2EW9A

Solution structure of apowln5-6
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
149
structure length
149
Chain Sequence
MAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHASLAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-transporting ATPase 2
publication title Structure of human Wilson protein domains 5 and 6 and their interplay with domain 4 and the copper chaperone HAH1 in copper uptake.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 33
structure length 149
sequence length 149
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ew9A01
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ew9A02
2LQ9A 4Q2LA 3HFKA 2PD1A 2XMVA 4Y2KA 1V3ZA 5T7LA 3T9NA 2AW0A 5KAKA 2RMLA 2BBEA 1JWWA 1X8DA 1Q4RA 2OD4A 2ZDPA 1S6UA 2EW9A 3LGNA 3HHLB 3HDSA 1ULRA 2OD6A 2FB0A 3FGVA 4DPOA 3UDCA 1GXUA 4HL9A 2ROPA 5T7LB 2CRLA 4A48A 2BYCA 1K0VA 2N4CA 1FD8A 3IWXA 3DXSX 3TNVA 4FNHA 2L3MA 1GXTA 3MZIA 2OMOA 1TR0A 2AJ1A 1FEEA 2HIQA 4HI1A 4HH0A 4QOTA 1SB6A 2W4CA 1IUJA 4OIXA 1YJVA 2OAUA 2W4PA 2XMTA 2RSQA 2OP5A 2W4DA 2JDJA 1Y3JA 4ZA1A 1S6OA 2KKHA 2GV1A 5A6WA 1TUVA 3TRGA 1YRXA 2N4DA 3VTIA 1OQ6A 1RJJA 5B0CA 2HQIA 1CC7A 4F67A 1R6YA 2GGPB 5A6PA 4A4JA 5IXUA 1U7LA 1YG0A 1VQSA 1N5TA 2K7KA 2K2PA 2QYCA 2IYGA 5B0DA 4OJHA 3GZ7A 1X0PA 2FTRA 2GA7A 1SI9A 2XMWA 1APSA 3BF4A 1X7VA 2RILA 3KG0A 2ACYA 1Q8LA 3E8OA 1P8GA 2N7YA 4ZOSA 1KQKA 1P6TA 2K7JA 3BGUA 5F0UA 4YDXA 1Y0HA 4DL0C 5B0FA 2HFNA 1VQYA 2GCFA 2HLUA 2XMMA 3BB5A 2K1RA 1FESA 2PGCA 3KKFA 3HHLD 2FHMA 2KT2A 3I9ZA 2QIFA 1LQ9A 1W2IA 1OPZA 2GFFA 3MCSA 5F0WA 4OJ3A 1YJTA 2FIUA 1URRA 2BJEA 2LQBA 2XMJA 2AP6A 4HI2A 3TOQA 5B09A 1QUPA 5B0BA 1N5SA 3KNGA 4HH1A 2ZDOA 1TL5A 2LDIA 2QLWA 2IYIA 3HHLC 4OJGA 3FMBA 3QGPA 1AW0A 1YJUA 1WD6A 1AFJA 2KYZA 4NL5A 3HHLA 2OKQA 5B0EA 2HFOA 4Y2IA 4U9RA 1CPZA 1Y9OA 2ROEA 1FE4A 1OQ3A 3BM7A 4A47A 2VV5A 1JK9B 1Q53A 3DCAA 4Y2MA 1MWZA 4OJ1A 2OFGX 1XBWA 2ROGA 5B0AA 4NPOA 2LXFA 5B08A 1OSDA 2VH7A 3BR8A 3CJKA 1AFIA 1CC8A 3KG1A 3LO3A 4DN9A 4Q2MA 2IFXA 2RU9A 1MWYA 2G9OA 3K7RA 2OFHX 3HX9A 3QMQA 1FVSA 3HF5A 1TZ0A 2ASYA 1Y3KA 2QLXA 3FRYA 1KVIA 4YEAA 2K1RB 3IWLA 2XMUA 4EFAC 1N5QA 2BJDA 2GGPA 5B0GA 2AJ0A 1YJRA 4FNIA 4A46A 1FVQA 3BDEA 1N5VA 3BN7A 1SQEA 1FE0A 3CJKB 2BUNA 2GO8A 2HLTA 2KT3A 5K9FA 1TL4A 2Q3PA 2XMKA 3WDOA 1KVJA 3LGMA 1Q8BA 3F44A
chains in the Genus database with same CATH superfamily
1S10A 2BKPA 1K44A 3TYTA 3PX0A 3HHDA 1LK5A 3QT5A 4DV2J 2CJQA 1KLMA 2D69A 3O8WA 1QAIA 4C4WA 1TL1A 2VG6A 3M2VA 4Z7CA 2W8KA 1DJ0A 1R0BG 1K8AT 1QTMA 1JLFA 1RK8A 3KXDA 3M32A 4ES2A 4LSZB 2AHOB 3KG4A 2QL5B 1NKBA 2C22A 2AX0A 1TAUA 5GAHI 3FQKA 5DZ7A 3M2UA 3BO4A 1U0HB 3W7BA 4A8OA 2ZH9A 3EXYA 2OFGX 4NPOA 3CJKA 4LSNB 4V19X 2MY7A 2ERRA 2XZTB 3BDPA 3KNAA 9RUBA 2W7PA 2FUG9 4NWBA 4O4GB 2BW7A 4M5KA 2PFDA 3J7YU 4W4MA 2MLYA 5KFZA 4RNFA 1WHYA 3TVYA 4JUZA 4DR2J 2HK3A 2GX8A 5T7LB 4DR5F 4P52A 1Q5VA 3VGUA 2DR5A 3ZZUA 3BO2A 2CPEA 1NPRA 1U1MA 4YFUA 4QWDA 3MM8B 9ATCB 3M6VA 1SI9A 2DBBA 3I32A 2FHOB 3TA1A 4DUZF 4Y2AA 3W61A 1B7YB 2HNDA 1U8WA 2F4VF 1JNRB 4F4KA 2Z2YB 2WK4A 4HI2A 1JXVA 4LVOP 1TKTA 2JRSA 1FJEB 3QNWB 4G1QA 3K5LA 4KSEB 4DFKA 2ROGA 2RKIA 2N3OA 4F02A 3M8WA 4R0EA 4CO5A 1HYSA 4KHPJ 3T41A 2V8HA 1UVMA 2AJ0A 2HAFA 4UQTA 3UVJA 2DHXA 3B54A 3ET6A 5KT2A 3KLVA 3AD9C 3EVMA 4ES3A 2QFIA 3K17A 3IGVA 2JEFA 2ZKTA 3CULA 3WIVA 1IWGA 3V2UC 1HW9A 3NS6A 2CFXA 4NRUA 2L48A 2LQJA 2XM3A 1OQ6A 5C7PA 4F67A 2DIVA 4NLRA 3GV5B 1OWXA 3VR1A 4JYAF 1S7IA 4PXCA 4ANCA 4ICLB 2UUBF 3TEGA 3JAMU 4B3MF 5HROA 1CJUA 1WI6A 2B9WA 5ADZA 4ANDA 1Y9OA 2MLXA 4JI4F 1NHUA 1AXQA 3R5CA 1I94F 4CYUA 2UU9F 2OFHX 3HKWA 4L75A 4F4YA 2E5JA 3H5UA 3W5YA 3V4IA 4EK2A 4IO1A 2AW0A 1U25A 1X4CA 4ZHRA 1SC1B 4G65A 1OO0B 1ULRA 3QT7A 3TWZA 4C6AA 4J9SA 2A3JA 1XNQF 4QBUA 3CWJA 1NK9A 3NOGA 4OZ1A 1W26A 2BJ7A 1LKZA 2CPFA 1S9GA 2I0XA 3SIPB 2HK2A 2NREA 5KFDA 4K5SA 3D3CJ 4NZ0A 2C2NA 4ZPTR 4ZCKA 4KHRA 2BQUA 1ZYQA 2QA4G 3HPOA 1I3OB 1D0EA 2PA3A 2DNNA 1NM2A 1O51A 2ZNZA 3Q89A 3NG8A 4ED6A 2GAGC 1L3KA 1RAJA 4QU7A 3UCGA 2ZJQQ 3TOQA 3IRXB 4JI3F 3CO0P 3TUZC 1DHMA 1TVRA 1T3NA 1FDNA 3IS9B 1EHWA 1GK8A 3IR6B 1MWQA 1HARA 3C6UA 4QPXA 3RRHA 4FYDA 2HRYA 2YH1A 2X3GA 5F8MA 1HNVA 2CQ3A 5C42A 1N88A 4C8MA 5ETOA 1NNDA 3KLEA 3IN5A 2CQ1A 3THVA 4RUAA 1V3ZA 4ZP7A 1VOMA 1YKWA 2B4OA 2FB0A 2VG5A 1H98A 2NUUG 2DJWA 5H9FK 2DGTA 4DR3F 4XPCA 3W64A 1I51B 1ELOA 2YX4A 3SCKE 4XAKA 5JMNA 5J2NA 1YRXA 5L46A 1IQTA 1R0AB 1UVIA 3LANA 4L74A 1F9HA 1IWAA 3VVUA 3E2EA 2GHPA 4IKAA 2GA7A 3KG0A 3BN4A 3H59A 3BKTA 2KZZA 2D74B 1T9VA 3CVKA 3U1MA 3G82B 3KNGA 5DETA 1OY8A 3OSPA 2KVQE 2X1GA 5EDWA 4O0IA 4EZ6A 3N5BA 1U48A 4RW7A 4RW6B 2W9BB 1XWLA 4X4UA 2HQGA 3K0JA 3HMJG 3J80U 4AL5A 1VQOS 2VB6A 1HIYA 2GIQA 1M1HA 3A12A 4Q2MA 2R8IA 2F65A 1VYAA 1RT5A 1WDTA 5KFXA 1GNKA 2XZWA 2DGUA 4OZJA 3TQ1A 3RB4A 5A0YA 3W65A 4MIBA 4FNHA 4ECVA 4B9SA 1GMVA 4NXNJ 3Q23A 3MMCB 2LEBA 2KFNA 1HKAA 3MCOA 4OYIA 3S7RA 3MTKA 4O23A 3ZZ0A 5HQLA 1FXRA 1VQPS 2KXHA 3NGKA 1LXNA 4WFAQ 3NGTA 4QWBA 5LJ5Y 4OI6A 3W1YC 5D3GA 1MMNA 4J9QA 3FDSA 3ADAC 1M5PC 2FJWA 1WOOA 5CQGA 2IJFA 4DQSA 4LF7J 1F2GA 5B09A 4RW9A 2XS5A 3D6MB 3GV7B 1KR4A 1Y4ZB 2DKOB 2WBMA 5CD4H 1HMVB 2Y8YA 5B0AA 4AL7A 1CS4A 3DRSB 3H5XA 3KLIB 1TP7A 2ADCA 3QAUA 1EARA 1VRTA 4NCGA 2XYGB 2EFOA 3N01A 4K5RA 2GVDA 2NSCA 3OBIA 2BJDA 4RBVA 5K9FA 4RU9A 2FVQA 3J7AN 4YS2A 3M30A 3T9NA 4F04B 4K4WA 1R8PA 4DV0F 1IBLJ 4I56A 4AQYJ 4ETXA 3A3PB 4NZ7A 4LR9A 4K59A 3CB4A 1X4GA 3DRXA 2OI2A 4Q5VA 2RQMA 2ZJRQ 2FJAB 3ZZPA 1X4FA 1FDBA 5B0CA 3ZC4A 3LUYA 5M2RA 2QA4S 1SJ1A 2I5JA 3CJSA 4DX5A 2FVPA 1LW0A 2B43A 2V4JB 1FTRA 4PQAA 4ZK7M 5BJRA 3ONQA 5HN0A 1H0HB 5GVQA 4DV6F 4B3RF 2LECA 2MKJA 2XMAA 4DF8A 1AB8A 4OJGA 2DXEA 4ZVUB 3NBPB 2ZITA 5CZXA 4K0KF 3L7PA 4DOZA 2HHSA 1H73A 3TVZA 3PX6A 2MEWA 1Y5IB 1JLEA 1KHWA 4YQWA 3GSIA 4AFFA 4M95A 3VQSA 1HQUB 1VHFA 2CQIA 2KG1A 4MIWA 4CO2A 1JLGA 2XEXA 3CCSS 3PEHA 2CJAA 4A46A 3Q2SC 3JQKA 2B7CB 2OPRB 4ER8A 2HLTA 2WB4A 3OTOJ 1REVA 2ZE2A 4C0BA 5E3AA 4ELVA 5HAOA 1KS2A 3TZYA 4RR5A 3PVXA 5D4LA 1HBMB 2MKSA 1XMOF 4ECWA 3BS9A 4OYZA 1RT7B 1QY7A 3RB3A 5F8IA 1S0OA 1WC4A 3H42A 4QWCA 5CABA 3ELHA 1V6HA 1KDNA 4BLGA 4CLKA 3GONA 3MMBB 4J9RA 1QTNB 2HS4A 4C97A 2EC0A 4F3MA 2NPFA 2G0CA 4U96A 1FFWB 2E5HA 3HVRA 1IKWB 2KYXA 3DRRA 4Y2IA 3BM7A 1HWUA 4XIUA 2KTQA 4J5OA 1LW2A 3KLHA 2UXBF 2M7SA 2MGZA 2YXLA 1R31A 3HHEA 2JJ4D 1VRQC 1FRLA 4PG7A 1KFSA 3GSDA 3U1NA 5DRKA 4YHHJ 3QZ8A 1EB0A 2BANB 5HVHA 1R43A 2HSEB 4GVBB 3OR1A 4WBFA 2ATCB 3UD4P 3I31A 2LFVA 4KYZA 2DT9A 2KU7A 2HZAA 1ICEB 3QLHB 3TRGA 2A1BA 1V5VA 2PSZA 3P6YC 4DJBA 1JX4A 2W24A 4DQPA 5I4MA 3MR3A 4IOCQ 5LOQA 1RXOB 2WW4A 5A8RB 4NX9A 4CO0A 3QSIA 3R1HA 2HWIA 2VOOA 1HFEL 4IRDA 2BRLA 2MXYA 1URNA 2HBZB 3PX4A 2R7VA 3B82A 3RU0A 4I6WA 3HSJA 2DNZA 1EAYC 3U27A 1N5QA 3PW0A 4DU8A 4USUA 2P5VA 3IO1A 5KAKA 1T9UA 1RAEB 1JJCB 4JI1J 1S12A 2C42A 4YUDA 3FBFA 3R7SB 4UZBA 2H51B 2HHPA 3SMZA 2BVZA 4PABA 3D28A 4F2SA 1H2TZ 5F8JA 2RHQB 4D3HA 1VQKS 4NA2A 4M5DA 1X0FA 2IMWP 4ILLA 5DG8A 3WHIA 2IY5B 2HHXA 2DH9A 3ZZTA 3OR2A 4AXIA 3HHNB 4ZOSA 1BWEA 4C8NA 3U7JA 5GAHU 3CTRA 5J1PA 4BHQA 1BWVA 3GB0A 1CJKA 1O0PA 2Q79A 2J9DE 4NEZA 2FVSA 1MU2B 1KD1T 2XY5A 4IG3B 1FRKA 1M5VC 5HP1A 1S7HA 4JI2J 5L39A 4MKBA 2B6AB 1LWFA 3LPYA 3FC9A 1S59A 2B5JA 1FVSA 1NJWA 4WPAA 3MECA 4BC7A 2E9ZA 1QM9A 2Y1JA 3DLGA 3KJVB 4O44A 3QO9A 5J1EB 3W8GA 3QATA 4MIAA 5C24B 2VZ9A 3HT3A 4TY8A 3NGDA 4IO9Q 4LF5F 2HGLA 2DD8S 4ED3A 2HBYB 3BR9A 2NCKL 2XMWA 2GMHA 4ZVEA 4I6YA 3T6JA 2ACYA 4XTTA 5HLFA 1MLAA 3ZZRA 3H20A 4WWSA 4IH7A 1DZ5A 5BR8J 2E7XA 2QL9B 3ITHA 5CYJA 1FJ7A 3AJ1A 4LFAJ 4C98A 5IFMA 3DLEB 1XMBA 2V6AA 4LUBA 1UP1A 1L3SA 4X4OA 4B3OB 3Q8YA 3LP0B 1EIYB 2ILZA 1QAXA 2V8GA 3HZGA 2HHVA 4MFBA 2LXFA 5KG0A 3OPKA 3MCMA 3QMQA 1UFKA 2F40A 1VC5A 1YJRA 1SQEA 3GWCA 3IA0A 1PJ7A 1Q8KA 1N4LA 2XMVA 5LM7E 3TARA 2KFYA 4YR2A 3H4BA 1NB7A 3MAAB 5ETMA 1N36F 1FNOA 3BYPA 1T03B 3EGWB 2EI5A 3OUYB 3CJTA 4X4RA 5K14B 1PC4A 1HNZJ 3M05A 2XHWA 3IRWP 4IDKB 5HBMA 2K7KA 5GMEA 4CTAA 2KJVA 1U1OA 1UTAA 1NCLA 4DSLA 3D6HB 4ID8A 2VFTA 1HR0J 3MEGA 1TU0B 1XEZA 4EYHB 2VA2A 5I3QA 2WSFC 3IBCB 1GEHA 4PCQA 3NCRA 3QFWA 3MPUB 3W2WA 2XWYA 1FK9B 4FBUA 2L9WA 3Q8SB 5HL7Q 5KFKA 2KVIA 4DL5A 2E1RA 2D7SA 2MZSA 1VQLS 3M8PB 4C48A 5EGYA 3TX8A 4X4NA 2DRBA 3BQ1A 2RIJA 5KG6A 4F26A 1SJRA 2COLA 3MPDA 1S6OA 1S6PA 3MD1A 4X66F 2O3DA 2G2ZA 5K20B 1QUVA 1X7VA 4F2RA 1FTCA 3MM6B 5E3QA 3FQLA 1IVZA 5KT6A 3FRZA 1UAWA 1S1WA 1AT1B 1KLMB 3FMBA 3J7Z5 1YZ6A 1TL1B 3DLKB 1AFJA 4ZP6A 3IR5B 1X31C 3OLBA 3KLFA 4DQQA 3M32B 1JLAB 2P9EA 4HVZA 3G9CA 3A3NB 4ZIVA 5IQQA 2J0QD 3C6TB 2RU9A 3S1TA 2W25A 3OT9A 1NZAA 3SCIE 5KFOA 3CXCR 2G2YA 3N5FA 4NMXA 3BYRA 4NXNF 1AYEA 3DU6A 1HHTP 2MZTA 1MMDA 4OX9J 4DQIA 1UZHA 4L6V3 2Q1LA 3M9NB 1YHQS 1Z2LA 1K0VA 4ZCMA 2JHEA 5KT5A 3MUTP 1VQNS 1Y7PA 3WIUA 2M0GB 3VVTA 4DR7J 5AE1A 1HHSA 4LVNP 4LF7F 1HBOB 4PWUA 3M8YA 2BKOA 3PV8A 1AA1B 3PIPQ 3GIMA 5KTQA 1GMWD 4NOHA 4M94A 3DRYA 2AJ4A 2VFVA 3K89A 2DNKA 4DV3J 1C1CA 4HDHA 2MKKA 4KV8A 1RWPB 1WKLA 4USIA 5EWFA 1WACA 2M70A 3GG1A 5AE2A 1RWOB 1CJVB 2YNHA 4DL3A 4EMDA 3IMQJ 1XMQJ 3KG1A 1CJTA 4XDDA 2HNDB 2MHNA 3K58A 1VLYA 2W9AA 4DI6A 2HHQA 4MKVA 1C2PA 4DUYJ 3K59A 1JXEA 3VAGA 4B17A 1LEOA 4JI0J 2ZC3A 1RT3B 3AHPA 1E6VB 3JB9k 2AEJA 1P27B 4G1QB 4IFVB 4QQBA 1FKAF 1E6YB 4DV4J 5L9XA 3M9OB 1RLCL 5IS2A 1RBLA 5E5NA 1HYSB 2KKHA 2XYHB 2Z4PA 3MR7A 3OTBA 3GZ7A 2XTJP 3EZ5A 4DR4J 2WSCC 1TL7A 1H3DA 4QIFA 4DV5F 1FDDA 3POTB 1T02A 1NHVA 1ZM2A 4CNYA 4IFYA 2WVFA 2CQ0A 1SH2A 1IXKA 2V63A 1UJ6A 2R7UA 2AIRB 1JLQA 2Q43A 2QLWA 1SC6A 2J7KA 3FNNA 4JV1A 1VQ7S 4RL1A 3MUMP 4DN0A 1WKKA 2WW8A 5EX3A 5RUBA 2LXIA 3P45B 4KKOB 4ED2A 2M5YA 3DI6A 1W7WA 1L3VA 5HMZA 3CCLS 2L08A 4J9UE 1CJUB 4JI8F 3I55S 3PR4A 2ZH5A 4KGVB 2LKZA 3OFGA 1YX2A 5A8KA 3KLGA 3G8TA 3CJ4A 3ZZZA 2OEKA 2RUSA 5CZVA 3VAJA 3L3CA 4NASA 1X9SA 2PDAA 3R2CJ 4CYUB 2PMZD 2DB1A 4AUKA 1U7LA 4KTQA 3QSYB 1DTQB 1JLCA 2CQGA 2FDNA 3FZ2A 4PPZA 2R2UA 1WC3A 1YWXA 4TVAB 3BKFA 1IM6A 3HSGA 4NA1A 2PGCA 4WFZA 1MROB 3BGFA 2CQCA 5KFGA 1IKYA 2DXDA 2ZBCA 1WEYA 4LF6F 2ROEA 1F3VA 1UVKA 3EGNA 1KNZA 3S6EA 4LIRA 2ASDA 4MH8A 4A8WA 1XERA 1VC0A 5HATA 3THTA 4KO0A 4ZLNA 3DOMA 2DGQA 2HMIA 2KI2A 1UJ4A 2BR0A 3CCRS 3KK1B 2IC3B 4EI2A 4DS5A 2CJYB 1NH7A 4O3OA 3VAIA 1X60A 1WHXA 3D68A 2AQ4A 1J5OA 1ZBTA 1RISA 1HHQA 1NK5A 3LTOA 2POKA 3EE3A 2JWNA 5KT3A 4DR6J 1T0TV 3I0RA 4FVMA 4DR1F 2OUGA 3S01A 2K2PA 2MQQA 3KLEB 2IM3A 4X4PA 1NDLA 3MHYA 3L4BC 3KJQB 4C8OA 1T9XA 2B4VA 2B4PA 5HI7A 4K4YA 3PRVA 3OXGA 1VCTA 4U95A 2MZQA 2HVZA 1QUPA 1YGYA 1ZAVA 1RKJA 1RHQB 2RU3A 3O6QA 3B4MA 2BE2B 2HQCA 4BCAA 2FZKB 5KFEA 2Q6CA 3OFEA 1YITS 3E01A 2VU5A 4K7QA 1NK6A 2AGQA 1XR6A 3HZEA 3B4DA 5KFCA 3JYTA 3T1YJ 1R3NA 1VK3A 3I0SB 5F41A 2IRXA 3V6KA 4H4MA 2EG2A 3HD1A 1N32J 4DPOA 2MLZA 4OZ5A 3AQOA 4DUTA 2IHR1 4AE5A 3L95X 4R8UA 1H38A 5E3RA 4ZPBA 1VBYA 3BJYA 4GVLA 4Y34A 4JI7J 1S4EA 4HLBA 1SVDA 4HDGA 2AJQA 4FYVB 2HRTA 2HVDA 2F8MA 2YNGA 1XJWB 1S1VB 4JI2F 2I1RA 1A0OB 2ADBA 2DRAA 5CYMA 2E7VA 1BQNB 4OI1A 4JOUA 1VLOA 2BJ1A 3T5HA 2MQPA 3VAHA 1D9DA 1FX2A 2XI3A 4J9OA 2GMLA 4DS4A 2CNKB 4QJVA 2YWHA 2VODA 4ZVRB 2UVWA 4I2QA 4A8XA 4X2BA 2DTJA 2XSJA 1QVFR 5D3GB 5IM0A 3MR5A 1UWAA 2GC8A 1S0NA 1CQMA 2IDLA 3THPA 5J2MA 4C3MA 2LU2A 4G6VB 1FCAA 3GFYA 2KM8C 4PWDB 2X3DA 3R3TA 4I4BA 5ETLA 4CZCA 5KG3A 4KGXB 4I7FB 4NCGB 1PYTA 5IXUA 2N82B 4ATNA 2ZD1B 1S48A 5J2PB 3L09A 1W2BR 3M30B 1NZ8A 4A8QA 4DV7F 1HI0P 1PBAA 2DY9A 2VPWB 2RRBA 2M3DA 4HACB 2J7UA 2KT2A 1Q16B 3AD7C 1MMLA 2UUCF 1W2IA 2UUAF 5KOXA 2CPJA 3F41A 2QT7A 5E2QA 4PG4A 1BY9A 3DGPB 5LMNJ 1FE4A 4OZNA 2YY3A 3ICLA 2WVCA 5IT9Y 2C3YA 1BHNA 4K4XA 1VMBA 3R8YA 4LR7A 5HMWA 4M1KA 3CSKA 1B0TA 2DCUB 3DDNA 1HNZF 1RAGB 3OW2R 2LP4A 8AT1B 4ID5A 2BBEA 2LQ8A 4B9NA 2H9ZA 3LGNA 2UV8A 2VQFF 4P71A 3LP1B 3GJTB 3UFCX 3OXLA 4NCAA 3AT1B 1RTHA 3DXBA 2YVSA 1WUUA 2GJIA 4PG5A 3N9UC 2P9CA 1JLGB 2HFUA 2UXCF 2AU0A 2NR0A 3HKZD 1C1BA 2RB7A 2OELA 3A8JA 1VJWA 2R7QA 2PI5A 3QJLA 4UOCA 2F7VA 2AJ2A 1XR5A 2OPPA 5ETRA 2EFNA 2HFNA 1LQ9A 3BH7B 3N79A 4R5PA 3OD2A 2BOAA 4HH1A 4MK9A 1U49A 1VR6A 2DCLA 3CMAS 3TO8A 2OKQA 2FHJA 1FRXA 2NZ4A 3F0NA 2GVZA 2H5IB 2JX2A 1RGVA 3HFZB 1B4SA 2FC8A 1DLOA 4JI6F 4F25A 2ASLA 2VOPA 3RRGA 2F3JA 2GGPA 1BXNA 1UMJA 1RP5A 3H5YA 3QT8A 4K4VA 1EP4A 2I38A 2XMKA 3FEYB 1RAAB 2DR8A 4QIEA 4P74A 4DR5J 1JXLA 3MF5A 1LW2B 2BM1A 2V67A 1HLWA 3MUVP 1RACB 1PBUA 5K8OA 2AWZA 4KGMA 5AJ3F 4QWAA 4LRBA 2O66A 4DUZJ 4NLVA 3PYDA 5KFIA 2A6OA 2F4VJ 2LA4A 1N56A 3NWGA 3AQPA 2J6UA 1FESA 4PKDB 3JTNA 4J90A 3ISND 4NI2A 2JNJA 2RJZA 1NPKA 2I6WA 2AYEA 1YQHA 3EGVA 1TL3A 2VPZB 2J9CA 4NRTA 3R7BB 4WYWA 3V6HA 2MZJA 2VH7A 1CC8A 3MXHP 2DITA 2Y9HA 4MTPA 3SQGA 3MMJA 4FNIA 4CLFA 3D66A 2XHCA 2M4MA 2EK6A 2KN4A 4QYZK 4ZVFA 3OTDA 7AT1B 2F4FA 2LCWA 3CCWA 3D9BA 1RHMB 3PJWA 4EUVA 1RT6B 1FWKA 1FEEA 1WTBA 1RYSA 4WZQA 4UT4A 2MQLA 2WB1D 4CQ1A 1WF0A 3PFEA 3GJRB 2KO1A 4KHMA 1QAJA 2H54B 4DLGA 2P8IA 4JYAJ 1SV5A 2W2OP 2V2QA 2R8GA 2HLUA 4DG1A 4EEYA 2UUBJ 4DSJA 2XS2A 1H7XA 2QIFA 4B3MJ 3N0VA 3OL9A 2DHGA 3BREA 3MPWA 2HVEA 2Z58B 1T95A 2XSFA 3BGOP 3VAKA 1UA1A 1LOUA 3QAEA 4HT5A 3EPGA 1FXDA 1RA7A 4DUYF 3JSMB 1I94J 1ZS6A 2RDDA 2HNYB 1FKOB 4JI0F 2UU9J 1JJHA 3Q22A 2NYIA 4DV1F 3HFVA 3H90A 4B3TF 1NHKL 2RT3A 2PMHA 4FKYA 1FRHA 3LPEA 2MHEA 3D0HE 1T9YA 4KE5A 3BGRB 4F50A 2VD3A 1T05A 1XNQJ 1NEEA 3R6GB 3PFOA 2RS8A 4A8MP 4DR4F 3DLJA 2XG8A 2LDYA 2D9PA 3DMJA 1EETA 3QT6A 4ZDNA 1FI4A 2JEGA 3KMQA 3GIJA 4LF1A 3SCJE 5G0RA 2M8DB 2DXFA 3PW5A 2D3O1 1R27B 1IR1A 3DOLB 2C3MA 4FP9A 3LA0A 2QZ8A 5B0FA 1S1XA 4DSIA 2XMMA 1FFSB 4OHVA 3SCLE 3MURP 1BUXA 3W9JA 4WFBQ 3CPWR 4JI3J 2FZGB 2EFVA 1NUEA 3GFHA 1ZZNA 1WF1A 2ZVSA 4QWEA 3UCZP 4UOFA 1M5OC 2ZWPA 2UP1A 3BSAA 1GXLA 4FDFA 1SL1A 4F4WA 3AFGA 1EKSA 4V19J 3T1HF 2D41A 4EWTA 2YNFB 1WG4A 4Y28C 2CDQA 5DS7A 1M1KT 4B9MA 3V6DA 4EFAC 3KK3B 1HWJA 3V5RA 1YBTA 2XQCA 3LALA 3UNYA 2ZH7A 1VIXA 3IM9A 4UW2A 3J81j 1VISA 2J5AA 1S9EB 4M63A 2HURA 4DR3J 2R8JA 1NAQA 4PRFA 1YJVA 3K5PA 4M5LA 2R2TA 4NLGA 2CIMA 3R5BA 2RNEA 4MK7A 2XLKA 4O3SA 1Y0HA 3A13A 3HP6A 4FBTA 1BGXT 1RBAA 3EM1A 4EZ9A 3D0GE 3DOKB 3CCVS 1ZM4A 2KM8B 1FJGF 5K8PA 2CPXA 2XLIA 4WU2A 1WG5A 1YK9A 2FY1A 1HNXF 4DL7A 4RNMA 2DPJA 5I3PA 3TP2A 2KHDA 1TZ0A 4HHUA 1CSJA 4X4SA 3MEGB 5E3PA 4M5HA 1TKXA 2VONA 4LR8A 2BOPA 3RYLA 1F5AA 3QWUA 3UN5A 5D15A 4CT8A 3IAM9 4GO5X 2XS7A 2UV8G 3L9ZA 2BYCA 3FEXB 1YTYA 4CLSA 2KFZA 4L73A 2W7AA 3QIDA 1D1UA 4USVA 3M1VB 2EKYA 5KFMA 3P5BP 1FDAA 3SBMA 3EVWA 3TAMA 1KQSR 1ZZFA 3MMAB 2FJBB 5HJXA 1RYRA 3ISNC 3FFIB 1F9FA 4I6AA 1RWVB 5A2QY 5F8HA 5D4PA 3NL0A 2X51A 4FZVA 4NLWA 2VBXA 3ZNJ1 1F6TA 5EHHA 2QA1A 1UPPA 1HL6A 3SDEB 2Y0BB 1J5EF 3SI8A 1XNRF 2WOMB 1Q7LB 4ZCLA 1JKHA 2P6SA 2VHGA 1HQEA 1OY9A 4LF2A 3BBBA 1MWYA 4WK1A 1Q7YT 3IBFB 2VF3A 2BM0A 2KZMA 1QVGR 1T9TA 3GYXB 3D54A 2P9GA 3DC2A 2DO0A 5KFJA 2JLEA 5B7WA 4DV0J 2CYYA 3RAMA 3HI9A 3EPIA 3D7SB 1IBKF 2KHCA 1UVNA 2FY8A 4KY3A 1RSCA 3QRQA 2OPSA 5A8WB 3A8IA 3CC7S 4TYBA 5KFNA 2C2KB 4MT1A 1U0HA 1VQMS 4OZ0A 3AA9A 3J7A1 4IH6A 4B3RJ 2XWXA 1WC5A 3CD7A 3M9MB 1UL3A 2A18A 3EMTA 1TKZA 4K0KJ 1RB0A 4HTIA 3MCNA 3TZXA 4U9RA 4R25A 2M2BA 2RF2B 1AFIA 1ROFA 3A8EA 4ENOA 1RADB 4EU0A 2MDAA 3V4MA 1WF2A 2CJKA 5T7LA 3NGUA 1JWWA 2AGPA 3D1HA 4LSLB 3C14A 1L3TA 1W25A 2XYPB 5H9EK 1XMOJ 2R4FA 4YOEA 2YNHB 1X5OA 3NS5A 3MM8A 4URQU 1ZOTA 3DN9A 4PYDA 4N7TA 3QJJA 3EZOA 2BZ2A 2W01A 3W5XA 5C2GA 2N7CA 4N47A 1F5CA 2KB2A 3CCUS 3DNCA 2XZDB 1YRUA 2QYGA 2WVEA 1QSYA 1AUDA 2NPIA 5A2QU 2PO4A 2FVRA 1TL5A 3CCQS 4M5GA 4ECYA 1L3UA 4NMLA 3GU0A 4FYYB 2CKWA 2UXBJ 2Y1LB 1TL7B 4A8KA 4O0NA 3V81B 3BN7A 3RJMB 4HHHA 2X1FA 4QW9A 2UVVA 2VFRA 3MEEA 3U1LA 2HHTA 2B4UA 5HJYA 2E29A 1B7FA 1JQGA 1UZDA 1D9FA 1RT1B 1JJ4A 2VBYA 1P1TA 4N41A 2CWKA 3DXSX 3TZZA 3DHXA 4L76A 4DCPB 3ZTSA 4CDIA 1PKUA 2XC9A 1HNWF 2AMCB 2E5GA 3PW2A 2DNGA 2BABA 5KG4A 4DHVA 5HQ8A 4ICLA 2LEAA 5FLXY 1S1TB 4NLDA 1ZPVA 3BF4A 1JLBB 1Q8LA 3TUJC 2N7YA 2NUHA 1SJ3P 3KLGB 1F60B 2NSBA 1TK5A 1S6QA 4PUOB 2XMJA 4QU6A 2L41A 1V3RA 1TKDA 1UEKA 2MJUA 2Q6BA 4KB7A 1O6XA 2HQDA 2BX6A 3LF0A 1DARA 2QLBB 6AT1B 2VV5A 3TW0A 3OVAA 2OJ3A 5JVHQ 3E51A 5F3TA 2JFKA 3OFHA 4LFBF 1NBEB 3AJDA 3BSOA 2IM2A 3BV8A 1NRKA 1TL4A 2M52A 4UOGA 3JS9A 5HO4A 1U1PA 1IKYB 4DF4A 3VCDA 2OGUA 3TZWA 2J8AA 2YKNB 4TNOA 2OTJS 3HXMA 2MKHA 1C0TB 2D1CA 4ZS6A 4PQUB 1G2EA 4ECSA 3LQVA 4YY3F 4GRSA 2N4DA 5JUMA 3KHHA 5KFTA 1D09B 5DLFA 2GQ2A 4CO3A 3HLUA 2VC0A 2PI4A 2KDOA 3IRXA 3TAPA 2FPHX 3DLLQ 3N6MA 3IS9A 1X4BA 3MCSA 4M5MA 4FVCA 5DJBA 3KK2A 1R89A 4DX8H 1S79A 2HVIA 1HBUB 4L3KA 1SXLA 4DSEA 3WZ0A 1YDLA 3BSNA 2BQ3A 4CLYA 2VG7A 1SIZA 3BSCA 3IFEA 4ZPWR 1OSDA 4K4ZA 2W2MP 2J0WA 5AXLA 2QSFA 1VFJA 1PSDA 4LBIA 2DIUA 2G1HA 5D77A 3R6LB 4FPRA 1SC3B 3HDSA 3LGHA 3FGVA 4IQXA 5DZ6A 1R0AA 1S77D 2GAHC 5SUHA 2OMOA 4LF5J 5IWAF 1DY3A 3HT0A 2RSQA 2IRUA 4Q8EA 2E9TA 3OJSA 3IP0A 8RUCA 3CJ2A 5A6PA 1OS5A 1S9FA 3CIMA 3G87A 1VJQA 4CH7A 3UDVA 2KT5A 5D0HA 4LMZA 5D4NA 3G82A 4HEA9 1WSRA 5GMKa 1FRJA 5E41A 3UDLA 3C3LA 1Q86T 4RW6A 2W9BA 1HQ2A 3Q8UA 2PN6A 2B3TB 2E7WA 4YP3A 3ILLA 1KOOA 3DRPB 2VPYB 4FKXA 2IYIA 4R8UB 4IQMA 5CCLA 4ZLLA 1WD6A 5H1SV 4B9UA 2ZKUA 2CVEA 1ZTTA 2OLWA 1DFDA 3NOCA 4U6PA 2DGWA 4FF3A 2B51A 3BQ2A 1RT2B 4U8VA 4V1Ak 2C3UA 3CF5Q 3MMCA 5CXTA 1N36J 1CULB 1VS3A 1N6QB 3CDUA 5F8GA 1SB6A 1NDPA 4RNHA 2IVFB 2WONB 4DLEA 3VZIA 3I6PA 2APOA 2J8SA 1I6JA 2CZ4A 2LMIA 4A4JA 4Z7YA 1CBKA 1DQ8A 3HO1A 2IJNA 1X0PA 2ZM6F 4PG8A 3WBZA 4TQSA 3D67A 2NXJA 4BS2A 1QJHA 5IOLA 3OTCA 1N5YA 3KKFA 4WCEQ 1M1GA 1OPZA 4YB1P 1KLNA 5CAAA 1PYSB 3I56S 1K1SA 2VPXB 1UW9A 2A6MA 1AZSB 3HHLA 1MSWD 3DRSA 3KLIA 4CH0S 1R7IA 2O01C 3R27A 2P2CB 5DGAA 2R7OA 3TANA 3DM2B 2HW3A 4RBTA 3PNIA 4QIWD 3OTEA 3RG6A 2LA6A 2MKYA 2C2OB 2AZ1A 3ZTRA 2FJEB 2C2RA 3NMRA 4IUFA 3C2PA 5DLGA 1U09A 1QSLA 3G6XA 4J9MA 4NZ6A 3C16B 2BQRA 4GO7X 2CRLA 4LF9J 1X9MA 2JDJA 1Y3JA 1GX6A 3QIPB 2CXEA 3W9HA 4X66J 1GTHA 1U2CA 3BO3A 2C1EB 2V4JA 4FYWB 4MYTA 1U47A 2HHUA 3Q86A 2FZCB 1QLNA 4ED5A 1HNIB 3IG1A 2YQ1A 2NXEA 3RGIA 4BDPA 1RT4B 3NBPA 4W90B 2CPHA 2E1AA 4E98A 4DPUA 4WJBA 1RWUA 2ALZA 4A8YA 4O4RA 2JH3A 1RTHB 1SBRA 1OYEA 2YBVA 3D1QA 4OYMA 1CG2A 1HQUA 2MSSA 2OHDA 1H6KX 2R9LA 2J6SA 4LQ3A 1Q8IA 1H2UX 1S76D 3JTPA 1YBAA 1NB2A 4OI2A 4ZP9A 5DG9A 4AD6A 2W9CB 1F2HA 4W92B 1HBMA 2YPYA 3PYGA 5GAEI 2Y8WA 3MM5A 1T8EA 1RT7A 5DDQC 2ZOMA 2OD4A 4DFMA 2PE8A 2JLFA 2OIHA 1IM4A 4FF1A 4CLUA 3EX7B 4KGZB 2OP5A 4OYOA 3MMBA 5EWGA 2BDPA 2ZUAA 4TXSA 1UETA 2GGPB 2YWWA 2GHVC 2DNHA 2ASJA 2LQ5A 4WXWA 2X1AA 4B3SF 3GPAA 2BMBA 1HW8A 4E8UA 1MW7A 4J9LA 1OPIA 4EBDA 4U7UD 3LP2A 4OFZA 2CZVC 1C0UB 1IKXB 2JVOA 2JC0A 4P10A 4N5SA 4YR0A 1IBCB 4OJ1A 3MM9B 4P2MA 1KFDA 2BANA 2RQKA 3M8QA 4D3GA 2QLXA 3PJXA 4RNOA 5LSLA 4GVBA 2CQHA 1N48A 3ZTPA 3PG9A 3G6YA 4JV5F 1NKCA 4NI2B 1UVLA 2RMLA 4J7CA 1R6VA 1TFWA 2UXDF 1MN9A 5I3UB 4C9DA 4F4ZA 3DDKA 2UVUA 3QLHA 1TL3B 4C0OC 2A10A 4I2PB 4OZLA 3TEHB 5H9EJ 2CNLB 3NY0A 1IQZA 2HNZB 1Q79A 1ZA1B 8ATCB 2R2RA 1YVFA 4DQRA 2QO3A 2BJ9A 3CCJS 4DV5J 3CCES 7FDRA 5A8RA 3D5MA 4N8OA 3MI7X 3IXQA 4U7CA 3GFZA 5JJBA 2AYMA 1G3OA 1SUQB 3I4HX 1GAOA 4JV0A 1UEVA 5FDLB 4DDFA 1FRMA 2G1DA 2QN6B 4Y2MA 1RTDB 2KH9A 2XULA 5L1LA 4J91A 3QJPA 4QR2A 1TFYA 1IN0A 5GADI 1PGZA 1RAIB 3MM7B 4JI8J 2DISA 3AD8C 1RDRA 2HHHF 1X4DA 3R5DA 4CLPA 2J9DA 4LF4F 4X62F 5D4OA 4KJIA 2Z2MA 4XO0A 5CYQB 5C5JA 1FNMA 5ETQA 2JC1A 3TVKA 2UVRA 4LBPA 4C11B 2QYCA 4B02A 3UD3P 4UY85 1KC8T 3HVTB 3RAXA 2VQEF 4J9PA 4OYAA 1N33F 2F1FA 2GCFA 4IG3A 2FHMA 4LBHA 1RZMA 3JSBA 2D3UA 2V8VA 2LYVA 1H74A 2B6AA 3HULA 2A0FB 3DMJB 1QSSA 4DPYA 2V4QA 4TU9A 5AXMA 5B0EA 2U2FA 4ALZA 4LF6J 1PYOB 4XDCA 3UDEA 4KFBA 4A47A 4ZP8A 2HAIA 1R8CA 5HMYA 2IBOA 3CD0A 3I9V9 4GKKF 1U1KA 3QFHA 4LREA 1U1NA 1PJ5A 3KJVA 2RQ4A 5J1EA 1EQ0A 3TJAA 1CLFA 1FVQA 5C24A 3Q0AA 5KFLA 4USJC 4GC6A 3NXZA 3F56A 2OSRA 1U2FA 4JI5F 2N4CA 1BQMB 4DPWA 1TR0A 4QOTA 4RU2A 4RWWA 3RBZA 2PA8D 5LMUF 4P2FA 4DR1J 3CJ3A 4IG0B 4ED1A 4ELUA 3GIIA 1XK8A 2ZNYA 3TQEA 5F0UA 3PJ9A 3BGUA 2VASA 3UI3A 4C2MA 3Q2TC 4RW4A 3BB5A 3DLEA 3W2VA 3GIRA 3GILA 4FXVA 1U1LA 3OJUA 3IC1A 3CEDA 4DL2A 3TUIC 2K8GA 3RBEA 2R7SA 5ETVA 4CLLA 3G6ES 3M6WA 4NXMF 3M2RB 5I42B 2GQQA 3CJRA 4XPEA 3JTOA 4E2FB 2BV3A 4ZJLA 2ABYA 1SKSA 1RBOB 4NLYA 2CPYA 2WVBA 3NCPA 3MPYA 4ED7A 4F0MA 3MEDB 1LK7A 1T03A 3SXLA 1Q4RA 5K14A 1NK8A 4H4OB 5C25B 1SCJB 4TU7A 2DHAA 4GC7A 1FF2A 3I87A 3CDBA 1Q5YA 1V3SA 4P2SA 3CCMS 1NJIT 4MKAA 3SQOP 2FYXA 2VA3A 2ZH4A 3RRKA 1R0CB 2V0NA 4WTOB 3FUYA 2MMYA 2DNLA 1CVJA 4PYAA 2XCPA 2ZBIA 4RNNA 1VIOA 3B8HA 1FERA 1JIHA 1VRUB 3L7UA 3MGJA 5LT5A 4DMZA 5L1KA 1FK9A 4WP9A 4FXWA 2E9RX 2KXFA 3DLBA 2W8LA 2Z0GA 1XQIA 5FJ4A 3M8PA 2FLNA 3N28A 1UEUA 3AA8A 3LW5C 3AOAA 3O3LA 4OHZA 4KPYA 2HFZA 3H98A 2JLGA 5LJ3Y 2V50A 4CNZA 1WELA 2VKRA 4TKTA 1RWNB 4X64F 4A8FA 2UZAA 3H4DA 1XTZA 2CJBA 3QZ7A 1YJ9S 3MM6A 3SZ2A 3C15A 2HZCA 4ZPDA 3LH2S 1RQ0A 2BACA 3C8YA 4ILMA 1ZH5A 4DV7J 3OL7A 3ZTQA 3NNCA 2CVIA 2K1RA 2ZH3A 3DLKA 2HFSA 1ITPA 2UUCJ 2UUAJ 1XC9A 3NP5A 2VL1A 4U67Q 3D6TB 3HHLC 1U6FA 1JLAA 2BE7D 4X65F 3C6TA 1CPZA 2OPSB 2QLJB 5U47A 3JAMY 3IBWA 1OQ3A 3ILJA 5KFUA 2HWTA 1S1UB 3AOBA 1GH8A 1RAFB 3QPIA 5ETSA 2LVWA 4DN9A 2EVZA 3FRYA 1GX5A 4YEAA 3BDEA 1N5VA 2P6TA 2Q3PA 5H9FJ 4AYBD 1LWEB 1TKZB 3NKYA 4CLWA 2VQFJ 2OPQB 3AB2B 2IA6A 4RW8A 4DPTA 1S97A 1HBOA 2MPUA 2XO7A 1V9OA 2R7RA 2AJ1A 4C0HA 3TAQA 4DX6A 1IKVA 1TK0A 3GE9A 1KQGB 2UXCJ 2XLJA 1KN6A 3CUNA 4WFXA 1WSVA 1VQSA 2HBRB 2IAJB 1RKIA 1B64A 2B7BB 3W9IA 5ETKA 2CPDA 5J2QB 3C14B 3KHLA 1BLUA 4M5IA 3HK2A 4FXDA 3P5TL 5DM6Q 3T1AA 1CJVA 3D1OA 4HR2A 5A76A 4LFCF 4QR1A 2VKZG 1KTVA 4ZN3A 4JI6J 2IFXA 4NYPA 2RHSB 1VBKA 4UOHA 2E1MC 1HI1A 4LF9F 1B70B 1RT3A 3FBBA 1E6VA 2HS0A 2XNRA 2ZZTA 4IFVA 2K06A 5L9NA 3DHWC 1E6YA 1UWBB 4UQGA 4HYKA 2EW9A 1HBNB 1XIQA 1B0VA 2YKMB 2XY7A 4ECXA 3MAQA 2LU1A 1NSAA 4CLZA 2VUGA 1S0VA 3AJ2A 3PHTA 4X84A 3SFUA 3RR8A 5AJ3J 4I68A 3POTA 5BYQA 3M8ZA 2VG6B 3M2VB 3MEEB 1SJ4P 4NLTA 2VC1A 3HJVA 2R8HA 2DR9A 1YRTA 4HT7A 1JLFB 3P8BB 1TV6A 1WHVA 2CQBA 4C3KA 3ZXWA 3PKYA 1CQNA 2LDIA 5BYSA 1AW0A 4IR1A 2LEPA 3MTJA 4IOAQ 1G6BA 4KKOA 1IR0A 3BGLA 2CZ9A 3M2UB 1DAXA 3I82A 4TLQA 3FCVA 2A2DA 3LO3A 1T94A 1LWCA 1VQ6S 3J80Y 4WK3A 1S6QB 4RKUC 2Z30B 4USTA 1FE0A 3CJKB 1WC0A 3R5JB 3HCXA 1FKPA 3IR7B 4Y2KA 1KKHA 3FJ2A 4PXBA 3GJQB 4KPCA 4OL8A 5HMXA 4Y65A 1PAUB 4QCLA 1DTQA 3RAQA 3C19A 3UN2A 1YG0A 4EO8A 2BJ3A 1EX8A 3X3UA 3O2IA 1KTQA 1MROA 2WBRA 4CIOA 4USHA 2V4RA 2QSWA 3Q8PB 3I9ZA 2RRAA 5D0RA 2LQBA 2VJUA 2C3OA 1ZAXA 1X4AA 2EBEA 4M8LA 5BXIA 3PRDA 4WE1A 4WF9Q 2VFUA 2XB2D 4EYIB 1X5TA 4GKJF 4AXJA 4RZRA 4LF8J 2ZBQA 1TKTB 1U6ZA 4FPIA 5F8LA 1I5OB 1XBWA 3B6BA 2QA2A 2BJ8A 1M5HA 4ED0A 5T41A 2MTLA 3RZAA 4DV1J 3KK1A 2IC3A 5IV4A 5GAEU 4B3TJ 2RKIB 3GLJA 3KK2B 3HFKA 2UUTA 5MLCV 3IGNA 3CE8A 3UVJB 2VG7B 5LSRA 4HKQA 1SL0A 3ET6B 2XMTA 1D8YA 4ZVTB 2ZVIA 2FJVA 3AOCA 3G6VA 2XGQA 2QTWA 1YI2S 2FTRA 4QZVB 2H65B 2C2DA 3GJSB 4Q43A 3MDFA 3G8QA 1NMEB 5KG2A 2BE2A 3X1LB 4J37A 2B9XA 4ELTA 3EZUA 1DRZA 1RTZA 5KFHA 2FD2A 1NJYA 5HK4A 2JVRA 2B56A 5HROB 1G4CA 1JK9B 3KHRA 1S57A 3I5AA 1WDDA 3I0SA 3T1HJ 2BE9B 3NS7B 4DSFA 4FS1A 2F8HA 2IM1A 4PPDA 4WZMA 4RLEA 4TYAA 2XMUA 3GTYX 5THWA 4WP3A 1I1GA 1KEKA 4Q2LA 1X4EA 2GIRA 3N6NA 3RB6A 1X5SA 4BC9A 2CQDA 2YQ3A 2PEHA 3J7ZT 4J9NA 2RQCA 3RB0A 1LFWA 1T3OA 3V4IB 4ZHRB 2IVYA 2ZEJA 1PCAA 2Y1RI 2HBQB 3T5LA 3PYFA 4ZA1A 2R3VA 1WEXA 1CC7A 1S1VA 1H72C 2HS3A 2C2ZB 1S9GB 1BQNA 5KG1A 5GMDA 1NK0A 1KQKA 4M5JA 3NRBA 3EVOA 5KG7A 2XGPA 1URRA 5DDRC 2DNPA 1FJGJ 4Y00A 1WOSA 2J6TA 3KJNB 4F0HA 1TQLA 2HQFA 3P96A 1TTHB 3VV2B 3GR1A 3SV3A 1TMJA 5E33A 3K57A 1TVRB 1HNXJ 5AXKA 5GADU 2G9OA 3HX9A 3C6UB 3CC4S 3KUGA 2Z57B 4OZ3A 5HVGA 1N5YB 3KTQA 4KC5A 4WIQA 1HNVB 4PWDA 4B9TA 5C42B 1WKJA 3GYGA 3V6JA 3HHLB 2E5LF 4X4TA 2QL7B 4I7FA 2X7IA 1FX4A 2ZD1A 5J2PA 1YJWS 2VG5B 3CJ0A 4WFNQ 4F4XA 4I0WA 2PEBA 4HACA 3UW1A 4RUCA 1R8HA 2JSXA 2ZOFA 2RILA 2EC2A 4URSA 1SKWA 5J2NB 1UJ5A 3GV8B 1N34F 1ZPWX 4OI3A 3CNQP 3DGPA 2RUGA 5LXRA 3M6XA 1TELA 4OMFG 2AEMA 1YJNS 1YJUA 2NQPA 1J5EJ 1JNZB 1SC4B 4WFYA 1XNRJ 4LRAA 3W3SA 1J27A 2O67A 2PIIA 1Y5NB 2VFSA 4RW7B 2Q66A 2CNOB 3IG1B 4LRFA 4W98A 2KXNB 3LP1A 2CDRB 5C2CA 3NGRA 2HRUA 2XNQA 1RT5B 1IBKJ 5D0EA 1WC1A 1A6LA 4A48A 5EX0A 4K4UA 5CCMA 2CNNB 4F36A 4DEZA 1FJCA 1SKRA 5A0YB 2I2YA 2FGCA 1BC6A 1N5TA 4OJHA 3LOUA 4JBCA 4Y6IA 2CG4A 3MM5B 4BWJA 3H2VE 3MR2A 4ZITA 2K3KA 2GFFA 1YJTA 5B0BA 2BRKA 2QGFB 2QEXS 1BMQB 2MKCA 3CJ5A 4RW9B 4N8NA 1KP6A 1N0UA 5DDOC 2FGOA 3MOJB 4YB7A 1CS4B 1FHTA 4C8LA 1Q8BA 1VRTB 4YDDB 1DQAA 2GVDB 2ILYA 3LP2B 4CH1A 4E0DA 3RUBL 1C4AA 4DV2F 1VK8A 1YBUA 4N77A 1Z2ZA 2ZBRA 1XR7A 3RBDA 3M8QB 5IT4A 3LWMA 1NSPA 5KFRA 3J81Y 1OJ4A 4TQRA 2DGXA 2DVIA 1UA0A 3HSDA 2AD9A 5E3CA 4Z2XA 3TUPA 4WKYA 4IRCA 2HWHA 4OYBA 1G1XA 3VQTA 1N0VC 3OLAA 3QGIA 2I5JB 1NJXA 4ZPAA 1LW0B 1Q81T 3EJMA 1OSCA 5KT7A 3ILIA 2YWGA 4CM2A 5HANA 4K50A 3KJFB 2E66A 3GR0A 5F3ZA 2R7WA 2ZHOA 3KMSA 2AYGA 2H48B 4Q0BA 1JLEB 3LAKA 4NLOA 3CDWA 2GO8A 4K2JA 1ZAWA 4XK8C 2PD1A 3ZZYA 4KH1B 2HVHA 1M5KC 1OYDA 1RT6A 4O3PA 1AUSL 5MAOA 3W5ZA 3NAIA 2JFDA 4DR2F 1REVB 2ZE2B 2KJWA 1H2VZ 3PXGa 2CWXA 2CQPA 1IUJA 3KFWX 3R1LA 1HNWJ 3TA0A 2QV6A 1FD2A 3JQMA 1WC6A 4IYQA 2CG8A 4OYXA 5DG7A 1FWPA 1VQYA 1HWLA 4ZIWA 3FSIA 1TUWA 3JSMA 3S8SA 4JB8B 2HNYA 1FKOA 2DRDA 4OX6A 2ZC4A 3ETOA 4FS2A 2MZ1A 4HHJA 2C2MB 2DGOA 3DRRB 1SL2A 1PO6A 3A8KA 4LFBJ 2YKQA 4OLPA 3K7RA 4JV2A 4KHPF 3BGRA 2BEFA 2G0JA 3KLHB 2MKIA 4BBYA 2MGZB 3VAFA 1VQ8S 2AEFA 2ZH8A 2QMUB 1U4BA 3C66A 3K8VA 2GMJA 4P6QA 1Y10A 5KFSA 4KFBB 1U45A 4CO1A 3H5SA 2GS8A 3T6BA 2G2OA 3TI0A 4YY3J 3OR1B 2EEYA 2PT0A 3DOLA 3AH6A 3VTIA 4MMOA 2EFQA 3G96A 2ZH6A 1EQMA 5E0OA 5IT0A 2R8KA 3J81U 1DTTA 2YKOA 3R7NB 5ITHA 4Q45A 2CUYA 1GMWA 5IT9U 2IJRA 2V8PA 1RHRB 2H4YB 1M90T 2DH7A 4IR9A 2E44A 2YNFA 1U26A 3KK3A 5KFWA 3ISZA 4NCBA 5B08A 2H4WB 2W2QP 3AAWB 2VBZA 1VC6A 3UPFA 2DNQA 4WU3A 4RW4B 3VHQA 3UR0A 3W2VB 1KONA 1JMTA 3T9ZA 1S9EA 5KOWA 1RTJA 3OHAA 2HIYA 1GFWB 4ILRA 4P7VA 4YB5A 1K73T 2YKAA 3NCQA 1RE1B 4LIWA 2Y1IA 1T9WA 4RPFA 5IWAJ 1UFLA 5KT4A 2W4PA 5G4DA 2WCXA 4UUXA 3HJFA 2AF6A 1RWMB 4P75A 2R42A 3D6FB 3DOKA 1APSA 4PEOA 2QJ3A 4M5DB 4LF8F 1CEZA 3P49B 4DSKA 2CPZA 3OR2B 2HPUA 2Z56B 4KBIA 2DNYA 5ETTA 3Q8QB 3QRPA 4F7VA 2IPOB 3OV7A 1CJKB 1RAHB 4CCHA 3PHEA 4ZJOA 4YN3B 2DNRA 4QR0A 2CJ9A 3BPSP 5HP1B 3T3FA 1ZTWA 4TLRA 1HWKA 3K2YA 1K9MT 1LWFB 2BA9A 1RTIA 2B5JB 2YX7A 4ES1A 5L1IA 3MECB 4ZVHA 4EBEA 3BPDA 3DLGB 3VGVA 3QQCD 3M1VA 4PXDA 3EGZA 5K5MA 4PWWA 3Q8VA 4O44B 3QO9B 4OZ2A 2FJDB 4ECZA 4ZKAA 3ENAA 4KR0B 1RU2A 3CO9A 3MMAA 1TUVA 2WAQD 3FFIA 4TY8B 4ZVGA 3DU5A 1WOPA 1M5SA 3UCUP 4WTYA 2H3EB 3JSRA 3FMWA 2ZM6J 5IC6B 3DYAA 5KFVA 3E8OA 3RTVA 4K4SA 1QE1A 2XI2A 3SDEA 1UCNA 2FHJD 1KWMA 3SV4A 3SSQA 5AT1B 2VJVA 4NLQA 1HPZA 2FVCA 4DCOB 2WOMA 4NYOA 5HLFB 4OHWA 2ALYB 3KHGA 3EWGA 3NAHA 4BWMA 2V9KA 1H7WA 1U02A 1WHWA 3C15B 1Q53A 3H2UB 3ITHB 1IBMJ 4DZDA 3MAHA 2ZWOA 1RU1A 1T11A 4B08A 4JP8A 1KVIA 2K1RB 2BW2A 5IV3A 4MFBB 3SFGA 2EXUA 3WDOA 1KVJA 4C8KA 1RHJB 5FIIA 1MNEA 1X8DA 1N8RT 1F0XA 2KRBA 2OD6A 2B8PA 4DFPA 1U2RA 2NXCA 5A8WA 1FNXH 4Y3CA 2L3MA 3MZIA 3I96A 1XN9A 2OAUA 3ENVA 3SSRA 2X1BA 3UR3C 1RWWB 1YSJA 3H25A 4KAIA 3OHBA 2YQ0A 2GJ2A 1HI8A 1UFWA 4F3QA 1D3WA 1SJFA 1EKRA 3PZPA 4DL6A 5DQIA 1WNEA 3NNHA 1P8GA 3VGTA 3OVSA 4ZPVR 4USWA 2RAQA 2GO9A 5HBMB 4ZVPB 4PAAA 2CQ2A 3H7HB 1FWLA 4RW8B 4CTAB 3UWTA 2BJEA 2AP6A 1IJEB 5J1NA 3PRBA 2RF2A 4ECUA 3US5A 1S49A 4NL5A 1IKVB 2MQMA 2RE1A 3MR6A 3DGVA 1RABB 1RWXB 4RBUA 4ECTA 4CT9A 3BEGB 1JB0C 3BZQA 4PZVA 4LSLA 3PY8A 2BKNA 2EFGA 3W63A 1WEZA 6FD1A 2V34A 2VDHA 2LQ9A 3W2WB 3KOAA 2YNIA 3UO0A 1S6UA 1IBLF 4AQYF 2ZZNA 4LJMA 4HL9A 3IWXA 3TNVA 1SIWB 4U7UK 3UNGC 5GAGI 4ETZA 1PC5A 3D4JA 4Q7AA 1R8BA 1UKUA 1S6PB 2PMWA 2MSTA 4B3SJ 1OY6A 4EGLA 2DEIA 2I9SA 4H54A 4RUHA 3LWLA 4DBQA 4KIAA 4OJ3A 5F9LA 1FA0A 4FF2A 4R0JA 2ZHAA 2MJNA 2LLZA 1VI7A 4EBCA 2J7WA 2Y3YA 4Z37A 1S1WB 2PFFB 1FFGB 3BBFA 3D0IE 3V81A 4LT6A 3R2DJ 4C3LA 3GCWP 1GT8A 3DFEA 2ASYA 4DZ6A 3IWLA 3KLFB 1TV6B 1RT1A 3OTOF 4JV5J 2WZ1A 2DR7A 1WJ9A 1P9QC 5L38A 3EXCX 2UXDJ 4G3IA 4WXOA 4P9SA 4USKA 1F3FA 1SKUB 4MJKA 1GXUA 1K0TA 4CRJA 1HD1A 3ENQA 2D9OA 3KYLA 1YJ7A 2HIQA 3PO4A 2DPIA 1S1TA 1LWCB 1JLBA 4J9KA 3GQCA 1OMSA 2F8EX 5B0DA 4MK8A 4PUOA 2XY6A 5F9NA 1FKPB 4LSNA 3H2LA 5DO2A 2Z2LA 2JOQA 2F9JA 3O1LA 2IIHA 4F4AA 2ZH2A 4O4GA 3I4PA 4PXEA 3KDNA 5ETPA 2ACMA 3M8RA 4P73A 3VGSA 1Q0NA 5K8MA 2O1PA 3QRRA 2U1AA 1LWXA 2V2ZA 3CCTA 4P7TA 1C1CB 3CMES 1U0SA 4KV8B 1BD6A 2W7OA 2JZ5A 2DNMA 2ZHBA 4ED4A 1Y11A 1BE4A 2IDEA 5KG5A 4OX7A 4OHXA 2EG1A 5AE3A 2KT3A 2HKEA 1CJTB 5LL6d 2QMXA 4YHHF 4ZVSB 2YKNA 2HG4A 3W8PA 3D3BJ 2HHHJ 2IVMA 1C0TA 3H40A 5LXYA 1REGX 4WE1B 5DM7Q 4PQUA 4ITSA 1O8BA 4K4TA 2EWHA 1NSKL 2ZFHA 5D6GA 2AV5A 1KHVA 4LF4J 4X62J 3R9LA 3U02A 4NLUA 2ZH1A 1N52B 4FF4A 3WQPA 2GW8A 5K8NA 1M0SA 5DQHA 1VBXA 3AY0A 1LV5A 3QGHA 2Y0SD 3PYEA 2XCAA 2VQEJ 4QYRA 1MN7A 1N33J 1HBUA 2OH2A 4C8ZA 3CDAA 4L3NA 3IWNC 1SH0A 3G71S 4Q44A 1UW4A 4MKYA 1N5SA 2G4BA 2RH3A 4OV6A 2MQ8A 4IFYB 2V9WA 2HFOA 3FBEA 3ZFVA 1JLQB 2CAJA 3DCAA 1S0MA 4OQJA 4KQZA 4GKKJ 3O44A 3MFHA 3CD6S 2WVDA 1X5PA 5KFPA 2K3IA 3MD3A 2LXUA 5B0GA 5HSPA 2B9YA 4H4KA 4LRCA 5HQMA 3RBXA 5KFYA 2V5HG 2NS1B 4G1PA 3DI6B 5F8NA 3QYYA 4JI1F 1RA6A 4G1IA 3KUHA 3HHKA 4JI5J 2W1BA 2V2KA 5M2UA 5A8KB 1F1BB 5LMUJ 2HHWA 1GMUA 2IMOA 2AZ3A 3G4SS 2IBKA 4TN2A 3MOZA 3DRPA 3NWRA 2H5JB 3PKMA 1JLCB 2DNOA 1ZM9A 2GIFA 2ZDOA 3I5CA 5D8HB 2J76E 3NNAA 3FKBA 5DDPC 1U1QA 1PIEA 2I8EA 3JSYA 1NDCA 2YWEA 4NXMJ 3ENWA 5CD4A 4QYZJ 1RT2A 3GMGA 5HVFA 2V8DA 3GFXA 2XO6A 3OQ2A 3CCZA 2FLLA 3BKUA 2BUNA 3FZBA 1CULA 3LAMA 3NMAA 4RJVA 4DWIA 1N6QA 2M9KA 1A7GE 1YIJS 1VGYA 2WONA 4KO0B 2HEKA 2HQ3A 3DOMB 1FXLA 2A2CA 2CQ4A 2HMIB 1FD8A 2EK1A 1V5IB 4MAKA 2AJFE 3QGGA 1TUGB 1RCOB 4ZVQB 1KRPA 2W4DA 2GV1A 4WKRA 2G0IA 1J5OB 1RJJA 2IRYA 1AROP 2NZCA 2DY1A 3IAS9 4RX6A 3PO5A 3OSNA 3I0RB 2WSEC 2CJXB 4CP5A 3OL8A 4I69A 1AZSA 4ECQA 4CI0B 1U24A 1NK7A 3SYZA 2RD5C 1LNQA 5BR8F 2CA9A 3DM2A 4LFAF 3TA2A 3TJ9A 5JVGQ 3FCWA 2FHKA 1SQFA 4USMA 2RDIA 1SH3A 3OVBA 4Q8FA 3E01B 1MG7A 2Z8QA 2XBPA 4J9VA 3C16A 3GP9A 5FD1A 1FRIA 4YB6A 3JYTB 1VBZA 5SZTA 3SSSA 1T7PA 1K1QA 3RW6A 3J7YI 3MEKA 2YH0A 3HD2A 3QIPA 2DYAA 2M88A 4X64J 4FN5A 4H4MB 2ZUGA 2VICA 5FLXU 4HH0A 2W4CA 1WORA 5D0GA 1HNIA 3VALA 1RHKB 3RW7A 4CLTA 1RT4A 1U6BA 2W2NP 2HGNA 5T14A 4DPXA 1R8AA 2V2VA 3UD5A 4QIVA 3C46A 2AGOA 4DL0C 1SQGA 3DKDA 4QW8A 4FYXB 4OV1A 3OL6A 5IC4B 1U8SA 4DL4A 3R5AA 1HR0F 3K5OA 3T19A 2YNGB 1ACMB 2R7TA 2WHOA 5CYMB 1B3TA 4I64A 4X65J 3ULHA 5JXSA 1Q95G 3F73A 4YMEA 1MWZA 3GIKA 2W9CA 1LXJA 2QLFB 1IJFB 3MWBA 3ETMA 2ATLA 2DEJA 2R7XA 4I2QB 3KDOA 1DBDA 2V69A 2IM0A 2XSJB 5IM0B 4ZJQA 1J2VA 5EWEA 2MQNA 3PCOB 2PC6A 2C2EA 2NXNA 4OI0A 1IR2A 3PACA 5J2MB 2QX0A 3TX0A 5KFFA 2GZOA 5L1JA 4ZLPA 4KT0C 1B0PA 1HMVA 3CJQA 4ZMMA 2OEJA 2GNKA 1P6TA 2C3PA 4YDXA 3UQSA 1IBMF 1PJ6A 3ZO7A 2Z2ZA 2E1CA 1C0UA 1IKXA 2OO4A 3M8SA 4B9VA 3ILOA 3OFFA 3MM9A 2H1YA 1UVJA 4LFCJ 2YTCA 3DLHA 4O3QA 4CO4A 3L7OA 1GQEA 3DDIA 4C8YA 2M8HA 4O3NA 2E5IA 3ZTOA 5I3UA 2FLOA 3CC2S 1RCXB 4I2PA 3EDQB 4OX9F 1PAEX 4NLSA 3VF0B 2VDIA 1S4FA 3UDCA 2HNZA 2ROPA 4ID5B 3AB4B 2NYHA 1JJ2R 5DQGA 4DR7F 4K2XA 2EBGA 3TJ8A 2E1PA 3ZNUA 2DGVA 4Q0BB 3RR7A 2IYGA 1TAQA 2YWFA 3PTWA 3FVYA 2EKNA 4PR6A 4P72A 4N56A 1SUQA 3NLCA 1Q82T 1RWKB 4IOBA 1C1BB 5CH7B 1HWIA 5FDLA 2OPRA 4RWXA 2DR6A 4DV3F 4X4VA 2OPPB 1Q78A 1RTDA 4F8RA 3QGPA 3K5NA 1NO8A 2JEJA 3W62A 2GJFA 5CA5A 2V68A 4R5PB 3CD5A 6FDRA 1Y5LB 2QRRA 3KUEA 1FT8A 3MM7A 3GG0A 1P1LA 1XMQF 2J9EA 4B9LA 5EN1A 3HVWA 2GVZB 2CPIA 1Z4UA 2RS2A 2F9DA 2EPIA 2DO4A 3EICA 4UTGA 1DLOB 4NLPA 5CHCB 4ZCIA 4O3RA 4JI4J 2FC9A 1NDKA 1QAYA 3BQ0A 4HTJA 5CYQA 1EP4B 3CDEA 2L9NA 4OHYA 2HGMA 2VIHA 1NPPA 3FSXA 2MQOA 1GXTA 1Y00A 4C11A 2UUWA 4DV4F 3EUNA 3R5GA 4WIIA 1IKWA 4TY9A 3HVTA 2NXUA 4RO0A 1KSPA 4L72B 1D8ZA 1SJQA 3P3DA 2QMWA 4DX7A 4RUBA 3AXKA 5IQ6A 2QC3A 2HZVA 1RAOA 3Q83A 2MB0B 1X9WA 2V94A 1N54B 2J0SD 3H0PA 4GKJJ 1S5ZA 3R97A 1NXIA 3I5BA 1L5UA 1Z1ZA 3FEZA 3BBCA 3PM9A 4LQ9A 1DURA 3EDRB 3N4WA 2ZJPQ 1UPMB 3CGIA 1NJZA 4TU8A 5L8RC 1WWHA 3HF5A 1DTTB 4KH0B 3WC0A 2FJXA 4WYLA 2AYBA 2JL9A 2HFVA 3JQJA 1BQMA 1B99A 4AL6A 1P9YA 4DFJA 2B0GA 1NH8A 3SQGB 3TR5A 1VQ5S 3B78A 2N3LA 4IG0A 4HI1A 4MYUA 4QPTA 3FSYA 1DQ9A 5GAGU 2YPZA 2D3ZA 4OYWA 4UUWA 2ZOGA 4C7QA 3G8SA 3E3XA 3KWMA 3AODA 1RTJB 1VQ4S 2QG9B 3HHLD 3A1YG 3AXMA 1NLKL 2ZZMA 1ZETA 1SV5B 3PIOQ 3M2RA 5I42A 2DHSA 4DG1B 3SEOA 2F5GA 2WRMA 4KRWA 4A8SA 1WTFA 1F9EB 3M7VA 2FQQB 4QIGA 3WC2A 1KBRA 3FK4A 5KFBA 3QBCA 3N6LA 2AX1A 1S72S 3MEDA 1NKEA 4F0KA 3GCXP 2DGSA 1NSQA 4NA3A 7FD1A 1WG1A 2SXLA 3HVAA 4X4QA 3HM9A 4H4KC 4H4OA 4Y2CA 2QE5A 2KG0A 5C25A 4ANEA 2KRRA 3IM8A 4CWBA 2ZDPA 5EUHA 4K8RA 2MYFA 4N76A 5DGBA 3GYNA 3ZZOA 4GMKA 3QWPA 4ZLJA 5ETNA 1MU2A 3H8YA 1T05B 1PG5B 3A3OB 4DR6F 3OXFA 1EZZB 1ZM3A 4EO6A 3VAMA 3O5TB 4LRDA 1Q1KA 1EETB 5KFQA 1RTIB 2OEMA 3NGSA 5IZHA 4NEYA 1KVKA 2OTLS 2AT1B 1U1RA 4IRKA 2O5DA 4I1TA 5G0RB 1VRUA 4OLOA 2RVJA 4NYZA 2J0XA 1G7CB 3D2WA 5D78A 4ECRA 2B9EA 1S1XB 1HA1A 4M5NA 2H5EA 4ZN1A 2ZBPA 4P2XA 2W2PP 1PILA 2RRNA 1C4CA 3FBCA 4Y0FA 3K8WA 2YKPA 1K47A 4OYPA 1VHIA 3BR8A 3DYAB 3Q24A 3T5JA 1RLDA 3T1YF 1QE1B 1TK8A 1TMMA 2VBWA 1YZ7A 2MY8A 3T5KA 1HPZB 3UE2A 1O5JA 4UF4A 2D3OR 2WTFA 1EJ7L 3V6DB 4KGKA 2E5LJ 1KQFB 1N32F 4IH5A 1HD0A 2KL8A 2HYIB 2IA0A 2DHHA 4UZCA 2OSQA 2OMLA 2FLPA 2YWKA 4CM0A 4AT1B 1SPBP 4B3OA 1VDHA 2F63A 2HQIA 4ZVOB 3PEJA 3LP0A 2NLWA 4JI7F 4DXLA 2RDJA 2DH8A 1X4HA 2G13A 4DU7A 1A9NB 3A4TA 2L9DA 3PDNA 1N34J 1RI7A 5E7OB 3G2XA 2B8QA 1FO1A 4I67A 5F0WA 3CMQA 2FIUA 4U8YA 3PW7A 1S1UA 3FCHA 1QD1A 4F3OA 2KYZA 4NLXA 1NK4A 3MAAA 2R2SA 4ZPCA 3OUYA 1QDUB 4DV6J 5KFAA 3CW2C 1LWEA 3HSZA 5BYRA 4IDKA 3W66A 2OPQA 3BH6B 1KOHA 2C28A 3LGMA 3G86A 2MZRA 4PG6A 2AKWB 3M6UA 1BQXA 3NEKA 2QFJA 1NU4A 1TKXB 4ERDA 1RUSA 4ED8A 3JXOA 3P4UB 2YX1A 1GTEA 3PW4A 2IAJA 3CIZA 3WX8A 4OIXA 3W60A 1ZA2B 1D9AA 2GHWA 5A6WA 3CJ8A 5J2QA 4URGA 1YLXA 1WI8A 3Q8RB 1R6YA 1FEHA 5M2PA 2JEIA 4NE9C 1LFPA 1S99A 2YNIB 1RHUB 1F5BA 2K7JA 4S0MA 2GQCA 3CT9A 4WP8A 3TAMB 3M4XA 2DK2A 3VZHA 2CADA 3UN3A 3MFIA 3EYZA 2BXJA 4OI4A 5AXNA 4YR3A 5LMNF 3PR5B 3WX4A 2EFPA 1OIAA 3MPVA 1VQ9S 4UY8T 3K5MA 3VWSA 1Y3KA 1UWBA 1JKHB 1HBNA 4OX8A 1HQEB 5LSOA 4DCJB 2YKMA 3F44A
chains in the Genus database with same CATH topology
2DGQA 1S10A 2HMIA 3MM5A 4ILRA 2KI2A 1T8EA 4P7VA 1RT7A 5DDQC 1UJ4A 2BR0A 2ZOMA 3TYTA 3CCRS 3KK1B 3PX0A 2IC3B 2OD4A 4DS5A 4YB5A 4DFMA 3HHDA 1LK5A 1K73T 2YKAA 3NCQA 1NH7A 4LIWA 4O3OA 3VAIA 2PE8A 1WHXA 2CJQA 2JLFA 2Y1IA 2OIHA 1IM4A 2AQ4A 1J5OA 1ZBTA 4FF1A 1RISA 1NK5A 3EX7B 1KLMA 2POKA 3O8WA 1QAIA 4C4WA 1UFLA 5KT4A 2JWNA 5KT3A 2W4PA 5G4DA 2WCXA 1TL1A 2VG6A 3M2VA 2OP5A 3MMBA 3I0RA 2W8KA 4FVMA 4UUXA 5EWGA 1DJ0A 4DR1F 2BDPA 4TXSA 1K8AT 1UETA 2GGPB 1QTMA 3HJFA 3S01A 2AF6A 1JLFA 2GHVC 1RK8A 2K2PA 3M32A 2MQQA 3KLEB 2IM3A 2DNHA 4X4PA 4ES2A 3DOKA 3MHYA 1APSA 2ASJA 2LQ5A 4WXWA 2X1AA 3KG4A 4M5DB 4B3SF 4C8OA 2B4VA 4LF8F 1CEZA 2B4PA 1HW8A 4E8UA 5HI7A 1NKBA 3P49B 1MW7A 4K4YA 2C22A 4DSKA 3OXGA 2CPZA 2AX0A 1TAUA 5GAHI 3OR2B 2HPUA 3FQKA 2MZQA 2HVZA 1QUPA 1YGYA 4KBIA 4J9LA 1OPIA 4EBDA 3M2UA 2DNYA 1ZAVA 1RKJA 3BO4A 3Q8QB 2RU3A 3O6QA 3B4MA 2BE2B 3LP2A 3W7BA 4OFZA 4A8OA 2ZH9A 4BCAA 3OV7A 2CZVC 5KFEA 1C0UB 1IKXB 4CCHA 2Q6CA 3OFEA 3PHEA 2JVOA 2JC0A 1YITS 2DNRA 4QR0A 4N5SA 3E01A 4YR0A 3EXYA 2CJ9A 4OJ1A 2OFGX 3MM9B 4NPOA 1NK6A 2AGQA 1KFDA 3CJKA 1XR6A 5HP1B 3HZEA 4LSNB 3T3FA 1ZTWA 4V19X 2MY7A 4TLRA 1HWKA 3B4DA 2ERRA 3K2YA 5KFCA 1K9MT 2BANA 2RQKA 3M8QA 3JYTA 4D3GA 3BDPA 2QLXA 3KNAA 1R3NA 1VK3A 3PJXA 2W7PA 4RNOA 2FUG9 5LSLA 1LWFB 2CQHA 4NWBA 1N48A 4O4GB 3I0SB 5F41A 2BA9A 3G6YA 2IRXA 1RTIA 2B5JB 2YX7A 3J7YU 4JV5F 1NKCA 1UVLA 3V6KA 4H4MA 2RMLA 2EG2A 4ES1A 5L1IA 5KFZA 1TFWA 2UXDF 4RNFA 3MECB 5I3UB 1WHYA 4ZVHA 3TVYA 4C9DA 4F4ZA 3DDKA 4EBEA 4JUZA 2UVUA 3QLHA 1TL3B 4DPOA 2GX8A 3DLGB 4C0OC 5T7LB 3M1VA 2A10A 4I2PB 4OZLA 4OZ5A 4PXDA 5K5MA 4DR5F 3EGZA 4O44B 3QO9B 3AQOA 5H9EJ 2IHR1 4AE5A 3L95X 4R8UA 2FJDB 1H38A 4ECZA 4ZKAA 5E3RA 4KR0B 4ZPBA 2DR5A 1VBYA 3CO9A 3ZZUA 3MMAA 3BJYA 1IQZA 3BO2A 1TUVA 2WAQD 3FFIA 2HNZB 4TY8B 2CPEA 1Q79A 4Y34A 4ZVGA 3DU5A 2R2RA 1M5SA 3UCUP 1YVFA 4DQRA 4HLBA 1U1MA 4WTYA 4HDGA 2AJQA 2QO3A 3JSRA 4YFUA 4QWDA 3FMWA 3MM8B 3M6VA 1SI9A 2DBBA 3DYAA 5KFVA 3I32A 3CCJS 2FHOB 3TA1A 3E8OA 2F8MA 4DUZF 2YNGA 3RTVA 4Y2AA 2HNDA 1S1VB 7FDRA 3CCES 4K4SA 1QE1A 5A8RA 4JI2F 2F4VF 2I1RA 2XI2A 1JNRB 4F4KA 3D5MA 2ADBA 2DRAA 5CYMA 3SDEA 2WK4A 4N8OA 2FHJD 3MI7X 3SV4A 3IXQA 1BQNB 3SSQA 4OI1A 4NLQA 1HPZA 2FVCA 4HI2A 4JOUA 2WOMA 4U7CA 4NYOA 5HLFB 4LVOP 3GFZA 4OHWA 3KHGA 1TKTA 5JJBA 3T5HA 2AYMA 1G3OA 1SUQB 3I4HX 3NAHA 2MQPA 1GAOA 2JRSA 3VAHA 4JV0A 1UEVA 1FJEB 5FDLB 4BWMA 2V9KA 4DDFA 1D9DA 1H7WA 2XI3A 1FRMA 1WHWA 2GMLA 4J9OA 2G1DA 4G1QA 1Q53A 3H2UB 4KSEB 4Y2MA 3K5LA 4DS4A 4DFKA 3ITHB 4QJVA 1RTDB 2ROGA 2RKIA 2YWHA 2N3OA 2XULA 2KH9A 5L1LA 2UVWA 2VODA 3QJPA 4F02A 4I2QA 4QR2A 3MAHA 4A8XA 4R0EA 4X2BA 4CO5A 2DTJA 1TFYA 1HYSA 1IN0A 2XSJA 5GADI 4B08A 1PGZA 1QVFR 1KVIA 5D3GB 2K1RB 2V8HA 2BW2A 5IM0A 1UVMA 2AJ0A 3MM7B 4MFBB 3MR5A 4UQTA 3SFGA 3WDOA 2DISA 1KVJA 4C8KA 5FIIA 2GC8A 1S0NA 1MNEA 2DHXA 1CQMA 1X8DA 1N8RT 1F0XA 1RDRA 2HHHF 2KRBA 3THPA 5J2MA 5KT2A 2OD6A 4C3MA 3KLVA 1X4DA 2LU2A 3R5DA 4ES3A 4G6VB 1FCAA 4DFPA 1U2RA 3GFYA 3IGVA 2KM8C 4PWDB 2JEFA 2J9DA 2ZKTA 3R3TA 4I4BA 5A8WA 1FNXH 4Y3CA 4LF4F 2L3MA 3CULA 3MZIA 3I96A 5D4OA 4X62F 4KJIA 2Z2MA 4XO0A 5CYQB 3V2UC 1XN9A 2OAUA 1HW9A 3ENVA 4CZCA 5C5JA 3SSRA 1FNMA 2CFXA 2X1BA 3NS6A 5KG3A 3UR3C 4NRUA 1YSJA 3H25A 2L48A 4KAIA 2JC1A 4I7FB 4NCGB 3TVKA 2LQJA 3OHBA 1OQ6A 2GJ2A 1HI8A 4F67A 1UFWA 4F3QA 1D3WA 1SJFA 2UVRA 5IXUA 2DIVA 4NLRA 2N82B 3GV5B 4C11B 4ATNA 2QYCA 2ZD1B 4B02A 1S48A 3PZPA 4DL6A 5J2PB 3UD3P 4UY85 3L09A 1KC8T 1W2BR 5DQIA 1OWXA 3VR1A 1WNEA 3NNHA 3M30B 3HVTB 3RAXA 1P8GA 2VQEF 3OVSA 4J9PA 4A8QA 4DV7F 4ZPVR 1HI0P 4JYAF 1N33F 2F1FA 2GO9A 2VPWB 2RRBA 4PXCA 2M3DA 2GCFA 5HBMB 4IG3A 4ICLB 2J7UA 2FHMA 2KT2A 1Q16B 2CQ2A 1MMLA 2UUBF 2UUCF 1W2IA 2UUAF 4RW8B 4CTAB 4B3MF 3JSBA 2D3UA 5KOXA 3UWTA 2BJEA 2V8VA 1WI6A 5HROA 2AP6A 2B9WA 1IJEB 2LYVA 5ADZA 5J1NA 3PRBA 2CPJA 2B6AA 3F41A 2QT7A 3DMJB 2RF2A 4ECUA 3US5A 1QSSA 1S49A 2V4QA 4NL5A 4TU9A 5AXMA 1IKVB 5B0EA 2MQMA 2U2FA 5E2QA 4PG4A 2RE1A 1BY9A 4ALZA 1Y9OA 1FE4A 4XDCA 3MR6A 4KFBA 4A47A 4OZNA 4ZP8A 2HAIA 4JI4F 1R8CA 5HMYA 2YY3A 3ICLA 1NHUA 2IBOA 4RBUA 3CD0A 1AXQA 3R5CA 3I9V9 4ECTA 5IT9Y 4GKKF 2C3YA 1I94F 1U1KA 4CT9A 4K4XA 1U1NA 3KJVA 3BEGB 1VMBA 2RQ4A 2UU9F 2OFHX 5HMWA 1JB0C 4M1KA 3BZQA 3CSKA 3HKWA 5J1EA 4F4YA 4LSLA 3PY8A 1CLFA 1B0TA 2DCUB 1FVQA 2E5JA 2EFGA 3H5UA 1WEZA 5C24A 6FD1A 3DDNA 1HNZF 3V4IA 3Q0AA 4IO1A 5KFLA 3OW2R 2LQ9A 3W2WB 3KOAA 4ID5A 2YNIA 2AW0A 1U25A 2BBEA 1X4CA 4ZHRA 4B9NA 2H9ZA 1S6UA 4USJC 4GC6A 3LGNA 2UV8A 1OO0B 1ULRA 2VQFF 1IBLF 3F56A 4J9SA 4AQYF 3LP1B 2ZZNA 2A3JA 1XNQF 2OSRA 4LJMA 4QBUA 3UFCX 3CWJA 4HL9A 1U2FA 1NK9A 4OZ1A 4JI5F 2N4CA 3IWXA 3OXLA 1BQMB 4NCAA 3TNVA 1LKZA 1RTHA 3DXBA 1TR0A 4QOTA 1SIWB 2YVSA 4RU2A 2CPFA 1S9GA 2I0XA 4RWWA 4U7UK 2PA8D 2GJIA 5LMUF 4PG5A 3UNGC 2NREA 3N9UC 5KFDA 2P9CA 4K5SA 1JLGB 4NZ0A 2UXCF 4ZPTR 5GAGI 3CJ3A 4ZCKA 4ETZA 1PC5A 2AU0A 3HKZD 4Q7AA 2NR0A 4IG0B 4ED1A 1C1BA 4KHRA 2RB7A 1R8BA 4ELUA 2BQUA 1ZYQA 1VJWA 2R7QA 3HPOA 2QA4G 2PI5A 3QJLA 4UOCA 2F7VA 3GIIA 1D0EA 1S6PB 1UKUA 2PA3A 1XK8A 1XR5A 2DNNA 1O51A 2MSTA 2OPPA 2EFNA 2ZNYA 3BGUA 5F0UA 2ZNZA 4EGLA 2I9SA 4H54A 4RUHA 2VASA 3UI3A 4C2MA 3Q2TC 3NG8A 3LWLA 2HFNA 4RW4A 3BB5A 4ED6A 1L3KA 3DLEA 1RAJA 4KIAA 3W2VA 4DBQA 1LQ9A 3N79A 4OJ3A 4QU7A 3UCGA 4FXVA 3GILA 2ZJQQ 3TOQA 4R5PA 1U1LA 3IRXB 4JI3F 5F9LA 4HH1A 4MK9A 3TUZC 3OJUA 1U49A 3IC1A 1DHMA 1FA0A 1TVRA 4FF2A 2DCLA 3CMAS 1T3NA 4R0JA 1FDNA 3CEDA 3TO8A 4DL2A 3IS9B 2ZHAA 2MJNA 3TUIC 2OKQA 2FHJA 2K8GA 1FRXA 3RBEA 2LLZA 2R7SA 2NZ4A 1VI7A 4EBCA 3IR6B 1HARA 2J7WA 3C6UA 2JX2A 4Z37A 1S1WB 1RGVA 2PFFB 4QPXA 3RRHA 3G6ES 3M6WA 2FC8A 4NXMF 3M2RB 5I42B 4FYDA 3D0IE 1DLOA 2HRYA 3V81A 4LT6A 2GQQA 4XPEA 2YH1A 3JTOA 2X3GA 2BV3A 4C3LA 5F8MA 1HNVA 4JI6F 4F25A 2ABYA 2CQ3A 2ASLA 1GT8A 2VOPA 3DFEA 2ASYA 1SKSA 5C42A 3RRGA 3IWLA 2F3JA 1N88A 2GGPA 3KLFB 1TV6B 4NLYA 1UMJA 2CPYA 4C8MA 1RP5A 3H5YA 1RT1A 4K4VA 1NNDA 1EP4A 2I38A 3NCPA 3KLEA 3OTOF 3IN5A 2XMKA 3MPYA 2CQ1A 4ED7A 3FEYB 3THVA 4RUAA 3MEDB 1LK7A 1T03A 2DR7A 3SXLA 1V3ZA 4ZP7A 1P9QC 5L38A 2DR8A 3EXCX 1VOMA 1Q4RA 4G3IA 4WXOA 2B4OA 5K14A 1NK8A 4H4OB 4QIEA 2FB0A 2VG5A 5C25B 1H98A 4MJKA 2NUUG 1GXUA 2DJWA 2DGTA 1K0TA 4TU7A 4DR3F 2DHAA 4GC7A 1HD1A 1FF2A 3I87A 3ENQA 4XPCA 2D9OA 3KYLA 1JXLA 2HIQA 3PO4A 3CDBA 3MF5A 1ELOA 1LW2B 2YX4A 2DPIA 3SCKE 2BM1A 1V3SA 4XAKA 4P2SA 3CCMS 1S1TA 1LWCB 3MUVP 1JLBA 1NJIT 4J9KA 5J2NA 1YRXA 4MKAA 1IQTA 1R0AB 1UVIA 3GQCA 3LANA 5K8OA 2AWZA 4KGMA 5AJ3F 4QWAA 2F8EX 2VA3A 3E2EA 2ZH4A 5B0DA 4MK8A 2O66A 4PUOA 2GHPA 2XY6A 4IKAA 2GA7A 5F9NA 1FKPB 3RRKA 3KG0A 4LSNA 3H2LA 3BN4A 4NLVA 5DO2A 3H59A 2V0NA 5KFIA 2Z2LA 2MMYA 2JOQA 2LA4A 2DNLA 2F9JA 3NWGA 3AQPA 1N56A 2J6UA 1CVJA 3O1LA 1FESA 2KZZA 2D74B 3CVKA 4PKDB 3U1MA 2XCPA 2ZH2A 4O4GA 3I4PA 3JTNA 2ZBIA 4PXEA 4RNNA 3KNGA 1VIOA 3ISND 5DETA 3OSPA 2X1GA 5EDWA 4O0IA 3B8HA 1FERA 3M8RA 4EZ6A 2RJZA 3N5BA 1U48A 1JIHA 2AYEA 1VRUB 4RW7A 4RW6B 2W9BB 5K8MA 2O1PA 1YQHA 2U1AA 3MGJA 1XWLA 3CCTA 4X4UA 3K0JA 4P7TA 1TL3A 1C1CB 4DMZA 5LT5A 1FK9A 2VPZB 5L1KA 2J9CA 3CMES 3HMJG 4NRTA 4FXWA 4KV8B 4AL5A 4WYWA 2E9RX