2EW8A

Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
247
structure length
229
Chain Sequence
b'QRLKDKLAVITGGANGIGRAIAERFAVEGADIAIADLVPAPEAEAAIRNLGRRVLTVKCDVSQPGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVNMLQAIPRLQVPLDLTGAAAFLASDDASFITGQTLAVDGGMVRH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (S)-1-Phenylethanol dehydrogenase
molecule tags Transferase
source organism Azoarcus sp. ebn1
publication title Crystal Structure and Enzyme kinetics of the (S)-Specific 1-Phenylethanol Dehydrogenase of the denitrifying bacterium Strain EbN1
pubmed doi rcsb
total genus 81
structure length 229
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.311: (S)-1-phenylethanol dehydrogenase.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ew8A00
2I9PA 3RBZA 1DHTA 1ID1A 4BMNA 1K3TA 4PRLA 3MTGA 4K9DA 1DOHA 3GNTA 5DBFA 1L7DA 1X0XA 4CV3A 2D8AA 3RC9A 2PTGA 1Y81A 3RVDA 3MJCA 2P68A 2VZ9A 1IL0A 4NU6A 4R1TA 3GQVA 3H9EO 2FPPA 3SEFA 5FI3A 4FFPA 3DL2A 1P0FA 3Q9NA 4R41A 1F0YA 1KEVA 4RO0A 3MCVA 5A9SB 1A4IA 5DP1A 2BGLA 4GGOA 4MOWA 3AOEA 1UXKA 1VJ1A 2WSBA 2X0NA 1SBYA 5G0WA 4GSKA 3WWYA 3P2OA 1NP3A 1T1SA 3VAZA 3ZWVA 2JHFA 5JSFA 4IDAA 3GRPA 1AN9A 4Y9DA 5EERA 4JX8A 4P4GA 3LC7O 3VZPA 2DT5A 4GLOA 3R3JA 4TSKA 2VWQA 3WR5A 3ZN2A 5A1TA 1O6ZA 2Q2WA 4WLNA 1ZXBA 2JCYA 3TFQA 4GKVA 2J6IA 2X9GA 3ZU4A 1H94A 3VPXA 5KCZA 3Q6IA 3ZWPA 1AUPA 3KB6A 3ROQA 3KLMX 5ENVA 2B37A 1IHYA 1IULA 3MJTA 1O95A 4AJEA 3BMQA 1B26A 3DZJA 5T6BA 1SEVA 4O0LA 1FMCA 4IDGA 5DP2A 4DBVO 3DAFA 2G5CA 3T7CA 3L0DA 1ZK2A 1PL6A 1KOLA 5L45A 3A14A 1YOVA 4J0EA 3DQPA 4OXYA 4WKGA 1FDVA 1V3UA 3GH3A 1M66A 3DBLB 4WLOA 3DZFA 2R6JA 1NVMB 4ZU3A 1E7RA 2DTEA 1D4FA 1BVUA 4J3FA 4BHTA 4TQGA 4XJTA 1ZCJA 4LSWA 1DBVO 1GQQA 4CMCA 1XEAA 4RCVA 2PA3A 1MB4A 3FPCA 3EDMA 2Y68A 2B83A 3VDQA 2B5VA 1CQIA 1XDWA 1ENOA 4URFA 2X6TA 1F14A 4AFNA 1HETA 2WDZA 2X23A 4E30A 3ZH2A 4FOOA 2CF5A 3EAGA 1XIVA 4MVJH 1HE5A 2JFFA 5CPFA 3GDGA 2VT2A 2NLOA 3ZHBA 3F5SA 2BFAA 4BIIA 2FZEA 2EV9A 3INGA 1SAYA 4NU5A 2P4HX 1X13A 3V5NA 4EITA 3L07A 4LRTB 2YJZA 3SXPA 4YJGA 1GADO 4CLDA 1E3SA 2P5UA 3CSDA 1U8XX 4D46A 4ROSA 3GLQA 3AUAA 4LSMA 5K0ZA 2CDAA 3VH4A 1ADGA 3KSUA 4P8RA 1GPJA 1G0NA 3FR7A 4YQYA 8LDHA 5JY1A 3JQ9A 1WMAA 3VPGA 4MPDA 1YL6A 3G79A 3TZ6A 2Q3EA 2ZIZA 3NT4A 4G2NA 2NACA 2CFCA 1UZMA 2EF1A 1Z82A 4IQ0A 5BNFA 4BV8A 4OHUA 4EEZA 4ZICA 1LSOA 4IMPA 4P22A 2POQX 4D43A 1I01A 1PJTA 1IOLA 2J3HA 3STHA 2IZZA 5HRUA 4ND1A 3D4PA 2HRZA 2PD3A 5I7FA 2R00A 2EXXA 3MZ0A 3DXFA 3BTUA 1BDBA 3GG9A 4MP6A 2EP7A 1E77A 3WX0A 2DM6A 2IXAA 3DBLA 5I9MA 1H5QA 3ZCXA 1WP4A 4NR0A 1DRVA 1VKOA 1XSEA 4PLFA 2WD7A 4NZ9A 2B4TO 2HMUA 4Z9XA 1GCOA 2JAHA 2I5PO 3GGGA 1O8CA 2E48A 4M87A 4NI5A 4QFCA 2QRKA 3WMXA 2YQ5A 3WJAA 5H82A 1K5HA 1DPGA 1R4NA 4N54A 2BFPA 3NTQA 3WMWA 3JQEA 2DU8A 3RFXA 4XA8A 1OFGA 3BTSA 1IYZA 1I32A 4PCVA 5JDIC 2JHGA 2EJWA 4JGBA 1R66A 1PU2A 3HQ4O 4WNCA 4RL6A 4IM7A 2RBEA 1DDOA 1Q0HA 1UZNA 1I30A 2OXIA 3UVEA 5U4QA 3G49A 2HMSA 1GV1A 3C1AA 1GUFA 3C8MA 4M49A 3F1KA 4FGWA 4PLYA 2RH8A 1NAHA 4OSPA 3B70A 4DPKA 2DAPA 1GUZA 2P9EA 4DWVA 5L40A 1KERA 2YV3A 1GL3A 1XU7A 4IZHA 4YJGB 4AL4A 2HKIA 1CETA 1E7MA 2FSSA 3DC2A 2OBYA 2VNSA 1NYTA 1GEGA 3DMTA 4RF5A 1ISIA 4L4RA 2V6BA 1RPNA 2JCVA 3JD2A 3W8DA 1ZFNA 3FBGA 1NQAO 3QVOA 4INAA 4YT5A 4YAJA 5GY7A 9LDTA 1NHGA 2IYPA 4YRAA 4DMMA 3TDKA 1U3WA 3BMCB 1LX6A 3GVHA 3I4FA 5G0SA 3OETA 1DIBA 4GX5A 4LGVA 4MIYA 4YYZA 1P0CA 3ZWMA 3V1UA 2CSUA 2AEJA 5IN5A 2HAEA 3RQSA 2OO5A 1V0JA 4Z9FA 3GT0A 1NR1A 1XGKA 2BMAA 4DIBA 2A92A 4F3YA 2O3JA 4YAIA 4YPOA 2GGSA 4WPGA 4NDNE 3NDJA 3ON5A 4FFRA 3SVTA 4JNKA 2PK3A 4ZN6A 1GEEA 1U3UA 2CMDA 2X5JO 4PG6A 4S3MA 3HUDA 2IODA 4PLPA 4QSMA 3RUFA 4L0QA 3WIEA 5ITVA 1HE2A 4Q3CA 4NBTA 3WGZA 1HDOA 3TOXA 1UAYA 1QSGA 1A9ZA 1VLLA 1EVIA 3IUSA 3BMQB 1JWBB 4MO2A 3RUAA 1CF2O 2AEMA 3GVXA 3VZQA 4M8SA 3FTPA 2IYOA 1P3DA 2FPIA 4IJUA 4CLOA 1ORRA 4RDHA 5C7IO 3A9WA 1U8FO 4IJWA 3PZRA 5C5IA 3AY6A 4J1SA 1B15A 5C7OO 2PKQP 4CR8A 4B3JA 3EZLA 1JN0A 3KEQA 1O89A 2ZYDA 3DBHA 4E32A 1ZKMA 3K73O 3KYDB 2IZ0A 4QT0A 2X9NA 1AXEA 1M2WA 1Q2XA 1QG6A 2G17A 3EZYA 2G82A 5LCXA 3WYEA 4YT4A 2EERA 3FBTA 4J9VA 4XGKA 5K6AA 4Z6KA 4WCFB 4BGUA 5L4LA 2VZ0A 4I9UA 5CPBA 3INTA 4D0RA 4F45A 1YOVB 4BMVA 2ZTVA 1VJTA 4IMRA 1YL5A 2AG5A 2RAFA 2PH5A 5ITWA 4R4JA 1PS9A 1E6WA 2X86A 4ZQHA 4PZEA 3BYZA 5F5LA 3ZWOA 5JMPA 5F5NA 1Q0QA 5DCUA 1H2HA 3FD8A 2X58A 2J5QA 4PLHA 3W1VA 3TL3A 1LEHA 2FY8A 3LZ6A 3GZNB 2Q1UA 1TVEA 2QYSA 1BVRA 1QV7A 1A27A 3EYWA 5EIOA 1HDRA 3L4BC 3DO5A 3HN2A 4NHEA 2OL4A 3VTFA 5COAA 1JKIA 3AFMA 5LDGA 4M86A 5L3ZA 3AUSA 4WUVA 3CZRA 3CMMA 3TRIA 1R4MA 4WCDA 4YDRA 4L4XA 2EKPA 3QWBA 4CMGA 1GZ6A 4E31A 3LYLA 5CAEA 1NM5A 1XELA 3DHNA 4ND5A 1EDOA 4RZHA 1H93A 4BUCA 1OC2A 3IOYA 2VTDA 4XIJA 4DRYA 1PIWA 1FDUA 2Q45A 3CIFA 3ASUA 4BKPA 2PGDA 3OA2A 1HDZA 4D7AA 3GMSA 2E82A 1E3JA 3I52A 4MINA 3LF2A 3O9ZA 4EUEA 4FBGA 3G3EA 1E1KA 5JDCA 2WD7B 2P9GA 4R1SA 4YJFA 1R15A 2EWMA 3VDRA 3KUXA 1G1AA 1V8BA 2W8ZA 2HSDA 4IIUA 4OKIA 2RHCA 1MXHA 2XXBA 1GTMA 4DPLA 1P1FA 3RI3A 1PL8A 1JLLA 2AQIA 2AEFA 4CMEA 3KVOA 1C0KA 2X8LA 3FWNA 1ADFA 1TT5A 1IB6A 4WJZA 2AE2A 2C0CA 4UVIA 5AOVA 5F3RA 4LVCA 1UP7A 4CODB 4WLFA 3H6KA 3PFFA 3W6ZA 2YV1A 1W0CA 2VUSA 1N92A 4J2OA 1LDEA 2C82A 2PH3A 5DOVA 4IIVA 4GX0A 3UXYA 3ANMA 2Q49A 2BF7A 4JN6B 2OUIA 3CUKA 2GNAA 3GFBA 1PJ2A 4OL9A 1M67A 3PEFA 4TRNA 1B0AA 2O4UX 2X5KO 1EBFA 1Z73A 2EP5A 3ZWNA 1SB9A 1E1NA 2BFOA 5L9AA 4PG7A 5KIAA 4NJMB 3DOJA 3SLGA 2AXQA 1YE3A 1MC5A 2FMUA 3Q9UA 1I24A 2Q4EA 3JCZA 4FW8A 2P5YA 4CMAA 1SB8A 3PQEA 1EDZA 4CV1A 4L74A 4A10A 3PTZA 5A9TA 4KOAA 4KZPA 4BNJA 5L95A 5AXAA 4YT2A 1KEPA 4GWKA 1YXMA 4IXWA 4C4OA 5BSGA 1P74A 4ALJA 3PZBA 3MWEB 4UVDA 2O2SA 2NVUB 4YRBA 4GVLA 3WS7A 5EESA 4HKTA 3CTMA 3AI2A 3HZZA 1KEUA 2CVOA 4PLGA 1EBUA 4KUGA 1LRJA 4CM9D 4BNUA 2FR0A 4FFOA 3QY9A 1UP4A 3VOSA 1YKFA 1KVQA 4NH4A 4I8XA 2B36A 5C37A 4HFRA 4WASA 1LDNA 3P7MA 4I1IA 3JQ6A 4YCAA 2GDZA 5GMOA 2B35A 1F8GA 2W2KB 1PQPA 1PJCA 3QP9A 4NPCA 4Z0HO 2B0JA 3O8QA 4YJHA 1ZSNA 4R69A 1VL8A 5THQA 2R00C 5TLSA 4B3IA 4P4NA 4IDEA 4OJNA 4KWHA 1YRLA 2GSDA 3X2EA 2VCYA 3W8FA 1X15A 1TLTA 3KXDA 5DZSA 4CM4A 3OFSA 5TIIA 1AHHA 4L9RA 5K9ZA 1GYQA 4R9RA 3UN1A 2IRWA 3JYOA 5G0TA 2C2YA 4ZHSA 3H3JA 2B5WA 3K2BA 4TMFA 2DTDA 1KBZA 1W6UA 4Z3DA 4R68A 3EUWA 3K30A 4YVFA 3ROMA 1LRKA 1YBMA 1E0DA 1PJ4A 2X1HA 1D3AA 4HX5A 3OEYA 2VNAA 4GMFA 2HUNA 3PIIA 3WICA 3GAZA 1SOWA 1U4SA 2FR1A 5A9RA 5TGDA 1CEQA 3Q1LA 4R51A 3JV7A 4IBOA 2VRBA 3WGGA 4BQPA 3WQQA 2CF6A 2BGKA 3EC7A 1T2EA 3M6IA 4LK3A 1WZIA 2DQ4A 2NVUA 3SX2A 4U5QA 3HDHA 4M1QA 3VVCA 2OP1A 5ICSA 3FTNA 1EEHA 3TJRA 3LC2O 3SJUA 3BAZA 4J43A 2ZB7A 4BO3A 5IDXA 1P44A 4W7HA 2GN8A 4BMSA 3QLJA 4O63O 5EL0A 3ZNPA 4TRRA 3S2IA 1LI4A 1LLUA 2BI7A 2UUOA 3ONEA 3VKUA 2X0RA 4DYVA 1C1XB 2VHVA 1X1TA 1LLQA 3G1TA 2DUWA 4P38A 2AQKA 2EEZA 4AJLA 4A26A 3TZHA 2WTBA 1OBFO 3BA1A 3GVIA 2O7SA 3Q2KA 3OM9A 3EW7A 2GLXA 1DFHA 3RBXA 5CEJA 1HE3A 2DBZA 2H5LA 3ZV3A 3NJ4A 4W99A 3CINA 2QZ9A 4YEDA 1YDWA 2ZATA 4AVYA 3KETA 1X7HA 3ITDA 3O26A 3ABIA 1T2DA 1WMBA 4Z9YA 3NTOA 4EUHA 1V35A 3IL2A 4TVOA 4A5OA 4FFLA 4CMBA 4B4OA 2I76A 3QV1A 3NDRA 3TZCA 1ZEJA 3JD4A 4XQEA 1E1MA 2GF2A 4Y98A 3UW3A 3K6JA 4K6FA 4UEOA 2HMWA 4DLLA 3HNPA 1B3BA 3OSUA 4ND3A 5G4KA 1QYCA 1Y9AA 2D5CA 4KMSA 1E5QA 3GHYA 2FPGA 3PDUA 4RLHA 3ROPA 4FDAA 1HKUA 1MG0A 2HO5A 2NADA 5A05A 2VQ3A 1I3MA 4Z0TA 4JP3A 1UP6A 4BGEA 3QHAA 4YRDA 1GR0A 4R5MA 2DFVA 4XDYA 3T7EA 1WDMA 2NQ8A 4D0SA 3S2GA 1UXIA 3QA9A 5EQDA 1FDTA 3LDHA 3KRTA 3GN1A 4OAQA 4XRRA 1U28A 1A9YA 2VUTA 3DBRB 3WSWA 1P1HA 3DEYX 4BNWA 2JFHA 4E13A 3AU9A 4AJIA 3Q2IA 5TNXA 2NU6A 2D0IA 1OOEA 5JCJA 4HNHA 2C54A 4LISA 1L7EA 1C1XA 3GFGA 3E48A 4M54A 4A73A 3OQBA 3DFUA 4DIFA 1MLDA 2NWQA 3VPFA 3E18A 5AYVA 1JKFA 3JD0A 4QX6A 4AG3A 3PYXA 2HDHA 3OJ0A 3A06A 4XEHA 3PXXA 1C3VA 1NHWA 2VHWA 1PS8A 3R1IA 4YQZA 3NGXA 4FN4A 3DOOA 2EJVA 3DZKA 5CDSA 4OOFA 3M2TA 2IZ1A 4W9NC 1YJQA 2ZB8A 1AGNA 1N8KA 1ZJYA 3E9QA 4BQRA 5C3MA 2FN7A 4TKLA 2YDXA 4W6ZA 1GZ3A 3JQAA 2NQTA 3EVTA 1MUUA 4BL5A 2O2YA 3DHYA 3NDIA 4WCFA 1QP8A 4RLSA 5T8KA 3OIGA 1KETA 4XDZA 4IZIA 2IEBA 3RAJA 2QIOA 4KUHA 2B69A 3V1TC 1TEHA 3ANLA 3MEQA 3ROKA 1A7KA 4JQCA 3VH3A 3DAPA 2FHSA 4YACA 1KC1A 3UUWA 3GN2A 4FSHA 2PGLA 1VRWA 1NQTA 3NT5A 1JA9A 3PLRA 1UDAA 4MKRA 3ENNA 5ER9A 3H5AA 1HRDA 3PJEA 2A4KA 4IGEA 1I10A 4XB1A 1I2CA 3DBVO 2O7QA 4XZ3A 5JDCC 3RC2A 2O3UA 2Y1CA 3JQAB 3TQHA 1G0OA 1Z6ZA 4RF2A 4DQVA 1WDLA 4DXHA 2AG8A 4HP8A 4RVFA 2W2LD 4XYLA 1RYDA 5ER6A 2BLLA 1PGQA 3KTDA 1UUFA 1QXSA 1LXCA 2PNFA 1PSDA 1WVGA 1WZEA 2GASA 1PQUA 3L4SO 1HEUA 3EGOA 1U5AA 2PFGA 4KUEA 5J23A 1A72A 4HXYA 3SC4A 4BKQA 3K9QO 4B4VA 3DMYA 4U0JA 4OM8A 5A4DA 3GC6A 3LLSA 3SJ7A 4TZKA 4FJ1A 5EJ2A 2C5AA 1HT0A 4CQMA 3ZWCA 4YAKA 2BI8A 5TT0A 1R4MB 5MGBA 2IDZA 3QVTA 5F1KA 5IDWA 5G0UA 2YDYA 1DLIA 1G6KA 1EQ2A 5CDTA 1DRUA 3JQGB 3TZKA 2OORA 4AJNA 4MKXA 4UUPA 4XX0A 3ZI0A 5DN9A 1NXQA 4NBUA 1YBVA 3QVWA 4LMPA 5JCXA 1KVUA 3IKVA 3NRCA 1UXHA 4CUJA 1YB1A 2NTJA 3JD1A 4XGIA 4BO5A 4BNIA 4A27A 3WGTA 2ZYAA 4JJFA 2NNLD 4J9UE 2VHZA 1JU9A 2NUAA 4G65A 4PLWA 3ZNQA 5K6AC 3PHLA 1U3VA 2AA3A 5IG2A 5BSHA 1ENYA 3WQSB 3MWDB 3WJ7A 3SBOA 4Q3EA 4UVEA 2ZK7A 1XYGA 3R3SA 4IDCA 4D44A 1PGOA 1YQGA 4QUKA 1E92A 2ZYGA 3WB9A 1RM4A 5KJCA 2V6FA 5TRTA 3D4NA 1HL3A 2NV6A 3Q3CA 2VOJA 5A06A 1C14A 1T26A 3RUDA 4J6FA 1HZJA 3OECA 3EHEA 4CM7A 3U9LA 1H6AA 4JCOA 1NFQA 4GKBA 3KYBA 5JC1A 2WYUA 3L9XA 4GMGA 2X5OA 1IZ9A 2Y1DA 4YBZA 4TZTA 5HS6A 1HDYA 1AXGA 2HJRA 5AQ1A 1Q7CA 2V6GA 3LC1O 4W9NA 4B7UA 1LBEA 1ENPA 4XYBA 4YJDA 4L73A 2Y66A 3A4VA 4ONEA 2ZB3A 3JQ7A 4OGWA 1NVTA 5T8KC 1WW8A 1MXFA 5CDUA 3O4RA 1E3EA 3S2EA 3NKLA 2QG4A 4J7XA 2AHRA 1E5LA 5A02A 1VPDA 1QV6A 5B12A 2VRCA 2GRAA 3AY7A 1EK6A 4AJHA 1DRWA 4R1UA 3HJAA 2JL1A 3W4JA 3GEGA 3ZV6A 3KSDO 1XWFA 3LQFA 3GGOA 4NK5A 2UYYA 4OYRA 4AJPA 4GSLA 4D3DA 4E5KA 4CM5A 5AXDA 3RJ9A 3ZWBA 1QR6A 1BXZA 3AUUA 2NVBA 4AICA 3LK7A 3KSZO 2CD9A 1XLTA 4NG5A 5DNAA 4HFJA 5JAIA 5CHEA 1EMDA 4I5FA 1LLCA 2YQ4A 3VH2A 5TQVA 4CLRB 5ILOA 1RYEA 4EI2A 3H2SA 1LNQA 3PGXA 2DPHA 3EY4A 7ADHA 4RPJA 4RJTA 1A4UA 1HYHA 1M75A 2VHYA 1DXYA 4C7JA 2HK8A 2CDBA 4MJLA 3WTBA 1PWZA 4FPXA 4RVGA 5I9NA 1PJLA 3L6DA 5U9CA 3I6QA 1GQYA 1LQTA 1M76A 3BZUA 4FJ0A 4HY3A 2E6UX 3JQBC 2VT3A 1F06A 3GZNA 1XKQA 3F1LA 3FCOA 2HMTA 1LTHR 2BFMA 3PYLA 4JBHA 5I7EA 3RC1A 5JC8A 5I8ZA 2PLAA 3WG9A 2BKAA 4O5OA 3HWRA 5DF1A 3BMCA 3WBBA 3OA0A 2SCUA 1O0SA 3D7LA 3OJOA 2O4CA 2WJPA 1F12A 2RIRA 4IS3A 1LU9A 3C1TA 5CDGA 1OC4A 2ZTMA 4FS3A 2Q1SA 2VRCD 1MX3A 3E9MA 2AE1A 3CE6A 3MOIA 2UVDA 5G4LA 2DBQA 4E3ZA 2A9FA 3DTTA 1XQ6A 5EQFA 4R1NA 1ZK0A 2YFQA 3IQDB 1GV0A 3EK2A 1T2CA 3GUYA 1PZHA 4O1MA 4J7UA 4HUJA 3DR3A 2RCYA 4YJFB 4AJ2A 3TSCA 2I99A 1M6HA 3U49A 4ZA2A 4UUMA 2WWRA 3JQ8A 2D4AA 2WYVA 3V2UA 3AUTA 4XKJA 3JYLA 1KY5A 5KVQA 4E2XA 2ZCVA 2H6EA 2Q2VA 4K6CA 2PR2A 2H9IA 4PG5A 2VUUA 4A0SA 5JYEA 1R6DA 1MA0A 2DBVO 4CLOB 2GN6A 3KHUA 2NU9A 1E7QA 1SNYA 1E7YA 4BO7A 2JAPA 2G76A 1B16A 3UAGA 3L77A 4E5YA 3L6EA 1IUKA 2EW2A 4FGSA 1PGNA 4J1QA 1UR5A 1XU9A 4MVJD 3U4CA 3U3XA 1JAXA 2Z5LA 5IAAA 3FHLA 4QQRA 2HU2A 1LDMA 1QRRA 3NYWA 4M89A 1MFZA 1YH3A 4ALMA 3WYCA 1NX6A 2WYWA 3UICA 1Y8RB 1K6JA 3TWOA 4ESOA 4RORA 5TT1A 3W6UA 2J3KA 2I3AA 4WOJA 4LW8A 5TC4A 5COBA 4B4WA 4P4LA 3E8XA 2HJSA 1UXGA 3GNQA 2BHLA 1VC2A 4GBJA 4MP3A 4YJHB 4BGVA 4PZCA 4XQGA 3PI7A 1B8UA 1GYPA 5U1PA 1ZZEA 3GGPA 1DC4A 4Q3BA 5DBGA 3ENKA 3UF0A 4C7KA 2ZB4A 1H9BA 2WE7A 4KWIA 1C1DB 4DIOA 4IXTA 5EINA 3GAFA 5JCJD 1GCUA 1AE1A 3O03A 1LJ8A 3PDJA 4Z0PA 1P45A 4ALIA 1YL7A 4CQLB 3BTVA 3VZRA 1I3LA 3WBFA 5EMHA 4BNXA 5KKCA 3M1LA 4ZRMA 1DSSG 1DO8A 4UVGA 1DEHA 4IY1A 3PVZA 3QJ5A 6ADHA 1GYRA 4L76A 2YYYA 3OIFA 4ZD6A 2I6TA 3IKTA 4WK6A 4BGIA 3K8ZA 4OMUA 2VYVD 4B7XA 1U7TA 1W8DA 5DCYA 1Q7GA 1I2BA 2NM0A 2Q50A 3WLEA 1U2DA 5BNIA 5THKA 3MJ4A 3ZZNA 1BWSA 4BKRA 2R2GA 4BNFA 3AOGA 2EW8A 3NV9A 4IINA 4FC7A 3HB4X 4KP7A 1T4DA 5B1YA 3CZMA 3QVXA 2PZKA 5T67A 4XB2A 4RPHA 1E1LA 1NVGA 2PZJA 1LSSA 1LDGA 3IAHA 3CH6A 1HDCA 3E9NA 2BD0A 1JKJA 1HSOA 3H4VA 3AJRA 1KY4A 2NTNA 3PYMA 5KJ6A 1Y7TA 5CG2A 3VKVA 3GDFA 1QLJA 1YS4A 4DUPA 4EGFA 1U1IA 2AQ8A 4TVBA 4W7IA 3OICA 5IFLA 3KYCA 1ADCA 2Q99A 1ULUA 2VHXA 4DC1A 1PS0A 3WGQA 1RM3A 4IS2A 4RPLA 2YZ7A 2O50A 1BHSA 2GUGA 4ID9A 4DA9A 4DQUA 2FOIA 3VH1A 2O3TA 1JVSA 4RPKA 4WEQA 3R6DA 5IZCA 2Y05A 2GCGA 3AOEC 4JJGA 2PZMA 1IZ0A 1ZJZA 1N9GA 3LT2A 3ETGA 4GPD1 1ONOA 3AM5A 1NR7A 3HFSA 1B8PA 1GU7A 1YDEA 2F1KA 4ZQBA 2BGMA 2Q4BA 2Y67A 3JYQA 3PQDA 4BNLA 3H9QA 4CR7A 4J1TA 1BXGA 1HLDA 3WNVA 1HDXA 3PFWO 4Q3AA 1WPQA 5KKAA 5KVCA 5JAMA 4UREA 3VVBA 3F4LA 1PTJA 4BO9A 4CLHA 2P91A 1XCBA 1YB4A 4DQXA 3HE3A 5GZ6A 3FF4A 3IS3A 3PWZA 5ILGA 1GDHA 4CMEC 1I33A 2VTEA 3NAQA 3BHJA 1K89A 2CZCA 4PLZA 1U3TA 3KV3O 4DGSA 5DBIA 2V65A 3B1KA 1XR3A 4PFJA 3AM4A 3HB5X 1D1TA 4U6QA 3ZGYA 4JROA 4ZJUA 4BNMA 3LF1A 4L75A 4A2CA 5A03A 3LLVA 3TZQA 1K0UA 3KEOA 4EJMA 1PGJA 2W2KA 4RVUA 1BTOA 1FF9A 3IP1A 4CL3A 2VYND 2CNBA 3ZV4A 4IQ8A 1E7WA 2V6MA 2BRUA 3RKUA 1ZH8A 2QZZA 4I9NA 2C2XA 3K5PA 3AM3A 1ZBQA 3DAGA 4CV2A 3NUGA 2ET6A 3BMNA 4Q39A 1DFGA 3H7AA 1WWKA 1LC0A 4CMIA 5C7LO 4XR9A 1SCUA 5HM8A 1HLPA 1T4BA 3H5RA 5FYDA 3VPHA 1E3LA 3RUCA 2Q2QA 1GAEO 1I2ZA 1DC3A 3FSRA 1DLJA 4Y8VA 1U5CA 3I4CA 1J6UA 3HDYA 4GAEA 3QE3A 4CUZA 1EQUA 2Y0DA 4OSOA 2FWMX 1RM5A 1H2BA 4HADA 4E4YA 1T2AA 2WMDA 3K96A 4I9HA 3GA0A 1YGYA 4B8WA 3ZWAA 3MJVA 1HZZA 2O23A 3ZU3A 3GDOA 3KOUA 1HE4A 1BMDA 1PGPA 2PV7A 1X0VA 4J4TA 1U7HA 4HV4A 4XIYA 3ZV5A 5IN4A 3GNSA 3GEMA 3I83A 3FR8A 3WYBA 3QWFA 3F3SA 1Z74A 4MVJA 2CY0A 2VOEA 2UUPA 3DOCA 3IDSA 4PG8A 3OHSX 3PQFA 4CMIB 3GY0A 4NBWA 4U8GA 1T24A 3JQ7B 3AY3A 3I5MA 4OQYA 4F46A 1ZK1A 2YW9A 4F6CA 2DPGA 4EYEA 4IUYA 3RIHA 1X1EA 1Y9EA 1YO6A 2ZQYA 4BNZA 4UUNA 1J49A 1XHLA 3IJRA 1SZJG 4FJ2A 5GZ3A 3U4IA 3RUEA 1IPFA 2YHIA 2Y93A 3BTOA 1HYGA 2VYNA 1SO8A 4CL8A 2J3JA 4WCFC 3EMKA 4LMRA 4U0KA 3ONDA 3ETDA 2OOSA 2Z95A 4G81A 4LVUA 3E82A 4QXMA 1ZSYA 3ICCA 3MJSA 1P77A 3GVCA 1PJQA 4RQUA 1GZ4A 2W90A 5I7VA 1WLYA 5CEEA 2VWPA 2X7HA 3TPCA 3KLPX 1LA2A 4BO1A 4DYDA 1RJWA 1MP0A 3CMCO 1C0PA 4XJSA 5BQFA 1EVZA 1O9BA 3GZ4A 3VHRA 4NFYA 5ES3A 2ZJ1A 4XD2A 3WFJA 3RSHA 3JQGA 1KC3A 4YT8A 1LDYA 4FC6A 1YBAA 3E6AA 3EVNA 3OIDA 3Q0EA 4BKUA 4DVJA 4YXFA 4ZGWA 3D4OA 1P1JA 4CM9A 1V3TA 5KVSA 4KTTE 4CM6A 2CUKA 1E3IA 3OJEA 1D8AA 3GR6A 1PJ3A 2DLDA 1R0SA 4N5NA 3CPSA 1C0LA 1B3RA 1PX0A 2I65A 1SOVA 2D5AA 4H3VA 4E2ZA 3ZHXA 4FOSA 4QECA 4Z3KA 1ISJA 1GQ2A 3O38A 2VWHA 2FZWA 4N5MA 1YB5A 3WTCA 1GD1O 2PY6A 5TX7A 4XWYA 3FWZA 3I9KA 1WDKA 4CM8A 2QX7A 4BO0A 4IGFA 3AWDA 3RJ5A 5JFOA 2EGGA 5G4KB 3V2GA 1N7HA 4L8VA 1QYXA 2FR8A 1Y5MA 4BO2A 1VM6A 1IE3A 3P2YA 4R01A 3I9LA 1CERA 5LDHA 3S2FA 1K6IA 3RD5A 1O5IA 1UH5A 1RM0A 2I3GA 3N74A 3ULKA 3I9JA 5JAQA 4GH5A 4QTZA 1P31A 1Y8QA 3JYPA 7MDHA 1I3NA 2GYYA 3DDNA 4GVXA 2Z1MA 3GHHA 4OO3A 1DC5A 4IQGA 3GPIA 4WGGA 1EUCA 4OH1A 1ISGA 3QWHA 4N7RA 1YJ8A 4B79A 1IHXA 4D79A 1EUZA 5BR7A 3JYNA 3FNHA 3ZDFA 1NFRA 4BB6A 2Q46A 1UZLA 1LSJA 1RWBA 3FPLA 4FFMA 4GGPA 1MC4A 4QEDA 4WLVA 3PJDA 2BELA 2VN8A 1AHIA 3KZVA 1EFKA 1CIVA 3ST7A 2CVQA 1Y6JA 4BKOA 4MVJI 3ZWWA 4DLAA 4AJOA 4NFHA 4NMHA 4TKMA 3GG2A 1QLHA 2JFGA 1KEWA 1RKXA 2E4AA 4R16A 3BHMA 3BMOA 3ETEA 3F46A 3JQFC 4YA6A 3ZNOA 1H6DA 1T1RA 2WD8A 1NWHA 4IDFA 5TJHA 2C59A 3M2PA 1GY8A 1NASA 1DIHA 1Y8QB 5MDHA 2E49A 2NVWA 4ILKA 1WXDA 3H8VA 4NQZA 1BW9A 4K26A 4BOYA 4IJVA 1E6EA 2J3IA 4EBFA 3WDSA 2ZKLA 3UGKA 4BO6A 1BSVA 3RUHA 4TROA 3IIEA 1H9AA 4FCCA 2D3TA 3DFZA 4YWJA 4D3FA 2D1YA 2JD0A 4BNVA 1LSUA 4CQMB 5B4VA 1ISFA 5IZCC 3UHAA 1F17A 3OQ6A 3U62A 4PG4A 4OXKA 3UKOA 3DMTC 4CV0A 4GWGA 2GN9A 2GERA 1M6WA 4XYEA 1ENZA 1NFFA 2UAGA 4HBGA 1C1DA 3PHHA 5L7TA 2AMFA 2P2SA 2HRBA 1H6CA 5HWSA 5A3JA 3RKRA 1NPTO 2B4RO 3D3WA 2G1UA 2PWZA 3V1YA 2YV2A 3E03A 3KYDA 5F1PA 3ZU5A 4B8ZA 2B4QA 3H9JA 4X54A 4B4UA 5I8WA 1I8TA 3LVFO 3W4IA 1Z75A 5JYDA 3H5NA 1DIRA 4OQZA 3VC7A 5IDYA 1ZMTA 3HDJA 4LN1A 2TMGA 3DWFA 1LDBA 1MG5A 1F8FA 5JDIA 4AJ4A 4ALKA 1E7SA 1QYDA 2OZPA 4PIVA 4DLBA 5BNTA 2IEDA 4CMJA 2XXJA 1DB3A 3JTMA 1GUYA 4PN3A 4UUOA 4AJJA 1QYVA 4I08A 1BDMA 4FR5A 3U09A 1BXKA 5AVOA 1SEPA 1OZAA 4J2HA 5B37A 3IP3A 4PGFA 1TI7A 1CJCA 3K2EA 5L7WA 1Z7EA 2W98A 1ZK3A 3NTRA 1VE9A 1FXSA 3E1KA 1P33A 3GK3A 3ZHYA 3H65A 1NPYA 1DJQA 1QKIA 3TN7A 5FEUA 3VTZA 4GX2A 1TA4A 2FSVA 5IZ4A 1UDCA 4FD3A 4I5GA 4BNGA 3KO8A 4JBIA 4BO8A 2OBNA 2UV8A 1FDWA 4ND2A 4Y6PA 1HWYA 3D5QA 3TOZA 1CWUA 2IE0A 4DBZA 5CFZA 1KS9A 5JS6A 2C7VA 2PKQO 5HBRA 4Q3NA 1WNTA 5BSEA 4QFDA 3UCFA 3I1JA 1YWGO 3QWIA 3S8MA 4NK4A 1LUAA 3G0OA 3UFXA 3WNQA 5A5EA 2PD4A 2PGJA 1D1SA 3D3WB 2X0JA 1R0KA 5CP8A 5JXWA 1N9GB 3QVSA 1W73A 3RFVA 2IXBA 3C7DB 1SC6A 3JQAD 4A7PA 3UOGA 1EUDA 1LRLA 2DBRA 2XOXA 5KJFA 3Q11A 4WLUA 5JLAA 3INRA 4J91A 4MIOA 1ONPA 2JKVA 5FI5A 3U0BA 5KWEA 2PKRA 4I5EA 4EUFA 4EW6A 3C7AA 5KJEA 4J7CA 1I0ZA 2GZ1A 4EDFA 4NIMA 4CLXA 5I9LA 1YVEI 4NBRA 2HLPA 5FF9A 1QYWA 1OMOA 1K6XA 4CMKA 2H1SA 4RVDA 1PZGA 5L53A 2EGHA 3ZW8A 5H83A 3F9IA 3BMNB 5JMWA 4LCEA 3PHIA 4II2A 1YQXA 4J49A 4TRMA 4GX1A 3K31A 4NBVA 1V6AA 1KIFA 5T5QA 3QRWA 2ZJ0A 3ICPA 2XF8A 3HHPA 3C24A 1JTVA 3PGJA 3L4BA 4MVJM 4D3SA 1ISMA 1ZMOA 5BSFA 3HSKA 5F21A 5JO9A 2GR9A 4YAGA 2QRJA 4JBGA 4FIZA 1ZUD1 1H6BA 4OOEA 1ISHA 4Y6SA 1GFSA 2CDCA 5TF4A 4KTVE 1ZEMA 2O3SA 3T4EA 5DCWA 3LSYA 1TT7A 5JPIA 2EKQA 1EK5A 1KVSA 4DC0A 2DVMA 2DUUA 3DTYA 3ANNA 2ZCUA 4HFNA 1OAAA 3HN7A 3UCEA 4WOKA 4I5DA 3H9GA 3B1JA 1Q1NA 1CQJA 1LLDA 5H81A 3ITKA 1KYQA 4M55A 1ZO8A 3GMDA 2D59A 4J90A 3ORFA 3RU7A 1D7OA 3QW2A 1P1IA 5ICMA 3ZWYA 3BHIA 2GD1O 1ZK4A 1UXJA 4UEKA 5HS4A 1P1KA 5TSDA 1DAOA 3OMLA 5IF3A 1Y5RA 2YHUA 4ZVVA 1A5ZA 3H3FA 3NT2A 1EE2A 4O6VA 1YQDA 2VYVA 3BIOA 4CM3A 4E5MA 1ULSA 1S6YA 3I9MA 4ALNA 4AJKA 5A04A 2YUTA 1HXHA 1XQ1A 4J0FA 3WSVA 5JBIA 2YY7A 1VKNA 4GI2A 4DPMA 2C29D 5KJ1A 5KVVA 2ZTLA 1MFPA 2JD2A 4BNYA 3M1AA 4YAEA 1HF3A 1U4OA 1U9JA 4E6PA 3ASVA 3PP8A 4CUKA 3DBHB 3JQBA 3WXBA 1DJNA 4PLVA 1DHRA 4ZQEA 3OJLA 4AJ1A 3U4DA 1CYDA 4FB5A 3DBRA 4KDFA 3CKYA 5F1OA 1B7GO 4EJ0A 5I7SA 5JY6A 3DB2A 1EFLA 2I67A 4YTEA 5FWNA 2Q1WA 1VL0A 4NNJA 4BS9A 5HTOA 1TXGA 3ZU2A 3OJFA 3FNFA 1Y8RA 3ZNNA 3WGHA 4E0BA 2NSDA 5A9SA 1E3WA 4IJKA 3C85A 4E5NA 3F47A 3MJEA 5LC1A 3WOHA 1Y1PA 3HDQA 1P9LA 4PVDA 1EVYA 4ALLA 1VL6A 3RFTA 4BB5A 3OP4A 2OGUA 3WLFA 2HK7A 3PHGA 1IPEA 4CLEA 3B6ZA 3NEPX 4FFNA 2AQHA 3C1OA 4XQ9A 4ND4A 3LT1A 4A03A 4E21A 3GEDA 1JWAB 2Y1GA 1NWCA 1QORA 3HFGA 4RVHA 5JW6A 3HADA 1NQOA 4GLLA 1BGVA 4RDIA 4HFMA 3IJPA 3U5TA 4IDDA 2V7PA 2YFHA 3DHEA 3GF4A 3BXXA 1N7GA 2VZ8A 4EJ6A 5A5FA 2JJYA 2Q1TA 4R9SA 2QYTA 1N2SA 3W4KA 1J4AA 4D41A 6LDHA 5BT9A 4RZIA 1C0IA 1QMGA 3ONFA 2Y99A 4RGBA 1Q0LA 3AK4A 2Y0CA 3QIVA 4ZRNA 3F6YA 3DZHA 1CRWG 1HYEA 1N5DA 2HK9A 2OHXA 4DL9A 3JQDA 2O3QA 5CG1A 3IC5A 4BNHA 3JQFA 3WIDA 3TF5A 4QO8A 1HSZA 3JD3A 1EE9A 2Y0EA 4CR6A 2ZQZA 1HTBA 4E12A 5KTKA 1R0LA 3AFNA 4WECA 1PJSA 2QHXA 4ZQGA 1V3VA 3F4BA 4H15A 1I3KA 3WQRA 2C07A 2OFPA 4CQMD 1BRMA 3WGIA 2PD6A 1DIGA 1Q7BA 2EG9A 3H2ZA 4II3A 5JO0A 5L4NA 1ONNA 1FDSA 2X4GA 4XCVA 2F00A 4PVCA 4TRJA 4DREA 4CLRA 4XYGA 4PZDA 4UULA 4BNTA 4R54A 1DC6A 3A1NA 4W82A 1ADBA 3AI3A 4G5HA 2AW5A 4Y6RA 1IY8A 4B3HA 4R3WA 1V9LA 4MKZA 1ZSVA 1R12A 3CXRA 3FNGA 3NX4A 3AI1A 3L6OO 1PR9A 3A28A 3V2HA 1R37A 3FI9A 5IXSA 2JCXA 3MTJA 4XRGA 2W2LA 3OBBA 1WAMA 3DZGA 3HG7A 2P9CA 1J5PA 3IUPA 1DIAA 2Y1OA 4MDHA 2UDPA 2VWGA 4K1LA 4WLEA 5IXYA 4B7CA 1E3WB 4BVAA 2X9VA 4JLWA 3I3OA 3I9NA 5DULA 4N18A 3RASA 3ADOA 1PL7A 2G0TA 3PWKA 1YONA 2J8ZA 4XYMA 3WGOA 1NQ5A 4PRKA 5JAZA 1N1EA 1U2GA 3ZW9A 3JSAA 2FRDA 1XA0A 4RV9A 3I23A 3O8QB 4KDEA 1O94A 3ZWXA 4CM1A 4QO7A 5L4SA 3LT0A 2O48X 3OQ1A 3QQPA 1LC3A 3S55A 2X22A 1UDBA 1A71A 2DTXA 3E5RA 1K2WA 4L4SA 4K28A 5EN4A 1OI7A 3SLKA 1B8VA 1MV8A 1JW9B 4TWRA 1GPDG 3WWZA 2JD1A 4MVJE 1NAIA 2PZLA 3PLNA 3D0OA 4JP2A 3RUIA 3UH1A 4E33A 1NNUA 2GN4A 1JAYA 3GRKA 2C20A 2DC1A 2EHDA 3JQCA 2W4QA 4PLTA 3I6IA 1T25A 4UVHA 3VPSA 2HQ1A 4MVJP 3C7CB 3GPDG 4D42A 4JXKA 3RU9A 5COQA 1KVTA 3X2FA 2ZTUA 3GOHA 1BXGB 2C5EA 4UAGA 2YHIB 4HWKA 5DT9A 4ITUA 1JQBA 3KYCB 1UAGA 3AW9A 4JJIA 3WGYA 1ARZA 2H63A 5DOZA 1FK8A 4CM4B 1ZVMA 5EPOA 3PHJA 3RCBA 4U6SA 2QW8A 5KNLA 2QQ5A 9LDBA 2I66A 4XR4A 3B1FA 4O59O 4RF4A 2J5KA 3IMFA 3KM0A 3C3XA 5L51A 1PJBA 3N58A 1ZNQO 5JE8A 2DFDA 2WEKA 4J16A 3GVPA 5ENDA 1S7CA 5DDIP 3S1LA 4XGNA 1Z7BA 2E37A 2RHRA 4EZBA 3E5MA 4UEJA 3G17A 2OP0A 3OF2A 3VZSA 1ZW1A 4JK3A 4BV9A 5IDQA 2O3RA 3PJGA 4JIGA 1X7GA 5G2OA 2GPTA 2A94A 4KQWA 4E2YA 3NJ8A 1P1RA 1NPDA 1XG5A 2RH4A 5AXCA 3TFOA 3RWBA 3I9OA 4XQCA 5T57A 5IJZA 1R16A 1X14A 4NJMA 2GZ3A 2LDXA 3CEAA 1BG6A 1B14A 2OMEA 4MP8A 4YR9A 3OH8A 1W4ZA 1TT5B 4EEXA 4RVSA 5HA5A 4F6LA 3DONA 3B20A 4U7WA 3LU1A 5L7YA 1ZIDA 4H7PA 1DAPA 3UCXA 2QRLA 4GL4A 4MVJG 4BNKA 1ZXLA 2WM3A 4NFSA 1PZFA 1JVBA 3D64A 5CEFA 1LQUA 1VI2A 2Z1NA 4RQTA 3P5SA 1SPXA 4LRSB 5G0VA 1SMKA 3DZIA 3PPIA 3FN4A 4D45A 2D2IA 4CQLA 4Q3DA 3PIDA 5JNLA 5T64A 4FQ8A 2LDBA 3TL2A 4R3NA 2NU8A 3PK0A 1PZEA 2ILTA 2NU7A 1J0XO 4Y67A 3RBVA 3U4HA 5B4TA 4HNGA 3KBOA 3MOGA 2A35A 2GO1A 4R5HA 4MVJF 1ML3A 5GZ1A 1TB4A 3P19A 1L1FA 3QWAA 4J4BA 4H16A 4WE3A 3D5TA 4IPTA 5B4UA 5A3VA 3R0IA 5ADHA 3DZBA 3ZHZA 1CDOA 1VSVA 1A7AA 4J1NA 4GQAA 4OXNA 3D1LA 3SC6A 3GUCA 4CPDA 4OKNA 1EVJA 2XPCA 1BW9B 3F5QA 2J5RA 3PWSA 4J4HA 4N5LA 4BO4A 5KOIA 1PEDA 4LCJA 1UJMA 3ADPA 3N7UA 1DFIA 2WE8A 1MGOA 2HCTA 3WFIA 3QSGA 4PLCA 1R4NB 3OEWA 4NJOA 4DTIA 4WEOA 1FJHA 2Y1EA 2TMDA 2EKLA 8ADHA 3NGLA 3TNLA 4Q9NA 1E6UA 2FP4A 1HDGO 2HMVA 1N1GA 3BMOB 3LT4A 4W4TA 5FFFA 1T2FA 3RROA 3L9WA 5AXBA 4IDBA 3PJFA 4E5PA 1B2LA 2C7GA 1H0KA 3FNEA 2P4QA 4YB8A 1JDJA 2X0IA 4OIMA 4RPGA 2NTVA 3K92A 3T4XA 2Y1FA 2GZ2A 1PWXA 4BNNA 3V8BA 4MIEA 1PQWA 2DKNA 1I5RA 2BH9A 4CMHA 4E2WA 1PR3A 5TJ9A 1EZ4A 2EIHA 1NTOA 3JQ8B 5TS3A 2CVZA 3W8EA 3D3EA 3RC7A 4DMLA 4RF3A 4KQXA 4CJXA 1VSUA 3G1UA 5CDYA 1I36A 1NBOA 1Z45A 3FRJA 4CM8B 3H9UA 3JQ9C 3AU8A 1KVRA 3COSA 4ZQFA 3PRJA 4WNIA 1X7DA 4S1VA 1VJ0A 2XAAA
chains in the Genus database with same CATH superfamily
4MKFA 3AFIA 1YQWA 1ID1A 2WHYA 2QGNA 1M0SA 2V3VA 1TD1A 3QBVA 4LE2A 4LRYA 3KJEA 3TQCA 2QXUA 3AL3A 3LA6A 5JSQA 2PZEA 1Z5GA 3G2LA 4MS4B 1MT0A 1X0XA 3GB9A 4W1PA 2NPOA 3FJYA 3I2YX 3RC9A 3TXAA 2PTGA 1Y81A 1EXNA 1XVVA 2QUZA 2QUBA 4JHLA 3O7MA 4Y2TA 3MERA 5FO0A 5JWOA 2BSQA 2XB2A 5E9WA 3SSNA 3L6UA 1CUHA 4G1FA 3NIBA 1YULA 3GQVA 2Z6VA 3H9EO 4INJA 4L15A 4FFPA 3DL2A 4E2YA 4RSMA 4URYR 1KDZA 1EFPA 3DA8A 4M38A 2BZSA 4UARA 3L0YA 1CS0A 3ZQ6A 1CR1A 1XCLA 4RO0A 1CY4A 3QEMB 5A9SB 1E3MA 5DP1A 2BGLA 5K0LA 1TVKA 4JLPA 4CDNA 1UXKA 2H06A 2FPXA 1E62A 1VJ1A 1QH1B 3LPNA 4K9RA 5FCDA 4BPRA 5G40A 1LK0A 1OU0A 1UOQA 1R0BA 2IYTA 3QEKA 4RA9B 5CM8B 1L5NA 2JHFA 3AR3A 2VAPA 2FPGB 4IDAA 3SE7A 3GRPA 5F4BA 1JSZA 4KCGA 2ZS8A 2XHZA 4HWPA 2NIPA 3U7GA 4QOHA 1QAOA 2VWQA 5A1TA 4LY3A 2GXSA 4PXAA 5FBHA 2NO7A 4WLNA 3GDHA 1ZXBA 5BXQC 3GD7A 4GKVA 3HH8A 1H94A 3Q6IA 3GRUA 3ZWPA 1E2GA 3KB6A 3ROQA 5ABPA 5BOVA 1P2TA 3PCXA 3W0LB 1IHYA 1YS7A 1XQXA 2XTNA 2BONA 2PZ8A 2V4MA 4CFSA 4CDRA 3BMQA 5EIXA 1IZYA 2XYHA 1V43A 3G89A 4FB4A 4IFIA 3BJZA 1N7JA 1XLWA 3WLAA 5M2QA 1N3LA 1OLOA 3L43A 3ROXA 2Q6TA 4LNUA 2FE1A 2G5CA 3SR3A 2JGIA 3EGDA 3UWDA 1KEEA 1YOVA 4FK8A 5HKKD 1KMMA 4J0EA 4OGFA 3OQPA 5CB4F 2DSNA 3GH3A 2EGUA 2Q5LA 3IEKA 3OM1A 3EGIA 1NVMB 1ZYUA 4FFSA 2DTEA 3TQTA 3MBOA 4EFKA 1OWPA 3KT6A 2XWQA 1DKOA 3GLRA 3ICOA 4J3FA 5J5AA 2PVPA 3LJKA 2ZI6A 4NCJA 2M98A 5DYGA 4BWFB 4FEGA 5JJLA 4F8EA 5LQAA 2P11A 1QZZA 1DBVO 1OREA 1G5HA 2FUEA 1ZHFA 2ZRLA 3E1GA 2XZTA 3EF0A 1KYVA 3D4LA 3JRXA 3PFHA 3FPCA 3EDMA 5FYQA 5WRFA 2Y68A 3ANXA 2B83A 3I28A 4LTNA 1DRKA 4GNRA 5CVCA 2TSYB 2XZLA 4BU0A 4EH1A 4HGPA 5G53C 1ENOA 4D4KA 1OXBB 3RVJA 3W6PA 2HA3A 2RGUA 1EFPB 3KKZA 2ACWA 4YAUA 5K8TA 1H23A 3CLHA 4D3ZA 4S05A 3B6EA 3ZLBA 1V7PC 2BGUA 4E30A 1EI9A 2QRQA 2CF5A 3A1TA 1A4XA 1L4NA 2GO7A 3R0VA 1VKZA 2FUG1 3R3UA 3L1UA 2WZBA 1V45E 3DCYA 1OGIA 2JAWA 1CIJA 3UQYS 2NLOA 4ICIA 4QATA 1FRQA 1T3LA 2FZEA 4X62B 4AB1A 3CG4A 5CCBA 2I2WA 1CQWA 2FN4A 5ALPA 3AKZA 3OZTA 1QK5A 3CSDA 3E0XA 1IEQA 1KDVA 1U8XX 4X20A 4ROSA 3AXTA 3WMRA 2FUKA 4HS4A 4FE7A 4D46A 2XZOA 3LY8A 2V54A 5EE9A 3VH4A 5C46F 3H0KA 1EWTA 1XXHA 2I6QA 2F4VB 1TYAE 1RZ3A 5JY1A 8LDHA 3JQ9A 5B5SA 2HI0A 3SCZA 2VYFA 4IP0A 3STTA 1YL6A 3G79A 4FBLA 3TZ6A 4DNPA 1C30A 1VJCA 1HMPA 2ZIZA 1Y42X 5AUPB 1SU7A 3LCCA 1UZMA 4UU0A 3H05A 3EWNA 3QVMA 5BNFA 1K86A 1J21A 1LSOA 5AOBA 4F4FA 3PENA 3SX0A 3RO7A 4D43A 1FU4A 4PYLA 1PJTA 3I42A 4JGGA 2WOJA 3GI1A 4IEFB 5LOVB 4Q15A 2IZZA 4D5EA 4ND1A 2JH9A 3TI7A 3I8SA 4F84A 1QHHB 1XZDA 4GZLA 4MTCA 1Z4NA 5DX1A 4EZIA 3D4PA 2HRZA 2K7ZA 1WVMA 3L6BA 2WTAA 4XWTA 4ENQA 3R7BA 1T5OA 2PRZA 2EFDB 3A1SA 3I5AA 5TGZA 1T35A 3C45A 1YA8A 3AT1A 2EP7A 1T0UA 2H5EA 2IXAA 2HV9A 1EIWA 1WP4A 5F2NA 3IA7A 3STUA 1FUYB 2NN3C 2DQYA 2ZI7A 3B6KA 1NMXA 3DYIA 1VKOA 2Q2NA 3K53A 4R9UC 4PLFA 1YHZA 4E11A 2B4TO 2HMUA 1P62B 2OLKA 4Z9XA 1L8AA 4TTSA 2JAHA 4OFWA 4EB3A 1IU9A 1HX7A 3B6IA 2RGRA 2QRKA 1P73A 3AP2A 4Y2JA 3ZEIA 5BUZA 2YQ5A 3ANSA 3F6RA 1QHEA 3OURA 4NSNA 4O08A 1K5HA 2IP2A 4OLFA 4P83A 4DVGA 1DPGA 1R4NA 4N54A 3SKVA 5A5GA 3NTQA 1CT9A 1CUFA 4EL5A 3WZLA 2UYCA 3JQEA 1ZC4A 4FYYA 4H08A 1N25A 4XA8A 4PCVA 2JHGA 2JGLA 2A0KA 4JGBA 3ITNA 3HQ4O 2CLFB 5CLHA 5DFAA 4JYAB 1Q0HA 5EZ6B 1WOYA 2I71A 1UZNA 4IH1A 4IJMA 5EJEA 5U4QA 3G49A 4LXHA 2CDNA 1GV1A 4MULA 1Q22A 4E4TA 3MXTA 3C8MA 3SJAA 3Q7EA 4NNPA 2V6JA 1AS3A 2NZWA 4DPKA 4HI0E 3KE8A 4GL2A 5ALEA 5BW6B 1GL3A 1KERA 1XU7A 3IAS6 4RD0A 2GPBA 1XZPA 2HKIA 4CG3A 2XR1A 3OWHA 4PGAA 4AS2A 2FPUA 2DR0A 1E7MA 4QNNA 3NVAA 1E69A 3CVJA 4F4CA 2QT0A 2VNSA 4R81A 3PCTA 5IXJA 2ZYVX 2V6BA 4PNHA 4JSYA 3QVOA 3LT5A 3QPVA 1NYRA 4YAJA 4OCZA 5GY7A 3MGAA 1NJ1A 2IYPA 4YRAA 4DMMA 1WUTA 3BXPA 3I01M 3TDKA 2A9RA 2JLUA 5HQJA 2OSVA 2ZUEA 1Z5WA 5HFJA 1QHXA 3OD5A 4M1SA 4XTCS 3LDUA 3U7QB 7AT1A 3KVVA 4JVMA 4MIYA 4QUHA 2ZWPA 2DERA 4YYZA 1P0CA 1NVVQ 3ZWMA 3K6SA 2WINI 2GESA 2YH2A 2GQ0A 3TCNA 5IT5A 2VAXA 4F56A 4YMGA 3F5DA 3AXSA 4MUAA 3RQSA 3K94A 1Q0SA 2A5JA 2VO1A 2PPLA 3JR7A 3RWOA 2G7MC 4GBGA 5GADl 1MRSA 1NR1A 1OLUB 3PF9A 4O0MA 4ZDJA 1XVTA 4TV9F 3R40A 4H6XA 5JPCA 1VGVA 2ISQA 2GGSA 2R6HA 4UD6A 4WPGA 3ON5A 1PEKE 3BE4A 4FFRA 3AJAA 1WULS 4TUYB 4ZU1X 1Z6PA 3DR5A 2FVYA 3E3MA 4S24A 4YO7A 3UWOA 1AY0A 4ZN6A 2UXBB 1VPLA 2E85A 3HUDA 1EJ0A 1T9BA 2BBSA 2OVFA 4XI9A 2NPFA 1XRNA 1Q1GA 2IYUA 3RUFA 1E1YA 4N5IX 3O8RA 1Z39A 3VHQA 3REGA 1HE2A 4C3UA 4Q3CA 3HJHA 2IP1A 3PNSA 3WGZA 1ZKDA 4C7XA 3TOXA 2WB4A 2HB6A 1CLUA 4IL5A 4G36A 3OE7D 2H31A 1T8UA 2A0WA 1EK0A 3EXHA 4LYYA 5HGXA 3THYA 1V1RA 2WIJA 1RR6A 3BMQB 1T9ZA 4LY0A 1JWBB 2GCNA 3QELB 3R8XA 4EF4A 4A3SA 1D7AA 2ZUWA 1LD3A 3TNYA 3WWOA 1G5RA 1WABA 4M8SA 1FFXB 3QPBA 3OKFA 3MWFA 3FCAA 3A9WA 1HBJA 1U8FO 4IJWA 2OBBA 5C5IA 1NVAA 2B78A 1OYYA 2PL5A 3JZMA 4PC2A 3P9RA 3KLOA 3U7IA 4KN9S 1A7JA 5C7OO 2P41A 1Y7LA 1AGPA 1JN0A 3NAGA 2O59A 3F4KA 5CDHA 2ZQ5A 2B61A 3MILA 4B3XA 3CBQA 1C7IA 2ZYDA 3T7SA 4WVLA 2FG6C 5J1SB 4MZDA 4FNMA 2IV3A 2PIAA 1WY7A 4J29A 4DA8A 5FWYA 2AYZA 2OORC 3MW8A 3EZYA 3IOBA 2QQEA 2N75A 1MAUA 5CJJA 2VKTA 3GRZA 1CQXA 1W88A 3FBTA 4JR0A 4J9VA 3BERA 3M6LA 4KFRA 4NBNA 4QLOA 4XGKA 4B83A 1QRDA 2KI5A 2WWIA 4K2HA 4M99A 1P0QA 4X45A 4Z6KA 1FYEA 4WFQA 1E1DA 2VYQA 3ZCQA 4E7OA 5ALGA 1WUYA 1PG5A 1G17A 1ODCA 3INTA 5CPBA 4V2IA 1L4BA 1WZCA 2ZTVA 2IFTA 3NDPA 5L3RA 2ZSIA 2JB9A 1FZQA 5DN6A 1DJPA 2PH5A 5F2EA 3QHQA 2Q8PA 4K6OA 5EYPA 1E6MA 2X86A 4ZQHA 2JLYA 2RGDA 5F5LA 2GDJA 4O4LA 3DV2A 3RV3A 3TTXA 5F5NA 5AJHA 2AF4C 3MTAA 1THGA 1HT3A 3ETHA 2O54A 1ZR2A 3PLAE 3VR6H 2FY8A 4X24A 4PNPA 1VQ1A 2ZSBA 1KI1A 1T4MA 3CXUA 1WW3A 1THMA 2IPAB 2Q8QA 4JA2A 3JZDA 2I2AA 1A27A 3EYWA 4L8FA 1CUUA 2FUNB 4ZO6A 4HC4A 3DO5A 1YJXA 5DXJA 4I3HA 3HN2A 1TQ8A 4YIKA 3N59A 3OFJA 1DU4A 3GJXC 1JF8A 1QP4A 2VA8A 3FMGA 2ZXFA 1XTTA 4M86A 3SKYA 4AQ7A 4BJ5A 3COVA 3CZRA 3CMMA 4KEAA 2HADA 2SCUB 4NV1A 1H3FA 7REQB 2OK7A 4COOA 3GT7A 1U0FA 1VG9B 1JPUA 1DEKA 2EKPA 2P67A 3QWBA 4FX2A 2NXWA 4CMGA 2PYDA 2YNMA 1J0EA 4E31A 2Z3VA 1UDWA 3V80A 3SICE 2Z43A 2JATA 3DHNA 5I4CA 2I1LA 2PU5A 1GKUB 1OC2A 2X7JA 1ZIYA 2O0MA 4H4CA 3UYKA 1IK4A 4XIJA 4AF8A 4E08A 4EUKA 2Q0XA 1TYCA 2Z5FA 4BKPA 2BR5A 3KVYA 4KQGA 2QNIA 2PGDA 3RC8A 4ND7A 1EX7A 2E82A 3GLKA 1NOKA 2F1JA 4LRUA 3K15A 4P2GA 1N2ZA 1XCJA 1XNGA 2NYUA 3SC2B 5IJ0B 1AQYA 4HGRA 3VDMA 5JDCA 5ALZA 4YJFA 2ECQA 2C4TA 1TTHA 4UBIA 3UJCA 3VDRA 3WL3A 2VYCA 4EMTA 4F7WA 1CJMA 1Z37A 4KQKA 2C4WA 2VJBA 1IBLB 2CUNA 4EECA 3JVDA 1UCFA 2O8FB 4JT9A 3TEFA 4QLBA 3DJYA 1MXHA 2XXBA 3RGWS 4M98A 1QU3A 4GXRA 2ZS7A 3D31A 4EHDA 1EFRD 1D07A 3KVOA 4WKOA 1O5TA 1FTQA 4ZJYA 3CEHA 2YZMA 1ADFA 1TC1A 4QD3A 1II0A 1TT5A 3THOA 4U8HA 1PZXA 1SQSA 2OK8A 3MOSA 4IWYA 3RNOA 2JLRA 2ZFUA 4JX9A 3A6PC 5LIPA 4ZDIA 1N34B 2AE2A 2YHSA 2RH9B 3FUCA 4O2BA 2CJPA 4RETA 3TIXB 3B38A 3RVOA 3EEOA 2C95A 1PDVA 1G20B 3JAWB 4L51A 1PNQA 4DTCA 1FC0A 2NO4A 4UPDA 4A0GA 5K20A 1GAXA 3UJNA 2QZJA 3GBSA 3KKMA 4O2RA 4DCNA 4DCPA 1RWXA 2MTBA 2YXPX 2ZRMA 3AR5A 4J2OA 4AULA 5C1OA 4FHZA 2OZLB 3D4BA 1IEVA 2AMYA 3CLRC 5ECWA 3NHWA 5B3AA 2XEXA 1LGYA 2PIDA 5DYYA 2ZRBA 3SM9A 3CONA 3CUKA 3EVDA 2EG5A 5LBUA 3URMA 4D9MA 2GNAA 5JNUA 3GA5A 3DDCA 1M67A 1O87A 4KMMA 4P54A 4TRNA 2O4UX 1NRWA 5AOCA 3GRCA 4HRAA 2EP5A 2J6HA 1PJ8A 3BUSA 1DS6A 1TM7E 5L9AA 4C22A 3K0AB 2RKWA 2AXQA 2RBGA 1OWOA 2WICA 3QF4B 4BRZA 3CGWA 1SULA 1J90A 3J7TA 1I24A 2K2QB 3HSSA 3Q9UA 5A4AA 4DG8A 1U9IC 1GDDA 1EHYA 3JQQA 2BUBA 3KTAB 4KZPA 5A9TA 4BNJA 1GQFA 1UBLS 4MRMB 4DZRA 2PE5A 4FNGA 1EIZA 1YCGA 2R4UA 4KAAA 2ZR8A 4GWKA 5JATA 4C4OA 1SCJA 3PNQA 3NBYC 2ZRFA 2WV9A 2I2DA 3MWEB 4UVDA 2O2SA 4HBZA 2NVUB 2G70A 4V0LA 4US2R 5EESA 4UPVA 5KHAA 5KYKA 4YRNA 2BGWA 3Q7PA 1UQTA 2CJWA 1KEUA 1POWA 4J0QA 2OQVA 1EBUA 2PBZA 4CM9D 3FLEA 3ZLTA 1XALA 1QX3A 5M04A 3QHPA 2SKDA 3OZSA 4EY6A 1WKVA 1WPGA 1KVQA 1XCOA 4NH4A 3N0RA 1R27A 3V1NA 2B36A 1OT3A 2Y1XA 1S89A 1UC4B 4AZ0A 8ABPA 3WB1A 4F86A 1TRHA 2GDZA 1G9TA 5GMOA 2FUG6 1F8GA 2B35A 2W2KB 3BDIA 4NPCA 4BLOA 1RDFA 1VDMA 1U0LA 1VL8A 2EQBA 4GLJA 3VOTA 2R00C 3HZHA 2F8MA 3ECSA 3H2YA 4IIEA 3DUFA 3CNQS 3FUVA 2C42A 3GDWA 4OJNA 4XARA 1EWVA 3IERA 4YCNA 4H17A 1GPLA 3WLLA 2A1UA 1X15A 3GJ3A 3DVAB 5E3JA 1RKUA 1TLTA 2QENA 1JQJC 2OC9A 1M1YB 4MMYB 4IDQA 1CP2A 3RLIA 3NIWA 1OASA 5FJJA 1GYQA 4R9RA 3VOBA 2IRWA 3LRTA 3JYOA 1G5FA 2UZ0A 4TMFA 3ZZMA 2ZBUA 5EUBA 1BQEA 2DTDA 5IASA 1W6UA 4ADSG 1E1RA 2P3QA 1PTJC 2VDWA 3BWXA 3EUWA 1YK0A 3K4QA 1IIRA 1AD2A 1LRKA 2JEOA 4QA9A 1EP1B 3OQIA 3RFCA 3SIXA 4DDVA 2AI2A 2GVZC 3SMQA 4MR9B 4KX5A 3LPLA 4RJJA 4HX5A 3CLSC 4MVYA 1DUVG 4GMFA 4IKEA 3B3AA 4KDCA 3WICA 2A88A 1UMCB 3GAZA 3Q7QA 4XDGA 3EZ9A 1UJBA 3SJCA 4LSGA 2JZCA 4CF5A 2FR1A 4ZODA 5J59A 1CR4A 4LC1A 3TRDA 3Q1LA 5TE9A 3UHPA 5BQPA 5H4GA 4X60A 4R51A 2RAPA 4UZSA 3ABQB 1EM6A 3EZ6A 4HEJA 1JHUA 2ZUCA 1FDRA 2V7VA 4X66B 4MYRA 5A71A 3U1VA 4BQPA 4WJLA 3R8FA 1A76A 1JIKA 3IVGA 4L85A 3TZLA 3T6KA 1WZIA 2XYPA 2GBCA 3AIMA 1OX5A 4U5QA 4WESB 1VJRA 5G1OA 4B81A 1LBSA 1C9MA 3VVCA 5E2BA 5AM2A 5ICSA 3NUZA 1ZUIA 3TJRA 1Y1LA 4DDMA 1PHPA 2EARA 1G3QA 3KPUA 4NE2A 3HVHA 4J43A 1MIOA 3AB7A 2PMEA 4ZCIA 1XZMA 2BBTA 3OZRA 5IDXA 2QGFA 4DR1B 4IQ4A 4B85A 3BRWA 4O63O 4EB8A 2VT7A 2CLMB 3S2IA 3UFBA 3WSTA 2BI7A 5LQCA 2UUOA 1YZNA 3C3KA 1IUNA 2NQ2C 2GZRA 3F9CA 3NM5A 2WUVA 4R2XA 3BJIC 5D7NA 3VR1A 1WZUA 2L2QA 2DUWA 2BMEA 3G1TA 3LCVB 2AQKA 2RARA 4AJLA 2EAUA 1W2GA 1V4NA 1VB5A 2O7SA 4BQFA 3Q2KA 1NI4B 3L7OA 4IEEA 2FAXA 3EW7A 4RZXA 1XP8A 4F60A 5BR1A 1DFHA 2NMVA 1JQAA 2I22A 3M89A 5AW9A 4BMCA 2DBZA 1YNOA 3WC4A 4L08A 2YICA 1ES9A 4UBLA 4NQZA 2QZ9A 1G66A 1KO7A 5E9QA 3HFRA 5DT2A 2O9JA 3ITDA 2GS9A 3ZKWB 1T2DA 3O7WA 4D9GA 4PSKA 2ANCA 2D2XA 5AO9A 5JD5A 1FJ2A 1YT5A 4TVOA 3TVYA 3AKCA 1IM5A 3USCS 3EIWA 3HL4A 4UAJA 4BB0A 2XXAA 1H8HD 3TZCA 3JZAA 5EJIA 3I9FA 2NU7B 3NS7A 4XQEA 1L3CA 2FSUA 4Y98A 1DBWA 3IEIA 4UEOA 1SXQA 1QCDA 2HMWA 4DLLA 1GZ5A 2C5SA 3QYPA 2WQZA 4D9FA 1L3IA 4ND3A 3OSUA 3BB4A 1NF8A 2G9RA 3OCJA 3TPFA 2WIDA 1E5QA 3K09C 2FPGA 2MINA 4RLHA 1EFRA 1J24A 3ROPA 4X8HA 1VPTA 2JANA 1HKUA 1MG0A 2HO5A 2QN6A 3WMEA 1MZPA 1CPYA 4EA9A 1Y33E 2PPVA 4TS3A 1GPUA 1W29A 2HK6A 2WFLA 3AIOA 2JJQA 1RQRA 2FSFA 2P79A 5JEEA 3UWKA 4R5MA 5LQRA 2DFVA 5JU6A 1CQZA 2CC2A 3I0ZA 4HEA6 2WF9A 3T7EA 4TZ6A 4KRGA 1W5EA 1Y82A 3UW1A 1VECA 1D4ZA 2VHCA 3QA9A 1MQAA 1QKKA 1GRRA 4K40A 4LJ7A 5AM5A 1JLHA 2D6FA 4J0CA 3BH0A 3HJTA 1U28A 3NAZA 1XDUA 2BJVA 4V03A 1KU6A 1P1HA 3QU2A 4FR2A 4YJ3B 2H9AA 5ECYA 1EU1A 3AU9A 3HB0A 4ZYUA 3B9QA 5DHAA 5TNXA 1K06A 4RENA 1HM5A 3MA0A 3TTYA 3DBOB 5BSWA 4LHZA 1A9XA 2HSGA 1YZQA 2C54A 3K0AA 1L7EA 4LISA 1T0IA 3NEAA 3GFGA 5A4FS 3FETA 2AR0A 3RYFB 4EYGA 1D6JA 1GAWA 1X70A 5I8PA 2O1XA 3GW8A 1M2JA 2MDTA 3AP1A 3GCZA 3KSAC 2W6QA 3E18A 3JZIA 4AG3A 2QXTA 5DYTA 2Y0PA 3P27A 1Z6YA 3G8BA 3M5PA 1JIJA 9ABPA 4NMXB 1VRVA 2YHBA 4ILEA 3X1JA 3L7DA 4TL7A 3DOOA 2EJVA 2R8YA 1XMSA 1N8TA 1DKPA 2B9EA 1SQ0A 2RGNA 1YJQA 1S4MA 1SGWA 4W9NC 421PA 621PA 1OZHA 1TUIA 2BCGY 1JG2A 1GG9A 2PQ0A 4BAGA 3E9QA 2R9VA 3AETA 4Q7LA 1VE1A 2HWYA 4TKLA 1GZ3A 3OZWA 5E8RA 1KI6B 2V6IA 3UTCA 4BLVA 1KR5A 1V95A 3C98A 4U2BA 1E6CA 3DHYA 2XUDA 1CVIA 3ZTYA 4WCFA 4UQOA 4RS3A 3PA6A 5T8KA 4BMDA 3EE6A 1KETA 1OROA 4E1AA 4XDZA 4IZIA 4LYEA 3IDAA 1R5OA 1K1EA 1WR8A 2BBOA 4KUHA 2UYHA 5HXAA 5LA6A 1CW2B 2BW0A 2PUGA 2IOYA 4URXR 3GGJA 1P81A 4QGFA 3ANLA 3MEQA 3Q3JB 4UTZA 3WAGA 2G9UA 1MEJA 2SNIE 3RYIB 1ZG3A 1ZWKA 3I2FA 3VX3A 1G4HA 4DLXA 2OUKA 3DLHA 2PGLA 4QVIA 4B1FA 4MB0A 1VRWA 2HDNB 1KJ8A 4PBSA 2PSHA 1BH2A 1WS6A 1BX0A 1N6HA 3DSRA 1BFUA 1NDQA 1VHQA 2Y1KA 5FD8A 4WI1A 1ZN9A 1PRYA 1SVLA 3QYFA 4M1TA 2R7NA 2G9VA 2YR0A 1HRDA 3PJEA 4R8MA 1XZKA 3AERB 2Z8XA 2A4KA 4QVKA 1BVHA 1BE1A 1KI7A 4QARA 1ZCAA 2ASEA 1MKYA 2C97A 4RPCA 5IJAA 1I2CA 3VX4A 16PKA 3R44A 3V7UA 4UOEA 2WHEA 2Y1CA 1SKBA 1O1YA 3KQQA 5EMMA 3GO4A 1G0OA 1Z6ZA 4HDSA 1OH6A 4DQVA 3N5CA 1WDLA 3NJRA 5DTIA 4C0KA 1G8MA 1OLXA 3GYBA 4DXHA 4DOMA 2YXDA 4GYKA 3I37X 4RTJA 3UPUA 3BT7A 2GPYA 3FY4A 2IYZA 1DAGA 3KXLA 4LNHA 4TVKA 5K0SA 5ER6A 1BMFA 3LMKA 5A7HA 5K7SA 3TNFA 2Z5VA 3KTDA 4MRNA 1O4WA 1WF3A 4PU0A 4U4AA 2AX3A 5JCPA 1TM2A 1OH7A 1P7WA 2RK4A 2EJCA 2ZRAA 1E9FA 3EGOA 5DU2A 2DG2A 1F9EA 1Q6ZA 1X7WB 4LYJA 4FONA 1ACLA 4KUEA 1KEKA 5J23A 4MRVA 3DZ8A 4HSEA 4IIFA 3DMYA 5JZ9A 1EEXB 2J48A 3HUFA 4OM8A 1Z18A 4TZKA 1MIOB 1JAIA 2C5AA 1TGVA 3VR4H 3ZWCA 2WT9A 4YAKA 2BI8A 2PGXA 1R4MB 1DC8A 2HRCA 3G0IA 5F1KA 4P93A 1U2EA 2YOFA 1Y8CA 1DLIA 5IDWA 4LWOA 1EQ2A 4MYCA 4AT1A 3JQGB 1YVDA 4C3OB 1ZQ9A 1NXQA 1AGRA 1JP7A 2IEAA 2Z2ZA 2XYVA 3LGSA 2F3PA 1YBVA 3QVWA 4JAVC 3WV4A 4B75A 3TKYA 4IO0A 1KVUA 4QU5A 1XTPA 1FU8A 4R0NA 1WKCA 3ONNA 2C7BA 1EFVA 1WVIA 4HDMB 2CZQA 3NG1A 4HZIA 2BI4A 1GSIA 4JJFA 1V5GA 4J9UE 1WF6A 1JU9A 1DBPA 3V7YA 2NUAA 1M2VB 5J4LA 1KHHA 2PT7A 2WWXA 5JEDA 5K6AC 1GA4A 1FFHA 2H48A 2AA3A 4KQEA 4JA0A 3WQSB 5LKAA 1Y9ZA 3WJ7A 3WBKA 1T0HB 2GN2A 2ATIA 4Q3EA 2ZK7A 3VU3A 5BN1A 3RKSA 4RAOA 1EXDA 1DELA 2NOAA 3EGDB 1YQGA 3TTTA 1VLJA 3DQQA 4B80A 2H57A 2W0SA 3DKIA 2HZ7A 3LG2A 1JQLB 2WTNA 1GA6A 2ZYGA 3ZZ1A 3WB9A 5CVUA 5J2TA 2O8VA 1APBA 1DEXA 2NV6A 1WLSA 3D6JA 2VOJA 5FLEX 1WPRA 4G67A 3QTTA 3RUDA 2IBTA 3EPHA 4J6FA 2DY0A 3OECA 1MOQA 1GG5A 4QVGA 4P4TA 5A3QA 4XX0B 3I2HA 2QMEA 3IFSA 1SCIA 2XE4A 2WYUA 2HUPA 4GMGA 3T9FA 4A2QA 4BLPA 3HJUA 4JL5A 4AWXA 1PEAA 1M5RA 3COYA 1HDYA 3U09A 2V6GA 2VHJA 1FVFA 2ZSEA 1H2WA 4GOJA 2C2HA 4M7PA 4W9NA 4Q03A 3UBMA 1NW5A 3U13A 1FSFA 1U8YA 1IVYA 3BX1A 4NH0A 5DK4A 3TW6A 4LJLA 4PX3A 1J20A 4YJDA 2Y66A 1UFKA 4B7AA 2EZTA 3AKDA 4ONEA 4HB3A 1WW8A 1MXFA 1ZM7A 2A7XA 3LHIA 2H5IA 5F2OA 1RBQA 2HBQA 2QVZX 2QG4A 4KE7A 2WJ4A 1V7CA 2Q21A 1QV6A 2AYYA 3DF9A 4OHMA 4WKNA 1THZA 2GRAA 2W37A 3FFXA 3AY7A 4A8TA 3X1ZA 4Y2UA 3VOAA 4BN0A 2F48A 2J09A 4ZMSA 1RYMA 1U9ZA 2GPNA 4YCLA 4TKZA 4OYRA 4LEIA 4KXUA 3S2YA 4D3DA 3EZ2A 1WHTA 2QOEA 4BFZA 3IBTA 3LCJA 3AUUA 3WK4A 3LK7A 4IF6A 4ZVRA 2V7XA 4HQ0A 4L22A 2JNWA 2QY6A 5JXHA 2WF8A 1QE5A 2YXNA 1IMOA 2DHRA 1U1GA 1ACMA 2P7IA 2CJYA 5C8VA 3AO0B 1EMDA 2IC5A 3PL5A 1LWNA 1AK9A 2Z9BA 3AJ8A 1E2JA 2W2XA 2YQ4A 3QLTA 4LAFA 4MW1A 2FEPA 4HQFA 3H2SA 1LNQA 2FA9A 1AG9A 4EB0A 3EY4A 3FCYA 4L72A 3FYUA 2MJLA 1L5QA 1TAGA 2O07A 2P5TB 4QYMA 2L0XA 2PRIA 3A9VA 3D81A 4TKVB 4ZYVA 2AKAB 1OBOA 5JLJA 1AU9A 3NHRA 3OJCA 1JHPA 1I2MA 3D02A 3OUUA 4GDMA 4C7JA 4DIMA 2JKZA 1OHHA 2HK8A 1FYWA 4WXMA 4D6PA 5LQDA 3A4YA 5IK2A 2FMHA 4KIUA 1JEYB 1DKNA 1L4KA 3GXBA 4QWMA 1YZHA 1JR3E 4FPXA 1PJLA 2FW1A 1H1LB 2CLEB 4XWAA 2WPDA 2GBIA 1IC6A 2E6UX 3KKKA 3LTNC 4RSHA 4EG1A 1E2EA 5AESA 4MUJA 5LP6A 3ZVMA 3F1LA 5E2AA 1Q84A 2C9BA 1GA1A 2XD9A 3QFHA 4RYLA 4TLMB 4ARZA 3RC1A 5I8ZA 3B2QA 4O5OA 5T3YA 2Z2JA 3D3NA 4FD2A 4JEIA 4WDQA 2E7ZA 2SCUA 2AI3A 3D7LA 3EAQA 3Q98A 4TV8F 5AICA 3UC5A 4CU5A 1U7ZA 2JLQA 2O4CA 3NTVA 4U7HA 2ZJOA 3PDWA 1VBMA 1LU9A 2Q5FA 1J22A 4QDOA 1FDIA 4QU0A 4F2WA 1XWWA 3TAHA 3LYAA 5CDGA 1YDGA 3R7DA 2ZTMA 4XGRA 1Z06A 1O58A 1YD7A 2Q1SA 4ETMA 2X6QA 3BREA 3HM9A 1L5VA 1SBCA 5K0FA 2B2NA 3PEWA 1VZ2A 1BMQA 2DBQA 3DKPA 4LJ4A 4LZJA 5G4LA 3SY8A 4E3ZA 2A9FA 1ZK0A 4AO7A 4OBWA 3EQ2A 4BDTA 4ZAGA 2HXGA 1IXSB 4KIGA 1T2CA 4O1MA 3HC7A 4Q00A 3T0IA 3VO1A 5LWHA 1NJFA 2VJDA 4J7UA 2DKFA 2W6NA 2NT3A 3DR3A 4YJFB 3R3YA 2IIVA 2J0UB 3DL7A 3SIPA 2PX5A 4UUMA 3J80A 2WWRA 1U3CA 3QOFA 4I1VA 5FRDA 3OQMA 2LIPA 1FRZA 1UMBA 3JYLA 1KY5A 2ZCVA 3EIOA 1RLMA 4CG0A 2H9IA 3SDSA 3NVKI 2IY9A 4PG5A 1QRUA 5LR6A 2YJGA 1QANA 4YCJA 3WLKX 4A0SA 4YRIA 2YOGA 1M7HA 3OC6A 5C1BA 1R6DA 3F5MA 5H4HA 5BNWA 5KWIA 4I4NA 3WLQA 4ZOLA 3L1IA 3N8GA 4LFAB 3H2HA 3RS4A 1E7YA 2JAPA 4YCDA 3D0KA 3UAGA 1WXQA 4L07A 3ITEA 3L77A 4LY6A 4RX1A 3ESZA 5AI8A 5K3AA 4DY4A 1IUKA 2OHIA 4J1QA 2JASA 4C7VA 1UR5A 4AZTA 2VDPB 5KPDA 3AJEA 1JAXA 1A50B 3B9RA 3NW9A 3T7TA 3V4ZA 3TG2A 2OM2A 3U37A 2HU2A 4NU0A 1HMYA 2IYYA 3HBMA 1MFZA 1YH3A 2Q7DA 5DYWA 2GHIA 3ZYZA 3WYCA 2FDCA 4G1VA 2I2FA 4TTAA 3EEQA 1OY1A 1KU0A 1QYIA 3W3ZB 1E8NA 3AVUA 1PD1A 4IG9A 4LRQA 4R2WA 1WXHA 4GXNA 3K1JA 4PFQA 4B4WA 3K9CA 5EGSA 2ECPA 3U60B 4JMPA 1PSZA 3TLJA 2HJSA 2QTRA 2EU8A 5LQKA 3K70C 1L3BA 2O8NA 1C3EA 4AS1A 3QPWA 4ESHA 3UMMA 1Y1TA 3B13B 4QC2A 3WB0A 1Z4QA 2W6ZA 1BCSB 3STVA 4OX9Y 3MCUA 2J3DA 3LNTA 1ZZEA 1L7NA 3ILVA 3R5FA 2QT1A 4ZVQA 1ILWA 3HR4A 2BKVA 2X77A 3ECCA 1QFSA 1T10A 1FFEA 1YAHA 1Y1SA 4Q3BA 5DBGA 1P0MA 1HFJA 3RBAA 2BAGA 2FN9A 3KZNA 4DQLA 4ZJZA 1XEWY 3ZR4B 3P0JA 3TTWA 1H9BA 1Z0FA 2WE7A 2OGZA 1C1DB 4QXQA 2XDYA 1E64A 4TWJA 3LVQE 3A1UA 1TQHA 2YINC 5B7QA 1UBHS 1FXWA 2WF7A 5BWMA 1WB9A 1GCUA 2RI0A 3PGLA 1P45A 4FMDB 4ALIA 3K71B 1NBMD 4CQLB 5HF8A 4OGLA 2DKOA 1I3LA 3WBFA 4MV8A 4YMHA 3H16A 4BNXA 2PKEA 3M1LA 1MJNA 4Y2YA 5HM6A 1DEHA 2IWRA 4EM6A 1NN5A 2WIKA 3NASA 5HKLA 1I14A 4DNOA 4XVHA 3HCRA 3GP8A 4IUBS 1MQSA 4HNAA 4ZD6A 5KB3A 1N8SA 4NABA 4ASUA 2VYVD 3PR2B 1YI0A 4B7XA 1PK7A 2Z2IA 1W8DA 1NU6A 4H4DA 3TI9A 1Q7GA 4QJ3A 3OKCA 1Q3TA 1M1YA 3KOXA 1I2BA 3Q6NA 2PQMA 3IAM1 2CLDX 3OZBA 4RTRA 3A2MA 2CB0A 3AF3A 4BNFA 4RTLA 4W1RA 1RXSA 2EW8A 1D5WA 1X8LA 4KP7A 5DHQA 1T4DA 2GMWA 3GROA 3QVXA 4MVWA 3HBFA 3BRCA 4OXQA 1O0CA 3PNLA 3GFOA 1BHQ1 1W25A 4XWOA 2AB0A 3BPSA 4Z4IA 1UFVA 2V0CA 3OLXA 4PAOA 4QUGA 1WUHS 4BC0A 1Q12A 3OE5A 1AQUA 3E9NA 1JLMA 1UKEA 3DDWA 3IAHA 4KDRA 2AJLI 1HSOA 1VL5A 1V1JA 3BEDA 4KVZA 2ZE5A 3U39A 1KY4A 4Q3OA 3OIYA 3PYMA 3U3RA 3ZHQA 5K03A 5LLDA 4I81A 2Z5GA 1KAMA 3MS7A 1JV2B 4Q4JB 3R8CA 5LMNB 1UPUA 1N1DA 1YS4A 5JJCA 3FLBA 1CB0A 1V2HE 4I55A 3CO5A 5BOSA 5IBPA 1PFUA 2JF0A 4Z7NB 1W96A 5IFLA 1E2IA 4TTTS 2ATEA 3IAEA 4XIFA 2Q99A 2XGGA 5KMGB 3FOAA 2VHXA 3KJHA 4C6RA 2XUZA 4GUAA 4CKYA 5DM2A 4ZFNA 2AZXA 1RM3A 1YVRA 2CXQA 1HRKA 4IS2A 4KXNA 4ZVTA 4DQUA 4PYJA 3O93A 5JH7B 3NC4A 3QE9Y 1S96A 4O4IB 3ZIAA 2O19A 2VHTA 2AZDA 3QTLA 1BXRA 1HEIA 4XWWA 2GCGA 1NL3A 4MVXA 2ZRIA 4JJGA 5IM4F 2G80A 2BEWA 3HB9A 2IHUA 4GPD1 3ZZUA 1E2HA 2O06A 3THYB 1NR7A 1TDJA 1Z2AA 4IIDA 4EK9A 2YRWA 3ASYA 2V8BA 3G88A 3V3TA 4PN7A 2BGMA 1WEKA 2VPTA 3B1VA 3PQDA 1G2QA 4Q7QA 1L7VC 4KX3A 3WNVA 3RSZA 4Q3AA 3IBYA 1I7DA 3OE7A 3QLVC 3ELWA 4M22A 4YDHB 5K5EA 4ZZ3A 4BO9A 1NSFA 2OZKA 2P91A 2WSSA 4OFZA 4A1OA 4DQXA 1UKYA 1KZ7B 1QOPB 2G9ZA 4RELA 4CMEC 4G0YA 4BIMA 3EZXA 3NAQA 2P2GA 3PNPA 5AVKA 5C5CA 1U3TA 3KV3O 3WWCA 3S6JA 1SA0A 3NB0A 1PFQA 5DBIA 5AVRA 5DVZA 2ZRJA 1AIPA 3KELA 1XR3A 4FMDF 2XUHA 1G5IA 3AM4A 4PW0A 3ER8A 1TUBB 2B1QA 3ZGYA 2BZGA 4BNMA 2J32A 5D1NA 1L9KA 1TIKA 2W2VA 3V4FA 4AXXA 1EB9A 4EENA 1GZVA 1Z13A 2QAGC 4RTSA 3A9CA 3E23A 4WQMA 2A84A 2FMIA 1BDIA 4DR6B 2ZUDA 1V25A 1FF9A 2GK4A 1KR2A 1CX9B 2R86A 1QC5A 1T6XA 3LDGA 1BOFA 1DBSA 1U7DA 2CK3D 3PR1A 1GG2A 1MPXA 4LYAA 2COEA 5J5VA 4IQ8A 1KRWA 2IIBA 4QBFA 2BRUA 1XDSA 3RIXA 1KHTA 5H5JA 3K5PA 3GGCA 2ET6A 4Q39A 2WF5A 4YK7A 1Q95A 3BDAA 1LC0A 4DLTA 4XR9A 1U0RA 2CNKA 2V4UA 3IPXA 4MJXA 4DR3B 3N28A 1KRXA 3H5RA 1LPPA 4H3SA 1B1AA 3P8ZA 4O4IA 4B9AA 2VLBA 3UENA 1THTA 4NL4H 3NOOA 3ZGNA 3QEJA 1E3LA 1E66A 4R7ZA 3RUCA 1WV1A 2Y2UA 4PC7A 2Q2QA 3JALB 2WTUA 2JHAA 5BPFA 1NMSA 2EEPA 3UGTA 2FPMA 1NVDA 3DBIA 3UJ8A 5CFNA 1Z2NX 3I4CA 4YRZA 1L5FA 5DNVA 5EE0A 3LXMA 4YI3A 4HQKA 5FR2A 3OTQA 3ZCTA 2JVJA 3HRKA 3WYAA 3R77A 1K8QA 2RGEA 3BWDD 3H2BA 3CPJB 4I9HA 5HR5A 4F4JA 1G8FA 2XUKA 4DMCA 2BSXA 4DS3A 1HZZA 2DWCA 2FQQA 2O23A 3MMXA 3ZU3A 3P9PA 5IDVA 3AEZA 1HE4A 4C7OA 4YRFA 3Q3GE 4G3XA 4MYUA 1U7HA 4CYMA 2D13A 4KQ1A 2YWEA 1P3JA 4WXHA 1YB6A 5IN4A 4JC5A 1UQRA 3WYBA 3QWFA 3HBAA 5B3JC 1ICIA 4UUAA 4MVJA 1UK7A 3Q8XB 1JEJA 3GH1A 3DOCA 5HCUA 3IDSA 4C0BA 1TTQB 4RTOA 3PQFA 1U3GA 3AEYA 1K0FA 4U8GA 2J7KA 3AY3A 4QOIA 5FULA 3BICA 1OAKA 1ZVKA 4BWGA 4F85A 2DPGA 4G5GA 4EYEA 5I6DA 2O1WA 4RHCA 4UUNA 1J49A 4LG1A 3FKQA 4MEJA 5EWLA 5G02A