2EW8A

Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
247
structure length
229
Chain Sequence
b'QRLKDKLAVITGGANGIGRAIAERFAVEGADIAIADLVPAPEAEAAIRNLGRRVLTVKCDVSQPGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVNMLQAIPRLQVPLDLTGAAAFLASDDASFITGQTLAVDGGMVRH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (S)-1-Phenylethanol dehydrogenase
publication title Crystal Structure and Enzyme kinetics of the (S)-Specific 1-Phenylethanol Dehydrogenase of the denitrifying bacterium Strain EbN1
pubmed doi rcsb
source organism Azoarcus sp. ebn1
molecule tags Transferase
total genus 81
structure length 229
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.311: (S)-1-phenylethanol dehydrogenase.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ew8A00
1X14A 1E7RA 2Q1TA 3M6IA 3OEWA 5HS4A 5KJCA 4HFRA 2I9PA 3TNLA 2CZCA 1VSVA 5AXBA 4UEKA 2IDZA 1GY8A 4IPTA 3RFXA 3PYLA 2I76A 3X2FA 4CMCA 3HUDA 5JBIA 5DP2A 1ZXBA 2NVWA 2WJPA 3JQFC 2C2YA 3HHPA 4WLVA 1Z7BA 3ZWWA 1LQUA 4FPXA 2ZYAA 2DPGA 4TRRA 3CZMA 3JQ7B 3F1KA 3WLFA 3H5AA 3U4DA 3SLGA 2BRUA 4WK6A 2ZJ1A 2VCYA 4DTIA 5JC1A 3WTCA 4CPDA 3GAFA 1PJLA 3Q6IA 4YRDA 1T24A 5B4TA 3T4XA 1N5DA 1YXMA 1JTVA 4MIEA 4WASA 3PRJA 4GKVA 1GUYA 3G79A 1DRVA 2PGJA 4MO2A 2FR0A 1HWYA 2VUUA 4HKTA 3T7EA 2PH3A 1XQ6A 3DEYX 3I3OA 3F3SA 5JS6A 5L40A 3DTTA 1LLDA 1F17A 2C5AA 3UVEA 3KUXA 3QV1A 3INTA 4R01A 3MJEA 1JKIA 3ZV6A 4EZBA 1M66A 3L6DA 4LVUA 5G0UA 4BO1A 1JWBB 1LXCA 3DTYA 1HDGO 2NADA 2GERA 3AUUA 4RPGA 4A03A 1GCOA 4ZQHA 4ZGWA 1Z6ZA 3RBVA 2FSSA 1CWUA 4II3A 2B4TO 1EDZA 2BGKA 2IYOA 3RUDA 4W6ZA 2W2LD 4NBRA 2GZ2A 1QG6A 4PLGA 2AQHA 3GFBA 4O1MA 2Q49A 1P1RA 2HUNA 5CPBA 5JY1A 1C0IA 2Y67A 4PG5A 5L95A 3H2ZA 4DREA 1Q1NA 1X0XA 4JBHA 5JMPA 4ILKA 3LQFA 4J7XA 2FOIA 2VUSA 4C7JA 4J16A 3VH4A 3G49A 3E82A 1WMBA 1Y5MA 2DM6A 2O3TA 1NX6A 2AG8A 2P4HX 1ZUD1 3KYCA 1OC2A 2YV1A 3ONDA 1U7TA 4E4YA 2EHDA 1YDWA 4UVEA 1PIWA 5GZ6A 1C1DA 3DR3A 3FN4A 1CETA 4D7AA 1GZ6A 3ICCA 1DC3A 1K5HA 2O50A 4BNUA 3AY6A 2B37A 4LCJA 2NU6A 3DMTC 4N54A 1I30A 2W2LA 4R3NA 2A4KA 1HRDA 4J3FA 1A72A 1H6BA 3ANNA 5H82A 5IDWA 2UAGA 1BDBA 3AU8A 3BTOA 4GWKA 1CJCA 2Q2VA 4ZA2A 1KERA 1LLCA 3JQGA 4L74A 1CEQA 2FMUA 3GUYA 2G82A 4RDHA 1F0YA 1U8XX 4QO8A 3C24A 4YB8A 1U28A 4IM7A 4MKRA 4GX0A 4PZEA 5KWEA 1LX6A 3VPGA 3KBOA 1NR7A 2VHXA 3B1JA 1PU2A 2Q1SA 1Y5RA 5JAQA 3TZHA 3VZQA 4A0SA 1BG6A 1I10A 1P0CA 1XGKA 2J3JA 4IZIA 2G0TA 3H5NA 3FWZA 3GRKA 3V1TC 1XELA 4CM6A 2I6TA 3ROPA 1H2BA 1QYWA 3QWHA 2DUWA 3O38A 1NNUA 2P4QA 5JO0A 1W0CA 3D3WB 4EYEA 4P22A 3R0IA 1E7QA 3OM9A 1NVMB 3ROQA 4YQZA 2X86A 4I9HA 1VJ1A 1FF9A 4YAJA 4Q9NA 5HM8A 1PJBA 2Y0EA 3WIDA 4B3HA 4XGKA 1HYHA 1ZH8A 2DAPA 2JAHA 3I4CA 4U0KA 4YJGA 4N5MA 2IZ1A 4Z0PA 4BNTA 4U6QA 4E32A 1HYEA 3FHLA 3B70A 4BQPA 3INRA 3L77A 3DFZA 4A2CA 4CM9D 1DJNA 1R4NA 4ZD6A 4J49A 4ND1A 2PV7A 1XU9A 1LDBA 4ALMA 3WLEA 4CV3A 1B2LA 9LDTA 1PGJA 1AN9A 1HT0A 2NQTA 4AG3A 4BO5A 1R37A 1KEVA 1VKNA 3C1AA 4CMAA 2ZTVA 3STHA 3DZIA 2IE0A 3GFGA 4DRYA 1P0FA 3W8EA 4L4RA 1DIBA 3PWZA 4R16A 4YRBA 1E7SA 1ISJA 1MG0A 2VOJA 1L1FA 2JJYA 1C3VA 4W7HA 1XWFA 4IDCA 3KSZO 3KYBA 3ZWNA 4A7PA 4CQMD 2EW8A 1JU9A 4O6VA 5I7EA 3QHAA 2E37A 1B3RA 3VAZA 1R12A 2Y1OA 4CUZA 4PG6A 1N7GA 5ADHA 4CR8A 2WD7A 4PLCA 5KJ1A 1U1IA 3ULKA 2B5VA 3U4CA 5J23A 1KYQA 3PYXA 5FF9A 3DMTA 2ZTLA 3WYEA 2WEKA 3EGOA 1X13A 4TMFA 3ITDA 2GSDA 1NYTA 3L9XA 2P68A 3GPDG 1UXJA 4HV4A 2BGLA 1HE4A 1O5IA 4OYRA 2NVUA 2OORA 2SCUA 3U3XA 4BNIA 3AM5A 5DBGA 5BSFA 2O4CA 3Q0EA 4YJGB 3GVIA 1NBOA 4LSWA 5COAA 2R6JA 1ZSYA 3HE3A 1J4AA 3GEMA 3TQHA 5CEJA 1PEDA 1ZO8A 4CQMA 1R4NB 3QWIA 3WYCA 4IJUA 2G5CA 1BWSA 2EG9A 2JHFA 5T67A 1VRWA 1YO6A 2GZ3A 2OBYA 2ZJ0A 2ZYGA 4E30A 1ISFA 2FWMX 2JCVA 4OO3A 5DCUA 1D8AA 1NVGA 4KUHA 4MPDA 5JAZA 1PJ4A 3DL2A 1PJQA 3K31A 4Z9XA 4PGFA 5TRTA 4NK4A 1U4OA 3AI2A 2C07A 4KZPA 3GGPA 3NAQA 4MIOA 3TL2A 3UH1A 3WBFA 5I9NA 2G1UA 4WLNA 4XJTA 5KIAA 5KVCA 4KTTE 1ADBA 4PLHA 3RVDA 1BSVA 3OEYA 4AJNA 1KEUA 1IPFA 4GL4A 2DLDA 1FDTA 1KC3A 1HLDA 1KVTA 3CE6A 3IJPA 4U5QA 2WD7B 3TZKA 2D4AA 2YQ5A 1O9BA 1WDKA 1T25A 1JAYA 2PK3A 3GN1A 2EKQA 4CM7A 3HWRA 3KLMX 4NR0A 1PJTA 4MVJE 1IZ9A 3BHJA 2X9NA 1QYXA 3SXPA 4IIVA 3WSVA 3KETA 1HE5A 3AUTA 3QVTA 1UR5A 3V8BA 1PL8A 4DYDA 3H9UA 1SPXA 1KY5A 1KS9A 2GN4A 4LK3A 4CQMB 3JYNA 4PLZA 1ZMTA 1SCUA 4Q3BA 2DBRA 1ADFA 4IS3A 1LI4A 5JE8A 1RM0A 1MX3A 1Z73A 2GD1O 1O89A 4MVJM 5THQA 3KXDA 3VC7A 4LW8A 4FFNA 3HFSA 4L0QA 1OZAA 3UF0A 3Q2KA 2H5LA 1TT5A 2EP5A 2EXXA 1OC4A 4D44A 2VN8A 3OHSX 2EERA 3K8ZA 2YYYA 4YAKA 3K2EA 4BNYA 4AJLA 1PJCA 4QO7A 3QA9A 1Y8RA 1NQOA 1XDWA 3VPFA 4BO7A 1UAYA 4S3MA 4I9UA 4DPMA 4JX8A 1YJQA 4G2NA 2ET6A 3AM3A 3LC7O 1P31A 5BSGA 1P1KA 5MGBA 1OI7A 5CDUA 1E7WA 5DOVA 4YT8A 3QIVA 5B12A 1KBZA 5A9TA 4U6SA 2YHUA 4UUOA 3ZDFA 1EEHA 4IXTA 3DZKA 4CQLA 4WJZA 1UZMA 3UXYA 1R4MB 2CF5A 5C37A 2QZ9A 3DC2A 3LT2A 3D5QA 4QQRA 4FFMA 2GYYA 4CMHA 1AUPA 2AE1A 2DTXA 2YDXA 3A28A 1EUZA 2Z1MA 4CMKA 5KTKA 4LN1A 2H9IA 1UDBA 1DO8A 2UYYA 2J6IA 3BTSA 2YFQA 3MJCA 4PLPA 5BSEA 4CLRA 4MKZA 3JQ6A 3PDUA 4RQUA 4DYVA 1E7MA 1JQBA 3NJ4A 3EMKA 3GZNB 2VT2A 1HLPA 1U8FO 3GNQA 5G0SA 4ZJUA 4FDAA 5LDGA 1YL6A 1H5QA 3VZSA 4XB2A 4NQZA 3U0BA 1ZZEA 3JQ8B 4Q3AA 2BMAA 4JNKA 2W90A 3EHEA 1GUFA 2DQ4A 1DIHA 3JTMA 1YDEA 1ZSNA 2AEFA 3VZRA 4Q3DA 2NSDA 3DOCA 4W7IA 3TPCA 4BNGA 4OJNA 4GAEA 2NU9A 1TT5B 4RF2A 5IDQA 2EJWA 1N2SA 4GBJA 2WYUA 4AL4A 4EITA 1IYZA 2A9FA 2FRDA 1W8DA 4B7UA 4BKQA 1DAOA 2PZMA 2CVQA 4P4NA 6ADHA 3WBBA 4J1TA 1NXQA 1KEWA 3IP3A 4WLFA 2YUTA 4Q3NA 1ZW1A 4R51A 2VT3A 3K92A 3D0OA 1D1SA 1PZEA 1EFKA 3CMMA 4XYGA 4RL6A 4CQLB 5I9LA 1WAMA 4RVSA 1DAPA 1PS0A 2UUOA 3FSRA 1BW9B 2FHSA 2D3TA 3WB9A 4GLOA 4ALLA 4CR6A 1E0DA 3LF2A 3BMNB 3RC7A 1S6YA 3JYLA 4HFMA 4QUKA 1MP0A 3SC4A 2B36A 4TQGA 1ZK3A 5CG2A 1PL7A 2ZYDA 2FN7A 4W82A 2PGLA 1QKIA 3TZCA 1F12A 1EUDA 3DBRB 3OIFA 1H6CA 3EYWA 3OIGA 2V65A 1O94A 4CLRB 4NFSA 4YTEA 2UUPA 4MVJP 3MEQA 2PR2A 1T2FA 4I9NA 3JQDA 5TF4A 1UJMA 4OM8A 1I3LA 2NTJA 3H3FA 4M89A 3IP1A 5F5LA 3OJOA 4GSKA 4PG8A 3GAZA 4ND3A 2AHRA 4IMRA 1Z7EA 4RLHA 3FF4A 3T7CA 2B4RO 3OSUA 4J0EA 3BTUA 4M49A 1Z75A 4EW6A 3DBLA 4XR9A 3AOGA 3B20A 3H5RA 4ONEA 3OQBA 4C7KA 4CM5A 3GY0A 3MJ4A 4WPGA 3Q9NA 4CM4A 3BXXA 3FTPA 4BL5A 1E92A 3QJ5A 1LEHA 4ZRMA 3AUSA 1S7CA 1M76A 4NPCA 4M87A 3RFTA 5JAMA 3EY4A 1ZK0A 1X1TA 1ENZA 4BO6A 3HDQA 1HDOA 5A5FA 3ZU4A 1WP4A 5L4NA 4XQ9A 3RJ9A 4CL3A 1HKUA 1MXHA 4MVJI 3OECA 5HS6A 2PFGA 1YQDA 1MG5A 2ZTUA 3AI1A 2C7GA 1WNTA 4O0LA 2X58A 4R1NA 3JQCA 4LSMA 4RVDA 1I2CA 1V6AA 3EW7A 2GZ1A 5I7FA 4CMGA 2QG4A 2QW8A 2B35A 1G0OA 3I9KA 4YJFA 4ZVVA 3RBZA 5LDHA 2JKVA 4QXMA 1Y9AA 3M2TA 2I3AA 2BELA 3E03A 3L4BC 1LSOA 4L9RA 3QQPA 4FGWA 3MCVA 4H16A 3ZGYA 1C1XB 3A1NA 3BAZA 2D8AA 4IQGA 4XWYA 5BNIA 3FR8A 2PZKA 3NTOA 4PZCA 3RC1A 3W4KA 1XYGA 1DLJA 4Y98A 1GQYA 1QP8A 1XKQA 4INAA 1HE3A 4IS2A 1ORRA 2CVZA 3DXFA 4RF4A 1EVJA 4BV8A 4TRJA 4BO4A 4ND2A 1ARZA 2I66A 3GMDA 4A73A 1NQ5A 5L7WA 4CR7A 1C14A 2WD8A 3A4VA 2QRJA 2AXQA 1E3SA 1LSSA 4HNHA 4OXYA 3CPSA 3DHYA 5I7SA 3O9ZA 2CFCA 3PHHA 4CM4B 4OKNA 3I9NA 2P91A 1KVQA 2C7VA 4XYEA 5KCZA 1KVUA 3VPSA 1EK5A 1Q7GA 2ZTMA 1VL0A 4L75A 5FYDA 2C0CA 2C20A 1LJ8A 1TXGA 1GADO 4DPKA 1VJ0A 5CG1A 5IG2A 2FPIA 4FFRA 3BMQA 2JD0A 2PD6A 3KEOA 1E7YA 4XJSA 1NFRA 1UXGA 1EFLA 3PPIA 4E0BA 1A5ZA 2C2XA 2WYWA 5CHEA 3EUWA 4O5OA 3GLQA 3UOGA 1L7EA 3HADA 3PJGA 3V2UA 3TDKA 2F1KA 1YOVB 2AQ8A 4KWIA 3BHMA 4FOSA 2FPGA 1TB4A 3A14A 4K6FA 4D3SA 3JQ7A 5F3RA 4EI2A 4J1NA 4R41A 2D0IA 4GSLA 4H15A 1T1SA 4FGSA 2WM3A 1DFGA 1LDEA 2VNAA 4NBVA 3FPCA 6LDHA 4YPOA 5A03A 3OJEA 3WGGA 4IJKA 1EQUA 4GX5A 2QRLA 3JYOA 5A3VA 4XX0A 3I1JA 3ASVA 1CRWG 5I7VA 1U3TA 2Q1UA 2DVMA 1ISIA 2DFVA 3KTDA 1OMOA 3L4BA 4E21A 1MUUA 1VSUA 3O8QA 3S2IA 1J49A 3L6OO 1DB3A 4LRSB 2NVBA 5ER6A 2C59A 1T1RA 4JQCA 5KJFA 2PD3A 4JP3A 1YGYA 4Z0TA 5T8KC 3ZWVA 2DU8A 4D46A 1U2DA 2ZB4A 2H6EA 2WMDA 4HP8A 3ZV5A 4D41A 3V5NA 5A9SB 2IODA 2YZ7A 1UZLA 4M8SA 2HJRA 3PZRA 2DPHA 5DBFA 4RJTA 4BMSA 3ADOA 4DLBA 4QFCA 5JDIA 4AJEA 4QX6A 3ZI0A 1G0NA 3FTNA 4BNVA 3HQ4O 2DBQA 2JFGA 2GR9A 1XQ1A 3KRTA 4KDEA 3IC5A 5F1KA 1TA4A 3RC2A 4LMRA 4MJLA 4NZ9A 2BFAA 3FWNA 4FCCA 3C7DB 5KVSA 1NASA 4CODB 1BMDA 4XZ3A 3Q2IA 4UAGA 5TS3A 4WNCA 3PLRA 5H83A 2Y1CA 4XDYA 1NHWA 4GMGA 2WE7A 5JC8A 1NAIA 1LQTA 3KV3O 1V3UA 1JKFA 5L4LA 2IXBA 1U9JA 2DFDA 4OAQA 1VL8A 1ONOA 2Y1FA 2BFOA 3D1LA 3I5MA 2YQ4A 4I5FA 2GNAA 3NGXA 4BNLA 2CD9A 5DZSA 5DNAA 3R6DA 2P5YA 4OQYA 1B15A 2W4QA 2OP1A 4AICA 1D4FA 1I33A 4MVJG 4N7RA 4QECA 2YFHA 3O8QB 4E13A 3VTFA 5A02A 3W8DA 4B79A 4TKMA 1E6EA 4FJ2A 2X8LA 2P5UA 4FOOA 4E5MA 4E2WA 2Z1NA 3FBTA 3G0OA 4YWJA 4PG4A 3DDNA 3TWOA 1PZFA 4J4BA 1HYGA 3LT1A 3GG2A 2AA3A 1T4BA 3LF1A 2Y1EA 4B3IA 4LMPA 4E5YA 1NQAO 1QSGA 3PHJA 2ZQZA 5A9RA 3D3WA 1BXGB 2QRKA 2PLAA 3QP9A 4B4UA 4OKIA 4OQZA 3OA0A 3DMYA 5IXYA 2VZ0A 3RBXA 1NPDA 2DBZA 3RI3A 4B7XA 2Y05A 5JMWA 1R6DA 5ICMA 2V7PA 4L76A 1BRMA 4Z9YA 3GR6A 5T8KA 4NBUA 4DQVA 1ZKMA 5L51A 3BZUA 1UXKA 4E6PA 2RHCA 4F3YA 4QSMA 2Q1WA 2HMTA 1N9GB 1HL3A 1WDMA 3HN2A 4NMHA 3LLVA 4ND4A 2R2GA 2YHIB 5A06A 1XR3A 1V0JA 2XF8A 4TKLA 3F9IA 2ZCVA 3L6EA 4RZIA 3UW3A 5L4SA 5ILGA 1VM6A 3O03A 3VTZA 1XSEA 3RFVA 4E2YA 2NNLD 3WQRA 4UVHA 1BGVA 3DZJA 4U0JA 4BNFA 3NDIA 4YAEA 4BS9A 2YJZA 3DOOA 1I32A 3DHNA 4BO8A 1ZK1A 4HX5A 1WWKA 2NACA 3PJEA 3TOZA 3UICA 4YEDA 2VRCD 3PLNA 3KM0A 1ISMA 1DFHA 3C1OA 3IKTA 3KYDA 1PJ3A 2Q4EA 5EMHA 2BFPA 3Q9UA 4CLDA 4NU6A 4YT4A 2HDHA 4GGOA 4S1VA 4IY1A 5ICSA 3WNQA 1IE3A 3T4EA 1JKJA 2CY0A 3KSUA 4K9DA 4AJJA 1BXKA 3SBOA 4BKPA 1K6IA 3ONFA 3KOUA 3I23A 1Q7BA 4HY3A 3QE3A 4B7CA 2HMUA 4P38A 3ETDA 5CFZA 3COSA 4TRMA 4ALKA 3JD4A 1EE9A 2WTBA 1PQPA 3ZNOA 2OL4A 1ADCA 1J5PA 3UN1A 2LDXA 2VRCA 1GYPA 4A27A 3LC1O 3RUCA 5B1YA 2Y99A 2VWQA 3CH6A 4KWHA 3HDYA 2VWGA 3LC2O 4BNWA 1PS8A 5JYEA 3NYWA 2J8ZA 4G65A 1I01A 1AHHA 1DSSG 3WJAA 2V6FA 1IPEA 4WOJA 3D7LA 4PRLA 4E31A 4TVBA 5K0ZA 3BMCB 1LC3A 3S55A 4KP7A 3NEPX 4Y8VA 4I8XA 3L0DA 4II2A 4E5KA 1C0LA 4CM1A 2I3GA 5JYDA 4EEZA 5K9ZA 4HUJA 4DLLA 1UH5A 2JCYA 4EJ0A 3F1LA 2DTEA 1UXHA 3GVHA 1FK8A 4XCVA 3G1TA 3KYDB 2NTVA 4MKXA 2E6UX 4DBVO 4YYZA 4WOKA 4N5NA 5HRUA 1WZIA 5L7TA 1U3VA 2VHYA 5CDTA 3HG7A 2AQKA 4MVJF 4UEJA 4CM9A 3M1AA 4R54A 1P1FA 3ADPA 1IL0A 1WDLA 2BF7A 4FS3A 3WYBA 4HNGA 5G4KA 2F00A 4IZHA 1B14A 1MLDA 3OQ1A 4DC0A 4BO9A 1PGQA 3L07A 2AW5A 3VOSA 2GPTA 1CQIA 1Q2XA 4K26A 5DDIP 3MJVA 4M1QA 3CINA 3ZU5A 1J6UA 3JCZA 1E3WB 1G6KA 4PLVA 1C0PA 2EWMA 2OBNA 3JD3A 4EJMA 2I67A 3DZGA 2FSVA 4CLXA 4F46A 1N1GA 3JSAA 1H9AA 1PX0A 3S1LA 1ZNQO 2QYSA 2J5QA 3D4PA 2G17A 1R0KA 3TFQA 4OSPA 4E12A 3MTJA 4BVAA 2D5AA 4UREA 4JJGA 3G17A 3ZHZA 1I24A 2HMWA 2YV3A 4R9RA 1YE3A 1XCBA 1EBUA 1ZSVA 3F6YA 3IQDB 3JQ9A 2AEJA 3I9OA 3SVTA 3QVOA 1EBFA 3GNSA 3ZV3A 5C3MA 2EGHA 4UVGA 4IQ8A 4WUVA 4DIFA 2PTGA 1CYDA 2Q3EA 1MC4A 2EW2A 4J2HA 1HE2A 3WGZA 4XGNA 1N92A 2BFMA 3C3XA 3GVCA 3ZNPA 3PEFA 3GHYA 1R4MA 1E77A 1A7AA 1I3KA 2Q2WA 3P2YA 2J3IA 4WLUA 4GI2A 4D3DA 4E33A 3HSKA 4TVOA 3ZU3A 5FWNA 1UDAA 3WG9A 1MC5A 1I8TA 1SEVA 5G4KB 3RWBA 4NNJA 5H81A 1BVRA 1DFIA 1FDWA 3SLKA 1VL6A 2FZWA 2HJSA 3OF2A 4FFOA 5COBA 3WDSA 1PWXA 2X22A 2QX7A 3GZNA 3ZNQA 3ZWYA 5GZ1A 3CKYA 3I9JA 5A5EA 1T2EA 2EP7A 2O7SA 3GG9A 2P9GA 1XU7A 4F6CA 5F21A 4Q39A 4WLOA 5JLAA 2ZCUA 2GDZA 3JQ8A 1N7HA 1NFFA 1NWHA 4XD2A 1OAAA 4BUCA 4YJHA 4KDFA 4N5LA 4D43A 4CLEA 1Q0HA 2Z5LA 4WGGA 4GH5A 5IDYA 1HDXA 3G3EA 3FBGA 4PLWA 3M1LA 1O8CA 2OMEA 4IDGA 1HF3A 2Q46A 1FMCA 3U62A 3RUHA 1GPDG 4CV0A 2TMDA 2QZZA 1LNQA 1B26A 2FPPA 2HSDA 2XOXA 3H7AA 5GY7A 3AM4A 2HKIA 3QLJA 1W6UA 3DQPA 4JXKA 4BMNA 4PLTA 2PY6A 1ZCJA 4BV9A 1RPNA 1QLJA 4BMVA 5IZCA 1V3VA 3GDFA 4P4LA 2YW9A 3P2OA 1BW9A 2EIHA 4FBGA 1Y8QA 1BHSA 2DUUA 3W4IA 1P9LA 4IMPA 2CDCA 4UVDA 3W6ZA 3BMNA 5FEUA 1EDOA 3GT0A 4R1UA 4O63O 3AOEC 4WLEA 3OJFA 1P74A 4MIYA 4B4VA 3DBRA 1ZMOA 1DXYA 4QT0A 1F14A 3VVCA 1DC5A 1M67A 3WS7A 1A9ZA 3HFGA 3OMLA 2IZZA 3VVBA 2EEZA 4NDNE 5G2OA 1I0ZA 2GLXA 1LDYA 3ZCXA 5GZ3A 4AJPA 4NIMA 3PVZA 3WQSB 1GFSA 1GYRA 2YY7A 4BB5A 3F4BA 4GX1A 4R5HA 4UUPA 1WVGA 2C29D 4R4JA 4FSHA 4BIIA 1B0AA 1YBAA 2RCYA 4PLFA 1JAXA 3ZW9A 3NJ8A 4NI5A 4YJHB 1E3IA 3VHRA 2G76A 2GRAA 5AXDA 2JD2A 5IXSA 5C7OO 1Q0QA 5ENDA 2HQ1A 3WMXA 5JAIA 5EINA 2O3RA 4I08A 3MWEB 1GR0A 2OZPA 2WSBA 1P45A 4TWRA 1BXZA 4J9VA 3IL2A 4DPLA 1EQ2A 3GEGA 4IDBA 2ILTA 1T26A 3H2SA 4FJ0A 1T2CA 2CDAA 4J4TA 1A71A 3TSCA 4EUFA 3WNVA 3TF5A 3ASUA 2V6MA 4MP6A 3A9WA 2HLPA 3MOGA 5L7YA 4CMEC 1H94A 3ZWOA 1LDMA 4FQ8A 1Y8QB 4LGVA 1GAEO 2H63A 4GGPA 5FI5A 1DRWA 4R69A 3GZ4A 1GTMA 3FNFA 1W73A 4IGEA 3JD0A 4BNJA 4CUJA 1CF2O 1RM5A 3GVPA 3OA2A 4R5MA 1U7HA 5TJ9A 4DMMA 5ITVA 3O4RA 3EVNA 1DRUA 4F45A 2Q99A 2QIOA 4MINA 3FPLA 2OOSA 1X1EA 3TZQA 1QORA 3ZW8A 5JPIA 1Z74A 1K6JA 4Y6PA 5AQ1A 1C1XA 5AXCA 5C7LO 4PVDA 5L3ZA 1GD1O 2Z95A 3LVFO 3ZZNA 5CDYA 2AE2A 2NQ8A 4NH4A 4IJWA 2DBVO 1R0LA 3EZYA 2A94A 3IJRA 1L7DA 4IXWA 3AU9A 5K6AC 3OIDA 4B4OA 3AOEA 2HRBA 2HK9A 3ORFA 4HBGA 4J90A 1JLLA 3C8MA 5ILOA 1HDYA 4NFYA 1NPTO 3PQEA 3WR5A 5BSHA 3QY9A 4FN4A 1WZEA 4E2XA 2X0NA 2GO1A 4XYMA 4IDDA 3C85A 5EPOA 1TVEA 4PRKA 4DWVA 1I5RA 4DC1A 2QQ5A 1R0SA 4M54A 2OHXA 1E1NA 4NG5A 2PZJA 3PIDA 4D0RA 3JQBA 4K6CA 3HB4X 4ZQBA 3DONA 1PGNA 1XHLA 5KJEA 3B1FA 3E6AA 1FDSA 4OMUA 3W1VA 1DJQA 3RCBA 3R3JA 4CMBA 3X2EA 1NM5A 3PWSA 3EAGA 1DLIA 3NGLA 5EL0A 2O3QA 1ISHA 5ENVA 1LLQA 3M2PA 4L4SA 3KZVA 1G1AA 1GQ2A 5EN4A 4JN6B 1KEPA 5AOVA 1P1HA 1NP3A 1Y6JA 3AW9A 2DC1A 1PJSA 5IZ4A 1D7OA 1HSZA 1YOVA 4WEQA 1P1JA 4YA6A 3S2GA 1NHGA 1PS9A 3WGYA 3BHIA 1YKFA 4NFHA 2B4QA 1AHIA 1ZEMA 3N58A 3PQFA 3TL3A 5IAAA 3HNPA 2NUAA 3E5RA 1E5QA 7MDHA 3RIHA 4YT2A 3WQQA 3KO8A 4JBIA 3DFUA 4WKGA 4DLAA 8ADHA 2PGDA 4A10A 4W4TA 5B4VA 4WCFB 4XIYA 1GL3A 3DO5A 3U4HA 4CMEA 3IDSA 1ML3A 2AEMA 1P33A 1KETA 4MVJD 1X15A 1T2AA 2X5OA 4DVJA 3F5QA 3P5SA 4KQWA 4XIJA 3ROKA 2B69A 2PKQP 1YL5A 1GEGA 4RF3A 4GMFA 4IBOA 5DCYA 1SOVA 1B8PA 3NX4A 1YBMA 4GLLA 1LDGA 4R9SA 5JDIC 4DBZA 1GEEA 5BNTA 2BKAA 2A92A 2UVDA 4Q3EA 4YRAA 1E3LA 4W99A 5KJ6A 2R00C 5EIOA 1PWZA 4PG7A 3IKVA 4XRRA 3WICA 1E1MA 1JWAB 5IJZA 1MFPA 4CMIB 1CDOA 3GGOA 1SEPA 3DZHA 3I6QA 1PTJA 3ON5A 4TROA 4CUKA 5K6AA 1CIVA 3H65A 5A9SA 2TMGA 3R3SA 3RROA 5JCXA 1A4UA 4Q3CA 4RLSA 4NBTA 3RAJA 1WMAA 4OIMA 3D5TA 4MVJA 3PIIA 3EDMA 4UUMA 2GGSA 1DEHA 3NV9A 5KOIA 4ROSA 5JW6A 1GQQA 1NVTA 3HN7A 4I5EA 4PVCA 1HETA 1SO8A 2P9CA 2O2YA 4H7PA 5HTOA 1EE2A 1PSDA 1VJTA 2BD0A 5DULA 2C54A 1IHYA 3GRPA 4AJIA 4NU5A 1MXFA 2HAEA 4GWGA 3NT2A 5F1PA 3AWDA 4BGIA 5IN4A 4ALJA 2VHWA 4IIUA 1U5AA 4X54A 2VNSA 3PFWO 3LSYA 4J91A 3RJ5A 1E3JA 3H4VA 5BR7A 2NV6A 3KHUA 5AVOA 1NR1A 2O48X 4BGVA 4G5HA 3RSHA 4D45A 1SC6A 2JFHA 1GV0A 1VC2A 1YQGA 3EC7A 3LU1A 4ZQFA 4CV1A 3WFIA 4H3VA 5IF3A 1SOWA 2ZATA 1GUZA 3SX2A 2Q50A 5B37A 3GPIA 5JFOA 4EEXA 3K6JA 1IUKA 3GQVA 3L9WA 1EMDA 3U49A 1D3AA 4W9NA 1PGOA 2B0JA 1QYVA 2I5PO 4DGSA 3N74A 4KQXA 3WGQA 4OOEA 3BMOB 5L9AA 3CEAA 5JSFA 1U3UA 4HXYA 3B1KA 1DDOA 3AFMA 4AJHA 4J2OA 3KLPX 1EZ4A 4ZHSA 2X6TA 2CDBA 1ULUA 1BXGA 2RIRA 1B16A 3JV7A 3O26A 4Y9DA 2R00A 5JY6A 3NDRA 4AJ4A 2YV2A 4R1SA 1ONPA 1U4SA 5TSDA 2FY8A 4JJIA 3K30A 3I9LA 4RQTA 1CERA 3GHHA 3DBVO 3TOXA 3DZFA 4XYBA 2OP0A 2X0IA 3CSDA 3JYPA 4L73A 3GGGA 3DBHA 4URFA 1XIVA 2E4AA 1U3WA 4TZKA 3UCXA 1N9GA 2O3JA 4Z0HO 5CPFA 3NTRA 2LDBA 3MZ0A 1I3NA 4F6LA 5L45A 2YHIA 3GEDA 4OH1A 4EJ6A 1JA9A 4L4XA 1Q0LA 1KVRA 1E6WA 1TI7A 3F5SA 3SC6A 4EDFA 1QLHA 2HK8A 1E1KA 1ENOA 2V6BA 4JROA 1PQUA 3DAGA 4D42A 1E3EA 3U5TA 3PYMA 1AE1A 2OXIA 1EVYA 2POQX 2D59A 1A27A 4GQAA 1JN0A 1GYQA 4JIGA 3DOJA 2IEDA 2RH4A 2CUKA 3F47A 1Z82A 4NJMA 5JDCA 2D5CA 3ZHBA 4RVUA 3ZWMA 3FR7A 1BDMA 3I4FA 4ZQEA 2J5RA 4M55A 5U4QA 3CUKA 4TZTA 3H8VA 4FB5A 4D3FA 3TN7A 1P3DA 3PXXA 4FW8A 1H93A 4FR5A 3FNEA 2WYVA 4G81A 2Q4BA 1V3TA 4J0FA 4XRGA 1YB5A 4NJOA 4RF5A 2VHZA 5I9MA 3WFJA 1E1LA 3AY7A 3RU7A 4EUEA 2EV9A 3E48A 2AG5A 1ZIDA 1RM4A 3VDRA 1DIGA 1PGPA 4OHUA 1H6AA 3WSWA 3QRWA 1H6DA 2ZB7A 4MVJH 1DHTA 2X9VA 3OBBA 4JCOA 4QEDA 3VKUA 5CEFA 4A26A 3MJTA 3C7AA 3MWDB 4CL8A 7ADHA 1HTBA 4J9UE 3OICA 2PH5A 5ER9A 3C1TA 3VH2A 3DBHB 5T6BA 5F1OA 2RBEA 4B8ZA 1LA2A 3ZN2A 4KUEA 1JW9B 1TLTA 3ITKA 4LVCA 4MOWA 3QVXA 3WXBA 1DIRA 3H3JA 2H1SA 1EVZA 1T4DA 4TSKA 3PZBA 4HFJA 1UUFA 3W8FA 5MDHA 2I99A 2PZLA 2A35A 4JLWA 3WIEA 1WXDA 3BMCA 3OP4A 4XR4A 5KNLA 3GK3A 3OJLA 3RKRA 2ZQYA 1A4IA 2FP4A 3U4IA 1ZJYA 4NJMB 4RZHA 3ZHXA 2GF2A 1F06A 2GUGA 4KMSA 1MGOA 3VPHA 2PKQO 1N1EA 2X7HA 3I9MA 1OFGA 1SB8A 4JGBA 1DIAA 1EK6A 2Y0DA 3K73O 1IULA 1X0VA 4J6FA 2P2SA 4BQRA 2D1YA 3PFFA 3JQFA 3CIFA 3PHIA 4LCEA 2BI8A 3ICPA 1NFQA 4AJ1A 4O59O 3IS3A 2E49A 5TLSA 2RHRA 1Y9EA 2JD1A 3P7MA 5IDXA 2O3UA 1PZGA 1SNYA 1HDRA 3AUAA 5IN5A 4DIOA 2Y1GA 3PJDA 2BI7A 2VZ9A 1SZJG 4XQEA 2WDZA 1NAHA 5G0TA 5BQFA 3GC6A 1GV1A 1C0KA 1SB9A 3QVSA 5EERA 1Y1PA 3JQ9C 4XQCA 1E3WA 2O4UX 4ND5A 2ZB8A 5HWSA 3PQDA 2B83A 1XA0A 1NPYA 3U09A 3OFSA 1IOLA 5CP8A 4BNMA 4Y6RA 1DBVO 3WWYA 3EK2A 3V2GA 2BHLA 1FDUA 1YS4A 1PQWA 1I2BA 2QYTA 4BNZA 3FI9A 2CMDA 3PHLA 2O2SA 1IB6A 2CSUA 1D1TA 1KOLA 3WWZA 3KYCB 4P8RA 2UV8A 1P1IA 5B4UA 3GUCA 1DHRA 3DAFA 1ADGA 3QW2A 1C1DB 4YT5A 1B7GO 2C5EA 2VUTA 1R66A 1YL7A 3JD1A 3FD8A 3JQAD 1TEHA 1NTOA 1Q7CA 1R15A 3L4SO 5TT1A 5TT0A 2O3SA 5U9CA 2W2KA 4OGWA 3LT0A 3JQGB 4D79A 1LC0A 4KUGA 4UULA 4RGBA 5IFLA 1DC4A 1UZNA 3AFNA 4A5OA 3WGOA 4CM3A 4Z6KA 4BO0A 1UXIA 2CF6A 2OUIA 1Z45A 4ITUA 4QFDA 4AJ2A 1HEUA 2P9EA 3OH8A 1DOHA 5TGDA 1YH3A 1MFZA 1BVUA 4L8VA 4ZRNA 3UCEA 4KOAA 1GZ3A 4IGFA 1I36A 5IZCC 1Y81A 4FC6A 2ZK7A 1YBVA 3PP8A 4YAIA 3JQAA 1O0SA 8LDHA 4HWKA 3K9QO 5DT9A 4C4OA 1MV8A 1LU9A 5COQA 1RWBA 3DWFA 4R68A 1ISGA 1UDCA 4RVFA 5FFFA 4BNKA 4JK3A 3CZRA 3IOYA 1F8FA 3IMFA 4BOYA 2OO5A 3EZLA 1RYDA 1UAGA 3RUAA 2GCGA 2VZ8A 2RH8A 4B4WA 1OBFO 1LLUA 3GOHA 3I83A 4N18A 3D4OA 3WMWA 1ZBQA 1V8BA 1KY4A 3RD5A 4BKRA 1BTOA 1I2ZA 2HCTA 4RPKA 4J7CA 3FCOA 2I65A 4JP2A 1U5CA 4UVIA 5LC1A 2D2IA 4AFNA 2EGGA 2UDPA 5CAEA 4E3ZA 4YQYA 4BKOA 2W2KB 2HMVA 1LTHR 2Y66A 4YACA 4P4GA 1N8KA 2Q2QA 3ZH2A 4BKUA 4ZICA 2E82A 1QV7A 1F8GA 4WCDA 5C5IA 1PL6A 5EJ2A 1ZEJA 2FR1A 3RC9A 2Y1DA 3B6ZA 1ONNA 1LDNA 2X5JO 4YR9A 1VPDA 3VKVA 1ZK4A 2VHVA 3HDJA 5LCXA 2VQ3A 3ROMA 2NU8A 2C82A 1ZJZA 5CDGA 5EQDA 2IYPA 2OFPA 2FZEA 3ZU2A 4J43A 3JYQA 1YRLA 4IDFA 1HDZA 4ALNA 4I5GA 4WNIA 4XKJA 1HZZA 5JCJD 4YAGA 1AXGA 4IQ0A 2NVUB 2J3KA 3ETGA 3IAHA 2HU2A 3JQAB 3K96A 9LDBA 2DT5A 3LK7A 2PA3A 3OETA 5TIIA 3GMSA 4GX2A 3E9NA 3DB2A 1GZ4A 1M2WA 4IJVA 3ABIA 1IZ0A 1WLYA 4RV9A 3ZNNA 3RU9A 2J3HA 4PZDA 4OXNA 2QHXA 2RAFA 3PK0A 4Y6SA 5JO9A 1NQTA 2CVOA 2E48A 3PHGA 4FIZA 1ZFNA 2ZKLA 4LRTB 4WECA 1ZXLA 1QYCA 4YVFA 3TFOA 4WCFC 2X9GA 4CLOA 2FR8A 3PI7A 4BHTA 4CMJA 1P77A 5AYVA 4AJOA 2IZ0A 3WTBA 3SEFA 4PN3A 4R3WA 1JVSA 4DUPA 5EQFA 1QXSA 5T5QA 4JBGA 1I3MA 1VLLA 5JCJA 3W6UA 4BGUA 5A4DA 3WOHA 2VRBA 4YXFA 3P19A 3Q11A 1OOEA 5KVVA 3EVTA 4XEHA 1PJ2A 4J7UA 2AQIA 1TT7A 3HJAA 3Q3CA 3VDQA 3WX0A 1V9LA 4CV2A 4EBFA 4EUHA 1LRJA 3WJ7A 4XA8A 4PIVA 3VH3A 3S2FA 1H2HA 4XDZA 5C7IO 3RUEA 3JQBC 2W8ZA 3CXRA 4IUYA 4J1SA 2NM0A 3KVOA 1K6XA 3H6KA 4Z3KA 3D64A 5KKAA 4E2ZA 1RYEA 3NKLA 3WGIA 4RCVA 5DF1A 4ALIA 3GF4A 1HDCA 4IINA 4MDHA 1UP7A 2WE8A 1J0XO 3OQ6A 3QVWA 4TRNA 2NWQA 3INGA 4FFLA 3UFXA 1LUAA 4ZN6A 1UP4A 3MOIA 4NK5A 5HBRA 4EGFA 3H9EO 3OJ0A 1YONA 2VYND 3GDGA 2NTNA 4RPHA 1SBYA 3NUGA 2ZB3A 1LRLA 3VZPA 1JVBA 1ZVMA 2Q45A 1LSUA 4NBWA 1GDHA 1RKXA 3E9QA 4CLOB 4RORA 1MB4A 3AJRA 3Q1LA 4IDAA 4DQUA 5T64A 2JCXA 3VPXA 1AGNA 4E5PA 4QTZA 3RASA 1ZK2A 3D3EA 2IXAA 5G4LA 1Y8RB 1PR3A 3LZ6A 4U7WA 5KVQA 3G1UA 2AMFA 4XQGA 3GVXA 3D4NA 1YB4A 4GVLA 5THKA 2EKLA 3ANMA 5I8ZA 4GPD1 2Y0CA 3LYLA 3I52A 5U1PA 1HXHA 5I8WA 1LRKA 2Y93A 5TX7A 4RO0A 4OL9A 4RVGA 5TC4A 3HDHA 1X7HA 1V35A 5G0WA 4DIBA 4WCFA 3E8XA 2YDYA 4BNXA 4J4HA 1VI2A 2GASA 2VYNA 1Y7TA 1O95A 4PLYA 2BLLA 3KB6A 3V2HA 4CJXA 3GDOA 4FC7A 2WWRA 4BNHA 1UP6A 2NU7A 4PFJA 5A1TA 3ZWAA 4MP3A 3LLSA 3TJRA 4HFNA 5BT9A 2IEBA 2VYVD 2HK7A 2O7QA 3KSDO 2X0RA 2X0JA 5FI3A 3QWFA 3NRCA 3ENNA 1NWCA 3U9LA 2EF1A 5CEEA 4DMLA 1M75A 2GN8A 3F46A 4CMIA 4BNNA 2HO5A 4UUNA 3PWKA 1B8VA 1K3TA 3ZHYA 4DA9A 1A7KA 4XGIA 2JHGA 3DHEA 1FXSA 1R16A 4GVXA 3K2BA 2HRZA 4RPLA 2XPCA 1B8UA 5JNLA 3NTQA 3UAGA 1PR9A 3V1YA 4CM8A 1HZJA 1K2WA 3BIOA 1E6UA 5DOZA 2OGUA 2EKPA 3UGKA 1X7DA 2X1HA 3UCFA 4M86A 1YB1A 3I6IA 3PJFA 1U2GA 2DKNA 5KKCA 3AK4A 3E1KA 3UUWA 4J1QA 3UKOA 2VYVA 1DC6A 5DN9A 2DTDA 2VTDA 4YDRA 4BO2A 3H9GA 4I5DA 3PDJA 1YWGO 4UEOA 4FFPA 4W9NC 4WE3A 5BNFA 4AVYA 2BGMA 5G0VA 1CQJA 5DBIA 5ITWA 2B5WA 3RUIA 1O6ZA 2XXJA 1X7GA 1LSJA 1YQXA 3DZBA 4OSOA 2PNFA 4RPJA 3GA0A 4E5NA 4K28A 4GKBA 4OOFA 4ID9A 1H0KA 4Y67A 1VE9A 3QWAA 1QMGA 3RKUA 3UHAA 4XB1A 4YJDA 1XEAA 3JD2A 4K1LA 4NHEA 3PGJA 1E5LA 3IIEA 3WGTA 3W4JA 1MA0A 3NDJA 2VWHA 3ST7A 5DCWA 3QWBA 2VWPA 4OXKA 1IHXA 3FRJA 2Y68A 1M6WA 3ANLA 2VTEA 5JXWA 1FDVA 4YBZA 5A05A 3BTVA 1EUCA 2PKRA 3TRIA 1KVSA 4Z3DA 3KEQA 1P44A 5TQVA 2VOEA 3A06A 3BMOA 1M6HA 2EJVA 3DBLB 5DP1A 4R1TA 5F5NA 3RUFA 3LDHA 3PGXA 3SJ7A 4CM8B 2HMSA 3AY3A 4KTVE 1ULSA 4WEOA 5T57A 4AJKA 3NT4A 1K0UA 1IY8A 1ENYA 4BGEA 4LISA 3GNTA 2JL1A 4B8WA 3FNHA 4FD3A 1WPQA 3VH1A 4MP8A 3H9QA 2XAAA 3C7CB 3K5PA 3V1UA 1B3BA 1GCUA 3ZWXA 3WGHA 1SAYA 4ESOA 4JJFA 3LT4A 1H9BA 2NLOA 5JDCC 1KIFA 1T2DA 2IRWA 4D0SA 3ZV4A 1GU7A 3ETEA 4FJ1A 1KC1A 1XG5A 1VKOA 4IDEA 3HZZA 5GMOA 4U8GA 1ENPA 4BO3A 5A3JA 3AI3A 4ZU3A 3E9MA 2XXBA 4HADA 3FNGA 1A9YA 4PCVA 2W98A 2BH9A 3CMCO 1ID1A 2PWZA 3E18A 4YJFB 5HA5A 2J5KA 1AXEA 3IUPA 1QRRA 4DL9A 2GN9A 3N7UA 2JFFA 3GH3A 1HSOA 2JAPA 1SMKA 4Z9FA 3SJUA 3S8MA 1QR6A 3ONEA 3RQSA 2X5KO 1QV6A 3H9JA 3QSGA 2ZIZA 4DXHA 1EVIA 1RM3A 3HB5X 3DAPA 1QYDA 2CNBA 3ENKA 4XYLA 5L53A 5ES3A 1K89A 5EESA 3TZ6A 3NT5A 1XLTA 3BYZA 2V6GA 3PTZA 4BB6A 1W4ZA 5TJHA 4DQXA 2GN6A 3F4LA 4CLHA 5CDSA 1PZHA 4RDIA 1LBEA 1GPJA 1WW8A 2PD4A 2X23A 3BA1A 3ZWBA 1RJWA 2X4GA 3R1IA 5TNXA 1YVEI 3JQEA 1JDJA 3CTMA 3E5MA 1FJHA 3IUSA 3S2EA 3GN2A 4RVHA 5AXAA 1DPGA 3ZWPA 1YJ8A 3MTGA 4YCAA 4B3JA 5A04A 4I1IA 3ZWCA 2O23A 3MJSA 3BMQB 4ZQGA
chains in the Genus database with same CATH superfamily
4CEJB 1D4OA 4RHFA 5EVJA 1WF3A 3BXGA 4MX8A 2I9PA 3TQQA 4D46A 2IH5A 3L82B 4UEKA 2FWAA 4PX3A 1BN7A 5DFAA 2KB0A 3WNCA 5E7QA 4HAYA 4CMCA 4Y2VA 4HAVA 5M34A 5DXAA 5AI4A 3TE6A 1Q44A 5LLSA 2VP9A 2NVWA 1ZC4A 1T36A 3SVZA 3LQ4A 4FI3F 4IYJA 3ZD9A 5I48A 1OHHD 4FGJA 3FAKA 2XRZA 3VR6H 2XMBA 1I5OA 1Z8HA 1OWLA 3CZMA 3EZXA 4OHCA 1BYIA 4PCLA 4PPNA 3T99A 5ECYA 3QHQA 4XPZA 4DY4A 1TRKA 1Y6ZA 3WJ2A 4HWSA 3D59A 3SLGA 4WK6A 4CG1A 2ZJ1A 3NHRA 1NJGA 4RQAA 3WTCA 3GAFA 1PJLA 3JVIA 3NC4A 1T24A 4NOJA 5CMLA 1GRNA 4HDNB 3GAMA 3ZDCA 4MIEA 4PQRA 1JTVA 2UVQA 9ABPA 3THXB 3UMRA 1N6OA 3PRJA 4Y2TA 1UFQA 3QE9Y 2XRYA 2AR7A 3WVNA 3SWWA 4F1WA 4MAMA 2LVBA 1SHLA 3G79A 2FZ5A 4UU1A 4A6DA 4MO2A 4E03A 5KYTA 1YF3A 2FR0A 3GBVA 1HWYA 3NYRA 4UBNA 3T7EA 1KPGA 3S27A 4UNSA 4WVLA 1FYVA 4TLMB 1KY3A 2PGAA 3T3DA 5CFOA 5JS6A 2GF9A 4B40A 5JT1A 3N9IA 2PUFA 3ROGA 2ZZNA 1YJAA 1R0YA 2AB0A 3U9SA 3UVEA 4HNAB 3VSEA 4ARZA 4WADA 5TY0A 3MJEA 4UM5A 3RLFA 3L6DA 1TYCA 2HSWA 2N75A 4LVUA 1WVMA 1RJEA 5G0UA 4JI1B 4ZHQF 1HDGO 5B7GA 4YJ2A 2YC2C 3EBLA 1L9XA 4A03A 3KR9A 5KPDA 2PJRA 4ZQHA 2Z4SA 1TA9A 1QJCA 2AG0A 4AY6A 3BGSA 3AILA 2CK3A 4HNQA 4II3A 1EDZA 1R6UA 4JL5A 2AN3A 4MS3A 4W6ZA 4X8OA 2Q7DA 1G20E 2GZ2A 4NBRA 3QKUA 1HA3A 2HBZA 1YDGA 3EVZA 3N2GA 5T7BA 5GINE 2Q49A 3GAAA 5GONA 1WKVA 1KOFA 2D54A 1C0IA 2F59A 2JGRA 5JY1A 4L6AA 5L95A 1L6IA 2HTEA 2RGWA 3H2ZA 3A70A 1E18A 1ESCA 3IBSA 4X7PA 1XD2B 4D2IA 4JYAB 3T95A 1XVTA 4YROA 3F6PA 1JFTA 1EK1A 1F4VA 2JLBA 4FW9A 1NX6A 1U0OC 2IHBA 2XKAA 3INYA 4JC8A 3B9RA 2PX0A 3E61A 3ONDA 2FW9A 2H65A 1U7TA 3NZEA 5K3AA 2EHDA 2W6CX 4E4YA 1SXHA 4IRUB 1RQPA 1V6CA 5KWVA 2OBXA 1HT3A 4RBNA 2YVQA 3FN4A 1RXVA 1GKYA 3GP5A 5I5EA 2YCBA 3ICCA 3GLHE 1N0IA 2B37A 3AC0A 3I9V1 2NU6A 4LDAA 4N54A 4X84A 1I30A 2W2LA 4C30A 1XEXA 1HRDA 4J3FA 3ANNA 1H6BA 2NO0A 3IIJA 3TTYA 1JPUA 2XADA 2XVAA 1Z6QA 3LQYA 4YJ3B 1LLCA 4LPKA 3GUYA 2J08A 3BUSA 2A3RA 2HA3A 5A62A 1N5KA 2IYLD 1TK9A 2IYVA 4KODA 2VTBA 3EX7C 4YNBA 1EH5A 3C24A 3DT6A 4YB8A 1I5EA 4RDXA 4GX0A 2PEZA 1LX6A 3HJGA 4HGOA 1NR7A 1PU2A 3VZQA 3ECCA 3CNHA 1Z56C 1XRPA 3IEIA 3DEZA 5FWXB 1XGKA 2GCPA 2J3JA 5JNVA 2PS3A 1TECE 4CM6A 4PYMA 1XELA 2WG2A 1J25A 4RNCA 4TMYA 4TVKA 1TZJA 3L6UA 3CF4A 2FPUA 1YIOA 3I2HA 2WB4A 3ROPA 5AK0A 3TG2A 3LW8A 1JJ7A 1NNUA 4ZMSA 2DJIA 5C46F 4N7JA 5FOWA 1KNQA 4JUBA 3R0IA 2IPNA 1K8XB 4QXOA 5TE9A 3ROQA 4U39A 4DCTA 1VJ1A 1FF9A 5HJ7A 4Q9NA 2PU7A 3LDAA 2Y0EA 4M0LA 3RSLA 1HYHA 1H1LB 1ZH8A 2C2WA 2DAPA 3E3AA 3MB8A 4Q3KA 4US1R 1JMVA 2C3PA 3AV3A 4Z0PA 4E32A 1KMMA 5IAKA 4H1VA 3VNSA 3L77A 3LI2A 4Y18A 1DEOA 1MAAA 3DFZA 4LY0A 4MRVA 4ZD6A 1G9XA 1CY1A 1GN9A 2DR3A 2PV7A 1LDBA 4ALMA 1E2LA 4P7GA 2VPPA 2C83A 4NZZA 3I3SR 9LDTA 1PGJA 1E3MA 4IFBA 1FNNA 3G2MA 1CS4C 1V45E 2QR5A 1WPGA 2VK4A 1EKXA 2GPWA 3G5UA 4BO5A 4BAZA 4E14A 3L79A 3QKRA 4ON9A 4I1PA 5I4KA 1U6KA 1G9TA 9MHTA 2G80A 1P0FA 3HL4A 1I6MA 3MJHA 1AHNA 4R16A 4Y0AA 4O4HB 4FEYA 1VJGA 2PXXA 2ZP1A 1S2DA 3DW3X 3EBOA 4LXTA 5K0FA 2FZGA 1C3VA 4OHZA 1DO0A 2MSLA 4UXJA 1YRHA 2QY9A 4EVRA 1WIWA 2H1FA 5I7EA 5JUWA 4CEIB 2HHCA 2E37A 3OT4A 2BEVB 2EBUA 2R8BA 3HXOA 4OHRA 3NLLA 4CUZA 4K9NA 1OTYA 3EGDA 4D9CA 1HQCA 5DYYA 4XX1A 1RPTA 2HRRA 3ULKA 1GTRA 3U4CA 2GPSA 3G82C 1D1QA 5JD5A 5FF9A 3DMTA 3TKLA 1V4NA 5DO9A 4WNAB 5JNRA 4ZI3A 2O8CA 3N7TA 1N5MA 2WT9A 4P32A 1NMXA 4B84A 2P68A 2P69A 1W6RA 4J0JA 3IEPA 4QJ4A 4DHEA 4EA8A 1HE4A 4CW7A 5EWJB 1O5IA 1PYOA 4MR9A 1AG9A 3AM5A 4Y7CA 2QVGA 2VPIA 1T9AA 3ENZA 1IXYA 2R9VA 5BSFA 3Q0EA 4PHCA 3DULA 4QYMA 4LSWA 5COAA 1OKKD 2P9ZA 4KJZA 4EG0A 1QGED 4WD3A 2C1ZA 1RLJA 4MA0A 3TQHA 2QTAA 3O31A 4OU5A 4R2XA 1R4NB 4JJ7A 3VFDA 4A8HA 4KAAA 2OESA 3ZZ0A 5HIKA 13PKA 1CDEA 3BWDD 4AECA 1XUOA 5C4MA 3H6GA 3ECSA 4KQGA 1P2VA 1VRWA 3OURA 2OBYA 5T67A 3WADA 5AJXA 3FDIA 3RVKA 1W1UA 4E30A 2FWMX 2R5NA 4BVBA 4GKKB 5DCUA 2OWDA 1O5OA 2AUTA 1ECFA 2QD4A 5IC6A 5JAZA 3DL2A 2PT7A 3K31A 1APBA 4TN1A 3R5FA 1IEWA 4PGFA 4R7TA 5TRTA 5CXUA 2WM9B 3NH9A 4I6GA 4WXHA 4DR1B 1U4OA 3HU2A 4MIOA 2PZAA 3GGPA 1D4ZA 2FX5A 4PFKA 3QVJA 2GXSA 4QJBA 4KAFA 1B4DA 1TMYA 2OXRA 1YR3A 2OAQ1 1TIPA 3DHVA 1SQSA 2QV7A 3LBIA 4KTTE 4CQNA 2Y6VA 2DF8A 3RREA 1PR5A 1RXEA 1KEUA 2DLDA 4U3JB 3IP5A 2H1OA 1JLSA 3O73A 1KVTA 3TX2A 4E88A 2I2CA 2HWWA 2I3DA 3GJSA 3TZKA 1MQ9A 1FSSA 2B7CA 4D25A 1RJFA 3CVJA 3TLJA 4QUJA 5CH3A 5CA1A 1VMEA 3T3HA 3VV3A 2FFBA 2O2ZA 3H5WA 4G25A 3EZ2A 3H1EA 1KAGA 1OTXA 1J0BA 1KF0A 1BX0A 4NR0A 1FP1D 3AVWA 1IZ9A 2QGNA 2WINI 4M1ZA 5ESRA 2SECE 4Q21A 5C1DA 4WJKB 1JIXA 1N0WA 4C7OA 1SVWA 1UR5A 2OXEA 5DASA 1CQIB 1J2RA 4ZVKA 4DYDA 2O0MA 3M34A 4HZUA 5JECA 1KY5A 2BKLA 1N32B 1J90A 1KS9A 1GLVA 4D3XA 4QM7A 4CQMB 3IE1A 5F77A 4Z4GA 1SCUA 4NYIR 2WKSA 4NMXB 1LI4A 2AOXA 3LY7A 2WUEA 1MX3A 1Z73A 4KXLA 4MVJM 1L7BA 5THQA 3VC7A 4EABA 5KREA 4LW8A 2C04A 4FFNA 2XVZA 4ECAA 1FOEB 1TT5A 2CKDA 3BXEA 4IW3B 4D44A 2H9AA 1ZRSA 2I6QA 3OHSX 3R8CA 4EUSA 3PNMA 4UARA 1NZDA 1PJCA 2W2NA 4YDSA 1T91A 2H4JA 3VPFA 5EJ8A 5LZ5A 4X6YA 1UAYA 2OCIA 4L6CA 1GVNB 2MMCA 3OCYA 2O5CA 3T3NA 3LC7O 2A9KA 3F78A 4P4UA 5BSGA 3K20A 3ONVA 1MOZA 1SWWA 1OI7A 1DT5A 2RG1A 4FKMA 2VAVA 1R8XA 5EMJA 4ZDKA 3FBWA 4MS1B 3M6UA 4WI1A 3L7YA 1S96A 1KBZA 1VFNA 2WHEA 5A9TA 1A0OA 4U6SA 2YHUA 3BOSA 5MN6A 3DZKA 5KB3A 3SX0A 1DQRA 4WJZA 1B6RA 3OD5A 1KDTA 1L3CA 1UZMA 2LBPA 2X42A 1IG0A 1YACA 5E2IA 3SDZA 3DC2A 3TR5A 3ZCTA 5ABPA 2AUNA 4FFMA 1SVNA 1YE5A 2LCIA 3AIOA 4CMHA 3EPPA 2Y0PA 1YU9A 3H04A 1KH1A 2IOFA 2VH2A 3WWEA 4CMKA 1TJNA 3RUDA 2J7PA 2QLLA 2H9IA 2JBAB 1JT2A 4RKWA 4ZAVA 3OTGA 4RL4A 2QNIA 2OEPA 2YVUA 4MKZA 4QQFA 5DTIA 3ZIDA 3SEZA 3L8FA 2WU4A 3JALB 1Z0UA 3JQ6A 3N0TA 4JJEA 1KQOA 4RQUA 5H70A 3TE7A 4CZ2A 4J6EA 4DYVA 3EMKA 5FUYA 2VT2A 5JSKA 1JKXA 3DG9A 3HXMA 3KB8A 1JNXX 3K1JA 1L5VA 5F2EA 4GM4A 1GQRA 4LS3A 5HE8A 1L4KA 3VZSA 1H4SA 2X9LA 1Q6ZA 4JLSA 1N3BA 1E2GA 1VPWA 5BMVB 4AY4A 2YNMD 4XB2A 3RIYA 1DBRA 1Z22A 2OSBA 4ZYWA 2VTBB 3VZDA 4N3GA 3JQ8B 4XWWA 2BMAA 2QSYA 4EAAA 2BBOA 4URHA 5ITZB 1NUAA 3M83A 5EP4A 3T9EA 3DOCA 4OJNA 4BNDB 1G17A 2E1RA 4KO1S 1QH1B 1V1MB 2IU3A 1A9XA 3THYB 1U7DA 2WYUA 3KSMA 1XKXA 4IKPA 4JELA 5DHQA 2FRDA 6PFKA 1E98A 5DN6A 4B7UA 2UZIR 2AI3A 3UUEA 3LUDA 3WO0A 1CNEA 1DJOA 2DWCA 2JIQA 2CHQA 3IVMA 2L18A 4BFTA 1RRVA 1Z18A 4NYIQ 4WLFA 4HSGA 1LLFA 1UINA 2YUTA 3F5DA 1THTA 4Q3NA 1KI9A 4NYJR 3TFWA 4C5AA 4R84A 3O95A 3TLAA 3R3UA 4CQLB 4JGGA 4ZHQA 1WAMA 2GTPA 4B6EA 1VRCA 4WX2B 5I9LA 3FSRA 1BW9B 4I50B 3TSYA 2DG2A 2GSWA 1TCCA 2G04A 2VQSA 2VYFA 1RDFA 2Z56A 5HF9A 4YECA 4B3BA 4CR6A 4F9FA 1E0DA 1E64A 3LF2A 3RC7A 3BGIA 3ZEIA 4QUKA 1JHDA 1MP0A 2RGNC 1I1QB 4QD3A 3SC4A 2ORYA 2ZYDA 3I8OA 2FEOA 4YI5A 2PYIA 4JUDX 1C3LA 4Q12A 5CJJA 1J42A 4ZT7A 3DBRB 1H6CA 3OIGA 2V65A 1ABBA 3VNBA 4CLRB 3SZLA 3EQ6A 2OTCA 4YTEA 4AWBA 3D3QA 2ACVA 4EB0A 1T2FA 2ZI7A 3ETLA 5CH8A 1Q20A 1UJMA 10MHA 1R3UA 1YKSA 1I3LA 1J9EA 1EGMB 1F2UA 1TYEB 1W2WB 3SSNA 3IP1A 1Z08A 5F5LA 4H31A 3PICA 1JDVA 4YUXA 4NZOA 1FFXA 2FF5A 2B4RO 1VIYA 2CW5A 2NIPA 2QS9A 1Z75A 2XKJE 2NN3C 2OHFA 4X1YB 4WBXC 3VKGA 3B20A 3EODA 4C7KA 4DJEC 4ETNA 2NSYA 1Q91A 4GFDA 4DDMA 4WPGA 2OCPA 3U26A 1SHJA 1SQ6A 4CM4A 2XQJA 3VKFA 3KQSA 4RS4A 3FUVA 4WN3A 1TVKB 2E87A 1LEHA 1SC4A 3LPAA 3AUSA 3DPUA 3P27A 4ZRMA 1V7QA 4FU0A 4U7JA 3TB6A 5CAEA 3RFTA 1YKGA 5JAMA 1NJSA 1ZK0A 4WNYA 3K0CA 2I62A 3QELA 1UZAA 1QAOA 1XO1A 1WP4A 2CLCX 4ZCQA 1M83A 2H1CA 1UOQA 1HKUA 2JLYA 1Y82A 2J59A 1U3CA 1JX6A 3QVUA 1AS0A 2IUUA 4MRMB 2CJWA 4EQZA 3CEJA 3WK7A 3KR2A 1J0AA 2PFGA 2YICA 2IW1A 2ZVQX 4P7BA 5HS6A 2WJAA 2XBLA 2Q6LA 3QBJA 2C96A 3QUQA 1I3OA 2FQWA 1QHNA 3KP1A 3R5XA 1WNTA 3RDPA 4XPIA 5C9ZA 4O0LA 3MWGA 2X58A 3C3AA 4KU4A 4LSMA 2HPZA 3EJ6A 4Q1VA 4R1NA 4TOIA 1I2CA 3EW7A 3QF4A 2SNIE 1KDZA 2GZ1A 1IVYA 1TZMA 1JLHA 2B35A 3I9KA 4HDMA 4BU0A 1JG1A 1G8AA 3KZCA 4QXMA 1Y9AA 2GNPA 2IVFA 1QH9A 1EUDB 3M2TA 1M0WA 4NEGA 2I3AA 2R6AA 4BMCA 4OXXA 3NM5A 1U7PA 2QUBA 1SUIA 3G2NA 3LY8A 2JVJA 5CT4A 3QQPA 5AW8A 2K87A 3ZGYA 3A1NA 1R4AA 2OHOA 2HNAA 2HJHA 1KO7A 4XWYA 3N07A 1KA9H 3FR8A 2PZKA 4Z53A 1Y37A 2FMIA 4N9WA 3OPYA 3RS5A 4I36A 4INAA 1HE3A 4IS2A 2CVZA 1YZLA 3DXFA 5K0TA 1EVJA 1U2DC 4BV8A 2W93A 4ND2A 1FNCA 4Q48A 3D2AA 1ARZA 3LXRA 3GMDA 4A73A 1TQ4A 5L7WA 4KRFA 1C14A 1GA1A 4FIDA 3FZQA 2IH2A 1QAMA 5JIBA 1EWVA 1W5FA 2HRDA 1AGRA 4I3GA 1VYUA 4DLWA 4MAAA 1M2VB 1P3JA 3AEUB 2A30A 4MI1A 2CXPA 1AUVA 1KVQA 2JH8A 2P91A 4MGZR 4S35A 3GYBA 3AEKB 2D1QA 1KVUA 3Q7QA 4LZPA 1LGYA 3HYCA 2YN2A 4RABA 4X44A 1GOTA 2PQ0A 3P26A 1IY1A 3QOYA 3TSAA 3CPEA 3E53A 4NP6A 1Y7IA 2EATA 3L8CA 4FNAA 4IX1A 1DQPA 1I4WA 2A78A 2O2JA 3N0WA 1VJ0A 4P7KA 4BQIA 4EMBA 2RK4A 5CG1A 2FPIA 2MMGA 5HP4A 3SBXA 1XHEA 2JD0A 2Z3VA 4PPFA 2UZ3A 1UXGA 1T15A 4CEJA 4MV6A 3H42B 2DMRA 3STXA 2R6FA 3FGOA 3MS4A 3CUEF 1IQ0A 3GLQA 4FR0A 2TECE 4GICA 4IH4A 1KQFA 3QK7A 2O57A 1GU1A 3TDKA 1ZPDA 3SFZA 4D9JA 3U44B 1YOVB 4HPJB 4ECEA 5A3RA 3MWLA 3BHMA 4FOSA 2NXCA 4ZFNA 3QJGA 4MJ3A 4IGKA 4YRSA 3FOEC 1JYEA 2IGBA 4H2DA 4L9WA 4LCBA 2O0HA 2V3VA 3C2QA 3UG6A 3V33A 4ZJZA 3BGWA 4K6FA 3CX4A 4D3SA 4DJTA 5FHRA 5KX5F 5F3RA 2HHJA 4J1NA 4EI2A 4XFJA 4JI4B 1QF9A 4R41A 1M1NA 3WL6A 5HQ3B 4P3NA 5AW9A 1DJLA 3ABQB 2A2ZA 1R0BA 1LDEA 2VNAA 2Q0XA 3WBKA 1FJXA 5UKDA 5HPYB 5EAIA 5ALEA 1Y8ZA 3OJEA 1RC1A 4P93A 2M1XA 5FB3A 5K4GA 1L4HA 1AS2A 2WC1A 4GX5A 2OXCA 5LP6C 4JS0A 1TFRA 4B6QA 5ES4B 5JNWA 1WETA 1DADA 3JYOA 4IV5A 4NABA 3AO0B 2PUHA 5I7VA 4XWGA 4GR4A 1X74A 4HTFB 1OIXA 4E07A 5LYJB 1WZ2A 2EWVA 4XASA 1ISIA 1FMTA 3KU4A 1G5IA 4F4DA 1A5TA 1MUUA 4JX9A 3D0RA 4ZP1A 3W2GA 4P0PB 2VHUA 2ZTSA 4HNAA 1DB3A 1XZIA 3OM8A 4IO1A 3LY9A 4X9XA 2PO5A 2J9FB 1T1RA 5LPNA 4JP3A 3HVIA 1YGYA 4Z0TA 1OFUA 1W4AA 2VLBA 5T8KC 1U8UA 1FRNA 1Z4PX 2BOVA 2Y77A 4M1TA 4B47A 1HNWB 4EY8A 1EJ0A 2H59A 4I50F 4HP8A 4OREX 3WKCA 3OKCA 3G88A 4MVXA 1P9WA 4GQBA 1ZG3A 3UAYA 4CDMA 3TECE 1A3CA 2QV0A 3ZZUA 2WJHA 3PZRA 3PXCX 1J00A 3USZA 5KNBD 1NR5A 1MHTA 1ULBA 1BYUA 2JJQA 5I01A 2WMYA 5C2JB 4Q37A 1DG1G 2ZRHA 4N7MA 1M0TA 2JIBA 1P9NA 3BRQA 1SU6A 4Y9RA 3FTNA 4CFYA 4G3XA 2A4MA 1SQGA 4XSHA 2R1TA 3HDTA 4HI0E 2NXNA 2JFGA 2W6NA 3Q3VA 1AZLA 3TOSA 3VOBA 3IXMA 5F1KA 3OQMA 1TA4A 3RC2A 4AU1A 3HBJA 4NZ9A 4OK5A 4ZYYA 4RGYA 3C7DB 1JAHA 1NASA 1Y1KE 3TCKA 4MV3A 3LL7A 1QH8B 2PYDA 3T12A 5TS3A 4B74A 1T4GA 2EIXA 3KEGA 3PLRA 2FNAA 4NZNA 4QUAA 5H83A 2C3YA 2A1UB 4A6PA 4Y2JA 5JC8A 2YWXA 3HEBA 4F3CA 5K3BA 2HADA 3K8YA 4JA0A 3A2KA 3ORRA 1U28C 2WIDA 3KV3O 4F92B 1H2WA 3QLVC 4CRWB 1N3YA 2YH2A 1IM2A 1GPYA 1VL8A 2Y1FA 3F6SA 2BFOA 4N76A 3GRUA 4ZXFA 1Q95A 2BGRA 3HCNA 4HRYA 4KO8A 3KQYA 1VE1A 3NGXA 5E6UB 4BNLA 2VF2A 5SZKB 4X00A 3NHJA 3H16A 2P5YA 1I7PA 3FDJA 1MDFA 4PZAA 4XX0B 2AHOA 4Y9SA 1MN6A 5DWQA 2HIHA 4MO9A 3S7ZA 1L5HA 4EQ6B 4QECA 4BJHB 4BQNA 4FDVA 2YFHA 2WP8J 4P34A 1GARA 3O8QB 2GTIA 4Z4FA 3VHXB 1ZD9A 4AW9A 4F5WA 4M8KA 1YULA 5ESWA 1DMSA 2E2WA 1VZ3A 2J07A 1OWPA 3W8DA 4EVIA 2X8LA 2P5UA 1AK1A 4X6XA 2Q3BA 2Z1NA 3G0OA 1P0QA 2YW2A 1J8MF 3JZFA 4M2LA 3UATA 3GLRA 1RSZA 3U37A 5FWXA 1IBCA 1T4BA 1W4CA 4HYTA 2OVFA 3V4RA 2XUFA 2Y1EA 5J4KA 2IYFA 1I14A 3JVDA 4C3UA 1HL7A 2ZGVA 3B2QA 2ZQZA 4JH0A 4LE2A 3RTEA 3LP8A 3AHCA 2QRKA 3FNIA 3QP9A 1ANKA 5SY4A 2BTQA 3HCBA 4J0IA 3RR2A 3DMYA 4J29A 1FLVA 1G3UA 4NOMA 2YOHA 2XMGA 1QOZA 1SUPA 3QE0A 1KPIA 5SV2A 3ZXYA 5FTMA 4CTNA 4OB6A 3VYRB 1BRMA 2Y2UA 3GR6A 2FUNB 5AESA 2CNKA 4JC0A 2VHQA 4DQVA 3HKDB 1GPLA 2BJHA 2J9RA 3QKTA 1NG9A 4QPZA 1ORTA 1TA0A 3DKIA 3DZDA 1ZM7A 1O1YA 1A95A 5DYWA 1Y4AE 4DOMA 2R2GA 2YHIB 5HOEA 5ALJA 1CR4A 4YPVA 1G6OA 2XMDA 3WK8A 4AROA 5KDLA 3F9IA 3L6EA 5L4SA 2PH1A 4TWZA 4B83A 1VM6A 5FLEX 1SUDA 3I8SA 1X6VA 2GZDA 1K97A 2OMKA 3VX4A 2WNIA 3BSSA 3NPAA 1NY5A 4UVHA 1BGVA 3DZJA 5EIHA 1ZM9A 2RHOA 4D97A 1COWA 1QR2A 2NPOA 4YAEA 1F2VA 4B32A 4BS9A 1Z4OA 5LDDC 1FZTA 3RIGA 1E32A 2YINC 4EF6A 1RZRA 4R2HA 3I05A 3CGWA 1ZK1A 4HX5A 3WQHA 4EKYA 1ILEA 2B94A 3MAJA 4UZEA 4CEIA 3PLNA 3C1OA 4PZZA 1V16B 1GWNA 2BEVA 3KYDA 4HGPA 1HKHA 4IIFA 3K70C 2UVPB 1ISPA 1Z28A 2C7QA 2P6NA 3TJZA 2O0LA 2HDHA 4IDHA 1KKUA 1UCFA 5K01A 2G1PA 2D13A 4GGOA 4PRZA 1A76A 1IE3A 1PG2A 2GS9A 2H92A 2GK6A 3FZEA 1E9BA 4PWZA 4QAQA 3TNJA 4B33A 4Y2RA 3HCAA 4MPRA 4K9DA 1T8RA 4RA6A 3O6VA 3VUEA 3B9BA 5EZ5A 1X7YB 2A86A 3TIGA 3EF3A 2IP4A 1K6IA 1IK6A 5L3VA 3KOUA 4WIAA 4F2HA 1JUDA 1M54A 5FUQA 1AGXA 2WWIA 2XNJA 3MGKA 1XCPA 4PBSA 1EXVA 4B7CA 2XQGA 1KZHA 1WW3A 2GAJA 3NO4A 3TD2A 2OHJA 1Q3KA 3BDAA 3ADBA 4QVGA 3ETDA 2ZYVX 3JD4A 4HWGA 5B2EA 1EE9A 3AR3A 1PQPA 4HN2A 2OL4A 1ADCA 1CUCA 4UXIA 3VOAA 1R6TA 4N7BA 3LC1O 5B1YA 4U9UA 2H51A 5TPZD 3ZVMA 4CT0A 2VWQA 3DFIA 2HSGA 3G02A 3HJHA 1WV1A 5JYEA 3WRYC 1DKLA 1G7TA 1VPEA 3GJ8A 4MRSA 3SPXA 4O29A 1PE0A 1IPEA 2CCJA 1SBQA 1KZ9A 3GEEA 3D7LA 2FEMA 5EUQB 4AC9A 2A9VA 2CBGA 5EMNA 3BMCB 4EPRA 2ID4A 4G41A 1JAZA 1SIBE 3W4KA 4KSCA 3NEPX 1UWCA 3UAXA 2C00A 2VP4A 1YZVA 5IAGA 4BJ6A 1AGYA 4II2A 4F4FA 1RRGA 4DL9A 3TUZC 5AKGA 2JAQA 1J8QA 2KS6A 2Z4TA 2PPLA 3H6HA 3SQOA 5JYDA 1WBBA 2IHUA 2JCYA 1EX9A 1U2ZA 4KQFA 5J3JA 3KIPA 1XRJA 4B8YA 4B76A 3GVHA 4PPQA 4DNFA 1FFBA 2DR0A 3G1TA 3Q8KA 1JEYB 1IN5A 2E6UX 2IIPA 4KLNA 3L92A 4PYQA 1E2MA 5GQSA 1U2QA 4RCYA 1MW8X 1U3VA 4HQKA 4JFRA 3ZGZA 4BC0A 2QM7A 3OLXA 5TQ2B 2CHEA 2AQKA 4UEJA 4UATA 1MPXA 4J03A 3WK6A 2Y1LA 4LX0A 5NLLA 1VSQA 5G41A 4KH0A 1P1FA 1UBJS 3ADPA 4FS3A 3WYBA 2WF6A 3DD1A 1JKJB 3M6AA 3M4XA 3MXOA 3P52A 4I55B 5DE3A 4DF3A 3T1TA 4HX9A 1XA4A 5AWFC 3F2IA 3OCWA 4CEHA 3AKEA 1B14A 1V7ZA 2NP6A 4Z0NA 3CN7A 2BGJA 2ZM5A 2RH9B 4FP9A 1DMRA 4AKHA 4FEEA 3HI6A 1D4AA 1ZGAA 1KYIA 5JXGA 2EX4A 2PX5A 5FCDA 3GARA 5FI1B 5K4HA 1CQIA 4WZAA 1Q2XA 4K26A 2IL1A 1X8XA 3W5CA 2RBGA 5DDIP 2SBTA 2FX3A 3HA2A 4M1QA 4YIKA 2YV4A 1NI5A 5KOJA 1EYZA 2ZZMA 1G6KA 1E99A 3AYXB 1U9IC 2FZKA 4MAFA 4PLVA 4YP0A 3JD3A 4F46A 2FSVA 2DRIA 2PS1A 1PX0A 3BF8A 3DZ8A 4LHWA 3LX8A 3WP0A 1AK9A 2QYSA 3KJZA 1XDSA 2D1RA 3M9XA 3C7TA 4WY2A 5ED0A 5B7NA 4WINA 1HTTA 1QPBA 1UJ5A 3D4PA 4KBFA 4BWVA 2D06A 3HM9A 3CUTA 4X1IA 1R0KA 4OSPA 2MYTA 5DGCA 4E12A 1CX9B 2ZBPA 3MTJA 3A9UA 2D5AA 4UREA 3MT9A 4ZARA 1DX4A 4A2QA 1EFPB 3HCDA 1CE8B 2I8AA 1I24A 4JYMA 4YDHB 3VR4H 3H4MA 3OKPA 1OI2A 4IILA 3QLUC 3I9OA 2R2AA 2AYXA 3SNHA 4REQA 3MHTA 4QXRA 4A0HA 1PTKA 3NU1A 4AJ9A 1B6GA 421PA 3DPSA 4QFMA 4IAOA 1U9CA 3AJEA 4G9GA 4MS1A 4ZT3A 4YUVA 3CCCA 2G0AA 2PTGA 1PDOA 1DAIA 5FUVA 1HE2A 1N92A 2BFMA 3UWMA 3LD9A 3PEFA 5LIPA 3U7RA 3LWBA 2QU8A 1A7AA 2P2ZA 3C48A 4DIEA 1ZS9A 4GI2A 4WLUA 3VNQA 4K9RA 1KMIY 4JDUA 1B8OA 1N2HA 3CONA 1KK3A 4E33A 1UDAA 4ZVNA 2OM6A 4OMFG 4WBSA 3SY8A 1MC5A 3BCRA 5H3HA 1FDRA 3RWBA 2CMFA 4NNJA 3FMGA 1BVRA 5FUBA 3KKEA 2EZ4A 4J94A 4M0KA 2YR0A 1QFSA 2RH5A 2R6CA 3LZDA 1D2NA 1VL6A 3SLKA 2QYOA 3RYCB 1AF4A 2PYZA 4ZPJA 3R5SA 4PE5B 1YMUA 1EZ1A 1UJBA 3G2KA 1FFSA 3JALA 3MMZA 4G5GA 5DXFA 2I8CA 5FPKA 3QPAA 3LUKA 3PIRA 5AW5A 5JHGB 4P0TA 3CKYA 3I9JA 5A5EA 4KPEC 4RK0A 4FCVA 4DV6B 5JCZA 5KX5A 3Q5DA 4HMPA 1J2TA 4BMOB 4DLYA 3I30X 3OX2A 3LA8A 4F6CA 5EQTA 1A5AB 1JFFB 4BBJA 4J1TC 3HBFA 2CXRA 2R0QC 4WLOA 1AKYA 2CMHA 5ALNA 1TZ2A 5JLAA 2GDZA 3JQ8A 3IHWA 5EGSA 4YRIA 1ODJA 3TGPA 2CNOA 4BP9A 3O8NA 4F5YA 4BQFA 1Q0HA 1P2GA 2I6GA 3VGPA 2XQVA 2Z5LA 1K4YA 2H0RA 5IDYA 4I1UA 4BNDA 5FBRB 4D4MA 4DV4B 1T2VA 3EZ7A 1NBMD 4EOGA 1UBHS 2GA9A 3I9FA 1HV8A 3IXLA 1QH1A 2YNMC 2ZUCA 2Z2IA 3AHDA 4X41A 2F43B 1YS2X 2A9JA 5DU2A 3ER9A 4XVCA 4GKAA 2FPPA 3WLKX 2EEPA 3RSOA 3H7AA 2CNDA 2HKIA 1UKYA 3OEHA 3NGMA 4Z99A 1W6UA 3VR2A 3X1YA 3DMRA 4ZK2A 3W78A 1Q1AA 1X7XB 4HQ0A 1CF4A 4PLTA 1FTGA 5IFKA 1ZCJA 3HWX1 4MWTA 1G20A 3HU3A 4ZODA 3UUFA 4OYHA 3GDFA 3ZUPA 1YZYA 4BMVA 4B3SB 1Z2EA 2CXQA 4XLTA 4P4LA 2K7ZA 2NAPA 3B82A 4B87A 1BW9A 1Z5NA 4I50A 4DLNA 2RFLA 1EDBA 3PITA 3TTVA 5CLFA 1QHFA 1BE8A 1GFZA 4ND6A 3I53A 5FEUA 4RTQA 3OTIA 3BWVA 3GT0A 2ZJZA 4R1UA 5BVGB 1GP2A 2QTNA 3O8LA 1RKVA 3TRKA 4P81A 4Z4QA 8MHTA 1VLMA 3OJFA 4Y2GA 3RRMA 3F4KA 4MWZA 1DQSA 4X66B 2OILA 3DBRA 1DXYA 4JSTA 1D2AA 1F14A 1WHSA 1M67A 1RXCA 5G1OA 5SY9A 4LVOA 1WKCA 2H2AA 3FRIA 4Y0NA 5I7HA 3NS7A 5BSMA 5GZ3A 2B34A 3MLEA 4IG9A 1XDUA 3PVZA 1GYRA 3I2KA 2WFLA 4B7AA 5AVYA 2XEXA 2IP2A 1DDIA 5H02A 1YDHA 4DJDC 1WVGA 2C29D 2HC9A 2I4OA 4C20A 3LAWA 5CT8A 5EZSA 3DGEC 1RMTA 4ZXPA 1M2GA 1JAXA 2GEVA 3SDSA 1E3IA 3HWSA 3OC0A 3RVRA 5IXSA 1GTL1 4KHPB 1Q0QA 5ENDA 2HQ1A 4V2IA 1QOQB 1LJUA 1H23A 1TJ5A 1DKNA 2W2OA 5CITA 1OZHA 2YIJA 1LW6E 5AJUA 1WE2A 1GPBA 3DCJA 3R20A 4J9VA 4MYCA 4ZYTA 1E5VA 3IUBA 1GZ5A 1EQ2A 1QRSA 4AY3A 1GLNA 2O06A 4B0OA 2Q6OA 1ABEA 2TRSB 3MT7A 4Q3OA 5HF6A 4FJ0A 4EUFA 3TF5A 3JATB 4JYZA 4MRMA 1T34A 4KBYA 2EFDB 4UUBA 4FINA 3WNVA 3ABSB 2MINA 2FK8A 2V6MA 2JJ2A 3M4ZA 5HMLA 4YMSA 2IWHA 1H94A 2ZWVA 1L8LA 3FVRA 4PGGA 4YXWA 1AZWA 1LDMA 3QGMA 1G4AE 4JODA 4LGVA 1ACMA 1G5PA 1JAIA 1GAEO 1NKVA 3KR1A 1SKMA 3QI2A 2WWWA 1D2HA 4R69A 2A6PA 2KE5A 1EX1A 3GZ4A 4TTIA 1LFDB 1R8YA 2F3PA 3WAGA 3T52A 2CL7X 3JD0A 1N2IA 5A5DA 1IOVA 3GFQA 3OA2A 1JHOA 4G8BA 4R5MA 5ITVA 2R6DA 1DRUA 4GRAA 4JLNA 4PQEA 4V0RA 3WFZA 4GQIA 4C04A 1LCIA 2WHXA 1X1EA 5HF8A 2IY8A 4AKEA 2JFWA 4U7TB 5JPIA 3S40A 2Q3HA 1Z38A 1GCIA 5C7LO 1OWMA 4ZOLB 1CRLA 3LVFO 3OIWA 3ZZNA 5KVAA 2VDJA 3AKDA 3GLIE 2Q2NA 3VM6A 5C8DA 4HD8A 3MTQA 1CFZA 2NQ8A 1AKMA 3AETB 5CD9A 3M3DA 2BSXA 2AK2A 4QPPA 1RQLA 4UFOA 4NCIA 5TF0A 3TNDA 5KSZA 3PDHA 4IXWA 5HKOA 3K15A 3AU9A 2NQ2C 3MBKA 4ZCIA 2PMKA 1VE6A 4ZCTA 3JRNA 3QBEA 1MA3A 1ODFA 4NPHA 3L4EA 4NFYA 3AV0B 1CUGA 4HGQA 4BN4A 1JECA 4WV3A 5CLIA 3WHLA 1Z5VA 4QHSA 2GO1A 1Y6FA 3C85A 1VCOA 1Q0PA 1TVEA 4PRKA 4MUGA 3E81A 3AEKA 4L5JA 1PQYA 3U19A 2DQKA 1U90A 3GJTA 2NUBA 4U63A 2R5WA 2QVBA 1WP9A 4JJ4A 4ZQBA 3EZGA 4RNDB 3ZWDA 1A9RA 1FDSA 3A4IA 3M1YA 4RS3A 2M6SA 5TS2A 3Q5GA 1L3BA 2ZREA 3OEEA 4FYIA 1XPOA 2H9YA 4B3TB 3NGLA 1DLIA 3PS9A 2Q0QA 5ENVA 1OY1A 1V96A 1LLQA 3ER8A 5ALRA 1FPQA 2NT3A 3DUFB 1G1AA 3VC3A 4JN6B 5DX1A 1KBOA 1P1HA 5J63A 2ZBFA 3RHFA 2ZXUA 3AW9A 1O6GA 4V2UA 1YOVA 3MYRA 4H7IA 3TLXA 2XI4A 4C07A 1MDBA 2YZ2A 1M5TA 1PS9A 2O1EA 5FA8A 3OI7A 3WGYA 3I37X 3TL3A 4N82A 4FUQA 3RBAA 2RAPA 3HNPA 1D9ZA 2ZT6A 1KR5A 1E5QA 4MYRA 1BE1A 3RIHA 4ZEXA 2WIGA 3LW7A 3WQQA 4EUNA 5BWOA 5JEEA 4LOAA 3ZHRA 1N25A 3E7WA 4FX5A 3NWOA 2JLAA 1E2KA 4G1BA 1H8HD 4PC7A 1ML3A 1LF5A 4U7DA 1SVIA 4G5YA 2AEMA 4C5BA 4A91A 2FPKA 5DX0A 1X15A 4W5QA 1A9SA 5GM1A 3ROKA 6YASA 1RYZA 4ZT5A 1NNEA 3Q8WA 4KV9A 1ULZA 5GP1A 2Z5GA 3PQCA 4GMFA 4IBOA 1UDRA 3B53X 4DG5A 3EWAA 2ZRCA 4OQQA 4S24A 3NX4A 4HTFA 4GLLA 4R9SA 5JDIC 4HNVA 5BNTA 4LPSA 5DLDA 2ZWOA 2EVWX 2ZTHA 1LKZA 3TBHA 2AFHB 4WUTA 4DQLA 3KDAA 2VT7A 2ZR8A 3Q88A 2R00C 4HB4A 1G3IA 5ALKA 3NWJA 4RXUA 5FL3A 1XZHA 3TW6A 4JQOA 3VR5D 4ED9A 3OESA 5BUQA 1FTWA 1INLA 1CDOA 1SEPA 1QP7A 1PTJA 1BMTA 3KJEA 4FFBB 2XAUA 1DX9A 2QVCA 2QXUA 3L7NA 4MI3A 5G3YA 3RTBA 1T3TA 5K6AA 3L7JA 3NMUF 3R3SA 5JCXA 3TB4A 4O33A 4Q3CA 1RZUA 4TM7A 3LUPA 4ZTZB 5LA6B 2ZLBA 2DH6A 3FFBA 4NICA 4GI3A 4DUYB 1KNXA 4LJYA 2P7HA 2MYUA 3M0EA 1PFGA 1XZEA 3M3PA 3MLAA 3NKVA 2WV7A 4NZYA 5DJ5A 5C1OA 3NV9A 3MN1A 3LOUA 5JW6A 2HL6A 5JARA 1GQQA 1NVTA 2OBFA 3K4PA 4FLFA 4OFZA 1XZKA 3SYNA 2X8JB 4AURA 2CJYA 4XM0A 3ZWQA 1JIVA 2JLCA 5JROA 4D9BA 4OGKA 1AX9A 2NUAB 3TM4A 5EHZA 3CB4A 1UT5A 1VB3A 5G53C 2A1UA 3RK0A 1H0SA 4PSKA 1OAKA 5IN4A 3HYNA 3KWLA 4EY5A 5JI3E 2UYCA 1U5AA 4X54A 3LSYA 3G2QA 1WRBA 1UJNA 4XXHA 1CQJB 5BR7A 1Y1QA 3UAWA 3EG9A 4PSVA 2B2CA 3WMEA 2G09A 3NIBA 3M5WA 5E6UA 4G5HA 2W6OA 3T1QA 4UZSA 3WWPA 1GV0A 1YQGA 3K05A 3L49A 4CV1A 2VI5A 2HT1A 2GFIA 3IVXA 1SOWA 1MX1A 5M2QA 1GUZA 2XZPA 4EQ6A 1TUBB 1WKBA 1UWKA 1CUAA 2VPYA 3K6JA 1QF6A 1IUKA 4LJSA 3JWGA 2JFVA 3PUHA 4PO8A 1D3AA 1NSTA 5EI5A 3U49A 1Z4IA 3GFPA 2FN9A 3IAS6 4JAVC 4W9NA 3RODA 1MO3A 4C4RA 2QZ4A 3HPRA 4CQJA