2EW8A

Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
247
structure length
229
Chain Sequence
QRLKDKLAVITGGANGIGRAIAERFAVEGADIAIADLVPAPEAEAAIRNLGRRVLTVKCDVSQPGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVNMLQAIPRLQVPLDLTGAAAFLASDDASFITGQTLAVDGGMVRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Enzyme kinetics of the (S)-Specific 1-Phenylethanol Dehydrogenase of the denitrifying bacterium Strain EbN1
pubmed doi rcsb
source organism Azoarcus sp. ebn1
molecule tags Transferase
molecule keywords (S)-1-Phenylethanol dehydrogenase
total genus 81
structure length 229
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.311: (S)-1-phenylethanol dehydrogenase.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ew8A00
4YBZA 5GZ6A 3RKRA 1JVBA 1EEHA 4DIFA 4KUEA 3WMXA 1NNUA 3MJCA 2O3TA 1QLJA 2CSUA 5EINA 5AQ1A 3FWZA 3QJ5A 1N7HA 2Q1UA 3TZ6A 1I3MA 4FFNA 5I9MA 4CM1A 3FRJA 1A4IA 3DMTA 1E5QA 2QIOA 3K6JA 5ADHA 3ZI0A 3B70A 1GCUA 3H3JA 3WX0A 2CVOA 2VT2A 4D43A 2Q50A 2O50A 3ZNPA 4MVJF 1WMBA 1XR3A 3DOCA 4Y6SA 5ER6A 4L76A 5G0VA 1B26A 3B20A 5C37A 4DTIA 1YOVB 1UXIA 3BMQA 1E3WB 4ITUA 4RQTA 3HDYA 1NQTA 1QV7A 1DOHA 1YE3A 2PA3A 3IOYA 2JHFA 4UREA 1RYDA 3FSRA 5COBA 4EEZA 1HYEA 2WYVA 5AXAA 5ENVA 1GD1O 1ENYA 4ZQGA 5BNFA 2VTEA 1PGQA 2YV3A 3PK0A 1KVRA 4E5NA 1V3VA 4LRTB 3V5NA 4B79A 3ZDFA 3PDJA 1X0XA 3DEYX 4ESOA 1DFHA 3NKLA 1OFGA 2BKAA 3WQSB 1YKFA 3I23A 5DBFA 1E7MA 2B0JA 4M55A 3VKVA 4DREA 3H9QA 1T2AA 1O9BA 5KVCA 3CZMA 1I32A 2NTVA 4FOOA 3ROKA 2ZATA 1YL7A 1U28A 2ET6A 4PN3A 3KEQA 2O3SA 3PZBA 1M6HA 1DC4A 4XA8A 2WE8A 2I67A 3CTMA 4NIMA 3QP9A 4YVFA 1R0LA 2NNLD 2C20A 4XQGA 2Q2QA 4U0KA 5AXDA 1PS0A 3AUAA 1NFFA 1TLTA 2IXAA 3DZFA 1BDMA 3DONA 3V2UA 5JFOA 4AVYA 2JKVA 5KJEA 2HAEA 3ZGYA 4MVJD 1R4MA 2BF7A 3DZGA 3BMCA 4E21A 1LBEA 4IDBA 3WGTA 3PQDA 1DRUA 3ULKA 1HDYA 3PGJA 4CUZA 3VZRA 3PEFA 2X23A 1I10A 1VI2A 4JBIA 2VCYA 4DWVA 3KXDA 2AEMA 1Y5RA 3HDJA 5L7YA 3SXPA 4EUEA 2Q46A 3E82A 1YH3A 4ILKA 3KYCB 2E48A 4MJLA 4ZA2A 3VPXA 1HDRA 4E5YA 2FP4A 1NQOA 5F1PA 2G1UA 4CMAA 4HFMA 4B4OA 4CR6A 2J5QA 5I8WA 1NASA 4I9NA 1C0KA 1BXKA 2IE0A 3LT2A 1HDCA 4YRDA 3TWOA 3DDNA 1K89A 1SO8A 3CE6A 5HS6A 1FF9A 4O0LA 2HKIA 2Y1EA 3VTFA 2ZB4A 4BNJA 1RPNA 1SOWA 1UXKA 4YWJA 1EBFA 4BV8A 2VT3A 1HETA 3SC4A 4CLDA 3NTOA 4KDFA 4D0RA 1HDZA 1I2CA 1JA9A 1GPJA 3DAPA 3K2EA 4IQ8A 2Q45A 4DUPA 1PQWA 3UOGA 1GDHA 1QYVA 1ZMOA 3C8MA 4M87A 4ALKA 2DBZA 3D5TA 4MP6A 2OOSA 4M49A 4GMGA 3Q1LA 4YJFB 2EHDA 2C0CA 3OA2A 4NJOA 4K9DA 1U8XX 1Y7TA 4WNIA 5JCJA 1T4DA 3S2IA 5CDYA 1LSOA 2ZCVA 3EAGA 2B36A 2B5VA 2QRLA 4NBRA 4NFYA 1ZKMA 4GVLA 5EMHA 3ZU2A 4Q3DA 1U5AA 3FPCA 5A05A 4BNVA 2Q2WA 3PJGA 1KVTA 4QFCA 1ZK1A 3UVEA 4TROA 4OSOA 4J16A 3K31A 4JJFA 1LQTA 4XQEA 4KQWA 3LYLA 1QYWA 1F12A 2QHXA 3ZU4A 1UAGA 2YFHA 4ZGWA 2IEBA 1LDEA 1I2BA 2WD8A 2DLDA 1DPGA 1C14A 2A92A 1KC1A 2HK8A 1HDOA 1GQ2A 4PLWA 5JY1A 1T26A 4QTZA 3OIDA 5BR7A 2IODA 4NI5A 5I7FA 5KVQA 1CERA 1B8VA 1KEWA 4L9RA 3EZYA 2DBVO 3GEMA 4A0SA 3JQEA 3WOHA 2Y1GA 2VYNA 2NU9A 1DLJA 2W2LA 2WWRA 1IPFA 3CINA 3D4NA 4F45A 1B7GO 3FWNA 3AI2A 5ILGA 5F5LA 4XYGA 3ZHZA 1TVEA 2FY8A 3BTSA 1WDLA 3UGKA 3PHLA 2DU8A 1BXZA 1TI7A 4MIYA 5K6AC 3DBLA 2ZTLA 1BMDA 3DMTC 4TRJA 4Y6RA 5KTKA 3PWZA 1YWGO 2IRWA 2ZB3A 3KSUA 1WAMA 3DZBA 5BNTA 4EYEA 4U5QA 1WXDA 2OP1A 3JQAD 1YQDA 4N54A 4CV3A 3FN4A 2E4AA 1Y6JA 4HP8A 1I8TA 3OJOA 4W6ZA 3ZNQA 1MFPA 4IMPA 3AU9A 5CDGA 4AJHA 4CM6A 3LC7O 3U5TA 4IDEA 3M2TA 3RFVA 5KJCA 1TB4A 4WEQA 2GN8A 3ITKA 3MOIA 5MDHA 5BQFA 5CG1A 4TZKA 1FXSA 3KYDA 3MJTA 4IIUA 1Z75A 3QWHA 3I52A 2I99A 3Q6IA 4AJJA 2Y1FA 4P4GA 4IXWA 2EP7A 4ZJUA 2B69A 4OKIA 2IEDA 2HCTA 2X5KO 4EBFA 1HE4A 3GLQA 1E7RA 3I5MA 3L9XA 2RH8A 1DAOA 4YAGA 4FR5A 4BKQA 1GY8A 3DBRA 3H65A 2P4HX 1Z7BA 4P8RA 4B3IA 1WDKA 1LLDA 3OQ1A 3X2EA 4URFA 4EZBA 2YQ5A 2HU2A 5JC8A 4WOKA 3L6EA 1E77A 2HJSA 3F1KA 3PIDA 3G3EA 4B8WA 1XQ6A 4MINA 5B4UA 2DTEA 4WCDA 5GY7A 4GLLA 3GZNA 4XB2A 2D3TA 1R0SA 2O7QA 3HN7A 1IPEA 4NZ9A 2HJRA 4TRRA 4C4OA 1RWBA 3RC1A 1CDOA 3QVOA 2NU8A 1PL8A 3RIHA 1D1TA 2EP5A 3LT0A 4GVXA 5L40A 2G5CA 2PFGA 4LK3A 2EWMA 1LDBA 4CMEC 2NQ8A 4NU5A 4IDAA 5U1PA 2VUSA 2Y0CA 2AQKA 4R68A 5JAQA 3NX4A 5K6AA 2X86A 3KTDA 1LQUA 4O59O 3U4IA 1I3KA 1GYPA 3U4DA 4AJLA 1DIAA 1I24A 1JTVA 2O7SA 3ZU5A 3CKYA 2X9VA 3O9ZA 2GN9A 3HG7A 1HZZA 3ZN2A 2HMUA 2OORA 3HDHA 4LCJA 1OOEA 5AVOA 2P9GA 4BGIA 3V1UA 2GERA 4CQMB 3U62A 5L9AA 1OI7A 3INGA 3VZQA 2CFCA 3ETGA 1Z74A 2PKRA 3LT1A 5GMOA 4E30A 3BTOA 5EESA 1LDMA 3KLMX 5JXWA 4FC6A 1P44A 2A35A 5B12A 1ZFNA 3FBTA 3M1AA 4J4TA 1P3DA 4KDEA 5EJ2A 4D45A 5CEEA 3V1TC 4KZPA 1FDSA 1E6WA 2VUTA 1DIRA 2Q99A 3HUDA 1DHRA 4UUNA 4QECA 4L75A 2JCVA 1YJ8A 2DFDA 1B8PA 2BFPA 2BGKA 2Y0DA 4QFDA 4XCVA 3A06A 1NFQA 3W8FA 4BKPA 2H6EA 4BB5A 1I33A 1JU9A 2VRBA 1MC5A 2F00A 5CP8A 3ZHBA 4AL4A 1PJSA 4UUPA 2X9GA 2CUKA 1X7HA 1YDWA 1HTBA 4U6SA 4D3FA 1T2FA 3AK4A 1RM5A 1GYQA 4DMLA 2HO5A 2IDZA 4W4TA 4E31A 3ZWNA 1A72A 3FNHA 1PQUA 4DYDA 2VZ9A 4H15A 4R3NA 5TS3A 4CM4A 3KV3O 1U3WA 3LDHA 1LNQA 2EKPA 4HUJA 4GI2A 1P1KA 1M6WA 4ZQFA 3IKTA 4CMEA 3GDGA 2ZB8A 3HJAA 4N5NA 4WLEA 5A03A 1IY8A 3JQ7B 4YT2A 4TRNA 5GZ1A 1H93A 3RUCA 4RPJA 1JWAB 4M8SA 3Q0EA 1DC3A 3HHPA 5TF4A 2AG5A 5G0UA 2CF6A 3NT2A 4R3WA 4HADA 2PH3A 4LSMA 3KVOA 1D1SA 4JLWA 3UN1A 1LUAA 2GR9A 4MDHA 4ALNA 3A4VA 2NVUB 1ONOA 1KERA 1Y1PA 2Z1MA 3VDQA 2H63A 2GD1O 3LZ6A 4B7CA 3UICA 1YJQA 3H5NA 4JP3A 1VM6A 2A9FA 3O26A 2AG8A 1V6AA 3I1JA 1AE1A 1F0YA 3F9IA 4FC7A 3V8BA 3JCZA 1E1LA 1DIBA 4Y98A 3PYLA 2BGMA 5TT1A 4JROA 4HWKA 1ZVMA 5CAEA 2Y1OA 3GRPA 4BGUA 3QA9A 4IJWA 5G2OA 5L3ZA 5A4DA 1T25A 2JHGA 3DAGA 3PFWO 3PRJA 4HY3A 1BWSA 4FFRA 4NBVA 4XQ9A 1LRJA 5KWEA 2QZ9A 2A94A 2IYPA 4J2HA 2UDPA 4YEDA 1SEPA 3BTVA 3VC7A 2POQX 1GZ4A 3UHAA 2WYUA 3KOUA 3MWEB 1GV1A 4JN6B 3FNEA 3BMNA 4GKBA 3S2GA 1R37A 3G17A 2O3UA 5T5QA 5G4KB 2EIHA 3ZHXA 1N9GA 1YQXA 2B35A 3CH6A 5IFLA 2YJZA 3NEPX 2BI7A 2Q1TA 3RKUA 3G79A 5B37A 3PJEA 5K9ZA 3C3XA 3GPIA 5DCYA 4FPXA 4CMIA 1DDOA 4WPGA 5IAAA 1NHWA 1H0KA 3P2OA 4NJMA 1UDBA 2P9CA 2P2SA 1W8DA 2BFOA 2X5OA 4EW6A 1VL6A 1GQYA 1YB5A 4PLFA 1NFRA 1Q0HA 2VWHA 1AUPA 1U1IA 3B1KA 1X13A 4QO8A 4NH4A 3OICA 1WVGA 4RVDA 3D4OA 3F3SA 1LDNA 3WWZA 2G0TA 2GO1A 2GPTA 4BO5A 4NU6A 3WNVA 3X2FA 2W8ZA 4G5HA 4OH1A 4DL9A 4FFPA 4MVJP 1B14A 2XF8A 2UUPA 4AJPA 3MTGA 4ZU3A 1HWYA 2ZCUA 4PG8A 3SLGA 4WLVA 1DFGA 3RI3A 1CJCA 4FGWA 3PQFA 3L07A 5JDIC 1Q0QA 4O1MA 5CDTA 3FF4A 1VRWA 2YZ7A 4B7XA 1X15A 1OMOA 4WGGA 3H2ZA 2DUWA 1B2LA 1E1MA 4FJ0A 4N5LA 3SC6A 1PJ4A 4ZHSA 2Y68A 5JNLA 3JQGB 1AXEA 3GEGA 4HBGA 4RGBA 3D3WB 1FDWA 1M66A 1SAYA 4EJMA 2VHYA 6ADHA 3JQ7A 4CM7A 2CDCA 4DPMA 4QSMA 4K28A 2JFFA 3MJSA 4FW8A 5C3MA 4BMVA 3L6OO 1U3UA 4I5EA 2GZ2A 1Z73A 4XJTA 1OZAA 2HQ1A 1NXQA 3M1LA 1E3IA 4UEKA 1Y81A 3WXBA 4XGIA 1O95A 4YDRA 1E3JA 3PDUA 2DPHA 3ZV6A 5DULA 1E7YA 2GDZA 3C7CB 2FSVA 2D0IA 1ZJZA 4IDCA 3RUFA 3GGPA 3H9GA 2Q4EA 1PGJA 3OECA 3F5QA 3GOHA 3NAQA 1JVSA 3JTMA 3NDRA 4FGSA 1W0CA 1MV8A 1WMAA 4OQYA 1O6ZA 3JQ8B 1P77A 4I8XA 5DCWA 4R69A 4YYZA 2EF1A 5G0SA 4EUFA 5COQA 2BLLA 1GUZA 1BTOA 3BHIA 3NJ4A 5JW6A 2RHRA 4OL9A 5EN4A 4BKOA 1MUUA 3UF0A 1GQQA 5G0WA 3K73O 1D3AA 4Q39A 5I8ZA 1SNYA 3OQBA 2EEZA 2QG4A 2GGSA 1X7DA 4Q3BA 5DP2A 2C2YA 1Z82A 4NBWA 3DC2A 1P1RA 1SCUA 4QEDA 1C3VA 1KIFA 2RBEA 4TKLA 4TWRA 4WCFC 4RZHA 1P1IA 5F3RA 4BKRA 1E1NA 2Z5LA 2O3RA 3WS7A 3JD3A 3LF2A 4YAEA 4DBZA 3A28A 3BMQB 1LRKA 4TVOA 3RWBA 3RVDA 4J1NA 1ORRA 3RUIA 3VHRA 2EJWA 1NQAO 1XELA 3WICA 1DIHA 4UVIA 5T8KC 3ITDA 4UAGA 2VWQA 1CYDA 1A4UA 3QQPA 4LSWA 1XSEA 3KB6A 4GAEA 3GHYA 3GNTA 2HDHA 2G76A 3KO8A 3CZRA 5JSFA 5TNXA 3I83A 1OC2A 3R3SA 2DPGA 3MEQA 4IPTA 4PRLA 4CMKA 5DNAA 1V9LA 3F4LA 4MVJM 3AM4A 4RCVA 4HFRA 1GFSA 1DBVO 1M2WA 4OSPA 4XDYA 1X7GA 1WW8A 4ND2A 1PJLA 3GNSA 4M89A 3VVBA 4JX8A 3EC7A 2IXBA 2PV7A 3EVTA 1HYHA 3ZU3A 1IHXA 4IQGA 4WLOA 1HYGA 2ILTA 1NR7A 3AUUA 4CM8A 1GV0A 3K2BA 4RF5A 4KP7A 2GCGA 1KY5A 1HSZA 5KIAA 3LLSA 2I3AA 2I9PA 2YW9A 3PWKA 4LVCA 4P38A 4NPCA 1MG0A 4QX6A 4CM3A 1PZGA 2VYVD 4LMPA 4ID9A 3W6UA 3MWDB 2PD4A 1UJMA 4OXYA 3U49A 3PPIA 4F6LA 3IS3A 3MCVA 3WFJA 4BNIA 4R9RA 4M54A 1LLUA 1VPDA 2QW8A 1EVJA 2ZYDA 3C1TA 3P19A 4CLOB 2Z95A 3GVCA 4U7WA 4A2CA 4A10A 4DYVA 2VOEA 2J3HA 4NBTA 4CR8A 4RF2A 3LT4A 1P9LA 3VOSA 3EMKA 5IJZA 2GYYA 1M75A 1PJ3A 1ADBA 1XU7A 5BSGA 4BO1A 4BIIA 1JQBA 3KRTA 4BNFA 4D3SA 4U0JA 4F6CA 3K96A 3N7UA 1Z45A 1XQ1A 1BSVA 4OHUA 1B3RA 1EDOA 3AY3A 2WD7A 3IIEA 2Q3EA 1PJCA 4I9HA 4EGFA 2WDZA 2D4AA 3ZNNA 1O94A 3W4KA 3QY9A 3ZV3A 3PXXA 3NT4A 9LDTA 2CY0A 3JSAA 3OA0A 3K8ZA 4DA9A 1ISMA 2W90A 4JK3A 2JFHA 1PZFA 1WNTA 1JKFA 2BGLA 5C7OO 2PGJA 2Z1NA 3PYMA 4ZQBA 3TFOA 3GEDA 4PRKA 1J6UA 4UVEA 2EKQA 3CSDA 2VHXA 4BUCA 2Q1WA 1ZH8A 3OJLA 5ICMA 3TZCA 1UR5A 3DFUA 2BFAA 3ONFA 1N1GA 2C7GA 4MPDA 2FPGA 1V35A 3KYBA 3VAZA 5FFFA 2BELA 1F8GA 4PIVA 2GZ3A 5L7WA 4AJKA 1EZ4A 5LCXA 1ZMTA 3D5QA 1YBVA 2PTGA 4CLRA 1ZUD1 5A9RA 1AGNA 1OBFO 3A9WA 1LEHA 3JYPA 2X4GA 3I6IA 3L4BA 3WDSA 3ZW8A 3I9JA 2I66A 2NVUA 4FQ8A 1C1DB 4M1QA 1D7OA 3KM0A 4XX0A 1E7SA 3TOXA 2J3IA 1PIWA 1Y8RA 4E2WA 2FR8A 3DMYA 4MP8A 5J23A 4MKZA 3ENKA 1VC2A 1ZEJA 2FR0A 4Y67A 4DRYA 1UAYA 3GNQA 3KUXA 4IS3A 4FBGA 4YTEA 1U7HA 3DZJA 3LVFO 1VJ0A 4J91A 1O0SA 4PLZA 1B16A 1YDEA 2QZZA 4YJHB 3WGZA 5MGBA 2CZCA 3RUDA 4ND4A 3KETA 3FHLA 1Y5MA 1Z7EA 2AEFA 4ZD6A 1ISGA 3H6KA 4PLGA 1TT7A 5HBRA 2FPIA 4CLEA 3IDSA 2DT5A 1R15A 4PGFA 1ZXBA 4JP2A 1NWHA 4E5KA 3WGGA 4QXMA 4J1QA 3TDKA 4WUVA 1KBZA 4BS9A 4JCOA 4MIOA 4I1IA 3QWFA 1PJ2A 2C07A 5JBIA 3VPFA 4CUKA 1ZXLA 3PTZA 2J3JA 4E2ZA 4BNYA 3AI1A 1EQUA 5I7SA 3FR7A 8ADHA 1U3TA 4J0FA 3FD8A 3INRA 3GVXA 4Q9NA 1NAHA 2DKNA 2HRBA 1BXGA 2I3GA 4Q3NA 4YJDA 4Y9DA 2PKQP 4D42A 1U8FO 2X0RA 1LX6A 1WP4A 1C1XB 1NYTA 1DAPA 3LC2O 2WMDA 3EUWA 3EY4A 3JQ9C 5DZSA 2C54A 3HNPA 1UZLA 3IL2A 2HSDA 3FR8A 4BO8A 3D3WA 4BNXA 3VH4A 4GX0A 3HE3A 3GVIA 1Q0LA 2DTXA 3HDQA 3WSVA 3JQFC 1GPDG 1AHIA 2EERA 1NTOA 2OP0A 5ITWA 1X1TA 3G1UA 3WGHA 3AU8A 1KYQA 2AQ8A 2OFPA 3ZV5A 5CDSA 2GRAA 4BO7A 3TZQA 5JAZA 3P5SA 3GF4A 1YXMA 3F47A 2JAPA 1GUYA 3WG9A 4J9UE 3GUCA 3B1JA 2PZMA 3E6AA 1BHSA 3WTCA 5C5IA 1ARZA 1UXHA 1PZEA 4R41A 5CPFA 4OQZA 1ISIA 3GGGA 3EVNA 3GA0A 2X9NA 5AXCA 3E9NA 1KC3A 2DVMA 5IZ4A 3G49A 4CMJA 4F3YA 3LF1A 4PLPA 4RZIA 3IJRA 1ISFA 2UV8A 4D41A 1CWUA 1EK6A 4EJ6A 1IB6A 3IMFA 2C2XA 3UW3A 3AY6A 1NHGA 4YJFA 2QX7A 4JGBA 4P4NA 3VZSA 3TZKA 4RORA 2I6TA 3CPSA 3WGIA 3RUAA 1UDCA 5EERA 3WMWA 2WEKA 4ONEA 5JLAA 3Q2KA 1K0UA 2JAHA 5T57A 4YRBA 5DBIA 5DN9A 1YQGA 3AOEC 4CV2A 3I9OA 2NVWA 3PJDA 5HRUA 3FTPA 1PGPA 2X0JA 3PHIA 4KTVE 5KNLA 4YAIA 2AA3A 3ICPA 3MJ4A 3DWFA 3DR3A 5A9TA 1NPYA 5TJHA 2X1HA 2HRZA 4QQRA 1YL5A 1PJQA 3RSHA 1K6XA 1YVEI 5F1KA 5HS4A 4NG5A 1XA0A 4NBUA 1LDGA 2AEJA 3RCBA 4BOYA 5A9SA 3OF2A 2RH4A 3KSDO 4K1LA 5DOVA 3VTZA 5CPBA 1JWBB 3GMDA 2PGDA 1C1XA 1UZMA 4PZCA 3PHJA 2DTDA 4IBOA 1E3LA 1ADGA 1E6UA 1U4SA 2B5WA 3DO5A 5IZCC 1E3EA 1XG5A 2V65A 1DJNA 1UH5A 3ROMA 1EUDA 3B1FA 4BO2A 1I01A 2CF5A 3QWBA 4FSHA 3GR6A 4BKUA 5IDWA 1TT5A 3DQPA 5L4LA 5JDCA 1O8CA 1PR3A 1UP4A 4YAKA 3ZHYA 2OBNA 5TRTA 4CPDA 4DPKA 1EDZA 4FFMA 3DOOA 3PVZA 1PEDA 4L0QA 2AE2A 2CDAA 2VNAA 5ENDA 2NWQA 5KKCA 3UCFA 1CIVA 2GNAA 1L1FA 2V7PA 1V3TA 3BIOA 1T2CA 4FDAA 2SCUA 1LJ8A 4INAA 1QXSA 1NVMB 1CETA 2A4KA 3D7LA 4LRSB 3DTYA 1ENPA 3H4VA 1BGVA 4LN1A 1HLPA 3O8QB 1NM5A 4OAQA 4Z6KA 2NADA 4W99A 5T64A 2P5UA 4E4YA 4YQYA 5JCXA 2VYVA 3UFXA 3ASVA 1BVRA 4H7PA 4NDNE 4RL6A 4C7JA 5G0TA 2CMDA 2QRKA 4BNMA 1F17A 1TT5B 4CQMD 1GZ6A 3GG2A 2B4TO 2X22A 2EG9A 4RVHA 1YOVA 1A5ZA 1PJTA 2Y0EA 4BNTA 1NVGA 1XYGA 1CEQA 1ULUA 1YB1A 4R51A 4PLYA 4BNLA 1RJWA 3DOJA 2CDBA 4FIZA 3UUWA 4R9SA 1PS9A 3PJFA 5CFZA 4E5PA 3OIGA 4CM4B 1DHTA 2JD0A 1Q2XA 1H6CA 5JDIA 5JAMA 3WIDA 3I9MA 1P45A 4DLBA 4CV0A 5KKAA 1N9GB 4OO3A 1T4BA 5CG2A 1JAXA 2VZ0A 2C82A 1GL3A 2R6JA 3ABIA 3OJEA 2AXQA 1WDMA 1Y8QA 2PZKA 1ADFA 1VSUA 4HFNA 5EQFA 3UCEA 3KZVA 3I3OA 2Q1SA 1K3TA 5KJ6A 4RVGA 2WJPA 1KVSA 4RVUA 1V8BA 2BD0A 2NSDA 1E6EA 3ZWWA 4BNGA 2D59A 1MXFA 1CQIA 4WNCA 1HL3A 3PIIA 4ZRNA 4IQ0A 3IQDB 2O2YA 5THQA 1XU9A 2PK3A 3U0BA 2OL4A 2E82A 4YT8A 3U4HA 5FWNA 2YHIA 1BG6A 3GFGA 4CL8A 4NR0A 5BSHA 2WD7B 3QW2A 2FMUA 2VHZA 3DL2A 3GRKA 3LLVA 4II2A 1MC4A 4CQMA 1DSSG 2EW2A 2W98A 3BZUA 4S3MA 3TZHA 4HXYA 2ZYGA 4JJIA 1JLLA 1T1RA 4IDGA 3K9QO 3TN7A 2DM6A 1B0AA 3WJ7A 1HXHA 5CHEA 3P2YA 3ZWXA 2VYND 3GQVA 2VRCD 1DC6A 1QR6A 1WZEA 3NTQA 3L9WA 3RD5A 4JIGA 4IINA 5F1OA 4W7HA 5DDIP 4F46A 1IZ0A 2CVQA 4BHTA 1UZNA 4LISA 1I30A 4J1SA 3ROQA 4ZQHA 1E7QA 3INTA 3GAFA 3PP8A 1R4MB 2J5KA 2ZJ1A 4XYLA 3ZWAA 2X8LA 3TL2A 4YJHA 5IN4A 2W2LD 4XR4A 2WSBA 4WASA 4O6VA 3QVSA 2J5RA 3DXFA 3JYQA 2Y99A 4WEOA 3DBVO 3CIFA 1KOLA 2HMSA 4E13A 2R00C 2D5AA 2ZQYA 3GAZA 1QMGA 4TZTA 1SPXA 4OIMA 4IDFA 1GEGA 3N74A 5JCJD 3GHHA 1EE9A 4OKNA 5KOIA 1G0OA 1N2SA 4GLOA 2FZEA 3L4SO 1PQPA 1GUFA 1MG5A 2X6TA 4IJKA 5B4TA 3CXRA 2EJVA 1RM0A 2OUIA 3BTUA 3WTBA 4AJNA 4XYEA 4ND1A 3WJAA 4K26A 3OHSX 2JD1A 1VL0A 3I9LA 1QLHA 5GZ3A 5TC4A 3JQBC 2GZ1A 1IL0A 5K0ZA 1KVQA 5KVSA 4GQAA 2OMEA 4A73A 4GSLA 4DBVO 4RO0A 3S1LA 3VDRA 5L4SA 3D0OA 1Z6ZA 2PWZA 4PG4A 4QUKA 1XGKA 4R5MA 1LU9A 1H6BA 2TMDA 2GUGA 2YDYA 3D1LA 4KWIA 4DC0A 1H5QA 1X0VA 5ER9A 1PL6A 5FYDA 3H5AA 1YGYA 2PKQO 1LA2A 1S6YA 4E0BA 1M67A 2Y67A 2BFMA 2XXBA 2BI8A 3DBHA 4YT5A 2YDXA 1LDYA 2TMGA 3CUKA 4YT4A 2OO5A 4K6CA 4RPKA 2FZWA 4B4VA 3GVHA 2FHSA 4KQXA 4GH5A 3L0DA 5A5FA 3BHJA 4N5MA 1K6JA 2BH9A 3VPGA 1LRLA 3F5SA 3TRIA 4Y6PA 1UDAA 1KY4A 4J90A 3ZWCA 2HLPA 3V2GA 3R1IA 4MIEA 4P4LA 3JQBA 4RQUA 1CRWG 5DT9A 3SBOA 4D79A 3JQ9A 3TNLA 3DZKA 2Q4BA 3E18A 3F1LA 1U2GA 3JYOA 3W6ZA 3ZWMA 2GASA 4CLRB 2J3KA 4D46A 4IM7A 2ZJ0A 4YQZA 4HKTA 1H9BA 1P1JA 1LI4A 2VHWA 4CMGA 3JQ8A 2V6MA 4D44A 3U9LA 1PWXA 3W4IA 4DIOA 4XGNA 3WQQA 1QP8A 2VQ3A 3TFQA 4EEXA 1YRLA 4J2OA 5I7EA 4HNHA 3PZRA 1P0CA 3D3EA 3GPDG 1R0KA 3OMLA 4L74A 2EW8A 1O5IA 2Y1CA 4NK4A 4E5MA 2YYYA 1NX6A 1QRRA 1TXGA 2UAGA 4IS2A 1ISHA 2NLOA 4QT0A 3VH3A 1UP7A 1R12A 1YBAA 2LDBA 4FN4A 1HLDA 1OAAA 1H2BA 4ALIA 3AFMA 5A5EA 2YY7A 4AJ2A 1MA0A 2AW5A 5DOZA 1HF3A 2BMAA 3DHEA 4PFJA 3WB9A 1ZBQA 1E92A 3ANNA 5L53A 1BRMA 1QYDA 1GR0A 1ZK3A 1GADO 2H1SA 3GY0A 3C1OA 3ZWOA 4W7IA 1QYXA 4GGPA 1WLYA 2RIRA 1VKNA 4OJNA 3EYWA 4AJOA 1PS8A 2E37A 1MXHA 4CODB 1D4FA 3QVTA 4A7PA 1HE2A 2JJYA 1PGOA 3QWIA 1VL8A 1JN0A 3WR5A 4R5HA 1T1SA 4J4BA 4OM8A 1JDJA 4XIYA 5F21A 4GSKA 2X0IA 4MVJG 3DZHA 4DIBA 1EVYA 1F06A 1GU7A 5IDXA 3TOZA 1FDUA 5ES3A 3KLPX 2WYWA 2PZJA 4D0SA 2OZPA 1W73A 4PLTA 4NFHA 3SJUA 1QG6A 3D4PA 3DAFA 4BL5A 5BSFA 4CLOA 2X7HA 7ADHA 1WPQA 4GL4A 4Q3AA 2X5JO 4RJTA 1FJHA 4XZ3A 2ZQZA 4X54A 5KVVA 5FEUA 5TT0A 1ZW1A 1HZJA 4YJGB 2PD3A 4Z9FA 5A1TA 2DFVA 3BMOA 1AXGA 3HWRA 4J6FA 4I9UA 1J4AA 4Z9YA 4MP3A 1U7TA 4C7KA 3BYZA 4R1TA 3IUSA 3ZH2A 3RC2A 4CM8B 4JBGA 3G0OA 3H8VA 2D5CA 4KOAA 3UH1A 1MP0A 3IUPA 3L6DA 5DCUA 4ZN6A 3R6DA 3EDMA 4DVJA 4IDDA 4CMBA 1ZK4A 3AW9A 2EXXA 1SZJG 3ICCA 4AFNA 1FMCA 1ZJYA 4WCFA 3ORFA 4EDFA 2NTJA 1KS9A 3NTRA 2V6GA 1N7GA 2P91A 3HFGA 5CEFA 1T2EA 5A3JA 4WOJA 5JPIA 5U9CA 1LSUA 1S7CA 1YB4A 2FR1A 3SX2A 4DMMA 1JKJA 4WK6A 2EKLA 3I9NA 3OSUA 4KTTE 1NR1A 3OFSA 3ST7A 5C7LO 3GN1A 1E0DA 3RBZA 2VZ8A 4BVAA 4WCFB 2HUNA 5JYDA 1VLLA 1FK8A 2UVDA 1IE3A 3A14A 4RPGA 4W9NC 1ONPA 1IUKA 2H5LA 2ZB7A 5A9SB 2ZTUA 1XEAA 2NU7A 4MO2A 3TSCA 1W4ZA 5JO9A 1J49A 4XWYA 4I08A 4LMRA 9LDBA 3PYXA 1EFKA 1PTJA 1ZEMA 2B37A 3U3XA 1NVTA 4PLCA 4OGWA 3KYDB 3JD1A 2VOJA 4TQGA 1DXYA 4AICA 2JL1A 1GAEO 3AM5A 3DFZA 1H2HA 2E6UX 2VRCA 2NACA 2ZTMA 3GGOA 2Y05A 4G2NA 4E6PA 1L7EA 1WWKA 2Y93A 3E1KA 3ASUA 3RU9A 2PZLA 3FNFA 5TGDA 2YUTA 4CUJA 1FDVA 1VKOA 2ZKLA 4EUHA 1VJ1A 4CL3A 5THKA 2ZK7A 3IAHA 3K92A 3RAJA 4YR9A 1BW9A 3ADPA 4CQLA 5H82A 6LDHA 4PG6A 1TEHA 1R16A 1LC3A 2O3QA 3ON5A 1MB4A 3DB2A 3QHAA 3WGYA 1NAIA 5FF9A 1PWZA 4BNUA 4R1UA 5FI5A 4BNNA 5I9LA 3ONDA 4BQRA 3H7AA 3NUGA 1J5PA 4WECA 5FI3A 3LSYA 5LC1A 4IIVA 1OC4A 3QVXA 4B8ZA 2DAPA 3R3JA 3WYEA 3CMMA 2QQ5A 2WE7A 4J1TA 2NVBA 4RF4A 3VPHA 1R4NB 4FB5A 1L7DA 1PX0A 2DC1A 5DP1A 5L45A 3IC5A 4R1SA 3QVWA 4MKRA 4RF3A 1V0JA 4TRMA 3KBOA 2XPCA 5AXBA 2YV2A 4W9NA 2GN4A 3RFTA 3R0IA 1ML3A 4A5OA 3MJEA 2Y1DA 2GN6A 1BDBA 4GPD1 4NMHA 2PLAA 2O48X 4YCAA 1EBUA 2V6BA 3LC1O 4ALJA 3JYLA 4WJZA 4QO7A 3WQRA 1P31A 1XWFA 1NWCA 4J9VA 4PVDA 4XGKA 4AJ4A 3NGLA 1K5HA 2O4CA 4WLFA 5BNIA 3I4CA 5DF1A 3M6IA 3VH2A 4N18A 4KWHA 4E32A 4J0EA 3Q3CA 1G6KA 5DBGA 4J43A 4RVFA 4WLNA 3KSZO 4L8VA 3L4BC 4PVCA 2AQHA 2GSDA 1GZ3A 3C7AA 1RM3A 1I2ZA 2QYSA 4K6FA 4RVSA 4RV9A 3TJRA 5IZCA 3RC7A 3H9EO 4OXKA 1A9YA 2W2KA 3HN2A 8LDHA 2FSSA 3ZWYA 2C29D 3W8DA 2QYTA 1LXCA 4U6QA 1VSVA 4XEHA 3AJRA 1P0FA 4BGVA 2XXJA 4ZQEA 1XCBA 2PGLA 1FDTA 5JC1A 1MX3A 4XD2A 5IF3A 4EITA 2D2IA 1D8AA 4XR9A 4HV4A 2AMFA 3E8XA 3F46A 4R4JA 1Y8QB 4FOSA 1HRDA 5IXSA 3DHYA 5H81A 1Q7GA 1SOVA 4RPHA 4BMNA 1IYZA 3ZWBA 4NQZA 1P74A 1MGOA 2PNFA 2NUAA 3LK7A 2I76A 1E1KA 3JD0A 1Y9EA 2X58A 4RLSA 4XYBA 5A04A 2B83A 3GT0A 3C7DB 4MVJI 4XJSA 3CMCO 1E3SA 3DTTA 3T7CA 3SLKA 5T6BA 4A26A 3PFFA 2O23A 1C1DA 4RLHA 1Q7CA 2FPPA 4Z0TA 4ND5A 1ZZEA 2UUOA 1B3BA 2YV1A 1AN9A 3Q2IA 2RAFA 2GF2A 5G4LA 3RBVA 4L4SA 1BW9B 2FOIA 3OEYA 4YRAA 5IXYA 1DFIA 5COAA 1ID1A 3BMCB 1GCOA 4RPLA 4Z3DA 3P7MA 3PLNA 4D3DA 3ETEA 2P5YA 5IDYA 1V3UA 3UXYA 4ROSA 4IGEA 3S8MA 3PI7A 4IY1A 1SC6A 3V2HA 4XRRA 4LCEA 4OMUA 7MDHA 3E5MA 1MLDA 3NYWA 2PD6A 2RCYA 3WYBA 5ICSA 4H16A 3RQSA 1C0PA 1U2DA 2VTDA 3E9MA 4B4UA 4BNKA 3QV1A 4KUHA 1N92A 3QWAA 4WLUA 2J8ZA 3F6YA 5TLSA 1UXGA 1WZIA 3OM9A 3T4EA 4DQXA 3PWSA 4FCCA 3HB5X 1ISJA 3BA1A 3JQAA 4A03A 2CD9A 2I5PO 3WBBA 4J49A 4B7UA 1YBMA 4GWGA 3RFXA 2AE1A 1J0XO 3COSA 1DEHA 3D64A 1HDXA 3VZPA 3JD4A 2DQ4A 4O5OA 3GC6A 5JO0A 4FJ2A 4CM9D 3IP1A 3RASA 1ZK2A 4DXHA 4ND3A 3NRCA 2ZIZA 4BNWA 3T4XA 4NNJA 3W1VA 5L95A 1YO6A 3HFSA 3E48A 4BO3A 1IZ9A 4R01A 1I3NA 1K6IA 4BMSA 4MVJA 2EV9A 4R1NA 4J7CA 1ADCA 4GWKA 3JQDA 4U8GA 2XOXA 3KHUA 4G81A 3GN2A 5IDQA 1I5RA 1LSJA 4AJEA 4PZEA 2JFGA 4UVDA 1SBYA 3EW7A 3RU7A 5I9NA 1KEUA 1EUCA 4TKMA 5HM8A 1XHLA 3BHMA 4J7UA 3W4JA 4DLLA 3QLJA 2YFQA 4JBHA 3TPCA 4E2XA 3BAZA 3SJ7A 5CDUA 2WTBA 4XYMA 1XIVA 4GKVA 4GBJA 5F5NA 3WGQA 5LDGA 2D8AA 4CMIB 3OQ6A 5C7IO 3ZNOA 3GH3A 3U09A 3VH1A 2B4QA 3GUYA 3SEFA 4CR7A 3M2PA 1DRWA 1Q7BA 1X14A 5TQVA 4BO4A 5TIIA 3IJPA 4L73A 2P4QA 1NBOA 3AOEA 3BMNB 3DHNA 4W82A 4YAJA 4OOEA 1R6DA 4RDIA 4AG3A 3S2FA 3AWDA 1ZIDA 4PG5A 4CJXA 4DQUA 1U4OA 2C7VA 3KYCA 4KMSA 5JMWA 3H9UA 3I4FA 1YONA 1P1HA 3ANLA 5JMPA 2FN7A 4BGEA 1I0ZA 2P9EA 4YJGA 1CF2O 1SB9A 5EIOA 4Z0HO 4DPLA 4YB8A 1H94A 2AQIA 5JAIA 1C0LA 1XKQA 3HQ4O 5EL0A 4IJUA 1LSSA 1EUZA 1Q1NA 3NGXA 3FNGA 4II3A 4CM5A 1CQJA 4JJGA 4YXFA 3DZIA 4DC1A 3ROPA 4IUYA 3ZCXA 1ZK0A 4JQCA 4O63O 1QSGA 4I5GA 3H9JA 1ULSA 5IN5A 4DQVA 3Q9NA 3C1AA 3OP4A 3DBLB 5JS6A 1NQ5A 2IZ1A 4I5FA 1PL7A 3SVTA 1XLTA 4CV1A 2C59A 4XIJA 1F8FA 1EE2A 2VUUA 3ADOA 3STHA 3ONEA 3PLRA 2NQTA 5B1YA 3Q9UA 3QSGA 2CNBA 3OBBA 2WM3A 3HZZA 5B4VA 1B8UA 2F1KA 3FTNA 3JQFA 5JY6A 3S55A 1HKUA 2IZ0A 1NPTO 2E49A 1A7AA 3FI9A 3IP3A 1VE9A 2UYYA 1JAYA 1LC0A 1TA4A 1HT0A 1KETA 3HB4X 3GMSA 1PSDA 2I65A 5U4QA 3H3FA 3RROA 1VJTA 4UUOA 5EPOA 1ZSVA 2NV6A 2Q2VA 2ZTVA 1EVIA 1ZSYA 1U5CA 1N1EA 3E9QA 1NPDA 3FBGA 3WWYA 3C24A 1KEPA 2JCYA 1PR9A 4XB1A 3OJ0A 5AYVA 1GYRA 3WLEA 3WLFA 1G0NA 1U9JA 4PLVA 3MTJA 3ETDA 4Z3KA 2O4UX 5L4NA 4WE3A 4EI2A 4G65A 1EMDA 4RDHA 3A1NA 2BRUA 1KEVA 2FRDA 5H83A 5A3VA 4MVJE 3VVCA 4OOFA 1XDWA 1K2WA 1B15A 2B4RO 3TF5A 1IHYA 1ZO8A 3LU1A 3EGOA 4MVJH 4BO6A 3AM3A 4ZICA 4ZRMA 3QIVA 4L4RA 2EGGA 4PZDA 4XQCA 5TSDA 1BVUA 3WGOA 4A27A 3OIFA 3WIEA 3DBHB 3T7EA 4BB6A 3UAGA 2Y66A 1Y8RB 2XAAA 3OEWA 1ZSNA 3F4BA 4J7XA 3JYNA 2ZYAA 3O38A 4M86A 1PU2A 4UEJA 3TQHA 4EJ0A 3VPSA 4ALMA 2AHRA 2HK7A 4E3ZA 3HADA 2VNSA 5EQDA 4DLAA 1ENOA 5LDHA 4GMFA 4E33A 3K5PA 4CMCA 4AJIA 3ZZNA 2NTNA 4TVBA 1I3LA 3E5RA 3V1YA 2EGHA 4HNGA 4DGSA 1O89A 2Q49A 3AFNA 3ENNA 4H3VA 1I36A 4JNKA 4NHEA 1HE5A 3RJ5A 3I6QA 3MZ0A 1N5DA 3JQ6A 4Q3CA 3RJ9A 1YS4A 4CMHA 1UP6A 1T24A 3RBXA 3WFIA 1DRVA 1SB8A 2R00A 5TJ9A 5T8KA 2YQ4A 4CLXA 3RC9A 5L51A 3GDFA 4NJMB 5KJ1A 3MOGA 4YACA 3L77A 3PGXA 4P22A 1DC5A 1X1EA 2X0NA 5JDCC 4XRGA 3FPLA 3MJVA 3OH8A 1R66A 2O2SA 1A27A 2P68A 2CVZA 3DBRB 1U3VA 4LW8A 4N7RA 1E5LA 1C0IA 3AI3A 1EVZA 3ANMA 4Z0PA 3JQGA 3RUEA 2H9IA 5G4KA 1ZCJA 4XKJA 5HTOA 1QYCA 5AOVA 4Z9XA 4HX5A 5KCZA 4FJ1A 3PHHA 1BXGB 4GX1A 3TL3A 4BQPA 2VHVA 3OJFA 3IKVA 4YPOA 4CQLB 5HA5A 1RKXA 3UKOA 1A71A 1DIGA 4XDZA 1H9AA 4S1VA 2DUUA 1PJBA 1P1FA 4J3FA 4OYRA 4L4XA 5KJFA 1ENZA 3JQCA 3FCOA 3GG9A 4KUGA 2OXIA 4BNHA 3O03A 1LTHR 5T67A 3HSKA 4TMFA 2PR2A 1EQ2A 2GLXA 1W6UA 4UUMA 5TX7A 2W4QA 3GZ4A 2HMWA 4PG7A 1F14A 2R2GA 4NK5A 2IYOA 4CM9A 3UCXA 2LDXA 5A02A 3PHGA 3GZNB 1GTMA 3AOGA 5ITVA 3GDOA 2VN8A 4WKGA 4Y8VA 3E03A 1QV6A 4ZVVA 2G82A 3GVPA 1UXJA 1M76A 1HEUA 1HDGO 1LLQA 1SEVA 4UVGA 1DB3A 3WNQA 3AY7A 2FWMX 4BNZA 2HMVA 4NFSA 3JD2A 1DO8A 4BO9A 3JQAB 3EHEA 4OXNA 4CLHA 1KVUA 5JE8A 5L7TA 5ILOA 3OETA 1E7WA 4PCVA 4B3JA 3AUSA 4IZHA 3WBFA 1H6AA 1T2DA 2DBQA 4R54A 2QRJA 4MKXA 1A7KA 3ZWPA 1QKIA 2HK9A 3NT5A 5IG2A 1EK5A 4Q3EA 1R4NA 2HMTA 1EFLA 4YA6A 4FFLA 3ZWVA 3PQEA 3KEOA 2O3JA 4HFJA 1LLCA 2JCXA 1ZNQO 3WSWA 2IZZA 2BHLA 2W2KB 3GK3A 3N58A 4IXTA 5A06A 3G1TA 2VWGA 3JV7A 3H5RA 4FD3A 2DBRA 1HE3A 1A9ZA 2C5AA 1N8KA 1IULA 1JKIA 2J6IA 2VWPA 4IMRA 3LQFA 1NP3A 4GX2A 1PZHA 4B4WA 3C85A 3BMOB 1QORA 1MFZA 1DLIA 4I5DA 4BV9A 1Y9AA 2G17A 4LVUA 4PLHA 3K30A 5CEJA 1DJQA 1UUFA 3S2EA 1SMKA 3EZLA 3W8EA 4UVHA 5I7VA 1GEEA 1YL6A 4UULA 3EK2A 4J4HA 3RUHA 4R16A 1P33A 3I9KA 1HSOA 3NJ8A 2OBYA 3NV9A 3ZV4A 4UEOA 5BSEA 2NM0A 3ZW9A 3O4RA 3GFBA 3O8QA 3H2SA 5JYEA 3VKUA 2OHXA 1G1AA 1AHHA 4LGVA 4B3HA 2PY6A 2OGUA 2JD2A 3NDJA 4GGOA 4FFOA 4TSKA 3B6ZA 4E2YA 3Q11A 3BXXA 4FS3A 3WYCA 4MOWA 4AJ1A 1ONNA 4E12A 2YHIB 1H6DA 3AUTA 1RM4A 5HWSA 1JW9B 2PH5A 3QE3A 1PGNA 4D7AA 3NDIA 2RHCA 4GX5A 2YHUA 3QRWA 1E3WA 5BT9A 2V6FA 3U4CA 2C5EA 4JXKA 4IJVA 4IGFA 1IOLA 3CEAA 1RYEA 4IZIA 4ALLA 2NU6A 4BO0A 2D1YA
chains in the Genus database with same CATH superfamily
1BEUB 4YBZA 5K8LA 2OXEA 3WMXA 1NNUA 3MJCA 1QLJA 2Z8ZA 4HSEA 5DYTA 4BFZA 1V9CA 5KQPA 1W76A 4PC7A 4LWPA 2HPZA 2CCKA 2WWVD 3RYIA 1IQPA 2VXCA 1KARA 4LJ4A 4UDXX 4X24A 5I9MA 3VGJA 3FRJA 3FIUA 4WZBA 3VYVA 4CM1A 4R7ZA 3I05A 2QD3A 3RAPR 1MN6A 4UNRA 1PSZA 2VT2A 4NAUA 5I9SA 3RAGA 2ZAOA 1IVSA 3O1IC 1D6JA 3A7DA 1REQA 3O8OB 3U3JA 1BJKA 3H2JA 1M1NA 4GXTA 1R88A 5FI0B 1B26A 1HQKA 3LPNA 5C37A 1C80A 2GZSA 3C4VA 4AJNA 4DTIA 4DIMA 2C4HA 3TW6A 3FTDA 2DPXA 3ZIDA 1B8OA 2XT6A 1XEWY 1DOHA 1YE3A 2X15A 2BI4A 5FB3A 5A4IS 3EDRA 3K0SA 3P27A 1EFRA 4LJSA 3EQ9A 1I1NA 3KAKA 1R8SA 2VEDA 2OHJA 3ISTA 4UREA 3SZMA 1YTUA 3EFEA 3FSRA 5BWLA 4GMXA 4H7HA 4Z4FA 2GK7A 3PK0A 1V47A 3EX7C 4ZZ2A 3I5YA 1BEZA 3OUTA 1ZMXA 4E03A 1G20B 4M0KA 3V5NA 4B79A 2AI3A 2W2PA 3OFNA 2EARA 1DADA 1VIMA 4EVQA 2PE5A 1CJSA 4QTUB 2ZAYA 4BCCA 4Z54A 3V33A 1F5NA 4UOQA 1WLSA 3WQSB 1MVNA 3EMVA 1X77A 2JFBA 1Z35A 2QLNA 4LAFA 4QM6A 5D86A 4US0R 4PZPA 1GPAA 3OO1A 5EZYF 3VKVA 1VMDA 5H68A 4I3HA 3H9QA 3O3NB 4ZXFA 2J3LA 2OZLB 2GXQA 4DZRA 1T8YA 5KVCA 3CZMA 1P6UA 4FOOA 2WV7A 4R6WA 4G3XA 3ROKA 1W5FA 5IJ9A 4PN3A 4RHEA 4PN7A 2FP3A 3PZBA 1M6HA 3G6KA 5DU2A 4LRXA 4WA7A 1XXLA 1JR3E 1E2KA 4FQ7A 4HUQA 5B2EA 3HV2A 3ICEA 4OQDA 4EY7A 4KSBA 2Q6LA 4UHDA 3T9EA 3NFRA 5JYCA 1M54A 2Z4SA 3SS7X 3A26A 4RH1A 2P79A 3NG1A 1F60A 5AVVA 2XWBF 1NFFA 2YXBA 1UFOA 3N05A 4FFDA 2IXAA 1B1AA 5HK8A 3T7DA 1BDMA 4QKQA 5DHPA 2W6CX 3PVCA 3UMFA 4CIWA 2V3VA 1RJDA 2B9EA 3ZGOA 2XKJE 3HXMA 3ZGYA 2VDNB 5FKJA 3CB4A 2AUMA 3RV4A 3W3AD 1P9WA 3QFFA 1DBQA 3I0ZA 4M0EA 1YDMA 3L41A 3WGTA 1ZCBA 2XXAB 3A1TA 3AEYA 5E6UB 3LZDA 4M0DA 3TCXB 2R84A 3VZRA 3PEFA 3TBKA 2O6HA 2I4RA 4PY2A 5HKAA 3JYHA 1K9VF 5CVDA 2FCRA 3T1HB 2XQGA 5NLLA 3HDJA 5L7YA 3MLEA 3IDQA 2ZE8A 4ZI7F 5JATA 1YRQA 1RS0A 3O82A 3CX7A 4RELA 3KE8A 4PFKA 4IQFA 2CGEA 2PDAA 2FP4A 4NZZA 4NFLA 1DJLA 1DEAA 4HFMA 4BJ5A 1VDMA 4XASA 1KGSA 3K5IA 4WACA 2V9ZA 4BXOA 5MFZA 2IIPA 3TIVA 5ELXA 1BXKA 3QLEA 4C3OB 2GAIA 1EAMA 1P8JA 1MX1A 1QQ6A 2PRSA 3K9NA 3LT2A 3OD5A 3CNBA 3DDNA 1K89A 3EPHA 5AHKA 3MWYW 2Y1EA 4MCJA 1CDDA 2W37A 4X3OA 3UM9A 4EQZA 2O0KA 1OXMA 1G20E 1RRFA 5FBVB 3EXG2 5CH5A 1O94C 3V4VB 1SOWA 2OCXA 4A82A 4OPMA 5AOBA 3HDTA 3UJ6A 1EBFA 3VRHA 4BV8A 2VT3A 3L4EA 1J42A 1YT5A 4J3NA 4CLDA 3L8YA 3NTOA 5EP4A 2HN9A 2Y76A 1I2CA 4R1MA 1GPJA 1MQSA 3K2EA 4NSNA 5J4YA 4DA4A 5BT8A 2VSFA 1OXUA 1QYVA 4BFXA 4BECA 1P29A 1YBFA 2DBZA 2GCOB 2OOSA 5C5CA 2Y4NA 3Q1LA 1V39A 1X7WB 1ZG3A 2EHDA 4LXXA 5I9BA 3GUHA 1GAJA 3C3PA 2PXAA 2ATCA 2FP4B 4PPGA 1U8XX 3VKHA 2FFBA 4MW1A 2FG6C 1WOYA 4US2R 5JCJA 3U3OA 1T4DA 1YU6A 2C4NA 4G63A 3S2IA 5FWXB 2ZCVA 3D3QA 2B36A 3EAGA 2XGOA 4NBRA 1ZKMA 2DY0A 1RLUA 4IHKA 4GVLA 3OFJA 1QTNA 4M1KA 4F9FA 5A3QA 3RFUA 1QIHA 4BNVA 1DBPA 5K8IA 4TROA 4D3ZA 2IXDA 2P67A 2FGKA 4QOJA 2WKPA 4Q24A 4B3XA 1JSLA 1LQTA 4XQEA 2ZR0A 3L1UA 4ZOLA 2UU9B 3OT1B 4PTLA 2QTCA 1N6PA 2YNMC 1KAGA 1R5BA 4KQWA 3OQMA 2BHSA 1L4GA 2ZBGA 4JGGA 2Q8QA 5ALRA 2GJSA 3ZU4A 1RTKA 2DHCA 3MCAA 1HK7A 2O0LA 3QKRA 3B38A 1KH1A 5K20A 2ANCA 1T6ZA 2UZ3A 3Q8WA 5T3YA 1EX7A 2DLDA 2CB9A 3VNAA 5AVSA 5I7OA 5J47A 4ETMA 2A92A 1M1YA 4ARUA 2R6CA 2D3WA 4H17A 4RK0A 5DI9A 1SXJC 1T26A 5BR7A 2Z2YA 3OIDA 5BXYA 3A9SA 2IODA 4NI5A 1XCOA 5KVQA 4A8HA 1LBHA 4KZKA 5E3IA 4L9RA 4OGFA 3AF6A 2EG5A 4M0LA 1F3LA 3CUSA 2IPMA 4Q3KA 1TKAA 5A5DA 3CVXA 2ZRJA 2AUNA 4M0PA 3WOHA 1L8XA 4MUGA 2VYNA 3IKMB 1DLJA 3GQBA 1KI4A 5EMLA 1CQJB 4I1OA 1QB7A 2OHOA 1A9XB 2BJHA 3N86A 3Q15C 4M37A 3RVRA 3TVTA 1GCAA 4FZJA 3ESDA 1BE1A 1WDLA 5BWOA 5JWOA 3UC5A 1IBRA 1QYRA 4X7MA 1U04A 2PKCA 4MIYA 1O6FA 2OPHA 5CCEA 1JEJA 1DEXA 2W7TA 1BMDA 3L0IB 5IULC 3R3VA 2K6GA 1GG9A 1S4QA 1YWGO 2IRWA 1EP3B 2IT1A 2ZRCA 2WFMA 1B0PA 3DUFA 3CS3A 3EVBA 3KSUA 1OWPA 3DZBA 5DRYA 2XQIA 3ZD8A 3M70A 3E05A 3LYAA 1NC3A 6REQA 4EYEA 4KGDA 1WXDA 2OP1A 3AHDA 2OC9A 3JQAD 3KYJB 4GNKA 1O08A 4X92A 2FPLA 5EFOA 2WWWA 1L7PA 1OI3A 3KPUA 2E4AA 3E7WA 3ZZMA 2Z2JA 4AN1A 5BN4B 3OJOA 1TTQB 1A1VA 1G98A 2VAXA 1K2VN 3OESA 3L18A 1QK5A 2ZXFA 1GQOA 3LHIA 5ADWA 3NR2A 1KO7A 1TB4A 2UYGA 3ME5A 4WEQA 5EVJA 3OVMA 3R5KA 3TAUA 3REGA 6PFKA 1Z38A 4NYJQ 3MJTA 4Y2TA 4IIUA 1Z75A 4C0LA 1E79A 4XIIA 3BSWA 2LPMA 2ZUVA 3Q6IA 1CY6A 1ZM4A 3IMGA 2FEOA 2CHFA 3C3CA 4IXWA 5IYZF 3I4LA 3WLIA 4ZJUA 3VNRA 2B69A 2CE7A 4OKIA 1RRKA 3X1DA 4LI3X 1TMGE 9ATCA 5TE9A 1YTLA 5BPHA 2JIPA 1HE4A 3GLQA 1CS0A 1I9CA 1WHSA 5EKTA 1OZGA 1E7RA 3L9XA 3VC3A 3ZDCA 2Q3HA 3TZLA 3KQLA 2Q27A 1PX2A 4O2AB 4P8RA 2P4HX 1OTYA 4ETNA 4IG4A 3CNNA 1WDKA 1SIOA 4JEIA 2VA8A 3X2EA 3CZ9A 4URFA 2GTHA 2V1XA 2QT9A 1V7ZA 2M1XA 4H7IA 4IJMA 5EJ4A 4BJ3A 4NE2A 4RE5A 3G3EA 3L0BA 2IV2X 4PYQA 1OJLA 1Z37A 5DE3A 2H17A 1WTAA 2GPSA 1JEAA 4XB2A 3VUEA 4FM9A 1L7RA 1RCFA 2O7QA 1QH1A 5FUXA 4F1WA 1IPEA 2HJRA 3NBQA 1H2AS 1T0UA 1N5KA 1QH9A 1U31A 3KQYA 3DF7A 3MK31 2NU8A 4IDOA 2EP5A 3HCPA 4MRSA 1WSBA 3OX2A 2PFGA 2COKA 1PVOA 5DW0A 5JJ5A 3SVLA 2NQ8A 4NU5A 1DEKA 5U1PA 1JQJC 2Y0CA 5DX0A 3BCRA 4BX0A 3M49A 2DPMA 4R68A 5FPYA 5JAQA 4DLNA 5K6AA 1AV6A 2I4NA 3B60A 5JZBA 4G0ZA 1LQUA 4X3CA 4N01A 1Y5IA 3U4DA 4F9TA 3ZU5A 1H3FA 2X9VA 3MYYA 4YV1A 5BQOA 1HZZA 3ZN2A 2HMUA 3IX7A 2G6TA 4B6FA 1RWPA 3VPAA 4ML3A 4FHFA 3UJ3X 3RNOA 4AU1A 3H1TA 4BGIA 1XVUA 3U62A 4W5JA 4YMGA 3INGA 2H18A 3CBQA 3LT1A 1WB5A 2W00A 3FNQA 5GMOA 1K88A 3U3DA 1M2GA 3BTOA 3KLMX 4IQ4A 5JXWA 1N5RA 1P44A 5B12A 1ZFNA 2ZRLA 3KOMA 3HJCA 1P3DA 3JATB 4D45A 4R6XA 2QD2A 2ONKA 5TGZA 2PGAA 2H08A 5G3ZA 1W0KD 2BDUA 4A8PA 4E1AA 1FP1D 3CKMA 1ZX1A 2QSJA 5D5PA 2ACWA 3FKSA 4P83A 3TXXA 2JIDA 1NJFA 4DABA 5JHGB 2PYDA 1TF7A 4BV2A 1BE0A 1NFQA 1E0SA 1U8TA 3O1JC 4DF3A 1XMPA 4BB5A 1MC5A 4JUDX 2WC1A 3ZHBA 5B3JC 4WTOA 3L6UA 4HVAA 1KZ9A 2VC2B 3LA6A 3PRYA 1X7HA 4R2HA 4E11A 2AXPA 3G2NA 1T2FA 1UM8A 4RD2A 1TJYA 3QNUA 3W3AH 1QIJA 1RM5A 3D1JA 1J1ZA 1GYQA 1NVKA 2AIRA 2HO5A 1OWMA 3OMXA 3QLVA 3K5WA 2IDZA 2WJJA 4W4TA 4F21A 1M2OB 4YLEA 1YV9A 4J29A 1TVKA 1PQUA 1R74A 5LXTF 4E4TA 4R3NA 1OFIA 4F2HA 3K9BA 5TS3A 4CM4A 3QHQA 2DFNA 4KLNA 2GRJA 2PMCA 1U3WA 4JT2A 4Y9SA 1W29A 2VS1A 1T8WA 1TGVA 2FLVA 2QN2A 1ORDA 1LNQA 2EKPA 3N2EA 1IIBA 1WJGA 2ATXA 2BUBA 4PANA 4PHTA 1FSZA 3GJ4A 3WLQA 5AUNB 3L5KA 3ZGLA 5H0IA 4L0CA 3EZ2A 4ZI3A 2O2CA 4IV0A 2YW2A 3PGMA 2ZB8A 2J7PD 3BGWA 4GYJA 1G6HA 4N5NA 3LUGA 1COWA 1FVXA 2V3CC 4TRNA 5AJVB 4CKWB 3LP6A 3DQZA 4KXXA 2BMVA 1H93A 2J41A 1KJJA 3SAJA 4RPJA 3NHSA 1VHDA 3E3NA 3HDVA 3SDBA 1T0IA 2I80A 4F72A 3MS2A 2FHPA 1CFJA 3ZX4A 7REQB 3PQ8A 4HWPA 3UKDA 4EB0A 4E14A 4F5YA 4F92B 2RH5A 1Q1EA 5G0UA 5K0FA 4RFSA 3QI7A 5LMUB 1PJAA 4HADA 3UJHA 2QAGB 2XYQA 2Z09A 3KVOA 2PU7A 3MQFA 4KW7A 5AVZA 4CL2A 2A86A 1C9DB 2CB0A 1KJ9A 1LUAA 3E0XA 2IZ6A 5CYOA 4KXNA 2LCFA 2A5LA 2CNNA 5DV9A 5IJXA 2GKOA 3LZ6A 2GD1O 3IEKA 2AX4A 5M7EA 5BVHA 2YXPX 2B1JA 3EVCA 1CQZA 4JUCA 4MUIA 2OGWA 1BCSB 1QVRA 4U9UA 2C3YA 1NIPA 3SEQA 4NPHA 3V8BA 2FMXA 2XDWA 4P58A 3GPLA 1II8A 4HWKA 4B0OA 1ZGBA 1AZWA 3GX1A 5KNDA 1FNSA 4Q47A 2HJHA 3PX7A 1LTQA 2C7OA 1T25A 4IZ6A 3PFWO 3PRJA 3AFIA 2YWFA 5IUJC 1BWSA 3OFVA 4XQ9A 1BA3A 1EGHA 3RS2A 4ZIRA 1DUVG 1E1QA 5KWEA 3DV0A 3ZPXA 1F2UB 2C3OA 3TXYA 4YEDA 3UMJA 4DCGA 5BP7A 3QV2A 3DXXA 1QPGA 1T5HX 4DOMA 3KJHA 2XZLA 1KP9A 1Z26A 3LUHA 4R8MA 4QHTA 3FNEA 4GKBA 3G17A 3QY0A 1QDEA 3OKPA 4ZJZA 1EXWA 2XBMA 1N9GA 3CH6A 1QVWA 2E1RA 5IFLA 2ZZNA 2B21A 2JKZA 1V1MB 3U9SA 4X7PA 1MENA 5B2FA 3THYA 3QVVA 3WP0A 3P71T 3MELA 1I51A 1YCFA 2ZWIA 2R7KA 4B6QA 4W5OA 3HVIA 2WU3A 1H0KA 4HB2A 4I3FA 3ZQUA 1YU9A 1OROA 5BWBA 1ZWLA 3RK4A 2HSGA 3TLKA 4ZMBA 2QVGA 1LNSA 1VL6A 3DLBA 1T2UA 4ATNA 1QK3A 5IAEA 3HYLA 1RKQA 3KUUA 5CK5A 4RVDA 4DMCA 2Q4DA 4MV4A 2E4UA 2NXNA 4QJ4A 5GGXA 3F3SA 1KEEB 3TGLA 3E2IA 2GPTA 2BE9A 2CCGA 3SN6A 3KUCA 4G5HA 3R9XB 1UDRA 1P60A 4Q18A 4M8IA 4R2JA 4PX5A 3OPNA 1NRXA 4AJPA 4BEBA 3FCXA 2AFHA 4ZU3A 4QU5A 5K3CA 4TKUB 4Q4AB 4WLVA 1DFGA 1QHHA 1IAVA 4JYZA 2EZ9A 5TXGA 4EA6A 2IH2A 1Q16A 4HGPA 5BSKA 3A1SA 2JJ2A 1Q0QA 1ULAA 1VLMA 1WMDA 4V0OA 4TYNA 2QTTA 5EOVA 4YRJA 2SKEA 2OO5C 4AROA 3KB2A 4TSFD 4R8SA 2BZ0A 4BCBA 1S02A 2AFVA 3S4YA 1R5OA 1H65A 1I6LA 2Z6QA 1F2VA 1J99A 1UBMS 3H2ZA 4PF1A 4U8HA 3LLUA 2WSSD 1QHFA 2HIMA 3C45A 3DMNA 1W19A 2IPXA 3DLPX 1PJ4A 4N5LA 3SC6A 5E6UA 3WK4A 3GEGA 4RGBA 1BGWA 3D3WB 1JXOA 1UM9A 1M66A 5JTUA 6ADHA 2VHYA 13PKA 2Q2OA 5K3FA 3JQ7A 3UQYS 4LHWA 2P3SA 5JAPA 2CDCA 3ZCSA 4QSMA 4K28A 3L1HA 3MJSA 2WU1A 3EVGA 4GXQA 1BFKA 1U3UA 1M5UA 2JBAA 3GCZA 4PS0A 8OHMA 2WD9A 1NXQA 2HQ1A 3HBNA 4OA5A 4X62B 1D6NA 1FPQA 3GFFA 1QIFA 4C6TB 1SBZA 4QM7A 4UM8B 1YJXA 1YZGA 3VMMA 4YO8A 3RRFA 3C7CB 3GH1A 2FSVA 1CD5A 1COWD 2PL3A 2D0IA 3TTSA 1D4AA 3CW2A 1RBMA 3C8ZA 3BKXA 3H9GA 3R20A 1BMFD 4C43A 4D97A 2AD5A 3GFRA 3VNUA 3OECA 3T5MA 3BULA 1JVSA 1Z3CA 2GCOA 3GBSA 3JTMA 3LQKA 3QXHA 4H3SA 4KDRA 1MV8A 2Q07A 1D2AA 4D9HA 1SY7A 2PRZA 3QITA 4I8XA 3B53X 1ZVVA 4L6IA 2EJBA 1O5TA 1TRHA 2G8NA 1HL7A 4Z8YA 4YYZA 4MW6A 4EUFA 3M6VA 3UUFA 5CFRA 2H1IA 1T0HB 1ZA1A 1LI5A 2G40A 4OL9A 3B6EA 2YXDA 4ZOBA 2DBYA 4EFLA 5FHRA 1GQQA 4ZVMA 4V1CI 2CYBA 4GXNA 3K73O 5EYPB 2PUVA 4UE6A 1XMXA 5IYZB 1G16A 1EA7A 4LMAA 3UMSA 4UU8A 3JTEA 3B5JA 1ZNYA 1SNYA 3I8SA 2EEZA 2QG4A 5G3YA 1Z5ZA 2GGSA 4INPA 3BXPA 1SU8A 1PFVA 2OORC 1XVLA 2GCNA 1Z82A 5FUVA 2CWDA 2Q0QA 2WJZB 3Q41A 2PXCA 4KQEA 5F1YA 4QEDA 3BZBA 4QHYA 3HMKA 3OU7A 3BCUA 1TA9A 3OOWA 2F8SA 1J9GA 1O9HA 4RZHA 3EUAA 4KH0A 4GI5A 3WS7A 3Q8KA 2J4DA 1Z6GA 1N1MA 4TVOA 1A2OA 1CQPA 2EL7A 3K20A 3CEPB 1ORRA 1QANA 2LIVA 2C5SA 3ETCA 3I1IA 2ZJ2A 4MQLA 4MR8A 3R7LA 3KZMA 2B30A 3N2GB 4GD3Q 1Y34E 5E95A 3TDMA 3L7OA 1JNXX 2GSWA 2NTYC 1ORVA 3L0ZA 3AUXA 4UVIA 3KHTA 1XLWA 1SD1A 2FU5C 3GCGA 3F3YA 4ZVTA 5K0JA 2VWQA 3QQPA 2QROA 2GWHA 4LSWA 3LH5A 4U7GA 4WBSA 1YCHA 1ODSA 5JMTA 4QUIA 1KEKA 2DPYA 4GAEA 3HP4A 2XVXA 5REQB 2HDHA 3STYA 2HLDA 1GQFA 1L4YA 3D6AA 2FFQA 3I2YX 4EG7A 1ECPA 2AN5A 1TMKA 1UJCA 3CUWA 4C03A 4TXHA 4YPVA 4AKTA 3S8EA 1CEYA 4H9GA 2ZRKA 3K6RA 3QVKA 2KE5A 5DNAA 3RSQA 4CDGA 1U8UA 3CLHA 1XA3A 3TQCA 2BKEA 4HFRA 4OSPA 2VH2A 3PPYA 4GQBA 4JX8A 3G13A 3UJ8A 2PV7A 1F2TB 1NXWA 3HYNA 4HGQA 3K0FA 2GDJA 2ILTA 1PEKE 3K2BA 3PFHA 3F6BX 4KP7A 2VF2A 4UBNA 3TOCA 3C7TA 5IAJA 1VSQA 4HDRB 2B94A 2IUYA 2ZJ3A 2YW9A 4MI3A 3P4YA 4JVSB 3L7BA 1TLFA 1N2EA 2O06A 1Z4JA 4JL8A 4Y0VA 3WNDA 4CM3A 1IZ8A 2X4LA 3W6UA 4ID9A 1L6RA 4DV3B 2QUZA 4DDUA 2QE7D 4NE9A 4QOHA 4RXMA 3IJEB 3OLCX 3Q9SA 4OXYA 3RUPA 3U49A 1NW6A 2CFIA 3WYAA 3IS3A 4QGFA 3WFJA 1C7EA 1AS2A 3I58A 4OXIA 4N5HX 5LBIA 2JGNA 1LLUA 3K1TA 3G23A 3K05A 4XQ0A 3C1TA 4YRDA 5EE5B 1HC7A 3UJBA 4U7WA 4CLOB 2IS2A 4NBTA 4Y7CA 3SSNA 4F4UA 2PIDA 3ZR4B 3DFFA 3RJMA 3HEBA 4TWAA 4U2KA 3VOSA 3CJRA 1BAPA 4FFSA 4UBMA 2PLFA 3O1HB 3NASA 2GYYA 3OOJA 4BN0A 6GPBA 5HZKA 4BN4A 1EWKA 1SVIA 4CW7A 2RG1A 1XU7A 4HGRA 4LY0A 1CF9A 3A1WA 1JQBA 3AYXB 3CUYA 4H6WA 2ZYSA 4TL7A 4TXMA 4D3SA 4EP1A 1DUIA 2FW0A 1XEXB 3CLTC 3JAKA 1DT3A 3K96A 4ICIA 4P0TA 4GEKA 3MMNA 4L9AA 4F6CA 1Z45A 1BSVA 1UANA 1GNQA 3KKZA 4HAXA 1ZP6A 4LZOA 3D6TB 3U56A 1ACJA 1DUSA 3R3WA 3K3PA 1RJGA 2RGBA 4G5YA 4OAPA 1O94A 3ZNNA 1N6OA 2FW1A 2Z4TA 3NT4A 4YRFA 5K99A 5CXQA 1JFLA 2CY0A 4GOND 1FS6A 2IDKA 4Y2HA 3ODPA 1D4ZA 4JK3A 2JFHA 2J31A 1JP7A 1R8JA 2WJ6A 3SZGA 3PYMA 5FADA 3DHWC 3UOAB 3EZXA 1ODFA 1R6XA 3A1CA 5IARA 4BEWA 2RHOA 3CSDA 4BUCA 4IHAA 1XQ9A 2ORYA 4EG1A 1GRVA 1HPLA 2O2GA 4IKEA 4LDPA 1N1GA 2ATVA 4RE6A 3MM4A 2AT1A 2GD6A 3OKAA 4BNDA 4RTKA 1EM6A 3SVZA 4I1UA 3T9AA 2J6HA 2FPGA 1P9NA 2UZ1A 4FONA 2PUWA 4EF5A 3C43A 4G8JA 4YRPA 3VAZA 1HZZC 3MUOA 2BELA 2FUG1 1F8GA 2BFBB 2N46A 2V7XA 3Q2OA 4RZ3A 2XECA 3H2GA 2QPOA 1A2KC 2JLUA 1ILWA 4P3XA 5DM60 2WIJA 1IHUA 2OHFA 1OR8A 1T1IA 3NWPA 4CL0A 4HT3B 1DOAA 2BKLA 2HXYA 5LQCA 2XUPA 2JGIA 3ECAA 3SNKA 2IEYA 3EXEA 1SWWA 5D51S 4RXUA 2PUFA 3LUFA 1HQYE 4B3GA 2ONYA 5LDDC 2R8PA 3C5WP 2X4GA 5G1PA 1E2QA 3WDSA 4MYTA 5T4HA 2I66A 4OJKA 3KEMA 1GA1A 1D7OA 2OENG 1RE0A 2JGDA 1S8FA 2R25B 1M2JA 3TOXA 3EUFA 2FWAA 3BPSA 3NUZA 3I62A 3Q10A 4DUGA 2FR8A 5A5VA 5J23A 4LV6A 4MKZA 2B5OA 3ENKA 1VC2A 4MULA 4GZ3A 3BB1A 3SI7A 4EO4A 2XWPA 3ZGNA 3E5NA 3IALA 3MT0A 3RPEA 1JALA 3LK6A 3KUDA 4Y67A 2ST1A 1UAYA 1WSAA 5AVQA 4IS3A 1IHDA 1BC5A 3N53A 2NP7A 1C8LA 1JTEA 1U7HA 2OQ2A 2ABWA 3AP2A 1VJ0A 3LVFO 4J91A 5K1ZA 3DV2A 4PLZA 2Z4RA 3UWMA 2WF8A 4UAVA 4BMYA 4EKYA 5K4GA 3WXMA 2CZCA 1XMVA 3V7YA 5K0EA 3KETA 2PXXA 4B83A 1RLJA 1P2DA 1ISGA 1D0SA 4WI1A 4LZJA 4MRMB 4FDTA 5HBRA 4EI8A 5IJ9B 2DT5A 1CUHA 2WU0A 3I2KA 1R15A 1RYZA 4PGFA 3CJTA 2PS0A 4HLQB 4YO7A 3BJIC 1JDBB 4JP2A 5C1IA 3IUNA 3WGGA 1ZKDA 4QXMA 5CDFA 2O7NA 3HMQA 4RWZA 4WUVA 4E5KA 4BJ6A 4QA9A 4AMZA 2JGLA 3EH1A 4EHFA 3UXHA 4GMHA 3FTEA 1JS1X 4JI6B 2NO9A 1PJ2A 2JIRA 3IE0A 1C8VB 2C07A 3HO8A 3AEUA 1XCMA 3QBTA 4PQGA 2Q9CA 5FPTA 3VBEA 4X7BA 3M1YA 4F7WA 4NEQA 3RT1A 3PTZA 1NKTA 4E2ZA 4K6MA 2RHWA 4D9KA 1NV9A 4OI0A 8ADHA 4MV0A 4MWTA 3BBPA 4OK6A 2FPPB 1CUJA 2WAYA 3INRA 4Q4HA 1VP9A 4OATA 3GVXA 4QICA 2H31A 1SCDA 1ZUHA 2C4VA 3G1WA 2HRBA 4BAZA 2FXIA 1VG1A 1BXGA 3AKCA 3H11B 1MJHA 3NEAA 4Q9AA 1II0A 1YK1A 4A16A 1AQIA 3M6LA 4AT1A 1Z2NX 2VQ6A 2GESA 5LYJF 1KKUA 1WP4A 1NYTA 3AGQA 3LC2O 2WMDA 1DV1A 3EUWA 3EY4A 3JQ9C 3K6SA 3KQTA 1P4SA 3NC1C 3MS7A 2BFFB 2QRGA 2Y92A 4TTSA 1J33A 4IR7A 1PW5A 3FR8A 3D3WA 2P0EA 2EKDA 4M0UA 4BNXA 3G9ZA 2W6ZA 2EL9A 3HE3A 2BFCB 5A3SA 3GJZA 4RS3A 2JLAA 1OVGA 3HDQA 3JAWB 3WSVA 3BF7A 1GPDG 3BD8A 3NWOA 1NTOA 4HB0A 3TEMA 4Q4CA 3G1UA 1ESZA 3TQQA 4E70A 1SUSA 3K09A 5CFQA 4YQEA 121PA 3CQ9A 2UZIR 4C0XA 3U4QA 1HI9A 1WY7A 4U3JB 5CDSA 4EKIA 1WDWB 5F7JA 2H0QA 3TZQA 2C2WA 3A4MA 3P0FA 3E1GA 1LS6A 4J9UE 4LE0A 2XUJA 1ZAKA 3A25A 2PX5A 3FRIA 4MTLA 3WNZA 3BRQA 4IF4A 3LBNA 1ZL0A 2PGNA 1ARZA 3FA2A 1PZEA 4MROA 2FX5A 1L4EA 1T29A 1IAQA 3RWBA 5EJ6A 1UJ6A 4UJ5A 1ES9A 3MPUA 3QXXA 4MICA 3GA0A 1FU7A 3B9PA 1KC3A 2DVMA 4PZ0A 2QMHA 3LE8A 3U17A 1OH8A 1MHTA 2W0SA 2I22A 1OJ7A 2Y6VA 3LF1A 4X20B 5FNVF 4UTVA 2AOTB 2FXVA 3D3JA 4G0OA 1CZKA 2TYSB 3NHUA 5JH7A 1NVAA 1DG9A 4WKNA 3RS9A 3TNDA 3THRA 4B3CA 1VKZA 5D5QA 4EJ6A 1CZUA 3MGCA 4Y2SA 2IOFA 4KXUA 3RWMB 3AY6A 1NHGA 1NYLA 3UW3A 3UJ9A 2QX7A 2ZS9A 3IUBA 4EH1A 3BE4A 3ZY3A 4KH1A 2H4XA 3TZKA 5EJ9A 3FMIA 3RUAA 2VAVA 2OLKA 3O90A 4QD3A 2JAHA 4ZYUA 5KYGA 5J2TB 3ND6A 3IQZA 3OCJA 2G70A 1RDFA 2OFOA 2RC5A 3AOEC 3C6MA 4KAFA 2IVZA 1M6YA 2FDRA 2W71A 1QGOA 3H2BA 1KJWA 4PCUA 3KSRA 4FMBB 1KGDA 1M2EA 3UPDA 2X0JA 2B8EA 3CWCA 4L8GA 3LGSA 4JHXA 3ICPA 1E2LA 2FZGA 3DWFA 3DV0B 3WIUA 2H1CA 2BP7B 5TJHA 3O8CA 1UEXC 1PJQA 4D96A 2K2QB 2JIZA 5LLSA 3KU4A 1XA0A 4G0MA 3LXMA 3M8KA 4JI7B 4K0RA 4W5RA 5A9SA 3TQSA 3OF2A 1A88A 5CX1B 2RHGB 2E1PA 3A9UA 2PUGA 3BXGA 4PZCA 3PWTA 3AVYA 2C88A 4DC9A 3L46A 5DEOA 5CCDA 3FFAA 2DTDA 1OVMA 3CONA 2PX0A 1E6UA 4IBOA 1BYIA 4ZU6X 3O5AA 1PEYA 3KFXA 1E3EA 3MRTA 4HOYA 3R23A 3PQ7A 3UH0A 1H85A 3C5EA 5CYPA 5HMMA 2IS6A 3VHLB 3W7AA 2D06A 1E9DA 4F3KA 4FSHA 2CF5A 3FYCA 4BKUA 3GR6A 3ZLTA 2O1XA 3DMDA 2D2EA 1ECLA 1K6EA 4UCQA 3ZWQA 5ADVA 1AXRA 1WBBA 3ZOZA 3TIGA 4ZC1A 1A9RA 1G5TA 1HV8A 1KOJA 2FPSA 2WUGA 1I13A 2A57A 1PR3A 1UP4A 5FTJA 2IYVA 1J8YF 1WXQA 2AGVA 5TRTA 4PO1A 3PEVA 4C0QC 3LKDA 3DMGA 1SHUX 1ZZGA 3K0AA 4L0QA 1PEDA 3O4IA 3KT6A 5I9TA 1TAUA 1JDTA 2VNAA 2XD9A 5ENDA 3BE6A 1CIVA 2QNBA 1L1FA 4M98A 4EVRA 5KPDA 1KO5A 3A2LA 4DA6A 4GP9A 2CFTA 2A5GA 4FDAA 1ECGA 1NVBA 1RRPA 4RH0A 2SCUA 3GRRA 3LX6A 4V0NA 5A6VA 1J23A 4JB2A 1NVMB 2QVYX 4WDQA 1CETA 1KZGB 5CVCA 4ZQCB 3P4UA 3SBXA 4LRSB 3I04A 4CI0B 1GTJ1 1L4LA 3GMIA 2I4TA 2NP6A 2QD4A 5FUYA 3R8CA 1IC6A 3JAMA 1Q21A 2WFZA 1NM5A 1MW8X 3S28A 1U0RA 1KYTA 2R1TA 3SHFA 4FWBA 2EVWX 2PMBA 4W99A 2Q9BA 5T64A 3TPFA 4OHPA 4E4YA 1DWUA 1THGA 3DKPA 2EX1A 5BOVA 4CG3A 3T5BA 5AVYA 2DMRA 4ZAFA 3RFCA 2GM3A 2OWEA 1E1RA 4K05A 1A77A 1SGWA 2Z6VA 2AJLI 5G0TA 4GNRA 3OC0A 2CMDA 4BNMA 2QM0A 4MPJA 4P98A 2ZXEA 1RVDA 2B4TO 2IWRA 2XEDA 2Z5VA 4RVHA 2BISA 1YOVA 1MZPA 1PJTA 3V00A 4UNNA 2F8MA 2FEKA 2HZ7A 5KTOA 1CEQA 2QD1A 4R51A 4BNLA 3LQQA 2OR3A 1NLFA 5AW6A 3OWOA 5LOVB 4JV5B 3DOJA 2WPDD 4X60A 1P1BA 2QF7A 4P4SB 2X13A 5FL7A 3M4JA 4G2TA 1A8UA 1TC2A 3BM5A 3QKRB 3NPMA 1RCUA 3H0CA 1UKCA 4KO8A 2IYNA 4E5PA 2H1VA 5AVTA 4Y1FA 2JZOA 3ZVNA 2HFKA 1BOFA 2JD0A 4DJAA 3CWZA 2CLIB 3C2QA 3D5EA 3WIDA 1JDZA 1DARA 3ELDA 1MO4A 3OZFA 1UJ4A 1WKVA 3A8TA 4UM5A 2NUTB 4V39A 4X41A 1HG1A 4ZCLA 5LQNA 2VZ0A 3DVLA 2YZ2A 1E6CA 4IXNA 5I8PA 3A36A 1WUJS 3ABIA 4HEQA 2AXQA 1HUQA 4DJEC 4UE2A 2QP9X 5E4JA 1V37A 3KZVA 3V8EA 2XCIA 4UPEA 3RARA 3PC8C 4RSGA 1JKXA 4BWGA 3NM6B 4NBSA 2D1FA 3CR7A 3ND7A 2AI2A 5L3QA 4I4TF 1P72A 2NSDA 3O9MA 1CQIA 1Z88A 1HL3A 3UWPA 1IMJA 4ZRNA 3IQDB 2YOHA 3NC4A 3ZJ5A 4MW7A 4IEFB 1XU9A 4L16A 3H8WA 4YT8A 2XZTA 3HXKA 1RI1A 1EIZA 2D1QA 3GLFA 2YHIA 1H2XA 1JG7A 3B36A 3K9GA 5BSHA 1AQUA 3I73A 1GNVA 3IOBA 2C3MA 2VHZA 4II2A 6REQB 4GI1A 1AZSC 4F1JA 2COEA 2Z04A 2ZRQA 4O4HF 4AIIA 2UYCA 1PG0A 2OQVA 1XROA 1XTBA 2G07A 3IEVA 1NN0A 3K32A 4EW3A 5BQXA 1QV9A 2Q2NA 3AX6A 2ZTHA 2VYND 3P2YA 5TMDA 3FLAA 5EIAA 1DC6A 4DUZB 3CX3A 3T1VA 3CPHA 1OZ0A 2FZCA 4OBEA 1NNEA 1JQ5A 4JIGA 3GIDA 5DDIP 1X1CA 1SOUA 4F46A 1IZ0A 2CVQA 4FFBA 1BJRE 5D3MB 1X8JA 3A6ZA 3KJIA 3WNCA 2XTZA 2MSEB 3LY8A 1RWKA 1K27A 3V97A 3A31A 3JALA 4LC9A 4ZYZA 2O8EA 4W9RA 4GM0A 3TE7A 4GKJB 4N5DA 4GMKA 2VSQA 1Z16A 3DNMA 1COZA 1SKYE 5IN4A 1FTQA 4XR4A 2WSBA 4JSRA 5FOUA 2JFXA 1Q95A 3NETA 3ONNA 3QVSA 1O8BA 2KQUA 5JCPA 4NZYA 4MV1A 3VKGA 2WV9A 4DR4B 3CRVA 1DDIA 4NARA 4DV0B 1FRFS 3AUJB 3QX9A 1K8QA 1JX6A 1EFVA 2J9XB 4E13A 1QMGA 2PPLA 4A6EA 3QTLA 1JE1A 3AFGA 4F9EA 4FFWA 2PG3A 2SKDA 1JI0A 3O6VA 3N74A 3WB2A 1H4VB 4UC0A 5JCJD 1SXPA 2LKCA 3GHHA 1EE9A 1OBOA 1G21B 1OYOA 1W4AA 2ZJ4A 4GR9A 1P4AA 3OZTA 4OKNA 1TQHA 4P3YA 4PBTA 1YASA 3IEXA 4GLOA 3WGUA 3MCWA 3FSEA 2YR0A 5FPHA 5BYAA 3L4SO 4O4JF 4DKJA 3QENA 3HGTA 3U0VA 2NO1A 3B3GA 4YV2A 1CNFA 1D2MA 1MG5A 4FDLA 2GA9A 3FDZA 3V32A 2F4VB 1RAHA 4QUDA 5KBYA 4HSGA 2IK8A 5J3JA 1RM0A 3BTUA 3R6TA 4GZMA 5AXAA 4YAKA 2WZDA 3V8MA 3WJAA 3LI2A 5I7AA 2WZCA 3H97A 2AFIA 1GZ7A 4JYAB 2GZ1A 1IL0A 3CSUA 1K7FB 1Z4LA 1KVQA 1J70A 1VPTA 3GAMA 2O07A 4HTAA 4AF6A 2OMEA 2G7MC 3HZHA 1UWKA 4DBVO 4ER5A 3PFKA 5CDHA 1VL5A 1ZGZA 2D5LA 2PWZA 1XGKA 3TXAA 4R5MA 1LU9A 1U7OA 4ZANA 2TMDA 2QJWA 4UUBA 1XDZA 5AMXA 4DC0A 4PYRA 5E3HA 1PL6A 1Q12A 1KQ3A 2ZUUA 5FLEX 4PZAA 1PK7A 5FNZA 5F64A 1LA2A 4GZLA 4ZO7A 1NJGA 2WABA 3P26A 3FGPA 3BT7A 2BI8A 3F74A 3CUKA 3VJRA 1E62A 1JR4A 1XZLA 1SBNE 2AOUB 3P9QA 5D2CA 3USCS 1BKDR 3PDCA 3GVHA 2HU5A 3KE9A 5HHTA 3HP1A 4QVGA 5DXAA 4N5MA 3YASA 4KFSA 3B9RA 4YJ3B 3MB8A 3OQOA 2XX3A 4WZBE 1KY4A 4B3MB 1DPFA 2OHVA 4J90A 3ZWCA 1ZH0A 2Y77A 2CCJA 4P4LA 4KO2S 4MIEA 3CPEA 3L7CA 3CEJA 4TZ0A 1Q20A 4YCMA 5JNWA 3MBKA 3ANXA 3WWEA 5M3BA 2NMVA 1YR1A 2XKBA 2Q0SA 4GSYA 3MUFA 2WQ6A 3ZWMA 1KO8A 2J3KA 4IM7A 3ESZA 3RIEA 4JVMA 4CHGA 3W6NA 5LP6A 1H1LA 3SHTA 1GG5A 4JVOA 1TJNA 2YXLA 4PTZA 1IZ7A 2A1TR 1XRJA 3ZLVA 5JAUA 3TMAA 3U9LA 2HPHA 2JIQA 5HP4A 3RVNA 3HCOA 4DIOA 1RI4A 3WQQA 2XIJA 3W78A 4GQIA 1MJFA 2VQ3A 3TFQA 4DV2B 4UHCA 3R9KA 3GEEA 3KTAB 2ZIGA 4J2OA 3RSGA 4HEHA 3D3EA 4PPNA 1XDGA 3AW8A 2EW8A 4LE1A 4OHZA 3JQRA 1QAMA 5CB8A 1KA9H 1ZCFA 2YYYA 1NX6A 1QOPB 2UAGA 1ISHA 1PG2A 2XV1A 2CZGA 3QBVA 3I1YA 1R12A 5DNUA 1YBAA 1S1CA 3U1BA 1FY2A 1OX4A 1FFGA 4PZZA 1OAAA 3IT0A 3K0HA 2YY7A 5A5EA 4IYJA 5DOZA 1U0OC 5FTLA 1JMYA 1HF3A 2C3PA 3DHEA 3IT2A 4NCHA 3WB9A 3ANNA 3KKNA 1QHXA 4I4NA 4DDTA 5K3FB 1TIKA 4MYDA 3T99A 2GHTA 4Y2XA 1XWWA 3ZZUA 4DNQA 5J5CA 3BIWA 4FEAA 4AJOA 2AOUA 1JHVA 4QU8A 4ZQIA 4M1TA 2QWXA 4RTRA 2JBWA 3QVTA 1RJEA 1BCSA 2Y1XA 3LQ1A 1GT91 1PGOA 2LGJA 2X8JA 1VL8A 3WRXC 5DNYB 4OLBA 4MGEA 3KOWA 4NCIA 2I6XA 3WQBA 1S3IA 1T1SA 3EB9A 3O7WA 4KQ1A 4D5GA 4XE5A 2A9QA 4XIYA 1XXHA