2EW8A

Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
247
structure length
229
Chain Sequence
QRLKDKLAVITGGANGIGRAIAERFAVEGADIAIADLVPAPEAEAAIRNLGRRVLTVKCDVSQPGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVNMLQAIPRLQVPLDLTGAAAFLASDDASFITGQTLAVDGGMVRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Enzyme kinetics of the (S)-Specific 1-Phenylethanol Dehydrogenase of the denitrifying bacterium Strain EbN1
pubmed doi rcsb
source organism Azoarcus sp. ebn1
molecule tags Transferase
molecule keywords (S)-1-Phenylethanol dehydrogenase
total genus 81
structure length 229
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.311: (S)-1-phenylethanol dehydrogenase.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ew8A00
2GF2A 3N7UA 1JDJA 2H1SA 3H4VA 4IXWA 3FNGA 4FW8A 5G4KA 4CMJA 4DQXA 3GR6A 2J6IA 4WLVA 2VZ9A 3DZJA 5ADHA 1P0CA 1WDMA 2X5OA 3IIEA 3WJ7A 3ZWBA 3KUXA 1D3AA 2QHXA 4DWVA 3GOHA 3W8DA 1F14A 1CF2O 1U8XX 4GX1A 3RI3A 4FFPA 2JAPA 4IIVA 2FSSA 2O2YA 4YAJA 1YJQA 1JLLA 3H5RA 4P22A 3WSVA 2QRJA 3ETEA 2C20A 4RQTA 2X5KO 3TRIA 5A3VA 3U62A 8LDHA 1DPGA 2X86A 2FY8A 3KSDO 4Z9FA 1ZJZA 2Q1WA 3BMOB 3ZHYA 3GNTA 3TNLA 4XB1A 1XGKA 4B4UA 2AE2A 4DTIA 5GZ1A 4LW8A 5L7WA 4MP8A 4G5HA 3RAJA 3E8XA 4R1UA 4BGVA 3IQDB 4JIGA 1J49A 1KVRA 3FPCA 3TPCA 2ZB7A 1QXSA 5F1KA 1ML3A 2NUAA 1D1SA 3GVPA 2HKIA 4RVGA 1ZSYA 1ZIDA 4UUPA 3I1JA 4O0LA 1ADFA 1KVUA 4R54A 2QYSA 1ADCA 4IXTA 1PX0A 3QVWA 3PI7A 3C8MA 2CVQA 1DC4A 3T7CA 1AHIA 3Q9UA 1SB9A 1ONOA 4UULA 3KEOA 4I5EA 4BO0A 3D4NA 5DDIP 2R00A 2GR9A 4IDFA 5L40A 4F6CA 4YAKA 4OXKA 3VVCA 3RIHA 1LRJA 4GX5A 1HYGA 3I9JA 1IZ0A 3I6IA 4GMFA 3WFJA 5JS6A 1HE3A 1HZJA 2PV7A 1RYEA 4WLNA 1Y1PA 2FZEA 2JCVA 2X0IA 3Q11A 4N54A 3Q2IA 3AY3A 1GCOA 2VUSA 1ISJA 3VOSA 4BNHA 4OIMA 4CM9D 3DMYA 3L07A 2PD4A 4J6FA 3JQ7B 3PYLA 4F3YA 1OOEA 4MIOA 1RM4A 1XELA 3IP1A 3MWEB 4DLAA 1ZXBA 1UZNA 3PFWO 1H2HA 1Y8QB 4UUMA 5T5QA 4B3JA 3AUAA 3ICCA 3VC7A 3GGOA 4DXHA 4ZGWA 2W8ZA 3CUKA 2J3HA 2VZ0A 4G65A 1C3VA 1M2WA 4XGNA 3JYPA 4OO3A 4DGSA 2ZTLA 1EDZA 4XEHA 3G79A 3PTZA 3HUDA 1ZK4A 5H83A 1KY4A 5CPBA 4I9NA 4TQGA 4J1SA 1FDTA 5JCJD 4ALJA 3DFZA 2VWQA 1JKFA 2DQ4A 1WDKA 1ZCJA 2CZCA 2V6FA 1QR6A 2RH8A 1E1NA 4MVJA 4L4SA 5ENDA 5I9NA 4JN6B 3HDYA 2PTGA 1KC3A 4M54A 4AL4A 2O3RA 4R9SA 5A4DA 4HWKA 2IODA 1CETA 2X8LA 3HWRA 1KYQA 4Z0TA 5DULA 1JKIA 3A1NA 3C85A 5EJ2A 2ZQZA 3OH8A 5DP1A 4BB5A 4A26A 4XQGA 5JPIA 3H2ZA 2AXQA 5IXSA 4EDFA 2H6EA 4BNYA 1GV1A 1J6UA 4FB5A 5DP2A 3UXYA 1EK6A 4J9VA 3O9ZA 4MO2A 4BO7A 3U09A 3FF4A 4OSPA 2QRLA 1BVRA 1X7GA 3RFXA 4MP3A 1HETA 2X7HA 5IAAA 2A35A 2X22A 3EYWA 1YDWA 2QZ9A 4DC1A 3PIDA 1MC5A 4BHTA 3D5QA 3MJ4A 1B15A 4FC7A 4CM4A 4PLPA 5C37A 1YS4A 2EW2A 3I9LA 3TQHA 4B79A 3GN1A 2ZATA 5L3ZA 1KY5A 4R1NA 3SXPA 2Y93A 3K2EA 4OQZA 2I3AA 4LN1A 1FK8A 2Q2QA 1DOHA 3JQ7A 3ZWNA 5DCYA 4I5GA 2A9FA 4PG5A 4ZJUA 3LQFA 3WGIA 4M1QA 3WGOA 2AEJA 2ZKLA 4DVJA 3LZ6A 1V3UA 2YV1A 2BGKA 3PHHA 4YQYA 4D45A 1LDGA 5EQDA 4PG7A 4KQXA 2Q50A 2ZIZA 3N58A 4HADA 1HDYA 1WWKA 4L9RA 4NFSA 4IQ0A 1HE2A 2NQTA 3U49A 3R1IA 1LUAA 5IF3A 1A9YA 1QRRA 1WXDA 4HX5A 4B7UA 2C82A 2YFQA 2D2IA 1V0JA 2X9VA 4JNKA 1D7OA 5L7TA 4YJDA 4OXNA 4XQEA 1AHHA 1H9BA 4K6CA 1HF3A 4WCFA 5A9SA 4D7AA 4QO7A 4ND5A 1ZUD1 3ZV3A 5KCZA 5CPFA 3MTJA 4CQLB 4RO0A 4XWYA 4TKLA 3GDFA 1VRWA 1P0FA 3UW3A 4UEJA 5HM8A 2BELA 3IKTA 5ITVA 4FFNA 5U9CA 5FEUA 1T4DA 1ULSA 2HJSA 4J7UA 1GUYA 2WWRA 3ZWYA 2Q1TA 3ZW8A 1O95A 3LC1O 4GMGA 2EGHA 4I9HA 4P38A 5JFOA 4G81A 4XZ3A 3TZQA 3F9IA 4XCVA 4A73A 2DAPA 1X0XA 1M6WA 3SJUA 3ZDFA 4JROA 4OXYA 2VUUA 4D42A 3CIFA 4MVJH 2J5RA 4DRYA 1Y9EA 1LI4A 4EUEA 3P19A 2JCXA 5TT1A 1U28A 2VWHA 1ENPA 4NG5A 2FPGA 4FJ1A 1LLQA 3KXDA 4YRBA 4ZQBA 4DLBA 4KUGA 1K89A 4N7RA 3KV3O 4Y9DA 1W73A 1NVMB 4NQZA 1TT5A 3LSYA 4TMFA 3FSRA 4L76A 4UEKA 2Y1DA 3S2FA 1HEUA 4Z3DA 4RVSA 1EVYA 3GN2A 4PG6A 1XA0A 4ND1A 3GNQA 1AXGA 1EBFA 2EGGA 3PYMA 4CV3A 4J1TA 3OMLA 4BNNA 1K6JA 3BXXA 3ASVA 3MOGA 3HN2A 4E21A 1DDOA 1YWGO 2YV3A 3OJOA 4NR0A 3W1VA 1B8VA 1H93A 2NWQA 3ROQA 2J3JA 1I30A 3ICPA 1IZ9A 2GZ2A 4WKGA 4BNMA 3DBVO 4YR9A 4YB8A 4ND2A 3VPGA 2YHUA 1XCBA 3WYEA 2OBNA 3E9QA 1MGOA 5TS3A 1I2BA 3CMMA 3HZZA 4RDHA 3RKRA 4KOAA 4UVGA 5KKCA 1UDBA 4BNZA 3OICA 3L9WA 3GAFA 3RUEA 1ZMOA 5A9SB 3H3FA 4G2NA 4MVJI 3O8QA 3KOUA 4RPKA 3V2UA 2D3TA 2NV6A 4RPJA 1B8PA 4R5HA 1VJ0A 4KTVE 4WECA 1WPQA 2YDXA 4DPKA 5CEEA 1N7GA 4OGWA 4BNXA 5JE8A 2E48A 1UAGA 1C1DB 1KEWA 1IL0A 4UVEA 3DZIA 3PLNA 4LMRA 5AXAA 5JDIC 1YQDA 3NGLA 4TROA 2HMVA 2NVUB 3R3SA 1YBAA 4MDHA 2W2KB 3V1YA 3DZBA 2J3IA 1Q7GA 2RH4A 4CQMA 2OGUA 2CDCA 2UDPA 4H7PA 1ZSNA 5CDTA 3L6DA 5B37A 3G17A 5LC1A 1HDCA 3UOGA 4LRSB 4UVIA 4B7XA 2X0RA 2B37A 3RC2A 4CM3A 3JQGA 3WS7A 3ZV4A 3I4FA 2CFCA 3NJ4A 4IS3A 3PZRA 2X1HA 4GBJA 4BQPA 1XKQA 1JTVA 4J4HA 2DU8A 3LDHA 1DLIA 1I32A 5LDHA 1UR5A 2NU7A 3OF2A 1L7DA 4NHEA 4NPCA 5CDUA 4NH4A 2HRBA 1E1KA 1ZBQA 2IXBA 5JCJA 1PL6A 4MVJE 3GVIA 3ADOA 3GNSA 4Y6SA 1DIHA 2HK9A 3QWBA 1K6IA 1U9JA 1MG5A 2WJPA 5JAMA 2FZWA 1EVIA 1VJ1A 4J43A 5HS4A 2VOEA 3EDMA 2GN9A 1FXSA 4RQUA 2BFAA 3WGGA 2EF1A 3OIFA 2EV9A 3ABIA 1LNQA 2QYTA 3T4XA 4LSWA 5IZCC 3BTSA 3NYWA 3ULKA 1Y5MA 1PZGA 3F1LA 4Y8VA 3RQSA 4W99A 5EESA 2D1YA 5C7IO 3B20A 4IPTA 3ZWAA 1DRWA 5COBA 3U0BA 1GYPA 4D0SA 4FOOA 2YJZA 3W6UA 1UDAA 2X23A 1E7RA 3UHAA 3E5MA 4CMCA 5BNIA 5AXDA 2CDAA 3HE3A 1I3MA 2NTJA 4XYGA 3OETA 5T64A 1T2AA 3H6KA 2OOSA 3GZNB 1G0NA 1UJMA 3RC1A 2BLLA 1HLDA 2E4AA 2JAHA 1PJSA 1E7WA 4KWHA 1ZVMA 5EIOA 5EN4A 2AG8A 2GZ3A 3U5TA 2Y0DA 5JAZA 1BVUA 4WCDA 1AN9A 5IG2A 1XR3A 4IY1A 1QKIA 1NYTA 1VKNA 1Y8QA 4DIFA 1SC6A 5I8ZA 5TT0A 3AOEC 3UAGA 5L4LA 1ZEJA 3GVXA 2G76A 4E5MA 2I3GA 4AJPA 1JW9B 3STHA 3F4LA 1FDUA 1ZK3A 3G49A 4J91A 5B4VA 5JY1A 1X14A 4WNIA 4XA8A 1YBVA 1W6UA 1BRMA 4UUNA 4ZQEA 2OMEA 4K1LA 3Q1LA 4CMEA 1PQWA 2FN7A 2PGJA 3EC7A 4TZTA 1WLYA 3MZ0A 2Y68A 1LDBA 5FI5A 3WTCA 1Y6JA 4OH1A 4TVBA 2DVMA 5L7YA 5GZ3A 3H65A 5JSFA 5A1TA 1XDWA 5L9AA 1Z7BA 2UYYA 1HDGO 2G1UA 1XQ1A 3WBBA 2HSDA 1Y8RA 1R16A 4OOFA 5B1YA 5EINA 1NQAO 1CEQA 4XKJA 3R3JA 2Q2VA 1P1IA 2PD6A 4ND4A 1T26A 3PRJA 2RHRA 1GPDG 2P91A 3PPIA 3ZU2A 3RC9A 3T7EA 4W9NC 1O6ZA 3MCVA 4FGWA 1A9ZA 1R0LA 3GEDA 3GFBA 1B0AA 2FMUA 3JYLA 1DC5A 4OJNA 5COAA 3VZSA 4Z9XA 2Q49A 2ZJ0A 5ICMA 4HKTA 2EIHA 3AFNA 1E0DA 4LGVA 2C7VA 1I0ZA 1ZZEA 3LLSA 5G0VA 3UVEA 3ZHXA 3DMTC 2ZCUA 5F21A 3BIOA 3RUCA 2BKAA 1YBMA 3UUWA 4D41A 2QZZA 3HJAA 1Z75A 4H3VA 5CG2A 4M86A 1GUFA 1R66A 4NBTA 4UUOA 2TMDA 4CLEA 4XX0A 1IOLA 5DT9A 2Y1GA 3KSUA 3MTGA 3EZLA 1RYDA 4CLRA 3IOYA 3P2OA 1XEAA 1LC0A 4RJTA 5G4KB 1XG5A 3CZMA 4RPHA 3I83A 3JD4A 4RZHA 4RLSA 4EBFA 5JYDA 2NSDA 1YOVB 3RSHA 2IYOA 2HLPA 3QY9A 2YV2A 1GDHA 1T25A 4DL9A 3GFGA 2AMFA 4NJMA 3S2IA 1BTOA 4FN4A 4INAA 2QX7A 5CP8A 2GZ1A 3KSZO 1DXYA 1U1IA 3AOGA 3V5NA 2JHFA 5IZCA 1C0KA 4NK5A 3ENKA 4BGEA 3PHGA 3PJGA 3EK2A 5GY7A 2NVBA 3PDUA 1H2BA 2DPGA 4BNFA 4E31A 4NFYA 2GLXA 1N1GA 1NFFA 3TN7A 2DT5A 3AM5A 3I9OA 4BKUA 4CM8A 1JN0A 5L4SA 3RBXA 3UCFA 4YTEA 1EUDA 2FOIA 3KB6A 4RF4A 3D4PA 3VH4A 5JDCA 1U8FO 2J5QA 4U0JA 4WCFB 5ER9A 4U0KA 2V6BA 2CVZA 1E77A 4WLOA 5TNXA 4CM1A 3KTDA 1DIGA 4I5FA 4TRJA 4YWJA 1KC1A 3HFGA 4NU6A 5H81A 5F3RA 1PGNA 2PKQP 2VHXA 2YW9A 3ROMA 1TI7A 1J0XO 2C29D 3GPIA 2VYND 3BMCB 1BWSA 1DB3A 2IRWA 4Y98A 4WGGA 1MXHA 1EE2A 2PWZA 2VRBA 3W8FA 3GK3A 3OJLA 4CQLA 1NPTO 3Q2KA 3WLFA 4CLOA 4J16A 3OHSX 1JKJA 3MJSA 3DTTA 1PQUA 4NJMB 3NRCA 3L9XA 1PIWA 2Y1EA 3VKUA 4ZD6A 4RPGA 2DC1A 3E82A 3B1KA 2Y0CA 2Q45A 3AI2A 1NX6A 2VOJA 1A5ZA 1E3JA 3AFMA 2AEFA 4GI2A 4DC0A 1NR7A 4RVFA 4E5KA 3OQBA 3WYCA 1XU7A 2X9NA 4JBGA 3C7CB 5AXBA 2WEKA 4E12A 4Q3BA 4A2CA 4KTTE 1YE3A 2EKLA 3WR5A 3JCZA 3DBLB 1GCUA 4MIYA 5DNAA 1SEPA 1UP7A 5L4NA 3AUSA 2IE0A 2DUUA 1T4BA 2PH5A 2C59A 2JD0A 4W9NA 4M89A 3GHHA 4Y67A 4CV2A 4YT8A 3HADA 2BMAA 3VZRA 4OMUA 1M76A 1GD1O 1Z7EA 3BTOA 4EEXA 4BKQA 5JDIA 4TRRA 3BMCA 4CUZA 1DHTA 4YJGA 2CMDA 5A04A 2OZPA 4XYLA 4BKOA 5U4QA 3RUDA 4GLOA 5CEJA 3GMSA 5A9RA 2AHRA 4EUFA 2OFPA 3JQ9A 1ZO8A 1YXMA 3JD3A 2PK3A 4BO2A 5JAQA 1YGYA 2P9CA 1I8TA 1V35A 4N5NA 3NUGA 5G0SA 3KEQA 1KEPA 4TVOA 4CMBA 3UH1A 1XYGA 4BNLA 1CQJA 4BNWA 1BW9B 4WLUA 1W0CA 5H82A 2JHGA 2NADA 1OFGA 2Y1OA 5HBRA 4CV1A 4P8RA 1ZJYA 2F1KA 5TLSA 1KEVA 4I8XA 1TVEA 4XRGA 1VI2A 1X13A 3WIDA 2DBVO 5HTOA 1FF9A 2IZ0A 1SMKA 1VKOA 2P5UA 3L4SO 2JL1A 1NPYA 4JBIA 4TRMA 5AVOA 2HAEA 1UXIA 4ZHSA 5I9LA 4XR9A 3FNHA 3AK4A 3UGKA 1YRLA 4MKZA 2FP4A 4II3A 3X2FA 1Z6ZA 1OI7A 4GL4A 4E3ZA 5DOVA 5K0ZA 2Q3EA 4I08A 3E48A 3VVBA 1Z73A 1ADBA 1UP4A 1R37A 3OEYA 5T6BA 3S1LA 3ZZNA 1LSJA 3HB5X 1ENOA 1U2DA 4B4OA 1Q1NA 3BHMA 3GLQA 4JK3A 1WMBA 4XJTA 4ZN6A 5BSGA 1V3VA 4EZBA 2ZYGA 4D44A 4XDZA 5TRTA 3EUWA 2Q1SA 1GPJA 2X58A 4ONEA 3WQRA 2PZKA 1E7SA 1A27A 2DFDA 4WEQA 1WZEA 1BXZA 2R00C 4RPLA 5I9MA 3HDQA 5FFFA 2ZB8A 3JQBC 2YY7A 1IULA 4ZA2A 4BKPA 4QECA 3JV7A 3CH6A 4Q3NA 1U7HA 2P4QA 3WGTA 1GL3A 4N5MA 1OAAA 3O26A 4HFMA 3ZWXA 2CF5A 4CMGA 1KERA 2FSVA 3IS3A 4Q3DA 1D4FA 3DEYX 4XDYA 4W7HA 2W98A 4AG3A 1Y81A 4LCJA 3RASA 3ONDA 4JQCA 2BFPA 2OL4A 3DTYA 1WP4A 2YQ5A 2O7QA 3VPHA 1E5QA 4GH5A 3ST7A 4URFA 4CMKA 5L51A 2AQKA 4L73A 5BSFA 4BO5A 1E3EA 4R68A 3V8BA 3CMCO 2RCYA 1E6WA 1RPNA 1QYVA 1CWUA 5CHEA 2WYWA 4PLHA 1E5LA 3NX4A 5GZ6A 3ZN2A 4YXFA 4BQRA 1E92A 1N92A 5MGBA 3NTRA 1NVGA 1ZK2A 1P1FA 2GRAA 3EMKA 4GGOA 4ZICA 5BQFA 2OO5A 4TSKA 4TWRA 3W8EA 4E30A 4PLFA 4A5OA 2IZ1A 2ZCVA 1LSUA 1O8CA 2PNFA 4ZRMA 3ZH2A 3PQEA 4JLWA 3W4IA 2Y0EA 3D3WB 4BVAA 5TIIA 3I5MA 4JGBA 4DQVA 1EMDA 1SCUA 3F5SA 1ISFA 1VL0A 3IUPA 1LSOA 2C7GA 5CAEA 4J90A 4EJ0A 4S1VA 2HK8A 5A05A 1CQIA 3COSA 1MXFA 3ZWCA 2YDYA 1CYDA 1P45A 3H5AA 1FDVA 4IMPA 2GSDA 3JQAA 4E5PA 1LBEA 4I1IA 2O48X 4YEDA 2C2YA 3VDRA 5KJFA 5KNLA 1JWAB 2B35A 5THKA 1YB1A 2O3TA 3R0IA 3BZUA 4OM8A 4PZDA 3MJTA 2I67A 4ILKA 4U6QA 2JCYA 2NLOA 4YT5A 2DTXA 1VE9A 3DZGA 3VPSA 4IDDA 1RM5A 1X7HA 1UXGA 1MX3A 3EAGA 3MWDB 3RROA 1B7GO 1IPFA 3WGYA 1R4NB 1LTHR 5JBIA 2RBEA 4WLFA 3JQDA 1P74A 3Q0EA 2I5PO 5I7VA 3BMOA 1E6EA 2O23A 1JVSA 1HDXA 3UKOA 2PKRA 3MOIA 2BGMA 3BAZA 4GPD1 1O5IA 3RUIA 1SB8A 2LDXA 5CDSA 2GERA 2NM0A 2WE8A 4MVJF 2AQIA 4XRRA 3FD8A 4XIJA 2GPTA 2HU2A 4DYDA 4E6PA 2BFOA 1SEVA 1T2CA 4GWGA 3OFSA 5HA5A 1B26A 2C0CA 1ZH8A 3LLVA 4IGFA 3ROPA 2HJRA 3DHYA 3SX2A 1HDZA 1MP0A 3HHPA 4CM9A 6LDHA 2C5EA 2G0TA 1U4SA 4DPLA 2C54A 4K9DA 1AE1A 2OUIA 3QP9A 3MJEA 4R1TA 2ZTUA 1PSDA 1EQUA 4FC6A 4AJ4A 2EHDA 4YVFA 4XGKA 3JQCA 1N2SA 3CPSA 2BRUA 5BNTA 1BMDA 1ZKMA 2HO5A 1NWHA 1RKXA 3NDIA 4E2YA 4PLGA 1PZHA 3ZNPA 1H0KA 1ID1A 4AJOA 1I3LA 3FTPA 2DBZA 1A4UA 5COQA 1UZLA 3KYBA 3PHIA 5HWSA 3F46A 4WCFC 4GSLA 2NU9A 4F45A 5B12A 7ADHA 1DJQA 5FI3A 3INRA 4KWIA 4PLYA 3KETA 2VWGA 3FWZA 5KIAA 1C0IA 1JAXA 2P4HX 3SLKA 4QX6A 1C1XA 4J0EA 2E82A 1L7EA 2JFFA 5DCWA 3FRJA 2OXIA 1HLPA 4CJXA 4MVJM 1F8GA 5THQA 2Y1FA 4LMPA 1DFGA 1BGVA 2CNBA 1I3NA 3PEFA 3GT0A 3HB4X 5EPOA 3NTQA 4BMVA 2H63A 3QE3A 3WB9A 2DBQA 3AU8A 1U5CA 1MLDA 3QJ5A 3QV1A 4KQWA 5KVVA 1AXEA 1B3BA 1RWBA 3GQVA 4N5LA 5CG1A 3DXFA 1X1EA 4NNJA 1QV7A 1LSSA 2W2LA 4FGSA 2CD9A 2PGDA 5DBFA 1UZMA 3DBRA 5ER6A 3RVDA 4YYZA 3B70A 3A4VA 2AW5A 4YPOA 1IHYA 1YO6A 3EY4A 4GVXA 1E1MA 4AJJA 1NHWA 1NFRA 3PLRA 2O50A 2RIRA 4YQZA 2ZYAA 4IDBA 2O4CA 1H5QA 3JYQA 2P2SA 3M1AA 3P7MA 4KDEA 4Q3EA 1MUUA 1O0SA 4CM6A 1LLDA 1OC4A 2CY0A 4D46A 3FNEA 1H6CA 1GU7A 2NTNA 4Y6RA 3OJ0A 4EITA 1O94A 2D4AA 3ENNA 1A4IA 4HUJA 4RVHA 4B8ZA 1JWBB 3WWYA 5AQ1A 2GYYA 3QVSA 4GGPA 5KTKA 5G0UA 3BTVA 4IJUA 1WDLA 5HRUA 4NK4A 3KZVA 5J23A 5A06A 2O3JA 5TF4A 2GN6A 4U8GA 3AJRA 3D64A 2OBYA 3E6AA 3IJRA 3JQ8B 3PWKA 2GO1A 4P4LA 4BO9A 2V7PA 4HNHA 5ITWA 3F4BA 4ID9A 4CUJA 3KYDB 3Q9NA 4YRAA 5T57A 3RU7A 1NM5A 3O8QB 4LVUA 1PGPA 3VPXA 4J4TA 4PGFA 3AI3A 4U7WA 3DHNA 1HYEA 1YB4A 1B3RA 1EZ4A 2WE7A 2Y1CA 3V1TC 3WSWA 2GDZA 3G3EA 1BDMA 4IJVA 4BNIA 2VT3A 2QRKA 1YL7A 2HDHA 1Q0LA 1KEUA 3KO8A 4O1MA 3V2HA 2IEBA 4L0QA 1N1EA 1GZ3A 5LCXA 4GWKA 3LF2A 2J5KA 1I36A 1VL8A 1VM6A 2NU8A 2W2KA 3PQDA 4J1NA 4YJHA 3KYCA 3AM3A 3WWZA 1DBVO 1N8KA 2O3SA 9LDBA 1P1RA 3FCOA 1LLCA 1PJLA 3KM0A 1PJQA 2XPCA 3PHJA 1B16A 3GG2A 1TLTA 1KS9A 3W4JA 2B4QA 4MKXA 4BUCA 1PGJA 1ISMA 2BI8A 2FR0A 3V1UA 3JQFA 4GQAA 3B1FA 3D3EA 3JYNA 1VPDA 1BXGB 1WNTA 3H9JA 2GUGA 2WDZA 2YHIB 2D59A 4Q39A 5TC4A 3TZKA 5I8WA 4E5NA 3GVCA 4OQYA 1ULUA 1LX6A 4J49A 3ZWPA 3TL3A 3ITKA 3OIDA 2VHYA 1B8UA 4YT2A 3HFSA 3WX0A 3SC6A 5JXWA 3OECA 2I6TA 4L4XA 1WMAA 3K92A 3TOZA 3QVOA 2E37A 4IUYA 2NU6A 3ETGA 4CQMD 3I4CA 3OJFA 4X54A 5C7OO 1UAYA 1M67A 1GZ6A 3LF1A 1SBYA 3WIEA 4ESOA 3WGQA 5I7EA 4DIBA 1R6DA 3H7AA 4II2A 3SC4A 3DAFA 3NAQA 2JFGA 4PLZA 3ZWWA 3IKVA 1U3UA 3GEMA 3OA2A 4QQRA 2DBRA 1Z82A 4E2XA 4R9RA 4FBGA 1FMCA 2GN4A 4E13A 3W4KA 4O59O 1I3KA 1H9AA 1LDNA 1NR1A 4OL9A 1ONPA 3GEGA 2B83A 1J4AA 2XF8A 3UICA 5TJHA 2W4QA 3F47A 3IJPA 1V9LA 2GNAA 1ZXLA 3CXRA 4BO4A 4DPMA 4O63O 3LT2A 1IPEA 1EFKA 2GASA 3NJ8A 3WXBA 4E4YA 5A03A 3GG9A 1ONNA 4IZIA 1N5DA 4WK6A 3N74A 4AJKA 3LT4A 5ILGA 3C24A 3WG9A 4PCVA 3OBBA 3PFFA 3KRTA 4O5OA 3DAGA 5A5EA 4QFDA 3WICA 3TZ6A 3HQ4O 4ALKA 3PWSA 5A9TA 5TX7A 4DBVO 2PR2A 5C3MA 2Y05A 4IDCA 2GD1O 1S7CA 2EKPA 4L8VA 5KJEA 3GY0A 2O4UX 3DHEA 4ZU3A 3D1LA 3KYCB 5AYVA 1PJ3A 2PY6A 4L4RA 1T1SA 3QSGA 4BNKA 5L95A 1P1HA 4FIZA 2CF6A 1GQ2A 1UDCA 4IMRA 2UUOA 4FOSA 2QW8A 3DZHA 4UVHA 3RKUA 2C07A 1XQ6A 3DL2A 1R4MA 2VNSA 4M55A 4CM5A 2SCUA 2F00A 3M6IA 1DEHA 4IQ8A 4PIVA 4QTZA 1CJCA 1DSSG 4CMIB 2D5AA 1NXQA 2I65A 3DR3A 4PLTA 5EERA 3OIGA 4W6ZA 4BL5A 5T67A 3AU9A 5C5IA 1DRUA 1KOLA 1VSVA 5LDGA 1WZIA 3ANLA 1CDOA 3QHAA 4J3FA 4EI2A 4L75A 4TRNA 4E33A 5B4UA 1PWZA 3INGA 3FTNA 2VHWA 4L74A 3JQAB 3JD0A 4FPXA 1GFSA 3ZU5A 4CLRB 1AUPA 2AEMA 1GYQA 4BMSA 2VTDA 3VTFA 1EUZA 3PK0A 1L1FA 3E18A 3WDSA 2PH3A 5IN4A 3WQSB 4J0FA 2PZLA 3L0DA 3VAZA 3RFVA 4QO8A 4WLEA 1VL6A 4QFCA 5BT9A 2IZZA 3CINA 4B3IA 4BO6A 3M2TA 3VKVA 3SBOA 1VJTA 2ZB3A 2O3QA 4MJLA 4C7JA 1P1JA 2WD8A 3U4HA 2H5LA 3CEAA 3HSKA 1Y7TA 4C7KA 3JSAA 4LCEA 4QT0A 3E9NA 4NBRA 5JO9A 4N18A 3GDGA 3S2GA 1GTMA 1K3TA 2NVUA 4RVUA 3FR7A 2ZTVA 3ZWVA 3WMXA 1O89A 1GAEO 1UUFA 2Z95A 5MDHA 1ISIA 2V6MA 3IAHA 3GHYA 3OQ6A 3D5TA 4LVCA 3I3OA 3F5QA 4B8WA 3BA1A 3H5NA 2HK7A 5IDYA 3GPDG 4AJ1A 3JQGB 2AG5A 3KVOA 3OJEA 5G0WA 1P31A 5FYDA 3DZKA 2Q46A 2C5AA 1PTJA 2OORA 1HXHA 2WMDA 4RL6A 2UAGA 1F0YA 4ROSA 5JC8A 1R0SA 4EYEA 4F6LA 1FDWA 1JAYA 2VTEA 2IDZA 1LEHA 1IY8A 4NBUA 4BS9A 1I10A 4DYVA 2BD0A 3ZI0A 2X6TA 3PGJA 1CIVA 7MDHA 2VQ3A 1LU9A 2BHLA 3V2GA 1GR0A 1U4OA 4W4TA 3UFXA 3OA0A 5EMHA 1C1XB 3HN7A 3IDSA 1PGQA 2DLDA 3UCXA 4BKRA 3DBHA 1YQGA 3NT4A 3DONA 1Y8RB 3K73O 1DAPA 1QYCA 1T1RA 2AA3A 4KP7A 2JD2A 3KLPX 1N9GA 1QYWA 1PU2A 3GZNA 1CERA 3ETDA 3U3XA 1PGOA 2D8AA 4YT4A 4ALNA 2CUKA 2E6UX 3AOEA 3VDQA 3QIVA 1Y5RA 1Q7CA 4JBHA 3K9QO 2DFVA 4R41A 4P4NA 2VYNA 4P4GA 1I2ZA 4CLDA 1H6DA 4CMEC 5IZ4A 4A03A 4K26A 4XB2A 5AXCA 2NVWA 4HFNA 2A92A 2IXAA 3E9MA 1PL8A 1HDOA 1QMGA 3L77A 1GQQA 4NZ9A 4KUEA 3S55A 1H6AA 1KIFA 4CM4B 4JJFA 4IJKA 1Z45A 4OKIA 5JYEA 2P9EA 1E3WA 1NWCA 4HFRA 2Q4BA 1O9BA 4BO3A 2BF7A 2O2SA 2YFHA 2BH9A 1SOVA 2HMUA 5IXYA 4J2OA 4W82A 4BV9A 3B6ZA 4EW6A 3I9KA 5JW6A 1Q7BA 3A9WA 1HSZA 3BHIA 4S3MA 3AY6A 4WUVA 4AVYA 1SZJG 2EERA 2HRZA 3O4RA 3DBHB 2PD3A 2ZQYA 1E3LA 1MFPA 2D0IA 3CZRA 1HDRA 3INTA 1E3SA 3Q3CA 1EBUA 3LT0A 4PG8A 3VZQA 4PZCA 3PIIA 3EGOA 2X4GA 4DREA 2O3UA 2OHXA 4Y6PA 3UF0A 4Q9NA 3WMWA 1E3IA 3ZV5A 3JQFC 3OEWA 5G2OA 2JFHA 3O38A 4ZQGA 2AE1A 4DBZA 3ZV6A 3WLEA 4EJ6A 5A3JA 2B36A 4IM7A 4Z0PA 4YAIA 4YJFB 1IUKA 1DJNA 2Q2WA 1ZNQO 1C14A 3E5RA 1XWFA 1Z74A 1TEHA 1YOVA 2EWMA 2YYYA 2ET6A 3DBRB 1LQUA 3ZNOA 1TT7A 1OC2A 3GRPA 5BNFA 2IEDA 1TXGA 3L4BA 5DBGA 1CRWG 1ISGA 1YDEA 4CV0A 3FNFA 3UN1A 1MFZA 4YCAA 3ZWMA 1RM0A 2P68A 4NDNE 3AWDA 2FRDA 1XSEA 5I7SA 1PZEA 3KYDA 3W6ZA 3QQPA 3EVNA 3WGHA 1E7YA 1KETA 3JQ8A 1GEEA 1UXJA 1QLJA 1NVTA 4I5DA 1J5PA 1XLTA 2NNLD 1LDMA 1P77A 3G0OA 2PKQO 2G17A 4RF2A 1G6KA 4YJHB 3TL2A 1A7KA 2PLAA 3C7DB 3DDNA 5I7FA 1I5RA 3FWNA 3CKYA 2B4RO 3GC6A 3HDHA 2B5WA 4CLHA 4Z3KA 1DC3A 5IDWA 4HBGA 5T8KC 1E1LA 1NFQA 3F3SA 4FR5A 3RWBA 4D43A 4AJIA 5JDCC 3ZWOA 3P2YA 3RUHA 2BI7A 1X0VA 1LA2A 3C1OA 1DIBA 2VUTA 4R69A 1U3WA 4RVDA 1GADO 3OQ1A 2O7SA 4OHUA 4FFOA 4J2HA 1BXGA 1G0OA 2UVDA 4E0BA 4R51A 4ZQFA 2DTDA 2ZK7A 1HE4A 1V3TA 3B1JA 3HNPA 3QWHA 4H16A 5KVQA 1NASA 3GMDA 5GMOA 3TJRA 3JQBA 4CLOB 3RCBA 3HG7A 4FSHA 4FDAA 1HZZA 4DMLA 1HKUA 2EJVA 3TZHA 5KWEA 4Z6KA 4FJ0A 1LRKA 5CDYA 3JQ6A 1I24A 4PZEA 4CL3A 5CDGA 3WNQA 2HCTA 1BSVA 1BHSA 4BB6A 3ANNA 4OKNA 4WEOA 4BO8A 1LC3A 5EL0A 3GH3A 4IDEA 2YQ4A 3IL2A 5ILOA 2Z1NA 3R6DA 4ALMA 1IB6A 3RJ5A 1AGNA 1FDSA 4Z9YA 4E5YA 2DTEA 4EUHA 2Q99A 1U7TA 4WJZA 1TB4A 5HS6A 3ZCXA 4BNJA 4IINA 1PJ4A 3M1LA 3GUCA 4J1QA 1OBFO 4HFJA 1C1DA 1GUZA 4M49A 4J7XA 3F6YA 4R1SA 4C4OA 1YONA 1YL6A 4IBOA 1PS9A 4RZIA 4CODB 5JMPA 3GDOA 1DRVA 1LLUA 5KVSA 3WGZA 4DIOA 3PWZA 5L53A 4JJGA 3AM4A 3RU9A 3BMNA 4AJNA 2QG4A 4D3FA 4B4VA 5IFLA 1ENYA 3Q6IA 3PJFA 4A10A 4YAEA 1OZAA 2G82A 3QA9A 5BSEA 4E2WA 4QUKA 3NGXA 2B0JA 2GCGA 3I9MA 3JTMA 3SJ7A 4GKBA 2V6GA 1KBZA 3DAPA 2LDBA 3RD5A 5CEFA 4NJOA 1U3TA 3QW2A 5JMWA 1XIVA 1YL5A 3A06A 4I9UA 3RFTA 2QQ5A 2FR1A 4XYEA 3ZGYA 5F5NA 1HWYA 5KKAA 4PRKA 1GYRA 1P33A 5IDXA 3JQ9C 5DN9A 4B3HA 3I23A 3KBOA 3RBVA 5A02A 1PJCA 3QLJA 2OP1A 3ITDA 4CPDA 3AI1A 3NTOA 4HP8A 2VHZA 4R3WA 3FR8A 4RLHA 4NU5A 2XXBA 4NMHA 1NPDA 4KDFA 3L4BC 4D79A 3G1UA 4CR8A 3FN4A 4WPGA 4ITUA 2VCYA 5C7LO 4WE3A 1C0PA 1R4NA 1I2CA 3I9NA 3K5PA 2JKVA 1V6AA 4BOYA 1GV0A 3EHEA 2NTVA 4KMSA 4GX0A 3C1AA 3PJDA 4GAEA 4XQCA 2W90A 1I01A 1RJWA 5JCXA 2FWMX 4CMIA 2DKNA 3D4OA 2JJYA 5F1PA 1G1AA 1N7HA 4AJHA 4BV8A 4D0RA 3DOCA 2A4KA 1R4MB 3ZU3A 1EDOA 2VHVA 3K2BA 2WD7B 4PN3A 1BW9A 4E2ZA 1DFHA 5FWNA 4MVJP 3ASUA 1K2WA 3GUYA 3NKLA 3H9UA 4MPDA 4U6SA 5T8KA 3P5SA 1YB5A 4ND3A 4XYBA 4D3SA 1ZW1A 2Z1MA 4CMHA 1F12A 2R6JA 3BMNB 1PR3A 3ADPA 4Q3AA 3GGGA 4BGUA 1DIAA 3K30A 3QVXA 2HMSA 2VNAA 4IZHA 4HV4A 4FFMA 2D5CA 4OYRA 2I99A 3NT2A 3GAZA 1ORRA 1EFLA 1TT5B 4BMNA 4KUHA 4OOEA 3LK7A 3LC2O 1YVEI 3LYLA 3ZHBA 3VH1A 2FR8A 3E1KA 3D0OA 5DOZA 1WVGA 4R3NA 4R01A 3RUFA 2EP5A 2HUNA 1P1KA 2VYVD 2CVOA 3BMQA 4PVDA 4ZRNA 1SO8A 2GGSA 3TWOA 5TGDA 4WOKA 4GVLA 1D8AA 1DIRA 3ANMA 3DOOA 4RDIA 2EKQA 4WOJA 4IDGA 3WBFA 3DWFA 2C2XA 2EEZA 3PXXA 4ZVVA 2PZMA 1NQTA 3NDJA 4EEZA 1JA9A 2EW8A 5KJ1A 1DHRA 1LRLA 2DPHA 4MKRA 3NDRA 4UVDA 2HMTA 5KVCA 5JNLA 2Y67A 2FPIA 1KVTA 4HXYA 1JU9A 3F1KA 1BG6A 1PJ2A 3DQPA 4J7CA 4NBWA 1EE9A 4FCCA 1PS8A 3DO5A 2CSUA 3U4CA 2JD1A 4YRDA 1NBOA 1K5HA 1NAIA 1WAMA 4LISA 4IQGA 1TA4A 3PZBA 4DMMA 3WQQA 1OMOA 2VRCA 4KZPA 4M8SA 5IN5A 3VZPA 3G1TA 1M6HA 1SNYA 1YKFA 5ICSA 4QEDA 2X0JA 4OAQA 3TSCA 1UH5A 2ZYDA 3DMTA 2WM3A 3H2SA 2X5JO 1HYHA 4AJEA 2OP0A 5KOIA 2DUWA 4BNGA 3GVHA 3SEFA 1P9LA 3D7LA 3EZYA 4TKMA 4GLLA 2FHSA 3FHLA 3RC7A 2ZB4A 2UV8A 1ZMTA 2GN8A 1N9GB 2DM6A 1NQ5A 1T2FA 3CTMA 3H9EO 3H9QA 4Q3CA 4EJMA 1HE5A 3GGPA 1PWXA 4BO1A 4MVJG 2AQHA 5BSHA 3FBTA 2I66A 1PL7A 4CL8A 4CM8B 4QSMA 1MA0A 1NNUA 1NTOA 1SAYA 1E3WB 2V65A 3FPLA 2VZ8A 4BNUA 2P9GA 5FF9A 1U5AA 1K0UA 3E03A 3PHLA 3BTUA 4XGIA 1ZK1A 4R4JA 3ZNQA 2W2LD 4CMAA 3K6JA 2YZ7A 4PLCA 5KJCA 3JQEA 1MC4A 4O6VA 4CR6A 3CSDA 3BMQB 1E6UA 1H6BA 3K96A 2EP7A 4W7IA 2B5VA 3ONFA 1P44A 2Y66A 5JO0A 5F1OA 5JLAA 3JQAD 1V8BA 1C0LA 1K6XA 1ISHA 1UXKA 2Y99A 4J9UE 3TFQA 5DBIA 2B4TO 1A71A 2AQ8A 2PGLA 4E32A 1PS0A 4J4BA 1VC2A 3AY7A 4PLVA 1PJTA 1IHXA 3C3XA 1Q0QA 3UCEA 3PQFA 2VT2A 3DZFA 4HNGA 4U5QA 4ZQHA 1MB4A 3U9LA 3LVFO 3AW9A 4AICA 3DOJA 5BR7A 3TFOA 2B69A 4MOWA 4BNTA 1F8FA 3U4DA 1M66A 3H3JA 5JC1A 2NQ8A 2E49A 1EQ2A 3EW7A 4MIEA 2X0NA 3LC7O 3OP4A 2QIOA 4YA6A 1LXCA 1SPXA 2FPPA 4IDAA 5ENVA 3C7AA 4FFRA 3QRWA 3IUSA 2EJWA 4PVCA 2Z5LA 3GRKA 4H15A 5DF1A 4GSKA 5U1PA 3WFIA 4BGIA 1DC6A 2P5YA 2A94A 1W4ZA 4EGFA 4R5MA 4CR7A 9LDTA 3ORFA 1B14A 4NI5A 3WNVA 3TF5A 4RF3A 1ZEMA 1ZFNA 5F5LA 1E7QA 3JD1A 4RCVA 3JD2A 4CLXA 4NIMA 1ZSVA 5KJ6A 1PQPA 3DB2A 1ARZA 1IE3A 1IYZA 4PLWA 2WYVA 1DLJA 4Z0HO 3WJAA 2PA3A 3FI9A 3TOXA 1T24A 2POQX 2PFGA 3IMFA 3O03A 2RAFA 1QYXA 5TSDA 1VSUA 1JVBA 4BNVA 1A72A 1A7AA 1YQXA 3PVZA 3ONEA 1XU9A 5TQVA 1Q0HA 1YJ8A 2ZJ1A 4MP6A 1BXKA 3DBLA 1ADGA 3QWFA 1EVJA 2VRCD 1RM3A 2VYVA 4K28A 5K6AA 2ILTA 1D1TA 4AJLA 3AUTA 2Q4EA 4DA9A 5K9ZA 2XAAA 4LRTB 4JP3A 1M75A 4AFNA 3L6OO 3ZU4A 4RV9A 4CUKA 1DFIA 2HQ1A 3GA0A 3I52A 1MV8A 1I33A 4LK3A 4DUPA 3SVTA 1B2LA 4OSOA 3A28A 1EVZA 3PYXA 3WOHA 3ZHZA 1R15A 3KLMX 4A0SA 1FJHA 3VPFA 3KHUA 2I76A 4FQ8A 3H9GA 1X15A 3NT5A 1UXHA 3A14A 3WYBA 4BIIA 4M87A 1VLLA 2Q1UA 1QYDA 2XOXA 1Q2XA 1GY8A 3T4EA 2J3KA 4UAGA 1DAOA 3H8VA 3K8ZA 1QORA 1EEHA 1H94A 2G5CA 4GKVA 1GEGA 1NQOA 3WTBA 5B4TA 4PRLA 2H9IA 3S2EA 2VN8A 5CFZA 2WTBA 3L6EA 1JQBA 3QWAA 4CM7A 1EK5A 4GX2A 4HY3A 4PG4A 1LQTA 1NAHA 4WASA 3MEQA 1ZK0A 4IS2A 3M2PA 3RBZA 4MINA 3VH3A 3PGXA 3HDJA 4NBVA 2IYPA 2R2GA 2HMWA 2WYUA 2VWPA 2NACA 5DCUA 4AJ2A 3VTZA 4B7CA 3RUAA 2X9GA 2YUTA 1LJ8A 2J8ZA 4JX8A 4YDRA 4FD3A 5IJZA 4JP2A 3ON5A 2I9PA 5G0TA 2WSBA 4IJWA 2XXJA 1X7DA 3LT1A 1PEDA 3SLGA 3QVTA 5AOVA 3I6QA 3MJVA 4NFHA 3DFUA 4ALLA 3IC5A 5DZSA 2UUPA 2ZTMA 1F06A 5ES3A 1PZFA 4JXKA 4XD2A 1R12A 1KVQA 1WW8A 3VH2A 2PZJA 1HTBA 1U2GA 1NHGA 4PFJA 6ADHA 3NEPX 4A27A 5JAIA 3ROKA 3S8MA 4RF5A 1GZ4A 3IP3A 2BGLA 3NV9A 3PP8A 3LU1A 3C1TA 4FJ2A 1Y9AA 4LSMA 1UP6A 3RJ9A 3DC2A 1X1TA 2CDBA 1SOWA 1MG0A 1P3DA 1ENZA 1T2DA 4JCOA 4XJSA 1EUCA 4A7PA 1LDEA 5A5FA 3ZNNA 4FFLA 5L45A 4QXMA 8ADHA 4UEOA 3MJCA 3QWIA 4YAGA 1BDBA 3D3WA 4WNCA 1F17A 3AUUA 1T2EA 4YACA 4XR4A 3BHJA 4MVJD 4JJIA 4XYMA 2RHCA 4UREA 1QG6A 1QV6A 4TZKA 4FS3A 3BYZA 3CE6A 1E7MA 4K6FA 3FBGA 4YJFA 1PR9A 4B4WA 3VHRA 1GQYA 1HSOA 1KVSA 1PJBA 1NP3A 4XIYA 4XQ9A 2WD7A 4DQUA 4D3DA 4IIUA 4IGEA 3TDKA 3GF4A 3GZ4A 4CQMB 1LDYA 1S6YA 2YHIA 1R0KA 5EQFA 1QP8A 2BFMA 5K6AC 5JY6A 1U3VA 1DO8A 1QLHA 3OM9A 3PDJA 5IDQA 5G4LA 2EXXA 2TMGA 3X2EA 4YBZA 1QSGA 3EVTA 1XHLA 4DLLA 5TJ9A 4RORA 4RGBA 3ZW9A 1HL3A 3OSUA 1HT0A 1YH3A 3PJEA 1W8DA 3U4IA 2EG9A 4R16A 3TZCA 3JYOA 4YJGB 1HRDA 4ALIA 4F46A 3K31A
chains in the Genus database with same CATH superfamily
2GF2A 2G6BA 3BGDA 4RM3A 3BFKA 3HBMA 4DQXA 1O96A 4JAVC 2PEYA 4Z99A 1TZMA 3JY6A 4G0QA 4B9EA 1QNLA 1U9IC 3IIEA 3H8SA 4KGZA 5BYKA 5EWJA 3K0AA 2JG3A 4J1TC 2XDQB 1E2LA 5IBQA 1WUIS 3HKDA 3A4MA 3NYQA 3GZTB 4MO9A 3V7WA 4GX1A 3RI3A 4FFPA 4DQKA 2BHRA 2FSSA 1PQYA 4JLAA 1F0KA 4LE2A 2DR2A 2VTBA 4NAUA 4P22A 4AWAA 4RQTA 2C20A 1SXPA 2PUHA 3G7SA 4G0NA 4N9QA 2W43A 1ZJZA 4YMHA 3OUTA 5E4TA 2R1TB 3LCJA 4MLPA 4UOEA 1N5LA 2WM9B 2QRMA 2AE2A 4DTIA 5GZ1A 5IKXA 4DLWA 1VGRA 3VR2A 1PLKA 4G5HA 2XCSB 3RAJA 1COWA 3FWKA 2RJ3A 1W47A 4KYVA 4LHXA 5CTAA 4BGVA 4EJSC 3AF0A 2ODPA 1QFZA 2ZB7A 5FH9A 1QXSA 5F1KA 5J2UA 3ZJTA 2NUAA 4RZUA 2IYNA 3GVPA 4R71A 4ZI7F 1ZSYA 1R4ZA 3QVMA 1SUFA 4OK3A 1IIRA 1Z34A 2MSKA 3I1JA 4O0LA 1VMAA 1N5MA 2MJLA 4HGOA 3FYSA 3IMCA 2PCJA 4PFKA 2JIMA 2I62A 1VCNA 1U8CB 2XVZA 3C8MA 5DHUA 3T7CA 1AHIA 4BU0A 4EB3A 4X8MA 1T2NA 4ZZ1A 3HXOA 3EYAA 3UOWA 2E85A 4BO0A 2XWQA 2DPXA 3KUDA 4Q47A 2RB4A 4XJXA 3SQMA 1FJXA 1Z15A 3J81k 1WULS 1KQGA 4QVKA 4G0WA 1UIRA 3AJ8A 5AK3A 4F60A 4D96A 4DR4B 1UBFA 3VVCA 4GX5A 1HYGA 2YFYA 1DCTA 1IZ0A 3WFJA 4GMFA 1JMYA 5ENZA 5LQAA 4DT1B 2ZIXB 3FDZA 3L6UA 1GSAA 4AS3A 2ZM5A 4WLNA 2ASVA 4PYNA 1G8JA 4JOCA 4QELA 1A69A 2XWPA 1Z6QA 4I3GA 4EYOA 4RD3A 4NCHA 1GCOA 2C99A 2VUSA 3OWOA 3PC8C 4NLLA 1LWNA 2ZRIA 5EJ6A 6CHYA 3DKRA 3EJWA 3SS9X 4DKXA 1P72A 1NU8A 4CM9D 2PD4A 3K6KA 3PYLA 3MXTA 1T0UA 1XELA 2RAPA 1ZXBA 1DAEA 5DHPA 1EBBA 4FMCF 1GGEA 1UZNA 3VSAA 4X66B 3UMYA 1H2HA 4B3JA 1YIDA 3DM9B 4G5OA 1LCIA 1TRKA 2LP4Y 3CU5A 1M6VA 1E1RA 2HY7A 3VC7A 3T1YB 3GEBA 4DXHA 3IAS1 4IILA 3S40A 4G65A 1C3VA 4PHGA 1M2WA 3UWPA 3AT1A 3UXEA 3L41A 2AX3A 4OO3A 1TF5A 3O0TA 1N6HA 1OXSC 4D4IA 4XEHA 3T95A 1C9JA 1N2CE 1RAGA 2OO5C 4FZJA 1TTTA 5AHXA 2AH5A 3M49A 1VYTA 1BH2A 3LNCA 3LUCA 1ACLA 1KJZA 3FKSA 3KELA 4KPUB 4NEGA 4TQGA 4U9IS 5DTMA 4AKTA 4HLUC 4R6XA 1ZCJA 3GLVA 1UJNA 3MMSA 3QEMB 4C7MA 1P4GA 4OJMX 3EWAA 3T35A 4WXYB 2XRFA 4K05A 3OQPA 4JENA 4MWGA 2QTMA 5IUKC 1E1NA 5ENDA 2HZBA 3T1NA 5IEJA 3HDYA 3K53A 3GJ4A 4JD5A 1KC3A 2NO9A 4JZKA 4B6JA 3AKCA 3WKEA 1Y89A 4QQNA 1OWLA 3EFOA 2BGTA 2ZKIA 4HWKA 4LHWA 3FI0A 2FN8A 3BJZA 4PPQA 5DULA 3I5XA 1U0BB 3THXA 1Z26A 3JRNA 3BWVA 3LQQA 3C85A 3HVRA 3ZVMA 1V5WA 4NYMQ 1L4MA 3IT3A 5LNK6 1WBBA 5JPIA 4BP1A 3QM1A 1OBCA 2R66A 1QG2A 4KQ2A 4BNYA 1M83A 2HHAA 4FB5A 2PN1A 4R2JA 1OI4A 3UBMA 1G1MA 1EK6A 2H16A 1S7GA 4UBMA 2HLDA 5AI9A 5JOQA 4D0LB 1T9CA 2P40A 2HU5A 2I3ZA 2J48A 4XWAA 2Y9MB 5F51A 1YDMA 3RFXA 3ZY4A 4ZK6A 1X7GA 1G8AA 5AW7A 5J3JA 3LOQA 4MP3A 1INLA 4Q9IA 2IHZA 3EYWA 3SF8A 1XJCA 3HFJA 1ONBA 4M0EA 4QC2A 4KHPB 3U3DA 2QZ9A 1NTRA 5JSQA 4DC1A 5DGDA 2F1RA 3QKUA 1NX9A 4BHTA 2Q6LA 2AF3C 4Q01A 5KYWA 3ZW7A 2XMGA 4PLPA 1TE2A 4LQLA 1X39A 1EZ1A 2H17A 2PPLA 3K5WA 4KE9A 3FJYA 3I9LA 1F8UA 3R75A 3OT1A 2ZATA 1T0PA 4EI8A 4IMJB 4XD7D 3ANSA 3WJ1A 1AS2A 2PMFA 1UMKA 2ZSJA 4U2DA 3ICWA 4F3KA 4DMCA 4IXDA 2Q2QA 1L7NA 2WYIA 2ZIFA 4AX4A 3HWSA 3JZIA 3A37A 4MUAA 2DWPA 2E3JA 2HH9A 4Z4QA 5BURA 4N48A 3O74A 3WGIA 4JDUA 3M5PA 1T29A 3QUTA 4HK4A 3N8GA 4O3MA 2P7IA 5D7NA 1BX0A 1KH1A 5BSMA 2OHHA 5F73A 1XDZA 3HJBA 5EQDA 2X1MA 4PG7A 4KACA 4TL8A 4KQXA 4LWOA 4S1NA 2QQFA 3JVDA 4PZ9A 4KXVA 2WWGA 3NBFA 3SFTA 2PSEA 2A84A 2RI1A 3IKJA 5A3QA 1L7MA 4IQ0A 3TM4A 2NQTA 4GZ5A 1V71A 2HHCA 2PYDA 5IF3A 4L8WB 4B7UA 3IALA 2TSYB 4WZBA 2JBHA 1NMXA 1I2MA 1W9MA 2X9VA 4HDOB 1YVRA 3NVKI 3F8WA 4OXNA 4YRKA 5ECWA 3F67A 1AHHA 2C58A 1ODLA 1SBNE 4K6CA 2BFCB 5GP1A 5HGXA 4WCFA 4FMPA 4OEHA 3IJEB 5A9SA 2AWNA 3W5BA 3S5JA 4QO7A 3N07A 4FUTA 4ND5A 5D3MB 1KZ6A 1QHXA 3BMXA 2PX4A 3DTVB 5CPFA 3SYTA 4RO0A 2ZGVA 1QZZA 3G2KA 2JLBA 3ELYA 3GDFA 1QVVA 1KEEA 2JC3A 1XZQA 1P0FA 3S4YA 4OY3A 1OAOA 3UW3A 5J4HA 1TM1E 3Q88A 2RJOA 4G4IA 4YGYA 4S0XA 3TKLA 1M34E 4FFNA 5U9CA 2CC2A 3BE4A 3RKSA 1ULSA 1WMSA 3WHIA 4LRYA 4DNFA 4EKEA 1P0IA 3IV9A 4J7UA 3DVQX 3N9IA 4OQ4A 3CURA 1QWOA 1RWXA 3F9CA 4P4SA 5CH5A 4LHZA 1P73A 2O20A 3ZW8A 2PUTA 4WUTA 4GNRA 2CL5A 1T5BA 1BCRB 5FUYA 3HP1A 3BXZA 4TXLA 3PDIA 1ZGGA 4Y30A 1M7BA 1KHHA 3SJUA 4JYZA 5AW8A 4TVOA 3ASYA 3HM2A 2FCAA 3LX5A 1KAEA 1G6OA 4QGGA 4V0QA 1Y4AE 3CIFA 1JJFA 3UK6A 4D42A 4DCGA 1HT3A 2Q7XA 2I03A 3P19A 2Z9CA 3PNBA 4B3DA 3IQFA 5FLYA 3ML1A 2XVAA 4M53A 2VWHA 4HMOA 4NG5A 3TLGB 2BEWB 3ZTTA 3VX3A 4YRBA 1V11B 2XGGA 3FY4A 1SQ5A 2WSMA 2EAUA 3G0DA 3PC7A 4DLBA 1MW8X 1H1TA 3H83A 1SHZA 5KKNB 4H17A 1Z8NA 4FHFA 1QC5B 2GI4A 2N1MA 2VLIA 3EGVA 5JZOA 3TDMA 3LL7A 3EGCA 1EVYA 3GN2A 4V3CA 3R9WA 1QIMA 4JI5B 3P20A 1DNPA 2ZR7A 1XA0A 4NBNA 4ND1A 3I4LA 3IRUA 4GR5A 4OPMA 4BBJA 4PICA 4CKWA 3B3JA 1I4EB 3R4CA 3C6ZA 1XZAA 1O94C 3C3BA 4O4IB 4RANA 3HN2A 4TLAA 2Q0SA 2OILA 4JEHA 1YWGO 5MFZA 3PR1A 2RJNA 3OJOA 1EUCB 3H2JA 3RNLA 4BFVA 3LVQE 5CCXA 3IQXA 1B8VA 1RIFA 2V96A 4DILA 1E2EA 2GILA 4KGDA 2DHDA 1EDBA 4A4DA 4LKRA 2GZ2A 2QE6A 4H7DA 4LF9B 3OC6A 3DPUA 2R96A 4K8RB 4ND2A 4X63A 5AIAA 1Z0FA 3VPGA 3WK8A 3ZS9A 1SUDA 3EMVA 2QD2A 3LFUA 4XGQA 3I05A 5TS3A 5F7OA 3CMMA 1XJ0A 1HR0B 4FHCA 3RKRA 4KOAA 4EA8A 3OICA 2Z5FA 1ZR2A 1N32B 3BERA 3RUEA 3OLQA 5KS2A 1XJ5A 2KE5A 5A9SB 4P7GA 5HF5A 1AB6A 2YFKA 4IG9A 3UUGA 3R3XA 3GP3A 4K46A 3SHWA 2I29A 5FBZA 3V2UA 2AW3A 1K3FA 5ESRA 5CH8A 3RS3A 1AK2A 1VJ0A 4KV7A 2RGGA 4DDWA 1JQ5A 4KR3A 3AUXA 2PPVA 1Z4KA 3L7YA 4DPKA 1KJQA 2NSYA 1JDSA 4GIBA 1N7GA 4OGWA 2OE2A 3OLXA 2AS0A 4G3XA 4Y2HA 2E48A 5F4ZA 2YBDA 1SCKA 4XLTA 1Z33A 5CB6A 3HL4A 2HLDD 2IXDA 3DZIA 3PLNA 1RLMA 4LMRA 1YQDA 3NGLA 3CRNA 2HMVA 4RM2A 4CKEA 3IURA 2E21A 3DYIA 3GFVA 2ZYUX 4QWWA 1YBAA 3IPAA 4MDHA 2H7CA 4OYLA 2B1QA 4URHA 1KAMA 2ICAA 2J3IA 3M6XA 2GZAA 5DBHX 2YJ3A 2Z8XA 2RH4A 1N6IA 4CQMA 2CDCA 4NXMB 1SHLA 2ZJ6A 2ZIAA 3Q85A 2AN1A 3ABOB 5IM5A 1CT9A 2ENUA 3G17A 5LC1A 3AJAA 4LRSB 1XRSB 5JATA 5G53C 4JI8B 2A9OA 1B4DA 2II6A 3JQGA 3H0CA 3HRIA 1WOMA 5EJEA 3WLSA 2Z08A 2CFCA 4UDOA 3VUFA 3OI7A 1LNZA 4S1PA 3GYGA 4GBJA 4ZDKA 4BQPA 1XKQA 1JTVA 3COZA 3LDHA 2W6NA 1DLIA 1B6SA 3T9EA 1Z7YA 4MLCA 1H2XA 2UXCB 4IXMA 3OF2A 4Y0NA 3GUZA 3HB1A 4NH4A 2HRBA 3TGWA 2GJKA 5A0TA 2WIBA 4LMAA 4DMRA 5DYYA 1QYRA 3NLLA 1GVNB 4MA5A 3BREA 1ULZA 4QOJA 3EXHA 3GPLA 1GTVA 3L7CA 2VNIA 3P32A 4E1AA 1MG5A 1Z29A 5JAMA 1EVIA 1Z6TA 5D01A 1DCKA 1VE1A 3HU2A 4GR4A 4YNBA 3UC5A 2TECE 2YHBA 3MC1A 4DV7B 1XMIA 2Z6QA 4FT4A 4MMZB 2YY6A 2WU8A 4WDQA 2HPZA 1PLLA 3TK1A 4CIAA 4I4IA 3ZGZA 1FXSA 1T1IA 5C80A 2B92A 3RODA 5KNDH 3QOFA 1ESNA 1FA9A 2M2IA 4Y0AA 3T4XA 4EX6A 5K6TA 4G36A 3T7RA 1JE0A 1SCDA 4YP1A 5FI1B 1WD5A 4LY9A 1PZGA 3THWB 3F1LA 2W2NA 3HKBA 3KVRA 4R40A 4KX5A 3RQSA 3TYXA 4W99A 3JYHA 2CV1A 2D1YA 2WFZA 5AKZA 1VFPA 4IPTA 3ZWAA 3AF2A 1EJ0A 4ND7A 2COKA 2OKCA 4FOOA 2YJZA 4OQMA 4N3GA 1SY7A 3E3OA 3R3YA 3O2JA 3UHAA 4X5OA 1T8UA 1TLFA 3EC1A 1RDFA 3UC9A 4CMCA 2CDAA 4UTOA 1I3MA 1U02A 2NTJA 1BAPA 3K05A 5T64A 3VHXA 4FKZA 3H6KA 3NEYA 3PSAA 2NZWA 2QM0A 4PBTA 1D5CA 2UVPB 2PCLA 3RC1A 4DM4A 1VP9A 4X1IA 5JR3A 2JAHA 1U1CA 1YJXA 2IOFK 5CFPA 1C1YA 2ZS8A 4U2FA 5EN4A 1RKUA 2AG8A 3A8TA 4PBSA 3P71T 3CUTA 4WCDA 1KEKA 1U0JA 1N5RA 1AMOA 4L02A 3CE9A 4NV0A 1FRZA 1U9ZA 3LHSA 2GSWA 5I8ZA 5K99A 5L4LA 5HBGA 4KH1A 4PCLA 1M5TA 1FDUA 1B0ZA 1C7QA 1YRHA 2C04A 1I6KA 2HCRA 2JEOA 2RGCA 1WU7A 1Z37A 3PUWA 1X14A 5ALTA 1IC6A 4WK0B 4DR6B 1O4WA 2CXXA 1YBVA 1GSHA 2HHLA 3H2YA 2Z04A 5CFOA 3FVTA 4G8CA 4GICA 5AVQA 4CF5A 4CMEA 3DMGA 1Z08A 2P65A 4DDKA 1WLYA 2FDXA 2WHPA 4AG5A 2WNHA 2VPPA 2IP2A 5FI5A 3WTCA 2CLCX 1OHHD 1W46A 3KJXA 4TVBA 4B6QA 2RGNA 5L7YA 3IHWA 3OCVA 4ES6A 2BGNA 2UYYA 3EZXA 4WWHA 1S2LA 4MI3A 4JV5B 2HSDA 3VI3B 1Z2NX 2A5LA 1SUPA 1FFXA 4NS1A 1CEQA 2XW6A 4PEVA 5J1TB 3SF0A 5CFRA 1S8FA 4OG2A 2FGJA 2HJ9A 2V3WA 4HBZA 2Z5GA 1TRHA 1UT5A 1G9XA 1FE8A 1I7PA 1O4VA 1SKQA 1NF3A 2P91A 5JHHB 2AFIE 1R6BX 1X7ZB 3AUKA 3DP7A 3I58A 2D5IA 4W9NC 5TF0A 4CIDA 4DLSA 2ZXFA 2BMFA 1VG0B 3LQ1A 1RXYA 2WKQA 1QCYA 3GEDA 4HLQB 1ONSA 4Z5XA 1F7UA 3JYLA 4OJNA 1CE8B 1Q1EA 4DIKA 3BSWA 4I3FA 3RYTC 2FXIA 3ESDA 3AFNA 1E0DA 1XD2B 1T5HX 2QX8A 1ZZEA 3LLSA 3QVGB 1T9DA 4HDMA 5FLEX 2PL3A 3M4XA 4PONA 3O4GA 4TTJA 3P8ZA 3F96A 4S05A 3H7IA 3U31A 1Q7TA 4TYQA 5EZ5A 1Z75A 3A6FA 1SG9A 2REXB 4U7TB 3SIWA 1NU6A 2BEVA 2P1ZA 2WT9A 5CG2A 5TMPA 2PS9A 1QBGA 1Y1KE 3DLTA 4Y2VA 1AXRA 1DX4A 4UUOA 4CZ2A 3ELDA 1NF8A 1RZ3A 1RLOA 1X1RA 4YI3A 2Y1GA 3BE8A 3B2EA 1FS4A 1EU1A 1RMYA 3MTGA 1TZJA 5C81A 3T3GA 4EPRA 3HTXA 3FTCA 4CCYB 3K8YA 5CGQB 1T36A 2FWAA 3A58B 3IOYA 3KQSA 5H9VA 1LC0A 4EG8A 4CLRA 1CY8A 1DKPA 4ZAWA 3U7HB 5F7ZA 3E2PA 3OLVA 2IUYA 2CXUA 2H2HA 4RPHA 1ZUHA 1P0MA 2FRDC 1E58A 3E3MA 3IXMA 3JD4A 4MUYA 1UJCA 1YQWA 3UB3A 1CIJA 2YZGA 4M0UA 5JSKA 2HLPA 2I2AA 1ULBA 1GDHA 3T5DA 1T25A 1YJCA 4DL9A 1ZM4A 2WG1A 4O2AA 1BTOA 2QX7A 2HXGA 3FYTA 3K0CA 4PU0A 1L5YA 1L4YA 3NETA 1DAMA 4PZLA 5DT2A 4GKKB 3NM6B 1B8NA 3LY5A 3B12A 5HIKA 2G04A 3LWDA 3BFXA 3VYVA 1ZH0A 2V97A 3TKAA 4KLRA 3PHGA 4BGEA 1V25A 3PJGA 1AA9A 1W4LA 2KYRA 5FBHA 3RVPA 4BNFA 3VOTA 1NQWA 1N1GA 1IN7A 3TN7A 5B6PA 4ERNA 3I9OA 3OEHD 4CM8A 1JN0A 5L4SA 1SU7A 1J1IA 2C1EA 4GI1A 3RBXA 3ZQKA 5A4FS 3TE7A 3L4KA 4MW9A 3MFQA 4REQA 1EUDA 1IM8A 5EY5B 1GL9B 2I7DA 3C6YA 2V6BA 1Z36A 1AMUA 1PZMA 1QGZA 4TV9F 5CT6A 4C3ZA 1BU8A 5KNDD 3MSCA 4IIXA 1U2ZA 3E22A 1KC1A 2I2WA 4NU6A 5H81A 3PD0A 2PKQP 2IPOA 3R74A 4XJVA 2GFHA 4C76A 1RJ9B 2XUIA 1ZICA 3VMFA 2I3BA 2YYSA 1PEAA 3AFIA 2H1LA 4FEAA 4S35A 1X9GA 1X92A 3BMCB 5DM1A 2J41A 2B1IA 2W2VA 4EL0A 4H7JA 4DWWA 5KYUA 1DB3A 1SWVA 3W1EA 4Z2AA 5AVUA 3BDVA 5TDHA 2SBTA 1GNPA 4NF2A 1OXVA 2X40A 3T9DA 1VE6A 3UMGA 2GTHA 2Q5LA 2O2EA 5IM4F 3NHJA 3DTVA 4JVOA 4PSKA 3OJLA 2VRNA 4RD1A 2VDWA 5I3ZA 3QTLA 3PC4A 5KOJA 2WUGA 4CLOA 1MRNA 2N46A 3O1IC 4MTLA 3DTTA 1PQUA 4NJMB 3G13A 4ETMA 5JNWA 3PPWA 4BFZA 5ECDA 1XD2A 1NRWA 2MSLA 2HREA 4YLGA 4K81B 3BRQA 1U63A 5JFTA 4H3SA 4ODIA 4LY0A 3AFMA 3CF6R 4G84A 4JBWA 4C0BA 2AEFA 1KO8A 4DC0A 4EHJA 1XU7A 1CP2A 2X1LA 3MERA 4JBGA 3C7CB 1QVRA 4B2LA 2CZQA 4E12A 1GPWB 1SUSA 2P27A 4XIIA 1TYCA 3RVOA 2EKLA 3T3HA 3N2GB 1FU7A 1W4BA 2PT6A 4N65A 2XCUA 1H22A 5E1OA 1UP7A 1B6RA 2C4MA 1JHXA 2Q8QA 2PH5A 4HDRB 3QUBA 4M2LA 4Q4LA 4GGMX 5K3DA 3ZVLA 5FUQA 3STWA 5DXJA 1S8NA 3K2QA 2H08A 3OFVA 4TLEA 3RVSA 2BMAA 4DCCA 1HK7A 1OFUX 1VIYA 2D1TA 3VZRA 2GCNA 1A1VA 4BBAA 4K88A 4M4SA 4QXRA 1ZD1A 4V1CI 2PS0A 3IR7A 5K01A 4BKQA 4ZVSA 1JS1X 2RHGB 1NDQA 1KR5A 1SC4A 1DHTA 2YMPA 1NIJA 4PF1A 3RO7A 2CMDA 2Q9AA 3ESXA 3CCCA 4R9NA 3HDTA 5DX1A 5U4QA 3EVBA 2OD9A 4GLOA 3RUDA 1BS9A 4AXXA 3ZHQA 5JECA 5JFGA 1PNOA 3G2LA 3M3HA 2NAPA 5DTIA 4P0PB 1YC2A 4ENQA 1ZO8A 3TQFA 3RVLA 4QULA 3JD3A 1QP7A 1K7EB 3N2KA 1NXTA 3RIEA 1R0CA 1L7XA 4OLHA 1IOWA 1EFCA 4N8DA 4Q00A 1JIJA 1WSAA 3DT8A 4XB6B 3G5MA 1WCYA 2ZJYA 1YGYA 2C2ZA 3L8EA 2IS4A 5JXGA 1T1EA 3OHPA 3OESA 1MOPA 5TQ0A 2PUWA 2VT7A 3P0JA 4N5NA 3QYAA 1Z4LA 3FTDA 4N03A 4YRZA 4DA4A 1G20E 4L6AA 1PP4A 1GRQA 2WNIA 2IWHA 3UH1A 2ACEA 2R8ZA 2ZRFA 1CQJA 4UXIA 4BNLA 3CNEA 4KJXA 1W0CA 1CJSA 1SBZA 2HA0A 2I4OA 4FYHA 3S29A 1N5IA 1GLNA 4YAOA 5AKLA 4E5SA 1DEAA 1XTKA 1J97A 3D1VA 1RBQA 4GMDA 4RMGA 2FN3A 3JARA 4I8XA 4O2BB 1EK2A 1N2JA 1Q74A 2ODNA 4XRGA 5CB4F 1X13A 3O4IA 5M29A 2YXEA 1NVVR 4HN9A 4JVLA 2P5UA 3E0XA 3BGIA 3G6WA 2E55A 1JP7A 2F2TA 2ONCA 1DT5A 3A9UA 1CQPA 3WAGA 2HAEA 3GXBA 4K9MA 3FGNA 4ZP1A 1AIPA 4OHZA 5C46F 4Q1FA 2F8MA 1TOAA 5KTSA 4K40A 3KU4A 4BRZA 1TQ6A 2XBMA 4LRQA 4E3ZA 4OK6A 2H8GA 3H1FA 3VVBA 3W9SA 1Z73A 2AYZA 4YMIA 1UP4A 4YQEA 1EFVB 5T6BA 1RZRA 3TVYA 5HZGA 1ENOA 1U2DA 4K86A 1Q1NA 2PIDA 4JK3A 4HAIA 3PNYA 2VK4A 1AQYA 5DGXA 5IWCA 5KTOA 5E3JA 4LFBB 4CEJB 3GJ8A 4KLZA 4LOAA 4JIMA 1NUHA 3T9AA 2L18A 2Q1SA 3DDHA 1GPJA 4MDFA 2X58A 1HE1C 2O52A 4ONEA 3MLEA 3WQRA 2QYHA 2IEAA 2DFDA 2YOHA 4DAEA 4GPBA 1UEIA 4WEQA 4QGSA 1YRAA 2X13A 1BXZA 1MAVA 2XRYA 3B82A 1UBHS 2R00C 3GARA 3O1HB 1IMJA 2BFWA 2HV9A 2IEIA 3B53X 3HDQA 4KVZA 4R1OA 5AW1A 2VSFA 2ZB8A 1NSFA 3JQBC 2YY7A 1JHUA 2IXTA 3P2IA 4IDOA 4QGAA 5AVKA 4J94A 4BKPA 1KYZA 1NMSA 2FOLA 1CY1A 1HG1A 2B34A 1BQ4A 3H17A 1U7HA 5ED0A 3WGTA 3UK7A 3O26A 4IIEA 2WIDA 1YS6A 5AM4A 3EXFB 1I9CA 1OGJA 4EHFA 4TSFA 3HPQA 5EVJA 2WQ6A 2BE7A 2ID4A 3IS3A 3PCTA 4H1VA 2WB2A 2EG5A 3OQJA 4YAWA 3D8SA 3FJOA 2BTQA 3DEYX 1MW9X 4W7HA 5E9QA 5IFKA 2X76A 4J2TA 3A1DA 3ONDA 3RASA 4WT7A 5IJAA 3F0TA 3KPJA 4V03A 1MQ9A 5EJ7A 4LY3A 1T0JB 1Q17A 1WP4A 1RQ2A 2O7QA 3DG9A 4L1KA 4MICA 3ESZA 1V6SA 2FPIB 4PINA 4TL7A 5DFAA 4O4LB 1H2EA 3DULA 8ATCA 5A6SA 1XCMA 1M2OA 3O75A 4URFA 3NWJA 4ZT3A 3ST7A 4S1OA 2QBYA 4L73A 1Z06A 2WTEA 5DXFA 2CW5A 1YR7A 1YZNA 2GEUA 1NJSA 2WMNB 3DOHA 5EMKA 1QE0A 2ZRDA 1BEUB 4F9EA 1QYVA 1XZMA 1CWUA 2CFRA 2UZAA 5CHEA 5GZ6A 4KVGA 3EH2A 4YXFA 1IVSA 2QM3A 4AK9A 5MGBA 3NTRA 1A5AB 1ZK2A 2GRAA 2NT3A 3EMKA 4GGOA 4NSNA 1XTTA 5BQFA 1SUIA 4WZBE 3MJHA 3AR6A 4TS1A 4TSKA 2A1IA 4M9SA 2ONZA 1O8CA 2PNFA 2VVTA 5F23A 3PQEA 4YJ2B 4HLUA 4PPNA 4D0SA 1SG6A 1Y6QA 1A9QA 5EEHA 2DLNA 4YFYA 2FSHA 1QH0A 5B1SA 3D54D 3UHPA 5A5VA 3DDWA 2EL7A 3ELBA 4JGBA 2JGMA 4JOBA 3ND9A 5FUVA 2DSNA 3F5SA 1BWQA 3VKFA 4IG4A 5J2UF 4EUKA 1E0SA 1VL0A 1D03A 2XTAA 3HR4A 1ORTA 1XTUA 4HDSB 1M74A 3JVVA 3B9RA 2XE7A 2C7GA 5CAEA 2DYKA 1SA0A 4MUJA 4UCFA 4EJ0A 5EIFA 5KOHA 3CEHA 5A05A 2ZM6B 5AHRA 2W7TA 5H7XA 3VR5A 1KZHA 4WN9A 1DXQA 3COSA 1MXFA 2G7ZA 3PD1A 5DPMA 3ZWCA 2JIBA 3S81A 3CZAA 4DZTA 2BOVA 1IXZA 1YU9A 2AFRA 1AG9A 2DFKB 5DNYB 1Y8CA 5KJFA 1LBEA 4I1IA 2O48X 1JRLA 3TLJA 4TKUB 4DLKA 3BS4A 5CNIA 3BZUA 1RS0A 1CUXA 4XW2A 4RESA 3IPYA 2PX6A 3UHJA 2AB0A 4DHWA 3TAXA 1WPGA 4X6YA 4ILKA 5J2TB 4EG3A 1B23P 4X1KB 1RYHA 1D2EA 1SBQA 2DTXA 2I2DA 1KO7A 3DD1A 3VPSA 5AUOB 4RKEA 3U4QB 1X7HA 1V8FA 1OKKA 4J0CA 2ID8A 2UZ1A 3L0YA 3MWDB 1W48A 2C03A 5F64A 4R2IA 5ALIA 1B7GO 2XUGA 1LTHR 5JBIA 3UMMA 2AR0A 3V8EA 3JQDA 1RHMA 3N6RA 4MV7A 1S5PA 3Q0EA 3WP0A 2JKZA 1AS3A 4ER3A 2I80A 4G4SP 5DEOA 1JVSA 1HDXA 1K0FA 3MOIA 1NM5C 2A86A 3R7AA 1O5IA 3RUIA 1O95D 2LDXA 1E4YA 1WLSA 3NHMA 1GJRA 1LWOA 1K9SA 2WE8A 4IGAA 3FD8A 4MVJF 4XRRA 2GPTA 4D74A 4JHLA 4DYDA 5AUPB 4E6PA 2BFOA 2PWBA 4RADA 1MEEA 4GWGA 3AF1A 3VVMA 3W6OA 2A78A 3PE4A 2C0CA 4OFWA 2OD2A 3PFIA 4FYJA 1G5TA 4R2HA 4RVCA 3V7FA 5B58C 1XPUA 3LPDA 3ELUA 1U4SA 1R9JA 3OEHA 2QVGA 5EJ9A 2XQKA 5BRJA 2OUIA 3MJEA 4ZVLA 5JAUA 1PSDA 4KR9A 4NOLA 2OCIA 2C3MA 4NQRA 4I6EA 1N2SA 2G36A 3CPSA 3GAMA 1VKHA 3CLTD 1H4SA 3ND5A 2JLRA 2BFEB 3ICOA 3U0VA 2YINC 3CBGA 2HO5A 1TFRA 1KJJA 4E08A 4I55A 2A1UA 3TW8A 3ZKWA 1PZHA 4LXIA 1ID1A 2H9YA 4DNPA 5K8VA 4NX2A 1NF9A 3FTPA 2EKDA 1T3SA 2XQJA 1GO2A 3WO1A 4GR9A 4PRYA 3UMJA 4DC9A 3QX8A 3GBPA 4F45A 1DAFA 2EBUA 2X0DA 4H31A 1AQLA 2AFHA 2OPBA 4RIGA 3INRA 1NN3A 4PLYA 5DTEA 1EESA 1QGED 3BH6A 3NHLA 3IEXA 3L7AA 2R86A 5TPZD 2QTVA 3SR0A 2XMDA 2PANA 4URXR 4J0EA 2J7PA 2JFFA 1JEQA 2W6CX 3PEYA 1WIWA 3PKZA 2QNBA 4H0NA 3CR7A 3WP1B 1HLPA 5ANRB 1MCZA 3ZTYA 4EKYA 2Q3CA 3OE1A 4LZOA 4MVJM 2HB6A 5THQA 3UQYS 4LMPA 1UQTA 2BEKA 1P7CA 2ZTSA 3P9RA 2FK7A 3OU2A 5LD2C 1ES9A 2PZBA 2XZTA 3NTQA 3NKVA 1K8ZB 2NQ2C 2V5VA 4BMVA 5LWHA 1Y3AA 1AM4D 4QLBA 3GLIB 1G3UA 5FTJA 2DBQA 4HYYA 4HNAB 4L7VA 1R5JA 2GN0A 3RVRA 4RMHA 4HH0A 4YLEA 4FHGA 4KQWA 4YV7A 5KVVA 5L8VA 4N5LA 1QH8B 4LYEA 1SKYB 1GKKA 3RJMA 3WWCA 7ABPA 3CGGA 2I7TA 2AG1A 1W581 5D86A 4FGSA 5ALQA 4BP9A 3LGAA 4EY3A 2G0AA 3Q3JB 1AX9A 1OQAA 4YYZA 1DG3A 5G3ZA 4JOSA 3A4VA 3K9NA 1KMHB 2FEAA 1D9XA 1IHUA 3O0DA 2BFFA 3E5HA 3OOWA 4TGLA 4YGXB 1NHWA 3CC8A 5I51A 5LQKA 2FKAA 3EEYA 3EIXA 4QBIA 1ANKA 2O50A 2XBLA 2OD7A 4BTVA 2G8NA 1JDBB 1NA5A 1WZCA 2O4CA 2XDWA 3JYQA 4UFNA 1KYTA 1AKVA 1AVTA 1NBEA 2N9UA 2OA0A 3S7ZA 1LLDA 1OC4A 1XZHA 1XZGA 3FOBA 2QVZX 2RHHA 1H6CA 2Y3IA 2PTHA 4R0VA 2NTNA 4AZ3B 3OJ0A 4QTTB 3IAEA 4DM7A 1O94A 3DQZA 1DI0A 1GUBA 3ENNA 3ORRA 3FIJA 4RVHA 4B8ZA 3D9QX 3HKCA 4TV8A 1JWBB 5AQ1A 4D99A 1USUA 4GGPA 5K20A 2MR6A 4MS4B 4DJJA 1I0LA 2FOXA 2ZBEA 1VKZA 4FBMA 3DAHA 5TF4A 2GN6A 3PGMA 3AJRA 3D64A 3IJRA 3JQ8B 3F74A 2DHCA 1Z39A 3C98A 2V7PA 4URVR 1QAMA 4GXNA 4ZAFA 4RABA 4DSAA 2DMRA 4TMVA 3BWYA 2RD2A 5K0FA 5T57A 1F4VA 3TQCA 2EFYA 3L7IA 2FFQA 1AKQA 3VBCA 3BICA 6NULA 3GPBA 1PGPA 2VQSA 2LIVA 2DSTA 3WMGA 1I1HA 3AI3A 3SKVA 4U7WA 2D13A 1IVYA 2GN2A 2HZ7A 3BE5A 1M9NA 5BXYA 1YB4A 2WYHA 2Y1CA 2WE7A 3DE7X 1E64A 2ODBA 1O87A 2O19A 4L0DA 2F1HA 3DLCA 1W96A 3NBZC 5CNJA 1BDMA 2OZKA 1ZWLA 3VR1A 5ALHA 3HC7A 2VT3A 2ATIA 4AUNA 1E5TA 3NQ41 4RTSA 1KEUA 1E2HA 3KO8A 4I19A 4NVRA 3TD9A 3V2HA 5K2MA 2IEBA 2ZYHA 3AWIA 4AAYA 2XCIA 4QQ8A 1I4WA 4L0QA 4RPIA 1N1EA 1SCAA 2IHVA 1UK7A 2ORED 2J5KA 3I76A 4KPEC 3LH5A 1A3CA 1I36A 1X8JA 1VM6A 1MN6A 2W2KA 3PQDA 2JI7A 3OIYA 3TBHA 1OGIA 5C9ZA 2W6JD 2WIJA 9LDBA 4X62B 2O3SA 4Y9UA 3CVYA 3FCOA 4F3NA 1PJLA 1GSOA 1PJQA 1P4HA 1JUDA 1U7DA 3KM0A 4HH4A 4B6SA 2W2OA 1J5EB 3I9V6 1RLUA 2LNDA 1SURA 1B16A 3W4JA 1TLTA 2B4QA 4MWBA 4BUCA 2BI8A 1F4LA 1ISMA 1ETUA 3LRTA 4X00A 5HCIA 4BVLA 5CLJA 2FR0A 2I34A 3IX7A 4F93B 3M7IA 2FW0A 3DGEC 1GL6A 3JYNA 4QGBA 4FKBA 4Y2GA 4N7JA 5LMCA 1U7UA 1XMJA 3N7AA 1VPDA 1V96A 2G4LA 3B6JA 3KTOA 4H6PA 4BLRA 4KIUA 2PE5A 2C3OA 3QPCA 3V4FA 1LV8A 4J3NA 5JI2E 2IYWA 1LX6A 2DFLA 2PWPA 3DW1X 3K15A 1T9GR 1PW7A 2P77A 3EZ2A 3OIDA 2VHYA 3C6MA 1Z5NA 3HFSA 1IJEA 4DSUA 5IRCD 3FPBA 4RIEA 2RHOA 4F97A 4R7GA 3V00A 6YASA 4O2BA 4N6NA 4X7BA 1KQPA 2PJDA 1SOUA 3AUFA 3M1YA 4OYHA 3B5JA 1E5VA 1X86B 4L3VA 2XZPA 3QVOA 1SWWA 2W42A 1MF7A 2NU6A 2ZE5A 2YYZA 3NKFA 1YDFA 1NKVA 3ETGA 1BE1A 4CQMD 4Q02A 3RSLA 4C6TA 2OBXA 3NB0A 2XEXA 3HV0A 4BMXA 1PR1A 3D6TB 4RH0A 3H1BA 1M67A 2FVYA 1AO0A 3IH5A 3BXOA 3LF1A 3VTAA 4FX5A 2CN1A 3D2LA 3WIEA 4F4IA 2B6HA 3DEAA 5I7EA 4DIBA 2BJVA 4M9RA 4JWKA 1N9KA 3SC4A 3OE5A 1NXPA 1X94A 3NBQA 1QLWA 2EDCA 2DG2A 4PLZA 2VP3A 1U3UA 3GEMA 3IKVA 1YU6A 4KYIB 2DBRA 3PR3A 2RE8A 2X2EA 4C08A 2E5LB 1O5OA 4FBGA 4KKVA 3RHFA 2J6BA 4CGYA 1SHTX 2EFEB 1FIUA 4DDMA 3O9MA 4O59O 3FXAA 3HEMA 1H9AA 3HFRA 2X3YA 3EFBA 3IVXA 2J3QA 4D5GA 3W2FA 4AY4A 3J7AC 1TYBE 2B83A 3GEGA 3Q7TA 1J4AA 1VYVA 2GCPA 4D3XA 3IJPA 4UCQA 2GBIA 3LFTA 2GNAA 2W2QA 1KFKB 1ZGAA 3CXRA 3IQWA 1THGA 4BO4A 4WXHA 3KQKA 1PV2A 5AM2A 5ITSA 1A9OA 1IPEA 2IYLD 5L3VA 3ZDQA 4E4YA 2VS1A 3LL4A 2ZIEA 4WK6A 3G85A 3N74A 3LT4A 3OCCA 5JTUA 3T9BA 4HPWA 5FT9A 1PLJA 3QTTA 5E6UB 3HQ4O 3R20A 3SNHA 4ALKA 1TIBA 1J8VA 3CPHA 4YP7A 1VOTA 3M70A 3CS3A 2P4UA 3DTNA 4JYCA 3RTCA 4QTYA 1X1DA 4M60A 3KE9A 3A0RB 4HZGA 1TEXA 1RLIA 2Y05A 3G0IA 4TLDA 2GD1O 1RHRA 2BP7A 2DOKA 3FW1A 3UAZA 5BQ5A 3GY0A 4GRIA 3U3OA 3DHEA 4MKHA 2XVYA 2ZI4A 1P8AA 5FA5A 2PY6A 1M2OB 3D59A 4RGVA 1N3BA 5L95A 3ZS8A 1E0KA 5FHRA 3MGKA 4FN5A 1UDCA 4AY6A 2HBRA 2ZRPA 3QKSB 4MQ4A 4ZODA 4DY4A 2CHEA 2VI5A 5EG5A 2P2YA 3PS9A 8ABPA 2QW8A 4PAOA 2GVDC 3G8YA 3E1SA 2MHCA 2VNKA 4IOJA 4UVHA 1U2QA 2YRFA 4WXEA 1Q2UA 2FHPA 1NVAA 5K05A 4CM5A 5HM6A 4M55A 4AMYA 1J09A 2L2QA 3D31A 1JG7A 3I2FA 4RK6A 1EUYA 4QPJC 1TCUA 4NU0A 4U7JA 4CF4A 1CJMA 4DCTA 4LGCA 4OBXA 2D5AA 1NXQA 2ECKA 2KLHA 3V6LA 4YRQA 5EERA 1LBIA 4PTLA 1NW3A 4L5YA 4QPDA 4BL5A 4QUGA 1FUUA 4PR0A 1TK3A 4A82A 2DERA 3OPYA 1VSVA 2ZPUA 4W5HA 3JASA 2PFSA 2WG2A 4RNDB 2O0JA 2X4DA 1WSDA 1EI9A 1JB9A 3DOEA 3QFSA 3VYTB 1GFSA 2WQZA 2JFQA 5EIWA 1TX4B 4PZPA 5IJ0A 1SC3A 2XD9A 3AEKB 4UDNA 4BMSA 3D0KA 3CUSA 3TLKA 1AKEA 5PNTA 5FJIA 3F3KA 2PAFA 1Z8FA 4PZUA 3PX7A 2BCJQ 2J9XB 3L0DA 4MGZR 4RHXA 3F6PA 3NDPA 2BV3A 5AJTA 3RFVA 1XVAA 3A3YA 1JPNA 2I6SA 2VJPA 2AV6A 2ZI7A 3FZGA 2O6HA 4JLBA 2ERCA 4I4TA 4B3IA 3HXTA 3COPA 3USZA 3M2TA 1YA8A 1W85B 3VKVA 3TNYA 6AT1A 2JFPA 4WZZA 3U44B 4LF7B 4C7JA 3RS8A 3UB2A 1P1JA 2WD8A 4I3HA 5K0GA 5CIYA 3NNNA 5EFZA 3L92A 1E1YA 1QHHA 3E9NA 4BLVA 5JO9A 4N18A 4MI1A 3TKYA 1GG8A 3GDGA 3A25A 1PFKA 3WLIA 1Y5LA 1LZLA 4WGFA 4C43A 1I6MA 4QRDA 4Y1FA 1RWMA 2XNHA 4WXRA 5JLJA 1CY6A 3WMXA 1O89A 3N8HA 3VU9B 2Z95A 2EJBA 3AERA 5MDHA 4Y2XA