI6 A;  3S6B A;  1KQ0 A;  3PKA A;  1Y1N A;  1KP0 A;  1W7V A;  4U75 A;  2GA2 A;  5CDV A;  1N51 A;  5D6F A;  2GG2 A;  3MAT A;  4RGZ 1;  4S01 A;  4S2T P;  5JFR A;  2Q94 A;  2BHC A; 
#chains in the Genus database with same CATH homology
 2EA4 A;  4R60 A;  4U6Z A;  1JAW A;  2B3H A;  2BWY A;  2Q8K A;  5E5B A;  5CIK A;  1YW9 A;  5D6E A;  2EVC A;  3PKE A;  2GU4 A;  5CLS A;  2BWX A;  4IKT A;  3D27 A;  4ZWO A;  2DFI A;  2Q96 A;  2V3X A;  2GG0 A;  4FLK A;  2NQ6 A;  2BWS A;  4S00 A;  1XGO A;  1MAT A;  1C21 A;  3FMR A;  1QXZ A;  4JUQ A;  5CDE A;  2BHA A;  3CTZ A;  2GTX A;  4FUK A;  1C22 A;  4IPA A;  2GGB A;  3TB5 A;  3CB5 A;  3ROR A;  2EA2 A;  4FKC A;  3PKB A;  2BN7 A;  2P99 A;  1XNZ A;  1M35 A;  4PNC A;  2V6C A;  4MAT A;  1WLR A;  4U70 A;  1PV9 A;  2Q93 A;  1QZY A;  2Q95 A;  4FLL A;  5JHU A;  2BB7 A;  2BHB A;  2OAZ A;  4U71 A;  4U1B A;  4A6W A;  2B3L A;  1QXW A;  1YVM A;  2P9A A;  1BOA A;  2EVO A;  1BN5 A;  4HXX A;  3IU9 A;  4FLI A;  4B28 A;  3PKC A;  1XGM A;  2IW2 A;  3Q6D A;  2EVM A;  4FO7 A;  4U6J A;  1R58 A;  4A6V A;  3IG4 A;  2GU5 A;  1XGS A;  4S2R P;  2Q92 A;  2BWU A;  1XGN A;  4KM3 A;  4QR8 A;  3RVA A;  1KQ9 A;  2GG5 A;  2GG9 A;  3PKD A;  2BWT A;  3FM3 A;  4U76 A;  3MR1 A;  4OOK A;  4RZY A;  2GU6 A;  1WL6 A;  3BIP A;  1C27 A;  1A16 A;  1B6A A;  5CNX A;  4IDY A;  4IKR A;  1CHM A;  1YJ3 A;  2B3K A;  2GG8 A;  2V3Z A;  4IF7 A;  5FCF A;  5CE6 A;  2GGC A;  3BIQ A;  2BWV A;  3L24 A;  4IKS A;  1QXY A;  1O0X A;  2GG3 A;  1YW8 A;  2OKN A;  1WY2 A;  4FLJ A;  2BWW A;  2BH3 A;  4EGE A;  1WBQ A;  4ZNG A;  2GZ5 A;  1W2M A;  3BIT A;  2P98 A;  3FMQ A;  4IKU A;  1WN1 A;  4ZWP A;  4ZWU A;  4IEC A;  5CDL A;  1C24 A;  3CB6 A;  2ADU A;  3MX6 A;  3TAV A;  2HOW A;  2V3Y A;  4U6E A;  2NQ7 A;  4RZZ A;  1YW7 A;  4U73 A;  1C23 A;  4U6C A;  4IU6 A;  2GU7 A;  4U6W A;  3IU8 A;  1WKM A;  2G6P A;  2ZSG A;  4FO8 A;  4U69 A;  3L7G A;  3IU7 A;  4Z7M A;  2BHD A;  5FCH A;  2MAT A;  1R5H A;  4PV4 A;  1R5G A;  2GG7 A;  1B59 A;  1WL9 A;  5JI6 A;  3S6B A;  1KQ0 A;  3PKA A;  1Y1N A;  1KP0 A;  1W7V A;  4U75 A;  2GA2 A;  5CDV A;  1N51 A;  5D6F A;  2GG2 A;  3MAT A;  4RGZ 1;  4S01 A;  4S2T P;  5JFR A;  2Q94 A;  2BHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...