2EW9A

Solution structure of apowln5-6
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
149
structure length
149
Chain Sequence
MAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHASLAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human Wilson protein domains 5 and 6 and their interplay with domain 4 and the copper chaperone HAH1 in copper uptake.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Copper-transporting ATPase 2
total genus 33
structure length 149
sequence length 149
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ew9A01
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ew9A02
2BBEA 2OFGX 2FB0A 2GFFA 5B0EA 2ROEA 1R6YA 1S6UA 1K0VA 1FVQA 3BF4A 1VQYA 4A4JA 2OD4A 1MWYA 1P8GA 3I9ZA 1XBWA 1TL4A 3QGPA 3FGVA 4Y2KA 4OJGA 2QLWA 1GXUA 1Q4RA 1APSA 2OKQA 2AP6A 2HIQA 4OJ1A 4HI1A 5B09A 2BYCA 5B0BA 1YJTA 3CJKB 2FIUA 4NL5A 1Q8BA 4Q2MA 2QYCA 3BDEA 3DCAA 4OJ3A 5B0GA 2IYIA 1AFIA 1WD6A 1OSDA 3CJKA 3IWXA 1S6OA 5B0CA 2GCFA 2ZDPA 2OAUA 4FNHA 1V3ZA 2PD1A 3BGUA 2PGCA 4Y2MA 5T7LA 3DXSX 1CC8A 1P6TA 2XMUA 3QMQA 1FE4A 4HL9A 2W4PA 3T9NA 2GGPA 4A47A 4DN9A 3LGNA 2EW9A 2AW0A 5B0DA 1YJRA 4A48A 2XMKA 2QLXA 3KG0A 2W4CA 5K9FA 4A46A 2LQ9A 1SQEA 1U7LA 3HHLC 1OQ3A 3BR8A 2ROPA 2OFHX 2AJ0A 3FMBA 3HDSA 1OQ6A 2N4DA 4HH1A 2N7YA 2N4CA 1AFJA 2G9OA 3FRYA 1LQ9A 1N5TA 1TZ0A 4YDXA 1CC7A 2FHMA 2LXFA 3E8OA 2ACYA 1FD8A 1MWZA 1AW0A 2ZDOA 5IXUA 4ZOSA 2BJDA 1SB6A 1OPZA 4YEAA 2K7KA 2AJ1A 1N5SA 3VTIA 1X0PA 4DL0C 2HFNA 1KVJA 2OP5A 2W4DA 3K7RA 2OD6A 3LO3A 1JWWA 5KAKA 4F67A 4FNIA 4OIXA 3TOQA 3KNGA 4Q2LA 1VQSA 3MZIA 2KKHA 1N5QA 2ROGA 1N5VA 2K7JA 2XMMA 1FE0A 1YJUA 2GO8A 1X7VA 3HHLD 3LGMA 4ZA1A 3HHLA 2LQBA 1W2IA 4OJHA 2GGPB 4HH0A 4U9RA 2VH7A 1CPZA 2KT2A 3HF5A 5B08A 2RSQA 1ULRA 3HFKA 5T7LB 1TR0A 3HX9A 2K2PA 2XMVA 3MCSA 1Y3JA 1JK9B 2RILA 1YG0A 1Q8LA 1TL5A 1SI9A 3KG1A 4DPOA 2BJEA 5A6WA 1KQKA 1FVSA 3BB5A 3TRGA 1URRA 2ASYA 2K1RB 3BN7A 2HQIA 2HLUA 2L3MA 4Y2IA 5B0AA 2HFOA 1GXTA 2RMLA 5A6PA 3WDOA 1YRXA 1FESA 1FEEA 2XMJA 2IFXA 2LDIA 4QOTA 1Y3KA 2JDJA 2QIFA 3F44A 2GV1A 2OMOA 3UDCA 2KT3A 1IUJA 2KYZA 1Q53A 1TUVA 2HLTA 2XMTA 3TNVA 1KVIA 4EFAC 1Y0HA 1YJVA 1X8DA 2VV5A 5B0FA 2RU9A 4HI2A 2K1RA 3HHLB 3KKFA 1Y9OA 2IYGA 2Q3PA 4NPOA 2XMWA 2FTRA 2CRLA 3GZ7A 1QUPA 3BM7A 2BUNA 3IWLA 1RJJA 5F0UA 2GA7A 5F0WA
chains in the Genus database with same CATH superfamily
1T02A 3AA9A 4NXMF 2BBEA 2GIQA 3ZZPA 1N6QA 2HHQA 3U7JA 1D8ZA 2ROEA 1R6YA 2MZJA 3EGNA 4C4WA 2MZ1A 1T9YA 1MMNA 2QA2A 1KTVA 2DGUA 3H2VE 2YX7A 4UUXA 4DUZF 4NLYA 4DR5J 2E9TA 1IQTA 1Y5NB 4FS2A 4LR9A 3UW1A 1E6VB 1TELA 2NUUG 3NY0A 4N5SA 3IR5B 1SC6A 4U67Q 1XR6A 4CLYA 2D3O1 1V3SA 1NK5A 1Z1ZA 2ABYA 2CDRB 1DZ5A 5FIIA 2Z4PA 4UOFA 3AOCA 4PUOA 3DCAA 2VQFF 4HTIA 2AGPA 2IVMA 4OZ2A 1HBUA 3PDNA 4M5LA 3W5ZA 5M2UA 3CO0P 4B3OA 3G2XA 1X4CA 3S1TA 2RDDA 1T05B 4E2FB 2HAFA 2ZE2B 2CADA 4DX5A 7FD1A 1IBLF 3X3UA 4NLRA 5K5MA 1O6XA 4OZ5A 1CC8A 4E98A 2BE2B 2L9WA 4M95A 4PUOB 2R3VA 1U8SA 4LREA 4RL1A 2ZZNA 2Z2MA 3GJQB 1RZMA 4ZVFA 1S1VB 1S59A 1BQNB 1R89A 2KRBA 3RAQA 3TQEA 7AT1B 1X4EA 1OY6A 3EJMA 2YKQA 2BRLA 2WSEC 3FKBA 3MMBA 4GRSA 4ANCA 3PX6A 4F4YA 2J7UA 3NCQA 1SBRA 2VFRA 2LA6A 4F0KA 5KT3A 1RWXB 4FYWB 2R7WA 1R0AA 2R8GA 2ADCA 1DLOA 1S0OA 2N4DA 1R3NA 1RAHB 2HS3A 4TLRA 1UVMA 4RBUA 3ZZ0A 1PSDA 1YBUA 4TU9A 2R7XA 1KLMB 1VFJA 2R4FA 3V4MA 1N52B 1AW0A 2E5IA 4ZKAA 2V0NA 3BSNA 1FNXH 4K8RA 4N77A 4X2BA 4CDIA 5EUHA 4DL0C 1FKOA 2KM8C 2E9ZA 3RB0A 4B3RF 4DL2A 4WZMA 1REVA 4LF5J 1EP4A 3M32A 3CCVS 2W7AA 1H6KX 1NSAA 1PJ5A 4J90A 2ZJPQ 2C2DA 4MKYA 1X4AA 2XO6A 3CCRS 3PRVA 2M3DA 4J9MA 2XG8A 1Y5LB 1DRZA 4L3KA 2F1FA 3PEHA 2R7QA 3HK2A 1F2GA 1HIYA 1X5OA 1NO8A 4LQ9A 2XGQA 3FBFA 2EK6A 3IS9B 1CPZA 3BGRA 4WZQA 1XMOF 4RX6A 1VDHA 1VS3A 1ZA1B 1RABB 2WBMA 2QL5B 2WVFA 3EXCX 3NOCA 2DGTA 4QIGA 2F65A 4RR5A 1WHYA 3JAMY 3M30A 5DDOC 3HPOA 3TRGA 3HVRA 3A3PB 5J2QA 4ZPCA 1N0UA 4RZRA 1WWHA 3NGRA 4JBCA 4ED3A 2HLUA 4KV8A 4ZS6A 4EBCA 1UVNA 5A6PA 1SIZA 1WTFA 2ALYB 2CPYA 3A12A 4RWWA 5KFUA 5F8IA 1EJ7L 4X4TA 3KYLA 3TZZA 1XC9A 2CQPA 1QSYA 2DXFA 3GONA 1M0SA 4I4BA 1Q53A 2CWXA 4QIVA 4N7TA 4CP5A 3QRQA 2F9DA 2B6AB 1EETB 1CJVB 2PA3A 4BWJA 4NLGA 2CNNB 5KFSA 4DOZA 4LRFA 3QSYB 3BSCA 2PFFB 2JH3A 4EZ9A 5D0HA 5EGYA 2N3OA 3H4DA 2V34A 3DHXA 4JI3F 2Q66A 2E7XA 3HHKA 1N36J 1UEUA 3M2UB 2I5JB 1FWPA 3GYGA 3QT8A 2G4BA 2VBYA 5DDQC 2LA4A 2EFOA 2CJXB 5D6GA 4CO5A 1QD1A 4OJGA 1L5UA 3G8SA 3ZZOA 1HNXJ 1U0HB 2O1PA 3CJQA 2HHPA 4LT6A 1SJRA 5LMUJ 2LU1A 1VJWA 1C1CB 1SC3B 1Q8BA 2CZ9A 3EGWB 2V4QA 4QCLA 2B5JB 2OEMA 2RT3A 3TJAA 3N6NA 4NEYA 2VL1A 1FNMA 4DG1B 1C0UA 2OPSA 3IG1A 4FF1A 2RUGA 3AAWB 2CWKA 2ZBIA 1CG2A 1V3ZA 3QGHA 5C2GA 2QX0A 3BGFA 3FNNA 1QE1B 2RAQA 3OR1B 1GFWB 4MAKA 4DU8A 1NK0A 3T3FA 2OMLA 1FJCA 1NPKA 3OFEA 2XY5A 4PWDA 3VVTA 4CO2A 3O8WA 4QPTA 3JYTA 2QMWA 3RB3A 5B0DA 3PEJA 1MNEA 2AQ4A 2B3TB 3PR5B 4ZITA 5CZXA 1KEKA 4A46A 5A8KA 1U7LA 2GC8A 2HZAA 5EDWA 2MYFA 4ITSA 5LMUF 1LW0B 4OZLA 2RRNA 3ITHB 3N79A 4WXWA 4UZBA 1HMVA 3C66A 4HEA9 3GMGA 2KN4A 1VLOA 3FQKA 3KK1B 4P2MA 4F3OA 5DETA 2BANA 1T3NA 3G9CA 1KS2A 2RF2B 1AFJA 2LXUA 1LQ9A 1N5TA 1Q16B 1JNZB 2KXHA 3MMJA 4G1PA 1RGVA 2QL9B 2DISA 1KBRA 4ZMMA 1FRLA 1VQKS 2W9CB 2A6MA 1VGYA 3DRSB 5MLCV 4KSEB 3MPVA 4E0DA 4UT4A 2HW3A 1RYSA 2D41A 3R9LA 3D66A 1N32F 1QAYA 1S1UB 2OD6A 3DLKA 3LO3A 2HVDA 4DLEA 4F02A 2B4VA 5LJ5Y 4HHHA 4ZCMA 2AGOA 1NM2A 1HNVA 2RB7A 4C11A 5I3UA 1BQNA 5M2PA 1GT8A 1S97A 1NSKL 4LRDA 2ZHOA 5G0RA 4KHRA 3RUBL 1U1QA 4W90B 3ZO7A 1YBAA 3MUTP 1TR0A 4IFYB 3UNGC 4B3SF 3QNWB 1Q7YT 1SQGA 4DV1J 4RU9A 1M1GA 2RILA 1H7XA 2VHGA 1PILA 2ZEJA 4WFYA 4O44B 4N56A 3KMSA 2OTJS 3DMJB 1PYSB 4JI1J 1UVLA 4FVCA 3UCZP 3MEGB 2B0GA 2Y3YA 2ZOFA 2ZKTA 3PX4A 3FFIB 1Q86T 1VISA 3R7BB 4Y6IA 2KG0A 2HHHJ 3O5TB 2F4VF 4DV3F 1AUSL 4UF4A 1E6VA 3KFWX 1HBOA 5HROB 1OS5A 3UD4P 4ED5A 1A0OB 1NLKL 4K7QA 4MFBA 3JTPA 2VV5A 3QT7A 5CYMA 2RU9A 5A8WB 2HYIB 2KZZA 2XMAA 3A8IA 3MM9B 2IYGA 5A0YA 3PRDA 4DZDA 5IS2A 1QSLA 4O3QA 3CSKA 2MZTA 2BE9B 2WSCC 3M1VB 4NPOA 1T9UA 4WF9Q 5ETOA 5KFYA 3PHEA 2PMWA 1ZPWX 1VHIA 4OYPA 3GV8B 1P9QC 2GFFA 3GFZA 1UEKA 3FZBA 4NMXA 3SDEB 4KR0B 1LW2B 3IBFB 4KYZA 1T03B 4OI3A 2MJUA 3ITHA 4L3NA 5F3ZA 2AKWB 2XWYA 4ALZA 2VFTA 3G6ES 4GKJF 3PYGA 1UFLA 4JI5F 2VFSA 3VAIA 2CPFA 3BN4A 2ZH8A 3MWBA 1F0XA 2ZC3A 1NUEA 2DR6A 2BRKA 1KHWA 4NASA 3CTRA 2DNHA 5HVGA 2Q6BA 2HHHF 4BBYA 1Q0NA 1QDUB 2OPPA 4OX6A 3THTA 3ZTSA 3TUZC 3KLFA 3T1YJ 1FKAF 1UWBB 3MM6A 1HQEB 4RUHA 4B3TF 4FF4A 2JNJA 3BREA 1IKWB 3H7HB 4R8UA 4KTQA 5T7LA 3J80U 3MUMP 2B5JA 4NE9C 2JEFA 2HZCA 2MLXA 1X9WA 4I64A 2FC9A 4F4KA 4RW8A 5A2QU 4DV1F 1BXNA 4QJVA 4I2QA 2C2OB 4ZJLA 2AMCB 8ATCB 2VBXA 4CLFA 4Y3CA 1F3FA 1HI1A 2UUWA 4JI8J 2HKEA 1VQ7S 1RDRA 3UDEA 2M88A 5K9FA 3CCQS 1SQEA 2W2OP 1H98A 2LCWA 4WTOB 1P1TA 1RT6A 4RU2A 1V3RA 3UCGA 2V8HA 4ZCKA 1PGZA 2AJ0A 4HT5A 3IM9A 2YNHA 2BJ7A 1FKPA 4CH1A 2DR5A 3L4BC 3NEKA 4GVBB 5K8MA 2UUCF 4IR9A 1A9NB 3I6PA 1J2VA 2H3EB 1CC7A 1F3VA 2A1BA 4NZ7A 5GAHU 2FJXA 4ZVHA 3KOAA 4EU0A 1VC5A 1WORA 4LF6J 4FYVB 4ED6A 1QSSA 3IN5A 4DSKA 4IRDA 4NOHA 2R8HA 3L95X 2VG6B 3KHRA 2HHWA 1RWNB 3IGNA 5E0OA 2VG6A 4B3TJ 2RQMA 2VDIA 3I4PA 4FPIA 4NRUA 5LOQA 4RNMA 4KT0C 1IBLJ 3EDRB 2MPUA 4LF7F 2KDOA 3MZIA 2PE8A 4P74A 5HBMB 1R7IA 3CGIA 3TUJC 2NUHA 2XMMA 1RT5A 3OVAA 3E2EA 5BYQA 3DNCA 3TEGA 1P9YA 4EO8A 4OHVA 2CJQA 3QT5A 3SV4A 3OXLA 1D1UA 5C7PA 5F8LA 2VQEJ 4R5PB 1RTIB 3OQ2A 2EC2A 2GHPA 2RSQA 1J5OA 1XR7A 4IOAQ 1IKWA 1U6FA 1IKXA 2MSSA 3G4SS 2V68A 1SH2A 3UN2A 3SV3A 4D3HA 2V5HG 4C3LA 4WFXA 4KB7A 4C0OC 2E1PA 5CA5A 2FVCA 1BC6A 1RT2B 1NHUA 1YJ9S 1VR6A 3M8QA 1GTEA 3R5JB 3JXOA 4CO4A 2DVIA 2FHJD 4QBUA 3CMES 1S10A 1FJEB 2UUBJ 1FESA 2ZFHA 2FQQB 2ZKUA 3D4JA 2HGNA 3NGSA 3PHTA 2RDJA 3NMAA 3EUNA 4KGZB 1NK8A 2EBGA 3GIRA 3M32B 1QY7A 4P73A 5AE3A 1REVB 1VC0A 1NK9A 2DITA 5E3QA 2HHVA 1XMOJ 5EHHA 2YNHB 1X8DA 2HGLA 3UDVA 3AOBA 4ED2A 1G3OA 3UE2A 1HLWA 3DLBA 1XERA 1HWUA 2B56A 2MQQA 4X4VA 4ZVQB 2Z2LA 4NLVA 2V63A 4H4OA 2FTRA 3KTQA 3DYAB 3IWLA 5KAKA 2RKIB 1UA0A 4CIOA 4DV2F 1TUWA 2C2MB 1S6UA 3E51A 4MT1A 2NS1B 4A4JA 2KFYA 5HROA 4WWSA 1TL1A 1B0VA 1A6LA 4O23A 4OHWA 3QSIA 1LWFA 3M8SA 3DI6B 3DOLB 2Q1LA 3D68A 3ICLA 1SQFA 2F8MA 2FJDB 4P7TA 3QGGA 5CYMB 3TVYA 5A8WA 3TAMA 1IJEB 2LEAA 4DS5A 2FIUA 3D9BA 2OI2A 3H40A 3TEHB 4LF4J 2FLPA 4UY85 3DMJA 4KE5A 4Y00A 2RD5C 4DCPB 1AUDA 1FHTA 3ENWA 3D54A 1BGXT 4K5RA 5J1PA 1V6HA 2XS2A 1OPIA 5J1EA 1RTZA 2OAUA 3D67A 1JKHB 3N5BA 2HHTA 2E5JA 3H59A 3U1LA 2IJFA 4CI0B 4ZIWA 3R6GB 2MGZB 3OSNA 1RT3B 2CJYB 3MEEB 1ZM9A 2DHHA 2WW8A 5HL7Q 2QFJA 3QATA 2VA3A 3DOMB 2G1HA 3N0VA 4J9UE 3RGIA 4A8OA 4KGKA 3CDUA 1TK8A 3I5BA 3KG4A 3AFGA 3FCHA 1MMLA 2G13A 3I32A 4Z7YA 2X1FA 2M8HA 3ZZUA 2J7KA 1LOUA 3GR0A 1H73A 1AXQA 1WHWA 1JLEA 2DNGA 3GJTB 4R0EA 3TX0A 1H2UX 3VV2B 4Z2XA 2ERRA 3RRGA 2KZMA 4KH0B 3SFGA 1SIWB 4X4UA 4UOHA 1DFDA 2C3YA 1WC5A 2LDYA 3MPWA 2FZGB 4RW9A 4X65J 3T1HF 4B3RJ 2NSBA 1GH8A 1CJKB 1HD0A 1MW7A 1K8AT 3BJYA 1U1LA 4XTTA 5F8JA 1DY3A 3NWGA 3M9MB 2E5GA 2CNKB 5EX0A 4EYIB 1NJWA 2DO0A 1REGX 7FDRA 1TMMA 3CD0A 4BC9A 5ETKA 2W9CA 4DV5F 3AODA 2GHWA 4O3SA 8AT1B 1DAXA 4Y34A 3TX8A 2MKIA 1FJ7A 4GO7X 2OH2A 2KHDA 5A8KB 1PO6A 1TVRA 3GFHA 4JYAF 2HFZA 1YJUA 3LGMA 1X7VA 2WOMB 3V2UC 5ETSA 2JL9A 3CDWA 4MKBA 1BY9A 3OV7A 3V4IB 3Q2TC 3NBPB 2JLEA 1NK4A 2DNKA 4ZPTR 3MAHA 2AX1A 3OR1A 2MQOA 2AHOB 2FZCB 5E33A 4ZDNA 2JSXA 2K2PA 1ZA2B 2XMVA 3G6YA 2QSFA 1DJ0A 2C3UA 5DQHA 3CMAS 1JK9B 3OHAA 1X60A 3PFOA 3JYTB 4DR3J 3IBCB 1U6ZA 3FSYA 3HVTB 3M6WA 2D9PA 4DPOA 5IFMA 2J0XA 4YQWA 4O0NA 3R3TA 1RBOB 1WEZA 1NAQA 1S57A 3POTB 3NNCA 1PAUB 5B0AA 1NHVA 4I2PB 3H2LA 3HKZD 4PG5A 1YRXA 2RQCA 1Y3KA 3CDBA 1KC8T 4JI4J 4ELUA 3V6KA 3QJPA 5CYJA 2RRAA 3QZ7A 2MHNA 4HHJA 4M5MA 2LECA 3BQ2A 2XMTA 3M2VA 4EGLA 4EMDA 1GXLA 4YHHJ 3HSJA 4H4KA 2HQFA 3MR3A 1JJ4A 3X1LB 2JZ5A 3P96A 4OI2A 5J2QB 3M2UA 1RWOB 1FWKA 3V81B 5AXMA 3KNAA 3TARA 3TANA 1FI4A 1F1BB 1Y10A 2POKA 3ISND 3K8WA 4O3PA 3D1OA 4I7FB 4OYWA 2HIQA 2GA7A 2YKMA 5F0WA 1RP5A 2EFNA 4O3OA 5EWFA 4ELVA 3LAMA 5BR8F 2JX2A 1FRJA 2CQ2A 4LSLA 4NMLA 5KFIA 4RUAA 1VBYA 2BJ8A 1K9MT 2IPOB 3R5CA 3CD5A 4TYAA 4WIQA 2MTLA 4J9VA 1JLBA 4LSZB 4LF8F 2E29A 1FNOA 2VFVA 5E3AA 2FJWA 3QIDA 2JEGA 3I82A 3T5HA 4P2FA 1APSA 2AP6A 2X3GA 4K2XA 2DT9A 3M2VB 2VD3A 3G8TA 1RTDB 4RUCA 4RNNA 4OJ3A 1T11A 2UXDF 1OSCA 3M30B 2FGOA 3OTEA 3ZNUA 1F6TA 2HBQB 2C2NA 2W2PP 4PAAA 1SUQA 4F0MA 5GMKa 3CD6S 2H65B 2YNFB 1XTZA 2IAJB 5THWA 2GCFA 4KV8B 3HT0A 3POTA 4A8MP 4FNHA 1IVZA 4B08A 1VI7A 2KFNA 2D3ZA 2L48A 3HXMA 1SKWA 4HDGA 2ASDA 4YB1P 3VALA 3WX4A 2LLZA 2IVFB 1DQAA 2DY9A 3T9NA 2GGPA 3HJFA 4DN9A 5HMYA 1IM4A 3MCMA 2C42A 3T1YF 3H20A 2ZD1A 2AT1B 3CJ0A 1U6BA 4ECWA 4C8LA 3EVOA 4OHXA 5IT4A 2RHSB 3AQPA 1HYSA 1EP4B 1FRIA 1T9VA 2IHR1 1WUUA 1ZETA 5KG0A 2B6AA 4WYWA 1S49A 5CCMA 4AXIA 5CD4H 4KGVB 4QU7A 4LBIA 4YB6A 5E2QA 4QWAA 2GHVC 3MDFA 2PIIA 4JV5F 3GIMA 1M5HA 2H5JB 3PX0A 4OYAA 1YITS 3E8OA 3G82A 4HTJA 5I42B 1UZHA 4CLSA 3RTVA 1KRPA 2UU9F 2KXFA 3DLHA 1OPZA 1R27B 1RT1B 4I2PA 1SCJB 4NYZA 3WX8A 2VOPA 2WB1D 4GC7A 3RW6A 1NMEB 3D6TB 4CM0A 1SPBP 4USHA 4OYIA 1LNQA 1IWAA 2CG8A 2VASA 4NLPA 3KHHA 4DFPA 1N33J 2ACMA 2O67A 2HWTA 1TU0B 3TOQA 4ZHRA 4ZN1A 4P75A 2MQPA 1QAJA 4WU3A 2KKHA 2V4RA 2BQRA 2CVIA 4NYOA 4QWEA 1JLEB 3Q8SB 1YSJA 3A3OB 3RB4A 1Y7PA 2WONB 3HHLD 3BGRB 4M63A 4JI6J 4PXEA 4YR3A 2Z0GA 1QTMA 1C4CA 3NBPA 4X66J 4U9RA 1T7PA 1K0TA 2LMIA 4IQMA 4LIRA 3UR3C 3W60A 3FVYA 3V6DB 2BOPA 5B08A 4UY8T 2MZSA 1OYEA 4F8RA 4WPAA 4ZP7A 5LL6d 4ECVA 4QWCA 3DRRB 3N9UC 3CT9A 1ZTTA 4PQUA 2ZE2A 3I0RA 3TO8A 3CJ4A 4NCGA 2MXYA 1NNDA 1RWUA 1TL5A 2JVOA 2BJEA 2MY8A 2ZNZA 1YTYA 1XNQF 3BB5A 4B3MF 4BHQA 3B4DA 3LP2A 4Q8FA 4NA3A 2ZUAA 5HQMA 1RLDA 1TVRB 2YWHA 2VODA 2GX8A 3H2UB 1N33F 2IDEA 3CCZA 2HNDB 4QW9A 1LXJA 3HVAA 1KOOA 2IFXA 2OHDA 4DPUA 1HQUB 1FTCA 1Q1KA 5AT1B 2M4MA 4F7VA 3PXGa 4YR0A 4G1QB 4ZVUB 2VDHA 4IH5A 4PG8A 9ATCB 2XY6A 2HVIA 3TAMB 3MEKA 2VKRA 3LALA 2MZRA 2W2QP 2IC3B 4WTYA 1DLOB 5B7WA 5F9LA 1N5YA 2M7SA 4F4AA 3BQ1A 4HHUA 1LWFB 3A3NB 4C97A 2FLLA 4H4MA 4P2XA 4JI0J 2BR0A 5DM6Q 3R97A 2I38A 3GPAA 1XNQJ 3WIVA 4TY9A 1VMBA 1JLAB 3HHLA 4PG4A 1FRXA 2M8DB 1DTQB 1S77D 2OFGX 2U2FA 5JVGQ 2U1AA 1N6QB 2DXDA 1YBTA 2YVSA 1AYEA 3KJVA 2EWHA 2V94A 2OD4A 4G1QA 4RO0A 3RRKA 2XCPA 1U49A 1FDNA 1Q82T 2M2BA 3F73A 3W1YC 2VZ9A 5KFZA 2CDQA 2Y1JA 2YNIB 3K5MA 1FWLA 1MN9A 1L3UA 2EFPA 3AJ2A 5IWAJ 3OFFA 2F63A 5F8HA 1CSJA 3VQSA 2CPIA 3RU0A 1O51A 2KT5A 1Q8IA 2B9EA 3L3CA 4EEYA 1M5PC 2XC9A 5B0GA 2IYIA 3NNAA 2Z57B 3G87A 1TUGB 1RCOB 2RQKA 4I68A 2CYYA 4DHVA 1VQ6S 1X5TA 4LIWA 4K0KJ 1RT2A 2PD1A 3WBZA 5D4PA 3J81U 4ETXA 5ETRA 5LXYA 4Q44A 1LWEA 1IJFB 2G0IA 3DM2A 4K0KF 4KIAA 5BJRA 3MR7A 1H2TZ 4ZCLA 4URSA 1DBDA 5IQ6A 3RAXA 5DGAA 2ATLA 2XI2A 5I3QA 1EB0A 2RKIA 2W8KA 2F9JA 4J9NA 4B3MJ 1N88A 5ETPA 2ZH1A 3KJNB 1FK9A 2UUTA 3QZ8A 1UMJA 5KG6A 2CJBA 3VF0B 5C42A 1HNXF 2Z56B 4AXJA 4ECSA 1OQ6A 2HK2A 4ATNA 2GAHC 3HT3A 1UA1A 1RT5B 1RWVB 2YKNB 3HI9A 4NLOA 5IT9U 2DNPA 1VOMA 4KAIA 2G9OA 4X64F 5C2CA 1RKIA 3Q8UA 5HAOA 4BWMA 1UTAA 1TL7A 2V8VA 1RHQB 2CQ4A 2EEYA 3G82B 4B9VA 2IIHA 5F9NA 1ZS6A 2A2CA 4OX8A 4JI4F 1X0PA 2BJ9A 5U47A 4LSNA 1RWPB 2WHOA 3ENQA 4JV0A 1HPZA 2CIMA 2GJIA 2ZH9A 4WKYA 2G1DA 3H5XA 3CCES 1ZPVA 4DUYF 4PWDB 4WK3A 4RWXA 3PACA 2DPIA 4I56A 1BQXA 4LVOP 4Q2LA 4ZVSB 3RBXA 2P9CA 3PCOB 2BE7D 5IM0A 1Q95G 1HBNA 2N3LA 3OBIA 4OZJA 2UXBF 3M8QB 1EX8A 1K73T 2ZD1B 1FE0A 2BKNA 3GIIA 1NCLA 4ZA1A 2BW2A 4MKVA 3G6VA 4OJHA 1KR4A 2GGPB 1WKKA 4J9KA 3VAHA 3O44A 2ZVSA 2DH8A 1TKZB 5LXRA 2HRUA 2XSJA 3D28A 2HVHA 1ULRA 4IG0A 3VAMA 1RI7A 4F4WA 4RNOA 2VICA 1WC4A 1WJ9A 2UXCJ 1NBEB 2MHEA 4ZLJA 4I2QB 5HMZA 4R5PA 2A10A 4XO0A 1W2BR 4DL5A 5A6WA 3Q83A 1M1HA 4F4XA 2QE5A 4LF9F 2LP4A 4DX8H 1F2HA 1RTDA 2JJ4D 5A8RB 4QYZJ 2VU5A 3THPA 2VA2A 4B9UA 3D7SB 3H98A 2RMLA 1PJ7A 2RE1A 2XB2D 1XNRF 4QW8A 3ET6B 3Q2SC 2GO9A 2OMOA 2X51A 5CAAA 2KT3A 3H5UA 3W2VB 1IBCB 1UPMB 6FDRA 2XQCA 3EVWA 1JLCA 2QA4S 5KFWA 4HACA 1T3OA 3KLEA 2ALZA 4HKQA 3I87A 4CT9A 3VGSA 4AYBD 2D9OA 4QIWD 1V5VA 2CPDA 3AJDA 4M5DB 3J7ZT 3GQCA 2DGQA 1X4GA 4WIIA 3S7RA 1H3DA 3CF5Q 3NMRA 2A2DA 2V8PA 3ENAA 3QBCA 3J7YI 2BUNA 3BZQA 3N4WA 3OW2R 3QYYA 5LMNJ 2WVDA 2NR0A 4LRCA 2Y1RI 4NI2A 4OV6A 4LRAA 4DXLA 1EIYB 4D3GA 3MMCA 1DHMA 1P8GA 5GAEU 1IBKF 1U1RA 3HHNB 4OYZA 5E3RA 2H1YA 3TVZA 4RW7B 1AZSA 1EARA 4LFAF 3HZEA 1UAWA 5B09A 5B0BA 1UWBA 3MM6B 1X4BA 3K57A 1R8AA 3ZC4A 2QYCA 3E3XA 5HANA 2DIVA 2VF3A 5AE1A 3KDNA 3GWCA 4IKAA 1OSDA 3CCTA 3HVTA 3KUGA 3OTBA 4H54A 3M05A 2FPHX 4EO6A 1S6QB 2F8HA 2C2ZB 3TJ8A 2XI3A 1RTJB 1IN0A 4IH6A 2GQQA 1NXIA 2JFKA 1S9EA 1U1MA 2LVWA 4F2RA 5D3GA 2XYHB 4B3SJ 2HQGA 3LGNA 5DO2A 4JI0F 2W9BB 2XYGB 4C7QA 3VAKA 2HNZA 3IC1A 3UO0A 4G1IA 2HK3A 3EWGA 3M8YA 4TU7A 2CPHA 4PXDA 2V50A 4UOCA 3FMWA 2IBOA 2BA9A 2AEJA 2DBBA 3W65A 3HDSA 3HZGA 2ZOMA 4C3KA 2ZWOA 3OUYA 4IO9Q 4A8KA 5HP1A 1UJ4A 3HLUA 1WELA 3DU5A 1JJCB 1KHVA 4V19J 1ZZNA 3UPFA 3CJRA 4J9PA 4FS1A 2YPYA 3MD3A 1XQIA 3LH2S 3MM8A 4CH0S 1KN6A 1W25A 2JRSA 5A0YB 1TV6B 4DF8A 2ZDOA 3W8PA 3K59A 3OXFA 3VTIA 2W8LA 2AJ1A 1N5SA 2RH3A 1IWGA 3AT1B 3JSRA 1WC1A 1U47A 3LWLA 4ECXA 2QLJB 1FFWB 2VB6A 3BKUA 1UWAA 3CDEA 4FP9A 1CJUA 4ZPAA 1LWCB 2J5AA 1B99A 4LFCF 2IMOA 4F67A 2YWGA 4O44A 1LFPA 2MKCA 3ILLA 4ES1A 1WHXA 2V6AA 4IDKA 2OPRA 2NXUA 2RF2A 1GMWA 3GYXB 3MEGA 4IFYA 5DGBA 3P45B 1IKYB 5HP1B 2CQHA 1F9EB 2IY5B 4F26A 2HMIA 1NEEA 3C19A 1RT3A 2F7VA 3HD1A 1FEHA 5IQQA 2XGPA 3HF5A 3W3SA 3BV8A 4WFAQ 2VQFJ 1PAEX 5I3UB 1NJYA 2JC1A 1RAGB 2OPRB 2YWWA 2CA9A 3AXKA 4BCAA 2BKOA 2LEBA 4OX9J 3NOGA 3V6DA 4KHPJ 1F5BA 3AHPA 2HQ3A 5G0RB 5D3GB 1NPRA 2Y0SD 2Z8QA 4OI1A 3FSXA 1CJUB 2FHOB 5KG7A 1S1UA 1R8PA 3DRPB 3CW2C 4OLPA 2ZBPA 5K8OA 1RTHB 1TL3A 1RUSA 5DDPC 1VQ5S 3AOAA 3DLEB 1GXTA 4ZHRB 4RW7A 3QWPA 1S79A 3DGPB 2QIFA 3TW0A 3JS9A 3CPWR 3UDCA 3CD7A 3CNQP 4F50A 4M5HA 4M5JA 3ENVA 2VFUA 5IV4A 2RU3A 4DSEA 4DR7J 1HNWF 4NX9A 1YWXA 2R7SA 1B0PA 2CPEA 1UW9A 2LKZA 2GIRA 1J5OB 2DJWA 1K44A 4M1KA 3QIPB 3MOJB 1ROFA 2PFDA 1Z2ZA 3DYAA 1U0SA 3ZTRA 3CULA 1I51B 1I1GA 3TAPA 1S9GB 3FBEA 1WOPA 3MPDA 2I5JA 3MECB 3PW5A 5L1JA 4HR2A 5ITHA 1NZAA 2KHCA 2XEXA 3PW0A 2CQ3A 3QRPA 1U09A 4AE5A 2J8SA 2NZ4A 1JMTA 1G2EA 2DD8S 2OKQA 4KHMA 3IA0A 2ASLA 1QM9A 3KHLA 4U7UD 1IR2A 4U7UK 2BM1A 2ZH4A 3M9OB 2GMJA 2IRUA 5GMEA 2I0XA 3OLBA 1HNIA 3H0PA 3O2IA 4DPWA 4DJBA 2JC0A 1C0UB 2OPSB 3IO1A 2KYXA 2R42A 3VAFA 3IWNC 3BGUA 2HAIA 1X5PA 1LK5A 2P8IA 2DR7A 1KSPA 4EZ6A 1FE4A 1JNRB 4DX6A 4JI5J 4L74A 1U25A 5HO4A 1IR0A 2FJBB 3BGLA 2Y8WA 4KFBB 3LPYA 1U8WA 3A8EA 4ZVPB 2UUCJ 4F2SA 3ZZYA 4X4RA 2L9DA 4ECRA 4DV3J 2GQ2A 3F41A 3DC2A 3LANA 3QQCD 1HBNB 4ZPVR 3V6JA 4GO5X 4ES3A 3KLVA 2V4JA 2C3OA 1P27B 3PW2A 3BKFA 1O0PA 1WKLA 2BMBA 2HFSA 2VUGA 1X9SA 5DZ7A 4WFNQ 1EETA 1OY9A 3MM5B 3HHEA 2N7YA 2N4CA 2KVIA 2OLWA 1QJHA 2MKYA 2SXLA 5IM0B 3ISNC 3P4UB 2HNYB 2LXFA 5FJ4A 1TKDA 4K4SA 3ZXWA 4Q0BB 5AXNA 3H5YA 1XNRJ 1U1KA 3EGZA 3MTJA 3M6UA 4ID5B 1VRUA 2X1BA 1H2VZ 3AJ1A 2ZVIA 1TKXB 5D15A 5BYSA 8RUCA 3FQLA 1EZZB 5F8NA 1HFEL 4DV6J 1L3TA 2QLBB 3E01B 4E8UA 4OIXA 3CCMS 1TQLA 4WP9A 1JJ2R 3MFIA 2XLIA 3SQGB 1WDDA 2L41A 4L75A 2LQ8A 2ZH5A 2F4FA 3T6BA 2UXCF 1FXLA 5IT9Y 2QV6A 1WKJA 2W7PA 3M4XA 4PYDA 5IZHA 4PZVA 4RW8B 1IBKJ 4C3MA 3PV8A 2Q43A 4CH7A 4J9OA 2C3PA 3QAUA 2XBPA 5CABA 4TU8A 3K58A 4IUFA 3MCSA 4M5NA 4C6AA 2VG7B 3M6XA 4R8UB 3HMJG 1H0HB 2E5LJ 4LF4F 5C25B 4DL6A 4X4NA 3LP1A 2QYGA 3O1LA 2YX1A 3OPKA 1UZDA 2OPPB 3KLFB 3EZUA 4AQYJ 3Q8PB 1EHWA 3GE9A 2QA1A 3V4IA 4IRKA 4QPXA 1ICEB 1N0VC 2JVRA 2F3JA 4NA1A 3L7OA 1RHRB 3SZ2A 5KTQA 4DS4A 3PKYA 2HQIA 4ID8A 2ZZMA 5ETQA 2DGVA 2WAQD 3PJWA 3EPGA 1S1TB 4U96A 4EBDA 3DKDA 1VIOA 2EKYA 2HRYA 2VJUA 1IUJA 1GAOA 4MIWA 2AU0A 2HVEA 3S01A 1PYTA 3G71S 4QQBA 4XAKA 1BLUA 1SKUB 1WI6A 1DTQA 1Q7LB 3Q8RB 2N82B 3HHLB 5ETNA 1R0AB 3I9V9 1NRKA 3IFEA 3OL7A 3WQPA 2ILZA 2DRBA 3HD2A 5GADI 3H25A 3FEXB 5D4LA 4P71A 3PIOQ 2UVWA 4YY3J 3C6UA 4NLSA 4TQRA 3C6UB 5I4MA 4DR1F 1OMSA 1FVQA 3DRXA 1VQYA 4DU7A 2HG4A 1ZBTA 2LEPA 5L9NA 5KFPA 1I94F 2OJ3A 4B02A 1LWEB 1XBWA 3DM2B 5HJXA 3FGVA 4H4MB 4Y2KA 3BQ0A 1IM6A 2QLWA 1DURA 3RR8A 4DQSA 1IBMF 1NDLA 2NXJA 4CLWA 4P2SA 4RUBA 2BYCA 2GMHA 1YJTA 3VZHA 3FRZA 4C98A 2X1AA 1VBZA 3Q8QB 1T05A 2AEFA 3NAHA 3VHQA 3UCUP 1YI2S 5D78A 2YPZA 2B43A 2L08A 2Z2YB 3D1HA 4ZVTB 3IWXA 4GMKA 3MPUB 5KFKA 4IOBA 3OTOF 5B0CA 4YMEA 3DRRA 1ZAVA 2YNIA 1U02A 2NZCA 4C8MA 2DO4A 1CS4A 3K17A 4CWBA 2OTLS 2XMUA 2AYBA 3RB6A 2W4PA 2RDIA 5J2MB 2ZH2A 5CCLA 3K8VA 1X31C 2YTCA 5HMXA 5IOLA 3KLGB 4K4UA 2BEFA 4W4MA 4CTAA 4JI1F 2J76E 4ILRA 1J5EJ 4FXDA 1EKSA 2EVZA 1S12A 3NWRA 2QT7A 3LTOA 2ZJRQ 4YR2A 5JMNA 2OFHX 4ZJQA 3NGDA 3CIZA 3GB0A 4U7CA 4DSFA 1BMQB 3PFEA 4ILLA 4PXBA 5AE2A 1BUXA 1IKVA 1RT1A 1YJNS 5D0GA 1WNEA 3R7SB 4B9TA 1ZAXA 2FHMA 2FLOA 3A8JA 3AH6A 4GVLA 2ACYA 2O5DA 3HSZA 4FN5A 4WE1B 1F5CA 3KUEA 1S48A 3T5LA 3ILIA 1S1WB 1VRQC 2K7KA 2FYXA 3ISZA 3RYLA 4UQGA 4ID5A 3IMQJ 4B17A 4DPTA 3LP2B 1OIAA 1PBAA 1HW8A 2RJZA 4PPZA 1T9XA 5KFCA 4ECTA 2BOAA 1LXNA 3A13A 1S1TA 4FYYB 2DGSA 3I55S 1I6JA 2EXUA 1H74A 2XULA 1LEOA 2H48B 3R5GA 4KY3A 4DR4F 4K4ZA 5JJBA 1N5QA 3TYTA 3KDOA 3W5YA 5HLFB 2VG7A 3JSBA 4OFZA 1M5SA 1S7IA 1C0TB 2RVJA 5AXKA 1NH7A 2J9DA 2XHCA 4M5GA 3GCXP 1HI8A 3NG8A 3TNVA 5C5JA 4PG7A 2F4VJ 1IR1A 2RS2A 3IP0A 4USMA 4J91A 2J9CA 4C48A 1N56A 4B9MA 1UEVA 2HFUA 3H42A 3LP1B 2KT2A 3AD7C 3CC4S 2Z2ZA 3DDNA 3OR2B 4A8FA 3RBEA 5LSRA 4YP3A 4Y2CA 4IR1A 1HHQA 3RAMA 4FBTA 1VQNS 1Y00A 1SC4B 2DEIA 1JLQA 2GW8A 2ZITA 3C14A 4NZ6A 1HW9A 3FK4A 3MTKA 5F3TA 5T41A 5EWEA 2HBYB 3GJSB 3C46A 4Y2IA 2WVEA 4U95A 3IBWA 1H38A 3W62A 2YNFA 3GV5B 3AB4B 4CRJA 2ZOGA 2QA4G 5D77A 3N5FA 1K47A 5HQLA 3B6BA 1WOSA 4NLQA 2KYZA 4JB8B 4ZVEA 1YVFA 1VRUB 1KVIA 1OJ4A 1YJVA 4DR4J 2Y0BB 4CLZA 1N34F 3OSPA 1R31A 3NGKA 2EI5A 2VQEF 5KFVA 3I96A 2HURA 3LOUA 1HBMA 4IFVA 5CQGA 2VC0A 3ZZZA 1KONA 3LWMA 4ELTA 3P3DA 1HBMB 5KFLA 4DV2J 3R27A 4RBTA 2RNEA 4WCEQ 2CNOB 2E7VA 2HS0A 2YNGB 4X4SA 2BACA 3MR6A 2B4PA 1WC3A 2NXEA 2FVPA 4DR6F 1K0VA 1Q5YA 2HGMA 4JV2A 2V4JB 3FCVA 2DHAA 1S9GA 3GG0A 3HULA 1SV5A 2OEKA 3L7UA 4NYPA 3ZZTA 5KG2A 1TL4A 1KP6A 3DXBA 3CJ2A 2DB1A 5DG8A 1B4SA 4MK8A 4DV4J 1L3SA 3EZOA 2GVZB 1XK8A 2AIRB 4USIA 1LV5A 2UUAF 4B9LA 4NXNF 2IAJA 1XR5A 2YH0A 2WB4A 2H51B 1CBKA 4K4YA 4JI3J 1Z2LA 4U8YA 4R25A 4Q7AA 4DCJB 4WXOA 1N48A 4DSJA 3KK3B 3I56S 1KNZA 2FHKA 3UR0A 3KK2B 1WG5A 4LF5F 4ERDA 1F60B 1HWKA 3ETOA 2VJVA 2J6UA 4LF2A 2CG4A 4OI6A 1VQ9S 1O5JA 3CIMA 3DXSX 4NLTA 4CCHA 1JLBB 1P6TA 1T94A 2DYAA 3NP5A 4HL9A 4CLTA 2FVSA 1R8BA 3HHDA 3WC2A 1G4CA 3H90A 1TP7A 2CZ4A 3A8KA 3CWJA 3KWMA 2HRTA 3MEDB 2I8EA 1KDNA 3OVSA 4DR5F 3OVBA 1X4HA 3KJQB 2DCUB 1YQHA 3BH7B 4KO0A 3C16B 4GKKJ 1RCXB 1B70B 3CE8A 1FDBA 3T19A 1OQ3A 2DEJA 2ZNYA 3VCDA 2P6TA 3BR8A 4WYLA 4ZIVA 1SL1A 3HKWA 1HR0F 4M94A 3IGVA 1HI0P 3DOKA 3MM7A 2WOMA 1C2PA 1RLCL 2BQUA 4ZPBA 1C1BA 2QZ8A 1YGYA 1VQMS 1FKOB 2CQIA 3GJRB 5KFOA 1IXKA 2XCAA 3EE3A 1RHKB 2OGUA 2D7SA 4QU6A 5AJ3F 4A8QA 2B7CB 3M2RA 2VPXB 1MWZA 2CJAA 2UZAA 2YQ1A 3DGPA 2CZVC 3K5OA 4G6VB 4USTA 1XEZA 2XWXA 3W9JA 1KLMA 5GAGU 4DF4A 1RE1B 3ULHA 2J6TA 2RRBA 2NPFA 1JXLA 1QLNA 4C0BA 3DRPA 5CYQA 3C2PA 2XNRA 4AL6A 1HBOB 1PBUA 2H4WB 2KB2A 3QFWA 1TFWA 4OX7A 1MWQA 4IQXA 2BZ2A 1GX6A 2JEJA 3KLHA 1RISA 2HIYA 3OL9A 4AQYF 2AWZA 1RTHA 1TL3B 1KKHA 2PEHA 3I4HX 1N5VA 1XWLA 2WCXA 4P72A 1S1VA 2QTWA 4FYXB 2UU9J 5KT4A 2E5LF 3MR5A 1S5ZA 2JHEA 4DWIA 4AL5A 1XMQF 1GMUA 2WSFC 2YWFA 4AUKA 4DL3A 1JXVA 2BJ1A 3BEGB 2HWHA 4C2MA 1F9FA 3DN9A 1NB2A 3LP0B 1SJFA 1EQMA 1K1SA 2AJQA 1GMWD 1NJZA 2CVEA 1H72C 2GIFA 1YG0A 5J2PB 4FDFA 4B3OB 5CHCB 4LUBA 2NXCA 2F8EX 2H54B 2VKZG 5CXTA 2E9RX 4I6AA 1RT4A 3TJ9A 4IG3A 3W9IA 4XDDA 1HNVB 1CJKA 2DNYA 4ZJOA 1UL3A 5LJ3Y 1TV6A 1YK9A 2JDJA 3R6LB 1U24A 1LWCA 2K3KA 3SYZA 2HS4A 3DLKB 3NGUA 3PW4A 4F36A 2AJFE 1U1NA 4FKXA 1PC4A 3K2YA 3EX7B 4FBUA 1BQMB 4ZP6A 3DRSA 3OL8A 1ZH5A 1NB7A 3G86A 3PIPQ 4PWWA 1Z4UA 1R43A 1TL1B 3UQSA 1WOOA 4O3NA 3UD3P 1TAUA 2IM0A 1U1PA 2K1RB 1S72S 1UJ6A 3IM8A 3KK1A 2RS8A 3HJVA 1IQZA 4DUTA 4PQAA 3MEEA 3FBCA 1MU2A 5KFQA 1JLFB 4LF8J 4C8ZA 1HD1A 2KVQE 4RNFA 3MOZA 3QGPA 4DCOB 2E1CA 3SSRA 2D69A 3MI7X 4DN0A 2QC3A 2W2NP 5DDRC 1VQOS 2VONA 5HSPA 1RXOB 3NL0A 2KFZA 4HACB 5HQ8A 3CJSA 1JXEA 3BS9A 1GX5A 3TA0A 4Q2MA 4DV4F 2VBWA 3R5DA 2ZH3A 3ZTOA 3HFZB 5HVHA 4EYHB 1MROA 4DQPA 1DQ8A 1VQPS 3LGHA 3TA1A 3TR5A 3NXZA 3THVA 3B82A 1S6QA 4FYDA 3HFVA 4I0WA 2LQJA 1UFWA 4O4GA 2IBKA 2FY8A 2XTJP 4ED0A 2AYMA 1M1KT 3QRRA 4RW6A 2CQ0A 4V1Ak 1N36F 2CQCA 2GQCA 4BS2A 1TK0A 2R8JA 1C1CA 3BBBA 4TKTA 3OT9A 4EK2A 1LWXA 3T1HJ 2C2EA 1WSVA 1RADB 2PO4A 4KJIA 2GAGC 4I6YA 5HJYA 1N34J 1CULB 1WC0A 1AZSB 3UVJA 2I6WA 3WHIA 5DS7A 1BE4A 1ZM4A 3JTOA 3ZFVA 1SH3A 4NLWA 3SCIE 5H1SV 1RTIA 3CMQA 1FFSB 3HHLC 2ZBCA 4H4OB 4MKAA 3GSIA 4JOUA 4YN3B 3E01A 3N28A 1U26A 3FMBA 4KRWA 2VPZB 3ETMA 3M8PB 3AXMA 1T9TA 1S0NA 1TZ0A 2J8AA 3MD1A 3PYDA 4NLDA 4YDXA 4DR7F 1AT1B 5HMWA 3OHBA 1CJTA 1FD8A 1FFGB 5IC4B 2UVVA 5IXUA 4YY3F 6FD1A 4NXNJ 1JLGB 2AZ1A 3QO9B 1UFKA 1X9MA 2DIUA 1ZM2A 3VZIA 5GAGI 5KFNA 4MYTA 4ZVGA 5AJ3J 3QJLA 3MGJA 1NKEA 3MAAB 9RUBA 2YX4A 2IA0A 2W7OA 4X64J 5KFRA 2ZWPA 1VQSA 2A0FB 4MK7A 3NGTA 5A8RA 2K7JA 3OJUA 2KJVA 4OZNA 4JI6F 4F4ZA 1JJHA 3M9NB 3AA8A 3QFHA 1M90T 2LQBA 1SJQA 2FGCA 1VK3A 3TQ1A 3TA2A 3N6LA 4DR2J 1R0BG 4HH0A 5A2QY 2R2TA 1E6YB 3M6VA 4NZ0A 1D8YA 4HT7A 4KC5A 3BSOA 2LU2A 2KRRA 4LJMA 2EFQA 1HWJA 2ZBQA 2PN6A 5SZTA 2UXDJ 2D1CA 3EMTA 3RZAA 4OLOA 3ONQA 2E1RA 1F9HA 3BO4A 2DNOA 4DFMA 2DRAA 4B9NA 3ILOA 4QR1A 4Y28C 2AJ2A 1SI9A 3I0SA 1MROB 1BWEA 2DHXA 1MSWD 1FT8A 5GAHI 2GJ2A 4CO0A 2DNRA 1SL2A 3D0HE 4AD6A 4LSNB 4CLLA 1JLGA 1VHFA 2L3MA 1WF1A 2HFOA 1UW4A 3SXLA 4CM2A 4Q5VA 1SL0A 4CLKA 4LFCJ 1CLFA 1FEEA 2DR9A 2XMJA 5KFJA 2DCLA 3Q0AA 3T41A 3UWTA 3F44A 2COLA 1XJWB 2EKNA 2J9DE 2W24A 3NLCA 5DG7A 1SJ4P 3V6HA 2HLTA 1TUVA 2CJ9A 3D3BJ 4DPXA 4Q43A 1H7WA 3SDEA 1T03A 1HL6A 2G0JA 2EC0A 1Y4ZB 1ZYQA 4N8OA 2K1RA 4ZVOB 4DV5J 2X1GA 1YKWA 3MUVP 1VC6A 2Q3PA 4DR6J 2QRRA 3M1VA 1CEZA 1B7YB 1TFYA 1IKVB 3GZ7A 1QUPA 2V8DA 4ZPWR 3QIPA 1HHSA 3KJVB 1R0CB 3MCOA 1S99A 1CULA 2CKWA 2DXEA 5J1NA 4OX9F 5B0EA 4BC7A 2MEWA 4CO1A 4DQRA 1VJQA 4I67A 1EKRA 2EG2A 2QLFB 1RT7B 1KTQA 2DNQA 2PDAA 2QJ3A 2KJWA 3MMBB 1BHNA 2WRMA 4MJKA 6AT1B 3KHGA 2CQGA 2W01A 1WDTA 4NRTA 2AYGA 5C24A 4LFBF 4IO1A 3DLGB 3W66A 5KFFA 4UZCA 3GFYA 4M8LA 3SCKE 2O66A 2ILYA 1B64A 4HI1A 1U45A 3M8WA 3J7Z5 5G4DA 1QAXA 1HQUA 1RAEB 2YKPA 1EAYC 1P1LA 1CS4B 1WD6A 2Y1LB 4HLBA 4CLUA 2VPYB 2MZQA 4DFKA 3H5SA 2DGWA 2M5YA 1GEHA 1KVKA 1KFSA 5KT7A 4FZVA 2OELA 2ZDPA 4QIFA 5K14B 2CPXA 3T5JA 2CXEA 3W5XA 2V2VA 1YRTA 2B4OA 4LFAJ 1NH8A 2JWNA 4AT1B 3CXCR 1G1XA 2XYPB 2HMIB 1LW2A 4NCGB 2IM2A 4KKOB 3K89A 5EX3A 2PI5A 4UOGA 4A48A 4F3QA 4PQUB 4MYUA 3TZYA 1KOHA 1FJGJ 3IR7B 3H8YA 4NLXA 2LQ9A 2BW7A 1NJXA 4K2JA 3DLLQ 3S6EA 3BYPA 2YKAA 4OYXA 2H5EA 3B4MA 4U8VA 3GSDA 1NHKL 1WI8A 2JFDA 3VGVA 3W9HA 3VAGA 1D9FA 4JI7F 2ZHAA 1BQMA 2CFXA 4UQTA 5CYQB 3ZTPA 4MFBB 1JLAA 5HVFA 5KT2A 4C8NA 1S76D 4OI4A 1ZZFA 3EICA 2XSFA 5ETVA 3BGOP 3GG1A 1YX2A 5CH7B 4DR2F 1ELOA 4DFJA 3QAEA 4XDCA 4ZP9A 3F0NA 3TWZA 1VQLS 2Y1IA 2KU7A 2DGXA 4YEAA 3FFIA 1ITPA 2HFNA 2OPQA 5F8GA 1KVJA 2A3JA 1FF2A 2DHGA 2W4DA 4CLPA 1AA1B 2DNLA 3DOKB 3MM7B 4RW4B 2PMZD 3T1AA 4OV1A 3JSMB 2JLGA 1RKJA 3MMAB 2E44A 2IMWP 1G6BA 4FKYA 3LAKA 1UCNA 2HNDA 3C16A 5BR8J 1AROP 3R1HA 2W25A 1WACA 2PSZA 4WJBA 2HNZB 5DQIA 4N41A 4NXMJ 2GO8A 4K59A 1RHUB 2MKHA 4MH8A 3JQJA 4NCBA 2HSEB 2Z58B 4FF3A 4QR2A 4OYMA 3T5KA 3BH6B 3J81Y 2ZC4A 5FLXY 1S1XA 3DGVA 3ADAC 5GVQA 1LW0A 2XZDB 3VWSA 2MB0B 3I0RB 1FX4A 1VBKA 2AD9A 4L73A 5HK4A 1RTJA 1RA7A 4ZP8A 5FDLB 4F0HA 2LYVA 4C11B 2YY3A 2UVUA 3R1LA 2NXNA 1HNZJ 4XK8C 3SI8A 1HWLA 3GV7B 3KG1A 4UTGA 4MMOA 4GC6A 3EDQB 4TN2A 3PR4A 1FVSA 2ZM6J 3G6XA 1T0TV 1XIQA 4QR0A 3SFUA 1WG4A 4HDHA 2C1EB 2Z30B 2RUSA 3SSQA 4JI8F 2LXIA 2B9YA 3FSIA 4DUYJ 2E1MC 5DQGA 1JIHA 3IG1B 3SIPB 1S6PA 5KFEA 2XZTB 3U27A 1NU4A 2XLJA 4CQ1A 2HHUA 3KK3A 5EWGA 3MURP 4OZ0A 4DR3F 4ANEA 4DI6A 1B0TA 2R7RA 4A8SA 3DFEA 4O3RA 3TP2A 2ZH7A 4A8YA 2YWKA 4X4OA 5KOWA 4XPCA 4LVNP 2FY1A 4X84A 5IT0A 1U0HA 2YNGA 4Q0BA 1WG1A 1NDKA 2AX0A 2IJRA 1S4FA 2LQ5A 5I42A 5E7OB 2JOQA 3IRWP 3EGVA 2CRLA 2NYIA 5F0UA 3TVKA 2VOOA 1UVJA 2HWIA 1S9FA 2NSCA 3IR6B 3P5BP 4LSLB 4M5DA 2XS5A 4YB5A 2O01C 2M52A 3PTWA 3QLHA 4CYUA 2WTFA 1CJVA 1RBAA 1XMBA 3MEDA 3IRXA 4J9QA 2UUBF 3BF4A 4FXWA 4OHZA 3SMZA 4RJVA 2XLKA 2D3OR 1MWYA 4MIBA 3NS7B 1QE1A 1QUVA 4PWUA 1FCAA 4OYBA 2EG1A 1RWWB 4L6V3 3HM9A 2DRDA 4ECQA 1RAOA 1R8CA 2QMXA 2DNZA 3QPIA 5M2RA 2D74B 2FVRA 1CVJA 1SUQB 1VLYA 4KGMA 4X65F 5HI7A 5L46A 4DQIA 3C14B 5I3PA 1NSQA 4MTPA 1RK8A 1RHJB 5IV3A 3MXHP 2BM0A 4FXVA 2KG1A 1JX4A 1TKTA 1TMJA 1HNIB 4FPRA 4ANDA 1RSCA 1TKTB 4TLQA 3GYNA 1X4DA 2AV5A 2GVZA 3Q86A 3QWUA 4LBPA 4N8NA 2PGCA 4IG0B 4USKA 1JB0C 3CJTA 2Y9HA 1SV5B 3JB9k 5KFBA 2GJFA 3W64A 2NYHA 4J7CA 4A47A 1CQNA 3JAMU 1FO1A 2EW9A 3RBZA 2MQNA 4C8OA 3EZ5A 1UKUA 1VK8A 4CYUB 2M70A 5DLFA 1HNWJ 3AQOA 3OR2A 4OI0A 2OUGA 5ETLA 5KFAA 3C8YA 1D0EA 1TAQA 3RJMB 4A8WA 2HBZB 4RLEA 1S1XB 4YFUA 5ADZA 4KH1B 4KGXB 3DDKA 1PG5B 1TTHB 2VC1A 2VBZA 4GKJJ 2RHQB 4I7FA 2IJNA 4LR7A 5DM7Q 1S1WA 3LA0A 3H4BA 4K5SA 1S0VA 1VYAA 2JLFA 3BR9A 1NDCA 5D4OA 5KFDA 3D6HB 3PNIA 4WE1A 2HHSA 3MPYA 3V81A 1WSRA 1FDAA 4ZCIA 5LSLA 4RW4A 2XO7A 3JSMA 2BJDA 4X62J 2BV3A 4H4KC 4QZVB 2CPJA 2OP5A 2OPQB 4FVMA 4LRBA 4RPFA 1MLAA 1KQFB 4TXSA 5KOXA 3OLAA 2GVDB 2JEIA 2HEKA 2IRXA 5D0RA 2MDAA 3BYRA 2P9EA 5FDLA 1RYRA 4TNOA 1W26A 3UN5A 4DL4A 1FXRA 3FDSA 4W98A 2NPIA 4USWA 5FLXU 2QSWA 4JV1A 3OXGA 2UUAJ 1RQ0A 3FZ2A 5HN0A 1KD1T 2EK1A 2HFVA 4ZK7M 1U4BA 3DRYA 1D9DA 2XZWA 2B9WA 3HFKA 3CVKA 3SEOA 1N4LA 2DR8A 3DOMA 3I5CA 4KPCA 1X0FA 1M5OC 3KLGA 3SQOP 2BABA 5J2MA 1Q81T 4PXCA 1Q8LA 4U6PA 3WZ0A 2MQLA 4LF6F 2MGZA 5L8RC 4IYQA 2MLZA 4XPEA 1JKHA 2UVRA 2RIJA 3R5BA 3FC9A 4ED4A 1U2RA 4I6WA 1S0MA 1HWIA 2R7TA 5A76A 5H9EK 1WF0A 1RB0A 4J37A 3A4TA 1F5AA 1WHVA 3V5RA 1VQ4S 3ZNJ1 1GK8A 3FCWA 4O4RA 2AZ3A 2AGQA 1U1OA 2MMYA 3D6MB 5DRKA 4EFAC 2YWEA 4LFBJ 2P9GA 4DEZA 1NJIT 2N7CA 3DI6A 3DOLA 3CJ3A 5C24B 4C8YA 3OTDA 1N32J 1FTRA 1ZOTA 4ZVRB 1D09B 2XMWA 4PR6A 1RU1A 4N76A 4PABA 2ZHBA 2HHXA 1YZ6A 3LPEA 4K4TA 3HVWA 4NCAA 1KWMA 3UNYA 3TUPA 1VRTA 4KKOA 2BJ3A 2WK4A 2AJ4A 5JVHQ 2VG5A 3B54A 4NLUA 1U2FA 4MK9A 2C2KB 1KLNA 1Q4RA 3NS5A 4JP8A 3EXYA 2K8GA 4OZ1A 5D8HB 4DSLA 2M9KA 4DV0J 3TAQA 2BX6A 4GKKF 3OFHA 2F5GA 3Q22A 2R2RA 3K5LA 4IH7A 5K14A 1JQGA 2ZJQQ 2UP1A 5J1EB 3LUYA 1FRMA 3W63A 5C25A 3BKTA 4EUVA 4ZN3A 1C4AA 3O3LA 2OO4A 3MAQA 1NKCA 2M0GB 4ZPDA 2C2RA 3CEDA 4KHPF 3DDIA 2PA8D 1RBLA 3AD9C 2QMUB 3FEZA 4ICLB 4G65A 4WU2A 2IDLA 1RAJA 1RACB 1RAIB 2AW0A 4P52A 3KJFB 2I2YA 3LF0A 4N47A 3LQVA 4A8XA 4NWBA 5E5NA 5DG9A 3GU0A 4DV0F 1E6YA 3M8ZA 3M7VA 4I1TA 2ADBA 3FJ2A 3D6FB 1UP1A 2ROPA 3GILA 1YZ7A 4K4VA 4WFBQ 1TKXA 3FBBA 3UD5A 4LF7J 4JI2J 3I5AA 3VQTA 5KT5A 3SQGA 3C15A 2DTJA 3HCXA 4JI2F 3ZZRA 2UV8G 1TK5A 1B7FA 2V2ZA 4QWBA 5KT6A 2HNYA 4J9SA 3KLIA 3NS6A 5FD1A 2WW4A 3HSGA 2CAJA 3U1MA 4WP8A 4DV7F 1HR0J 3AD8C 4ILMA 2MKSA 3F56A 5L1LA 2FHJA 3K7RA 5BXIA 2PMHA 3NRBA 1O8BA 1S4EA 1GTHA 1YIJS 3B8HA 3PJ9A 3QJJA 3UDLA 3I0SB 1XN9A 1DQ9A 1SXLA 2ZZTA 4FNIA 4R0JA 2D3UA 1FA0A 3KNGA 2E1AA 2R7OA 3GP9A 4TY8B 4AFFA 3BBFA 2PC6A 3D3CJ 3PM9A 4L72B 5LMNF 1PCAA 3ZTQA 1FKPB 2ROGA 1X4FA 2P6SA 2DNNA 4NA2A 5RUBA 4BLGA 1LK7A 1HNZF 1W2IA 1VCTA 3IXQA 3WIUA 2KXNB 1PJ6A 1RT6B 2HQCA 1DARA 3G8QA 1YRUA 3UFCX 3J81j 2KH9A 1UVKA 1SVDA 4ENOA 5E3PA 3UVJB 1BWVA 3NAIA 1SKRA 2B9XA 1RAFB 4URGA 4Q45A 4IRCA 2J0WA 4KFBA 2B8QA 2GMLA 3K5PA 1D3WA 1T9WA 4DV7J 2MY7A 1Q8KA 1AB8A 4AL7A 3DU6A 1UPPA 2ZUGA 2BVZA 2ASYA 2W9AA 4ED7A 1R6VA 3C3LA 2K06A 1FRHA 5K20B 4DV6F 3QGIA 2WZ1A 2VPWB 5E3CA 3W2WA 2MLYA 4I69A 5H9FK 2B8PA 4QOTA 1CJTB 1Q79A 1Y11A 4X4QA 1FX2A 3HSDA 3MAAA 1ZM3A 4UW2A 5GMDA 3OD2A 1SH0A 2FC8A 3QO9A 3IRXB 3MM5A 3L09A 3OTOJ 1WEXA 3I31A 3GLJA 4J9LA 5H9EJ 2AYEA 2YKMB 2KO1A 1NK6A 3CC7S 4QYRA 4QYZK 2J7WA 1GNKA 2ZM6F 1RU2A 2V2QA 2X7IA 1DTTA 4LF1A 3VVUA 4GVBA 1RJJA 2MQMA 3PY8A 3N01A 4FF2A 2C3MA 3D5MA 2H9ZA 3M8RA 2FB0A 2UXBJ 3CUNA 3J7YU 2QN6B 4ED1A 1ZTWA 4Y65A 1VQ8S 3PYFA 3FEYB 5J2NB 1Q78A 3BPSP 4TVAB 4WK1A 4QIEA 4CNZA 1RHMB 3MM9A 2CQBA 4LQ3A 3CC2S 5SUHA 3US5A 2R9LA 3J7A1 2G2OA 5JUMA 3AY0A 3CO9A 5IWAF 5LSOA 1LKZA 2R8IA 1SJ3P 1PIEA 4UUWA 1RA6A 4C9DA 4KQZA 4J9RA 4CT8A 4K4XA 2FJVA 1U2CA 2DGOA 3RR7A 2NCKL 3PVXA 1AFIA 4RW6B 4IOCQ 2V67A 1PC5A 2BQ3A 3Q8VA 3CJKA 5KFXA 2YKOA 1M5VC 3P5TL 1S6OA 4LF9J 4DDFA 2HPUA 1HQEA 4WBFA 3TUIC 3OL6A 2K3IA 2KM8B 4Y2MA 2XM3A 1KQSR 2E7WA 4PCQA 3C6TB 3DLJA 3N6MA 1Y5IB 1JLFA 4V19X 1V5IB 4ECYA 3R7NB 3MECA 2YBVA 4ECZA 3J7AN 1FXDA 1YJRA 2P5VA 2YQ0A 2CPZA 1HKAA 1XMQJ 3BDPA 3O6QA 2W4CA 4ED8A 1D9AA 4KPYA 3EM1A 3JSYA 4BDPA 1OY8A 4Z37A 4PYAA 4DPYA 3B78A 3MMAA 1MU2B 2C28A 2QO3A 3VGTA 4O0IA 3Q24A 4ECUA 1FERA 3D1QA 2ZH6A 4M5KA 4USVA 1URNA 4HH1A 2HVZA 1YJ7A 2L9NA 3K5NA 3Q89A 5T14A 1UVIA 4JV5J 4Y0FA 4IDKB 2IRYA 2BXJA 2EFVA 2LFVA 4DUZJ 1QTNB 3P49B 3U02A 4F25A 1KFDA 3PW7A 4RW9B 1N54B 3S8SA 3TI0A 4QWDA 4ETZA 3K0JA 3MM8B 4ZOSA 1FDDA 1L3KA 3DLEA 2IC3A 4OMFG 1N5YB 3PO5A 1KQGB 2H5IB 4Q8EA 1R8HA 1S7HA 4IG3B 3R2CJ 2QEXS 4KBIA 3D0GE 2I9SA 2CJKA 1JWWA 2C22A 5D4NA 3GIKA 2QGFB 4P7VA 4Z7CA 1WTBA 2XNQA 3Q23A 2I1RA 2ATCB 2F40A 3BO3A 4ZLLA 2XS7A 2UV8A 3GCWP 3BBCA 1X5SA 1RT4B 2G2YA 1NK7A 2BANB 3P8BB 2AEMA 1RWKB 3VGUA 2FJEB 3PYEA 4K4WA 1YLXA 2V9KA 3OTCA 2B7BB 2DK2A 5J2PA 2GS8A 1I5OB 2VH7A 3W61A 3W8GA 2VIHA 4DL7A 1IKYA 5F8MA 2FJAB 4KO0B 4OYOA 3J80Y 3HX9A 3LP0A 1RAAB 3GFXA 3CB4A 3MF5A 4P9SA 4HYKA 1Y3JA 2DH7A 4WFZA 2QL7B 5L1KA 1U48A 4ER8A 2E66A 1GQEA 2OIHA 4OHYA 2G0CA 2J6SA 3PKMA 3C6TA 3CJ5A 4LBHA 1S9EB 1WC6A 4S0MA 4HVZA 5ETTA 2B4UA 3CCJS 3VAJA 2WONA 2A6OA 1MG7A 3HO1A 1PKUA 4RBVA 3MFHA 2KTQA 3KLHB 2GVDA 3WDOA 4DR1J 1UJ5A 3DLGA 4DBQA 2Q6CA 4X4PA 2H4YB 2YXLA 2MQ8A 2R8KA 1QVFR 3QT6A 3SSSA 4XIUA 1RT7A 2GZOA 3CCSS 2E5HA 1J5EF 2HZVA 1J27A 4NI2B 4M5IA 3CJ8A 4K50A 5H9FJ 1C1BB 3HP6A 3MHYA 5L1IA 3T9ZA 3KMQA 2CQ1A 2IM1A 3IAS9 3CCWA 3MCNA 4HI2A 4YUDA 3OUYB 2YH1A 4LMZA 4RKUC 3M2RB 3SCJE 3T6JA 4ES2A 5L38A 1Q5VA 2V2KA 5LT5A 2WVCA 4X66F 2BDPA 2WVBA 4EI2A 3MMCB 1SKSA 2PI4A 3BM7A 3OFGA 4DX7A 1T8EA 2NREA 1PYOB 4CNYA 2FDNA 3BPDA 3IAM9 3CDAA 2W9BA 1HYSB 3KLEB 4YDDB 1VIXA 2NQPA 5AXLA 1HMVB 1W7WA 3NKYA 1OWXA 3LW5C 3MR2A 2R7VA 2CUYA 4OZ3A 3G96A 4W92B 3I9ZA 2MJNA 3CCLS 3ET6A 2B51A 4L76A 5BYRA 4PKDB 1UETA 3SBMA 4EWTA 1NKBA 1GXUA 4TYBA 1VBXA 2BKPA 3KXDA 2QG9B 4OJ1A 5KFMA 4DMZA 2R2SA 5DLGA 4DG1A 1NSPA 3CJKB 1IBMJ 1JLCB 1WEYA 2KL8A 4NL5A 3RRHA 3BDEA 2RQ4A 3EYZA 4G3IA 5CD4A 5K8PA 3Q8YA 3BO2A 2CNLB 1IKXB 3KK2A 1M5KC 2OSQA 1WF2A 2OSRA 4WP3A 3ELHA 1N8RT 5KG3A 1ACMB 4DLGA 3R2DJ 3PJXA 2XSJB 3U1NA 1QVGR 5J2NA 4B9SA 3QMQA 5GADU 1HA1A 2P2CB 4PRFA 4USUA 2IM3A 5HATA 1YHQS 2XMKA 3A1YG 4USJC 5JXSA 2QLXA 3KG0A 2O3DA 4YHHF 5EN1A 3KUHA 2KI2A 5HBMA 1DTTB 2QFIA 5KG5A 1V9OA 3PZPA 1HQ2A 1SJ1A 2GNKA 4P6QA 5KFTA 1OYDA 1LFWA 1BD6A 4YB7A 4C0HA 3OJSA 3JQKA 2HQDA 3QLHB 5KFGA 4EBEA 1OO0B 5CZVA 4PPDA 4DSIA 3FRYA 2R7UA 2ZBRA 2FUG9 3W2VA 4TQSA 3R5AA 4IFVB 3L9ZA 3ILJA 3RW7A 3JQMA 3RG6A 4JI7J 3AB2B 1SB6A 1CQMA 3W2WB 3C15B 5KG4A 1HPZB 4X62F 2MKKA 2PT0A 1K1QA 3WC0A 2FZKB 3R8YA 3M8PA 1NPPA 5E41A 2FLNA 3P6YC 5L39A 2Y8YA 3NCRA 2IVYA 2OEJA 3KLIB 5C42B 2XHWA 2AF6A 4C8KA 4CO3A 2EPIA 1B3TA 2IA6A 2FVQA 1TL7B 5MAOA 1S6PB 4MIAA 4DQQA 2NLWA 4ZLNA 1NDPA 3DHWC 2G2ZA 3NCPA 3EVMA 1EQ0A 2Q79A 2W2MP 3GTYX 4F04B 1G7CB 5L9XA 2R2UA 4JYAJ 4CZCA 4J5OA 2CQDA 2V69A 4DZ6A 5KFHA 2J0QD 2HBRB 4ZLPA 4ICLA 3D2WA 2J9EA 1TKZA 2MSTA 1JLQB 4LR8A 1QAIA 4PEOA 1FK9B 1ZAWA 3FUYA 3NNHA 1MN7A 3TZWA 2W1BA 5T7LB 1RWMB 4CTAB 1C0TA 1SC1B 2APOA 3VR1A 2ASJA 2PEBA 3PRBA 4O4GB 3EPIA 1I3OB 5HLFA 4TY8A 3IS9A 2V9WA 3L7PA 4WKRA 4NEZA 3GIJA 4Y2AA 1FRKA 4YOEA 2BE2A 2DHSA 3D0IE 5D0EA 5DJBA 5F41A 1KQKA 1URRA 2J0SD 3UI3A 2YQ3A 3PO4A 3BN7A 4F3MA 2XY7A 5LM7E 2EBEA 2X3DA 5KG1A 1GMVA 3SCLE 3RBDA 4OL8A 4OQJA 4PG6A 1T95A 2DKOB 2DNMA 3PG9A 5IC6B 1NZ8A 2V8GA 2LDIA 3JTNA 5K8NA 3UN3A 2DPJA 1HBUB 2GV1A 2A18A 1MMDA 1YJWS 3TZXA 2FD2A 5DZ6A 3BSAA 5GAEI 1L3VA 1VRTB 1Y0HA 1HARA 2YKNA 1FJGF 2EFGA 5B0FA 3W7BA 1I94J 4JUZA 1YDLA 2MKJA 3KKFA 4RNHA 4URQU 1Y9OA 5ETMA 1HHTP 2WBRA 3CCUS 4YS2A 1FD2A 2VG5B 1A7GE 4P10A 2DH9A 2DY1A 3GR1A
chains in the Genus database with same CATH topology
1T02A 3AA9A 4NXMF 2BBEA 2GIQA 3ZZPA 1N6QA 2HHQA 3U7JA 1D8ZA 2ROEA 1R6YA 2MZJA 3EGNA 4C4WA 2MZ1A 1MMNA 2QA2A 1KTVA 2DGUA 3H2VE 2YX7A 4UUXA 4DUZF 4NLYA 2E9TA 1IQTA 1Y5NB 4FS2A 3UW1A 1E6VB 2NUUG 4N5SA 3IR5B 1SC6A 4U67Q 1XR6A 1V3SA 1NK5A 1Z1ZA 2ABYA 1DZ5A 5FIIA 2Z4PA 4PUOA 3DCAA 2VQFF 4HTIA 2AGPA 2IVMA 1HBUA 3PDNA 5M2UA 4B3OA 3S1TA 1X4CA 1T05B 7FD1A 2ZE2B 3X3UA 4NLRA 5K5MA 4OZ5A 1CC8A 4E98A 2BE2B 2L9WA 4M95A 4PUOB 1U8SA 2ZZNA 2Z2MA 4ZVFA 1S1VB 1BQNB 1R89A 2KRBA 3RAQA 1X4EA 2YKQA 2BRLA 2WSEC 3MMBA 3PX6A 4F4YA 2J7UA 3NCQA 1SBRA 2VFRA 2LA6A 5KT3A 2R7WA 4A8KA 1R0AA 2R8GA 3CC7S 3MOJB 2ADCA 1DLOA 1S0OA 2N4DA 1R3NA 4TLRA 2HS3A 1UVMA 4RBUA 3ZZ0A 1PSDA 4TU9A 2R7XA 1KLMB 1VFJA 2R4FA 3V4MA 1N52B 1AW0A 2E5IA 4ZKAA 2V0NA 3BSNA 1FNXH 4N77A 4X2BA 5EUHA 4DL0C 1FKOA 2KM8C 2E9ZA 3RB0A 4B3RF 4DL2A 4WZMA 1REVA 1EP4A 3M32A 3CCVS 2W7AA 1H6KX 2ZJPQ 2C2DA 4MKYA 1X4AA 3CCRS 2M3DA 4J9MA 2XG8A 1Y5LB 1DRZA 2F1FA 3PEHA 2R7QA 3HK2A 1F2GA 1X5OA 1NO8A 4LQ9A 2XGQA 2EK6A 3IS9B 1CPZA 3BGRA 4WZQA 1XMOF 4RX6A 1VS3A 2WBMA 3EXCX 3JAMY 3HPOA 2DGTA 4QIGA 1WHYA 5DDOC 3M30A 3TRGA 3HVRA 4ZPCA 1N0UA 4RZRA 1WWHA 4JBCA 4ED3A 2HLUA 4KV8A 4ZS6A 4EBCA 1UVNA 5A6PA 1SIZA 1WTFA 2CPYA 4RWWA 5KFUA 5F8IA 4X4TA 3KYLA 1XC9A 2CQPA 1QSYA 4QIVA 1M0SA 4I4BA 1Q53A 2F9DA 2B6AB 1EETB 2PA3A 4BWJA 4NLGA 5KFSA 4DOZA 3BSCA 2PFFB 2JH3A 4EZ9A 5EGYA 2N3OA 3H4DA 3DHXA 4JI3F 2Q66A 2E7XA 3HHKA 1UEUA 3M2UB 2I5JB 2G4BA 2VBYA 5DDQC 2LA4A 2EFOA 5D6GA 4CO5A 4OJGA 1L5UA 3G8SA 3ZZOA 2O1PA 2HHPA 4LT6A 1SJRA 2LU1A 1VJWA 1C1CB 1Q8BA 3EGWB 4QCLA 2B5JB 2RT3A 3N6NA 2VL1A 1FNMA 4DG1B 1C0UA 2OPSA 3IG1A 4FF1A 2RUGA 3AAWB 2ZBIA 1CG2A 1V3ZA 3QGHA 3BGFA 3FNNA 1QE1B 3OR1B 4MAKA 1NK0A 3T3FA 2OMLA 1FJCA 3OFEA 2XY5A 4PWDA 4CO2A 3O8WA 4QPTA 3JYTA 2QMWA 3RB3A 5B0DA 3PEJA 1MNEA 2AQ4A 2B3TB 3PR5B 5CZXA 1KEKA 4A46A 5A8KA 1U7LA 2GC8A 5EDWA 2MYFA 4ITSA 5LMUF 1LW0B 4OZLA 2RRNA 3ITHB 3N79A 4WXWA 1HMVA 3C66A 4HEA9 3GMGA 2KN4A 3FQKA 3KK1B 4F3OA 5DETA 2BANA 1T3NA 3G9CA 1KS2A 2RF2B 1AFJA 2LXUA 1LQ9A 1N5TA 1Q16B 1JNZB 2KXHA 3MMJA 4G1PA 1RGVA 2DISA 4ZMMA 1FRLA 1VQKS 2W9CB 1VGYA 3DRSB 5MLCV 4KSEB 3MPVA 4E0DA 2HW3A 1RYSA 2D41A 1N32F 1QAYA 1S1UB 2OD6A 3DLKA 3LO3A 4DLEA 4F02A 2B4VA 5LJ5Y 4ZCMA 2AGOA 1HNVA 2RB7A 4C11A 5I3UA 1BQNA 5M2PA 1GT8A 1S97A 2ZHOA 5G0RA 4KHRA 4W90B 1U1QA 1YBAA 3MUTP 1TR0A 4IFYB 3UNGC 4B3SF 1Q7YT 4RU9A 2RILA 1H7XA 1PILA 4WFYA 4O44B 4N56A 3KMSA 2OTJS 3DMJB 1UVLA 4FVCA 3UCZP 3MEGB 2B0GA 2ZOFA 2ZKTA 3PX4A 3FFIB 1Q86T 4Y6IA 2KG0A 3O5TB 2F4VF 4DV3F 1E6VA 3KFWX 1HBOA 5HROB 1OS5A 3UD4P 4ED5A 4MFBA 3JTPA 2VV5A 5CYMA 2HYIB 2RU9A 5A8WB 2KZZA 3MM9B 2IYGA 5A0YA 3PRDA 5IS2A 1QSLA 4O3QA 3CSKA 2MZTA 2WSCC 3M1VB 4NPOA 4WF9Q 5KFYA 3PHEA 1ZPWX 3GV8B 1P9QC 2GFFA 3GFZA 3FZBA 3SDEB 1T03B 4KR0B 1LW2B 4OI3A 2MJUA 3ITHA 4L3NA 5F3ZA 2XWYA 4ALZA 2VFTA 3G6ES 4GKJF 1UFLA 4JI5F 2VFSA 3VAIA 2CPFA 3BN4A 2ZH8A 3MWBA 1F0XA 2ZC3A 2BRKA 1KHWA 3CTRA 2DNHA 2Q6BA 2HHHF 4BBYA 3THTA 2OPPA 3TUZC 4OX6A 3KLFA 1FKAF 1UWBB 3MM6A 1HQEB 4RUHA 4FF4A 3BREA 1IKWB 4R8UA 4KTQA 5T7LA 3MUMP 2B5JA 2JEFA 2HZCA 1X9WA 4I64A 2FC9A 4F4KA 4RW8A 4DV1F 4QJVA 4I2QA 2VBXA 4Y3CA 2UUWA 1HI1A 1VQ7S 1RDRA 2M88A 5K9FA 3CCQS 1SQEA 1H98A 2LCWA 1P1TA 1RT6A 4RU2A 1V3RA 3UCGA 2V8HA 4ZCKA 1PGZA 2AJ0A 4HT5A 2YNHA 1FKPA 4CH1A 2DR5A 4IR9A 5K8MA 2UUCF 1A9NB 3I6PA 1J2VA 1CC7A 2A1BA 4NZ7A 5GAHU 2FJXA 3KOAA 4ZVHA 4EU0A 1VC5A 4ED6A 1QSSA 3IN5A 4DSKA 4IRDA 4NOHA 2R8HA 3L95X 2VG6B 3KHRA 2HHWA 3IGNA 5E0OA 2VG6A 2RQMA 4RNMA 3I4PA 4NRUA 4KT0C 2MPUA 4LF7F 2KDOA 3MZIA 2PE8A 5HBMB 1R7IA 3CGIA 3TUJC 2NUHA 2XMMA 1RT5A 3OVAA 3E2EA 5BYQA 3DNCA 4EO8A 4OHVA 2CJQA 3SV4A 3OXLA 1D1UA 5F8LA 4R5PB 1RTIB 3OQ2A 2GHPA 2RSQA 1J5OA 1XR7A 4IOAQ 1IKWA 1U6FA 1IKXA 2MSSA 3G4SS 1SH2A 3SV3A 4D3HA 2V5HG 4C3LA 4WFXA 4KB7A 4C0OC 5CA5A 2FVCA 1BC6A 1RT2B 1NHUA 1YJ9S 3M8QA 1GTEA 4CO4A 2DVIA 2FHJD 4QBUA 3CMES 1S10A 1FJEB 1FESA 2ZFHA 2ZKUA 3NMAA 2HGNA 2RDJA 3EUNA 1NK8A 2EBGA 3M32B 1VC0A 1QY7A 5AE3A 1REVB 1NK9A 2DITA 5E3QA 2HHVA 5EHHA 2YNHB 1X8DA 2HGLA 4ED2A 1G3OA 3UE2A 3DLBA 1XERA 1HWUA 2B56A 2MQQA 4X4VA 2Z2LA 4NLVA 4H4OA 2FTRA 3KTQA 3DYAB 3IWLA 5KAKA 2RKIB 1UA0A 4CIOA 4DV2F 1S6UA 3E51A 4A4JA 2NS1B 2KFYA 5HROA 1TL1A 1B0VA 1A6LA 4O23A 4OHWA 1LWFA 3M8SA 3DI6B 3DOLB 2Q1LA 3ICLA 5A8WA 2FJDB 2F8MA 5CYMB 4P7TA 3QGGA 3TVYA 3TAMA 1IJEB 2LEAA 4DS5A 2FIUA 3H40A 1FHTA 2FLPA 3DMJA 4KE5A 4Y00A 2RD5C 1AUDA 3ENWA 3D54A 1BGXT 4K5RA 5J1PA 1V6HA 2XS2A 1OPIA 5J1EA 2OAUA 1JKHB 3N5BA 2HHTA 2E5JA 3H59A 3U1LA 2IJFA 4CI0B 2MGZB 3OSNA 1RT3B 3MEEB 1ZM9A 2WW8A 5HL7Q 2QFJA 2VA3A 3N0VA 1TK8A 4A8OA 4KGKA 3CDUA 3I5BA 3KG4A 3FCHA 3I32A 1MMLA 2G13A 2X1FA 2M8HA 3ZZUA 2J7KA 1LOUA 3GR0A 2DNGA 1AXQA 1WHWA 1JLEA 4R0EA 4Z2XA 2ERRA 1H2UX 2KZMA 3RRGA 4X4UA 3SFGA 1SIWB 1DFDA 2C3YA 2LDYA 4RW9A 3MPWA 3T1HF 2NSBA 1GH8A 1HD0A 1MW7A 1K8AT 3BJYA 1U1LA 5F8JA 3NWGA 3M9MB 2E5GA 5EX0A 4EYIB 1NJWA 2DO0A 7FDRA 3CD0A 4BC9A 2W9CA 4DV5F 2GHWA 4O3SA 2MKIA 1DAXA 4Y34A 3TX8A 1FJ7A 4GO7X 2OH2A 2KHDA 5A8KB 1PO6A 1TVRA 3GFHA 4JYAF 2HFZA 1YJUA 3LGMA 1X7VA 2WOMB 3V2UC 2JL9A 3CDWA 4MKBA 1BY9A 3OV7A 3V4IB 3Q2TC 3NBPB 2JLEA 1NK4A 2DNKA 4ZPTR 3MAHA 2AX1A 3OR1A 2MQOA 4ZDNA 5E33A 2JSXA 2K2PA 2XMVA 3G6YA 2QSFA 1DJ0A 2C3UA 5DQHA 1JK9B 3OHAA 3PFOA 3JYTB 1U6ZA 3FSYA 3HVTB 3M6WA 2D9PA 4DPOA 5IFMA 2J0XA 4YQWA 3R3TA 1WEZA 1NAQA 3POTB 3NNCA 5B0AA 1NHVA 4I2PB 3H2LA 3HKZD 4PG5A 1YRXA 2RQCA 1Y3KA 3CDBA 1KC8T 4ELUA 3V6KA 3QJPA 5CYJA 2RRAA 3QZ7A 2MHNA 4HHJA 2LECA 3BQ2A 2XMTA 3M2VA 4EGLA 1GXLA 3MR3A 4H4KA 1JJ4A 3X1LB 2JZ5A 3P96A 4OI2A 5J2QB 3M2UA 3V81B 5AXMA 3KNAA 3TARA 3TANA 3ISND 3K8WA 2POKA 4O3PA 3D1OA 4I7FB 2HIQA 2GA7A 2YKMA 5F0WA 1RP5A 2EFNA 4O3OA 5EWFA 4ELVA 3LAMA 5BR8F 2JX2A 1FRJA 2CQ2A 4LSLA 4NMLA 5KFIA 4RUAA 1VBYA 1K9MT 3R5CA 3CD5A 4TYAA 1JLBA 4LF8F 2E29A 1FNOA 2VFVA 5E3AA 2FJWA 3QIDA 2JEGA 3I82A 3T5HA 1APSA 2AP6A 2X3GA 4K2XA 2DT9A 3M2VB 2VD3A 3G8TA 1RTDB 4RUCA 4RNNA 4OJ3A 2UXDF 1OSCA 3M30B 2FGOA 3OTEA 5GMKa 1SUQA 3CD6S 2YNFB 1XTZA 2IAJB 5THWA 2GCFA 4KV8B 3POTA 4A8MP 4FNHA 4B08A 1VI7A 2KFNA 2D3ZA 2L48A 3HXMA 1SKWA 4HDGA 2ASDA 4YB1P 3VALA 3WX4A 2LLZA 2IVFB 1DQAA 3T9NA 3HJFA 2GGPA 4DN9A 5HMYA 1IM4A 2C42A 3T1YF 3H20A 2ZD1A 3CJ0A 1U6BA 4ECWA 4C8LA 4OHXA 5IT4A 3AQPA 1HYSA 1EP4B 1FRIA 2IHR1 1ZETA 5KG0A 2B6AA 4WYWA 1S49A 5CCMA 4AXIA 5CD4H 4QU7A 4YB6A 5E2QA 4QWAA 4JV5F 2GHVC 3MDFA 2PIIA 3GIMA 1M5HA 3PX0A 1YITS 3E8OA 4HTJA 5I42B 2UU9F 1KRPA 2KXFA 3DLHA 1OPZA 1R27B 1RT1B 4I2PA 4NYZA 2VOPA 2WB1D 4GC7A 3RW6A 4USHA 2VASA 4NLPA 3KHHA 4DFPA 2O67A 2HWTA 3TOQA 4ZHRA 2MQPA 1QAJA 4WU3A 2KKHA 2V4RA 2BQRA 2CVIA 4NYOA 4QWEA 1JLEB 3Q8SB 1YSJA 3RB4A 1Y7PA 2WONB 3HHLD 3BGRB 4M63A 4PXEA 4YR3A 2Z0GA 1QTMA 1C4CA 3NBPA 1K0TA 4U9RA 1T7PA 2LMIA 4IQMA 4LIRA 3UR3C 3V6DB 3FVYA 2BOPA 4UY8T 5B08A 2MZSA 4F8RA 4ZP7A 5LL6d 4ECVA 4QWCA 3DRRB 3N9UC 3CT9A 1ZTTA 4PQUA 2ZE2A 3I0RA 3TO8A 3CJ4A 4NCGA 2MXYA 2ZNZA 1NNDA 1RWUA 1TL5A 2BJEA 2JVOA 2MY8A 1YTYA 1XNQF 3BB5A 4B3MF 4BHQA 3B4DA 3LP2A 4Q8FA 4NA3A 2VODA 1TVRB 2YWHA 2GX8A 3H2UB 1N33F 3CCZA 2HNDB 4QW9A 1LXJA 3HVAA