2EW8A

Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
247
structure length
229
Chain Sequence
QRLKDKLAVITGGANGIGRAIAERFAVEGADIAIADLVPAPEAEAAIRNLGRRVLTVKCDVSQPGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVNMLQAIPRLQVPLDLTGAAAFLASDDASFITGQTLAVDGGMVRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (S)-1-Phenylethanol dehydrogenase
publication title Crystal Structure and Enzyme kinetics of the (S)-Specific 1-Phenylethanol Dehydrogenase of the denitrifying bacterium Strain EbN1
pubmed doi rcsb
source organism Azoarcus sp. ebn1
molecule tags Transferase
total genus 81
structure length 229
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.311: (S)-1-phenylethanol dehydrogenase.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ew8A00
3B6ZA 4ND1A 2NUAA 4YT4A 3A1NA 1DAPA 4Z9XA 2AG8A 1U7TA 3S2IA 4D42A 3V2GA 1J4AA 1JTVA 3HWRA 5G0TA 3TZHA 4CMCA 1GV1A 5JE8A 4ZRNA 1GZ6A 1PJBA 1QV6A 1RM4A 3ABIA 4DQVA 3DBHA 4G2NA 1HWYA 2GASA 1LDNA 1IE3A 1K6JA 1W4ZA 2YFHA 2Y0EA 3NGXA 4NJOA 5DCYA 4E5KA 2DFVA 1UZNA 1YOVB 2GO1A 3KYCA 2E6UX 4CMBA 1NHWA 3GVCA 4CR8A 1N7GA 4AG3A 2PTGA 3NEPX 1WAMA 5KIAA 1RYDA 1ZEMA 3HDJA 4FW8A 2O7SA 4P8RA 4WEQA 3IUSA 5JCJA 2OHXA 1VL6A 4PRLA 3DQPA 1QYWA 4YRAA 4WLOA 3JQBA 3Q0EA 1FDTA 4A2CA 4FB5A 3FNHA 5F21A 3FNGA 1R0LA 4R4JA 2VTEA 5JYEA 4I8XA 2X9GA 1KEPA 4H15A 3AY6A 2Y1GA 3GVXA 5DOVA 3RBVA 1LA2A 1DC3A 4E3ZA 4LSWA 1FF9A 1PZFA 3PLRA 1MG5A 3RFXA 2YV3A 1UJMA 3QY9A 3WFJA 2EG9A 4CL8A 3EYWA 2Q3EA 3OM9A 4PG7A 2BGLA 2Q49A 3C3XA 2V6BA 3GVPA 4RVUA 3K9QO 4AJJA 2I9PA 2AHRA 4Z0HO 2PNFA 3N7UA 5I9MA 3ZWAA 4CQLA 4EEXA 3OIDA 4LCJA 3BMQA 4IDCA 4DMLA 1HDCA 3ZGYA 3MZ0A 4Z0PA 1TT5A 5EQFA 3IKVA 3K96A 4N5LA 5L9AA 3C24A 1HRDA 1P1RA 4XGKA 3PJGA 3FF4A 5KVVA 3LU1A 3QVTA 4K6FA 4RF2A 1V9LA 5TX7A 1O6ZA 5DT9A 4B3IA 1FDUA 4FIZA 4XIJA 2HO5A 5ER9A 1Y7TA 4CMKA 5JNLA 3RJ5A 3UCXA 1BMDA 1NWHA 3FI9A 5GY7A 3RROA 3I9NA 3MJEA 3ULKA 5IN4A 4I5DA 1JWAB 1TA4A 4WOJA 1DRWA 4XR4A 5JY1A 4RQTA 3F9IA 4GBJA 4MP8A 3WJ7A 4ALNA 3KEOA 1BHSA 3I52A 3RAJA 3EDMA 1JW9B 2W2KB 4ILKA 2X5KO 3PEFA 4IJVA 2FSSA 1LDBA 2P5UA 1MG0A 2HU2A 1PGNA 5BSGA 1XYGA 4IM7A 3QVOA 4XQ9A 4A0SA 1NPTO 1CQJA 1B14A 2HK9A 4IQ8A 4MVJH 1R4MB 2VOEA 1I3KA 1PGOA 3OBBA 3NTQA 1VSVA 3AUUA 7MDHA 4CMGA 3CH6A 4YJGA 3BMNB 2DKNA 3U4IA 1HETA 3DWFA 4EZBA 3PJEA 2DUUA 2O3QA 5GZ3A 3TDKA 4YBZA 1ZVMA 2GZ1A 2WD7A 5DP2A 4PLVA 4I5FA 4PZEA 1T24A 2YDYA 1HDOA 3RCBA 1A5ZA 4IPTA 1XG5A 2ZCVA 2PH5A 3LT1A 3L4BC 4K1LA 3WQRA 3ZI0A 4W82A 3S1LA 4E4YA 3VH2A 4E32A 4P22A 3WWYA 2NVUB 4J49A 5HTOA 3S2GA 2I99A 1I01A 1PS8A 1OFGA 1HL3A 4W9NC 3UKOA 4YRDA 4OOFA 1NASA 3KUXA 4TKLA 2DUWA 3WR5A 3EZYA 5IJZA 4JBGA 2FSVA 4WASA 5KKCA 1ZSNA 5LC1A 1NQOA 4AJ4A 4XRRA 1HYHA 3GH3A 5LCXA 4TWRA 4UUOA 4CODB 4O63O 4FBGA 1EUZA 1NVTA 2RHRA 3F4LA 3RUFA 1X14A 1M66A 3WGQA 4A26A 4BVAA 4XZ3A 4CMEA 2E37A 2JD2A 2ZYGA 4KUGA 5TS3A 4E2XA 3AW9A 9LDTA 4BKUA 4OXKA 1E6EA 4M54A 1KYQA 3SJUA 2B0JA 1A7AA 4IQGA 2Y0CA 3EHEA 2A92A 3AU9A 5CG2A 1NFRA 2GCGA 5JDCA 1CETA 4OKNA 4L4RA 4WECA 5T6BA 3ONDA 4J4BA 2HSDA 3FSRA 3SVTA 3OQ6A 1JA9A 4TRJA 1X1EA 1F06A 3ZWBA 2X8LA 3NT4A 4AJ2A 3ANMA 3PHJA 5ILGA 3DMTA 3MJSA 3E9QA 3MOGA 3H5NA 4GGOA 4EJMA 3PIIA 1LX6A 4OYRA 4QO7A 4RZHA 1PJ3A 2JHGA 3HHPA 2QRJA 1EQ2A 2EW8A 2Y67A 2UVDA 1T4BA 2GUGA 4KQWA 3VTZA 5AOVA 3IS3A 2P9GA 1YJ8A 4Q3DA 3WNQA 2GDZA 3ENKA 2YHIB 4FQ8A 2ET6A 4QUKA 4YAJA 2PKRA 4TROA 3VPXA 3C8MA 4KP7A 1GADO 3ZV5A 5MGBA 2QZZA 1X1TA 1XU7A 4J91A 4R3WA 2NTJA 4ND4A 3ADOA 4JCOA 4HUJA 1FJHA 5CEEA 3WIDA 2Q4EA 2V6GA 3JQ8A 4NR0A 3HADA 4A10A 5K6AC 4KDEA 5IF3A 2BI7A 4JQCA 1ZSVA 4LK3A 4J9UE 3U09A 1L7EA 5FYDA 3RWBA 4EUHA 1PR3A 1OC4A 3OJLA 4LISA 5TNXA 5IFLA 2AQIA 4O6VA 1PL6A 1C0IA 3JQFC 4J7CA 3ZWPA 4BMSA 4PLCA 4EYEA 3AM3A 3GNQA 4EUEA 2QZ9A 2IZ0A 3O03A 2YZ7A 1SAYA 1AGNA 1IPEA 3ZWVA 8LDHA 1R12A 5JPIA 3VOSA 4BNIA 2H63A 3BTSA 4RO0A 3WG9A 2O7QA 2ZTLA 3BMOA 5HS6A 1BDBA 4BO9A 4RPJA 4BB5A 1I36A 2PGDA 1Z75A 4P4NA 5KOIA 3BMCB 2X5JO 3WGTA 5A06A 1JKFA 3GK3A 4PIVA 1BGVA 3HN7A 4RQUA 1XCBA 3UHAA 4DRYA 4FFMA 1NQAO 2OZPA 3QA9A 3FTNA 4C4OA 4EI2A 3IP3A 1R4NB 1GUFA 2WEKA 2WE8A 1Q1NA 3UVEA 1A71A 4NK5A 4DYDA 4ZQFA 2Y1FA 3K73O 2EP5A 1UDBA 1VKOA 4IIVA 3RASA 3UGKA 4AJEA 2C5EA 4R01A 1M67A 3GR6A 3GRPA 4I9HA 2QRKA 2VWPA 1YO6A 3MTGA 1SOVA 1KBZA 1P1KA 3OEWA 3PGXA 5ADHA 4MVJG 1J5PA 3DHYA 3E8XA 1ZEJA 2W8ZA 3I9KA 3H7AA 2Q1SA 3E9MA 3QSGA 1ZZEA 3CPSA 4D3FA 3MWEB 4FOOA 5JDIC 3WBBA 5IZCA 3AOGA 1ZSYA 2Q2QA 1PIWA 3AI1A 2Q99A 1V0JA 1P33A 3L9XA 3GZNA 1X15A 3MTJA 4J1QA 3PQEA 3U4CA 2BMAA 1NNUA 5JAQA 2Q1WA 1DIHA 4MVJM 2VUTA 2IYOA 4TMFA 4DC1A 2FHSA 1Y81A 5CDSA 3JQ7A 4WJZA 1VC2A 2X0RA 1ZK2A 4HFNA 1P3DA 2GR9A 3TSCA 4AJNA 2Q50A 4OXNA 3ANNA 5B4UA 2QQ5A 3L07A 5DCUA 2C0CA 1Y8QA 1LBEA 1DIGA 2JFHA 3T4EA 4WCFA 5HM8A 3K31A 2Y93A 4OMUA 4FSHA 3FR7A 2X58A 4A03A 2FOIA 4IJUA 4FGSA 1M6HA 4B4UA 3PFFA 2CDCA 3GNTA 1ZK0A 4KQXA 2OORA 3PLNA 1IL0A 4MOWA 3AJRA 1QYVA 3F1LA 4PLZA 4NBRA 5KNLA 3NT5A 1E1KA 3TWOA 3GPDG 5ICMA 4YAKA 1K0UA 1JWBB 2FPPA 1A27A 3NV9A 3JCZA 1J49A 2WWRA 4MPDA 4J1TA 2POQX 3GDFA 4FS3A 4KUHA 2I67A 3DEYX 3V2HA 3H9JA 3B70A 1Z7BA 5EERA 4DBVO 3D4PA 1YDWA 4D43A 1YH3A 1SEVA 2D5AA 4RDIA 2WM3A 5KTKA 4BGVA 1P77A 3WSWA 4DWVA 3JQAD 1S6YA 1GEGA 1D1TA 2PZMA 2WYVA 5JLAA 1WW8A 4I9NA 4YT8A 3TZ6A 4IXWA 4DIBA 2RIRA 3OMLA 4HBGA 1PJTA 4ND3A 2VT2A 2HJSA 4GLOA 4FC7A 3QVWA 3HFGA 3WIEA 3GVHA 1P45A 3JQBC 5AVOA 2R2GA 1GU7A 5A3VA 3B20A 3FD8A 4BMVA 4YT2A 1EDOA 1E1LA 5H83A 1I0ZA 3GAZA 4Z0TA 4AJ1A 1KEWA 2PR2A 3GN2A 4DXHA 4JJFA 5COAA 1UXHA 3PPIA 2NQ8A 1ZK1A 1WDMA 3AM5A 4YAEA 3A4VA 3WOHA 2NVBA 3V1TC 1NFQA 4II3A 2X5OA 1ULSA 3PWSA 4NHEA 1UAGA 4CV1A 4DMMA 4XD2A 1V3TA 5JMPA 1NHGA 2ZK7A 1JVBA 1PZHA 3BHJA 3JQAA 4BOYA 5JY6A 4TKMA 5T8KA 5CDGA 1H2BA 5L4LA 1T2AA 3WDSA 4YR9A 2AXQA 3AOEA 4RPLA 1VI2A 3ZHYA 5A05A 1DO8A 2AE1A 2C7GA 2Q46A 4B7UA 1I33A 3LQFA 3NJ4A 4KOAA 4BNVA 3G1TA 2O2YA 1SB9A 4CM3A 2B5VA 1B26A 2W4QA 3ITKA 3GMSA 4OSPA 3KSDO 3VPSA 1U2DA 3RU9A 2CSUA 3VH1A 4NNJA 4LMRA 4L0QA 4ALIA 3ETGA 4IY1A 3HQ4O 1NVMB 4U0KA 1UZMA 4PVDA 2WMDA 3EAGA 1BG6A 4AJHA 2ZKLA 3E48A 4CLOA 1U3UA 2EJVA 1MC5A 2DM6A 3CZRA 5A03A 2IZZA 1H6DA 1DJNA 4FD3A 1B7GO 1MXFA 1RWBA 4H16A 3FWZA 1XU9A 3L77A 4L76A 4M8SA 5U4QA 1GD1O 3GFBA 2NU9A 1B15A 3RUIA 4WLNA 3WBFA 1LC3A 4F3YA 4RPHA 3GPIA 1YL6A 4LGVA 3GT0A 3KYDA 4YJFA 4WNCA 1NXQA 2EV9A 2Z1NA 3EW7A 3O8QA 3E18A 4XYMA 4RORA 1E7QA 5ICSA 3KB6A 2O50A 3QWIA 4IDEA 1I5RA 1OMOA 3GN1A 1AN9A 3K2EA 3D4OA 1GCUA 3KLMX 2J8ZA 4GH5A 2B5WA 1QRRA 3OIGA 2F00A 4JP3A 3ZWNA 4XQEA 1MUUA 3DOCA 2DT5A 3I1JA 5TGDA 1U7HA 2AA3A 3VH4A 4MIOA 4CLRB 1ZUD1 1M76A 4GX0A 1LRLA 1Y9AA 2TMGA 3F5SA 3GC6A 2D3TA 4CLXA 3A06A 4Y8VA 4BO7A 4NBVA 2ZTVA 3SLKA 3FN4A 4TVBA 1GL3A 1Q0QA 3JD1A 5DNAA 4P38A 3DB2A 1D7OA 2Y0DA 5HWSA 3H6KA 1LUAA 2PD4A 4J3FA 1DAOA 5J23A 3LYLA 2BRUA 1Q7GA 4GI2A 4BNGA 3FCOA 3PHHA 5JC8A 5G0WA 2Q2VA 1SPXA 4RF5A 2NU6A 4W99A 1TB4A 4L4SA 4XYEA 2VTDA 4HV4A 5DOZA 3WGHA 4MP6A 4A5OA 5IDQA 3JQCA 4LRTB 4AJIA 4Y98A 3OJ0A 2PK3A 4R1NA 1EFKA 3W4KA 4LW8A 2ZJ1A 2DFDA 3QVXA 4CM8A 1E7WA 4NU5A 3K92A 1WPQA 4PLGA 3I6QA 3VDQA 4W6ZA 4DLBA 2DAPA 3CE6A 1YQGA 2HCTA 1DIAA 4WLUA 3O26A 4E21A 4CM5A 4UULA 1WLYA 5H82A 3JV7A 2OXIA 4CV3A 5EINA 2G0TA 4MKXA 4CUKA 1W73A 2AQKA 4FFLA 4GQAA 1YBAA 4ZVVA 3F46A 2CVOA 4N5MA 3TQHA 4CMEC 1E1MA 2V6FA 5KJEA 5BNTA 4PZCA 1PGPA 1UP7A 4BGIA 5B4VA 1C1XB 3AI2A 1C14A 4PVCA 2Y1DA 4XB2A 4OOEA 5G0VA 1UP4A 4BL5A 3LVFO 5L3ZA 5AQ1A 2VNSA 4EJ6A 4CQMD 3RC2A 1QG6A 1ISIA 5JS6A 2VYVD 2YV2A 3FTPA 4MKZA 5JDCC 1VE9A 3DO5A 1O94A 3E1KA 4B7XA 1K5HA 3ZW9A 3L4SO 3JD2A 4ALLA 2GYYA 3SBOA 5TQVA 1U1IA 2CZCA 3DDNA 2X0IA 5JMWA 3RKRA 5TC4A 3TZCA 1NYTA 3BTUA 3U0BA 2FPGA 3O9ZA 3UF0A 1GPJA 4BNNA 1E3WA 2EERA 3DMTC 2C20A 2J5KA 1F8GA 2VHWA 2XF8A 3ZHXA 2RBEA 3UICA 1YWGO 4KTVE 3VPFA 2J3IA 5IZ4A 5B4TA 3BTVA 4YQYA 1Q7BA 2BFPA 1YRLA 3AK4A 5AYVA 3R0IA 2W98A 3JYNA 1K6XA 4AL4A 3ADPA 1ZBQA 2VN8A 2PV7A 1NP3A 3BZUA 1PGQA 2B4TO 2NSDA 3QQPA 4YDRA 4BNLA 2JCXA 2YJZA 3B1FA 3WSVA 1NTOA 2XXJA 1CERA 2UAGA 5BR7A 3QE3A 1GY8A 4D44A 1ENYA 1IY8A 1BXKA 5EIOA 4QTZA 1HF3A 1F8FA 4BO4A 3G0OA 4RL6A 1OOEA 3VPGA 2J3KA 1UXIA 1T4DA 4YJHA 1ENPA 3DBLA 3GUCA 4E2ZA 4UEJA 1DSSG 3H9GA 4CQMA 4JK3A 1I10A 5DBGA 2VYVA 2XXBA 4TVOA 2WDZA 3JYLA 3L6DA 1M6WA 5LDHA 1JKJA 5JBIA 3U5TA 5L40A 1ZKMA 2RAFA 4M89A 1SZJG 5I7SA 3NDRA 4D3SA 3D3WA 1BWSA 2VNAA 2DBQA 4MP3A 1LRKA 3OJOA 2RCYA 3KZVA 4Y6RA 1LDYA 4II2A 3BA1A 1LI4A 5G4LA 3SLGA 3W8DA 3PYMA 1GR0A 3BAZA 3HE3A 1BW9B 3DFUA 2QRLA 3KLPX 4Q9NA 4YXFA 1ISGA 4X54A 3SC4A 1XELA 5IDWA 1SEPA 3WYBA 1RM3A 2JCYA 3JYOA 1ML3A 4RGBA 4FJ0A 1UXGA 4FPXA 5A9TA 5BQFA 2ZB3A 1CF2O 3F47A 3ZWOA 4RDHA 5FWNA 1ZNQO 2FMUA 4WLEA 4F46A 3LLVA 4D79A 1NFFA 3RIHA 1FMCA 3GA0A 1MA0A 1Y8RB 4I08A 1PQUA 1A9YA 3A9WA 1XLTA 1JKIA 4YQZA 2HRBA 3QWAA 5BSHA 1Y5RA 2GN9A 4ITUA 3WQQA 1Z45A 4U6QA 2I3GA 4Q3AA 1BXGB 1JVSA 3DBRB 1U5CA 2X86A 3ENNA 5A5EA 3G17A 5L45A 4ZQEA 3H3JA 4HY3A 1DFGA 1IB6A 5ITVA 3QWHA 5CEJA 2DPHA 3RUDA 3S2FA 3KO8A 1HSZA 4MIYA 1LLQA 2LDBA 1G0OA 2GN6A 2I65A 3COSA 3H3FA 5KVCA 1VSUA 3ZV6A 3L6EA 5IZCC 1E5QA 1I3MA 1VM6A 4HADA 1GZ4A 3NDJA 4QXMA 3JQGA 3Q9NA 4YACA 2BKAA 3H2SA 3UN1A 1H0KA 4CM9D 2DTEA 1YL5A 3SJ7A 3IDSA 4CLEA 3TN7A 5F5NA 1E7YA 1MX3A 3WJAA 3DZKA 3ROMA 4UVEA 2PH3A 3OICA 1ADCA 3LDHA 5COBA 4TZKA 2H6EA 2UUOA 1Y5MA 1EK6A 5L4NA 1BVUA 1KEVA 1V3VA 2RH8A 3AFNA 3GEGA 1LSSA 4OQZA 1PJCA 4GGPA 4MJLA 4JIGA 3K5PA 3G79A 5IXSA 1U3WA 3SXPA 3CINA 4Q3CA 1I2BA 1Y8QB 2GLXA 2VRCA 1B0AA 4BMNA 1QLJA 2B83A 4R1TA 4WCFC 3T7EA 4XRGA 2CF5A 3LT2A 1I2CA 4B4VA 4BKPA 4E31A 4WLFA 1HEUA 1I32A 2B36A 4XX0A 1KVRA 4NDNE 1SC6A 3DXFA 1RM0A 3QW2A 4I1IA 3DZHA 1DJQA 4L9RA 1UP6A 3INRA 5HRUA 3WGIA 2OBYA 3CIFA 5DULA 1PL7A 1E6WA 1KVUA 1U4OA 4FFOA 4LSMA 2PD6A 5B1YA 4BQRA 5U1PA 1F14A 1AXGA 2BD0A 4CM9A 3JTMA 2G76A 4EEZA 2BF7A 5GMOA 3IP1A 4K9DA 1ZW1A 2JKVA 4PGFA 2AEFA 1A9ZA 4F45A 4R9SA 4WLVA 4N54A 4XGIA 2XOXA 1YBVA 2VUUA 4N5NA 2DTXA 4WCDA 3RC7A 1HE5A 2VUSA 2W90A 3STHA 3ZH2A 4BIIA 3WYEA 3I6IA 2JHFA 2R00A 1N9GB 3TF5A 3FR8A 5EQDA 1GQQA 1R66A 4D0SA 3FWNA 1YB5A 3AY7A 3M2PA 2DBZA 4IXTA 2IZ1A 3IOYA 3KM0A 1ISHA 2HJRA 4BKOA 5CDTA 2YV1A 4KDFA 4KTTE 4ZA2A 1XDWA 1Z7EA 1U5AA 4HKTA 1EE9A 2X9VA 4FFNA 1YKFA 2DQ4A 2X4GA 4UEKA 2JD0A 3LC7O 4EGFA 3GGGA 1E3EA 5JO0A 4NBWA 2CDBA 4E5NA 1VJ1A 1RM5A 1LSOA 1VL8A 1X7GA 5C7OO 4R1SA 1N7HA 1GFSA 4GKBA 3GGPA 2DC1A 4TRMA 1PR9A 8ADHA 4CMIB 4UEOA 2E48A 4BNXA 9LDBA 5IAAA 5ENDA 4WE3A 3NTRA 4EJ0A 2G82A 3WB9A 2DBVO 3OF2A 4TSKA 1BTOA 4YTEA 4E33A 4EW6A 1DRVA 5JYDA 4DTIA 5T8KC 2I76A 5A9SB 3SEFA 4IDGA 1KERA 1N8KA 2CMDA 4R54A 3V1YA 5KJFA 3A14A 1DPGA 4EDFA 1B8PA 4J4TA 2O3TA 1ISFA 3AOEC 5A4DA 3K2BA 1E7SA 3ONFA 1AE1A 2EJWA 2GD1O 3UOGA 4DYVA 4ZD6A 3TFOA 1B16A 4J0FA 1C0PA 3OA2A 1DRUA 1ONNA 3D3EA 3PXXA 3ASUA 3PRJA 1NPDA 4QO8A 2YHUA 2WD8A 3AM4A 4ZU3A 5CP8A 3ICCA 3NRCA 3ZWMA 1ENZA 2UDPA 5G0SA 1NAHA 1WP4A 4L4XA 4CLOB 2NTVA 4ID9A 4R16A 3GLQA 2IE0A 1YONA 2YFQA 4D3DA 4DQXA 3ZN2A 2O3RA 2FN7A 3R3JA 4M49A 4PG8A 4O5OA 4Z6KA 1CIVA 1DHRA 5DCWA 5THQA 4RLHA 5TF4A 2GZ3A 1JAYA 1QYXA 1XHLA 4TRNA 2QYSA 4XKJA 4BO5A 2B69A 1T2DA 4FR5A 5T67A 1JAXA 3IMFA 5G4KA 3V5NA 4AICA 2BLLA 3SC6A 3VC7A 1CWUA 2D4AA 4E30A 3DZIA 2GERA 5I9LA 2PGLA 1I3NA 1PJ2A 4S1VA 1XQ6A 2Y99A 3MJVA 1WZIA 1H6AA 5G2OA 1JLLA 1ZIDA 4IQ0A 3NKLA 3I5MA 4F6CA 1HDZA 4E13A 3U4DA 1E92A 2FR0A 1HDRA 4JN6B 4F6LA 1T1RA 1E6UA 1PWZA 2GZ2A 4UAGA 2HQ1A 4R51A 4GX5A 1YQDA 3OH8A 2YDXA 3HNPA 1B2LA 3GZ4A 4ZICA 1VRWA 4A73A 3IJRA 3FNFA 4U5QA 3D5QA 6ADHA 1PJQA 3KSZO 1PJSA 4GVXA 1MFPA 2ZQYA 1DB3A 1N2SA 1NVGA 1LJ8A 2ZB4A 4OH1A 4IJKA 4J43A 4CR6A 4BNKA 5H81A 5FEUA 3H5AA 2XAAA 3F5QA 2EIHA 2W2KA 1JU9A 3I3OA 4ZQHA 1KVQA 3R1IA 5BNFA 4Z9FA 2I6TA 3IIEA 4WGGA 3FRJA 2GF2A 4CR7A 3N74A 3K6JA 4B8WA 3LT4A 1JQBA 1I3LA 4WUVA 1DLIA 4FJ2A 1YQXA 3MEQA 3M2TA 4AJOA 3PDUA 3PJFA 2VZ8A 1VJTA 2AEJA 3F1KA 4J90A 4ALJA 1D8AA 1PWXA 3E03A 1XSEA 1HYEA 1R4MA 3KSUA 3C7AA 4NFHA 3HDYA 1Q2XA 4G5HA 5TSDA 4UVIA 1MGOA 3GGOA 1ONPA 5CAEA 3BMNA 3AWDA 5A3JA 1ZO8A 2VWHA 1VPDA 4CM4A 4BNYA 2NU8A 3AI3A 4IMRA 3GNSA 3KTDA 2J5QA 1VJ0A 5EPOA 3KV3O 3LZ6A 1HE4A 2Y68A 3ZWWA 4DC0A 7ADHA 3PQFA 5L51A 1N1GA 5B12A 3LF1A 1WWKA 4R69A 3I9MA 3HJAA 2X7HA 5T5QA 1QP8A 4BNUA 4E6PA 4BO0A 1PJLA 3OEYA 5IDXA 1SOWA 4K26A 2J6IA 1H6BA 2EF1A 1AHHA 4DPKA 2AQHA 3U9LA 3W8EA 1T1SA 3DBHB 2FPIA 1T2CA 4Y6SA 4BUCA 2V7PA 1ULUA 3IJPA 4NI5A 5KWEA 3MOIA 2VCYA 2E49A 1O9BA 2QIOA 2HUNA 3JQEA 3E5RA 3KYCB 4FDAA 1QLHA 3WGOA 4FN4A 3AUAA 4ONEA 5A1TA 5F1OA 3PK0A 4XB1A 3T4XA 5DN9A 4IZIA 3R6DA 3GMDA 4BO8A 2F1KA 3EUWA 5FFFA 3DBLB 3L0DA 3Q2KA 4YEDA 4BHTA 4JJIA 3ZNNA 1HLPA 2VZ9A 3ZCXA 3B1JA 3DC2A 4K28A 5KJCA 4GPD1 1W6UA 3F3SA 4B79A 2D0IA 4CMHA 1DFIA 5JAIA 3BIOA 1U3TA 3D4NA 1IHXA 4RF3A 4RVFA 5IN5A 4ZQBA 2NTNA 3D3WB 5ES3A 4FJ1A 4BV9A 4DLAA 5GZ6A 1EFLA 1RKXA 1TT7A 1R0SA 4IDDA 2AW5A 1YS4A 1B3BA 3C7DB 1LQUA 5COQA 1F17A 2IXAA 3OA0A 3OQBA 5L7WA 4NFYA 2QX7A 4YWJA 3BYZA 1A4IA 5I8WA 4CQLB 2J3JA 4J16A 1LLCA 3VTFA 3GG2A 3BMQB 4B8ZA 2NQTA 3JSAA 1K3TA 3ZNQA 1TT5B 3DOJA 2FR8A 2ZTMA 3DHNA 3ZWXA 1O8CA 1EK5A 2PKQP 1HDGO 3W4IA 1P0FA 5HS4A 3AFMA 4QEDA 3AU8A 3KRTA 1E0DA 5T64A 4BNHA 3VZPA 1Y9EA 2X0JA 4HP8A 2YHIA 1ZJZA 3UW3A 3TZQA 4PLPA 2H5LA 4AJKA 2AQ8A 3OFSA 2NVWA 3H9QA 1XQ1A 4FOSA 1DXYA 3OSUA 1O5IA 3MCVA 4RVHA 4CMJA 1DDOA 3ZU4A 4BO3A 4DLLA 4B4OA 3CSDA 5IXYA 1Q0LA 4PG4A 3VZQA 3IQDB 1PX0A 2WTBA 1XR3A 1W8DA 1DFHA 2X23A 2D5CA 2HMUA 3H2ZA 5A5FA 3I9OA 3EK2A 3QVSA 4XDZA 4EBFA 5L53A 4E0BA 2PWZA 4NMHA 1A4UA 2ZJ0A 2GPTA 3G1UA 5JFOA 3N58A 1T2FA 3DZJA 4DGSA 5CHEA 4J1NA 3QJ5A 3RUCA 2JJYA 4GSLA 3GOHA 4BNZA 4MVJF 1H93A 1HE2A 1GUYA 1GEEA 4N18A 4J6FA 4DPLA 1O95A 5T57A 1U4SA 3GG9A 1QXSA 1IZ0A 1YXMA 5HBRA 5DBFA 4JLWA 2QW8A 1VL0A 1PSDA 4YJGB 1PS0A 5AXBA 3CTMA 1IOLA 1GQYA 2A35A 3GY0A 1KVTA 4OGWA 4WNIA 3OP4A 5A02A 1B8UA 2C54A 2ZCUA 2FWMX 1YBMA 4AVYA 2WD7B 2Q2WA 1BXZA 2FP4A 3RFVA 1ZMTA 3ZNOA 2C07A 1IULA 2FRDA 1R4NA 2JCVA 1CRWG 3RVDA 1GTMA 4KUEA 4NG5A 2DBRA 3BHIA 4YAGA 5CEFA 3PIDA 4BV8A 5C5IA 3QIVA 2IXBA 4CM7A 2PZLA 3EMKA 1R37A 4CL3A 3I83A 4KZPA 2TMDA 1LDEA 4PLYA 3RUEA 4UUMA 5F1KA 1VLLA 4R9RA 2VYNA 1G1AA 2E4AA 3CXRA 4HNHA 2GRAA 4OSOA 1Z6ZA 1E77A 1NAIA 4OHUA 3PFWO 2Q4BA 3TL2A 2JD1A 1HDYA 1JDJA 1R15A 3VZRA 4WKGA 3GF4A 1DC4A 3UFXA 6LDHA 3VAZA 3DTTA 3A28A 3OJEA 4BNFA 4JROA 3EVTA 4MKRA 2J5RA 5CDUA 3IKTA 3S2EA 3LSYA 3ZHBA 1J6UA 3DOOA 2HLPA 3WXBA 1GDHA 1MB4A 1ZK4A 3ZNPA 4CPDA 3P2OA 4NJMA 1OC2A 3PZBA 1T25A 2E82A 5CPBA 3HZZA 3ZWCA 1P9LA 4NBTA 5I7FA 3WICA 3PHGA 1L1FA 3GQVA 3X2FA 2R00C 4GL4A 2ILTA 1D1SA 2AG5A 1UR5A 5U9CA 1LNQA 3DAGA 2JL1A 1OI7A 5C7LO 5L4SA 1QORA 2IDZA 4QQRA 1V8BA 3WQSB 4B7CA 4ND5A 4E5MA 2OMEA 3IL2A 3HB5X 1G0NA 4YB8A 3E9NA 2PGJA 4XWYA 1P1JA 2IODA 4Q3NA 2OP0A 5TT1A 4FC6A 1XA0A 2B4RO 1H9AA 1E1NA 2Y05A 2ZYDA 3WMWA 4WPGA 4PFJA 2RH4A 3MJTA 3OHSX 1DLJA 1LDGA 1SCUA 4CMAA 4BO2A 1A72A 1HE3A 4WK6A 3TJRA 4H3VA 4LCEA 1TEHA 4GKVA 2DPGA 1GPDG 2Q45A 1TXGA 3CZMA 3PTZA 5BNIA 3DBVO 3VKUA 3QP9A 3AY3A 2GNAA 3DR3A 3P19A 4XA8A 3P7MA 3NAQA 3WX0A 3KBOA 1NWCA 2OL4A 3GFGA 1AUPA 4UUNA 2QYTA 1FDSA 1UDCA 2IYPA 1SBYA 4Y9DA 2CVZA 5JC1A 2PD3A 2BGMA 2D2IA 5IDYA 1WXDA 3JQ8B 2A9FA 3I23A 1I30A 1WVGA 3JYPA 3RJ9A 3Q11A 1GZ3A 4PLWA 1MV8A 4RV9A 4HX5A 2DLDA 3DZBA 3C1TA 3PHLA 3TZKA 2WYWA 4AJLA 3NJ8A 5JAZA 1NQTA 3H9EO 4LMPA 4I5GA 5TT0A 1N1EA 2YQ4A 3DFZA 1E3IA 4RLSA 2BI8A 3KVOA 3RUHA 3WLFA 4J2HA 5K0ZA 4LRSB 2NLOA 3RU7A 3ZDFA 3CMCO 4IMPA 3BMOB 4UVDA 1TLTA 3D1LA 1KS9A 4DA9A 2NNLD 4R5HA 5L95A 1N92A 1EVJA 1I2ZA 2EW2A 3FPLA 4UREA 4XYGA 5G4KB 2Y1OA 5G0UA 5TJ9A 3VPHA 4JGBA 4RPKA 4NH4A 1C1DA 2HK7A 3OIFA 4M55A 3JD0A 3W4JA 1YDEA 4AFNA 2VHYA 4D0RA 4DIFA 2EKPA 2ZB7A 5L7YA 1UXJA 1Z82A 2OUIA 3GRKA 3L6OO 3GAFA 3JYQA 2SCUA 1YJQA 3IAHA 4GWKA 2HMSA 2PFGA 2WYUA 5KVSA 4IBOA 5I7VA 1QV7A 5IG2A 2NM0A 3WGYA 2ZB8A 2B4QA 1XEAA 4ZGWA 3UH1A 1WMAA 1KY5A 1LQTA 4MVJE 2OO5A 5ER6A 1S7CA 5I8ZA 4XIYA 1PZGA 2VRCD 3PI7A 3FPCA 2VWQA 2PKQO 2BFMA 2FR1A 4NK4A 4NQZA 1U28A 3F6YA 3L9WA 5ITWA 1HYGA 3GDGA 1RPNA 5C7IO 2VQ3A 1E7RA 3TFQA 4FGWA 3O4RA 4S3MA 4XYBA 1Y6JA 2D59A 3EVNA 2UUPA 2O23A 2C5AA 4XQCA 2CDAA 2O4UX 5TJHA 1NBOA 2X9NA 2NACA 1ISJA 4PZDA 3GZNB 3ITDA 4MO2A 4Y67A 4OIMA 3UAGA 3ZW8A 5GZ1A 1H2HA 4L73A 4XJTA 2GN8A 3PVZA 1MP0A 3JQ9A 4B3HA 1UZLA 3EZLA 2FZWA 4MINA 5JCXA 2VOJA 4RF4A 3WYCA 2VHVA 3JQ7B 3P5SA 4PLFA 1DIRA 3ROKA 1TI7A 1LLUA 2GN4A 2BHLA 1GUZA 2O2SA 4XGNA 1NR1A 4MDHA 3ORFA 4ALMA 4JX8A 3CEAA 1ADBA 4YT5A 4IDAA 1P1FA 3DZGA 1AXEA 1DHTA 3INGA 4CLRA 1HXHA 2VHXA 2G17A 1TVEA 2WJPA 1FK8A 3JD3A 4WCFB 2EGGA 4PN3A 4DIOA 4TRRA 3RFTA 4RJTA 4XJSA 4CM4B 4GMFA 5JAMA 3GHHA 1QSGA 3TOZA 3VKVA 1O89A 4IS3A 2PZJA 3TRIA 3ZU3A 5FI5A 2EP7A 3NTOA 1GYQA 2DVMA 3EGOA 1X0XA 3GEMA 5HA5A 2WE7A 4E2WA 4N7RA 1UAYA 4XDYA 3IC5A 3M1LA 1R0KA 3ETDA 2O3JA 3CUKA 4HFMA 3KYBA 2C82A 3M1AA 3MWDB 1KVSA 1HTBA 1LDMA 4GWGA 2LDXA 1ID1A 4AJPA 1P74A 1T2EA 3VVCA 1DC6A 3E82A 3ZU5A 2O3SA 2JAHA 5CDYA 3DAFA 4J7UA 4L74A 3KOUA 2C29D 2HDHA 4M1QA 1E3SA 3WTCA 4DL9A 3LT0A 3HN2A 3RD5A 5LDGA 4I5EA 5AXAA 2OBNA 1ENOA 2VHZA 1LC0A 2X6TA 4IINA 3E5MA 1E3LA 1KIFA 1N5DA 4XEHA 5EJ2A 1LSUA 3VDRA 3RSHA 3LC1O 3JD4A 3ON5A 5EN4A 1SNYA 3S8MA 1YVEI 5A9RA 2OOSA 4E5YA 1A7KA 3NX4A 1SO8A 1OZAA 3P2YA 4QFDA 1C1XA 3WFIA 2JFFA 5DDIP 4BB6A 3OETA 1PQPA 4IS2A 1GCOA 1WDLA 1C0KA 2PLAA 3EC7A 5KJ1A 1ZK3A 1BVRA 1GAEO 1VKNA 3PQDA 4BO1A 2C2XA 3LK7A 1C3VA 4G65A 2I3AA 3PWKA 4J1SA 2RHCA 5FF9A 3UCEA 3U4HA 5CFZA 1CJCA 2P9EA 4PCVA 4GLLA 3JQAB 3DTYA 3LLSA 5THKA 3I9LA 2Y1EA 4QT0A 1LLDA 1E3JA 2QHXA 4BS9A 1W0CA 3S55A 4J7XA 5BSFA 1P1IA 4I9UA 3U3XA 3RKUA 3K30A 4H7PA 4MIEA 1IHYA 3K8ZA 1KC3A 2H9IA 2CFCA 4RPGA 4Z9YA 4DUPA 4EITA 1YOVA 3FNEA 3HUDA 2O48X 5I7EA 2EHDA 4IZHA 2C59A 4ZRMA 1U2GA 3VVBA 1BRMA 1CDOA 2EWMA 3E6AA 3PHIA 2NV6A 3U49A 2UV8A 1QR6A 4QSMA 4RCVA 3UXYA 4C7KA 2HMWA 2I66A 1H5QA 3ZZNA 1EUCA 2I5PO 1PZEA 3DONA 3LF2A 4XQGA 4P4LA 3V8BA 2Z95A 3SX2A 2CY0A 3WLEA 1T26A 4MVJD 3RBZA 1V35A 3C85A 3OJFA 1BSVA 2C2YA 2DTDA 2WSBA 1KC1A 3TOXA 4G81A 4OM8A 3D64A 1ZJYA 3PZRA 3UUWA 1IYZA 1PS9A 3W1VA 1LU9A 1LXCA 1YB4A 4CJXA 1FXSA 3KYDB 2NADA 2X22A 4YJFB 1WMBA 4CLHA 4NIMA 4IDFA 3QWFA 4DREA 3O8QB 1KOLA 5DZSA 2PZKA 3WS7A 1DBVO 3KEQA 4M87A 1EQUA 3ZV3A 4DBZA 3QV1A 4PRKA 2H1SA 2P2SA 3I9JA 4W7HA 1C0LA 4EUFA 2D8AA 3DAPA 4M86A 3GUYA 1EE2A 1YL7A 5JW6A 1MC4A 4OL9A 1DC5A 1MXHA 5DF1A 1XIVA 3JQ6A 4HFRA 4PLHA 3VZSA 4XYLA 3H5RA 1BW9A 1PTJA 5FI3A 3O38A 4O59O 3ZWYA 4OAQA 3INTA 3T7CA 3ZHZA 1NQ5A 4YCAA 2Q1TA 4URFA 2HAEA 3RC1A 1P31A 2UYYA 1Q7CA 4MVJA 1UH5A 4YPOA 3QWBA 4IDBA 5C3MA 1Y8RA 4C7JA 4OJNA 4TQGA 4OXYA 1Z74A 2OGUA 4Q3EA 4ZHSA 1EEHA 3DL2A 4DPMA 1ZMOA 3WMXA 1UUFA 4R5MA 1X13A 4FCCA 3W6UA 2IRWA 1RJWA 1U9JA 1BXGA 2P91A 3DBRA 1F12A 1ORRA 1WNTA 1UXKA 3ZV4A 4BNTA 4YRBA 5C37A 1WZEA 3WWZA 3V1UA 2EGHA 1QKIA 3HSKA 4CM8B 2YYYA 2Z1MA 4U7WA 3ASVA 1QMGA 4GX1A 4JXKA 1L7DA 3DHEA 3HG7A 5JSFA 3I4FA 1ISMA 4J0EA 5F3RA 4YJDA 4JP2A 5KCZA 4Q39A 3FBTA 1PEDA 3G49A 2BGKA 1CQIA 2AE2A 1P0CA 1YGYA 4NJMB 1NX6A 3RUAA 3Q9UA 2ZYAA 1U8FO 2FY8A 2HRZA 4D46A 1BDMA 1R6DA 3ROPA 1Q0HA 2G1UA 1X7DA 4PG5A 4PLTA 2O4CA 2EEZA 2Y1CA 1XGKA 1ZH8A 2Y66A 3VH3A 1ONOA 1EMDA 1HZJA 4OO3A 2A4KA 4CUZA 2VZ0A 1M75A 3HDQA 1H9BA 1NR7A 2ZQZA 2PY6A 1H6CA 2XPCA 3H8VA 3ONEA 4RVDA 4DQUA 1GV0A 3GDOA 2C7VA 1PU2A 3HDHA 3L4BA 3X2EA 2BH9A 3WNVA 5MDHA 1EUDA 1SMKA 1E3WB 1LTHR 5B37A 2YY7A 2NVUA 3DZFA 4BNJA 4NZ9A 3WTBA 1Z73A 5JXWA 4W9NA 2AEMA 1RYEA 1KEUA 5JCJD 4BNWA 1LRJA 2JAPA 1E7MA 4U8GA 5TRTA 1HT0A 1V6AA 4CUJA 4UVGA 4LN1A 1Y1PA 4RVGA 5ILOA 1OBFO 4IGEA 5KVQA 5AXDA 4YYZA 1HDXA 2G5CA 3B1KA 3Q3CA 1AHIA 4KWIA 4YJHB 3HB4X 1X0VA 1I24A 4CV2A 4LVUA 3I4CA 1I8TA 4CQMB 2P5YA 4YAIA 2EKQA 4PG6A 1DOHA 4GAEA 1H94A 4GSKA 2OP1A 1NM5A 2VWGA 2AMFA 4WEOA 4U6SA 3GEDA 4INAA 1N9GA 1OAAA 1HKUA 2FZEA 1KY4A 4IJWA 4B4WA 1ADFA 3PWZA 3PGJA 3AUTA 4ZJUA 1LEHA 4RZIA 2W2LD 1J0XO 4OKIA 1K6IA 4HFJA 1CYDA 1ZXBA 3HFSA 4BNMA 4CM1A 3C7CB 1PL8A 4OQYA 5EL0A 4P4GA 4HXYA 1IZ9A 1EBUA 4NBUA 4KMSA 4GMGA 4ROSA 4BQPA 4D45A 2X1HA 3Q6IA 4CLDA 1B3RA 3D0OA 3EY4A 2VRBA 3D7LA 3CMMA 4Q3BA 3G3EA 3WGZA 1ARZA 3KXDA 3FHLA 4IUYA 1FDWA 3C1AA 4CMIA 2YQ5A 1E5LA 2YW9A 2EKLA 4D7AA 4U0JA 3OQ1A 4A7PA 1C1DB 2YUTA 4XCVA 1XWFA 4GX2A 5ENVA 5A9SA 4CV0A 5AXCA 1G6KA 2DU8A 3CKYA 4YVFA 4ND2A 3NGLA 2BFAA 1EVYA 3ETEA 4QFCA 5F5LA 2X0NA 4BGUA 4NFSA 1XKQA 2HKIA 2GSDA 2NWQA 3MJ4A 3TNLA 4BKQA 3ICPA 5EMHA 4A27A 4ZQGA 3Q1LA 3FBGA 4MVJP 3NUGA 1PQWA 4Y6PA 1HLDA 4TZTA 3UCFA 1HSOA 4R1UA 4CM6A 4E2YA 1EVIA 3TL3A 2CVQA 5K6AA 1WDKA 1QYCA 3LC2O 5DBIA 2HK8A 3ST7A 4JBHA 5KKAA 2W2LA 4Z3DA 1R16A 1NPYA 3QLJA 4O0LA 3GVIA 1LSJA 4MVJI 1X7HA 1KETA 2P4QA 4J9VA 4QX6A 2V65A 1GYRA 3RBXA 3JQDA 3JQFA 2VYND 4J4HA 2IEBA 3F4BA 4K6CA 1YE3A 4O1MA 4HNGA 1D4FA 1EDZA 1IUKA 3H65A 3RC9A 1EZ4A 3QHAA 4R41A 1DEHA 1UDAA 3DMYA 3JQGB 3RI3A 4D41A 5BT9A 2D1YA 2ZTUA 4JJGA 5F1PA 1ZXLA 1SB8A 4XR9A 5EESA 2BELA 5CPFA 2VT3A 2ZATA 5L7TA 2ZIZA 1JN0A 2CF6A 3BMCA 3W6ZA 1EVZA 3JQ9C 1HZZA 2R6JA 2PA3A 1B8VA 2B35A 2JFGA 3TPCA 4ALKA 1ZFNA 3H4VA 3ROQA 3V2UA 4L75A 1YB1A 3RQSA 2BFOA 5TLSA 4BGEA 1P44A 2Q1UA 3BTOA 2GGSA 4W7IA 3ANLA 4Z3KA 3R3SA 2OFPA 5A04A 4NU6A 2IEDA 2CNBA 4QECA 5JO9A 1U8XX 2P68A 4BKRA 1GYPA 1D3AA 4FFPA 4JBIA 1EBFA 2QG4A 1PGJA 1U3VA 1V3UA 2P4HX 4E5PA 5TIIA 2J3HA 3NT2A 3W8FA 3AUSA 4IIUA 1CEQA 4HWKA 1FDVA 5JDIA 2Z5LA 4UVHA 4ESOA 5K9ZA 2B37A 3PJDA 4B3JA 3OECA 1QYDA 3MJCA 5I9NA 3KHUA 3PP8A 4FFRA 3IUPA 3NDIA 4R68A 5CG1A 1MFZA 4LVCA 1ZCJA 1K89A 2EXXA 3PYXA 5KJ6A 2HMVA 2V6MA 4J2OA 5DP1A 2HMTA 4DVJA 3BHMA 5BSEA 4GVLA 2CD9A 3M6IA 4UUPA 3H9UA 3KETA 4JNKA 1M2WA 3D5TA 3NYWA 1ADGA 1F0YA 4NPCA 4E12A 4BO6A 4YA6A 1GQ2A 4KWHA 3ZU2A 1IPFA 3PYLA 3WGGA 2O3UA 3PDJA 1PJ4A 1DIBA 1K2WA 4ZN6A 3Q2IA 4WOKA 2NU7A 1P1HA 3VHRA 4R3NA 1MLDA 2CUKA 4W4TA 2A94A 3GHYA 3BXXA 2P9CA 3C1OA 1O0SA 4L8VA 4RVSA 4IGFA 3QRWA 3U62A
chains in the Genus database with same CATH superfamily
2JB9A 3SZUA 2W6JD 2PUCA 4MW5A 2ZJAA 3HRKA 3RPEA 3RVRA 1U7TA 5LYJF 4UU8A 2F55A 4LC0A 2F7SA 3S7TA 3ZK7A 1LK5A 3TZHA 2R87A 1GV1A 2X76A 2IDKA 5JE8A 2BMDA 4E09A 4NX2A 3C6KA 1GZ6A 5F35A 4GVPA 3V32A 5K8IA 1QV6A 4QNRA 4NONA 4YP0A 5LZ7A 3DBHA 4DQVA 4Q05A 4R9VA 4R9UC 4WWHA 2FEMA 4KQEA 4YWHA 1HO3A 2C9ZA 5LQJA 1SOUA 1LTKA 1M7GA 2E6UX 5SZKB 5DYYA 4CR8A 1AQYA 2PTGA 2PQ2A 3X1KA 3NEPX 4PPYA 4US0R 1WAMA 4HEJA 1YS2X 5AI9A 3QXXA 3HDJA 3LLCA 4FW8A 3GH1A 3X1WA 6Q21A 3UPTA 2NP7A 1BWPA 3IUSA 1VL6A 4PRLA 4RJKA 4LDJA 4XGQA 3QEJA 5JEDA 4WLOA 2ZZMA 4Z4FA 1XDGA 5BNWA 5K8UA 1FDTA 3PG5A 5B3KA 4M53A 5BWNA 5E6UB 4R0MA 4PANA 3ZQ6A 1OH8A 1OJ7A 1NC3A 2INGX 3FNHA 3GFFA 1JGTA 2VTBB 3DUFB 4QU9A 1B4DA 3D6MA 2VTEA 5JYEA 1BX3A 4ZP1A 5LXTB 2GEJA 2VUIB 1GPWB 4HN4B 4H15A 5JXJA 2YWDA 3AY6A 4MV5A 5DOVA 1QIFA 3BKXA 1LA2A 4LF5B 3E70C 3K1YA 4HF7A 1FF9A 2WT8A 4OI2A 1H2ZA 3B6KA 2BFDA 4TXHA 4A6DA 2YV3A 1UJMA 3O92A 4C0LA 3A9SA 4BFVA 5JNRA 2OLKA 3BSFA 1KH3A 3E22B 5CJJA 4CL8A 3GLRA 2I8LA 3MWKA 3DA8A 3NHAA 2FZ4A 1JQJC 5FWAA 3OQJA 3ND8A 4RM2A 2V6BA 3OQPA 3QPBA 4RVUA 5AKJA 4CG0A 3IP8A 4HLQB 1CDDA 4DG5A 3N5KA 4AQ7A 3NHUA 3UJDA 1MH1A 2PNFA 1UM8A 1CU1A 5I9MA 2IEZA 4CQLA 2WIFA 4JLKA 1ZM3A 4ZYUA 3LE8A 1PTJC 3OU6A 3TUJC 4EYQA 4HJXA 4IDCA 3ZGYA 1J0BA 3DMFA 3RVNA 1OXXK 4UE2A 5DK4A 2ANCA 4QXOA 1F51E 3K96A 5FLEX 5AD1A 4XTCS 2MR6A 3N2IA 5C8XA 1RPTA 1HRDA 4GR5A 1ZG3A 3PJGA 3BJRA 1YU9A 4X7RA 1M2KA 3FMGA 3N2KA 3W3AA 5K3OA 2XUIA 1XXHA 1Z6PA 3QVTA 5DSXA 4A0FA 4F7WA 3OFJA 5TX7A 4FIZA 1FFXB 1WEHA 5ER9A 3T9BA 2FN4A 1KKUA 4I3HA 1ZOIA 4ZYXA 3QEMB 1QOQB 1YR3A 2QMEA 3LDAA 5EFOA 2Q5QA 2RGUA 4Q1FA 4ABYA 3G23A 4AX8A 2BFBA 4ZALA 4F6RA 3N76A 1V7CA 4JUDX 3MJEA 5IN4A 5LNK1 1X94A 1DRWA 4XR4A 2OHGA 1CZRA 2IYUA 4JI5B 1HBJA 4AMYA 2DCUA 1JPNA 3I52A 5AI6A 2ZPUA 2QP9X 3D7MA 3ZE8A 5L3QA 3IOMA 2ZBVA 4M21A 3EZ6A 4TS3A 3L02A 2BEUA 1XP8A 4LYFA 4OJQA 3LHKA 5DX8A 5H02A 3PJRA 3OZTA 1FSZA 3FUCA 5CU7A 3PEFA 2X8BA 4ANFA 4DBLE 3PA6A 1LDBA 4AMUA 4TUYB 2WT9A 3LPAA 5EXDA 2GTHA 4WK2B 3KHKA 4V24A 4DSUA 1G9TA 4BYGA 2X8WA 2N75A 2EKZA 4BTEA 3IBSA 1CQJA 3TI9A 1A1VA 1W44A 4U8HA 1PGOA 1CUHA 1RIFA 3OBBA 4JUAA 4KOEC 4CU5A 1OILA 3I1IA 1ZHOA 3AUUA 3ELWA 4E94A 3LNTA 4UDYX 7MDHA 5IF9A 5CNJA 5E6SA 1HETA 4EZBA 3N7TA 3L49A 2NU8B 3OCVA 3S5UA 2J3EA 4EW2A 3DXZA 5C8DA 5GZ3A 4MR9B 3KQTA 3VOBA 4OJTA 1KR2A 4YBZA 2HF7A 1JLMA 2GZ1A 1JIKA 1WOMA 4D6XA 5LP6F 4EY7A 2QL9A 1N3YA 1RAGA 4FD2A 5F98A 4K3VA 3H1AA 1CY1A 2A2ZA 4D56A 2IS2A 4L4ZA 1QONA 2ZCVA 1NE7A 1TVMA 3B9BA 4FR2A 4MS4A 3Q7SA 2GPSA 5KAMA 4CKBA 2BP7B 2FKAA 2XCRB 1GFZA 4E32A 2WT4A 2AFHB 4J49A 1XHEA 2ZI6A 3ZZ0A 2OK8A 1EGHA 4S1NA 1PS8A 1MQSA 4W9NC 1HL3A 1UQUA 1T9GR 4OOFA 3ODPA 2AV6A 1WXXA 2DUWA 2XKKA 4PRYA 2JGMA 4EG0A 3BPSA 3EZYA 3CGGA 1SUWA 4MKGA 2FSVA 1ZN2A 4XRRA 5G53C 5LQAA 5EHQA 4DIDA 1MC1A 5DE3A 5LCXA 4CODB 2E1PA 2NXCA 5BMVF 3UJPA 4QYIB 1NVTA 2RHRA 1E8DA 3LBNA 3PGA1 3E2PA 3MPOA 1M66A 4JUFA 4UBNA 5IBQA 3NLLA 2NO1A 3QHQA 1W1WA 3LM8A 3DVLA 4XZ3A 2QTRA 4D0GA 2JD2A 1QQ5A 2VP5A 4UQLA 1VLMA 4BAGA 5DYIA 2A6PA 2R66A 1B41A 4K6GA 4U1RA 2N0SA 2X0KA 2GWRA 3T5MA 4R1MA 3PXUA 4HNAB 3WE7A 2P9BA 1TO2E 1LV8A 2A92A 2FMKA 3K0CA 4C22A 3AU9A 4D9KA 3L93A 1RLTA 1GFIA 3STYA 1LCIA 3QYFA 3SJAA 3R7AA 3AFIA 1CY8A 4L4RA 4ZOCA 1AKWA 3AJ8A 5EIAA 1KIAA 1S5PA 3VYUB 1WABA 2PL9A 1JA9A 1JI3A 4N76A 1F06A 1LS6A 1SKBA 4R2WA 1ZD4A 2DQSA 5TVKA 3ZWBA 2Z8YA 3CLSD 2CUNA 5EKTA 3PHJA 1Y3HA 3F98A 4M1ZA 4BB9A 3NWBA 1T5LA 5CCBA 4JEIA 2HHCA 3JQPA 3MOGA 3OKFA 3U7EB 2XCSB 5LUBA 4OVKA 1YVPA 4EJMA 1W4RA 2YZ2A 2JFPA 3PIIA 4C3UA 3U60B 1LX6A 4QO7A 2HWXA 3LY5A 2NO9A 5IUJC 4ENUA 3CYFA 1WW3A 3HHPA 2H7CA 5D5QA 4OYHA 1GARA 2DFLA 1RNLA 4KQWA 1U1EA 4ZCMA 2V59A 4LJLA 1FIUA 3T12A 1W9MA 2JFVA 2JVIA 3JWEA 1EU1A 1CR2A 1HORA 3UGJA 1IONA 2GDZA 1UZUA 2YHIB 4FQ8A 2YKGA 4YAJA 5CH5A 1YOBA 4TROA 4Q9IA 4MUJA 5EEHA 4KP7A 2BGGA 3QLVA 3T1OA 4B3DA 4YMHA 1BVHA 1H2EA 1T15A 2I54A 3IT3A 5REQB 3T7JA 4DXDA 4X95A 3LOPA 4UNNA 1QHIA 3JAWB 4PO8A 3T3MB 1JJAA 4Q7LA 1UAAA 4GR9A 4IUBS 3KKZA 5GVRA 621PA 3O8LA 2ZROA 4RAQA 1L5HA 1KAEA 1Y1LA 1KXJA 1Z18A 4F1JA 3B6IA 1PR3A 1ZC4A 2ZWOA 3QI7A 1RYNA 4EELA 3ONWA 1JR3D 2GLTA 2ZSHA 3HVRA 2AQIA 4C08A 4O6VA 3BSWA 1FQWA 4OP1A 3TSZA 1C0IA 4P5DA 3JQFC 1G9XA 2AOUB 4J7CA 4UNQA 2BM9A 3P9IA 4M37A 1Z28A 4P2BA 5C0OE 2WOJA 3AB8A 4HQFA 2IYAA 3O03A 3ZVLA 2GNOA 1MORA 3UJ7A 1SAYA 3CNHA 3N0VA 1W30A 4MWCA 3WP1B 2MU1A 4A1OA 1TLLA 2PM8A 3SM9A 2ZTLA 3CKLA 3NAZA 4PGHA 4PINA 1BDBA 4QBFA 5HS6A 4MQLA 4RVOA 5HMMA 3SIWA 1ZUNB 2Z9BA 5KOIA 4P4NA 3WGTA 1G20E 1LPAB 2PKYX 4A82A 1XROA 4EB6A 1O6BA 1RSZA 2WAMA 4FEGA 1MB2A 2PSEA 3DZCA 4JYZA 4JKIA 2XRFA 1BGVA 1X8JA 1W96A 4I4TA 2P9ZA 2HIHA 2CCKA 5EOVA 4FFMA 1Z4QA 2VAPA 2W9XA 4HAUA 5LZ4A 1PQ4A 3UQYS 1MTOA 3IP3A 4FYJA 3DYVA 4FI3F 1XFDA 2WE8A 4LQ4A 2HLDA 4OBEA 4OX9Y 3F78A 5I51A 3UVEA 4NK5A 1T3TA 2SECE 1SU7A 3IPYA 3H5TA 4ZCTA 2Y1FA 4JELA 1V25A 2PGOA 1RWMA 1V2HE 3GZJA 2OO3A 3KWMA 2FW8A 4G9GA 3UGKA 4AJEA 4D0NA 3T1QA 1BDJA 1M67A 4I9HA 2O7VA 4WH0A 2QRKA 5FORA 2FWNA 1ISRA 3SFTA 4BWVA 1N2ZA 3IPAA 5SY6A 2C7OA 3FUTA 1P1KA 1PDVA 3FSGA 2QJRA 3RAPR 4LMAA 3STTA 4MVJG 4URUR 1G5TA 1L5VA 3P9YA 4KL8S 4H7IA 1CHDA 1TM4E 2VK8A 3DW3X 3QSGA 4BMDA 2WFMA 1ZZEA 2M6KA 5A6SA 1W8IA 1QZXA 3WBBA 5IZCA 5DGHA 2Z2XA 1CEYA 3JVIA 3PCTA 1DQYA 3L8MA 4UPEA 3L8HA 3OX3A 1YUMA 3SIPA 3IBCA 1EFAA 1D1PA 3AEQB 4ITVA 4ZJZA 4MSUA 3MTJA 4J1QA 4P6VF 4PYIA 1WE2A 4NJEA 2BMAA 2R65A 3NHBA 2WZQA 5HF6A 5JAQA 3ZDZB 4BN4A 1E3MA 2C5BA 3AUYA 1ABEA 4MVJM 5KSPA 2JA2A 2JK0A 3FYHA 4IG4A 1FTGA 4YMGA 1NP7A 1GKYA 3EASA 4P53A 4CTOA 3HN6A 3GLHB 3K1ZA 3AILA 1YK1A 2IYVA 3BS4A 3LMKA 3LCUA 5GQSA 3A05A 5EHGA 5B4UA 5DCUA 3L07A 3M6XA 3FFBA 3QKRB 1U7XA 4E88A 1NOKA 5A5GA 1DIGA 4OHRA 2Z3WA 4UTVA 2I3DA 3I6BA 1UBNA 4A03A 4DV5B 5H1YA 3NWJA 4PN7A 1M6YA 2FOIA 2WYHA 4C6SA 1D6NA 4H6WA 3PR3A 5HZMA 2FW1A 4IJUA 3WMGA 2RGXA 3T54A 3GNTA 1ZK0A 2K4MA 5AW5A 2OORA 3FTCA 1HQYE 2PXCA 4QHSA 5DBOA 1VMIA 3TLZA 4NBRA 2ATIA 5CM2Z 3ZY6A 4PYQA 4QUGA 2DB3A 1IUNA 3NT5A 3TWOA 3E3OA 3GPDG 5JI2E 5ICMA 2JAXA 1K0UA 3N6VA 3HNRA 5E0KB 3TM5A 3G8YA 3NV9A 4AYTA 2HI0A 1ESEA 2PSHA 1ST2A 2POQX 3GDFA 4FZ5A 4RBNA 1KI7A 2FLWA 2I67A 3V2HA 3ZIAD 4X65B 1QVZA 3FUXA 4ZAGA 2OK7A 4WADA 2BLNA 1YDWA 4KYVA 4D43A 1L4HA 1XCMA 1SEVA 1YH3A 4RDIA 2WM3A 3SQDA 2VQFB 1M2OB 3T4UA 5C4GB 2QA5A 1S6YA 1GEGA 2GM3A 2X13A 4EKGA 1ICEA 1E9CA 2I8AA 2B4AA 1FSSA 5LYJA 6GPBA 1JDBC 2QMZA 1G3UA 2RIRA 4AZ3B 5EUCA 5A5DA 3CVUA 1PJTA 2O2DA 3FVRA 2H4XA 2O7RA 2VT2A 2HJSA 1RADA 3VU3A 3SYRA 3DSRA 4CTJA 4FC7A 1NATA 5BWCA 2MMCA 1KEEA 3SNHA 2G3YA 2QSZA 3HFGA 3BA6A 3GVHA 3GP5A 3A7EA 5IJXA 2NPFA 3GLFA 3FSJX 5GGYA 4FXOA 3IMCA 5EIWA 5A3VA 5JVDB 1R5BA 2XJ4A 4GECA 4MUMA 2AG0A 5DHSA 4UXJA 5GP1A 1OHHA 4JUCA 3UMGA 4BLPA 1UMBB 2PR2A 3DHWC 3GN2A 2D5LA 3CA8A 5TB5A 4CFSA 4F2PA 1JP7A 1KZGB 2DPYA 5COAA 1Q5PA 4X7PA 1ECLA 1UMDA 4ZAWA 2O2GA 3LUJA 3WOHA 5HJEA 4LDAA 3R75A 2QPTA 3HB1A 1ZRSA 3BE6A 1AF4A 4QHYA 1BYIA 5B5SA 2JIRA 1XEXB 4K3UA 4M0UA 4NHEA 4XD2A 1UFVA 3EXFA 1IN4A 1XN4A 1JVBA 1PUJA 2DULA 2RB4A 2V8BA 4GZ6A 4ND7A 4MGEA 4OYYA 1Y9JA 3IQHX 1BN6A 1ELOA 1Z0DA 2EFHB 3PNSA 4BOYA 3FYTA 5JY6A 2Z57A 5T8KA 4QASA 4P5EA 2YHBA 1IAQA 1YK0A 1H2BA 5L4LA 3FIUA 2J59A 3DOHA 1WR8A 1NV9A 1D9XA 1XK6A 2AXQA 2H8KA 3K6KA 4DA4A 1ZAKA 1E8NA 4JA0A 3SZMA 3GZTB 5LBTA 3ZHYA 2CK3D 2PUAA 5IAEA 1KS2A 3QMMA 1VMEA 1I6KA 3KB2A 2RGDA 1M2VB 1G5QA 4B7UA 4QDOA 1VGVA 1KJ8A 2PZFA 3NJ4A 3OOWA 3KCQA 2PX2A 2O2YA 1SB9A 3B89A 1Q92A 1B26A 3AL3A 5HILA 5LXTF 1EHIA 1CJSA 1GQRA 4BQEA 3V6LA 3VPSA 1YT5A 1C3XA 2QRUA 2RIPA 1IQUA 1HQDA 1RRVA 3MJDA 4LMRA 4B83A 2OKGA 3ETGA 5T3UA 4IY1A 1CYEA 3CF6R 1Z0IA 1NVMB 3OFVA 2V7QD 2P2GA 5FTJA 1F0NA 2BCGY 2EYUA 3BHNA 3EAGA 5LQRA 5JCZA 1TZ2A 2ZKLA 1TE2A 3JZMA 2XOEA 4I99A 1JAHA 4M9ZA 5T6MA 3LGXA 4CLOA 4NICA 2QP3A 2EJVA 2IGBA 2DM6A 1BD4A 3OX4A 1TCAA 2IZZA 2ZRDA 3H1TA 4J0KA 5DHUA 2DR2A 3MHTA 2IOQA 4WKNA 1RWKA 1UBFA 2DETA 2NMVA 4WLNA 4F3YA 3EEBA 3MTDA 4LGVA 3DE5X 1K3UB 4UHJA 4N49A 4RJIA 1QS0B 3PPVA 2IPOA 2Z1NA 5CT8A 1ZGCA 3O8QA 1DT5A 3S40A 1EG2A 4PZUA 4BLQA 1E7QA 1CR0A 3KB6A 4NEGA 1NG9A 1I5RA 3K2EA 4B3CA 1MF7A 2HJHA 2J8ZA 4GH5A 4IJQA 4X85A 2IUEA 2PJUA 2V9ZA 4LIPD 3OIGA 3TGPA 2ZT5A 1AKMA 3HVKA 5TMDA 3TLBA 2CWWA 3FKQA 1MUUA 3ETCA 2X1LA 1FL9A 1A9RA 3I1JA 4C1NA 8ABPA 5LDDC 2AA3A 1H2WA 1SCQA 3A11A 4K8OA 3B9RA 1UQRA 1XAHA 4QARA 1FXWF 2ZBRA 3LFTA 1AOXA 4FKMA 5EKSA 5FJJA 3ORSA 3UAOA 1M76A 3PFCA 4B2LA 3GC6A 5DGCA 3GJYA 1YC5A 2D3TA 3A06A 2CNKA 4FYWA 4WBNB 2ZTVA 4GM4A 1B6RA 2HPVA 3JD1A 5DNAA 3F5DA 2OAQ1 3DB2A 5ETJA 1D7OA 4D4KA 4V1CI 3P9QA 1OFTA 1Q0PA 1XQXA 1YZNA 3SJBA 3AHEA 3FNRA 4XVQA 3OUUA 4HAWA 1PFGA 4Y2GA 3RRNA 1G6HA 2XA2A 2EF0A 5J23A 1VHTA 3G0HA 2V0CA 1O57A 1WW2A 2BRUA 1KOJA 1Q7GA 4O2RA 2KI5A 5A4KA 3ET5A 3RJTA 3FCOA 2XVXA 1R1DA 4P7GA 1MCZA 5FTNA 3TE7A 4RF5A 3UY4A 1V43A 4TUYF 1GPKA 1W1IA 4W99A 5J4LA 4BJHB 2VTDA 3F9CA 4G1EB 1NVEA 1DMRA 2GILA 3ELYA 3ZW7A 4EGQA 1SXIA 1AQIA 3TJMA 3OQOA 3T7RA 1A8QA 2D5IA 4AJIA 2PK3A 1SXJD 1IY0A 3W4KA 2B92A 2BM8A 5LP6A 1C3EA 4LW8A 4JI3B 3UQZA 1ZC3A 2BDTA 3LGSA 2YHAA 4CM8A 2CL5A 2QLTA 3G0GA 1E7WA 1K86A 2D4HA 2WIJA 4NBLA 4NU5A 2QRPA 1WPQA 2FSVC 3IBTA 1LS1A 4PLGA 1T0PA 2HZBA 3I6QA 3GRAA 4PWZA 4BVHA 4DLBA 1ADJA 1X42A 2AR7A 4IHQA 2WIKA 3O26A 4WJKB 2Q0HA 3OLCX 5BO5A 3HJTA 2OXIA 4WACA 1V37A 2GEUA 4WGFA 1ZH0A 3GA5A 2WV7A 1MJGA 4ZOEA 4CUKA 4LE0A 4NOLA 3U5ZB 4GQAA 4HCJA 4N5MA 3I5UA 1J5XA 4PZCA 1L8OA 2B20A 1CKEA 3ES9A 2CHQA 3JASA 4HDSA 1G3RA 2B6NA 1MIOB 4FOTA 4LHEA 3ESQA 3JRNA 1RBMA 3OPVA 1Y7IA 4NMXB 4C43A 2O8DB 3LWZA 4OOEA 5BMVA 3MS7A 2JH8A 2VNSA 1NMYA 2BHSA 3A9RA 4X1KB 2R751 3EDQA 4Y6QA 3VC3A 2GAOA 5DTRA 2WWFA 4A91A 1ISIA 3PS9A 4YRNA 2V74B 1O94A 3TAXA 1FQKA 3MK31 3N07A 3OM0A 3DL0A 3JD2A 3QFCA 4UTNA 3KQVA 5BVHA 3LHDA 2GYYA 4WHMA 3N2GA 3DV2A 4WY2A 1FNNA 1RXIA 2CZCA 2Q6IA 1ZVQA 2QP4A 5KTPA 4D8XA 3GLIB 1BXRA 4NE7A 2ZTHA 2ZJOA 1NYTA 4L0CA 1IRIA 3O9ZA 3UF0A 1GPJA 3G8CA 4RWZA 4BNNA 2FA9A 1EFUA 1OFUA 2XF8A 2VHWA 4I81A 3ZHXA 1EWQA 1IHOA 1CR6A 3K20A 1IOVA 1CUCA 1RLOA 1BMFD 1UWKA 3EF3A 2PO5A 1JL3A 4DR6B 2QXTA 2AFIE 1P5JA 4YCJA 3AVYA 3R0IA 4G6ZA 4EKIA 1DINA 1LPSA 4FX5A 1K7CA 2XKJE 5AUOB 4IEEA 1EHYA 2PV7A 4KPGA 2HD4A 4KQ9A 2R1VA 3Q4GA 1PGQA 1WV0A 3WXMA 5B53A 4EJFA 3DKVA 3KPVA 4G56A 1MDBA 1QO9A 4KJZA 3REQB 5BR7A 1GY8A 4D44A 1IY8A 2BC9A 4QTZA 3RSFA 3TGLA 2GXQA 3G0OA 2P35A 2XCQA 2HJWA 2J3KA 2HFJA 3DBLA 1XYYA 2CXHA 3GUCA 3JQRA 3LRXA 3MD9A 1DSSG 4UEJA 1W1UA 4YIKA 2M32A 1N0UA 3NYRA 4CQMA 3U6KA 1TZBA 1A76A 1KZ1A 4L15A 1T5DX 3MBOA 2XXBA 1ZQ9A 4FYMA 3N39C 1UFOA 1XZIA 2I4MA 3A3PA 3EGIA 3JYLA 3L6DA 4YJKA 3RS0A 5LDHA 2UU9B 1QRAA 4Q6BA 3GCWA 5J47A 5B2EA 1C7JA 1QH1A 1RMQA 3QKSA 1DKLA 5AVRA 2M6SA 4NYJQ 4UCFA 5AO9A 1W9HA 2RCYA 3ZGLA 1JDVA 1AA6A 4C7VA 1LI4A 3DGFC 2Y71A 3WLOA 1FSPA 1NUQA 3UO8B 2FUKA 3PYMA 1VPWA 4N4AA 3L01A 3DFUA 2QRLA 3KLPX 4LXUA 1O5OA 3NV7A 5CLFA 2CMKA 2YMMA 3SC4A 5IDWA 1SEPA 2PX5A 2XITA 4KU4A 1U7PA 4EYOA 3TB4A 1OT5A 3Q15C 4Y1RB 3L43A 1P18A 1UK9A 3FY4A 4HPJB 2ZB3A 1D2EA 1E3DA 4QOEA 5I7UA 2YUIA 3W5JA 3LKZA 3JWHA 1Z0JA 5TPWB 4OGFA 2JAWA 3LBIA 3PI6A 5IM4A 5ALHA 5EP1A 4X3CA 4B6PA 2QTGA 3ZLVA 3OPYA 4I08A 4WXPA 2P65A 1I4WA 1OQAA 2JGIA 2OXRA 1TDJA 2ZDHA 3A9WA 4LOAA 1XLTA 3O1IC 3REFA 2LWIA 1EFRA 1O3YA 1VG1A 5I47A 2UKDA 1J0DA 4MV6A 1GGJA 3HGMA 2OFFA 3K70C 1EVLA 2FCAA 1HURA 2O52A 4FOPA 4G1FA 4DZZA 3WQQA 4PPGA 1LFAA 3AR4A 1TCVA 2OQIA 3LOUA 4TN1A 5NLLA 3ZJYA 4NXNB 4H1VA 4GKJB 1W4AA 3DBRB 2Z2JA 4ZJPA 3IP7A 4KVZA 3G8BA 4MQEA 3ENNA 2WZDA 5A5EA 4MZDA 3MINB 4TXLA 2C7BA 2O05A 2PGAA 3A2LA 4E07A 1EXDA 1SK8A 2DPHA 4DADA 4MMZB 3RVQA 1B8OA 1KI9A 2G5GX 2DCMA 3HLYA 2LDBA 3TBKA 4L5YA 4K86A 2R0QC 1H8EA 4XUGB 2HL6A 2I65A 4EI7A 5B6IA 1ZIOA 4X20B 5IZCC 2GEFA 4KXUA 3IDAA 4EPRA 4U2BA 4ND6A 4MGIR 4R8RA 2VTVA 5AKZA 1XTTA 4LMBA 1KSGA 1MAUA 3KVNA 4LHXA 3U3KA 4FQ7A 4C4PA 3H2SA 3UN1A 3OQVA 4IQFA 4TMTA 5DWDA 3S3TA 5IJWA 1M5RA 4LQDA 3DTVB 3U3ZA 2QN2A 3W5IA 4CEIA 2IZ6A 2E55A 1E7YA 4QVGA 3ROMA 2FJ0A 1X77A 2W2NA 3L3BA 4F4IA 3HP4A 1N0WA 1ZINA 4TZKA 4YXWA 2H6EA 1QG0A 3ITEA 3KCNA 4MYRA 2XMQA 4AIIA 1TIKA 3TQOA 3BK2A 3AFNA 1V3VA 1SG0A 3GEGA 4OQZA 3FDIA 2SKDA 1PJCA 4GGPA 3RS4A 4JIGA 3IQXA 4RTJA 4Q21A 2RK3A 4G0OA 5BV2P 1E9EA 1L5OA 1NJFA 5IXSA 3SXPA 3CINA 3FB4A 3VA7A 4TVKA 3ABQB 3JRWA 5C4IA 2BW0A 2R2AA 4BMNA 2G77B 1PEKE 1QLJA 2W2VA 4FE3A 4HLUA 4LUCA 4M9RA 5IJAA 1ZRHA 1SY7A 3T7EA 1C7ZA 4R2HA 4F21A 1P1CA 4BKMA 1J2RA 4V0MA 4JBXA 4Z7QB 2V3WA 2SHKA 2QQFA 3K5HA 3BF7A 4TLLB 1IBLB 2Y0BA 3MFQA 4GSYA 4WLFA 2OORC 4XOIA 3CLTC 2C4WA 5BYJA 4Y2VA 2BHRA 4UXHA 1ZCZA 1RWWA 4LWPA 5HW0A 3MT0A 4WT7A 1U4OA 3AHJA 4FFOA 3TXXA 2W6NA 4TLDA 4UPDA 2XNHA 4BQRA 2P4UA 3H99A 5TQ0A 3ZHCA 5K8LA 3OHMA 3A4IA 1VCOA 3A2MA 3IP1A 2A30A 4YRQA 5AJUA 1W52X 3WHLA 1ZW1A 2JKVA 4QPNA 5D3MB 3E9RA 2BVNA 4TQAA 2AOTA 2Q3HA 1QFYA 1R8XA 1L5FA 2CC2A 3N8NA 4X91A 2JKYA 5GGXA 4FGZA 5KTMA 2VUUA 2DTXA 3LUFA 1HH4A 1NM5C 2VUSA 1RQPA 5AR1A 2VAWA 3DMGA 3GFTA 3ZGVA 1Z29A 5AUNB 1GXSB 2M98A 1CS0B 2QVBA 3TF5A 4LFAB 3PUJA 2X6RA 1NJ8A 1GQQA 2WDPA 3HTXA 1ADYA 3SZOA 1R66A 3R0QA 2W43A 1YTLA 3FWNA 3P0HA 4KRGA 4PBTA 3NEJA 2HCBA 2W5UA 4F4HA 5IJ0B 2EZ9A 5J2UF 2ZSIA 2IOYA 2R25B 2YXBA 3KM0A 4UUAA 4BKOA 5EMMA 1QE5A 2DGDA 2RHTA 2V54A 4G0NA 1IAVA 2ZR9A 3QNUA 4KTTE 3ITNA 1ORWA 2ZTSA 1ZD9A 3AF1A 3FMPB 5AJXA 4HKTA 1MZPA 5G40A 1EE9A 2X9VA 4FFNA 1YKFA 3UHOA 4UEKA 4EJ2A 2JD0A 3DQZA 4KLCA 2H5IA 1XDDA 3B1WA 1QDUA 1E3EA 2PGNA 2VDNB 3V4RA 2Z6AA 4NBWA 4S0XA 2CDBA 3EIXA 2ZIVB 2WPNA 1O6GA 5E7JA 4R1SA 4BVJA 1V5IA 4HXEB 3PCRB 4GKBA 4KACA 4TRMA 1NF8A 1WHSA 4OBWA 8ADHA 2JVKA 2C5SA 3WBKA 2E48A 2IOFK 4H60A 3RSSA 3LUDA 2V3CC 1KK0A 4TXNA 1D2CA 2O9JA 3GCXA 2AWNA 5LNK6 4QDTA 4YTEA 1PYGA 2NG1A 1B00A 2XCLA 1KE1A 4E33A 3EH2A 3IXQA 4EA9A 5T8KC 5A9SB 2P40A 4UBJA 2BEVA 3F67A 4IDGA 4R54A 2YWHA 1E5TA 1OLUB 2BCJQ 2BM0A 4ENQA 1I4DD 4NFLA 5HF9A 3IELA 1JTFA 5AOBA 1ISFA 1VCIA 3HJUA 3O4IA 3W2GA 1COWD 5JVDF 3ER8A 4ZD6A 1C0PA 3I5AA 1DRUA 4DEXA 1JIVA 3PXXA 3D3EA 1ETUA 2MSLA 3NHYA 1NPDA 5K0CA 4KYIB 4ZU3A 2HLDD 1R18A 4I55F 5CTAA 4BVEA 2I6SA 4R2MA 3NRCA 3ZWMA 2BFCA 3WLRA 3M33A 3PVCA 4GD3Q 4L4XA 4G84A 5E6UA 2G0NA 3N3AC 1G4HA 4OBXA 4P08A 4E5UA 1HDIA 3AR8A 1QWOA 4MYDA 3GLQA 1A9SA 3L8DA 4R16A 4RH3A 4YJ3F 5LXTA 2NXNA 4DQXA 2VHTA 1EAMA 3FSGD 2FQ1A 4LJAA 3B2EA 4ZZ2A 1UEXC 3EMBA 5F7ZA 4RQBA 3WIUA 1IDOA 2OQVA 3CZCA 4G26A 4Z6KA 1CIVA 3ECAA 3W79A 4Z5XA 2R1TB 4Y30A 5C8ZA 3VSEA 1MB9A 3MIZA 1XKTA 4IFTA 4JH0A 4OMDA 4TLMB 5TF4A 3ZDYB 4C03A 2FP3A 3MQ2A 4CT5A 5FV4A 3NOQA 2QYSA 1SUBA 1YZUA 2PS0A 4KGDA 1JFLA 2DWQA 4GQIA 4PZZA 4FR5A 3AUXA 1JAXA 2H1HA 4LHYA 3V6MA 1G20B 3O74A 2Y2UA 2OBLA 2XMPA 3BRWD 1G3MA 3K6SB 2ZG6A 2HF9A 3VC7A 5EIEA 3A9UA 1CWUA 4FKBA 1USKA 5KYXB 1T0JB 1A2OA 2OD7A 2P6NA 1K08A 3DZIA 4ZO4A 1P4RA 4ZXFA 4BX9A 2G9ZA 4E30A 5B6PA 5I9LA 4RESA 2O6LA 2PGLA 2IY7A 1C8BA 3IALA 4KAJA 4OHMA 3WJ1A 3L8GA 4FMBB 2WLSA 1XQ6A 1W29A 3MGKA 3TKYA 2IYRA 1CV2A 3C5HA 4FZJA 3QXSA 4DKJA 3QH4A 1L3BA 1PNQA 1FW6A 4A15A 1Y9DA 1JNXX 1D0VA 4BFWA 3AR9A 3NKLA 3T7KA 4DEYA 2F17A 4S1PA 1YFZA 3G0IA 2B30A 4R0NA 4S1OA 5CVUA 3U4DA 1SD5A 1HDRA 3SR4A 4EENA 1OKKA 1T1RA 1E6UA 2GZ2A 1AKTA 2C42A 2HQ1A 3PU6A 1U2TA 1Y82A 4MWSA 2P41A 2QT9A 4Y2PA 4L02A 3NIFB 2QVLA 1LLFA 1FFXA 3OH8A 3LY8A 1YIAA 1XMOB 1DWPA 1FXWA 3JARB 3OTGA 3GZ4A 2G6BA 4M8IA 4ZIRB 1XZPA 3QEMA 4U5QA 2BEJA 4A1FA 2B8NA 3D5QA 2QY6A 4QNMA 2HIMA 2VPWA 1USVA 4P3YA 3S2YA 2EFEB 2O14A 4GVXA 1G8YA 3K9GA 3QFRA 1DB3A 1VTKA 4TTQA 1N2SA 1TD9A 2DY0A 5EE1A 1LJ8A 2ZB4A 3DPUA 2VDMB 3BWEA 2VDJA 3N8IA 3PQ4A 4GE0A 3K9CA 4HEQA 4OH1A 3ZXXA 1JFRA 4M0PA 4DM4A 3KKOA 2O1EA 2XAAA 2VYQA 4KMMA 1AUQA 2EIHA 5LP6C 4NABA 1OLOA 2LPMA 4TMXA 3KR9A 4X7MA 1DQZA 3R1IA 2KLBA 3D0KA 2J46A 5KU7A 1EA7A 2BR5A 3H16A 4HDKB 3G0CA 3BXGA 4LXTA 4LQCA 4WGGA 5EMKA 5F78A 4WBNF 3N74A 4LRQA 3UWDA 3KV1A 1D4OA 1ZJ6A 2RHOA 3NWOA 1TO1E 3OU7A 4K7JA 4K0RA 1ZBDA 2R86A 4TUYA 4WOBA 2QKYA 1BD3A 1Z07A 3ICOA 3PJFA 4RGVA 3E05A 4QTYA 2W42A 4Q9LA 4W8OA 1D8AA 3E03A 1MJFA 1TYAE 4I6GA 4B46A 2QX4A 3ABOB 3C7AA 3LQ1A 2FRVA 4MPTA 4NFHA 3U1BA 4QDZA 3HDYA 1YZHA 2BJHA 5KNBD 5TSDA 1KQ3A 3AF6A 4M9QA 4UD6A 1JKMA 1JEQB 1ONPA 4B73A 5CAEA 1RLJA 4BQNA 5ELXA 1SRQA 4QNNA 4MPPA 5GWXA 1ZO8A 1VPDA 2NU7B 2NU8A 2YX1A 1Q0TA 1P72A 2J5QA 2QG6A 4E51A 3LZ6A 7ADHA 4MR9A 4XM2A 4X6LA 1MEOA 5T4BA 1N1GA 4BE7B 1O94C 4LK2A 4CQJA 5I4BA 5FJIA 2A0FA 3VR4A 3HJAA 2O2JA 3CUSA 3EA0A 1QP8A 4AO7A 2I4TA 2QMQA 4B2PA 4BO0A 1QVRA 1ZI6A 4R2LA 3DMDA 5IDXA 2D1FA 1N2CE 4K26A 1CZHA 4B9AA 3AUJB 1M2JA 3BD7A 4RKFA 2GAIA 2GYWA 3R3YA 3C3AA 2BP7A 4Q9JA 4KBYA 3U9LA 1NDUA 3VMFA 4AKTA 1FMLA 3L7MA 2AFHA 4JMLA 5E7QA 4DIKA 3EXIB 4RMHA 1GR1A 2SNIE 1B1CA 2E49A 2HUNA 3WGOA 4IIGA 1AQ6A 4FN5A 5HMLA 1KR5A 2G09A 2NOAA 1P7YA 3F7MA 4J0DA 1UBKS 2AG6A 3PK0A 3LVRE 4P3OA 3TRKA 1KRHA 3T4XA 3EPPA 1U7OA 2WTAA 3B2NA 1FOEB 5DN9A 5BWOA 5J4KA 3F49S 4RZUA 1PL0A 3R6DA 3K0AA 3CG0A 3GLTA 3P2MA 5I7AA 4BO8A 1KY2A 3HDGA 4PXSA 3HPQA 1C3LA 3L4JA 2RKWA 2JIMA 3AEXA 3Q2KA 3FJ1A 2Q6TA 4JJIA 5DT2A 3NCTA 2VZ9A 3B1JA 3DC2A 1IEXA 1P0QA 1FDOA 3M4NA 4YYEA 4C4RA 2ZITA 2BDUA 5EXSA 2G9VA 4QG7A 3FYDA 5EJ7A 1B0UA 1Q91A 1JU3A 2ZS7A 1A82A 1DFIA 4GC5A 5FI1B 4DIUA 1U3TA 2EJCA 1V96A 1IHXA 4ES6A 4RVFA 5IN5A 3GRRA 1O1YA 5JSUA 4UDXX 3AEYA 1Z2DA 3RRJA 3H2BA 5BR1A 4LFCB 3RARA 3TR6A 3TXAA 1TT7A 4IDDA 4XWAA 1XNGA 3C7DB 3NXSA 1U0BB 4LYEA 1BRTA 1S7GA 2X2OA 3IA2A 5L7WA 4B3MB 2PL1A 3E3NA 1P1BA 3HUEA 2BUCA 1A4IA 2PGIA 3LUPA 4OUKX 4RHEA 1TADA 1N4AA 4EJSC 1ZM7A 3M81A 5AHRA 3RK0A 4B8ZA 4TS1A 2XUFA 3AW8A 3JSAA 1G7CA 4GUAA 2JH3A 1TT5B 3DOJA 2H2FA 3P2EA 2MIIA 3A1FA 3ZWXA 4HI0E 4G0WA 4MI1A 3BX1A 1KZ9A 4YV2A 5HS4A 2QG9A 1HFWA 3AFMA 1JSXA 3W7BA 4B81A 4NBKA 2XCUA 1Y9EA 2PRKA 2X0JA 3K72B 4IILA 3PTLA 2YHIA 1ZJZA 3UMRA 2XZPA 1RPAA 2AQ8A 3OFSA 4BLRA 1LGYA 1NA5A 4D6PA 3OSUA 5REQA 4K5QA 2ZM6B 1E99A 3O3NB 2VIIA 4KXMA 5GPBA 1CY7A 1AUOA 1Z06A 2C61A 1NLUA 3JAWA 5ALRA 4D8TA 3VDNB 2JLSA 2XEXA 1ZAYA 2XQGA 1KMQA 1PX0A 2G4LA 2WTBA 3LBHA 4LJ5A 3BJIC 1DFHA 3EFBA 1AXRA 4B87A 3RU3A 3I9OA 3LCVB 5MHTA 2BF4A 3V8RA 4TYNA 4MI6A 3EK2A 2IIQA 4MQFB 4NMHA 3R5FA 2JEYA 2GPTA 2RB5A 3NBYC 3UHJA 3VTAA 4HLDA 3PXEA 3DZJA 1TU4A 2AJ8A 2AOUA 4MDEA 4W1SA 2C03A 1N8NA 4BNZA 1NLZA 3EWSA 1TK2A 3JALB 4TM7A 1SVNA 1NVWQ 2QORA 3IVCA 4Y7DA 4C5BA 4DPLA 1TZCA 2CFSA 2DY1A 5T57A 2WK1A 3KOZA 3U4GA 4MI9A 5DBFA 1GNVA 2WAAA 3MILA 2W2XA 1QOZA 5IAGA 3U1VA 3UHFA 4X1YB 2OG1A 4CYMA 1FX0B 4PAGA 1PS0A 4WFKA 1CE8B 2J08A 5F4ZA 3A4YA 2LGJA 5HJ2A 1ZUNA 2FW7A 5HZGA 3BE5A 4WNIA 3OP4A 1VIVA 4ZAVA 2J3QA 5HE9A 1FTSA 1NRXA 2C54A 1M1NA 2OAEA 1YBMA 2ZJZA 4V2IA 1KDZA 2WD7B 3ZE2B 3UWOA 2C1XA 3MAGA 2Q2WA 1P80A 3DZDA 2RHLA 1ZMTA 3ASZA 2P7HA 1X1AA 2HBQA 3UANA 2EYQA 3CY6A 2FDXA 4Z7OB 1XNQB 3HYLA 2HIGA 3ANSA 3H11B 1PV2A 4U9UA 4K40A 1NSYA 8MHTA 4HLUC 5I4IA 1CQZA 1W2WB 5IT5A 4BCDA 1PK7A 3EIWA 1DARA 4M4SA 1IBKB 3TG2A 3I83A 2G9UA 4DRXB 3GGSA 2PMKA 4Q4HB 3ZDCA 2DJIA 2X9QA 1RJEA 4R9RA 3R7DA 1QUEA 2HHLA 2G40A 4Y2XA 3N0XA 4OSOA 2EX4A 3IERA 1E77A 5E38A 3PFWO 5HKKA 1IPHA 1Z9BA 3FGZA 2QTHA 3SHFA 3VZRA 3KZCA 5JRDS 1DC4A 1FU7A 1XJCA 3QVJA 6LDHA 3BEDA 3VAZA 3DTTA 3BFKA 4LPKA 3OJEA 2BL4A 5DNVA 1R0CA 3NHJA 2UYOA 3GLKA 4HZGA 3ZGNA 2J5RA 4CDRA 3WLKX 5CIYA 2P3QA 2EKBA 4HAZA 3FVQA 3S2EA 2BE9A 4BQSA 3FHTA 3KZ1E 1ESMA 1LH0A 2FCRA 4CG3A 2K6GA 3AEQA 4OG2A 4B44A 5T4EA 3KG2A 3ZWCA 1JE1A 1XVUA 5J59A 5LM3A 3GGDA 4FZVA 3PHGA 4ZT7A 3ZVNA 3GQVA 2HQBA 1ZNYA 2XHEA 3R3XA 1AJEA 4HB3A