2EVRA

Crystal structure of a putative gamma-d-glutamyl-l-diamino acid endopeptidase (npun_r0659) from nostoc punctiforme pcc 73102 at 1.60 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
222
structure length
222
Chain Sequence
KLGEYQCLADLNLFDSPECTRLATQSASGRHLWVTSNHQNLAVEVYLCEDDYPGWLSLSDFDSLQPATVPYQAATFSESEIKKLLAEVIAFTQKAMQQSNYYLWGGTVGPNYDCSGLMQAAFASVGIWLPRDAYQQEGFTQPITIAELVAGDLVFFGTSQKATHVGLYLADGYYIHSSGKDQGRDGIGIDILSEQGDAVSLSYYQQLRGAGRVFKSYEPQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COG0791: Cell wall-associated hydrolases (invasion-associate
publication title Structural Basis of Murein Peptide Specificity of a gamma-D-Glutamyl-L-Diamino Acid Endopeptidase.
pubmed doi rcsb
source organism Nostoc punctiforme
molecule tags Hydrolase
total genus 63
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00877 NLPC_P60 NlpC/P60 family
A PF18348 SH3_16 Bacterial dipeptidyl-peptidase Sh3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2evrA01
3.90.1720.10 Alpha Beta Alpha-Beta Complex endopeptidase fold (from Nostoc punctiforme) endopeptidase domain like (from Nostoc punctiforme) 2evrA02
2IO9A 4Y92A 4F17A 4Q4GX 3THKA 4JZ3A 1K0SA 4AFZC 2KXDA 2RQVA 1MV0B 2KBTA 1YNZA 4CC7A 2DBKA 2GTOA 2JT4A 2DRKA 1N5ZA 1WI7A 2ECZA 2RN8A 1WIEA 1WA7A 5ECAA 2H8HA 2EW3A 1ARKA 2G6FX 4RUGA 2PNIA 4X1VA 4Q4NA 1K1ZA 2XIVA 2JTEA 3A98A 1VYUA 1SSHA 1JXOA 1UJYA 3SEMA 3VS7A 5L23A 3EHRA 2K79A 2BZ8A 1NG2A 2HCKA 1QKWA 3I5RA 4K11A 1AZGB 1ZUKA 1RI9A 2LZ6B 2W10A 1NEGA 2DYBA 3NE0A 2JM9A 4J9IA 3M0QA 3NHNA 4J9FA 2IOAA 3RNJA 2EQIA 3VPIA 1K76A 4CC2A 1PNJA 1OEBA 4FGIA 4RTUA 1UTIA 1T0HA 4OLKA 1E6HA 1TUDA 4RTXA 4FSSA 1BB9A 2J05A 1UG1A 4HZ9A 2DX1A 1AEYA 4M4ZA 1X27A 2KNBB 3I5SA 1GL5A 2EVRA 1WYXA 5I22A 4EQAA 1E6GA 3PBCA 4R0KA 2YT6A 4HVUA 1X69A 2ROTA 1JU5C 1TUCA 1Z9ZA 2DL5A 2KXCA 1K4US 1GBRA 5IXFA 1IO6A 3VS3A 2EGAA 4DEYA 2IO8A 3O98A 1QWEA 2GQIA 1H3HA 4EQ8A 1ZUYA 2EYZA 2EGCA 1X6GA 2GNCA 2J6KA 2BZYA 3R6NA 1SRMA 2DBMA 4F0WA 1GCPA 1M30A 1WXUA 4RTYA 2VWFA 1X6BA 4EIKA 1QWFA 1T0JA 1VYVA 4HXJA 1JQQA 3H0FA 3SHWA 1T3LA 4LE9A 1YN8A 3KW0A 3TSWA 2L3QA 2CSIA 3EG1A 3C0CA 2C0TA 1NEBA 1GCQA 1OV3A 2CT3A 2X3WD 1WFWA 1H92A 1CSKA 2RQUA 2CREA 1M27C 3EGUA 4QT7A 2ROLA 1AWWA 2LRJA 5FWCA 1FYNA 1RLQC 1AWOA 2MOXA 4OMQA 4RTZA 2EKHA 2LJ3A 2AK5A 3VS0A 1M3CA 2EBPA 3VS2A 1Y57A 2DL3A 4F16A 2QDLA 1AD5A 5IHKA 1RUWA 2EYYA 1X2KA 2MIOA 2EYXA 1KJWA 4LUEA 2D0NA 1FMKA 2A28A 1KSWA 1M3AA 3IQLA 4J9EA 4LNPA 1YWOA 1OOTA 2KYBA 3EHQA 1KIKA 2LQWA 2L3PA 3H0IA 4KRTA 4Z8AA 1QLYA 2EGEA 2DL8A 2DMOA 2HEQA 1NYFA 2FEIA 1M3BA 2AZVA 2O2OA 5GJWB 3VS1A 4CSHA 4WCIA 4F4MA 4FQAA 1YWPA 2VOBA 2LCSA 2ED1A 1BK2A 4LJ1A 2KRMA 2LMJA 3CQTA 1MUZA 2A08A 1ABQA 3ULRB 3PBIA 1X43A 1TG0A 4J9HA 1UDLA 2A37A 3GT2A 1VA7A 2SRCA 4F0VA 1UGVA 1UHCA 1GCQC 2ABLA 2B86A 4FDYA 1ZX6A 4DEXA 2J7IA 1Z9QA 1NLPC 2BTTA 2HBWA 1ZUUA 4Z89A 3VRYA 3REAB 1W1FA 2JM8A 2LP5A 2YUPA 3QWXX 4CGKA 4HPEA 3NPFA 1GFCA 2ENMA 2OAWA 2V1QA 4CC3A 2D1XA 4OMMA 1EFNA 2VPMA 4J9DA 4F14A 2O9SA 2YSQA 1XOVA 2C0OA 1G2BA 2KYMA 3TVTA 1WXTA 2HSPA 3VS4A 1W70A 1PWTA 2DRMA 2EPDA 4JJBA 2P4RA 2RQTA 4IIOA 2FPDA 5I11A 2PZ1A 5EC7A 2FRYA 3LH5A 4LN2A 2KRNA 3REBB 2CT4A 2LJ1A 1UJ0A 1NYGA 1SRLA 3TSZA 4J9CA 2BZXA 3UA6A 2YUNA 3EG2A 3A2YA 2RF0A 1WLPB 1K9AA 3M0TA 1UUEA 1V1CA 2JMCA 1BBZA 3O5ZA 4GBQA 2DLPA 2GGRA 1SHGA 2K3AA 4HVWA 2V1RA 2RNAA 1CKAA 1JO8A 2J6FA 2C0IA 1WDXA 2FG0A 1AWXA 4CC4B 4AFSC 4GLMA 2FO0A 2K7AA 1UFFA 4RTWA 3S0QA 3I9QA 3PVQA 4AFQC 3RBBB 1GRIA 1PRLC 2DA9A 1PKTA 1YP5A 2DJQA 1H8KA 1WXBA 3UATA 1MV3A 2X3XD 2M0YA 1NM7A 4ORZA 2ED0A 4JXBA 1B3QA 4D8DA 2HDAA 2DM1A 2OJ2A 4J9GA 1AZEA 1M8MA 2AKKA 1UECA 2JMAA 4OMPA 1OPLA 4E6RA 2GTJA 2AKLA 2JXBA 2J06A 5FW9A 2K1GA 2RPNA 2OI3A 4A63B 2O9VA 4AG2C 4FGEA 2NUZA 2O88A 1WX6A 3H0HA 4EOBA 3NMZC 3U23A 4OMLA 4HZBA 1ZBJA 1QKXA 2K3BA 2L2PA 2SEMA 1GFDA 2KR3A 4HVVA 3M0PA 1S1NA 4IIMA 1ABOA 1RLPC 2CDTA 2D8HA 2FRWA 1PRMC 3VPJA 4JJCA 2KGTA 2YUQA 1PHTA 1BU1A 4JJDA 2RMOA 2DVJA 1Y0MA 1A0NB 1GBQA 4AFUC 1U06A 2KT8A 4ESRA 1K0XA 1HSQA 2ESWA 1UE9A 4LUDA 2VVKA 5IHIA 2W0ZA 4ZNXA 3A30A 4FGDA 1W6XA 1AWJA 1G83A 2CH4W 3M0UA 4RTTA 3FJ5A 2KT1A 4AG1C 1B07A 3PE0A 2DE0X 5IHNA 2F2WA 4Q4TA 2DL4A 2YDLA 1ZSGA 2JS2A 3KFVA 4CT3A 1NLOC 2M51A 1I07A 3QWYA 1HD3A 3VRZA 3UA7A 3M0RA 5HCKA 5IH2A 2IF6A 1SEMA 2AZSA 4FQBA 1JXMA 1QCFA 2L0AA 2L3SA 3H41A 2NWMA 2I0NA 3EG0A 1U3OA 1SPKA 2CH4A 3I35A 3NGPA 2KEAA 2A36A 1AOJA 2DF6A 2GBQA 2RQRA 2F2VA 5GJVB 3JV3A 4OMOA 3ZL7C 3M1UA 2VPSA 2FPFA 2LX7A 2KRSA 4Z88A 2IOBA 3A2ZA 2LNHB 2RQWA 2CUBA 1HJDA 4JPBW 1VYTA 2K2MA 2CSQA 5IXBA 5FWBA 2MCNA 1KFZA 2IO7A 1OPKA 1CKBA 2E5KA 1PKSA 3EG3A 4RTVA 3I86A 2EYWA 2VKNA 2IIMA 1X2QA 2JW4A 1I0CA 4OMNA 2DL7A 2D8JA 1YCSB 2YUOA 1J3TA 2DNUA 2K9GA 1E7OA 2FPEA 4J9BA 3VS6A 1LCKA 2JS0A 2KE9A 1T3SA 1SHFA 2CUDA 2K6DA 2PTKA 3GBQA 4D8KA 1I1JA 2O31A 3VS5A 4JZ4A 1AVZC 1JEGA 1ZLMA 2LQNA 3PVLA 3M0SA 2J6OA 1U5SA 1UHFA 3UF4A 2F2XA 2KROA 2LJ0A 2DILA 4HCKA 2XMFA
chains in the Genus database with same CATH superfamily
4NL2A 3FB9A 1R0BG 3FEOA 4F17A 4LD6A 3CD6A 1MV0B 2KBTA 1GXIE 4FM4B 2XU8A 1VQNT 2DBKA 3JB9F 1N5ZA 1XQHA 3BY7A 1WI7A 2ECZA 2RN8A 1WA7A 5ECAA 2DIGA 2EW3A 3O8VA 3M4YA 1ARKA 4PLLA 2DZ9A 4Q4NA 3RMSA 1K1ZA 3OYHA 2FZKB 5IT9E 1WJRA 2ZPGB 3OBYA 5L23A 5KE2A 1K8AR 3CCQQ 4J6XA 1NG2A 2CZ1B 2HCKA 2JUFA 1IXDA 2LZ6B 2W10A 2HKNA 3QZ9B 5M9OA 4HFKA 2DYBA 4OF1A 1AHJB 1V76A 2JN0A 3RNJA 2DAQA 2HL3A 3UWNA 3JCMQ 1K76A 1ZHIA 2K5IA 1VQOT 4OLKA 1UTIA 4BI8B 1K8AC 4FSSA 4HKEA 1B34A 5KYXA 1UG1A 2DX1A 2LT4A 3TU4K 4M4ZA 1X27A 4A54A 3A1PA 3FLGA 1WHLA 4EQAA 2YT6A 4HVUA 2ROTA 2DL5A 3EFOA 5IXFA 4HA8A 1TWBA 2EGAA 4DEYA 2QDYB 3META 2RK2A 5LJ5d 2IO8A 1ZA2B 2EGCA 1FX7A 2PVOB 2V8KA 2DBMA 3A8LB 1M30A 1WXUA 4RTYA 4RG2A 1D0YA 3HFOA 4HXJA 3OYGA 1JQQA 3JB9J 3M4GA 3H0FA 3M59A 3SHWA 3CD6T 1YN8A 1UGQB 3TSWA 2L3QA 2IG0A 1NEBA 1QVGA 5LJ5h 3VKIA 1OV3A 1Q86R 1FMVA 4CRIA 1CSKA 4EMKA 2CREA 3EGUA 1AWWA 3OYYA 2QQAA 2MOXA 4OMQA 4RTZA 2LJ3A 3PMTA 4KUIA 2DFUA 1M3CA 3HTRA 2EBPA 2E3HA 2HQHA 5DLQE 4EPCA 1Y57A 1M2VA 3OYNA 5LL6S 4F16A 2D9TA 4ZTJA 3D7SB 2NUPB 2A7YA 1O75A 3M53A 4PJOE 1RUWA 2F5KA 1Q86C 1FMKA 2ZPBB 3GP8A 3EG9B 1QP2A 3F70A 2P0KA 4DA4A 2QAZA 3M9QA 2KYBA 3P8DA 1VQPQ 2LQWA 2C06A 4BE2A 1WHMA 4B9XA 4FW1A 1YHQQ 1M3BA 5C6SA 3JCMJ 2JOYA 3VS1A 1VQPA 2DVEA 2VOBA 3L2ZA 4X34A 1YHQA 4AT1B 2DERA 1VQ9A 4M7DE 1KG1A 3S3NA 3JCMf 4M7AE 2LMJA 3ME9A 4IUTA 1ABQA 3VYGA 4J9HA 1N27A 2RK1A 4C92A 3M58A 3EBQA 4C92F 3GT2A 1VA7A 1UGVA 1UHCA 1GCQC 2B86A 4LDVA 4DEXA 4RG8A 5GAN3 4C8QD 2BTTA 2CP3A 2HBWA 3MP8A 3A5ZB 3VRYA 3REAB 1KQ1A 3E2UA 2DD4A 2JM8A 2AT1B 1G3YA 1PD0A 4C8QA 3OSSC 3JCMP 3ER0A 1TU0B 3OYEA 1GFCA 2ENMA 4M75C 5I2MA 2D1XA 3GF5A 4OMMA 3OYCA 3QKJA 1OYXA 2YSQA 3MHXA 4N0AA 1Q7YC 2HSPA 3GOXA 3WVEB 1LNXA 2EQJA 2P4RA 1D0ZA 4FYVB 4IIOA 5EC7A 2PUOB 1K8AU 4LN2A 3DKMA 4PK4A 3E9GA 3CCLQ 2BZXA 1F1BB 2XI9A 3RERA 1YITQ 1WJQA 1WLPB 3EFSA 7AT1B 1I5LA 1VQMQ 1QVGP 2JMCA 2KI7A 2DLPA 1SHGA 3CCLA 2K3AA 2RNAA 4LXCA 1VQPT 5GAN8 1YITA 2V26A 3SWNC 4CC4B 1VQMA 1YHQT 4RTWA 3UT1A 3G71A 2M02A 4AFQC 1BYMA 1OX8A 1PD1A 4E2FB 2LT1A 1PKTA 1YP5A 2DK3A 2QQSA 3NTHA 1I4K1 3AT1B 1I5OB 4M78C 2X3XD 1RAIB 2V8IA 1ZA1B 1OU8A 4D6WA 2ED0A 4JXBA 4IUPA 2OTJQ 4D8DA 3GIBA 4J9GA 5GANj 3OW2S 3M57A 1UECA 3CCMQ 2JMAA 4OMPA 2K3YA 4BUGA 2K1GA 2OI3A 2OTJA 2KVQG 1UB4A 1PSEA 1FXXA 3NMZC 3U23A 5CO7A 1WGSA 1QKXA 3JCMd 3JCMe 3RUXA 1R0CB 1K73R 4B9WA 1PRMC 5GAOr 4DBQA 2KGTA 1PHTA 4Z02A 5KH6A 5CK9A 2DETA 2RMOA 1I81A 2DVJA 2PU9B 1R77A 4C0GA 1GBQA 2KT8A 2A3LA 3OMCA 4MDWA 4ANJA 3L2RA 1UE9A 3JCMW 3QYHB 2W0ZA 4JUVA 4FGDA 4KH1B 1W6XA 2JJ9A 2RA2A 2KT1A 1B07A 3PE0A 3E1SA 1RI0A 4M75B 4OB1B 5GAOq 3CBMA 4GLKA 3CCLT 2YDLA 2QYZA 1D3BA 3L1AA 2JS2A 4VUBA 1YITT 1VUBA 4OGCA 3HHTB 1HD3A 3VRZA 1VQMT 2CP5A 1LPLA 4IUVA 3NTKA 2RHUA 3FIFA 2LVMA 3AHUA 2IF6A 4FQBA 4V2SA 2L0AA 1LOJA 1MGQA 3QBYA 2XICA 3EG0A 2CH4A 2O01E 4HT9A 1Q82R 1M90R 1IRXA 1H3ZA 4E7HA 2X9HA 4KUDK 2GBQA 3ZEHA 3OS2A 3M5AA 4J6YA 2FPFA 2LX7A 2BIVA 2YHTA 3PIPA 2Y90A 2IOBA 5A0GA 2COZA 2LNHB 2OTJT 4M7DF 1WJSA 2CYZB 5LJ3j 2RQWA 2CUBA 3RKYA 1VYTA 1Q7YU 5GAMh 3CC2Q 3SWNB 1Q82C 1OPKA 1KD1R 1M90C 1CKBA 2E5KA 1QCOA 4RTVA 2E6ZA 3I86A 2DYIA 2IIMA 2L89A 2X35A 4OMNA 2WSEE 1YCSB 2YUOA 6AT1B 2DNUA 2KE9A 1SHFA 3GBQA 4M78B 1TS9A 4QQ6A 4IKFA 3BW1A 1ZLMA 2LQNA 1VOMA 2Y4YA 3M0SA 1KD1C 4MZMA 4XTVA 3DB4A 1U1SA 1PM3A 2ZPIB 1U5SA 1UHFA 1BI3A 4BY6C 3MEVA 5HK0A 3CMAQ 3CCUQ 2DILA 4NS5A 1MHNA 2XMFA 1VQ4Q 5J39A 2E65A 4Y92A 3THKA 4JZ3A 4AFZC 3CMAA 3CCUA 2XDBA 2HAXA 3HPWA 1Y96B 1M8VA 3HRUA 1VQ4A 3MCAB 3CXCP 3FC3A 2VV5A 1YCYA 4RUGA 2PNIA 4X1VA 3TREA 5HY6A 2E5QA 2JTEA 4E47A 1VYUA 2M1HA 4OB0B 1VQ6A 3C94A 1JXOA 3KXTA 1UJYA 3VS7A 2K79A 3QDRB 1AZGB 2DJZA 1RI9A 1NEGA 1JB0E 2JM9A 4J9IA 3M0QA 3NHNA 5GMKm 3ZFJA 5GAOn 4PFPA 3VPIA 5GAN5 2YXYA 1OEBA 1PNJA 2L3RA 4M78D 4PKCC 2QG9B 1YJ9Q 1T0HA 2EQMA 1N8RR 4JRIA 5KYUB 4MZTA 1VQ8A 3I5SA 3CMEQ 1YJ9A 1XJWB 2EJFA 4BB7A 4R0KA 4IUQA 3OS1A 1PSFA 1JU5C 4BI3A 2QEXQ 1GBRA 4DBHA 3VS3A 2K2VA 1MMAA 3CMEA 5LJ5f 1N8RC 1H3HA 4EQ8A 1RACB 1X6GA 2GNCA 2BZYA 2MK5A 4KH0B 1WNLA 2CP6A 2ZPHB 2QEXA 4QKUA 1X6BA 4EIKA 1T0JA 1VYVA 5LJ3g 3CMAT 3CCUT 4LE9A 3C4SA 4M77C 3EG1A 4C92E 1VQ4T 3C0CA 1YI2Q 2P0PA 2X3WD 2CT3A 1VIFA 1WFWA 2MF2A 1H92A 5CCAA 2WP7A 2RQUA 5GMKj 1IHVA 4R55A 1RLQC 1AWOA 2EKHA 3PNWC 1VQ6T 3G6EQ 3VS0A 1YI2A 2R5AA 2COYA 2RHZA 4C8QE 1I8FA 3VS2A 1ZSZA 4BY6B 1Q82U 1M90U 1AD5A 1G5VA 3A8MB 1KC8R 3MKDA 3G6EA 1X2KA 2EYXA 4JS5A 1M2OA 1M3AA 3IQLA 2EQKA 3EHQA 3CC7Q 4KRTA 3CPFA 2IVWA 4Z8AA 5CVIA 1QLYA 4XQ3A 2EGEA 5GJWB 2DMOA 1KD1U 4TVRA 2FEIA 3CCJQ 4CSHA 1R8OB 4PLIA 3CC7A 4E7JA 1VQ8T 3I55Q 2LCSA 3HKSA 1YJ9T 8AT1B 4DQ2A 2FVUA 1EX4A 3CCJA 5HKCA 2F5TX 1X6OA 2A08A 3I55A 3CMET 3ULRB 3OQ5A 3PBIA 4F04B 1W4SA 3X25B 4F0VA 2NUTB 2QEXT 2VXFA 1ZX6A 4FDYA 4OVAA 1NLPC 4N4GA 4QVZA 1ZUUA 2DIQA 4Z89A 2YRCA 2GCXA 2MMPA 3BDLA 4C0FA 3FDRA 5DM7R 3SD4A 2YUPA 2LP5A 3QWXX 2OTLQ 2E4HA 4HPEA 4JURA 2OAWA 1WPYA 2QQ9A 2RJDA 1OQKA 1W2BA 4CC3A 1IB8A 2EIFA 3J7AF 4J9DA 2O9SA 2OTLA 2DTOA 1YI2T 5CKEA 3TVTA 2EYQA 2CKKA 5GMKl 5LJ5e 2EPDA 2BKDN 2DRMA 3C12A 4JJBA 4FL6A 2AHJB 3G6ET 4PFZA 4ZGJB 3QUIA 2CT4A 2LJ1A 1SRLA 2EWNA 1KQSA 1QQJA 4J9CA 3EG2A 1AT1B 3A2YA 2RF0A 1K9AA 4M77B 1V1CA 2ZZDA 1G3SA 1WHHA 2GGRA 3PTAA 2K3XA 2V1RA 1YBYA 1M1KR 1C1AA 3CC7T 2J6FA 3EGXB 1N8RU 3V8KA 2FG0A 1AWXA 4GLMA 1WHJA 3CCJT 3URGA 4F7UB 3S0QA 2DXTA 3I9QA 3PVQA 1WZOA 3I55T 1H8KA 3LH0A 1OU9A 2CZ6B 1WXBA 4JJNK 4DOVA 1OZ2A 4Y28E 2QI2A 1QVFA 1D09B 2M0YA 1K9MR 4ORZA 1M1KC 2EFIA 1ZBXA 2CP0A 1BI0A 2DM1A 4PJOC 2PUKB 4XTUA 3SDZA 2QQBA 4JRKA 2JXBA 2J06A 2O4XB 2RPNA 3RKXA 1C0MA 2R57A 3QJ6A 5A0DA 1Q81R 1VQ9Q 4FGEA 5KE3A 2NUZA 4QW2A 2MYSA 2OTLT 1OULA 4HFLA 1YIJQ 2L2PA 2E64A 2PVDB 3DLLA 1GFDA 4HVVA 3M0PA 1QCNA 1S1NA 4IIMA 1QVGS 1ABOA 4QVDA 2D8HA 3VPJA 2YUQA 3PMIA 3MO8A 4M7DC 1YIJA 1Q81C 4M7AC 2DTHA 4M77D 1U06A 1K0XA 2ESWA 4B6MA 2DXBA 1N9SA 2P4TA 4JRQA 3A30A 2IPOB 1AWJA 3M0UA 1YFNA 2G3RA 3V7CA 4AG1C 2XIDA 5IHNA 4BE1A 4C8QF 5CIUA 1W2BP 2KDSA 2DL4A 2HZYA 1SKUB 2MWOA 3A8HB 4CT3A 3KFVA 2DTIA 3J80E 3JCMX 4ZGDB 3P8BB 5IH2A 1RADB 2MAMA 2NUPA 1QCFA 1NPRA 2L3SA 4FT2A 4RKUE 2VB6A 5GAMf 5KYYB 3CCRA 2NWMA 4FSXA 4OB2B 3EG9A 3MPUB 3NGPA 2KEAA 2A36A 2H3JA 4J83A 1KQSP 2JZ2A 1TOVA 4DBRA 2F2VA 5GJVB 3C95A 3M1UA 4HCCA 5GAOp 2RJFA 2KRSA 3OW2A 3M55A 3A2ZA 3LWIA 3R6OA 3G71Q 1PC0A 1HJDA 1M5Q1 5LJ5g 2CSQA 3G7ZA 3RMQA 2MCNA 2IO7A 1U8RA 1PKSA 1QMCA 2XDDA 3CCSA 2EYWA 3GNGA 1VQ9T 2DL7A 2D8JA 1YJWQ 3PFSA 3OYLA 1WHGA 2M0OA 1LCKA 1QVFP 1LVKA 2CUDA 3OYIA 4D8KA 1YIJT 4XAXB 4JZ4A 1YJWA 4ATOA 3GPLA 2HD0A 4PJOB 2F69A 1MNEA 2J6OA 4XTWA 2JTMA 5GANd 3L2WA 3I56Q 2HKQB 2FB7A 2DZCA 4FYWB 4M78G 2KROA 4N4HA 2ZPEB 3OBWA 3E9FA 2IO9A 3I56A 5CQYA 2E10A 2KXDA 2RQVA 1YNZA 2GTOA 2JT4A 2DRKA 1Q86U 1X01A 1M1KU 5GANh 5FROA 2H8HA 5FU7C 4M7DB 3CCRT 2G6FX 5EG2A 4M7AB 2K57A 2XIVA 2BUDA 2ZGWA 3T9NA 1RAAB 2X4JA 3EHRA 2RH2A 2B8AA 5HK3A 4XU3A 1RABB 2RD1A 1QKWA 4K11A 1JBMA 1K73C 1ZUKA 2FL7A 3NE0A 4XK8E 4QVCA 3JRZA 4JRPA 5GAN2 1BKBA 4J9FA 2IOAA 3LW5E 2EQIA 4LDXA 3CPWA 2Y4XA 5D7UA 3M56A 4LDUA 3CCST 1Y07A 5KCOA 1Q81U 3G71T 2E70A 3OSVA 2VC8A 5D6WA 5GAN4 1E6HA 5D6XA 4RCCA 4RTXA 4PJOD 2CP2A 2E3IA 3V8LA 2J05A 4QQDA 5GAMd 2RJCA 1DJ7B 5GAMe 1AEYA 4E7ZA 2KNBB 2EVRA 1WYXA 5I22A 1YJWT 3PBCA 5CQXA 3CC4Q 1X69A 1Z9ZA 3G4SQ 2KXCA 1K4US 3OW2P 1IO6A 3QG1A 2QTVA 2A0FB 3O98A 1QWEA 3CXCS 2EYZA 2J6KA 3CC4A 2QGFB 3G4SA 1GCPA 2VWFA 2ZCFB 3I56T 2KQWA 2LRQA 4LDYA 3V7SA 4JS4A 3HP9A 1GCQA 1P92A 3X20B 1M27C 2LRJA 5FWCA 5LJ3h 4M75D 5KYWB 2AK5A 2XD0A 2EAYA 4M75A 3WXMB 2VASA 2E1HA 4NL3A 1TTHB 5KCHA 3LWHA 2MIOA 1KJWA 2MI6A 2A28A 1JJ2A 2VGNA 3OYFA 4XTZA 3OYBA 2KSSA 1BCMA 1OOTA 1YWOA 3FRNA 1KIKA 4A4GA 3H0IA 2FHDA 1VQ6Q 2X51A 3OS5A 5FU7B 2AZVA 2O2OA 2QGGA 1O9SA 4F4MA 4PJLA 1YWPA 2FYKA 4LD9K 3HRTA 1B7TA 3QIIA 2ED1A 3FJPA 2DXCA 2YRVA 2L8DA 1QVPA 1M9SA 1OZ3A 3RDVA 3MJXA 4DOWA 2PVGB 3CQTA 1MUZA 3A8GB 4ZN1A 4PL6A 2P0QA 1X43A 3JCMg 4PJMA 2R58A 3BFMA 3CC4T 3PT9A 3SWNA 3G4ST 2SRCA 3CPWP 4XU1A 1OX9A 3VYHB 2J7IA 4EMKC 1Z9QA 3N5BB 2RHIA 2RO0A 1WQ7A 1VQ8Q 1W1FA 3EGDB 1RAHB 2BE9B 4CGKA 3QZ5B 3NPFA 4M78A 3MEUA 2V1QA 3HRSA 4M78F 4C5GA 1K73U 1U1TA 1Y7XA 2C0OA 1G2BA 2KYMA 2XG8D 2LCLA 4E7LA 3HFNA 1WXTA 2Z0WA 1RAGB 3VJPA 3VUBA 1W70A 3VS4A 4EDUA 2RQTA 2GFAA 4N4IA 2EKOA 3LH5A 3TQ7P 4E7SA 3ZBDA 1MMNA 2KRNA 3LGFA 1UJ0A 1NYGA 2VXEA 1Y96A 2KMTA 4FCYA 3LLRA 3M0TA 1UUEA 2RHYA 2HMAA 3CEYA 3O5ZA 4HVWA 1KQ2A 3RIRA 1CKAA 1JO8A 4C92C 2C0IA 2D0QB 5D6YA 1WDXA 4EMGA 4PNOA 2FO0A 2K7AA 1IGQA 1UEBA 4Q5WA 2K4YA 4M77G 3RBBB 4O5VA 4OGEA 1PRLC 2DA9A 3JCMV 4C8QC 2QASA 1MV3A 1SSFA 1D0XA 2QTXA 1JJ2P 1B34B 5KYXB 2PQWA 4L59A 1B3QA 3MP6A 4FYXB 2HDAA 2EQUA 2OJ2A 1AZEA 4F7UG 4II1A 2AKKA 5GMKh 3RESA 4PJNA 2GTJA 2AKLA 3EFOB 4N0AC 5FW9A 5KYUA 3LX7A 4A63B 2O9VA 4AG2C 1KC8C 3JB9D 2K5LA 3HL8A 2O88A 4GY5A 4XTYA 1G3TA 3OYJA 1VQ5Q 2KR3A 1D1BA 2MWPA 1IHWA 2RHXA 2FRWA 4JJCA 4JJDA 1BU1A 3EH2A 2CZ0B 2DPPB 1VQ5A 1BI1A 3GLXA 4DBFA 1JRIA 5FRNA 1HSQA 5GAOm 4EMKB 2LQKA 4KGXB 2CH4W 3TEEA 4RTTA 3FJ5A 2V8JA 3BDUA 3QPHA 2DE0X 1M2VB 4L5GA 1NPPA 3S3OA 4Q4TA 1ZSGA 2LX9A 4A4EA 2YRDA 2M51A 2AIRB 1C6VX 3CCQA 3QWYA 3E19A 2X4WA 2RI2A 3INZA 4C5HA 3JB9I 1SEMA 2AZSA 1HXDA 1IREB 2RI5A 5GMKi 3H41A 3RKWA 2XDPA 3CBOA 1U3OA 2WSFE 3V8JA 5FU6C 1AOJA 2DF6A 3MEWA 2LTOA 3JV3A 4OMOA 4ZN3A 1M1FA 5LJ5j 2KAFA 4PJJA 2WACA 4BDYA 4A53A 3JB9H 1OI1A 5IAYA 4ELYC 1BI2A 2VGMA 2KY9A 4JPBW 2DKGA 4J30A 2OAUA 4C92B 3JCMb 5FRMA 3JAME 3H6ZA 4BE0A 3X26B 3Q1JA 2RB6A 1NJIR 5J3BA 3QO3A 5CKBA 2JW4A 1I0CA 1LJOA 1J3TA 4WF2A 1W2BS 2D6FA 2K9GA 4J9BA 1E7OA 2FPEA 3VS6A 4C8QB 2NUTA 3QDFA 2JNGA 1T3SA 2K6DA 1VQ5T 1I1JA 2O31A 5IN1A 5CR2A 3LGLA 1JEGA 3QSUA 4HFFA 3PVLA 3JCMc 1NJIC 1QW1A 1RL2A 5GANf 3MEAA 3UF4A 3QYGB 4KBMB 2DD5A 3UDCA 2LJ0A 1EZZB 4HCKA 3HSBA 2M16A 1K9MC 1KQSS 4Q4GX 3CCQT 2XHCA 4PJOG 3X28B 1K0SA 4CC7A 4CI0C 2HNIA 1WIEA 2COWA 3OYDA 3CCVQ 2FZGB 5CKDA 4E7KA 1M4ZA 1YJNQ 3A98A 4ELZC 1SSHA 1KC8U 3SEMA 2HQEA 4M77A 4C92D 3CCVA 4A4FA 4M77F 3TCJA 2BZ8A 1D1AA 3I5RA 5I2SA 3QHSA 1HYOA 1YJNA 1QVFS 4M7DG 4M7AG 1X75C 3EGXA 3H8ZA 2RI3A 4BDZA 3OYAA 4WTOB 4F7UA 3DB3A 4CC2A 3CCRQ 1VQ7Q 4M75E 4F7UF 1Q7YR 4FGIA 4C0ZA 1MMDA 5A2QE 4RTUA 1TUDA 2MPXC 4M75G 3M54A 4EMHA 2LC4A 1BB9A 2YWWA 5GAOl 4HZ9A 5L8RE 1VQ7A 1MNDA 4RCBA 1GL5A 2QA4Q 5FU6B 3NTIA 1ACMB 1E6GA 3S3MA 5DY9A 1KHCA 2NLUA 3OYMA 3VU3C 3WVDB 1TUCA 2O4XA 5FLXE 2HQXA 3NFCA 2QA4A 1PCXA 2GQIA 1ZUYA 3CCSQ 3R6NA 1SRMA 4F0WA 2CGHA 5KYNA 5LJ3f 1QWFA 4J6WA 1FWZA 3QXEB 2CS7A 3OB9A 1T3LA 4O6JA 3SB2A 3CCEQ 2ATCB 3KW0A 2CSIA 3X24B 4FIBA 4HCZA 2EJGA 1FMWA 2C0TA 2F1LA 4J8OA 4KT0E 1N6AA 2HBPA 4QT7A 2ROLA 2RM4A 1FYNA 2L5QA 1D3BB 3CCEA 4BI4A 2R5MA 5CAIA 2KK4A 4C5IA 3S6WA 5GANe 3CCVT 4M78E 2DL3A 2QDLA 4FT4A 3V7RA 1YJNT 4BD3A 3DLMA 4HCBA 5IHKA 3SFMA 2XKOC 2EYYA 4LUEA 2D0NA 1KSWA 4MMKA 2HSEB 2HL5C 5A0LA 1NBEB 4J9EA 2CP7A 2DEQA 4LNPA 1VQKQ 1WQWA 2L3PA 2DO3A 2E6NA 2P84A 5KYYA 2DL8A 2HEQA 2OX7A 1NYFA 3RR6A 1NJIU 4OP0A 4WCIA 2ZPFB 4KGZB 3J81E 1VQ7T 4FQAA 1VQKA 3CCMA 3H9NA 4IURA 1BK2A 4A4HA 3PGGA 4LJ1A 2KRMA 3GNFB 1K9MU 1BIBA 4X9CA 4MZPA 4ME7A 2QA4T 1D1CA 2LNVA 1SG5A 1TG0A 1UDLA 2X4XA 4ZGEB 3CXCA 2A37A 1EIFA 1H641 2E12A 1RAFB 2ABLA 1MMGA 1TH7A 3JSCA 1VIEA 1UGSB 4JDSA 3JCMh 3LYIA 1ZSZC 8ATCB 3EAEA 2JVVA 3VUZA 1EFNA 4PJOA 2VPMA 3P8HA 4F14A 3OS0A 3CCET 4PJOF 4C0DC 1XOVA 2YLBA 5GAMj 1PWTA 4J32A 4C5EA 2FPDA 4YTLA 5I11A 2PZ1A 2FRYA 4PFOA 5LJ3d 5LJ3e 2JTFA 5C0MA 4MMLA 3REBB 4FW2A 1S72Q 4M7DD 3TSZA 3JB9G 4M7AD 3UA6A 2YUNA 1HK9A 2QQRA 3L2QA 2RJEA 4LDWA 5AT1B 4M7DA 1BBZA 4GBQA 2GF7A 3A8OB 4XU0A 4M7AA 1S72A 4M7AF 4ZTFA 3CPWS 1VQKT 2LDMA 3CCMT 2VYTA 2X4YA 4AFSC 2QK0A 1UFFA 1V29B 9ATCB 1TUGB 4RMOA 4OMFB 1GRIA 3CC2A 1KHIA 2DJQA 4M75F 1VQLQ 4Y91A 3UATA 2LQ8A 1WHKA 1TSFA 1NM7A 4HT8A 5CKHA 1M8MA 1VQLA 4KULA 4XU2A 1OPLA 4E6RA 3OA6A 3QJYA 1TXQA 5J26A 4R56A 4FU6A 3EH1A 5GANg 4KGVB 4E7IA 3KUFA 1WX6A 3H0HA 4EOBA 3KBGA 3L2VA 1RAEB 4OMLA 3CBPA 2BE7D 4HZBA 1ZBJA 4J7FA 2K3BA 2I2LA 2SEMA 3OYKA 1UGPB 1RLPC 2CDTA 1G3WA 1Q95G 3EFRA 3L2UA 1Y0MA 2H3EB 1A0NB 3L42A 4ESRA 4AFUC 1PG5B 2YLCA 4QQGA 5AYFA 4LUDA 2VVKA 5IHIA 4JLGA 4ZNXA 1IGUA 1G83A 2QXFA 4XTXA 2FZCB 4L6V5 3MP1A 1ZSZB 2F2WA 1VQNQ 3OY9A 2LCCA 1JJ2S 1S72T 2VUBA 5CKFA 1NLOC 5KYWA 5GAN7 1I07A 2CZ7B 4C0DB 2K5FA 3UA7A 2XK0A 2M9UA 3M0RA 2EJ9A 1KK7A 5HCKA 1VQNA 4P5NA 1BIAA 1UGRB 3CC2T 1JXMA 1IZ6A 1NE8A 2I0NA 1SPKA 2GQVA 3I35A 4NOYA 3G1JA 2E41A 5GAMg 1BCOA 4JLIA 2RQRA 4UC4A 1ZQ1A 3ZL7C 1VQLT 1N9RA 2VPSA 4Z88A 2GFUA 3ASKA 1M1GA 4IUUA 1XNIA 4J7IA 1VQOQ 3VV0A 4AMCA 2K2MA 5IXBA 1XTDA 2ZAEA 5FWBA 5GAN6 1KFZA 4M77E 1SF9A 4OB3B 1QP3A 3EG3A 5GMKe 2VKNA 5I21A 1X2QA 1VQOA 4A4KA 2DXUA 4FYYB 1NZ9A 3PIOA 5DLOA 2WSCE 4J5YA 2JS0A 2PTKA 4MDXA 3UPUA 4C92G 3VS5A 4X9DA 4F7UE 3OMGA 1AVZC 3EGDA 2NYSA 3BE3A 2DEUA 1Y71A 4C8QG 3CD6Q 1G8XA 2F2XA 4BACA
chains in the Genus database with same CATH topology
2IO9A 4Y92A 4F17A 4Q4GX 3THKA 4JZ3A 1K0SA 4AFZC 2KXDA 2RQVA 1MV0B 2KBTA 1YNZA 4CC7A 2DBKA 2GTOA 2JT4A 2DRKA 1N5ZA 1WI7A 2ECZA 2RN8A 1WIEA 1WA7A 5ECAA 2H8HA 2EW3A 1ARKA 2G6FX 4RUGA 2PNIA 4X1VA 4Q4NA 1K1ZA 2XIVA 2JTEA 3A98A 1VYUA 1SSHA 1JXOA 1UJYA 3SEMA 3VS7A 5L23A 3EHRA 2K79A 2BZ8A 1NG2A 2HCKA 1QKWA 3I5RA 4K11A 1AZGB 1ZUKA 1RI9A 2LZ6B 2W10A 1NEGA 2DYBA 3NE0A 2JM9A 4J9IA 3M0QA 3NHNA 4J9FA 2IOAA 3RNJA 2EQIA 3VPIA 1K76A 4CC2A 1PNJA 1OEBA 4FGIA 4RTUA 1UTIA 1T0HA 4OLKA 1E6HA 1TUDA 4RTXA 4FSSA 1BB9A 2J05A 1UG1A 4HZ9A 2DX1A 1AEYA 4M4ZA 1X27A 2KNBB 3I5SA 1GL5A 2EVRA 1WYXA 5I22A 4EQAA 1E6GA 3PBCA 4R0KA 2YT6A 4HVUA 1X69A 2ROTA 1JU5C 1TUCA 1Z9ZA 2DL5A 2KXCA 1K4US 1GBRA 5IXFA 1IO6A 3VS3A 2EGAA 4DEYA 2IO8A 3O98A 1QWEA 2GQIA 1H3HA 4EQ8A 1ZUYA 2EYZA 2EGCA 1X6GA 2GNCA 2J6KA 2BZYA 3R6NA 1SRMA 2DBMA 4F0WA 1GCPA 1M30A 1WXUA 4RTYA 2VWFA 1X6BA 4EIKA 1QWFA 1T0JA 1VYVA 4HXJA 1JQQA 3H0FA 3SHWA 1T3LA 4LE9A 1YN8A 3KW0A 3TSWA 2L3QA 2CSIA 3EG1A 3C0CA 2C0TA 1NEBA 1GCQA 1OV3A 2CT3A 2X3WD 1WFWA 1H92A 1CSKA 2RQUA 2CREA 1M27C 3EGUA 4QT7A 2ROLA 1AWWA 2LRJA 5FWCA 1FYNA 1RLQC 1AWOA 2MOXA 4OMQA 4RTZA 2EKHA 2LJ3A 2AK5A 3VS0A 1M3CA 2EBPA 3VS2A 1Y57A 2DL3A 4F16A 2QDLA 1AD5A 5IHKA 1RUWA 2EYYA 1X2KA 2MIOA 2EYXA 1KJWA 4LUEA 2D0NA 1FMKA 2A28A 1KSWA 1M3AA 3IQLA 4J9EA 4LNPA 1YWOA 1OOTA 2KYBA 3EHQA 1KIKA 2LQWA 2L3PA 3H0IA 4KRTA 4Z8AA 1QLYA 2EGEA 2DL8A 2DMOA 2HEQA 1NYFA 2FEIA 1M3BA 2AZVA 2O2OA 5GJWB 3VS1A 4CSHA 4WCIA 4F4MA 4FQAA 1YWPA 2VOBA 2LCSA 2ED1A 1BK2A 4LJ1A 2KRMA 2LMJA 3CQTA 1MUZA 2A08A 1ABQA 3ULRB 3PBIA 1X43A 1TG0A 4J9HA 1UDLA 2A37A 3GT2A 1VA7A 2SRCA 4F0VA 1UGVA 1UHCA 1GCQC 2ABLA 2B86A 4FDYA 1ZX6A 4DEXA 2J7IA 1Z9QA 1NLPC 2BTTA 2HBWA 1ZUUA 4Z89A 3VRYA 3REAB 1W1FA 2JM8A 2LP5A 2YUPA 3QWXX 4CGKA 4HPEA 3NPFA 1GFCA 2ENMA 2OAWA 2V1QA 4CC3A 2D1XA 4OMMA 1EFNA 2VPMA 4J9DA 4F14A 2O9SA 2YSQA 1XOVA 2C0OA 1G2BA 2KYMA 3TVTA 1WXTA 2HSPA 3VS4A 1W70A 1PWTA 2DRMA 2EPDA 4JJBA 2P4RA 2RQTA 4IIOA 2FPDA 5I11A 2PZ1A 5EC7A 2FRYA 3LH5A 4LN2A 2KRNA 3REBB 2CT4A 2LJ1A 1UJ0A 1NYGA 1SRLA 3TSZA 4J9CA 2BZXA 3UA6A 2YUNA 3EG2A 3A2YA 2RF0A 1WLPB 1K9AA 3M0TA 1UUEA 1V1CA 2JMCA 1BBZA 3O5ZA 4GBQA 2DLPA 2GGRA 1SHGA 2K3AA 4HVWA 2V1RA 2RNAA 1CKAA 1JO8A 2J6FA 2C0IA 1WDXA 2FG0A 1AWXA 4CC4B 4AFSC 4GLMA 2FO0A 2K7AA 1UFFA 4RTWA 3S0QA 3I9QA 3PVQA 4AFQC 3RBBB 1GRIA 1PRLC 2DA9A 1PKTA 1YP5A 2DJQA 1H8KA 1WXBA 3UATA 1MV3A 2X3XD 2M0YA 1NM7A 4ORZA 2ED0A 4JXBA 1B3QA 4D8DA 2HDAA 2DM1A 2OJ2A 4J9GA 1AZEA 1M8MA 2AKKA 1UECA 2JMAA 4OMPA 1OPLA 4E6RA 2GTJA 2AKLA 2JXBA 2J06A 5FW9A 2K1GA 2RPNA 2OI3A 4A63B 2O9VA 4AG2C 4FGEA 2NUZA 2O88A 1WX6A 3H0HA 4EOBA 3NMZC 3U23A 4OMLA 4HZBA 1ZBJA 1QKXA 2K3BA 2L2PA 2SEMA 1GFDA 2KR3A 4HVVA 3M0PA 1S1NA 4IIMA 1ABOA 1RLPC 2CDTA 2D8HA 2FRWA 1PRMC 3VPJA 4JJCA 2KGTA 2YUQA 1PHTA 1BU1A 4JJDA 2RMOA 2DVJA 1Y0MA 1A0NB 1GBQA 4AFUC 1U06A 2KT8A 4ESRA 1K0XA 1HSQA 2ESWA 1UE9A 4LUDA 2VVKA 5IHIA 2W0ZA 4ZNXA 3A30A 4FGDA 1W6XA 1AWJA 1G83A 2CH4W 3M0UA 4RTTA 3FJ5A 2KT1A 4AG1C 1B07A 3PE0A 2DE0X 5IHNA 2F2WA 4Q4TA 2DL4A 2YDLA 1ZSGA 2JS2A 3KFVA 4CT3A 1NLOC 2M51A 1I07A 3QWYA 1HD3A 3VRZA 3UA7A 3M0RA 5HCKA 5IH2A 2IF6A 1SEMA 2AZSA 4FQBA 1JXMA 1QCFA 2L0AA 2L3SA 3H41A 2NWMA 2I0NA 3EG0A 1U3OA 1SPKA 2CH4A 3I35A 3NGPA 2KEAA 2A36A 1AOJA 2DF6A 2GBQA 2RQRA 2F2VA 5GJVB 3JV3A 4OMOA 3ZL7C 3M1UA 2VPSA 2FPFA 2LX7A 2KRSA 4Z88A 2IOBA 3A2ZA 2LNHB 2RQWA 2CUBA 1HJDA 4JPBW 1VYTA 2K2MA 2CSQA 5IXBA 5FWBA 2MCNA 1KFZA 2IO7A 1OPKA 1CKBA 2E5KA 1PKSA 3EG3A 4RTVA 3I86A 2EYWA 2VKNA 2IIMA 1X2QA 2JW4A 1I0CA 4OMNA 2DL7A 2D8JA 1YCSB 2YUOA 1J3TA 2DNUA 2K9GA 1E7OA 2FPEA 4J9BA 3VS6A 1LCKA 2JS0A 2KE9A 1T3SA 1SHFA 2CUDA 2K6DA 2PTKA 3GBQA 4D8KA 1I1JA 2O31A 3VS5A 4JZ4A 1AVZC 1JEGA 1ZLMA 2LQNA 3PVLA 3M0SA 2J6OA 1U5SA 1UHFA 3UF4A 2F2XA 2KROA 2LJ0A 2DILA 4HCKA 2XMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IO9 A;  4Y92 A;  4F17 A;  4Q4G X;  3THK A;  4JZ3 A;  1K0S A;  4AFZ C;  2KXD A;  2RQV A;  1MV0 B;  2KBT A;  1YNZ A;  4CC7 A;  2DBK A;  2GTO A;  2JT4 A;  2DRK A;  1N5Z A;  1WI7 A;  2ECZ A;  2RN8 A;  1WIE A;  1WA7 A;  5ECA A;  2H8H A;  2EW3 A;  1ARK A;  2G6F X;  4RUG A;  2PNI A;  4X1V A;  4Q4N A;  1K1Z A;  2XIV A;  2JTE A;  3A98 A;  1VYU A;  1SSH A;  1JXO A;  1UJY A;  3SEM A;  3VS7 A;  5L23 A;  3EHR A;  2K79 A;  2BZ8 A;  1NG2 A;  2HCK A;  1QKW A;  3I5R A;  4K11 A;  1AZG B;  1ZUK A;  1RI9 A;  2LZ6 B;  2W10 A;  1NEG A;  2DYB A;  3NE0 A;  2JM9 A;  4J9I A;  3M0Q A;  3NHN A;  4J9F A;  2IOA A;  3RNJ A;  2EQI A;  3VPI A;  1K76 A;  4CC2 A;  1PNJ A;  1OEB A;  4FGI A;  4RTU A;  1UTI A;  1T0H A;  4OLK A;  1E6H A;  1TUD A;  4RTX A;  4FSS A;  1BB9 A;  2J05 A;  1UG1 A;  4HZ9 A;  2DX1 A;  1AEY A;  4M4Z A;  1X27 A;  2KNB B;  3I5S A;  1GL5 A;  2EVR A;  1WYX A;  5I22 A;  4EQA A;  1E6G A;  3PBC A;  4R0K A;  2YT6 A;  4HVU A;  1X69 A;  2ROT A;  1JU5 C;  1TUC A;  1Z9Z A;  2DL5 A;  2KXC A;  1K4U S;  1GBR A;  5IXF A;  1IO6 A;  3VS3 A;  2EGA A;  4DEY A;  2IO8 A;  3O98 A;  1QWE A;  2GQI A;  1H3H A;  4EQ8 A;  1ZUY A;  2EYZ A;  2EGC A;  1X6G A;  2GNC A;  2J6K A;  2BZY A;  3R6N A;  1SRM A;  2DBM A;  4F0W A;  1GCP A;  1M30 A;  1WXU A;  4RTY A;  2VWF A;  1X6B A;  4EIK A;  1QWF A;  1T0J A;  1VYV A;  4HXJ A;  1JQQ A;  3H0F A;  3SHW A;  1T3L A;  4LE9 A;  1YN8 A;  3KW0 A;  3TSW A;  2L3Q A;  2CSI A;  3EG1 A;  3C0C A;  2C0T A;  1NEB A;  1GCQ A;  1OV3 A;  2CT3 A;  2X3W D;  1WFW A;  1H92 A;  1CSK A;  2RQU A;  2CRE A;  1M27 C;  3EGU A;  4QT7 A;  2ROL A;  1AWW A;  2LRJ A;  5FWC A;  1FYN A;  1RLQ C;  1AWO A;  2MOX A;  4OMQ A;  4RTZ A;  2EKH A;  2LJ3 A;  2AK5 A;  3VS0 A;  1M3C A;  2EBP A;  3VS2 A;  1Y57 A;  2DL3 A;  4F16 A;  2QDL A;  1AD5 A;  5IHK A;  1RUW A;  2EYY A;  1X2K A;  2MIO A;  2EYX A;  1KJW A;  4LUE A;  2D0N A;  1FMK A;  2A28 A;  1KSW A;  1M3A A;  3IQL A;  4J9E A;  4LNP A;  1YWO A;  1OOT A;  2KYB A;  3EHQ A;  1KIK A;  2LQW A;  2L3P A;  3H0I A;  4KRT A;  4Z8A A;  1QLY A;  2EGE A;  2DL8 A;  2DMO A;  2HEQ A;  1NYF A;  2FEI A;  1M3B A;  2AZV A;  2O2O A;  5GJW B;  3VS1 A;  4CSH A;  4WCI A;  4F4M A;  4FQA A;  1YWP A;  2VOB A;  2LCS A;  2ED1 A;  1BK2 A;  4LJ1 A;  2KRM A;  2LMJ A;  3CQT A;  1MUZ A;  2A08 A;  1ABQ A;  3ULR B;  3PBI A;  1X43 A;  1TG0 A;  4J9H A;  1UDL A;  2A37 A;  3GT2 A;  1VA7 A;  2SRC A;  4F0V A;  1UGV A;  1UHC A;  1GCQ C;  2ABL A;  2B86 A;  4FDY A;  1ZX6 A;  4DEX A;  2J7I A;  1Z9Q A;  1NLP C;  2BTT A;  2HBW A;  1ZUU A;  4Z89 A;  3VRY A;  3REA B;  1W1F A;  2JM8 A;  2LP5 A;  2YUP A;  3QWX X;  4CGK A;  4HPE A;  3NPF A;  1GFC A;  2ENM A;  2OAW A;  2V1Q A;  4CC3 A;  2D1X A;  4OMM A;  1EFN A;  2VPM A;  4J9D A;  4F14 A;  2O9S A;  2YSQ A;  1XOV A;  2C0O A;  1G2B A;  2KYM A;  3TVT A;  1WXT A;  2HSP A;  3VS4 A;  1W70 A;  1PWT A;  2DRM A;  2EPD A;  4JJB A;  2P4R A;  2RQT A;  4IIO A;  2FPD A;  5I11 A;  2PZ1 A;  5EC7 A;  2FRY A;  3LH5 A;  4LN2 A;  2KRN A;  3REB B;  2CT4 A;  2LJ1 A;  1UJ0 A;  1NYG A;  1SRL A;  3TSZ A;  4J9C A;  2BZX A;  3UA6 A;  2YUN A;  3EG2 A;  3A2Y A;  2RF0 A;  1WLP B;  1K9A A;  3M0T A;  1UUE A;  1V1C A;  2JMC A;  1BBZ A;  3O5Z A;  4GBQ A;  2DLP A;  2GGR A;  1SHG A;  2K3A A;  4HVW A;  2V1R A;  2RNA A;  1CKA A;  1JO8 A;  2J6F A;  2C0I A;  1WDX A;  2FG0 A;  1AWX A;  4CC4 B;  4AFS C;  4GLM A;  2FO0 A;  2K7A A;  1UFF A;  4RTW A;  3S0Q A;  3I9Q A;  3PVQ A;  4AFQ C;  3RBB B;  1GRI A;  1PRL C;  2DA9 A;  1PKT A;  1YP5 A;  2DJQ A;  1H8K A;  1WXB A;  3UAT A;  1MV3 A;  2X3X D;  2M0Y A;  1NM7 A;  4ORZ A;  2ED0 A;  4JXB A;  1B3Q A;  4D8D A;  2HDA A;  2DM1 A;  2OJ2 A;  4J9G A;  1AZE A;  1M8M A;  2AKK A;  1UEC A;  2JMA A;  4OMP A;  1OPL A;  4E6R A;  2GTJ A;  2AKL A;  2JXB A;  2J06 A;  5FW9 A;  2K1G A;  2RPN A;  2OI3 A;  4A63 B;  2O9V A;  4AG2 C;  4FGE A;  2NUZ A;  2O88 A;  1WX6 A;  3H0H A;  4EOB A;  3NMZ C;  3U23 A;  4OML A;  4HZB A;  1ZBJ A;  1QKX A;  2K3B A;  2L2P A;  2SEM A;  1GFD A;  2KR3 A;  4HVV A;  3M0P A;  1S1N A;  4IIM A;  1ABO A;  1RLP C;  2CDT A;  2D8H A;  2FRW A;  1PRM C;  3VPJ A;  4JJC A;  2KGT A;  2YUQ A;  1PHT A;  1BU1 A;  4JJD A;  2RMO A;  2DVJ A;  1Y0M A;  1A0N B;  1GBQ A;  4AFU C;  1U06 A;  2KT8 A;  4ESR A;  1K0X A;  1HSQ A;  2ESW A;  1UE9 A;  4LUD A;  2VVK A;  5IHI A;  2W0Z A;  4ZNX A;  3A30 A;  4FGD A;  1W6X A;  1AWJ A;  1G83 A;  2CH4 W;  3M0U A;  4RTT A;  3FJ5 A;  2KT1 A;  4AG1 C;  1B07 A;  3PE0 A;  2DE0 X;  5IHN A;  2F2W A;  4Q4T A;  2DL4 A;  2YDL A;  1ZSG A;  2JS2 A;  3KFV A;  4CT3 A;  1NLO C;  2M51 A;  1I07 A;  3QWY A;  1HD3 A;  3VRZ A;  3UA7 A;  3M0R A;  5HCK A;  5IH2 A;  2IF6 A;  1SEM A;  2AZS A;  4FQB A;  1JXM A;  1QCF A;  2L0A A;  2L3S A;  3H41 A;  2NWM A;  2I0N A;  3EG0 A;  1U3O A;  1SPK A;  2CH4 A;  3I35 A;  3NGP A;  2KEA A;  2A36 A;  1AOJ A;  2DF6 A;  2GBQ A;  2RQR A;  2F2V A;  5GJV B;  3JV3 A;  4OMO A;  3ZL7 C;  3M1U A;  2VPS A;  2FPF A;  2LX7 A;  2KRS A;  4Z88 A;  2IOB A;  3A2Z A;  2LNH B;  2RQW A;  2CUB A;  1HJD A;  4JPB W;  1VYT A;  2K2M A;  2CSQ A;  5IXB A;  5FWB A;  2MCN A;  1KFZ A;  2IO7 A;  1OPK A;  1CKB A;  2E5K A;  1PKS A;  3EG3 A;  4RTV A;  3I86 A;  2EYW A;  2VKN A;  2IIM A;  1X2Q A;  2JW4 A;  1I0C A;  4OMN A;  2DL7 A;  2D8J A;  1YCS B;  2YUO A;  1J3T A;  2DNU A;  2K9G A;  1E7O A;  2FPE A;  4J9B A;  3VS6 A;  1LCK A;  2JS0 A;  2KE9 A;  1T3S A;  1SHF A;  2CUD A;  2K6D A;  2PTK A;  3GBQ A;  4D8K A;  1I1J A;  2O31 A;  3VS5 A;  4JZ4 A;  1AVZ C;  1JEG A;  1ZLM A;  2LQN A;  3PVL A;  3M0S A;  2J6O A;  1U5S A;  1UHF A;  3UF4 A;  2F2X A;  2KRO A;  2LJ0 A;  2DIL A;  4HCK A;  2XMF A; 
#chains in the Genus database with same CATH topology
 4NL2 A;  3FB9 A;  1R0B G;  3FEO A;  4F17 A;  4LD6 A;  3CD6 A;  1MV0 B;  2KBT A;  1GXI E;  4FM4 B;  2XU8 A;  1VQN T;  2DBK A;  3JB9 F;  1N5Z A;  1XQH A;  3BY7 A;  1WI7 A;  2ECZ A;  2RN8 A;  1WA7 A;  5ECA A;  2DIG A;  2EW3 A;  3O8V A;  3M4Y A;  1ARK A;  4PLL A;  2DZ9 A;  4Q4N A;  3RMS A;  1K1Z A;  3OYH A;  2FZK B;  5IT9 E;  1WJR A;  2ZPG B;  3OBY A;  5L23 A;  5KE2 A;  1K8A R;  3CCQ Q;  4J6X A;  1NG2 A;  2CZ1 B;  2HCK A;  2JUF A;  1IXD A;  2LZ6 B;  2W10 A;  2HKN A;  3QZ9 B;  5M9O A;  4HFK A;  2DYB A;  4OF1 A;  1AHJ B;  1V76 A;  2JN0 A;  3RNJ A;  2DAQ A;  2HL3 A;  3UWN A;  3JCM Q;  1K76 A;  1ZHI A;  2K5I A;  1VQO T;  4OLK A;  1UTI A;  4BI8 B;  1K8A C;  4FSS A;  4HKE A;  1B34 A;  5KYX A;  1UG1 A;  2DX1 A;  2LT4 A;  3TU4 K;  4M4Z A;  1X27 A;  4A54 A;  3A1P A;  3FLG A;  1WHL A;  4EQA A;  2YT6 A;  4HVU A;  2ROT A;  2DL5 A;  3EFO A;  5IXF A;  4HA8 A;  1TWB A;  2EGA A;  4DEY A;  2QDY B;  3MET A;  2RK2 A;  5LJ5 d;  2IO8 A;  1ZA2 B;  2EGC A;  1FX7 A;  2PVO B;  2V8K A;  2DBM A;  3A8L B;  1M30 A;  1WXU A;  4RTY A;  4RG2 A;  1D0Y A;  3HFO A;  4HXJ A;  3OYG A;  1JQQ A;  3JB9 J;  3M4G A;  3H0F A;  3M59 A;  3SHW A;  3CD6 T;  1YN8 A;  1UGQ B;  3TSW A;  2L3Q A;  2IG0 A;  1NEB A;  1QVG A;  5LJ5 h;  3VKI A;  1OV3 A;  1Q86 R;  1FMV A;  4CRI A;  1CSK A;  4EMK A;  2CRE A;  3EGU A;  1AWW A;  3OYY A;  2QQA A;  2MOX A;  4OMQ A;  4RTZ A;  2LJ3 A;  3PMT A;  4KUI A;  2DFU A;  1M3C A;  3HTR A;  2EBP A;  2E3H A;  2HQH A;  5DLQ E;  4EPC A;  1Y57 A;  1M2V A;  3OYN A;  5LL6 S;  4F16 A;  2D9T A;  4ZTJ A;  3D7S B;  2NUP B;  2A7Y A;  1O75 A;  3M53 A;  4PJO E;  1RUW A;  2F5K A;  1Q86 C;  1FMK A;  2ZPB B;  3GP8 A;  3EG9 B;  1QP2 A;  3F70 A;  2P0K A;  4DA4 A;  2QAZ A;  3M9Q A;  2KYB A;  3P8D A;  1VQP Q;  2LQW A;  2C06 A;  4BE2 A;  1WHM A;  4B9X A;  4FW1 A;  1YHQ Q;  1M3B A;  5C6S A;  3JCM J;  2JOY A;  3VS1 A;  1VQP A;  2DVE A;  2VOB A;  3L2Z A;  4X34 A;  1YHQ A;  4AT1 B;  2DER A;  1VQ9 A;  4M7D E;  1KG1 A;  3S3N A;  3JCM f;  4M7A E;  2LMJ A;  3ME9 A;  4IUT A;  1ABQ A;  3VYG A;  4J9H A;  1N27 A;  2RK1 A;  4C92 A;  3M58 A;  3EBQ A;  4C92 F;  3GT2 A;  1VA7 A;  1UGV A;  1UHC A;  1GCQ C;  2B86 A;  4LDV A;  4DEX A;  4RG8 A;  5GAN 3;  4C8Q D;  2BTT A;  2CP3 A;  2HBW A;  3MP8 A;  3A5Z B;  3VRY A;  3REA B;  1KQ1 A;  3E2U A;  2DD4 A;  2JM8 A;  2AT1 B;  1G3Y A;  1PD0 A;  4C8Q A;  3OSS C;  3JCM P;  3ER0 A;  1TU0 B;  3OYE A;  1GFC A;  2ENM A;  4M75 C;  5I2M A;  2D1X A;  3GF5 A;  4OMM A;  3OYC A;  3QKJ A;  1OYX A;  2YSQ A;  3MHX A;  4N0A A;  1Q7Y C;  2HSP A;  3GOX A;  3WVE B;  1LNX A;  2EQJ A;  2P4R A;  1D0Z A;  4FYV B;  4IIO A;  5EC7 A;  2PUO B;  1K8A U;  4LN2 A;  3DKM A;  4PK4 A;  3E9G A;  3CCL Q;  2BZX A;  1F1B B;  2XI9 A;  3RER A;  1YIT Q;  1WJQ A;  1WLP B;  3EFS A;  7AT1 B;  1I5L A;  1VQM Q;  1QVG P;  2JMC A;  2KI7 A;  2DLP A;  1SHG A;  3CCL A;  2K3A A;  2RNA A;  4LXC A;  1VQP T;  5GAN 8;  1YIT A;  2V26 A;  3SWN C;  4CC4 B;  1VQM A;  1YHQ T;  4RTW A;  3UT1 A;  3G71 A;  2M02 A;  4AFQ C;  1BYM A;  1OX8 A;  1PD1 A;  4E2F B;  2LT1 A;  1PKT A;  1YP5 A;  2DK3 A;  2QQS A;  3NTH A;  1I4K 1;  3AT1 B;  1I5O B;  4M78 C;  2X3X D;  1RAI B;  2V8I A;  1ZA1 B;  1OU8 A;  4D6W A;  2ED0 A;  4JXB A;  4IUP A;  2OTJ Q;  4D8D A;  3GIB A;  4J9G A;  5GAN j;  3OW2 S;  3M57 A;  1UEC A;  3CCM Q;  2JMA A;  4OMP A;  2K3Y A;  4BUG A;  2K1G A;  2OI3 A;  2OTJ A;  2KVQ G;  1UB4 A;  1PSE A;  1FXX A;  3NMZ C;  3U23 A;  5CO7 A;  1WGS A;  1QKX A;  3JCM d;  3JCM e;  3RUX A;  1R0C B;  1K73 R;  4B9W A;  1PRM C;  5GAO r;  4DBQ A;  2KGT A;  1PHT A;  4Z02 A;  5KH6 A;  5CK9 A;  2DET A;  2RMO A;  1I81 A;  2DVJ A;  2PU9 B;  1R77 A;  4C0G A;  1GBQ A;  2KT8 A;  2A3L A;  3OMC A;  4MDW A;  4ANJ A;  3L2R A;  1UE9 A;  3JCM W;  3QYH B;  2W0Z A;  4JUV A;  4FGD A;  4KH1 B;  1W6X A;  2JJ9 A;  2RA2 A;  2KT1 A;  1B07 A;  3PE0 A;  3E1S A;  1RI0 A;  4M75 B;  4OB1 B;  5GAO q;  3CBM A;  4GLK A;  3CCL T;  2YDL A;  2QYZ A;  1D3B A;  3L1A A;  2JS2 A;  4VUB A;  1YIT T;  1VUB A;  4OGC A;  3HHT B;  1HD3 A;  3VRZ A;  1VQM T;  2CP5 A;  1LPL A;  4IUV A;  3NTK A;  2RHU A;  3FIF A;  2LVM A;  3AHU A;  2IF6 A;  4FQB A;  4V2S A;  2L0A A;  1LOJ A;  1MGQ A;  3QBY A;  2XIC A;  3EG0 A;  2CH4 A;  2O01 E;  4HT9 A;  1Q82 R;  1M90 R;  1IRX A;  1H3Z A;  4E7H A;  2X9H A;  4KUD K;  2GBQ A;  3ZEH A;  3OS2 A;  3M5A A;  4J6Y A;  2FPF A;  2LX7 A;  2BIV A;  2YHT A;  3PIP A;  2Y90 A;  2IOB A;  5A0G A;  2COZ A;  2LNH B;  2OTJ T;  4M7D F;  1WJS A;  2CYZ B;  5LJ3 j;  2RQW A;  2CUB A;  3RKY A;  1VYT A;  1Q7Y U;  5GAM h;  3CC2 Q;  3SWN B;  1Q82 C;  1OPK A;  1KD1 R;  1M90 C;  1CKB A;  2E5K A;  1QCO A;  4RTV A;  2E6Z A;  3I86 A;  2DYI A;  2IIM A;  2L89 A;  2X35 A;  4OMN A;  2WSE E;  1YCS B;  2YUO A;  6AT1 B;  2DNU A;  2KE9 A;  1SHF A;  3GBQ A;  4M78 B;  1TS9 A;  4QQ6 A;  4IKF A;  3BW1 A;  1ZLM A;  2LQN A;  1VOM A;  2Y4Y A;  3M0S A;  1KD1 C;  4MZM A;  4XTV A;  3DB4 A;  1U1S A;  1PM3 A;  2ZPI B;  1U5S A;  1UHF A;  1BI3 A;  4BY6 C;  3MEV A;  5HK0 A;  3CMA Q;  3CCU Q;  2DIL A;  4NS5 A;  1MHN A;  2XMF A;  1VQ4 Q;  5J39 A;  2E65 A;  4Y92 A;  3THK A;  4JZ3 A;  4AFZ C;  3CMA A;  3CCU A;  2XDB A;  2HAX A;  3HPW A;  1Y96 B;  1M8V A;  3HRU A;  1VQ4 A;  3MCA B;  3CXC P;  3FC3 A;  2VV5 A;  1YCY A;  4RUG A;  2PNI A;  4X1V A;  3TRE A;  5HY6 A;  2E5Q A;  2JTE A;  4E47 A;  1VYU A;  2M1H A;  4OB0 B;  1VQ6 A;  3C94 A;  1JXO A;  3KXT A;  1UJY A;  3VS7 A;  2K79 A;  3QDR B;  1AZG B;  2DJZ A;  1RI9 A;  1NEG A;  1JB0 E;  2JM9 A;  4J9I A;  3M0Q A;  3NHN A;  5GMK m;  3ZFJ A;  5GAO n;  4PFP A;  3VPI A;  5GAN 5;  2YXY A;  1OEB A;  1PNJ A;  2L3R A;  4M78 D;  4PKC C;  2QG9 B;  1YJ9 Q;  1T0H A;  2EQM A;  1N8R R;  4JRI A;  5KYU B;  4MZT A;  1VQ8 A;  3I5S A;  3CME Q;  1YJ9 A;  1XJW B;  2EJF A;  4BB7 A;  4R0K A;  4IUQ A;  3OS1 A;  1PSF A;  1JU5 C;  4BI3 A;  2QEX Q;  1GBR A;  4DBH A;  3VS3 A;  2K2V A;  1MMA A;  3CME A;  5LJ5 f;  1N8R C;  1H3H A;  4EQ8 A;  1RAC B;  1X6G A;  2GNC A;  2BZY A;  2MK5 A;  4KH0 B;  1WNL A;  2CP6 A;  2ZPH B;  2QEX A;  4QKU A;  1X6B A;  4EIK A;  1T0J A;  1VYV A;  5LJ3 g;  3CMA T;  3CCU T;  4LE9 A;  3C4S A;  4M77 C;  3EG1 A;  4C92 E;  1VQ4 T;  3C0C A;  1YI2 Q;  2P0P A;  2X3W D;  2CT3 A;  1VIF A;  1WFW A;  2MF2 A;  1H92 A;  5CCA A;  2WP7 A;  2RQU A;  5GMK j;  1IHV A;  4R55 A;  1RLQ C;  1AWO A;  2EKH A;  3PNW C;  1VQ6 T;  3G6E Q;  3VS0 A;  1YI2 A;  2R5A A;  2COY A;  2RHZ A;  4C8Q E;  1I8F A;  3VS2 A;  1ZSZ A;  4BY6 B;  1Q82 U;  1M90 U;  1AD5 A;  1G5V A;  3A8M B;  1KC8 R;  3MKD A;  3G6E A;  1X2K A;  2EYX A;  4JS5 A;  1M2O A;  1M3A A;  3IQL A;  2EQK A;  3EHQ A;  3CC7 Q;  4KRT A;  3CPF A;  2IVW A;  4Z8A A;  5CVI A;  1QLY A;  4XQ3 A;  2EGE A;  5GJW B;  2DMO A;  1KD1 U;  4TVR A;  2FEI A;  3CCJ Q;  4CSH A;  1R8O B;  4PLI A;  3CC7 A;  4E7J A;  1VQ8 T;  3I55 Q;  2LCS A;  3HKS A;  1YJ9 T;  8AT1 B;  4DQ2 A;  2FVU A;  1EX4 A;  3CCJ A;  5HKC A;  2F5T X;  1X6O A;  2A08 A;  3I55 A;  3CME T;  3ULR B;  3OQ5 A;  3PBI A;  4F04 B;  1W4S A;  3X25 B;  4F0V A;  2NUT B;  2QEX T;  2VXF A;  1ZX6 A;  4FDY A;  4OVA A;  1NLP C;  4N4G A;  4QVZ A;  1ZUU A;  2DIQ A;  4Z89 A;  2YRC A;  2GCX A;  2MMP A;  3BDL A;  4C0F A;  3FDR A;  5DM7 R;  3SD4 A;  2YUP A;  2LP5 A;  3QWX X;  2OTL Q;  2E4H A;  4HPE A;  4JUR A;  2OAW A;  1WPY A;  2QQ9 A;  2RJD A;  1OQK A;  1W2B A;  4CC3 A;  1IB8 A;  2EIF A;  3J7A F;  4J9D A;  2O9S A;  2OTL A;  2DTO A;  1YI2 T;  5CKE A;  3TVT A;  2EYQ A;  2CKK A;  5GMK l;  5LJ5 e;  2EPD A;  2BKD N;  2DRM A;  3C12 A;  4JJB A;  4FL6 A;  2AHJ B;  3G6E T;  4PFZ A;  4ZGJ B;  3QUI A;  2CT4 A;  2LJ1 A;  1SRL A;  2EWN A;  1KQS A;  1QQJ A;  4J9C A;  3EG2 A;  1AT1 B;  3A2Y A;  2RF0 A;  1K9A A;  4M77 B;  1V1C A;  2ZZD A;  1G3S A;  1WHH A;  2GGR A;  3PTA A;  2K3X A;  2V1R A;  1YBY A;  1M1K R;  1C1A A;  3CC7 T;  2J6F A;  3EGX B;  1N8R U;  3V8K A;  2FG0 A;  1AWX A;  4GLM A;  1WHJ A;  3CCJ T;  3URG A;  4F7U B;  3S0Q A;  2DXT A;  3I9Q A;  3PVQ A;  1WZO A;  3I55 T;  1H8K A;  3LH0 A;  1OU9 A;  2CZ6 B;  1WXB A;  4JJN K;  4DOV A;  1OZ2 A;  4Y28 E;  2QI2 A;  1QVF A;  1D09 B;  2M0Y A;  1K9M R;  4ORZ A;  1M1K C;  2EFI A;  1ZBX A;  2CP0 A;  1BI0 A;  2DM1 A;  4PJO C;  2PUK B;  4XTU A;  3SDZ A;  2QQB A;  4JRK A;  2JXB A;  2J06 A;  2O4X B;  2RPN A;  3RKX A;  1C0M A;  2R57 A;  3QJ6 A;  5A0D A;  1Q81 R;  1VQ9 Q;  4FGE A;  5KE3 A;  2NUZ A;  4QW2 A;  2MYS A;  2OTL T;  1OUL A;  4HFL A;  1YIJ Q;  2L2P A;  2E64 A;  2PVD B;  3DLL A;  1GFD A;  4HVV A;  3M0P A;  1QCN A;  1S1N A;  4IIM A;  1QVG S;  1ABO A;  4QVD A;  2D8H A;  3VPJ A;  2YUQ A;  3PMI A;  3MO8 A;  4M7D C;  1YIJ A;  1Q81 C;  4M7A C;  2DTH A;  4M77 D;  1U06 A;  1K0X A;  2ESW A;  4B6M A;  2DXB A;  1N9S A;  2P4T A;  4JRQ A;  3A30 A;  2IPO B;  1AWJ A;  3M0U A;  1YFN A;  2G3R A;  3V7C A;  4AG1 C;  2XID A;  5IHN A;  4BE1 A;  4C8Q F;  5CIU A;  1W2B P;  2KDS A;  2DL4 A;  2HZY A;  1SKU B;  2MWO A;  3A8H B;  4CT3 A;  3KFV A;  2DTI A;  3J80 E;  3JCM X;  4ZGD B;  3P8B B;  5IH2 A;  1RAD B;  2MAM A;  2NUP A;  1QCF A;  1NPR A;  2L3S A;  4FT2 A;  4RKU E;  2VB6 A;  5GAM f;  5KYY B;  3CCR A;  2NWM A;  4FSX A;  4OB2 B;  3EG9 A;  3MPU B;  3NGP A;  2KEA A;  2A36 A;  2H3J A;  4J83 A;  1KQS P;  2JZ2 A;  1TOV A;  4DBR A;  2F2V A;  5GJV B;  3C95 A;  3M1U A;  4HCC A;  5GAO p;  2RJF A;  2KRS A;  3OW2 A;  3M55 A;  3A2Z A;  3LWI A;  3R6O A;  3G71 Q;  1PC0 A;  1HJD A;  1M5Q 1;  5LJ5 g;  2CSQ A;  3G7Z A;  3RMQ A;  2MCN A;  2IO7 A;  1U8R A;  1PKS A;  1QMC A;  2XDD A;  3CCS A;  2EYW A;  3GNG A;  1VQ9 T;  2DL7 A;  2D8J A;  1YJW Q;  3PFS A;  3OYL A;  1WHG A;  2M0O A;  1LCK A;  1QVF P;  1LVK A;  2CUD A;  3OYI A;  4D8K A;  1YIJ T;  4XAX B;  4JZ4 A;  1YJW A;  4ATO A;  3GPL A;  2HD0 A;  4PJO B;  2F69 A;  1MNE A;  2J6O A;  4XTW A;  2JTM A;  5GAN d;  3L2W A;  3I56 Q;  2HKQ B;  2FB7 A;  2DZC A;  4FYW B;  4M78 G;  2KRO A;  4N4H A;  2ZPE B;  3OBW A;  3E9F A;  2IO9 A;  3I56 A;  5CQY A;  2E10 A;  2KXD A;  2RQV A;  1YNZ A;  2GTO A;  2JT4 A;  2DRK A;  1Q86 U;  1X01 A;  1M1K U;  5GAN h;  5FRO A;  2H8H A;  5FU7 C;  4M7D B;  3CCR T;  2G6F X;  5EG2 A;  4M7A B;  2K57 A;  2XIV A;  2BUD A;  2ZGW A;  3T9N A;  1RAA B;  2X4J A;  3EHR A;  2RH2 A;  2B8A A;  5HK3 A;  4XU3 A;  1RAB B;  2RD1 A;  1QKW A;  4K11 A;  1JBM A;  1K73 C;  1ZUK A;  2FL7 A;  3NE0 A;  4XK8 E;  4QVC A;  3JRZ A;  4JRP A;  5GAN 2;  1BKB A;  4J9F A;  2IOA A;  3LW5 E;  2EQI A;  4LDX A;  3CPW A;  2Y4X A;  5D7U A;  3M56 A;  4LDU A;  3CCS T;  1Y07 A;  5KCO A;  1Q81 U;  3G71 T;  2E70 A;  3OSV A;  2VC8 A;  5D6W A;  5GAN 4;  1E6H A;  5D6X A;  4RCC A;  4RTX A;  4PJO D;  2CP2 A;  2E3I A;  3V8L A;  2J05 A;  4QQD A;  5GAM d;  2RJC A;  1DJ7 B;  5GAM e;  1AEY A;  4E7Z A;  2KNB B;  2EVR A;  1WYX A;  5I22 A;  1YJW T;  3PBC A;  5CQX A;  3CC4 Q;  1X69 A;  1Z9Z A;  3G4S Q;  2KXC A;  1K4U S;  3OW2 P;  1IO6 A;  3QG1 A;  2QTV A;  2A0F B;  3O98 A;  1QWE A;  3CXC S;  2EYZ A;  2J6K A;  3CC4 A;  2QGF B;  3G4S A;  1GCP A;  2VWF A;  2ZCF B;  3I56 T;  2KQW A;  2LRQ A;  4LDY A;  3V7S A;  4JS4 A;  3HP9 A;  1GCQ A;  1P92 A;  3X20 B;  1M27 C;  2LRJ A;  5FWC A;  5LJ3 h;  4M75 D;  5KYW B;  2AK5 A;  2XD0 A;  2EAY A;  4M75 A;  3WXM B;  2VAS A;  2E1H A;  4NL3 A;  1TTH B;  5KCH A;  3LWH A;  2MIO A;  1KJW A;  2MI6 A;  2A28 A;  1JJ2 A;  2VGN A;  3OYF A;  4XTZ A;  3OYB A;  2KSS A;  1BCM A;  1OOT A;  1YWO A;  3FRN A;  1KIK A;  4A4G A;  3H0I A;  2FHD A;  1VQ6 Q;  2X51 A;  3OS5 A;  5FU7 B;  2AZV A;  2O2O A;  2QGG A;  1O9S A;  4F4M A;  4PJL A;  1YWP A;  2FYK A;  4LD9 K;  3HRT A;  1B7T A;  3QII A;  2ED1 A;  3FJP A;  2DXC A;  2YRV A;  2L8D A;  1QVP A;  1M9S A;  1OZ3 A;  3RDV A;  3MJX A;  4DOW A;  2PVG B;  3CQT A;  1MUZ A;  3A8G B;  4ZN1 A;  4PL6 A;  2P0Q A;  1X43 A;  3JCM g;  4PJM A;  2R58 A;  3BFM A;  3CC4 T;  3PT9 A;  3SWN A;  3G4S T;  2SRC A;  3CPW P;  4XU1 A;  1OX9 A;  3VYH B;  2J7I A;  4EMK C;  1Z9Q A;  3N5B B;  2RHI A;  2RO0 A;  1WQ7 A;  1VQ8 Q;  1W1F A;  3EGD B;  1RAH B;  2BE9 B;  4CGK A;  3QZ5 B;  3NPF A;  4M78 A;  3MEU A;  2V1Q A;  3HRS A;  4M78 F;  4C5G A;  1K73 U;  1U1T A;  1Y7X A;  2C0O A;  1G2B A;  2KYM A;  2XG8 D;  2LCL A;  4E7L A;  3HFN A;  1WXT A;  2Z0W A;  1RAG B;  3VJP A;  3VUB A;  1W70 A;  3VS4 A;  4EDU A;  2RQT A;  2GFA A;  4N4I A;  2EKO A;  3LH5 A;  3TQ7 P;  4E7S A;  3ZBD A;  1MMN A;  2KRN A;  3LGF A;  1UJ0 A;  1NYG A;  2VXE A;  1Y96 A;  2KMT A;  4FCY A;  3LLR A;  3M0T A;  1UUE A;  2RHY A;  2HMA A;  3CEY A;  3O5Z A;  4HVW A;  1KQ2 A;  3RIR A;  1CKA A;  1JO8 A;  4C92 C;  2C0I A;  2D0Q B;  5D6Y A;  1WDX A;  4EMG A;  4PNO A;  2FO0 A;  2K7A A;  1IGQ A;  1UEB A;  4Q5W A;  2K4Y A;  4M77 G;  3RBB B;  4O5V A;  4OGE A;  1PRL C;  2DA9 A;  3JCM V;  4C8Q C;  2QAS A;  1MV3 A;  1SSF A;  1D0X A;  2QTX A;  1JJ2 P;  1B34 B;  5KYX B;  2PQW A;  4L59 A;  1B3Q A;  3MP6 A;  4FYX B;  2HDA A;  2EQU A;  2OJ2 A;  1AZE A;  4F7U G;  4II1 A;  2AKK A;  5GMK h;  3RES A;  4PJN A;  2GTJ A;  2AKL A;  3EFO B;  4N0A C;  5FW9 A;  5KYU A;  3LX7 A;  4A63 B;  2O9V A;  4AG2 C;  1KC8 C;  3JB9 D;  2K5L A;  3HL8 A;  2O88 A;  4GY5 A;  4XTY A;  1G3T A;  3OYJ A;  1VQ5 Q;  2KR3 A;  1D1B A;  2MWP A;  1IHW A;  2RHX A;  2FRW A;  4JJC A;  4JJD A;  1BU1 A;  3EH2 A;  2CZ0 B;  2DPP B;  1VQ5 A;  1BI1 A;  3GLX A;  4DBF A;  1JRI A;  5FRN A;  1HSQ A;  5GAO m;  4EMK B;  2LQK A;  4KGX B;  2CH4 W;  3TEE A;  4RTT A;  3FJ5 A;  2V8J A;  3BDU A;  3QPH A;  2DE0 X;  1M2V B;  4L5G A;  1NPP A;  3S3O A;  4Q4T A;  1ZSG A;  2LX9 A;  4A4E A;  2YRD A;  2M51 A;  2AIR B;  1C6V X;  3CCQ A;  3QWY A;  3E19 A;  2X4W A;  2RI2 A;  3INZ A;  4C5H A;  3JB9 I;  1SEM A;  2AZS A;  1HXD A;  1IRE B;  2RI5 A;  5GMK i;  3H41 A;  3RKW A;  2XDP A;  3CBO A;  1U3O A;  2WSF E;  3V8J A;  5FU6 C;  1AOJ A;  2DF6 A;  3MEW A;  2LTO A;  3JV3 A;  4OMO A;  4ZN3 A;  1M1F A;  5LJ5 j;  2KAF A;  4PJJ A;  2WAC A;  4BDY A;  4A53 A;  3JB9 H;  1OI1 A;  5IAY A;  4ELY C;  1BI2 A;  2VGM A;  2KY9 A;  4JPB W;  2DKG A;  4J30 A;  2OAU A;  4C92 B;  3JCM b;  5FRM A;  3JAM E;  3H6Z A;  4BE0 A;  3X26 B;  3Q1J A;  2RB6 A;  1NJI R;  5J3B A;  3QO3 A;  5CKB A;  2JW4 A;  1I0C A;  1LJO A;  1J3T A;  4WF2 A;  1W2B S;  2D6F A;  2K9G A;  4J9B A;  1E7O A;  2FPE A;  3VS6 A;  4C8Q B;  2NUT A;  3QDF A;  2JNG A;  1T3S A;  2K6D A;  1VQ5 T;  1I1J A;  2O31 A;  5IN1 A;  5CR2 A;  3LGL A;  1JEG A;  3QSU A;  4HFF A;  3PVL A;  3JCM c;  1NJI C;  1QW1 A;  1RL2 A;  5GAN f;  3MEA A;  3UF4 A;  3QYG B;  4KBM B;  2DD5 A;  3UDC A;  2LJ0 A;  1EZZ B;  4HCK A;  3HSB A;  2M16 A;  1K9M C;  1KQS S;  4Q4G X;  3CCQ T;  2XHC A;  4PJO G;  3X28 B;  1K0S A;  4CC7 A;  4CI0 C;  2HNI A;  1WIE A;  2COW A;  3OYD A;  3CCV Q;  2FZG B;  5CKD A;  4E7K A;  1M4Z A;  1YJN Q;  3A98 A;  4ELZ C;  1SSH A;  1KC8 U;  3SEM A;  2HQE A;  4M77 A;  4C92 D;  3CCV A;  4A4F A;  4M77 F;  3TCJ A;  2BZ8 A;  1D1A A;  3I5R A;  5I2S A;  3QHS A;  1HYO A;  1YJN A;  1QVF S;  4M7D G;  4M7A G;  1X75 C;  3EGX A;  3H8Z A;  2RI3 A;  4BDZ A;  3OYA A;  4WTO B;  4F7U A;  3DB3 A;  4CC2 A;  3CCR Q;  1VQ7 Q;  4M75 E;  4F7U F;  1Q7Y R;  4FGI A;  4C0Z A;  1MMD A;  5A2Q E;  4RTU A;  1TUD A;  2MPX C;  4M75 G;  3M54 A;  4EMH A;  2LC4 A;  1BB9 A;  2YWW A;  5GAO l;  4HZ9 A;  5L8R E;  1VQ7 A;  1MND A;  4RCB A;  1GL5 A;  2QA4 Q;  5FU6 B;  3NTI A;  1ACM B;  1E6G A;  3S3M A;  5DY9 A;  1KHC A;  2NLU A;  3OYM A;  3VU3 C;  3WVD B;  1TUC A;  2O4X A;  5FLX E;  2HQX A;  3NFC A;  2QA4 A;  1PCX A;  2GQI A;  1ZUY A;  3CCS Q;  3R6N A;  1SRM A;  4F0W A;  2CGH A;  5KYN A;  5LJ3 f;  1QWF A;  4J6W A;  1FWZ A;  3QXE B;  2CS7 A;  3OB9 A;  1T3L A;  4O6J A;  3SB2 A;  3CCE Q;  2ATC B;  3KW0 A;  2CSI A;  3X24 B;  4FIB A;  4HCZ A;  2EJG A;  1FMW A;  2C0T A;  2F1L A;  4J8O A;  4KT0 E;  1N6A A;  2HBP A;  4QT7 A;  2ROL A;  2RM4 A;  1FYN A;  2L5Q A;  1D3B B;  3CCE A;  4BI4 A;  2R5M A;  5CAI A;  2KK4 A;  4C5I A;  3S6W A;  5GAN e;  3CCV T;  4M78 E;  2DL3 A;  2QDL A;  4FT4 A;  3V7R A;  1YJN T;  4BD3 A;  3DLM A;  4HCB A;  5IHK A;  3SFM A;  2XKO C;  2EYY A;  4LUE A;  2D0N A;  1KSW A;  4MMK A;  2HSE B;  2HL5 C;  5A0L A;  1NBE B;  4J9E A;  2CP7 A;  2DEQ A;  4LNP A;  1VQK Q;  1WQW A;  2L3P A;  2DO3 A;  2E6N A;  2P84 A;  5KYY A;  2DL8 A;  2HEQ A;  2OX7 A;  1NYF A;  3RR6 A;  1NJI U;  4OP0 A;  4WCI A;  2ZPF B;  4KGZ B;  3J81 E;  1VQ7 T;  4FQA A;  1VQK A;  3CCM A;  3H9N A;  4IUR A;  1BK2 A;  4A4H A;  3PGG A;  4LJ1 A;  2KRM A;  3GNF B;  1K9M U;  1BIB A;  4X9C A;  4MZP A;  4ME7 A;  2QA4 T;  1D1C A;  2LNV A;  1SG5 A;  1TG0 A;  1UDL A;  2X4X A;  4ZGE B;  3CXC A;  2A37 A;  1EIF A;  1H64 1;  2E12 A;  1RAF B;  2ABL A;  1MMG A;  1TH7 A;  3JSC A;  1VIE A;  1UGS B;  4JDS A;  3JCM h;  3LYI A;  1ZSZ C;  8ATC B;  3EAE A;  2JVV A;  3VUZ A;  1EFN A;  4PJO A;  2VPM A;  3P8H A;  4F14 A;  3OS0 A;  3CCE T;  4PJO F;  4C0D C;  1XOV A;  2YLB A;  5GAM j;  1PWT A;  4J32 A;  4C5E A;  2FPD A;  4YTL A;  5I11 A;  2PZ1 A;  2FRY A;  4PFO A;  5LJ3 d;  5LJ3 e;  2JTF A;  5C0M A;  4MML A;  3REB B;  4FW2 A;  1S72 Q;  4M7D D;  3TSZ A;  3JB9 G;  4M7A D;  3UA6 A;  2YUN A;  1HK9 A;  2QQR A;  3L2Q A;  2RJE A;  4LDW A;  5AT1 B;  4M7D A;  1BBZ A;  4GBQ A;  2GF7 A;  3A8O B;  4XU0 A;  4M7A A;  1S72 A;  4M7A F;  4ZTF A;  3CPW S;  1VQK T;  2LDM A;  3CCM T;  2VYT A;  2X4Y A;  4AFS C;  2QK0 A;  1UFF A;  1V29 B;  9ATC B;  1TUG B;  4RMO A;  4OMF B;  1GRI A;  3CC2 A;  1KHI A;  2DJQ A;  4M75 F;  1VQL Q;  4Y91 A;  3UAT A;  2LQ8 A;  1WHK A;  1TSF A;  1NM7 A;  4HT8 A;  5CKH A;  1M8M A;  1VQL A;  4KUL A;  4XU2 A;  1OPL A;  4E6R A;  3OA6 A;  3QJY A;  1TXQ A;  5J26 A;  4R56 A;  4FU6 A;  3EH1 A;  5GAN g;  4KGV B;  4E7I A;  3KUF A;  1WX6 A;  3H0H A;  4EOB A;  3KBG A;  3L2V A;  1RAE B;  4OML A;  3CBP A;  2BE7 D;  4HZB A;  1ZBJ A;  4J7F A;  2K3B A;  2I2L A;  2SEM A;  3OYK A;  1UGP B;  1RLP C;  2CDT A;  1G3W A;  1Q95 G;  3EFR A;  3L2U A;  1Y0M A;  2H3E B;  1A0N B;  3L42 A;  4ESR A;  4AFU C;  1PG5 B;  2YLC A;  4QQG A;  5AYF A;  4LUD A;  2VVK A;  5IHI A;  4JLG A;  4ZNX A;  1IGU A;  1G83 A;  2QXF A;  4XTX A;  2FZC B;  4L6V 5;  3MP1 A;  1ZSZ B;  2F2W A;  1VQN Q;  3OY9 A;  2LCC A;  1JJ2 S;  1S72 T;  2VUB A;  5CKF A;  1NLO C;  5KYW A;  5GAN 7;  1I07 A;  2CZ7 B;  4C0D B;  2K5F A;  3UA7 A;  2XK0 A;  2M9U A;  3M0R A;  2EJ9 A;  1KK7 A;  5HCK A;  1VQN A;  4P5N A;  1BIA A;  1UGR B;  3CC2 T;  1JXM A;  1IZ6 A;  1NE8 A;  2I0N A;  1SPK A;  2GQV A;  3I35 A;  4NOY A;  3G1J A;  2E41 A;  5GAM g;  1BCO A;  4JLI A;  2RQR A;  4UC4 A;  1ZQ1 A;  3ZL7 C;  1VQL T;  1N9R A;  2VPS A;  4Z88 A;  2GFU A;  3ASK A;  1M1G A;  4IUU A;  1XNI A;  4J7I A;  1VQO Q;  3VV0 A;  4AMC A;  2K2M A;  5IXB A;  1XTD A;  2ZAE A;  5FWB A;  5GAN 6;  1KFZ A;  4M77 E;  1SF9 A;  4OB3 B;  1QP3 A;  3EG3 A;  5GMK e;  2VKN A;  5I21 A;  1X2Q A;  1VQO A;  4A4K A;  2DXU A;  4FYY B;  1NZ9 A;  3PIO A;  5DLO A;  2WSC E;  4J5Y A;  2JS0 A;  2PTK A;  4MDX A;  3UPU A;  4C92 G;  3VS5 A;  4X9D A;  4F7U E;  3OMG A;  1AVZ C;  3EGD A;  2NYS A;  3BE3 A;  2DEU A;  1Y71 A;  4C8Q G;  3CD6 Q;  1G8X A;  2F2X A;  4BAC A; 
#chains in the Genus database with same CATH homology
 2IO9 A;  4Y92 A;  4F17 A;  4Q4G X;  3THK A;  4JZ3 A;  1K0S A;  4AFZ C;  2KXD A;  2RQV A;  1MV0 B;  2KBT A;  1YNZ A;  4CC7 A;  2DBK A;  2GTO A;  2JT4 A;  2DRK A;  1N5Z A;  1WI7 A;  2ECZ A;  2RN8 A;  1WIE A;  1WA7 A;  5ECA A;  2H8H A;  2EW3 A;  1ARK A;  2G6F X;  4RUG A;  2PNI A;  4X1V A;  4Q4N A;  1K1Z A;  2XIV A;  2JTE A;  3A98 A;  1VYU A;  1SSH A;  1JXO A;  1UJY A;  3SEM A;  3VS7 A;  5L23 A;  3EHR A;  2K79 A;  2BZ8 A;  1NG2 A;  2HCK A;  1QKW A;  3I5R A;  4K11 A;  1AZG B;  1ZUK A;  1RI9 A;  2LZ6 B;  2W10 A;  1NEG A;  2DYB A;  3NE0 A;  2JM9 A;  4J9I A;  3M0Q A;  3NHN A;  4J9F A;  2IOA A;  3RNJ A;  2EQI A;  3VPI A;  1K76 A;  4CC2 A;  1PNJ A;  1OEB A;  4FGI A;  4RTU A;  1UTI A;  1T0H A;  4OLK A;  1E6H A;  1TUD A;  4RTX A;  4FSS A;  1BB9 A;  2J05 A;  1UG1 A;  4HZ9 A;  2DX1 A;  1AEY A;  4M4Z A;  1X27 A;  2KNB B;  3I5S A;  1GL5 A;  2EVR A;  1WYX A;  5I22 A;  4EQA A;  1E6G A;  3PBC A;  4R0K A;  2YT6 A;  4HVU A;  1X69 A;  2ROT A;  1JU5 C;  1TUC A;  1Z9Z A;  2DL5 A;  2KXC A;  1K4U S;  1GBR A;  5IXF A;  1IO6 A;  3VS3 A;  2EGA A;  4DEY A;  2IO8 A;  3O98 A;  1QWE A;  2GQI A;  1H3H A;  4EQ8 A;  1ZUY A;  2EYZ A;  2EGC A;  1X6G A;  2GNC A;  2J6K A;  2BZY A;  3R6N A;  1SRM A;  2DBM A;  4F0W A;  1GCP A;  1M30 A;  1WXU A;  4RTY A;  2VWF A;  1X6B A;  4EIK A;  1QWF A;  1T0J A;  1VYV A;  4HXJ A;  1JQQ A;  3H0F A;  3SHW A;  1T3L A;  4LE9 A;  1YN8 A;  3KW0 A;  3TSW A;  2L3Q A;  2CSI A;  3EG1 A;  3C0C A;  2C0T A;  1NEB A;  1GCQ A;  1OV3 A;  2CT3 A;  2X3W D;  1WFW A;  1H92 A;  1CSK A;  2RQU A;  2CRE A;  1M27 C;  3EGU A;  4QT7 A;  2ROL A;  1AWW A;  2LRJ A;  5FWC A;  1FYN A;  1RLQ C;  1AWO A;  2MOX A;  4OMQ A;  4RTZ A;  2EKH A;  2LJ3 A;  2AK5 A;  3VS0 A;  1M3C A;  2EBP A;  3VS2 A;  1Y57 A;  2DL3 A;  4F16 A;  2QDL A;  1AD5 A;  5IHK A;  1RUW A;  2EYY A;  1X2K A;  2MIO A;  2EYX A;  1KJW A;  4LUE A;  2D0N A;  1FMK A;  2A28 A;  1KSW A;  1M3A A;  3IQL A;  4J9E A;  4LNP A;  1YWO A;  1OOT A;  2KYB A;  3EHQ A;  1KIK A;  2LQW A;  2L3P A;  3H0I A;  4KRT A;  4Z8A A;  1QLY A;  2EGE A;  2DL8 A;  2DMO A;  2HEQ A;  1NYF A;  2FEI A;  1M3B A;  2AZV A;  2O2O A;  5GJW B;  3VS1 A;  4CSH A;  4WCI A;  4F4M A;  4FQA A;  1YWP A;  2VOB A;  2LCS A;  2ED1 A;  1BK2 A;  4LJ1 A;  2KRM A;  2LMJ A;  3CQT A;  1MUZ A;  2A08 A;  1ABQ A;  3ULR B;  3PBI A;  1X43 A;  1TG0 A;  4J9H A;  1UDL A;  2A37 A;  3GT2 A;  1VA7 A;  2SRC A;  4F0V A;  1UGV A;  1UHC A;  1GCQ C;  2ABL A;  2B86 A;  4FDY A;  1ZX6 A;  4DEX A;  2J7I A;  1Z9Q A;  1NLP C;  2BTT A;  2HBW A;  1ZUU A;  4Z89 A;  3VRY A;  3REA B;  1W1F A;  2JM8 A;  2LP5 A;  2YUP A;  3QWX X;  4CGK A;  4HPE A;  3NPF A;  1GFC A;  2ENM A;  2OAW A;  2V1Q A;  4CC3 A;  2D1X A;  4OMM A;  1EFN A;  2VPM A;  4J9D A;  4F14 A;  2O9S A;  2YSQ A;  1XOV A;  2C0O A;  1G2B A;  2KYM A;  3TVT A;  1WXT A;  2HSP A;  3VS4 A;  1W70 A;  1PWT A;  2DRM A;  2EPD A;  4JJB A;  2P4R A;  2RQT A;  4IIO A;  2FPD A;  5I11 A;  2PZ1 A;  5EC7 A;  2FRY A;  3LH5 A;  4LN2 A;  2KRN A;  3REB B;  2CT4 A;  2LJ1 A;  1UJ0 A;  1NYG A;  1SRL A;  3TSZ A;  4J9C A;  2BZX A;  3UA6 A;  2YUN A;  3EG2 A;  3A2Y A;  2RF0 A;  1WLP B;  1K9A A;  3M0T A;  1UUE A;  1V1C A;  2JMC A;  1BBZ A;  3O5Z A;  4GBQ A;  2DLP A;  2GGR A;  1SHG A;  2K3A A;  4HVW A;  2V1R A;  2RNA A;  1CKA A;  1JO8 A;  2J6F A;  2C0I A;  1WDX A;  2FG0 A;  1AWX A;  4CC4 B;  4AFS C;  4GLM A;  2FO0 A;  2K7A A;  1UFF A;  4RTW A;  3S0Q A;  3I9Q A;  3PVQ A;  4AFQ C;  3RBB B;  1GRI A;  1PRL C;  2DA9 A;  1PKT A;  1YP5 A;  2DJQ A;  1H8K A;  1WXB A;  3UAT A;  1MV3 A;  2X3X D;  2M0Y A;  1NM7 A;  4ORZ A;  2ED0 A;  4JXB A;  1B3Q A;  4D8D A;  2HDA A;  2DM1 A;  2OJ2 A;  4J9G A;  1AZE A;  1M8M A;  2AKK A;  1UEC A;  2JMA A;  4OMP A;  1OPL A;  4E6R A;  2GTJ A;  2AKL A;  2JXB A;  2J06 A;  5FW9 A;  2K1G A;  2RPN A;  2OI3 A;  4A63 B;  2O9V A;  4AG2 C;  4FGE A;  2NUZ A;  2O88 A;  1WX6 A;  3H0H A;  4EOB A;  3NMZ C;  3U23 A;  4OML A;  4HZB A;  1ZBJ A;  1QKX A;  2K3B A;  2L2P A;  2SEM A;  1GFD A;  2KR3 A;  4HVV A;  3M0P A;  1S1N A;  4IIM A;  1ABO A;  1RLP C;  2CDT A;  2D8H A;  2FRW A;  1PRM C;  3VPJ A;  4JJC A;  2KGT A;  2YUQ A;  1PHT A;  1BU1 A;  4JJD A;  2RMO A;  2DVJ A;  1Y0M A;  1A0N B;  1GBQ A;  4AFU C;  1U06 A;  2KT8 A;  4ESR A;  1K0X A;  1HSQ A;  2ESW A;  1UE9 A;  4LUD A;  2VVK A;  5IHI A;  2W0Z A;  4ZNX A;  3A30 A;  4FGD A;  1W6X A;  1AWJ A;  1G83 A;  2CH4 W;  3M0U A;  4RTT A;  3FJ5 A;  2KT1 A;  4AG1 C;  1B07 A;  3PE0 A;  2DE0 X;  5IHN A;  2F2W A;  4Q4T A;  2DL4 A;  2YDL A;  1ZSG A;  2JS2 A;  3KFV A;  4CT3 A;  1NLO C;  2M51 A;  1I07 A;  3QWY A;  1HD3 A;  3VRZ A;  3UA7 A;  3M0R A;  5HCK A;  5IH2 A;  2IF6 A;  1SEM A;  2AZS A;  4FQB A;  1JXM A;  1QCF A;  2L0A A;  2L3S A;  3H41 A;  2NWM A;  2I0N A;  3EG0 A;  1U3O A;  1SPK A;  2CH4 A;  3I35 A;  3NGP A;  2KEA A;  2A36 A;  1AOJ A;  2DF6 A;  2GBQ A;  2RQR A;  2F2V A;  5GJV B;  3JV3 A;  4OMO A;  3ZL7 C;  3M1U A;  2VPS A;  2FPF A;  2LX7 A;  2KRS A;  4Z88 A;  2IOB A;  3A2Z A;  2LNH B;  2RQW A;  2CUB A;  1HJD A;  4JPB W;  1VYT A;  2K2M A;  2CSQ A;  5IXB A;  5FWB A;  2MCN A;  1KFZ A;  2IO7 A;  1OPK A;  1CKB A;  2E5K A;  1PKS A;  3EG3 A;  4RTV A;  3I86 A;  2EYW A;  2VKN A;  2IIM A;  1X2Q A;  2JW4 A;  1I0C A;  4OMN A;  2DL7 A;  2D8J A;  1YCS B;  2YUO A;  1J3T A;  2DNU A;  2K9G A;  1E7O A;  2FPE A;  4J9B A;  3VS6 A;  1LCK A;  2JS0 A;  2KE9 A;  1T3S A;  1SHF A;  2CUD A;  2K6D A;  2PTK A;  3GBQ A;  4D8K A;  1I1J A;  2O31 A;  3VS5 A;  4JZ4 A;  1AVZ C;  1JEG A;  1ZLM A;  2LQN A;  3PVL A;  3M0S A;  2J6O A;  1U5S A;  1UHF A;  3UF4 A;  2F2X A;  2KRO A;  2LJ0 A;  2DIL A;  4HCK A;  2XMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...