2EVRA

Crystal structure of a putative gamma-d-glutamyl-l-diamino acid endopeptidase (npun_r0659) from nostoc punctiforme pcc 73102 at 1.60 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
222
structure length
222
Chain Sequence
b'KLGEYQCLADLNLFDSPECTRLATQSASGRHLWVTSNHQNLAVEVYLCEDDYPGWLSLSDFDSLQPATVPYQAATFSESEIKKLLAEVIAFTQKAMQQSNYYLWGGTVGPNYDCSGLMQAAFASVGIWLPRDAYQQEGFTQPITIAELVAGDLVFFGTSQKATHVGLYLADGYYIHSSGKDQGRDGIGIDILSEQGDAVSLSYYQQLRGAGRVFKSYEPQRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COG0791: Cell wall-associated hydrolases (invasion-associate
molecule tags Hydrolase
source organism Nostoc punctiforme
publication title Structural Basis of Murein Peptide Specificity of a gamma-D-Glutamyl-L-Diamino Acid Endopeptidase.
pubmed doi rcsb
total genus 63
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00877 NLPC_P60 NlpC/P60 family
A PF18348 SH3_16 Bacterial dipeptidyl-peptidase Sh3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2evrA01
3.90.1720.10 Alpha Beta Alpha-Beta Complex endopeptidase fold (from Nostoc punctiforme) endopeptidase domain like (from Nostoc punctiforme) 2evrA02
1AWXA 2KXDA 4OMPA 3UA7A 2EYXA 2RQUA 3NMZC 3VRYA 2LNHB 2KNBB 3M0TA 4JJCA 2AK5A 1WLPB 2EYWA 1H92A 2SEMA 3VS1A 1UHFA 2KGTA 3EHQA 2O2OA 4F0WA 2K2MA 1X6BA 3NE0A 1TUDA 2SRCA 4AG1C 4HVWA 5ECAA 1WXTA 2KRSA 1NM7A 1NEGA 4JXBA 1I1JA 2KBTA 2ED1A 2MCNA 5IHNA 4AFZC 1QLYA 4CSHA 1BK2A 1JO8A 1FYNA 2DVJA 2DL3A 4OMLA 1UECA 1BBZA 4RTTA 2JT4A 2A28A 1WI7A 2DX1A 4RTYA 4Q4TA 2OJ2A 2A37A 2X3WD 2RQTA 2VVKA 3GBQA 1B3QA 1WIEA 2IF6A 1K1ZA 4FQAA 1KSWA 2BTTA 2AKKA 4FGDA 4FGIA 2IO8A 4GBQA 1M8MA 4RTUA 2EYYA 2V1QA 2RN8A 1AZGB 2DYBA 1GRIA 2CREA 1K76A 3REAB 1CSKA 1LCKA 4F14A 2MOXA 2L2PA 2CUDA 1H8KA 3R6NA 2IOBA 4LE9A 2CSQA 4J9FA 2YUOA 5IH2A 3H0FA 5HCKA 1WFWA 1Z9QA 4HVUA 4AFUC 2JXBA 2ECZA 1ZUKA 2W10A 4J9GA 3I5SA 2LZ6B 1XOVA 4JJBA 4OMNA 1WXUA 2KROA 1U3OA 3QWXX 4ZNXA 2K3AA 2OI3A 1ABOA 2DL5A 2EGEA 3I86A 3PBIA 1GCPA 2DA9A 1U5SA 2O31A 3U23A 1AWOA 1X27A 1KFZA 4ESRA 1ZLMA 1FMKA 1SRMA 1BU1A 1B07A 2LCSA 4HXJA 2LJ0A 1TG0A 4EIKA 1GFDA 3EG2A 2IIMA 3I9QA 1PRMC 4J9BA 4LUDA 3VS0A 1J3TA 1T0JA 2AZVA 3IQLA 1YWPA 1T0HA 3JV3A 2J7IA 2OAWA 4JPBW 4D8KA 1CKAA 3THKA 2KYMA 1GCQA 2XIVA 1UJYA 4J9EA 1OEBA 4IIOA 2ENMA 2A08A 2DBMA 2DLPA 3H0HA 3RNJA 4JZ4A 3VS7A 2K7AA 4CC2A 4FDYA 1RLPC 4J9HA 4HCKA 2EKHA 3TVTA 2L3PA 3PBCA 5FWBA 4HZBA 4JZ3A 4CC4B 1W6XA 4DEXA 2NUZA 1M30A 1NYGA 1AWWA 2J05A 2J6KA 3NHNA 3RBBB 4LN2A 4OMOA 1UE9A 4JJDA 3VS2A 2PNIA 5L23A 3C0CA 1K9AA 2J6FA 1PKSA 2EQIA 2BZYA 2CDTA 3ULRB 2JMAA 1GBRA 1AD5A 1T3SA 2DJQA 1YNZA 1U06A 1OOTA 2EGAA 1MV0B 1UGVA 1OPLA 1EFNA 4FGEA 1NG2A 2FO0A 1M3AA 1T3LA 3KFVA 3VS6A 2KRMA 2LJ3A 1AEYA 3M0PA 2M51A 1N5ZA 2EVRA 4FQBA 1X69A 1WA7A 1WYXA 1HSQA 1ZUUA 1H3HA 2RQVA 1UTIA 2EGCA 1Y0MA 2DL4A 3H0IA 4LJ1A 5GJWB 4FSSA 1ZX6A 2ROLA 2KEAA 3M0UA 1E7OA 2HDAA 1VYVA 1YWOA 4KRTA 1JXMA 1ZBJA 4J9IA 1UFFA 3QWYA 4QT7A 5FW9A 5I11A 4DEYA 3H41A 2JS2A 2VPSA 4CGKA 3NGPA 1BB9A 3S0QA 3VS5A 2YUPA 2L3QA 2JM8A 2X3XD 1ABQA 4IIMA 2DRKA 3GT2A 3PVQA 2GBQA 4CC7A 3EG0A 4Q4NA 4Y92A 2J06A 2KRNA 1RLQC 3I35A 1NLPC 2M0YA 2H8HA 1ZSGA 1W1FA 2K79A 2LJ1A 4EOBA 2DNUA 5EC7A 2RF0A 3A98A 4GLMA 1VYUA 3PVLA 1X2KA 2KT8A 2F2XA 1RUWA 2RMOA 2LMJA 2IO9A 2D0NA 2DF6A 2V1RA 2DE0X 4E6RA 4WCIA 1OPKA 2DMOA 2NWMA 2GTJA 1VA7A 4K11A 2IOAA 2D8JA 1QKXA 1WXBA 4R0KA 4AG2C 1JQQA 1SSHA 1PHTA 2A36A 3EG3A 2VKNA 2YUQA 1AZEA 2EW3A 3O5ZA 4RTWA 5FWCA 3UF4A 2D1XA 3FJ5A 2DL8A 2QDLA 1G83A 2B86A 3M0QA 1WDXA 1IO6A 2FEIA 2CT3A 2K9GA 2G6FX 4RTXA 3SEMA 1UG1A 2HEQA 2AZSA 4Q4GX 2GQIA 2JTEA 4D8DA 1A0NB 2VOBA 4CC3A 1TUCA 1VYTA 4M4ZA 2FPFA 1E6HA 4AFQC 1SHFA 1GCQC 2O9SA 1QCFA 1K4US 2FG0A 3KW0A 2PZ1A 1K0XA 4RTZA 1UDLA 2CH4A 4AFSC 2VWFA 1ARKA 3PE0A 2LQNA 1UHCA 2AKLA 2PTKA 1HD3A 3UA6A 4A63B 2IO7A 4HVVA 1KIKA 4EQAA 2L3SA 1V1CA 2XMFA 2BZ8A 4RUGA 2FPDA 2RNAA 1UUEA 2ESWA 3M0RA 5GJVB 2E5KA 2LQWA 2RPNA 1PWTA 1M3CA 2YSQA 1X43A 2FPEA 1Z9ZA 1QKWA 3O98A 1SPKA 1GBQA 4ORZA 1SEMA 4OMQA 1E6GA 4CT3A 2O88A 2DRMA 1PKTA 2DILA 5IXBA 3I5RA 2DL7A 1SHGA 2LX7A 2ROTA 1JEGA 2GGRA 5IXFA 4LNPA 1YN8A 2FRWA 2ABLA 2YUNA 2JS0A 2EPDA 2KXCA 2HCKA 1KJWA 3VS3A 3A2ZA 2VPMA 1QWEA 3REBB 3UATA 1Y57A 1AOJA 1ZUYA 4OMMA 1WX6A 1NEBA 2KYBA 1K0SA 4F0VA 2CH4W 1RI9A 2O9VA 3SHWA 3TSWA 2JMCA 5IHKA 3A30A 1M3BA 2ED0A 1QWFA 2YDLA 2P4RA 2FRYA 2D8HA 3LH5A 1HJDA 2JW4A 3TSZA 1MV3A 1AVZC 2MIOA 1YP5A 3ZL7C 1MUZA 1SRLA 2KR3A 4F16A 3VRZA 1X2QA 1M27C 1I0CA 1YCSB 2J6OA 1X6GA 2W0ZA 4RTVA 2C0TA 1PNJA 2F2WA 4Z8AA 1GL5A 1OV3A 1PRLC 1NLOC 2HBWA 2I0NA 4J9DA 2KT1A 2L0AA 3A2YA 1JXOA 3VPIA 4OLKA 1UJ0A 2K6DA 2F2VA 4EQ8A 2RQWA 4X1VA 1AWJA 2CUBA 2KE9A 4LUEA 2DBKA 1NYFA 4Z89A 4HPEA 2LP5A 1CKBA 2YT6A 2C0OA 3CQTA 1S1NA 2EYZA 2RQRA 2EBPA 1GFCA 1JU5C 5IHIA 3EGUA 2GTOA 4F4MA 2LRJA 1W70A 3M1UA 3VS4A 4Z88A 1G2BA 3EG1A 2BZXA 2HSPA 4F17A 2K1GA 2CSIA 2JM9A 2DM1A 2K3BA 3M0SA 2GNCA 3NPFA 1I07A 3EHRA 4J9CA 5I22A 4HZ9A 3VPJA 2C0IA 2CT4A
chains in the Genus database with same CATH superfamily
2KXDA 2EIFA 3V8KA 3Q1JA 2K5IA 1B7TA 1V76A 4F04B 2KSSA 2KNBB 3M0TA 4JJCA 3CCRA 2ZAEA 4A54A 3CCMT 4IUTA 2DEQA 4M78B 4MZMA 4L59A 2GFAA 5GAN4 2E10A 2SRCA 3S3NA 5ECAA 2XU8A 1B34B 1NEGA 2KBTA 2MCNA 1S72T 3BDLA 1W2BA 4AFZC 2LQKA 1H3ZA 2DVJA 3CC4A 4QW2A 4YTLA 1SF9A 3CCLT 3JB9G 1YHQQ 2RJDA 1YJWA 2BE9B 4Q4TA 2A37A 2CP5A 1W2BP 1QQJA 2RM4A 2WSCE 3GBQA 2BTTA 3HPWA 3M56A 4MDXA 4FW1A 1K9MU 2AKKA 4RTUA 2EYYA 4M77B 4EPCA 1M1KR 1VQPA 2JVVA 3QJ6A 1G8XA 2CREA 1W2BS 2HNIA 2DVEA 1LCKA 1VQ6Q 2L2PA 1H8KA 2IOBA 5GAOm 2E65A 5IH2A 1XQHA 4AFUC 4J9GA 4JJBA 3G71Q 1SKUB 1U3OA 4PJOE 2K3AA 2DZCA 2DL5A 3I86A 2DA9A 4DQ2A 4HCCA 2O31A 4ESRA 1QP3A 1ZLMA 1SRMA 3CC7A 2LCSA 4HFFA 4EIKA 1SSFA 3OS1A 2V8KA 5KH6A 1S72A 2JTMA 2L5QA 1J3TA 4XTZA 3IQLA 2OAWA 3OYJA 3DLMA 5GAOq 1D0XA 3CC2A 2KYMA 4C92A 4M7DC 1UJYA 3ASKA 4J9EA 3TEEA 1OEBA 2ENMA 2A08A 1VQ9Q 4XAXB 2DIQA 4FYYB 1JJ2P 2HAXA 1BCOA 3VS7A 2HD0A 2KQWA 5D6XA 3VV0A 5GAN2 1R77A 1BI0A 4J9HA 4HCKA 2NUTA 3TVTA 1UGQB 2NUTB 2Y4XA 5FWBA 2FZCB 3CCST 3CD6T 1DJ7B 1QCNA 1NYGA 4BY6B 3OYDA 1AWWA 1VQ6T 2J6KA 4JRKA 4PJOA 2MI6A 4JJDA 5FU7B 3VS2A 5L23A 4OP0A 3QUIA 1Q86U 3C0CA 2RD1A 4C8QC 2BZYA 1EX4A 4F7UF 2EJFA 2CDTA 3ULRB 1H641 1GBRA 3WXMB 3G4ST 1YNZA 1VQOT 1VQKQ 2FO0A 2COYA 4DBFA 1T3LA 3OYKA 3VS6A 5GAMd 2KRMA 2KVQG 3KBGA 4D6WA 1N5ZA 4FQBA 5CKHA 1WYXA 4BDZA 1HSQA 2X51A 1PSFA 3QYGB 1KK7A 5GJWB 2LDMA 2KEAA 5I2SA 1E7OA 4KRTA 2HQEA 1JXMA 2E3HA 4BI4A 3QWYA 4ZGJB 5I11A 4DEYA 5GAOr 3H41A 2JS2A 4OGCA 3CXCS 3S0QA 3CBPA 3OS2A 2YUPA 5J26A 4NL3A 4A4GA 5FRMA 2X3XD 3GT2A 2K57A 5D7UA 3FB9A 5HK0A 2A3LA 2J06A 1RLQC 4N4IA 3OSVA 3R6OA 1YCYA 2O4XB 1MMGA 1W1FA 3CPWA 1YIJT 2PUOB 3CCUT 3X28B 3A98A 4FYWB 4M77A 1VYUA 2RHUA 2KT8A 2QTVA 1OULA 2F2XA 1M5Q1 3E1SA 1WZOA 4V2SA 3OQ5A 4RCCA 1OPKA 1G3SA 4HT9A 2GTJA 1B34A 4OGEA 2D8JA 2VGMA 1OQKA 2R5MA 2EAYA 4ANJA 4N4HA 3CCQA 2VKNA 1GXIE 3G6EA 4M78A 3FJ5A 5GAOp 2DL8A 1VOMA 1G83A 2MWOA 2FEIA 1XJWB 4M7AF 3RMQA 2QQSA 4Q4GX 3VYHB 2QEXQ 1RAIB 1TS9A 3QBYA 4TVRA 5GMKl 4M4ZA 1ZSZC 2O9SA 2CP6A 1QCFA 2FG0A 1D0ZA 2GCXA 4JJNK 3F70A 4RTZA 1G3TA 3AT1B 3JB9I 5I21A 1NJIR 1HD3A 4A63B 5GANd 1Q81R 4M77C 4N0AC 2L3SA 3TQ7P 4RUGA 3CBMA 3QZ5B 3M0RA 5LJ3d 2ZGWA 1X43A 4FIBA 2HQXA 4ORZA 4MDWA 4L6V5 2XICA 4FL6A 1E6GA 4J7IA 3E19A 3M4YA 2FZKB 2NUPB 4KT0E 1N8RU 3BDUA 4HA8A 2LT1A 3ME9A 4M75C 4QKUA 1TTHB 2K3YA 2QA4Q 2DTOA 2DEUA 2KXCA 2HCKA 4XTXA 3LWIA 1KJWA 2X9HA 4UC4A 3OW2P 2VPMA 3CCET 4M7DA 3QO3A 1N27A 5CR2A 2K5FA 2CGHA 3MP1A 4Y28E 2RJCA 1QVFA 3DKMA 4M7DB 3CMAQ 1K73U 1XTDA 2CH4W 3TSWA 3SHWA 1MMDA 1M3BA 2QG9B 3NFCA 3VU3C 1X75C 4M78E 2XG8D 5LJ5g 1HJDA 1QW1A 3BE3A 1LNXA 2RHYA 1MUZA 1UGSB 2QXFA 4C8QA 3VRZA 3C12A 3L2UA 4HFKA 1I0CA 5KE2A 4GLKA 5GAMh 4RTVA 3MHXA 3QHSA 2CS7A 3HHTB 4Z8AA 4F7UB 2QI2A 1NLOC 3V7SA 4JURA 1AT1B 3BFMA 2F2VA 4M75G 4X1VA 1QVFS 2M1HA 1M1KC 1CKBA 5A0GA 2K5LA 2C0OA 3JRZA 4BACA 3FJPA 2GTOA 2F5KA 3OYIA 2XI9A 3M1UA 2DIGA 3L1AA 1IB8A 2RB6A 2BZXA 4JRPA 3C4SA 2QYZA 2K1GA 3HRSA 2DM1A 2DXBA 5I22A 2MK5A 3CCJA 4M77D 4OMPA 2RQUA 3NMZC 2VGNA 3EGXA 5LJ5f 3QXEB 1VQMA 3CCJT 2QQRA 2EYWA 3CCQT 1JJ2A 3VS1A 2QEXA 1I81A 4HT8A 1Q86R 4F0WA 5LJ3j 1HYOA 4ZTJA 3OA6A 3G6EQ 4JXBA 2DD4A 3VKIA 4E7ZA 1X6OA 5IHNA 4A4FA 3CCQQ 4CSHA 5GAN8 1BK2A 1JO8A 2DL3A 4PK4A 1Q7YR 1WHKA 1BBZA 2QASA 3TU4K 2JT4A 4EMKC 5FLXE 2DX1A 5CQXA 2DERA 2F69A 1M2VA 1QMCA 1YJNA 1RAFB 2RQTA 3OMCA 2COZA 1EIFA 2O4XA 5LJ3f 2X4XA 2CP7A 1K1ZA 4PL6A 4OB0B 4FCYA 3PIOA 4FGDA 4FGIA 2EQMA 3QZ9B 3L42A 3INZA 1K76A 1CSKA 1KC8U 2CUDA 4PJNA 3R6NA 3ZEHA 2QGFB 4J9FA 4ZGDB 4KUDK 1WFWA 2ZPFB 1D1AA 1YIJQ 1YITQ 2JOYA 3I5SA 2CP3A 4XTYA 2LZ6B 3LLRA 2E1HA 4ZNXA 3PMIA 5GAN7 3PBIA 1GCPA 3RKWA 1AWOA 1KFZA 3DB3A 2LJ0A 3JCMW 1GFDA 3EG2A 1VQNQ 4LUDA 3VS0A 1T0JA 2AZVA 4O6JA 3EG9B 3J81E 2PVOB 2J7IA 1IHWA 3CMAT 2M9UA 5GANh 1ZSZA 4KGZB 4PJOC 3QDFA 2VB6A 2DBMA 4N0AA 3OYCA 1QP2A 2DETA 1WGSA 2ZPIB 2K7AA 2LRQA 4FDYA 4MMKA 1PC0A 3JCMd 2OTLA 3D7SB 4JZ3A 3TREA 3OY9A 3OYLA 3LGLA 4DEXA 1M30A 4XU1A 2J05A 2H3EB 3RBBB 1VQ8T 4ELYC 1I5OB 2J6FA 4C5EA 2D9TA 3OW2S 1NPRA 2DJQA 3CMEQ 2OTLT 4BDYA 1OOTA 1UGVA 5LJ5h 1EFNA 4FGEA 1NG2A 2R5AA 4BE0A 1M3AA 4ME7A 3CC2Q 2MPXC 1BKBA 2LJ3A 1OX9A 3VUZA 2ZZDA 1H3HA 2EGCA 3CCJQ 1Y0MA 3CC7Q 2DL4A 5EG2A 1ZX6A 2ROLA 3X26B 3M0UA 2HMAA 2HDAA 4ELZC 1YWOA 3RMSA 1UFFA 3S3MA 3OBYA 3LWHA 2E12A 3GF5A 4R55A 3QYHB 4RMOA 1D0YA 3VS5A 2VV5A 2XDDA 1PD0A 4BI3A 4E7LA 4E7KA 4DA4A 3OBWA 2DRKA 4PJMA 3X20B 1K8AR 2GBQA 2RK2A 3EG0A 4E7SA 3SFMA 4II1A 2KRNA 1VQPQ 3PNWC 4FT4A 1NLPC 2M0YA 4LDUA 4C8QD 2YRDA 4JLIA 4EMGA 2YWWA 3CMEA 2R58A 5EC7A 2RF0A 3QKJA 1X2KA 5KYXA 1VQLA 2HBPA 2D0NA 1X01A 3V7CA 4J8OA 4JRQA 5I2MA 2M0OA 1U1TA 1F1BB 2HL5C 1I5LA 2QEXT 2RHZA 3L2ZA 5KYXB 2YUQA 1AZEA 3O5ZA 2MMPA 3MO8A 3RDVA 2LNVA 3CEYA 2XK0A 3M0QA 4RKUE 1WDXA 2CT3A 3I55T 1VQOA 2G6FX 3SEMA 2AZSA 2GQIA 3CCRQ 1U1SA 4D8DA 3GLXA 4E7IA 4J30A 1RAEB 1E6HA 1SHFA 3CCVQ 2XDPA 1N8RC 4M7AG 1BIBA 1K0XA 2WSEE 3LGFA 2CH4A 3META 1KQSA 1ARKA 2PUKB 3PE0A 4NL2A 2LQNA 2EQUA 2A0FB 3UA6A 1NJIC 1VUBA 4EQAA 1YFNA 4OVAA 2RO0A 1G3YA 1N8RR 3EGDA 2LQWA 1PWTA 1KG1A 4AMCA 3GP8A 3JB9D 1QKWA 3O98A 1SPKA 1IZ6A 1GBQA 3CC2T 4C92D 3CPFA 1KHIA 4OMQA 4JS5A 2O88A 2DILA 5IXBA 3I5RA 2LQ8A 2CP2A 1SHGA 5CK9A 4F7UG 5HY6A 2RJFA 2X4JA 1TSFA 2FRWA 3G1JA 3V8JA 4QVZA 4C8QF 3ZFJA 2VUBA 3REBB 5CKBA 1Y57A 1ZUYA 2RJEA 3OB9A 3AHUA 1TUGB 3FDRA 2JMCA 4C92E 4HCZA 2ED0A 1IXDA 1TU0B 2YDLA 4M75A 3PT9A 2WSFE 2G3RA 1Q82U 4LDYA 4X9DA 3RERA 3PTAA 1YP5A 4KULA 3J80E 1M1FA 2KR3A 1M27C 2I2LA 1C6VX 1WQWA 4M7DF 2J6OA 3P8BB 2W0ZA 1R0CB 2F2WA 1GL5A 2WP7A 1N6AA 1N9RA 2HBWA 4J9DA 1O9SA 1YJ9Q 1FWZA 4OLKA 1K9MC 3HFNA 3L2WA 1TWBA 4JDSA 1AWJA 2RHIA 2KE9A 2BIVA 1RADB 3QJYA 4HPEA 2YXYA 1UB4A 2LP5A 3UWNA 3EG9A 2WACA 2EYZA 4PFPA 5GAN3 4JS4A 3SWNC 4Q5WA 2JNGA 1D09B 3X24B 3VS4A 5GANg 4M78D 1OZ3A 2OTJQ 1WHHA 4IUQA 1VQ8A 3N5BB 2HKQB 2RI2A 3E9GA 4XTWA 5LL6S 2CSIA 3CCMA 2RA2A 2K3BA 1Q81U 3M0SA 2GNCA 2DAQA 4J9CA 2YLBA 4HZ9A 1YJWT 3BY7A 1UGRB 3M53A 2CT4A 1AWXA 3M9QA 1IGQA 3LYIA 3UA7A 2EYXA 5FROA 4FT2A 3VRYA 3A1PA 5DY9A 2IVWA 3EFOA 1R0BG 3CCVA 1YJWQ 3CBOA 1YITA 4E7HA 3JSCA 1WLPB 3SB2A 4C92G 1PSEA 3CC4Q 2KGTA 1VQKA 2CP0A 3HRUA 4J6YA 3QDRB 1X6BA 1TUDA 3UT1A 3KUFA 2B8AA 5GAMf 4AG1C 5IN1A 1WXTA 3M57A 2KRSA 2XDBA 2DZ9A 2QA4T 1I1JA 2ED1A 2Y90A 5LJ3g 1Q82R 1QLYA 4A4EA 1VQ5Q 1ACMB 3H6ZA 1K8AC 1YJ9T 2JN0A 2YLCA 3OS5A 5CKDA 1VQ5T 1Y96B 2A28A 3HRTA 4WF2A 2BKDN 3GNFB 1KHCA 4GY5A 4M77E 3HL8A 4RTYA 2DD5A 1ZBXA 2OJ2A 1IGUA 2JUFA 5GAOl 2X3WD 2VVKA 4LXCA 4MZPA 1WIEA 2FHDA 5CVIA 3GPLA 1KSWA 4NOYA 5CCAA 1M8MA 1OU9A 3CCLA 4X34A 2RN8A 4XTUA 2DYBA 3E9FA 1LVKA 3O8VA 2MOXA 5LJ3e 1YIJA 4KH0B 2MWPA 3EGXB 2CSQA 2P84A 2YUOA 4RG8A 5HCKA 4EDUA 3I56A 3JB9F 4J83A 2JXBA 1NBEB 2HKNA 2W10A 3P8HA 4C0FA 1WXUA 2KROA 3RR6A 5LJ5d 4M7DG 3QG1A 5KYNA 1RL2A 3A8MB 5GAN5 3PFSA 1U5SA 3U23A 4J6XA 4Z02A 3RKXA 1FMKA 2XKOC 4EMKB 3OYHA 2LVMA 4X9CA 3I9QA 5GANj 1YWPA 1T0HA 3EBQA 4JPBW 2EFIA 1VIFA 8ATCB 1GCQA 4PJJA 2DKGA 2MAMA 2X4WA 1Q7YC 1VQ7T 2YRVA 2BUDA 1VQMT 4ZN1A 4JZ4A 1VQ4T 4CC2A 3JCMe 4M75D 2QK0A 3VYGA 1RLPC 1BI2A 3OMGA 2CYZB 4LDXA 4ZGEB 3PBCA 4HZBA 2DO3A 1W6XA 1HK9A 2NUZA 2E6ZA 2DFUA 2FB7A 4IKFA 3NHNA 4OMOA 1UE9A 1K9MR 2PNIA 5KYUA 1BYMA 4IUPA 4PLIA 1AHJB 4XU0A 4A53A 1K9AA 1PKSA 1M2OA 2EQIA 2XIDA 3LW5E 1AD5A 3MKDA 3V7RA 4DBQA 3PMTA 3CCVT 1MV0B 1OPLA 1WJSA 1I4K1 5C6SA 4JUVA 2M16A 4PJOG 1X69A 9ATCB 1WA7A 1ZSZB 4PJLA 3JCMJ 1D3BA 4BUGA 2KMTA 4M78F 2K3XA 4KGVB 3CCEA 1KC8C 2RI5A 1K8AU 2VC8A 3MEAA 3CCMQ 1ZBJA 4J9IA 2V8JA 3NTKA 5FW9A 4C5IA 1UEBA 2VPSA 4CGKA 3NGPA 4A4HA 3UDCA 1PM3A 2JM8A 1ZQ1A 3G6ET 3PVQA 2E70A 1G3WA 4C0GA 3HFOA 4Y92A 1WNLA 3J7AF 5M9OA 3KXTA 1VQ4Q 4M77G 5A0LA 3I35A 3OYAA 1NZ9A 1ZSGA 1MMNA 2ZPBB 2QQAA 2LJ1A 1Q86C 4EOBA 5GMKh 3JCMb 4GLMA 3QSUA 3PVLA 5DLOA 3WVEB 1Y96A 4DOVA 3G71T 3CXCA 2RMOA 2LMJA 4N4GA 2IO9A 2DF6A 5GANf 4L5GA 2V1RA 5LJ3h 2DE0X 4E6RA 2NLUA 1RABB 3OYMA 2DXTA 3QIIA 2NWMA 4PNOA 1VA7A 1M2VB 2IOAA 2L89A 4ZN3A 5CQYA 4AG2C 2DTIA 1SSHA 3A8LB 2A36A 1YJNT 1FX7A 2FVUA 3EG3A 5CKFA 5A2QE 5FWCA 3LH0A 4C5HA 1Q95G 2F5TX 2FYKA 2B86A 1IO6A 4C8QE 2ZCFB 2K9GA 3L2QA 3EFOB 4RTXA 1UG1A 2HEQA 4KH1B 2LCLA 5FU6C 1KD1U 1WHMA 4XK8E 1A0NB 2VOBA 4CC3A 1TUCA 1VYTA 1WHLA 4AFQC 1K4US 3KW0A 2GQVA 2PZ1A 4FYXB 2XHCA 4PLLA 4OF1A 3JCMg 2E5QA 4O5VA 2E6NA 1ZA1B 2IO7A 4B9XA 3X25B 2JTFA 4HVVA 4M7AB 3CCUA 2XMFA 4A4KA 1VQ4A 2OAUA 2CZ0B 2RNAA 2ESWA 3MEUA 1VQNA 1Y07A 5GJVB 2E5KA 5IAYA 1KQSP 2RPNA 4M77F 1M3CA 2YSQA 1WHGA 5GAMj 5L8RE 1IHVA 2M02A 1RAGB 1VQ6A 1MMAA 8AT1B 5AYFA 2FZGB 3CCSA 1VQLT 4PKCC 1KD1R 1OX8A 2DL7A 2LX9A 3I55A 1PCXA 3DLLA 3EFSA 5IXFA 4E7JA 4LNPA 1YN8A 2ABLA 1HXDA 3CMET 2OTLQ 3CCEQ 3EAEA 2YUNA 2JS0A 1OU8A 2EPDA 4FYVB 4F7UA 3NTIA 3EFRA 3VS3A 3JCMQ 1IREB 2GFUA 1QWEA 1W4SA 3UATA 1AOJA 2E41A 1WX6A 3JCMV 1NEBA 2KYBA 1K0SA 4F0VA 4M75B 1VQ5A 5IHKA 1ZA2B 3A30A 4F7UE 5CIUA 3OW2A 1QWFA 3MP6A 1OZ2A 5GAOn 2A7YA 3MP8A 2PVGB 4BE1A 3TSZA 1MV3A 4EMHA 2MIOA 2QA4A 1SRLA 1PG5B 1YBYA 2O01E 4F16A 4ATOA 3VJPA 1YI2A 4OB3B 2MF2A 1YCSB 2KK4A 1BI1A 2C0TA 5FU6B 1JB0E 2I0NA 5KYYB 1WQ7A 3A5ZB 3CCSQ 3L2VA 1M90U 2EJGA 5KYWB 2CUBA 1NE8A 3FRNA 2DBKA 4Z89A 3M59A 2YT6A 3CQTA 4LDWA 2CZ6B 3M54A 4IUVA 1JU5C 1VQPT 4M7AA 3G4SA 2LRJA 3GNGA 3V8LA 3MEVA 4XTVA 5HKCA 5AT1B 3A8HB 3G7ZA 3URGA 3EGDB 2E3IA 2YHTA 1SG5A 1UGPB 2JM9A 3HKSA 2OTJT 3E2UA 3NPFA 1I07A 1M4ZA 3EHRA 1I8FA 3VPJA 4RG2A 4XU2A 3OYGA 4KBMB 4LDVA 2EKOA 1YJNQ 5GAN6 1RAHB 3CC4T 2LNHB 2AK5A 1M1GA 1H92A 2SEMA 4HKEA 3M5AA 1UHFA 1MNDA 4HCBA 1FMWA 3EHQA 2O2OA 2K2MA 3NE0A 2RI3A 2EYQA 4HVWA 2EQKA 3CPWS 4HFLA 1NM7A 3CCRT 2AT1B 2AHJB 4QQGA 1FYNA 4OMLA 2VASA 2DXUA 4JRIA 1UECA 3CC7T 2ATCB 4RTTA 1YI2Q 1RAAB 1WI7A 4LD9K 2HQHA 5LJ5j 1KD1C 4XU3A 3TCJA 3T9NA 4CRIA 1JJ2S 1B3QA 2E64A 2IF6A 2Y4YA 4FQAA 3GOXA 3CMAA 3OYBA 1YI2T 2KY9A 5GAMg 1YHQT 5CKEA 2IO8A 4GBQA 4C0ZA 3FIFA 3JCMP 2V1QA 1AZGB 3A8GB 1KQSS 4J32A 1GRIA 3REAB 4F14A 4OB1B 3G4SQ 3FC3A 4LE9A 4BY6C 1TXQA 3H0FA 1Z9QA 2JJ9A 4HVUA 5FU7C 3I55Q 1FMVA 1LOJA 2ECZA 1ZUKA 4DOWA 1XOVA 3EH1A 4OMNA 3L2RA 3QWXX 4C92F 1M90C 2OI3A 1LPLA 2OX7A 1ABOA 4J5YA 1QCOA 2EGEA 2COWA 1D3BB 1X27A 5KYWA 4E47A 1BU1A 1B07A 1ZHIA 5GAMe 4HXJA 2EWNA 2LC4A 1TG0A 4C8QG 3NTHA 4M7DE 2IIMA 1PRMC 4J9BA 2OTJA 2X4YA 1C1AA 3JV3A 4XQ3A 4J7FA 5GMKe 2X35A 4D8KA 1CKAA 3THKA 2LCCA 2VYTA 2PVDB 2MYSA 1KQ1A 2XIVA 1WPYA 2PU9B 3JCMf 1QVGA 4FW2A 4OMFB 5KYUB 3CXCP 4IIOA 5KYYA 4M7AD 2KI7A 3RUXA 4NS5A 5GMKj 2DLPA 3H0HA 3RNJA 1G5VA 2DJZA 5CO7A 5DLQE 2EKHA 1YJ9A 6AT1B 2L3PA 1XNIA 4PFZA 3PIPA 4CC4B 3OYNA 2QGGA 3OYEA 1KC8R 4PJOB 2QQBA 2LTOA 3ZBDA 3RIRA 2R57A 4LN2A 4M7DD 5DM7R 4FM4B 3C95A 1QVGS 2JMAA 1T3SA 1WJQA 1U06A 3LX7A 2EGAA 2P0KA 2Z0WA 2L8DA 4BI8B 1EZZB 5FRNA 1OI1A 3KFVA 4C0DC 1AEYA 3M0PA 2M51A 2EVRA 5CAIA 3UPUA 4C92B 1TOVA 4C5GA 1ZUUA 4BE2A 1S72Q 4FSXA 3H8ZA 2E4HA 2RQVA 3QPHA 1UTIA 4M75F 2RH2A 4B9WA 3H0IA 3OYFA 1M9SA 2QAZA 4LJ1A 4FSSA 4KGXB 2DPPB 4IUUA 1M8VA 1VYVA 2YRCA 4AT1B 1D1CA 4QT7A 3G71A 5IT9E 1BB9A 4MMLA 3BW1A 4E2FB 2L3QA 2RHXA 5LJ5e 4M78C 1ABQA 4IIMA 3CPWP 3C94A 3OYYA 3S6WA 1VQ7Q 1VQ9T 4CC7A 1LJOA 1MGQA 4RCBA 4Q4NA 1OYXA 3SDZA 3JCMc 5J39A 2HZYA 2ZPHB 2H8HA 4QQDA 1WJRA 3M55A 3FLGA 2K79A 2VXEA 5D6WA 2DNUA 4FU6A 3PGGA 1U8RA 3SD4A 1RUWA 1QVGP 3A8OB 2DTHA 4R56A 3FEOA 1YHQA 4WCIA 2F1LA 2DMOA 1JBMA 3JCMX 1NPPA 4P5NA 5C0MA 4OB2B 4K11A 2NYSA 2CZ1B 1QKXA 3JB9J 1WXBA 3WVDB 1VQOQ 4R0KA 1VQKT 1JQQA 3MCAB 1M1KU 1PHTA 1V29B 5J3BA 1Y7XA 2EW3A 4RTWA 3UF4A 1K73C 2D1XA 4DBHA 4WTOB 2QDLA 2LT4A 3RKYA 2RK1A 2P4TA 2KAFA 3MEWA 2JTEA 4BB7A 2EQJA 3JCMh 3HSBA 1TH7A 2FPFA 2P0QA 3M58A 7AT1B 4C0DB 5GMKi 1GCQC 4QVCA 3MJXA 4LD6A 1RACB 4MZTA 1UDLA 3RESA 4QVDA 4AFSC 3CD6Q 3JB9H 2VWFA 4IURA 2ZPEB 1Y71A 1UHCA 2AKLA 2GF7A 2VXFA 2PTKA 2KDSA 5HK3A 2V26A 1VQ8Q 3GIBA 1KIKA 2DYIA 1V1CA 2BZ8A 3SWNB 4M75E 2QDYB 2FPDA 1UUEA 4CI0C 5D6YA 3JAME 2K4YA 3ER0A 3CCUQ 1VQ7A 2QQ9A 2FPEA 1WHJA 5GMKm 1Z9ZA 2BE7D 2P0PA 1JRIA 5A0DA 2IPOB 1SEMA 4Y91A 1M90R 1PD1A 4CT3A 1BIAA 3S3OA 1Q7YU 2L3RA 2DRMA 4JLGA 1PKTA 1Q81C 2ZPGB 1N9SA 3MPUB 1VIEA 3OS0A 2LX7A 3I56Q 2D0QB 2ROTA 2GGRA 2JZ2A 1JEGA 1O75A 5KE3A 1QVPA 3VUBA 2AIRB 4M7AE 1Q82C 4KUIA 3A2ZA 1R8OB 1VQLQ 4PJOD 1MHNA 2PQWA 4C8QB 3DB4A 3CCLQ 1VQ9A 2V8IA 3I56T 2CZ7B 2EJ9A 4OMMA 2DK3A 2FL7A 1D1BA 1RI9A 2O9VA 3EH2A 3M4GA 4M7AC 3H9NA 2P4RA 3OSSC 2FRYA 5KCOA 1K73R 2D8HA 1BI3A 3LH5A 1IRXA 4M78G 2JW4A 1AVZC 4J6WA 3ZL7C 1QVFP 2NUPA 1X2QA 4DBRA 4VUBA 1FXXA 3P8DA 1X6GA 1PNJA 2HL3A 1OV3A 1PRLC 4QQ6A 2DXCA 2KT1A 1VQMQ 2L0AA 3A2YA 1JXOA 2CKKA 3VPIA 1BCMA 1UJ0A 2K6DA 4EMKA 4EQ8A 1KQ2A 2RQWA 2QTXA 1VQNT 2HSEB 2K2VA 4LUEA 1NYFA 4BD3A 4PJOF 1C0MA 1S1NA 1RI0A 2RQRA 5GANe 2EBPA 1GFCA 2XD0A 5IHIA 3EGUA 4F4MA 2C06A 1MNEA 1W70A 2H3JA 4C92C 2IG0A 4Z88A 1G2BA 3EG1A 5KCHA 3HTRA 1NJIU 2HSPA 2D6FA 4F17A 3SWNA 1P92A 4PFOA 3HP9A 4B6MA 3CD6A 4ZTFA 1YITT 2C0IA
chains in the Genus database with same CATH topology
1AWXA 2KXDA 4OMPA 3UA7A 2EYXA 2RQUA 3NMZC 3VRYA 2LNHB 2KNBB 3M0TA 4JJCA 2AK5A 1WLPB 2EYWA 1H92A 2SEMA 3VS1A 1UHFA 2KGTA 3EHQA 2O2OA 4F0WA 2K2MA 1X6BA 3NE0A 1TUDA 2SRCA 4AG1C 4HVWA 5ECAA 1WXTA 2KRSA 1NM7A 1NEGA 4JXBA 1I1JA 2KBTA 2ED1A 2MCNA 5IHNA 4AFZC 1QLYA 4CSHA 1BK2A 1JO8A 1FYNA 2DVJA 2DL3A 4OMLA 1UECA 1BBZA 4RTTA 2JT4A 2A28A 1WI7A 2DX1A 4RTYA 4Q4TA 2OJ2A 2A37A 2X3WD 2RQTA 2VVKA 3GBQA 1B3QA 1WIEA 2IF6A 1K1ZA 4FQAA 1KSWA 2BTTA 2AKKA 4FGDA 4FGIA 2IO8A 4GBQA 1M8MA 4RTUA 2EYYA 2V1QA 2RN8A 1AZGB 2DYBA 1GRIA 2CREA 1K76A 3REAB 1CSKA 1LCKA 4F14A 2MOXA 2L2PA 2CUDA 1H8KA 3R6NA 2IOBA 4LE9A 2CSQA 4J9FA 2YUOA 5IH2A 3H0FA 5HCKA 1WFWA 1Z9QA 4HVUA 4AFUC 2JXBA 2ECZA 1ZUKA 2W10A 4J9GA 3I5SA 2LZ6B 1XOVA 4JJBA 4OMNA 1WXUA 2KROA 1U3OA 3QWXX 4ZNXA 2K3AA 2OI3A 1ABOA 2DL5A 2EGEA 3I86A 3PBIA 1GCPA 2DA9A 1U5SA 2O31A 3U23A 1AWOA 1X27A 1KFZA 4ESRA 1ZLMA 1FMKA 1SRMA 1BU1A 1B07A 2LCSA 4HXJA 2LJ0A 1TG0A 4EIKA 1GFDA 3EG2A 2IIMA 3I9QA 1PRMC 4J9BA 4LUDA 3VS0A 1J3TA 1T0JA 2AZVA 3IQLA 1YWPA 1T0HA 3JV3A 2J7IA 2OAWA 4JPBW 4D8KA 1CKAA 3THKA 2KYMA 1GCQA 2XIVA 1UJYA 4J9EA 1OEBA 4IIOA 2ENMA 2A08A 2DBMA 2DLPA 3H0HA 3RNJA 4JZ4A 3VS7A 2K7AA 4CC2A 4FDYA 1RLPC 4J9HA 4HCKA 2EKHA 3TVTA 2L3PA 3PBCA 5FWBA 4HZBA 4JZ3A 4CC4B 1W6XA 4DEXA 2NUZA 1M30A 1NYGA 1AWWA 2J05A 2J6KA 3NHNA 3RBBB 4LN2A 4OMOA 1UE9A 4JJDA 3VS2A 2PNIA 5L23A 3C0CA 1K9AA 2J6FA 1PKSA 2EQIA 2BZYA 2CDTA 3ULRB 2JMAA 1GBRA 1AD5A 1T3SA 2DJQA 1YNZA 1U06A 1OOTA 2EGAA 1MV0B 1UGVA 1OPLA 1EFNA 4FGEA 1NG2A 2FO0A 1M3AA 1T3LA 3KFVA 3VS6A 2KRMA 2LJ3A 1AEYA 3M0PA 2M51A 1N5ZA 2EVRA 4FQBA 1X69A 1WA7A 1WYXA 1HSQA 1ZUUA 1H3HA 2RQVA 1UTIA 2EGCA 1Y0MA 2DL4A 3H0IA 4LJ1A 5GJWB 4FSSA 1ZX6A 2ROLA 2KEAA 3M0UA 1E7OA 2HDAA 1VYVA 1YWOA 4KRTA 1JXMA 1ZBJA 4J9IA 1UFFA 3QWYA 4QT7A 5FW9A 5I11A 4DEYA 3H41A 2JS2A 2VPSA 4CGKA 3NGPA 1BB9A 3S0QA 3VS5A 2YUPA 2L3QA 2JM8A 2X3XD 1ABQA 4IIMA 2DRKA 3GT2A 3PVQA 2GBQA 4CC7A 3EG0A 4Q4NA 4Y92A 2J06A 2KRNA 1RLQC 3I35A 1NLPC 2M0YA 2H8HA 1ZSGA 1W1FA 2K79A 2LJ1A 4EOBA 2DNUA 5EC7A 2RF0A 3A98A 4GLMA 1VYUA 3PVLA 1X2KA 2KT8A 2F2XA 1RUWA 2RMOA 2LMJA 2IO9A 2D0NA 2DF6A 2V1RA 2DE0X 4E6RA 4WCIA 1OPKA 2DMOA 2NWMA 2GTJA 1VA7A 4K11A 2IOAA 2D8JA 1QKXA 1WXBA 4R0KA 4AG2C 1JQQA 1SSHA 1PHTA 2A36A 3EG3A 2VKNA 2YUQA 1AZEA 2EW3A 3O5ZA 4RTWA 5FWCA 3UF4A 2D1XA 3FJ5A 2DL8A 2QDLA 1G83A 2B86A 3M0QA 1WDXA 1IO6A 2FEIA 2CT3A 2K9GA 2G6FX 4RTXA 3SEMA 1UG1A 2HEQA 2AZSA 4Q4GX 2GQIA 2JTEA 4D8DA 1A0NB 2VOBA 4CC3A 1TUCA 1VYTA 4M4ZA 2FPFA 1E6HA 4AFQC 1SHFA 1GCQC 2O9SA 1QCFA 1K4US 2FG0A 3KW0A 2PZ1A 1K0XA 4RTZA 1UDLA 2CH4A 4AFSC 2VWFA 1ARKA 3PE0A 2LQNA 1UHCA 2AKLA 2PTKA 1HD3A 3UA6A 4A63B 2IO7A 4HVVA 1KIKA 4EQAA 2L3SA 1V1CA 2XMFA 2BZ8A 4RUGA 2FPDA 2RNAA 1UUEA 2ESWA 3M0RA 5GJVB 2E5KA 2LQWA 2RPNA 1PWTA 1M3CA 2YSQA 1X43A 2FPEA 1Z9ZA 1QKWA 3O98A 1SPKA 1GBQA 4ORZA 1SEMA 4OMQA 1E6GA 4CT3A 2O88A 2DRMA 1PKTA 2DILA 5IXBA 3I5RA 2DL7A 1SHGA 2LX7A 2ROTA 1JEGA 2GGRA 5IXFA 4LNPA 1YN8A 2FRWA 2ABLA 2YUNA 2JS0A 2EPDA 2KXCA 2HCKA 1KJWA 3VS3A 3A2ZA 2VPMA 1QWEA 3REBB 3UATA 1Y57A 1AOJA 1ZUYA 4OMMA 1WX6A 1NEBA 2KYBA 1K0SA 4F0VA 2CH4W 1RI9A 2O9VA 3SHWA 3TSWA 2JMCA 5IHKA 3A30A 1M3BA 2ED0A 1QWFA 2YDLA 2P4RA 2FRYA 2D8HA 3LH5A 1HJDA 2JW4A 3TSZA 1MV3A 1AVZC 2MIOA 1YP5A 3ZL7C 1MUZA 1SRLA 2KR3A 4F16A 3VRZA 1X2QA 1M27C 1I0CA 1YCSB 2J6OA 1X6GA 2W0ZA 4RTVA 2C0TA 1PNJA 2F2WA 4Z8AA 1GL5A 1OV3A 1PRLC 1NLOC 2HBWA 2I0NA 4J9DA 2KT1A 2L0AA 3A2YA 1JXOA 3VPIA 4OLKA 1UJ0A 2K6DA 2F2VA 4EQ8A 2RQWA 4X1VA 1AWJA 2CUBA 2KE9A 4LUEA 2DBKA 1NYFA 4Z89A 4HPEA 2LP5A 1CKBA 2YT6A 2C0OA 3CQTA 1S1NA 2EYZA 2RQRA 2EBPA 1GFCA 1JU5C 5IHIA 3EGUA 2GTOA 4F4MA 2LRJA 1W70A 3M1UA 3VS4A 4Z88A 1G2BA 3EG1A 2BZXA 2HSPA 4F17A 2K1GA 2CSIA 2JM9A 2DM1A 2K3BA 3M0SA 2GNCA 3NPFA 1I07A 3EHRA 4J9CA 5I22A 4HZ9A 3VPJA 2C0IA 2CT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWX A;  2KXD A;  4OMP A;  3UA7 A;  2EYX A;  2RQU A;  3NMZ C;  3VRY A;  2LNH B;  2KNB B;  3M0T A;  4JJC A;  2AK5 A;  1WLP B;  2EYW A;  1H92 A;  2SEM A;  3VS1 A;  1UHF A;  2KGT A;  3EHQ A;  2O2O A;  4F0W A;  2K2M A;  1X6B A;  3NE0 A;  1TUD A;  2SRC A;  4AG1 C;  4HVW A;  5ECA A;  1WXT A;  2KRS A;  1NM7 A;  1NEG A;  4JXB A;  1I1J A;  2KBT A;  2ED1 A;  2MCN A;  5IHN A;  4AFZ C;  1QLY A;  4CSH A;  1BK2 A;  1JO8 A;  1FYN A;  2DVJ A;  2DL3 A;  4OML A;  1UEC A;  1BBZ A;  4RTT A;  2JT4 A;  2A28 A;  1WI7 A;  2DX1 A;  4RTY A;  4Q4T A;  2OJ2 A;  2A37 A;  2X3W D;  2RQT A;  2VVK A;  3GBQ A;  1B3Q A;  1WIE A;  2IF6 A;  1K1Z A;  4FQA A;  1KSW A;  2BTT A;  2AKK A;  4FGD A;  4FGI A;  2IO8 A;  4GBQ A;  1M8M A;  4RTU A;  2EYY A;  2V1Q A;  2RN8 A;  1AZG B;  2DYB A;  1GRI A;  2CRE A;  1K76 A;  3REA B;  1CSK A;  1LCK A;  4F14 A;  2MOX A;  2L2P A;  2CUD A;  1H8K A;  3R6N A;  2IOB A;  4LE9 A;  2CSQ A;  4J9F A;  2YUO A;  5IH2 A;  3H0F A;  5HCK A;  1WFW A;  1Z9Q A;  4HVU A;  4AFU C;  2JXB A;  2ECZ A;  1ZUK A;  2W10 A;  4J9G A;  3I5S A;  2LZ6 B;  1XOV A;  4JJB A;  4OMN A;  1WXU A;  2KRO A;  1U3O A;  3QWX X;  4ZNX A;  2K3A A;  2OI3 A;  1ABO A;  2DL5 A;  2EGE A;  3I86 A;  3PBI A;  1GCP A;  2DA9 A;  1U5S A;  2O31 A;  3U23 A;  1AWO A;  1X27 A;  1KFZ A;  4ESR A;  1ZLM A;  1FMK A;  1SRM A;  1BU1 A;  1B07 A;  2LCS A;  4HXJ A;  2LJ0 A;  1TG0 A;  4EIK A;  1GFD A;  3EG2 A;  2IIM A;  3I9Q A;  1PRM C;  4J9B A;  4LUD A;  3VS0 A;  1J3T A;  1T0J A;  2AZV A;  3IQL A;  1YWP A;  1T0H A;  3JV3 A;  2J7I A;  2OAW A;  4JPB W;  4D8K A;  1CKA A;  3THK A;  2KYM A;  1GCQ A;  2XIV A;  1UJY A;  4J9E A;  1OEB A;  4IIO A;  2ENM A;  2A08 A;  2DBM A;  2DLP A;  3H0H A;  3RNJ A;  4JZ4 A;  3VS7 A;  2K7A A;  4CC2 A;  4FDY A;  1RLP C;  4J9H A;  4HCK A;  2EKH A;  3TVT A;  2L3P A;  3PBC A;  5FWB A;  4HZB A;  4JZ3 A;  4CC4 B;  1W6X A;  4DEX A;  2NUZ A;  1M30 A;  1NYG A;  1AWW A;  2J05 A;  2J6K A;  3NHN A;  3RBB B;  4LN2 A;  4OMO A;  1UE9 A;  4JJD A;  3VS2 A;  2PNI A;  5L23 A;  3C0C A;  1K9A A;  2J6F A;  1PKS A;  2EQI A;  2BZY A;  2CDT A;  3ULR B;  2JMA A;  1GBR A;  1AD5 A;  1T3S A;  2DJQ A;  1YNZ A;  1U06 A;  1OOT A;  2EGA A;  1MV0 B;  1UGV A;  1OPL A;  1EFN A;  4FGE A;  1NG2 A;  2FO0 A;  1M3A A;  1T3L A;  3KFV A;  3VS6 A;  2KRM A;  2LJ3 A;  1AEY A;  3M0P A;  2M51 A;  1N5Z A;  2EVR A;  4FQB A;  1X69 A;  1WA7 A;  1WYX A;  1HSQ A;  1ZUU A;  1H3H A;  2RQV A;  1UTI A;  2EGC A;  1Y0M A;  2DL4 A;  3H0I A;  4LJ1 A;  5GJW B;  4FSS A;  1ZX6 A;  2ROL A;  2KEA A;  3M0U A;  1E7O A;  2HDA A;  1VYV A;  1YWO A;  4KRT A;  1JXM A;  1ZBJ A;  4J9I A;  1UFF A;  3QWY A;  4QT7 A;  5FW9 A;  5I11 A;  4DEY A;  3H41 A;  2JS2 A;  2VPS A;  4CGK A;  3NGP A;  1BB9 A;  3S0Q A;  3VS5 A;  2YUP A;  2L3Q A;  2JM8 A;  2X3X D;  1ABQ A;  4IIM A;  2DRK A;  3GT2 A;  3PVQ A;  2GBQ A;  4CC7 A;  3EG0 A;  4Q4N A;  4Y92 A;  2J06 A;  2KRN A;  1RLQ C;  3I35 A;  1NLP C;  2M0Y A;  2H8H A;  1ZSG A;  1W1F A;  2K79 A;  2LJ1 A;  4EOB A;  2DNU A;  5EC7 A;  2RF0 A;  3A98 A;  4GLM A;  1VYU A;  3PVL A;  1X2K A;  2KT8 A;  2F2X A;  1RUW A;  2RMO A;  2LMJ A;  2IO9 A;  2D0N A;  2DF6 A;  2V1R A;  2DE0 X;  4E6R A;  4WCI A;  1OPK A;  2DMO A;  2NWM A;  2GTJ A;  1VA7 A;  4K11 A;  2IOA A;  2D8J A;  1QKX A;  1WXB A;  4R0K A;  4AG2 C;  1JQQ A;  1SSH A;  1PHT A;  2A36 A;  3EG3 A;  2VKN A;  2YUQ A;  1AZE A;  2EW3 A;  3O5Z A;  4RTW A;  5FWC A;  3UF4 A;  2D1X A;  3FJ5 A;  2DL8 A;  2QDL A;  1G83 A;  2B86 A;  3M0Q A;  1WDX A;  1IO6 A;  2FEI A;  2CT3 A;  2K9G A;  2G6F X;  4RTX A;  3SEM A;  1UG1 A;  2HEQ A;  2AZS A;  4Q4G X;  2GQI A;  2JTE A;  4D8D A;  1A0N B;  2VOB A;  4CC3 A;  1TUC A;  1VYT A;  4M4Z A;  2FPF A;  1E6H A;  4AFQ C;  1SHF A;  1GCQ C;  2O9S A;  1QCF A;  1K4U S;  2FG0 A;  3KW0 A;  2PZ1 A;  1K0X A;  4RTZ A;  1UDL A;  2CH4 A;  4AFS C;  2VWF A;  1ARK A;  3PE0 A;  2LQN A;  1UHC A;  2AKL A;  2PTK A;  1HD3 A;  3UA6 A;  4A63 B;  2IO7 A;  4HVV A;  1KIK A;  4EQA A;  2L3S A;  1V1C A;  2XMF A;  2BZ8 A;  4RUG A;  2FPD A;  2RNA A;  1UUE A;  2ESW A;  3M0R A;  5GJV B;  2E5K A;  2LQW A;  2RPN A;  1PWT A;  1M3C A;  2YSQ A;  1X43 A;  2FPE A;  1Z9Z A;  1QKW A;  3O98 A;  1SPK A;  1GBQ A;  4ORZ A;  1SEM A;  4OMQ A;  1E6G A;  4CT3 A;  2O88 A;  2DRM A;  1PKT A;  2DIL A;  5IXB A;  3I5R A;  2DL7 A;  1SHG A;  2LX7 A;  2ROT A;  1JEG A;  2GGR A;  5IXF A;  4LNP A;  1YN8 A;  2FRW A;  2ABL A;  2YUN A;  2JS0 A;  2EPD A;  2KXC A;  2HCK A;  1KJW A;  3VS3 A;  3A2Z A;  2VPM A;  1QWE A;  3REB B;  3UAT A;  1Y57 A;  1AOJ A;  1ZUY A;  4OMM A;  1WX6 A;  1NEB A;  2KYB A;  1K0S A;  4F0V A;  2CH4 W;  1RI9 A;  2O9V A;  3SHW A;  3TSW A;  2JMC A;  5IHK A;  3A30 A;  1M3B A;  2ED0 A;  1QWF A;  2YDL A;  2P4R A;  2FRY A;  2D8H A;  3LH5 A;  1HJD A;  2JW4 A;  3TSZ A;  1MV3 A;  1AVZ C;  2MIO A;  1YP5 A;  3ZL7 C;  1MUZ A;  1SRL A;  2KR3 A;  4F16 A;  3VRZ A;  1X2Q A;  1M27 C;  1I0C A;  1YCS B;  2J6O A;  1X6G A;  2W0Z A;  4RTV A;  2C0T A;  1PNJ A;  2F2W A;  4Z8A A;  1GL5 A;  1OV3 A;  1PRL C;  1NLO C;  2HBW A;  2I0N A;  4J9D A;  2KT1 A;  2L0A A;  3A2Y A;  1JXO A;  3VPI A;  4OLK A;  1UJ0 A;  2K6D A;  2F2V A;  4EQ8 A;  2RQW A;  4X1V A;  1AWJ A;  2CUB A;  2KE9 A;  4LUE A;  2DBK A;  1NYF A;  4Z89 A;  4HPE A;  2LP5 A;  1CKB A;  2YT6 A;  2C0O A;  3CQT A;  1S1N A;  2EYZ A;  2RQR A;  2EBP A;  1GFC A;  1JU5 C;  5IHI A;  3EGU A;  2GTO A;  4F4M A;  2LRJ A;  1W70 A;  3M1U A;  3VS4 A;  4Z88 A;  1G2B A;  3EG1 A;  2BZX A;  2HSP A;  4F17 A;  2K1G A;  2CSI A;  2JM9 A;  2DM1 A;  2K3B A;  3M0S A;  2GNC A;  3NPF A;  1I07 A;  3EHR A;  4J9C A;  5I22 A;  4HZ9 A;  3VPJ A;  2C0I A;  2CT4 A; 
#chains in the Genus database with same CATH topology
 2KXD A;  2EIF A;  3V8K A;  3Q1J A;  2K5I A;  1B7T A;  1V76 A;  4F04 B;  2KSS A;  2KNB B;  3M0T A;  4JJC A;  3CCR A;  2ZAE A;  4A54 A;  3CCM T;  4IUT A;  2DEQ A;  4M78 B;  4MZM A;  4L59 A;  2GFA A;  5GAN 4;  2E10 A;  2SRC A;  3S3N A;  5ECA A;  2XU8 A;  1B34 B;  1NEG A;  2KBT A;  2MCN A;  1S72 T;  3BDL A;  1W2B A;  4AFZ C;  2LQK A;  1H3Z A;  2DVJ A;  3CC4 A;  4QW2 A;  4YTL A;  1SF9 A;  3CCL T;  3JB9 G;  1YHQ Q;  2RJD A;  1YJW A;  2BE9 B;  4Q4T A;  2A37 A;  2CP5 A;  1W2B P;  1QQJ A;  2RM4 A;  2WSC E;  3GBQ A;  2BTT A;  3HPW A;  3M56 A;  4MDX A;  4FW1 A;  1K9M U;  2AKK A;  4RTU A;  2EYY A;  4M77 B;  4EPC A;  1M1K R;  1VQP A;  2JVV A;  3QJ6 A;  1G8X A;  2CRE A;  1W2B S;  2HNI A;  2DVE A;  1LCK A;  1VQ6 Q;  2L2P A;  1H8K A;  2IOB A;  5GAO m;  2E65 A;  5IH2 A;  1XQH A;  4AFU C;  4J9G A;  4JJB A;  3G71 Q;  1SKU B;  1U3O A;  4PJO E;  2K3A A;  2DZC A;  2DL5 A;  3I86 A;  2DA9 A;  4DQ2 A;  4HCC A;  2O31 A;  4ESR A;  1QP3 A;  1ZLM A;  1SRM A;  3CC7 A;  2LCS A;  4HFF A;  4EIK A;  1SSF A;  3OS1 A;  2V8K A;  5KH6 A;  1S72 A;  2JTM A;  2L5Q A;  1J3T A;  4XTZ A;  3IQL A;  2OAW A;  3OYJ A;  3DLM A;  5GAO q;  1D0X A;  3CC2 A;  2KYM A;  4C92 A;  4M7D C;  1UJY A;  3ASK A;  4J9E A;  3TEE A;  1OEB A;  2ENM A;  2A08 A;  1VQ9 Q;  4XAX B;  2DIQ A;  4FYY B;  1JJ2 P;  2HAX A;  1BCO A;  3VS7 A;  2HD0 A;  2KQW A;  5D6X A;  3VV0 A;  5GAN 2;  1R77 A;  1BI0 A;  4J9H A;  4HCK A;  2NUT A;  3TVT A;  1UGQ B;  2NUT B;  2Y4X A;  5FWB A;  2FZC B;  3CCS T;  3CD6 T;  1DJ7 B;  1QCN A;  1NYG A;  4BY6 B;  3OYD A;  1AWW A;  1VQ6 T;  2J6K A;  4JRK A;  4PJO A;  2MI6 A;  4JJD A;  5FU7 B;  3VS2 A;  5L23 A;  4OP0 A;  3QUI A;  1Q86 U;  3C0C A;  2RD1 A;  4C8Q C;  2BZY A;  1EX4 A;  4F7U F;  2EJF A;  2CDT A;  3ULR B;  1H64 1;  1GBR A;  3WXM B;  3G4S T;  1YNZ A;  1VQO T;  1VQK Q;  2FO0 A;  2COY A;  4DBF A;  1T3L A;  3OYK A;  3VS6 A;  5GAM d;  2KRM A;  2KVQ G;  3KBG A;  4D6W A;  1N5Z A;  4FQB A;  5CKH A;  1WYX A;  4BDZ A;  1HSQ A;  2X51 A;  1PSF A;  3QYG B;  1KK7 A;  5GJW B;  2LDM A;  2KEA A;  5I2S A;  1E7O A;  4KRT A;  2HQE A;  1JXM A;  2E3H A;  4BI4 A;  3QWY A;  4ZGJ B;  5I11 A;  4DEY A;  5GAO r;  3H41 A;  2JS2 A;  4OGC A;  3CXC S;  3S0Q A;  3CBP A;  3OS2 A;  2YUP A;  5J26 A;  4NL3 A;  4A4G A;  5FRM A;  2X3X D;  3GT2 A;  2K57 A;  5D7U A;  3FB9 A;  5HK0 A;  2A3L A;  2J06 A;  1RLQ C;  4N4I A;  3OSV A;  3R6O A;  1YCY A;  2O4X B;  1MMG A;  1W1F A;  3CPW A;  1YIJ T;  2PUO B;  3CCU T;  3X28 B;  3A98 A;  4FYW B;  4M77 A;  1VYU A;  2RHU A;  2KT8 A;  2QTV A;  1OUL A;  2F2X A;  1M5Q 1;  3E1S A;  1WZO A;  4V2S A;  3OQ5 A;  4RCC A;  1OPK A;  1G3S A;  4HT9 A;  2GTJ A;  1B34 A;  4OGE A;  2D8J A;  2VGM A;  1OQK A;  2R5M A;  2EAY A;  4ANJ A;  4N4H A;  3CCQ A;  2VKN A;  1GXI E;  3G6E A;  4M78 A;  3FJ5 A;  5GAO p;  2DL8 A;  1VOM A;  1G83 A;  2MWO A;  2FEI A;  1XJW B;  4M7A F;  3RMQ A;  2QQS A;  4Q4G X;  3VYH B;  2QEX Q;  1RAI B;  1TS9 A;  3QBY A;  4TVR A;  5GMK l;  4M4Z A;  1ZSZ C;  2O9S A;  2CP6 A;  1QCF A;  2FG0 A;  1D0Z A;  2GCX A;  4JJN K;  3F70 A;  4RTZ A;  1G3T A;  3AT1 B;  3JB9 I;  5I21 A;  1NJI R;  1HD3 A;  4A63 B;  5GAN d;  1Q81 R;  4M77 C;  4N0A C;  2L3S A;  3TQ7 P;  4RUG A;  3CBM A;  3QZ5 B;  3M0R A;  5LJ3 d;  2ZGW A;  1X43 A;  4FIB A;  2HQX A;  4ORZ A;  4MDW A;  4L6V 5;  2XIC A;  4FL6 A;  1E6G A;  4J7I A;  3E19 A;  3M4Y A;  2FZK B;  2NUP B;  4KT0 E;  1N8R U;  3BDU A;  4HA8 A;  2LT1 A;  3ME9 A;  4M75 C;  4QKU A;  1TTH B;  2K3Y A;  2QA4 Q;  2DTO A;  2DEU A;  2KXC A;  2HCK A;  4XTX A;  3LWI A;  1KJW A;  2X9H A;  4UC4 A;  3OW2 P;  2VPM A;  3CCE T;  4M7D A;  3QO3 A;  1N27 A;  5CR2 A;  2K5F A;  2CGH A;  3MP1 A;  4Y28 E;  2RJC A;  1QVF A;  3DKM A;  4M7D B;  3CMA Q;  1K73 U;  1XTD A;  2CH4 W;  3TSW A;  3SHW A;  1MMD A;  1M3B A;  2QG9 B;  3NFC A;  3VU3 C;  1X75 C;  4M78 E;  2XG8 D;  5LJ5 g;  1HJD A;  1QW1 A;  3BE3 A;  1LNX A;  2RHY A;  1MUZ A;  1UGS B;  2QXF A;  4C8Q A;  3VRZ A;  3C12 A;  3L2U A;  4HFK A;  1I0C A;  5KE2 A;  4GLK A;  5GAM h;  4RTV A;  3MHX A;  3QHS A;  2CS7 A;  3HHT B;  4Z8A A;  4F7U B;  2QI2 A;  1NLO C;  3V7S A;  4JUR A;  1AT1 B;  3BFM A;  2F2V A;  4M75 G;  4X1V A;  1QVF S;  2M1H A;  1M1K C;  1CKB A;  5A0G A;  2K5L A;  2C0O A;  3JRZ A;  4BAC A;  3FJP A;  2GTO A;  2F5K A;  3OYI A;  2XI9 A;  3M1U A;  2DIG A;  3L1A A;  1IB8 A;  2RB6 A;  2BZX A;  4JRP A;  3C4S A;  2QYZ A;  2K1G A;  3HRS A;  2DM1 A;  2DXB A;  5I22 A;  2MK5 A;  3CCJ A;  4M77 D;  4OMP A;  2RQU A;  3NMZ C;  2VGN A;  3EGX A;  5LJ5 f;  3QXE B;  1VQM A;  3CCJ T;  2QQR A;  2EYW A;  3CCQ T;  1JJ2 A;  3VS1 A;  2QEX A;  1I81 A;  4HT8 A;  1Q86 R;  4F0W A;  5LJ3 j;  1HYO A;  4ZTJ A;  3OA6 A;  3G6E Q;  4JXB A;  2DD4 A;  3VKI A;  4E7Z A;  1X6O A;  5IHN A;  4A4F A;  3CCQ Q;  4CSH A;  5GAN 8;  1BK2 A;  1JO8 A;  2DL3 A;  4PK4 A;  1Q7Y R;  1WHK A;  1BBZ A;  2QAS A;  3TU4 K;  2JT4 A;  4EMK C;  5FLX E;  2DX1 A;  5CQX A;  2DER A;  2F69 A;  1M2V A;  1QMC A;  1YJN A;  1RAF B;  2RQT A;  3OMC A;  2COZ A;  1EIF A;  2O4X A;  5LJ3 f;  2X4X A;  2CP7 A;  1K1Z A;  4PL6 A;  4OB0 B;  4FCY A;  3PIO A;  4FGD A;  4FGI A;  2EQM A;  3QZ9 B;  3L42 A;  3INZ A;  1K76 A;  1CSK A;  1KC8 U;  2CUD A;  4PJN A;  3R6N A;  3ZEH A;  2QGF B;  4J9F A;  4ZGD B;  4KUD K;  1WFW A;  2ZPF B;  1D1A A;  1YIJ Q;  1YIT Q;  2JOY A;  3I5S A;  2CP3 A;  4XTY A;  2LZ6 B;  3LLR A;  2E1H A;  4ZNX A;  3PMI A;  5GAN 7;  3PBI A;  1GCP A;  3RKW A;  1AWO A;  1KFZ A;  3DB3 A;  2LJ0 A;  3JCM W;  1GFD A;  3EG2 A;  1VQN Q;  4LUD A;  3VS0 A;  1T0J A;  2AZV A;  4O6J A;  3EG9 B;  3J81 E;  2PVO B;  2J7I A;  1IHW A;  3CMA T;  2M9U A;  5GAN h;  1ZSZ A;  4KGZ B;  4PJO C;  3QDF A;  2VB6 A;  2DBM A;  4N0A A;  3OYC A;  1QP2 A;  2DET A;  1WGS A;  2ZPI B;  2K7A A;  2LRQ A;  4FDY A;  4MMK A;  1PC0 A;  3JCM d;  2OTL A;  3D7S B;  4JZ3 A;  3TRE A;  3OY9 A;  3OYL A;  3LGL A;  4DEX A;  1M30 A;  4XU1 A;  2J05 A;  2H3E B;  3RBB B;  1VQ8 T;  4ELY C;  1I5O B;  2J6F A;  4C5E A;  2D9T A;  3OW2 S;  1NPR A;  2DJQ A;  3CME Q;  2OTL T;  4BDY A;  1OOT A;  1UGV A;  5LJ5 h;  1EFN A;  4FGE A;  1NG2 A;  2R5A A;  4BE0 A;  1M3A A;  4ME7 A;  3CC2 Q;  2MPX C;  1BKB A;  2LJ3 A;  1OX9 A;  3VUZ A;  2ZZD A;  1H3H A;  2EGC A;  3CCJ Q;  1Y0M A;  3CC7 Q;  2DL4 A;  5EG2 A;  1ZX6 A;  2ROL A;  3X26 B;  3M0U A;  2HMA A;  2HDA A;  4ELZ C;  1YWO A;  3RMS A;  1UFF A;  3S3M A;  3OBY A;  3LWH A;  2E12 A;  3GF5 A;  4R55 A;  3QYH B;  4RMO A;  1D0Y A;  3VS5 A;  2VV5 A;  2XDD A;  1PD0 A;  4BI3 A;  4E7L A;  4E7K A;  4DA4 A;  3OBW A;  2DRK A;  4PJM A;  3X20 B;  1K8A R;  2GBQ A;  2RK2 A;  3EG0 A;  4E7S A;  3SFM A;  4II1 A;  2KRN A;  1VQP Q;  3PNW C;  4FT4 A;  1NLP C;  2M0Y A;  4LDU A;  4C8Q D;  2YRD A;  4JLI A;  4EMG A;  2YWW A;  3CME A;  2R58 A;  5EC7 A;  2RF0 A;  3QKJ A;  1X2K A;  5KYX A;  1VQL A;  2HBP A;  2D0N A;  1X01 A;  3V7C A;  4J8O A;  4JRQ A;  5I2M A;  2M0O A;  1U1T A;  1F1B B;  2HL5 C;  1I5L A;  2QEX T;  2RHZ A;  3L2Z A;  5KYX B;  2YUQ A;  1AZE A;  3O5Z A;  2MMP A;  3MO8 A;  3RDV A;  2LNV A;  3CEY A;  2XK0 A;  3M0Q A;  4RKU E;  1WDX A;  2CT3 A;  3I55 T;  1VQO A;  2G6F X;  3SEM A;  2AZS A;  2GQI A;  3CCR Q;  1U1S A;  4D8D A;  3GLX A;  4E7I A;  4J30 A;  1RAE B;  1E6H A;  1SHF A;  3CCV Q;  2XDP A;  1N8R C;  4M7A G;  1BIB A;  1K0X A;  2WSE E;  3LGF A;  2CH4 A;  3MET A;  1KQS A;  1ARK A;  2PUK B;  3PE0 A;  4NL2 A;  2LQN A;  2EQU A;  2A0F B;  3UA6 A;  1NJI C;  1VUB A;  4EQA A;  1YFN A;  4OVA A;  2RO0 A;  1G3Y A;  1N8R R;  3EGD A;  2LQW A;  1PWT A;  1KG1 A;  4AMC A;  3GP8 A;  3JB9 D;  1QKW A;  3O98 A;  1SPK A;  1IZ6 A;  1GBQ A;  3CC2 T;  4C92 D;  3CPF A;  1KHI A;  4OMQ A;  4JS5 A;  2O88 A;  2DIL A;  5IXB A;  3I5R A;  2LQ8 A;  2CP2 A;  1SHG A;  5CK9 A;  4F7U G;  5HY6 A;  2RJF A;  2X4J A;  1TSF A;  2FRW A;  3G1J A;  3V8J A;  4QVZ A;  4C8Q F;  3ZFJ A;  2VUB A;  3REB B;  5CKB A;  1Y57 A;  1ZUY A;  2RJE A;  3OB9 A;  3AHU A;  1TUG B;  3FDR A;  2JMC A;  4C92 E;  4HCZ A;  2ED0 A;  1IXD A;  1TU0 B;  2YDL A;  4M75 A;  3PT9 A;  2WSF E;  2G3R A;  1Q82 U;  4LDY A;  4X9D A;  3RER A;  3PTA A;  1YP5 A;  4KUL A;  3J80 E;  1M1F A;  2KR3 A;  1M27 C;  2I2L A;  1C6V X;  1WQW A;  4M7D F;  2J6O A;  3P8B B;  2W0Z A;  1R0C B;  2F2W A;  1GL5 A;  2WP7 A;  1N6A A;  1N9R A;  2HBW A;  4J9D A;  1O9S A;  1YJ9 Q;  1FWZ A;  4OLK A;  1K9M C;  3HFN A;  3L2W A;  1TWB A;  4JDS A;  1AWJ A;  2RHI A;  2KE9 A;  2BIV A;  1RAD B;  3QJY A;  4HPE A;  2YXY A;  1UB4 A;  2LP5 A;  3UWN A;  3EG9 A;  2WAC A;  2EYZ A;  4PFP A;  5GAN 3;  4JS4 A;  3SWN C;  4Q5W A;  2JNG A;  1D09 B;  3X24 B;  3VS4 A;  5GAN g;  4M78 D;  1OZ3 A;  2OTJ Q;  1WHH A;  4IUQ A;  1VQ8 A;  3N5B B;  2HKQ B;  2RI2 A;  3E9G A;  4XTW A;  5LL6 S;  2CSI A;  3CCM A;  2RA2 A;  2K3B A;  1Q81 U;  3M0S A;  2GNC A;  2DAQ A;  4J9C A;  2YLB A;  4HZ9 A;  1YJW T;  3BY7 A;  1UGR B;  3M53 A;  2CT4 A;  1AWX A;  3M9Q A;  1IGQ A;  3LYI A;  3UA7 A;  2EYX A;  5FRO A;  4FT2 A;  3VRY A;  3A1P A;  5DY9 A;  2IVW A;  3EFO A;  1R0B G;  3CCV A;  1YJW Q;  3CBO A;  1YIT A;  4E7H A;  3JSC A;  1WLP B;  3SB2 A;  4C92 G;  1PSE A;  3CC4 Q;  2KGT A;  1VQK A;  2CP0 A;  3HRU A;  4J6Y A;  3QDR B;  1X6B A;  1TUD A;  3UT1 A;  3KUF A;  2B8A A;  5GAM f;  4AG1 C;  5IN1 A;  1WXT A;  3M57 A;  2KRS A;  2XDB A;  2DZ9 A;  2QA4 T;  1I1J A;  2ED1 A;  2Y90 A;  5LJ3 g;  1Q82 R;  1QLY A;  4A4E A;  1VQ5 Q;  1ACM B;  3H6Z A;  1K8A C;  1YJ9 T;  2JN0 A;  2YLC A;  3OS5 A;  5CKD A;  1VQ5 T;  1Y96 B;  2A28 A;  3HRT A;  4WF2 A;  2BKD N;  3GNF B;  1KHC A;  4GY5 A;  4M77 E;  3HL8 A;  4RTY A;  2DD5 A;  1ZBX A;  2OJ2 A;  1IGU A;  2JUF A;  5GAO l;  2X3W D;  2VVK A;  4LXC A;  4MZP A;  1WIE A;  2FHD A;  5CVI A;  3GPL A;  1KSW A;  4NOY A;  5CCA A;  1M8M A;  1OU9 A;  3CCL A;  4X34 A;  2RN8 A;  4XTU A;  2DYB A;  3E9F A;  1LVK A;  3O8V A;  2MOX A;  5LJ3 e;  1YIJ A;  4KH0 B;  2MWP A;  3EGX B;  2CSQ A;  2P84 A;  2YUO A;  4RG8 A;  5HCK A;  4EDU A;  3I56 A;  3JB9 F;  4J83 A;  2JXB A;  1NBE B;  2HKN A;  2W10 A;  3P8H A;  4C0F A;  1WXU A;  2KRO A;  3RR6 A;  5LJ5 d;  4M7D G;  3QG1 A;  5KYN A;  1RL2 A;  3A8M B;  5GAN 5;  3PFS A;  1U5S A;  3U23 A;  4J6X A;  4Z02 A;  3RKX A;  1FMK A;  2XKO C;  4EMK B;  3OYH A;  2LVM A;  4X9C A;  3I9Q A;  5GAN j;  1YWP A;  1T0H A;  3EBQ A;  4JPB W;  2EFI A;  1VIF A;  8ATC B;  1GCQ A;  4PJJ A;  2DKG A;  2MAM A;  2X4W A;  1Q7Y C;  1VQ7 T;  2YRV A;  2BUD A;  1VQM T;  4ZN1 A;  4JZ4 A;  1VQ4 T;  4CC2 A;  3JCM e;  4M75 D;  2QK0 A;  3VYG A;  1RLP C;  1BI2 A;  3OMG A;  2CYZ B;  4LDX A;  4ZGE B;  3PBC A;  4HZB A;  2DO3 A;  1W6X A;  1HK9 A;  2NUZ A;  2E6Z A;  2DFU A;  2FB7 A;  4IKF A;  3NHN A;  4OMO A;  1UE9 A;  1K9M R;  2PNI A;  5KYU A;  1BYM A;  4IUP A;  4PLI A;  1AHJ B;  4XU0 A;  4A53 A;  1K9A A;  1PKS A;  1M2O A;  2EQI A;  2XID A;  3LW5 E;  1AD5 A;  3MKD A;  3V7R A;  4DBQ A;  3PMT A;  3CCV T;  1MV0 B;  1OPL A;  1WJS A;  1I4K 1;  5C6S A;  4JUV A;  2M16 A;  4PJO G;  1X69 A;  9ATC B;  1WA7 A;  1ZSZ B;  4PJL A;  3JCM J;  1D3B A;  4BUG A;  2KMT A;  4M78 F;  2K3X A;  4KGV B;  3CCE A;  1KC8 C;  2RI5 A;  1K8A U;  2VC8 A;  3MEA A;  3CCM Q;  1ZBJ A;  4J9I A;  2V8J A;  3NTK A;  5FW9 A;  4C5I A;  1UEB A;  2VPS A;  4CGK A;  3NGP A;  4A4H A;  3UDC A;  1PM3 A;  2JM8 A;  1ZQ1 A;  3G6E T;  3PVQ A;  2E70 A;  1G3W A;  4C0G A;  3HFO A;  4Y92 A;  1WNL A;  3J7A F;  5M9O A;  3KXT A;  1VQ4 Q;  4M77 G;  5A0L A;  3I35 A;  3OYA A;  1NZ9 A;  1ZSG A;  1MMN A;  2ZPB B;  2QQA A;  2LJ1 A;  1Q86 C;  4EOB A;  5GMK h;  3JCM b;  4GLM A;  3QSU A;  3PVL A;  5DLO A;  3WVE B;  1Y96 A;  4DOV A;  3G71 T;  3CXC A;  2RMO A;  2LMJ A;  4N4G A;  2IO9 A;  2DF6 A;  5GAN f;  4L5G A;  2V1R A;  5LJ3 h;  2DE0 X;  4E6R A;  2NLU A;  1RAB B;  3OYM A;  2DXT A;  3QII A;  2NWM A;  4PNO A;  1VA7 A;  1M2V B;  2IOA A;  2L89 A;  4ZN3 A;  5CQY A;  4AG2 C;  2DTI A;  1SSH A;  3A8L B;  2A36 A;  1YJN T;  1FX7 A;  2FVU A;  3EG3 A;  5CKF A;  5A2Q E;  5FWC A;  3LH0 A;  4C5H A;  1Q95 G;  2F5T X;  2FYK A;  2B86 A;  1IO6 A;  4C8Q E;  2ZCF B;  2K9G A;  3L2Q A;  3EFO B;  4RTX A;  1UG1 A;  2HEQ A;  4KH1 B;  2LCL A;  5FU6 C;  1KD1 U;  1WHM A;  4XK8 E;  1A0N B;  2VOB A;  4CC3 A;  1TUC A;  1VYT A;  1WHL A;  4AFQ C;  1K4U S;  3KW0 A;  2GQV A;  2PZ1 A;  4FYX B;  2XHC A;  4PLL A;  4OF1 A;  3JCM g;  2E5Q A;  4O5V A;  2E6N A;  1ZA1 B;  2IO7 A;  4B9X A;  3X25 B;  2JTF A;  4HVV A;  4M7A B;  3CCU A;  2XMF A;  4A4K A;  1VQ4 A;  2OAU A;  2CZ0 B;  2RNA A;  2ESW A;  3MEU A;  1VQN A;  1Y07 A;  5GJV B;  2E5K A;  5IAY A;  1KQS P;  2RPN A;  4M77 F;  1M3C A;  2YSQ A;  1WHG A;  5GAM j;  5L8R E;  1IHV A;  2M02 A;  1RAG B;  1VQ6 A;  1MMA A;  8AT1 B;  5AYF A;  2FZG B;  3CCS A;  1VQL T;  4PKC C;  1KD1 R;  1OX8 A;  2DL7 A;  2LX9 A;  3I55 A;  1PCX A;  3DLL A;  3EFS A;  5IXF A;  4E7J A;  4LNP A;  1YN8 A;  2ABL A;  1HXD A;  3CME T;  2OTL Q;  3CCE Q;  3EAE A;  2YUN A;  2JS0 A;  1OU8 A;  2EPD A;  4FYV B;  4F7U A;  3NTI A;  3EFR A;  3VS3 A;  3JCM Q;  1IRE B;  2GFU A;  1QWE A;  1W4S A;  3UAT A;  1AOJ A;  2E41 A;  1WX6 A;  3JCM V;  1NEB A;  2KYB A;  1K0S A;  4F0V A;  4M75 B;  1VQ5 A;  5IHK A;  1ZA2 B;  3A30 A;  4F7U E;  5CIU A;  3OW2 A;  1QWF A;  3MP6 A;  1OZ2 A;  5GAO n;  2A7Y A;  3MP8 A;  2PVG B;  4BE1 A;  3TSZ A;  1MV3 A;  4EMH A;  2MIO A;  2QA4 A;  1SRL A;  1PG5 B;  1YBY A;  2O01 E;  4F16 A;  4ATO A;  3VJP A;  1YI2 A;  4OB3 B;  2MF2 A;  1YCS B;  2KK4 A;  1BI1 A;  2C0T A;  5FU6 B;  1JB0 E;  2I0N A;  5KYY B;  1WQ7 A;  3A5Z B;  3CCS Q;  3L2V A;  1M90 U;  2EJG A;  5KYW B;  2CUB A;  1NE8 A;  3FRN A;  2DBK A;  4Z89 A;  3M59 A;  2YT6 A;  3CQT A;  4LDW A;  2CZ6 B;  3M54 A;  4IUV A;  1JU5 C;  1VQP T;  4M7A A;  3G4S A;  2LRJ A;  3GNG A;  3V8L A;  3MEV A;  4XTV A;  5HKC A;  5AT1 B;  3A8H B;  3G7Z A;  3URG A;  3EGD B;  2E3I A;  2YHT A;  1SG5 A;  1UGP B;  2JM9 A;  3HKS A;  2OTJ T;  3E2U A;  3NPF A;  1I07 A;  1M4Z A;  3EHR A;  1I8F A;  3VPJ A;  4RG2 A;  4XU2 A;  3OYG A;  4KBM B;  4LDV A;  2EKO A;  1YJN Q;  5GAN 6;  1RAH B;  3CC4 T;  2LNH B;  2AK5 A;  1M1G A;  1H92 A;  2SEM A;  4HKE A;  3M5A A;  1UHF A;  1MND A;  4HCB A;  1FMW A;  3EHQ A;  2O2O A;  2K2M A;  3NE0 A;  2RI3 A;  2EYQ A;  4HVW A;  2EQK A;  3CPW S;  4HFL A;  1NM7 A;  3CCR T;  2AT1 B;  2AHJ B;  4QQG A;  1FYN A;  4OML A;  2VAS A;  2DXU A;  4JRI A;  1UEC A;  3CC7 T;  2ATC B;  4RTT A;  1YI2 Q;  1RAA B;  1WI7 A;  4LD9 K;  2HQH A;  5LJ5 j;  1KD1 C;  4XU3 A;  3TCJ A;  3T9N A;  4CRI A;  1JJ2 S;  1B3Q A;  2E64 A;  2IF6 A;  2Y4Y A;  4FQA A;  3GOX A;  3CMA A;  3OYB A;  1YI2 T;  2KY9 A;  5GAM g;  1YHQ T;  5CKE A;  2IO8 A;  4GBQ A;  4C0Z A;  3FIF A;  3JCM P;  2V1Q A;  1AZG B;  3A8G B;  1KQS S;  4J32 A;  1GRI A;  3REA B;  4F14 A;  4OB1 B;  3G4S Q;  3FC3 A;  4LE9 A;  4BY6 C;  1TXQ A;  3H0F A;  1Z9Q A;  2JJ9 A;  4HVU A;  5FU7 C;  3I55 Q;  1FMV A;  1LOJ A;  2ECZ A;  1ZUK A;  4DOW A;  1XOV A;  3EH1 A;  4OMN A;  3L2R A;  3QWX X;  4C92 F;  1M90 C;  2OI3 A;  1LPL A;  2OX7 A;  1ABO A;  4J5Y A;  1QCO A;  2EGE A;  2COW A;  1D3B B;  1X27 A;  5KYW A;  4E47 A;  1BU1 A;  1B07 A;  1ZHI A;  5GAM e;  4HXJ A;  2EWN A;  2LC4 A;  1TG0 A;  4C8Q G;  3NTH A;  4M7D E;  2IIM A;  1PRM C;  4J9B A;  2OTJ A;  2X4Y A;  1C1A A;  3JV3 A;  4XQ3 A;  4J7F A;  5GMK e;  2X35 A;  4D8K A;  1CKA A;  3THK A;  2LCC A;  2VYT A;  2PVD B;  2MYS A;  1KQ1 A;  2XIV A;  1WPY A;  2PU9 B;  3JCM f;  1QVG A;  4FW2 A;  4OMF B;  5KYU B;  3CXC P;  4IIO A;  5KYY A;  4M7A D;  2KI7 A;  3RUX A;  4NS5 A;  5GMK j;  2DLP A;  3H0H A;  3RNJ A;  1G5V A;  2DJZ A;  5CO7 A;  5DLQ E;  2EKH A;  1YJ9 A;  6AT1 B;  2L3P A;  1XNI A;  4PFZ A;  3PIP A;  4CC4 B;  3OYN A;  2QGG A;  3OYE A;  1KC8 R;  4PJO B;  2QQB A;  2LTO A;  3ZBD A;  3RIR A;  2R57 A;  4LN2 A;  4M7D D;  5DM7 R;  4FM4 B;  3C95 A;  1QVG S;  2JMA A;  1T3S A;  1WJQ A;  1U06 A;  3LX7 A;  2EGA A;  2P0K A;  2Z0W A;  2L8D A;  4BI8 B;  1EZZ B;  5FRN A;  1OI1 A;  3KFV A;  4C0D C;  1AEY A;  3M0P A;  2M51 A;  2EVR A;  5CAI A;  3UPU A;  4C92 B;  1TOV A;  4C5G A;  1ZUU A;  4BE2 A;  1S72 Q;  4FSX A;  3H8Z A;  2E4H A;  2RQV A;  3QPH A;  1UTI A;  4M75 F;  2RH2 A;  4B9W A;  3H0I A;  3OYF A;  1M9S A;  2QAZ A;  4LJ1 A;  4FSS A;  4KGX B;  2DPP B;  4IUU A;  1M8V A;  1VYV A;  2YRC A;  4AT1 B;  1D1C A;  4QT7 A;  3G71 A;  5IT9 E;  1BB9 A;  4MML A;  3BW1 A;  4E2F B;  2L3Q A;  2RHX A;  5LJ5 e;  4M78 C;  1ABQ A;  4IIM A;  3CPW P;  3C94 A;  3OYY A;  3S6W A;  1VQ7 Q;  1VQ9 T;  4CC7 A;  1LJO A;  1MGQ A;  4RCB A;  4Q4N A;  1OYX A;  3SDZ A;  3JCM c;  5J39 A;  2HZY A;  2ZPH B;  2H8H A;  4QQD A;  1WJR A;  3M55 A;  3FLG A;  2K79 A;  2VXE A;  5D6W A;  2DNU A;  4FU6 A;  3PGG A;  1U8R A;  3SD4 A;  1RUW A;  1QVG P;  3A8O B;  2DTH A;  4R56 A;  3FEO A;  1YHQ A;  4WCI A;  2F1L A;  2DMO A;  1JBM A;  3JCM X;  1NPP A;  4P5N A;  5C0M A;  4OB2 B;  4K11 A;  2NYS A;  2CZ1 B;  1QKX A;  3JB9 J;  1WXB A;  3WVD B;  1VQO Q;  4R0K A;  1VQK T;  1JQQ A;  3MCA B;  1M1K U;  1PHT A;  1V29 B;  5J3B A;  1Y7X A;  2EW3 A;  4RTW A;  3UF4 A;  1K73 C;  2D1X A;  4DBH A;  4WTO B;  2QDL A;  2LT4 A;  3RKY A;  2RK1 A;  2P4T A;  2KAF A;  3MEW A;  2JTE A;  4BB7 A;  2EQJ A;  3JCM h;  3HSB A;  1TH7 A;  2FPF A;  2P0Q A;  3M58 A;  7AT1 B;  4C0D B;  5GMK i;  1GCQ C;  4QVC A;  3MJX A;  4LD6 A;  1RAC B;  4MZT A;  1UDL A;  3RES A;  4QVD A;  4AFS C;  3CD6 Q;  3JB9 H;  2VWF A;  4IUR A;  2ZPE B;  1Y71 A;  1UHC A;  2AKL A;  2GF7 A;  2VXF A;  2PTK A;  2KDS A;  5HK3 A;  2V26 A;  1VQ8 Q;  3GIB A;  1KIK A;  2DYI A;  1V1C A;  2BZ8 A;  3SWN B;  4M75 E;  2QDY B;  2FPD A;  1UUE A;  4CI0 C;  5D6Y A;  3JAM E;  2K4Y A;  3ER0 A;  3CCU Q;  1VQ7 A;  2QQ9 A;  2FPE A;  1WHJ A;  5GMK m;  1Z9Z A;  2BE7 D;  2P0P A;  1JRI A;  5A0D A;  2IPO B;  1SEM A;  4Y91 A;  1M90 R;  1PD1 A;  4CT3 A;  1BIA A;  3S3O A;  1Q7Y U;  2L3R A;  2DRM A;  4JLG A;  1PKT A;  1Q81 C;  2ZPG B;  1N9S A;  3MPU B;  1VIE A;  3OS0 A;  2LX7 A;  3I56 Q;  2D0Q B;  2ROT A;  2GGR A;  2JZ2 A;  1JEG A;  1O75 A;  5KE3 A;  1QVP A;  3VUB A;  2AIR B;  4M7A E;  1Q82 C;  4KUI A;  3A2Z A;  1R8O B;  1VQL Q;  4PJO D;  1MHN A;  2PQW A;  4C8Q B;  3DB4 A;  3CCL Q;  1VQ9 A;  2V8I A;  3I56 T;  2CZ7 B;  2EJ9 A;  4OMM A;  2DK3 A;  2FL7 A;  1D1B A;  1RI9 A;  2O9V A;  3EH2 A;  3M4G A;  4M7A C;  3H9N A;  2P4R A;  3OSS C;  2FRY A;  5KCO A;  1K73 R;  2D8H A;  1BI3 A;  3LH5 A;  1IRX A;  4M78 G;  2JW4 A;  1AVZ C;  4J6W A;  3ZL7 C;  1QVF P;  2NUP A;  1X2Q A;  4DBR A;  4VUB A;  1FXX A;  3P8D A;  1X6G A;  1PNJ A;  2HL3 A;  1OV3 A;  1PRL C;  4QQ6 A;  2DXC A;  2KT1 A;  1VQM Q;  2L0A A;  3A2Y A;  1JXO A;  2CKK A;  3VPI A;  1BCM A;  1UJ0 A;  2K6D A;  4EMK A;  4EQ8 A;  1KQ2 A;  2RQW A;  2QTX A;  1VQN T;  2HSE B;  2K2V A;  4LUE A;  1NYF A;  4BD3 A;  4PJO F;  1C0M A;  1S1N A;  1RI0 A;  2RQR A;  5GAN e;  2EBP A;  1GFC A;  2XD0 A;  5IHI A;  3EGU A;  4F4M A;  2C06 A;  1MNE A;  1W70 A;  2H3J A;  4C92 C;  2IG0 A;  4Z88 A;  1G2B A;  3EG1 A;  5KCH A;  3HTR A;  1NJI U;  2HSP A;  2D6F A;  4F17 A;  3SWN A;  1P92 A;  4PFO A;  3HP9 A;  4B6M A;  3CD6 A;  4ZTF A;  1YIT T;  2C0I A; 
#chains in the Genus database with same CATH homology
 1AWX A;  2KXD A;  4OMP A;  3UA7 A;  2EYX A;  2RQU A;  3NMZ C;  3VRY A;  2LNH B;  2KNB B;  3M0T A;  4JJC A;  2AK5 A;  1WLP B;  2EYW A;  1H92 A;  2SEM A;  3VS1 A;  1UHF A;  2KGT A;  3EHQ A;  2O2O A;  4F0W A;  2K2M A;  1X6B A;  3NE0 A;  1TUD A;  2SRC A;  4AG1 C;  4HVW A;  5ECA A;  1WXT A;  2KRS A;  1NM7 A;  1NEG A;  4JXB A;  1I1J A;  2KBT A;  2ED1 A;  2MCN A;  5IHN A;  4AFZ C;  1QLY A;  4CSH A;  1BK2 A;  1JO8 A;  1FYN A;  2DVJ A;  2DL3 A;  4OML A;  1UEC A;  1BBZ A;  4RTT A;  2JT4 A;  2A28 A;  1WI7 A;  2DX1 A;  4RTY A;  4Q4T A;  2OJ2 A;  2A37 A;  2X3W D;  2RQT A;  2VVK A;  3GBQ A;  1B3Q A;  1WIE A;  2IF6 A;  1K1Z A;  4FQA A;  1KSW A;  2BTT A;  2AKK A;  4FGD A;  4FGI A;  2IO8 A;  4GBQ A;  1M8M A;  4RTU A;  2EYY A;  2V1Q A;  2RN8 A;  1AZG B;  2DYB A;  1GRI A;  2CRE A;  1K76 A;  3REA B;  1CSK A;  1LCK A;  4F14 A;  2MOX A;  2L2P A;  2CUD A;  1H8K A;  3R6N A;  2IOB A;  4LE9 A;  2CSQ A;  4J9F A;  2YUO A;  5IH2 A;  3H0F A;  5HCK A;  1WFW A;  1Z9Q A;  4HVU A;  4AFU C;  2JXB A;  2ECZ A;  1ZUK A;  2W10 A;  4J9G A;  3I5S A;  2LZ6 B;  1XOV A;  4JJB A;  4OMN A;  1WXU A;  2KRO A;  1U3O A;  3QWX X;  4ZNX A;  2K3A A;  2OI3 A;  1ABO A;  2DL5 A;  2EGE A;  3I86 A;  3PBI A;  1GCP A;  2DA9 A;  1U5S A;  2O31 A;  3U23 A;  1AWO A;  1X27 A;  1KFZ A;  4ESR A;  1ZLM A;  1FMK A;  1SRM A;  1BU1 A;  1B07 A;  2LCS A;  4HXJ A;  2LJ0 A;  1TG0 A;  4EIK A;  1GFD A;  3EG2 A;  2IIM A;  3I9Q A;  1PRM C;  4J9B A;  4LUD A;  3VS0 A;  1J3T A;  1T0J A;  2AZV A;  3IQL A;  1YWP A;  1T0H A;  3JV3 A;  2J7I A;  2OAW A;  4JPB W;  4D8K A;  1CKA A;  3THK A;  2KYM A;  1GCQ A;  2XIV A;  1UJY A;  4J9E A;  1OEB A;  4IIO A;  2ENM A;  2A08 A;  2DBM A;  2DLP A;  3H0H A;  3RNJ A;  4JZ4 A;  3VS7 A;  2K7A A;  4CC2 A;  4FDY A;  1RLP C;  4J9H A;  4HCK A;  2EKH A;  3TVT A;  2L3P A;  3PBC A;  5FWB A;  4HZB A;  4JZ3 A;  4CC4 B;  1W6X A;  4DEX A;  2NUZ A;  1M30 A;  1NYG A;  1AWW A;  2J05 A;  2J6K A;  3NHN A;  3RBB B;  4LN2 A;  4OMO A;  1UE9 A;  4JJD A;  3VS2 A;  2PNI A;  5L23 A;  3C0C A;  1K9A A;  2J6F A;  1PKS A;  2EQI A;  2BZY A;  2CDT A;  3ULR B;  2JMA A;  1GBR A;  1AD5 A;  1T3S A;  2DJQ A;  1YNZ A;  1U06 A;  1OOT A;  2EGA A;  1MV0 B;  1UGV A;  1OPL A;  1EFN A;  4FGE A;  1NG2 A;  2FO0 A;  1M3A A;  1T3L A;  3KFV A;  3VS6 A;  2KRM A;  2LJ3 A;  1AEY A;  3M0P A;  2M51 A;  1N5Z A;  2EVR A;  4FQB A;  1X69 A;  1WA7 A;  1WYX A;  1HSQ A;  1ZUU A;  1H3H A;  2RQV A;  1UTI A;  2EGC A;  1Y0M A;  2DL4 A;  3H0I A;  4LJ1 A;  5GJW B;  4FSS A;  1ZX6 A;  2ROL A;  2KEA A;  3M0U A;  1E7O A;  2HDA A;  1VYV A;  1YWO A;  4KRT A;  1JXM A;  1ZBJ A;  4J9I A;  1UFF A;  3QWY A;  4QT7 A;  5FW9 A;  5I11 A;  4DEY A;  3H41 A;  2JS2 A;  2VPS A;  4CGK A;  3NGP A;  1BB9 A;  3S0Q A;  3VS5 A;  2YUP A;  2L3Q A;  2JM8 A;  2X3X D;  1ABQ A;  4IIM A;  2DRK A;  3GT2 A;  3PVQ A;  2GBQ A;  4CC7 A;  3EG0 A;  4Q4N A;  4Y92 A;  2J06 A;  2KRN A;  1RLQ C;  3I35 A;  1NLP C;  2M0Y A;  2H8H A;  1ZSG A;  1W1F A;  2K79 A;  2LJ1 A;  4EOB A;  2DNU A;  5EC7 A;  2RF0 A;  3A98 A;  4GLM A;  1VYU A;  3PVL A;  1X2K A;  2KT8 A;  2F2X A;  1RUW A;  2RMO A;  2LMJ A;  2IO9 A;  2D0N A;  2DF6 A;  2V1R A;  2DE0 X;  4E6R A;  4WCI A;  1OPK A;  2DMO A;  2NWM A;  2GTJ A;  1VA7 A;  4K11 A;  2IOA A;  2D8J A;  1QKX A;  1WXB A;  4R0K A;  4AG2 C;  1JQQ A;  1SSH A;  1PHT A;  2A36 A;  3EG3 A;  2VKN A;  2YUQ A;  1AZE A;  2EW3 A;  3O5Z A;  4RTW A;  5FWC A;  3UF4 A;  2D1X A;  3FJ5 A;  2DL8 A;  2QDL A;  1G83 A;  2B86 A;  3M0Q A;  1WDX A;  1IO6 A;  2FEI A;  2CT3 A;  2K9G A;  2G6F X;  4RTX A;  3SEM A;  1UG1 A;  2HEQ A;  2AZS A;  4Q4G X;  2GQI A;  2JTE A;  4D8D A;  1A0N B;  2VOB A;  4CC3 A;  1TUC A;  1VYT A;  4M4Z A;  2FPF A;  1E6H A;  4AFQ C;  1SHF A;  1GCQ C;  2O9S A;  1QCF A;  1K4U S;  2FG0 A;  3KW0 A;  2PZ1 A;  1K0X A;  4RTZ A;  1UDL A;  2CH4 A;  4AFS C;  2VWF A;  1ARK A;  3PE0 A;  2LQN A;  1UHC A;  2AKL A;  2PTK A;  1HD3 A;  3UA6 A;  4A63 B;  2IO7 A;  4HVV A;  1KIK A;  4EQA A;  2L3S A;  1V1C A;  2XMF A;  2BZ8 A;  4RUG A;  2FPD A;  2RNA A;  1UUE A;  2ESW A;  3M0R A;  5GJV B;  2E5K A;  2LQW A;  2RPN A;  1PWT A;  1M3C A;  2YSQ A;  1X43 A;  2FPE A;  1Z9Z A;  1QKW A;  3O98 A;  1SPK A;  1GBQ A;  4ORZ A;  1SEM A;  4OMQ A;  1E6G A;  4CT3 A;  2O88 A;  2DRM A;  1PKT A;  2DIL A;  5IXB A;  3I5R A;  2DL7 A;  1SHG A;  2LX7 A;  2ROT A;  1JEG A;  2GGR A;  5IXF A;  4LNP A;  1YN8 A;  2FRW A;  2ABL A;  2YUN A;  2JS0 A;  2EPD A;  2KXC A;  2HCK A;  1KJW A;  3VS3 A;  3A2Z A;  2VPM A;  1QWE A;  3REB B;  3UAT A;  1Y57 A;  1AOJ A;  1ZUY A;  4OMM A;  1WX6 A;  1NEB A;  2KYB A;  1K0S A;  4F0V A;  2CH4 W;  1RI9 A;  2O9V A;  3SHW A;  3TSW A;  2JMC A;  5IHK A;  3A30 A;  1M3B A;  2ED0 A;  1QWF A;  2YDL A;  2P4R A;  2FRY A;  2D8H A;  3LH5 A;  1HJD A;  2JW4 A;  3TSZ A;  1MV3 A;  1AVZ C;  2MIO A;  1YP5 A;  3ZL7 C;  1MUZ A;  1SRL A;  2KR3 A;  4F16 A;  3VRZ A;  1X2Q A;  1M27 C;  1I0C A;  1YCS B;  2J6O A;  1X6G A;  2W0Z A;  4RTV A;  2C0T A;  1PNJ A;  2F2W A;  4Z8A A;  1GL5 A;  1OV3 A;  1PRL C;  1NLO C;  2HBW A;  2I0N A;  4J9D A;  2KT1 A;  2L0A A;  3A2Y A;  1JXO A;  3VPI A;  4OLK A;  1UJ0 A;  2K6D A;  2F2V A;  4EQ8 A;  2RQW A;  4X1V A;  1AWJ A;  2CUB A;  2KE9 A;  4LUE A;  2DBK A;  1NYF A;  4Z89 A;  4HPE A;  2LP5 A;  1CKB A;  2YT6 A;  2C0O A;  3CQT A;  1S1N A;  2EYZ A;  2RQR A;  2EBP A;  1GFC A;  1JU5 C;  5IHI A;  3EGU A;  2GTO A;  4F4M A;  2LRJ A;  1W70 A;  3M1U A;  3VS4 A;  4Z88 A;  1G2B A;  3EG1 A;  2BZX A;  2HSP A;  4F17 A;  2K1G A;  2CSI A;  2JM9 A;  2DM1 A;  2K3B A;  3M0S A;  2GNC A;  3NPF A;  1I07 A;  3EHR A;  4J9C A;  5I22 A;  4HZ9 A;  3VPJ A;  2C0I A;  2CT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...