2EW9A

Solution structure of apowln5-6
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
149
structure length
149
Chain Sequence
b'MAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHASLAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-transporting ATPase 2
molecule tags Hydrolase
source organism Homo sapiens
publication title Structure of human Wilson protein domains 5 and 6 and their interplay with domain 4 and the copper chaperone HAH1 in copper uptake.
pubmed doi rcsb
total genus 33
structure length 149
sequence length 149
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ew9A01
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ew9A02
4U9RA 1OQ6A 1GXTA 2EW9A 2VH7A 2QYCA 2OP5A 5B0BA 2FTRA 3KG1A 3HDSA 1ULRA 2HFNA 2AJ1A 1OQ3A 1Q8LA 2BJEA 2BUNA 2LQ9A 5A6PA 5B09A 1FVQA 1YJRA 2ROEA 1YRXA 3HFKA 1U7LA 3HX9A 1S6UA 3LO3A 4Y2IA 1JK9B 4A46A 2L3MA 2ROPA 2LXFA 2RSQA 2XMWA 2ZDOA 3GZ7A 3IWLA 3IWXA 1OSDA 2N4CA 4ZOSA 3MCSA 1AFIA 4FNHA 2OD6A 4HI2A 3TRGA 4A47A 1APSA 2GFFA 4A4JA 1CC7A 5IXUA 3BR8A 5B0GA 1AFJA 1FE4A 3HHLC 4NPOA 2N4DA 4QOTA 3F44A 1N5TA 3DCAA 1TZ0A 3DXSX 2XMUA 4HI1A 1TR0A 1N5SA 1K0VA 1KVIA 4HH0A 4F67A 1YJTA 2QLWA 3HF5A 3KG0A 1KQKA 5B0EA 3E8OA 1X0PA 4Q2LA 2K7JA 1X7VA 2OMOA 4Q2MA 1CPZA 2FHMA 1W2IA 1JWWA 1TUVA 2PD1A 2FIUA 4OJGA 3LGMA 1AW0A 5T7LA 2BBEA 3I9ZA 2FB0A 1IUJA 4HL9A 1YJVA 2LDIA 1QUPA 2HFOA 2VV5A 1GXUA 2GO8A 2K1RB 2KKHA 1FD8A 1Y9OA 2K2PA 1SQEA 4YEAA 2BJDA 2W4CA 2AW0A 1MWZA 1KVJA 5B0AA 3CJKB 2XMMA 2OKQA 2KT2A 2ZDPA 2HQIA 2IYIA 1X8DA 2HIQA 2KT3A 3BN7A 1Y0HA 4OJHA 3WDOA 2BYCA 2OAUA 2KYZA 4DL0C 2ASYA 2W4DA 3TNVA 4A48A 3FGVA 3HHLD 1VQSA 3KKFA 3FRYA 3TOQA 5B08A 2G9OA 1LQ9A 1FESA 1N5QA 2GGPA 1Q53A 1MWYA 2RU9A 5F0UA 2HLUA 2IYGA 4OJ3A 3BF4A 2AP6A 3UDCA 1SB6A 2CRLA 1Q8BA 2ROGA 1XBWA 1URRA 2OD4A 2QIFA 1YJUA 1YG0A 2QLXA 3BB5A 4Y2KA 2AJ0A 2W4PA 4YDXA 1WD6A 1P8GA 3T9NA 3LGNA 1Q4RA 1P6TA 1N5VA 3BGUA 1TL5A 2GV1A 4NL5A 2XMVA 3VTIA 3MZIA 1V3ZA 1CC8A 2HLTA 3KNGA 3QMQA 4DPOA 3BDEA 3QGPA 5B0CA 1S6OA 4DN9A 5B0FA 2XMTA 2OFGX 4ZA1A 2K1RA 2PGCA 5A6WA 1Y3KA 2OFHX 1Y3JA 2ACYA 2GA7A 1R6YA 4FNIA 2IFXA 2K7KA 3FMBA 2GGPB 1FVSA 1SI9A 2XMJA 3HHLA 5T7LB 5B0DA 3CJKA 1FE0A 5F0WA 2N7YA 2LQBA 1OPZA 4OIXA 4Y2MA 1RJJA 2RMLA 1TL4A 1VQYA 2RILA 4OJ1A 2XMKA 3K7RA 4EFAC 4HH1A 5K9FA 2GCFA 5KAKA 3HHLB 2Q3PA 2JDJA 1FEEA 3BM7A
chains in the Genus database with same CATH superfamily
1CULB 4LRBA 4G3IA 3I82A 4IOBA 4LBIA 5IT9Y 2A0FB 4A8WA 3EWGA 2MZTA 1BD6A 1MU2B 3MMJA 3D54A 4MIAA 1RA7A 1R27B 5HANA 1U1LA 4ETXA 4AUKA 4CT9A 2E29A 2M5YA 1KQGB 2QT7A 3Q86A 5IWAF 2VIHA 2FLLA 4OI0A 1K1SA 2GIRA 3PHEA 3U27A 4A46A 2NSCA 5C2CA 4O4GB 1TAUA 3D0GE 5DLFA 3CW2C 4ED7A 2E5LF 5CCMA 4ZCIA 1RADB 4ZOSA 1RAFB 3DU5A 2O67A 2FC8A 2CJKA 4DBQA 3BQ1A 2ILYA 2BE9B 2FC9A 2FZGB 1FFGB 3EGZA 3SEOA 3KLGB 4JYAF 4N7TA 1AXQA 5DQIA 3CJ5A 3NMAA 4GC7A 2HIYA 3GP9A 3UCUP 2ZC3A 2WAQD 4S0MA 3DLHA 1QVFR 5KFCA 4G1PA 1XEZA 5J2NB 2XSJB 3CCES 1TR0A 2F4VF 1SC1B 2QLBB 2YNGA 3HD2A 4M5IA 1U1QA 3NBPA 3EVMA 1DY3A 5DDQC 2HBZB 1W25A 3HHKA 2EG2A 2OMOA 1KQFB 4PG8A 3EPGA 5C42A 1OPIA 4X4RA 2JNJA 1XNRF 4ITSA 4KT0C 2Z56B 5CABA 2ZHAA 3V81B 4NXMJ 3LW5C 3OT9A 1YZ6A 4KGMA 1YKWA 1U48A 4H4OA 3L4BC 1U6ZA 1T05A 1WORA 3CO0P 1E6VA 4BWMA 1JLEA 2WZ1A 3MCMA 2CIMA 3QFHA 4DPYA 2YNIB 4J91A 1M5PC 4LREA 5KFGA 3MUVP 3ADAC 1H98A 3FSYA 2WSCC 1QSSA 1SJRA 4UUXA 4AL5A 3CD7A 2NZCA 2XMMA 3T1AA 4ZCKA 3BN7A 1G7CB 3I96A 3TNVA 3TVZA 3K5LA 4O4GA 5GAHI 1C4CA 3GV5B 3OLBA 2C2EA 1N32J 4I0WA 4OYXA 3VHQA 3V6HA 1QLNA 3FK4A 1M0SA 3NS7B 2FY1A 2BDPA 3TOQA 4DR4J 1J5OB 4CNYA 1RWUA 3TW0A 4ECXA 2NCKL 2OGUA 4FF3A 2BE2A 1S0MA 4OL8A 4ZKAA 1RT6A 1VQOS 1S12A 1GMWA 1KP6A 2ZHOA 1MROA 3DRPA 3M8ZA 1Q8BA 3QNWB 3UDLA 2ROGA 3VALA 5J2QB 1HNVA 3T19A 3RB4A 2ZJRQ 2V4RA 4TLRA 4R0EA 1L3TA 3PKYA 4DSFA 3JTOA 3U1LA 1R8HA 5IM0A 4KPCA 3BGUA 3DGVA 1IXKA 3C16A 1FXRA 4L3NA 5ETNA 3UD4P 1I51B 2JOQA 1QD1A 2OSRA 3MPVA 1ROFA 3J80U 1FKPB 1NK4A 1F1BB 4LBPA 2XM3A 3T5LA 5EX0A 2UUCJ 3KJFB 4DPOA 2BJ9A 1SH2A 3M8RA 1AZSA 3LA0A 1REVA 1S1TB 2MQOA 1Y3JA 2E1MC 3B6BA 4FXVA 1RHRB 4OZ1A 4UZBA 5FD1A 4ZHRA 4LF5J 2R8GA 2CQGA 2HFSA 3DNCA 2Z4PA 2CPEA 2D3UA 3GJTB 3IG1B 5A8WA 4J9QA 1MMDA 2CYYA 4ZIVA 1BMQB 1RT4B 4F4ZA 1PAEX 2EFOA 2RMLA 2UXDJ 1IVZA 5KFLA 3C46A 4ED2A 3CEDA 2VD3A 5K8MA 1OJ4A 1TU0B 5L9NA 4ED6A 1ZH5A 1S76D 1VI7A 3HHLB 4EK2A 3BR9A 3C6TA 3NGDA 3BO2A 4YB7A 5KFRA 4PWDB 1CLFA 4OYWA 4JI0F 1QDUB 3DRRB 1ZZFA 4Q45A 2V2VA 3AOCA 5E5NA 2BE2B 3HDSA 1QTNB 4NRUA 1FRKA 1HR0J 4IH6A 1UWAA 1NB7A 4YR2A 2DRBA 2GQQA 2ROEA 3I31A 4QR2A 1NJXA 2JLGA 3J81U 4C9DA 3OUYB 2Y3YA 3G71S 4CLZA 3DRXA 1I5OB 5GVQA 4YFUA 1RDRA 2W2NP 1C0TA 1JLAB 2FVCA 3M8SA 1ELOA 4G1IA 1FWPA 2YKOA 1KFSA 3BV8A 3M6XA 1CC7A 2DHXA 1V3SA 5MLCV 2B6AB 4MTPA 2LKZA 3P3DA 1U2RA 4FPRA 4PEOA 5L9XA 4IG0B 2KM8C 4YB1P 5GAGU 1X9MA 1NJWA 3BSOA 4U7CA 3ZTOA 3PDNA 2DH8A 2MZQA 5L8RC 2XMUA 4F7VA 2R2RA 2OJ3A 4IR9A 1FTCA 1B0TA 3U1NA 4RBTA 3GB0A 5HI7A 2XB2D 3NWGA 2CQIA 2HNZB 3H2UB 2HHWA 1VLOA 5CYMB 4AXJA 4YHHF 4YR0A 1SC6A 2DY1A 3Q23A 2J0QD 3NS6A 1IJFB 4JYAJ 2VF3A 1VQLS 3CMES 1FX4A 3EICA 2Q6BA 3QT7A 4HTJA 2EC2A 3NAHA 3W1YC 2VONA 1HD0A 4M5GA 1IUJA 5D77A 1NMEB 1F6TA 2ADBA 3L7PA 3HT3A 4OI6A 2EEYA 2YWKA 2AKWB 1S7IA 3QAUA 2E44A 1VRUA 2OPQA 3W63A 1UPMB 4F4AA 5JUMA 4C8OA 4P72A 3NMRA 1S1UB 4KIAA 1FXDA 4O3NA 4R8UB 3GJSB 3H4DA 4K4TA 2W4CA 2A6MA 3EJMA 2BX6A 5DZ7A 1S72S 4I6YA 3CDAA 3W64A 3H4BA 2R7QA 2DPIA 4B3OB 2OPSA 5CYJA 1ZZNA 1UFWA 2BYCA 1D8YA 1D9AA 4Q0BA 2BVZA 1A9NB 1I3OB 1NHVA 1SC4B 1WELA 3GONA 1U45A 1CJTA 4ZVGA 4CO5A 1UVKA 1M5VC 2UP1A 4LF6F 2CDQA 1GTHA 2V50A 3WZ0A 4BS2A 1SKUB 4EMDA 1H6KX 5CH7B 2QA4G 3KK2B 3DI6B 1BQNA 2ZH7A 3PM9A 1SUQA 2MQMA 2V4JA 5KFNA 2EI5A 1Q5VA 2WB4A 4MFBB 3W2WB 4C8YA 1HPZA 2VASA 2ZH2A 2RRAA 4C8ZA 3UN5A 5HVHA 2DGUA 2WK4A 1CQMA 3MI7X 2XCAA 3UD5A 5HO4A 4LSNB 2QRRA 1N34J 2JSXA 1ZM2A 4X65F 1IBLF 1FRLA 2Y0SD 1D8ZA 3ENVA 4J9VA 1BUXA 2MZRA 5K8OA 2J8SA 3BDEA 3CCMS 1WOSA 3JS9A 3VAJA 3VAKA 2J0XA 1IR0A 1RA6A 2GJFA 3E2EA 2RS2A 4ZA1A 5J1EA 5E3QA 3OVBA 1T0TV 1FTRA 2EVZA 3PR5B 3GTYX 2PC6A 2ACYA 2DY9A 2GA7A 2G1DA 2NYIA 2RUGA 4NLDA 4DZDA 1XMQF 1TKDA 4IRDA 3C2PA 4M5DB 1SI9A 1UW9A 4PG5A 1S79A 1D9FA 5CZVA 4Z7CA 5M2UA 3QSYB 1VBZA 1IBKF 5KOWA 2F63A 2VBXA 2VA2A 1VR6A 5HMYA 2PI4A 1LW2A 4ID8A 4M1KA 5AJ3J 4B3TJ 3NBPB 4QWDA 2DB1A 3CNQP 1S48A 5KFBA 5GAEU 4DSKA 2EW9A 1EKRA 4WIQA 2JC0A 5K14B 2HRUA 3SCKE 3V6DA 1H72C 2PSZA 2BJEA 2WW8A 1R8BA 1R8PA 2HURA 3LQVA 2FJWA 3ENWA 1PKUA 3IC1A 4F3OA 2ZM6F 3TX0A 1OSCA 1Y5LB 4RW9B 2RSQA 2CPHA 3VAMA 4EYHB 3EXYA 4GRSA 1RGVA 2CWKA 2LXUA 1U0SA 4ATNA 1XMBA 4TNOA 1HWUA 5FIIA 2GJ2A 1DRZA 5KG5A 2VQFJ 4KTQA 2K8GA 1S5ZA 4UY8T 4K5SA 3R8YA 2C3PA 1VRQC 4KSEB 4IH5A 4NRTA 2AF6A 3QGGA 1X4AA 2VZ9A 3M8QB 2IY5B 3CSKA 1IKYA 2XHCA 2D41A 2VG5A 2RE1A 4MK8A 4DQRA 3AJ1A 1HBNA 4C3LA 3P4UB 4ZLNA 5J1EB 1IBMJ 2X7IA 2B4UA 3Q8VA 1N6QB 4CLWA 2ZUAA 3GG1A 1CJKA 3QLHB 2K7JA 4NEYA 1ZM3A 3JSBA 3TZYA 3LP2A 1JLEB 3TJAA 4Y34A 2OTLS 4RU2A 3I5CA 1JIHA 4J7CA 1CSJA 2DNLA 3TYTA 3N9UC 3ZZOA 3OHAA 4EBEA 1HD1A 1NSKL 3H40A 2HNYA 2E5HA 2OEJA 4WFBQ 1WC5A 4PQAA 3M9MB 4KO0A 1TP7A 2G2ZA 4DV4F 4A8YA 1PSDA 4ELTA 4URQU 2GAHC 1RTHB 3FNNA 2XLKA 1WC4A 5JJBA 4ED1A 4LF2A 1GFWB 4LF4J 3V4IA 4GVBB 4FYXB 2B5JB 1HBOB 2L48A 2DHHA 2MHNA 1MWZA 5I3QA 4J9KA 4IOCQ 4K4SA 2P8IA 4DR7J 3T1HJ 1X8DA 3DDIA 3WC2A 4KV8A 2BM1A 2BKPA 1MNEA 2F9JA 2GMHA 3QATA 1HI8A 2Z2LA 4RW9A 2D3OR 1X5TA 3HULA 2F9DA 2APOA 2F5GA 2RF2A 3HKZD 1OS5A 3UR3C 1HNVB 1CJVA 4PWWA 3ZZTA 4ZHRB 3IM9A 4TU7A 1P9YA 4ERDA 4F25A 1M1HA 2RU9A 3ILIA 2BJ1A 2CWXA 5E0OA 2BV3A 2E1AA 2WBRA 4YHHJ 3OTOF 3EVOA 3FQKA 4NLVA 1S0VA 1K9MT 5KFSA 4RNHA 1WC3A 2DGWA 4AQYJ 2KTQA 4DSEA 3P8BB 1QAYA 1WUUA 1JLFA 5EGYA 3C15B 4F0KA 4L6V3 4N47A 2N3OA 2ASJA 2B8PA 3T9NA 2VPZB 3SBMA 4HHHA 1HFEL 2V5HG 2GMJA 4P7TA 1FJGF 2V8VA 3NGRA 4BCAA 3JYTB 3HI9A 3PJXA 3GIIA 3BGRB 2C22A 5FDLB 1FNXH 2DR8A 4NL5A 4OYMA 3NAIA 2OI2A 3KLHA 4BDPA 3NEKA 2CXEA 3KNAA 1B7FA 4YUDA 5HLFB 2M7SA 3ILJA 3PO5A 3FCVA 1RAGB 5DZ6A 3HSJA 4AFFA 2L41A 4DV4J 1S6OA 4ID5B 1NNDA 4B9NA 4L76A 4ZVUB 4DQSA 2U1AA 3KYLA 2HHPA 2JRSA 3HK2A 2BQUA 2QL9B 2WOMA 1FO1A 2OSQA 4F0MA 3ZZUA 1PJ5A 3TUZC 3SYZA 2O5DA 1XWLA 2D9PA 3DLEA 4PYAA 4WTOB 2V2KA 3QZ7A 2IJNA 3HHLA 2R2SA 2EBGA 4OFZA 3W8PA 1UJ4A 2Z57B 3SFGA 4QW9A 1EETA 1WG1A 2ZJPQ 4PUOB 2KZZA 2ZUGA 1S9EA 5DQHA 4DCPB 2BXJA 4DCJB 2YH1A 1UTAA 2RQ4A 3D6TB 3R5CA 1VC0A 1ZTTA 4L72B 3DOMB 3BM7A 3PVXA 2OELA 3N0VA 1MU2A 2M3DA 2ZKUA 4Q5VA 5ADZA 1YGYA 2QG9B 1FJ7A 2ZZTA 1OY6A 1YI2S 3H2LA 4CCHA 4DN0A 2XNQA 3HFKA 2VKZG 2UXCF 1U7LA 3FBFA 3EPIA 4MKAA 2NPIA 4QU7A 3G87A 1UFKA 2MKCA 2ATLA 2QN6B 1YTYA 2ZDOA 5F8HA 1YX2A 5E3PA 2B6AA 3IWXA 3QPIA 1T03A 4V19X 2R7XA 3AXKA 2E9RX 3KG4A 3MMCB 3UN2A 4E98A 1S59A 3B78A 1S10A 4F8RA 3WX4A 1U1NA 3GFYA 4NPOA 3AHPA 4CLTA 1N5TA 4C48A 3DXSX 2MLYA 2L9NA 3DM2A 3ISND 1KRPA 1GX5A 1VGYA 3CWJA 1HNWJ 4ZVQB 4FYYB 1H7XA 2Y0BB 2B7CB 1YK9A 4I2QA 2HS0A 2C3UA 2RIJA 5DGBA 3J7YU 1EHWA 3PZPA 4OYPA 4Y0FA 4NWBA 4Q8FA 4QIEA 3ZNUA 2ZC4A 2FUG9 3G96A 2VQFF 1K8AT 3BBBA 4PZVA 1KDNA 1TUVA 4HEA9 2MZSA 4FF1A 2YY3A 4Z2XA 4LRCA 1HA1A 3FEXB 4KJIA 1FT8A 5I3UB 4P2FA 3OL8A 1X4FA 1GXUA 2YNIA 2NS1B 3ZFVA 1FK9A 4MK7A 5DQGA 4B08A 4L74A 2HHQA 1HW8A 1LWCB 1UW4A 2O66A 2M52A 1LFPA 3D7SB 3KHHA 1ZYQA 4DCOB 4XPCA 1PGZA 1TV6B 1CJUA 1NHUA 3CCRS 4N41A 5EWFA 1K47A 2HIQA 3HSZA 3RB0A 3H2VE 2J9EA 2MY7A 3GE9A 2HQFA 4K7QA 2ZHBA 2EC0A 4DR3F 1GK8A 5FLXU 1C1BA 1KKHA 3NWRA 3FGVA 3Q8YA 5HROA 2X1FA 3UO0A 1TKXA 2GO9A 4K4ZA 2PN6A 2A2CA 1X4EA 3UDEA 2IA0A 3PR4A 4PG7A 4RW7A 3PW7A 5F0UA 2D69A 3IR7B 3KLFB 5I42A 1DLOB 3GR1A 3DRPB 3G86A 3DYAB 3C14B 2P9CA 2PIIA 1XTZA 2UUCF 3S6EA 4LF6J 3TWZA 1HNWF 4B3MJ 2KT5A 3MEEB 1L3UA 1YJUA 3BB5A 2ADCA 5CXTA 1LW2B 4CRJA 5C24B 3M2RB 1NK7A 1S7HA 2QA4S 4I56A 3RB3A 2B9WA 2LMIA 4X4SA 4NLPA 4U7UD 4LF5F 1H3DA 4Y3CA 3PRBA 3OR2A 3OXGA 4ZVTB 3PCOB 5C25A 1KHVA 2LU2A 4F2SA 1JLBB 3MR6A 3M9NB 2HGNA 3PNIA 3QMQA 4RWWA 4O0IA 2B8QA 2MSTA 4ZS6A 2V8PA 3LP1B 3FCHA 1U1OA 2P9EA 1B4SA 2PGCA 2FHKA 3CIZA 2UV8A 4DXLA 4LRDA 3LALA 4USWA 1G2EA 1NH8A 1KR4A 4NLOA 2XMJA 2QL5B 2HQGA 3D2WA 1G1XA 2VFVA 2ZBQA 1LEOA 3I4PA 2N7YA 2BRLA 1H73A 3MMBA 5E7OB 5IM0B 2WVBA 2KG1A 1VQYA 1SH3A 3S8SA 4DLEA 5K9FA 2R7SA 3IAM9 4ZJQA 1UVLA 1U26A 1FWKA 1HNIB 4KQZA 2DTJA 2DYAA 4L3KA 2B4OA 4QIGA 3ETOA 3FEZA 2XLJA 5BJRA 4B02A 1PILA 3R2CJ 2GW8A 1T95A 2YPZA 3BBFA 2RDDA 2QYCA 3L7OA 4NLRA 5AXKA 3KLFA 3B4MA 2FD2A 2GNKA 2F3JA 1BHNA 1C4AA 3R5AA 4IO1A 4AYBD 2ZEJA 1QSYA 7AT1B 2RNEA 5HJYA 3CIMA 3M32B 4UOGA 3R3TA 1PYSB 2MKIA 1SH0A 3CCVS 2HVHA 1JNZB 2DGSA 3TANA 4HACB 4ZCMA 4B9TA 2ACMA 5B7WA 1MWQA 3EXCX 2VQEF 4XIUA 5IOLA 2BANB 3TVYA 1NJIT 1T3NA 1FXLA 2GJIA 2B5JA 2Q6CA 4U8VA 2HSEB 4JUZA 3I56S 2VJVA 2UUAF 1U49A 1R89A 1CQNA 4KFBB 4DX5A 1Z4UA 3P5TL 3T41A 2QA1A 1TUGB 3PV8A 1W2BR 1NJZA 1NEEA 4V1Ak 1KN6A 3O8WA 2UU9F 2ATCB 5B0EA 2A10A 5ETRA 5AXNA 3CVKA 4B9VA 2HBQB 1DQ9A 4OZNA 3J7YI 2A6OA 8ATCB 2BE7D 4I7FB 5GAEI 4N5SA 3AQOA 1TL3B 3UN3A 2HFUA 2UXCJ 2BBEA 1IN0A 1Q95G 2FB0A 2WHOA 2J8AA 5KT5A 2V2ZA 1VYAA 1ZA2B 5KFMA 3V4IB 4YOEA 4O3OA 2MEWA 1HHQA 3A8JA 3MWBA 3NP5A 4PPDA 2XI3A 1EQ0A 2I0XA 1NM2A 2NXJA 2OPRB 2WVDA 2C2KB 2NXCA 3NCQA 4RPFA 4IFYB 1TL7A 1AUDA 4DR7F 2V94A 3UPFA 1RWMB 2ZOFA 3ZZYA 1PAUB 2FHJA 2L08A 3POTA 2J9CA 2IDEA 1CULA 4J37A 1NK0A 2DGVA 1SXLA 2YKMB 4CLYA 1F5CA 4ETZA 4DEZA 1NH7A 1U25A 2ASYA 3AD7C 2BM0A 4XPEA 3D6HB 4OV6A 4PR6A 3MCNA 2DGXA 1NHKL 2MKJA 3JQMA 5CQGA 4DR1F 4LRFA 4J5OA 4DUYF 4LFAJ 1NK5A 4QWBA 3IGNA 2FJDB 3CCTA 1DQ8A 3TUIC 5M2PA 1NK9A 5KFKA 4RW6A 4TXSA 4OJ3A 3KK2A 3DHXA 3E01B 1NDPA 3HJVA 1H38A 4KFBA 4LF9J 4KE5A 4RNNA 2PFDA 3QO9A 3UCGA 1FD2A 4DV6J 1UMJA 2VBYA 1C2PA 4KHMA 4QIFA 1F9EB 1WD6A 2NPFA 5HATA 3VAFA 1RP5A 1ZOTA 3F0NA 3GG0A 3DGPB 5KT4A 3FQLA 3ZC4A 5HLFA 1U1RA 1TVRA 5HBMA 5K8PA 4B3OA 3BKFA 2OLWA 1FFWB 3DHWC 3K59A 4O44A 1YJ7A 1WTFA 2FDNA 2LEBA 4WZMA 2CPXA 4DF4A 1RCXB 4A8OA 1IBKJ 3KNGA 3MECA 1JNRB 3OFGA 5JVHQ 2Y1IA 1YIJS 3HZGA 1H2TZ 3OXFA 3Q2TC 3CCWA 2W25A 2KYXA 3A3PB 2OFGX 5DS7A 1BQNB 3HVTB 3NGKA 2MHEA 3UQSA 2UVRA 3QBCA 1F0XA 4O4RA 2MZJA 3W62A 3A1YG 4FP9A 3RBXA 2XEXA 2AYMA 4HLBA 4RZRA 4OJ1A 3W3SA 3D4JA 2GIQA 3NGUA 1IR2A 1VBKA 1RSCA 3QJJA 1Y5IB 5F8IA 1LWEA 2HVIA 1JLCA 4MH8A 3NCPA 3EDRB 5D4LA 2OPPA 4D3GA 3KHRA 4F02A 4FPIA 2QTWA 3ICLA 5K14A 1HQEA 2FJEB 5GADI 3HFVA 4DQQA 4NI2A 3GFZA 1ULRA 3GV8B 3HZEA 4JBCA 2XSFA 3GYGA 5LXRA 3EX7B 1N33F 1LK5A 5B09A 1RHKB 1S97A 3D9BA 4DV3F 3R7NB 3W9HA 3MMCA 4OZ3A 4ED8A 4CLKA 2XQCA 1RTJB 1QM9A 2LCWA 2POKA 2R3VA 1Q8IA 1R8CA 4QU6A 1TVRB 3CULA 3D0HE 3TEGA 2XCPA 1Z2LA 4TU8A 3GQCA 2IMOA 1FX2A 4WYWA 2RVJA 3N28A 2OEKA 1GEHA 3F41A 4A47A 2W9BB 1HLWA 3ZZRA 3BR8A 3MAHA 3T1HF 1FE4A 1WF2A 1AROP 4C4WA 3IAS9 2RT3A 3MECB 4FYWB 4K4YA 5HP1B 1EQMA 1NUEA 4RJVA 2M0GB 3NNHA 1B70B 4A8MP 1UVNA 1HWJA 2HBYB 2MKSA 3OJUA 1TKXB 4LF8J 4KHPJ 1T9VA 2NUUG 1KQKA 1UEKA 3E8OA 1X0PA 4OI1A 5KG4A 3CD0A 2VA3A 5I3UA 1FHTA 1DLOA 2Q79A 2J9DA 2GQ2A 1UWBB 3Q83A 2ZE2B 4X62J 2RU3A 4QCLA 1IKVB 3MEEA 5H9FJ 4MYTA 4JV5J 1RYRA 2D74B 4JI8F 4X4OA 4UT4A 4ZP9A 3A4TA 3D1QA 4PG6A 1PJ6A 1RBLA 3CJ8A 3CCLS 2K1RB 2XI2A 4KKOA 4C8MA 3H5XA 2KKHA 5HL7Q 3GSDA 1IKYB 2RJZA 3PYFA 4CO3A 4NI2B 4TY9A 2I2YA 4CM0A 4RU9A 3IN5A 4NZ7A 3ZTRA 2B9YA 3EUNA 5KFAA 1EX8A 4ECTA 2MB0B 5ETKA 1JXLA 2KT2A 2AJQA 2LDYA 5A2QU 2KT3A 3DKDA 3MM6B 5G4DA 4DR6F 2KYZA 4DSJA 2CQ1A 2BEFA 2WCXA 3BH6B 1GX6A 4I1TA 2HWTA 1QSLA 4UW2A 2B9EA 4X4PA 5HMXA 3K5MA 5HJXA 1N88A 1RT1A 3Q8PB 4B3TF 3T1YF 2RHQB 4MIWA 4A8FA 3QJLA 4B3MF 3LH2S 1ZAWA 2AIRB 1SQGA 3ET6B 4KO0B 4NYPA 2IYGA 4IDKA 4C2MA 3RYLA 2ZH5A 1IBCB 4QYZJ 2W01A 1HYSA 2AP6A 2DEJA 2YKQA 2BKOA 1RWPB 3HLUA 5F9LA 4OX6A 2QLXA 4ZVFA 1FNMA 3FC9A 4DU8A 4EU0A 1U6BA 5BYSA 1HNIA 1KQSR 5KT3A 4ZPAA 2HNDB 2WRMA 1SIZA 3FMWA 1LXJA 2BACA 3LGNA 2HS4A 3ZXWA 2GQCA 4ES1A 2R8IA 2C28A 3K17A 1PCAA 4RUBA 4LT6A 4C0BA 3JAMU 2IC3A 3C66A 1RWWB 2CNKB 4L73A 4USJC 5C5JA 3G6YA 3EYZA 2IJFA 1XR6A 4K5RA 4W4MA 1RT3A 5CYMA 2HPUA 3QGPA 5A0YB 4JI4J 2ZWOA 1DURA 1N54B 3G8QA 5LSOA 3WHIA 2K1RA 2WB1D 3QGHA 4KKOB 2YPYA 2OFHX 3K89A 4XK8C 1RT5A 4WWSA 2YKAA 3W61A 2I5JA 3B54A 3DXBA 1VJQA 2E5JA 3QWUA 5LMNJ 2HQCA 2W2OP 3X1LB 1A7GE 5B0DA 3D0IE 2COLA 2AD9A 2EFNA 4PUOA 1TL4A 2HZVA 4J9NA 2ZH6A 2AMCB 4HVZA 1WEXA 3C8YA 4DV6F 1NCLA 5KAKA 3TUPA 3OR1B 3P49B 3VAIA 4C0HA 1PC5A 3HHEA 3MEDA 2CQ3A 2JC1A 2LEPA 2P9GA 4CLLA 2VH7A 3ULHA 3HCXA 5IWAJ 2FGOA 4IDKB 2BMBA 1SV5B 1CJTB 2AT1B 5ETTA 4QW8A 4WFXA 4OLOA 1B3TA 3M6VA 1JK9B 2Q1LA 3CMQA 3TZWA 4PPZA 2XY6A 2BW7A 2W9CB 1T03B 2N4CA 5IZHA 4IYQA 1XK8A 2YWGA 4J9PA 1BXNA 1EKSA 3BGOP 4W98A 2OD6A 4MFBA 2CDRB 3W2WA 4QYZK 1N33J 1RWVB 3EMTA 2DIUA 4DJBA 3SV4A 4RWXA 4QOTA 4OHZA 1U8WA 2ZKTA 4WE1B 2GC8A 2VBZA 2XYGB 5DM7Q 4DV1F 4JI5J 1REGX 2D7SA 1RBAA 5KFDA 2HK3A 1WI8A 2XGPA 2MQPA 1OYDA 3HF5A 1NK6A 1FEHA 2VDIA 3C6UB 4IFVB 4Q2MA 2IVFB 4DLGA 2KDOA 1QE1B 3M30B 2ILZA 4M5NA 2QV6A 1W2IA 3FCWA 4OLPA 3RUBL 2V8GA 3OFEA 3MF5A 9RUBA 5IQ6A 1K73T 1JWWA 1AW0A 5AE3A 3AB2B 1R0AB 5ETMA 2CJAA 2ZOMA 3W65A 3FJ2A 3ZNJ1 3QT5A 1T3OA 1Q8KA 1X60A 3A8IA 3RJMB 4EWTA 3RG6A 3M05A 1HBUB 1TL1A 2DITA 3I0RB 5HK4A 4LF7J 2HMIA 3FFIA 3O44A 4JI1F 2XULA 4LVOP 5B0AA 3HSGA 4AL7A 2IVMA 4RW4A 4X4UA 2ZDPA 3PIOQ 4OJHA 4LR7A 2OAUA 2IM0A 1U2FA 2NLWA 2RD5C 1C1BB 4A48A 3BO4A 2DR7A 2HYIB 4W90B 3H59A 3IRWP 4B9SA 1S1XB 3VF0B 1XNQF 2R7WA 3JTPA 3PG9A 4RR5A 2AX1A 2OEMA 2LP4A 1MWYA 3DYAA 2H48B 2HGMA 4LFBJ 4IG3B 2AEMA 1UKUA 2VUGA 1BGXT 2JX2A 4DUYJ 3RRGA 2XZWA 3AH6A 2AYBA 4IUFA 1LWCA 5HMZA 1FDBA 1QJHA 1M90T 1SVDA 2MYFA 4EO6A 4I67A 1JLCB 4OYZA 4KH1B 5F8GA 4UY85 2PA3A 2CPDA 3MR2A 1LWFA 4JI8J 2AGPA 2IIHA 3BYPA 4ZPCA 3PW2A 2V0NA 4X4QA 2RHSB 5K5MA 4OZ2A 3NL0A 2IM1A 1VHIA 1HBNB 1QE1A 5HAOA 5A8RA 4F04B 2RQKA 3CF5Q 4B3SJ 2ZZNA 3HHNB 3MAAA 1S49A 2VB6A 3HVTA 3WX8A 1M1KT 4DSIA 1GT8A 3M1VA 3QIPA 2KB2A 4PAAA 4PXCA 4IR1A 1CS4A 4NLTA 2E5LJ 1TKTB 4PQUA 3A13A 2G1HA 4AD6A 1LFWA 3T5KA 1Q7YT 3BH7B 3HO1A 1SBRA 2WSFC 1YQHA 4JV0A 1Y11A 2CJQA 4H4MA 1FVSA 3MEGB 1C0UA 1Q86T 1O51A 2G0CA 3LP0A 3O5TB 4F0HA 1J5EJ 4RBVA 5L38A 1HQEB 2K06A 1WKLA 3I9V9 2ZZMA 3BKTA 2JFDA 1O6XA 2FYXA 2B4VA 2JVRA 2GAGC 2GCFA 2QSWA 4TYAA 4DS4A 1CBKA 1WG5A 2C2OB 2MJUA 2FQQB 4FVCA 4I6AA 1L3SA 1ITPA 2VPXB 2DGTA 5CA5A 3M8YA 1RTJA 4LFBF 4DV3J 3DMJB 3K5PA 1S0OA 1IM6A 5B0BA 1HMVA 3R5BA 1ZM4A 4OZLA 5DG9A 2BZ2A 2UV8G 5DDPC 2ZE2A 1Q0NA 4P73A 2HWHA 1UVIA 1CJVB 2H4WB 5ETQA 2V9KA 4KR0B 4CTAB 1ZAVA 3UR0A 2WW4A 3GZ7A 2AEJA 4OQJA 4CYUB 5AJ3F 3MPUB 3AT1B 3PJWA 3HHDA 4Q43A 4WP8A 1RHMB 2YBVA 4EYIB 2ASLA 3B8HA 1WKKA 4B3SF 4MJKA 5MAOA 3Q2SC 2E5IA 2V69A 3C15A 1S9GB 4WYLA 4CQ1A 2RDJA 2C2DA 1UEVA 1XMQJ 3KLIA 2FJVA 4GMKA 4HT5A 4ZCLA 4RX6A 1NPPA 1M5SA 1S4FA 1FI4A 3W5ZA 4DQPA 4OI2A 4K0KJ 1RISA 1U0HA 1RT6B 2DR9A 1NU4A 1KLMA 1KNZA 4PQUB 1UL3A 1HW9A 1KVIA 1PIEA 3GIRA 4DMZA 2N7CA 1KTQA 1JXEA 4ZVRB 4JI3F 2DXEA 3VCDA 4I69A 4QIVA 4LFCJ 4OYOA 4CDIA 4HACA 4NA1A 4I7FA 3LP0B 3C16B 1F5AA 4P2SA 3KK3B 1FKAF 3UNYA 4EI2A 3CC4S 5LJ3Y 3BPDA 1E6YB 3LGMA 3DLEB 2W8LA 3TZXA 1HKAA 2MY8A 1RT7B 2E5GA 1RT2B 2R8HA 3OPKA 2AGOA 4HTIA 2LDIA 2R9LA 3PX0A 1UPPA 4G1QB 1AZSB 3EZUA 2DXFA 4WBFA 4CO1A 5F8LA 1REVB 4F2RA 3DMJA 2B43A 1JLQB 1HMVB 3AFGA 4YEAA 1YBAA 3POTB 2KO1A 3THVA 1S1TA 3IM8A 4R25A 1F2GA 1KVJA 3H0PA 2VKRA 3CJKB 5IT4A 4JOUA 1YLXA 4DR5F 2G0JA 2PT0A 1ZTWA 5KFZA 3BJYA 3R5DA 3MFIA 4JI5F 3NCRA 4B9UA 2BR0A 2VPYB 2D1CA 5ETVA 2CG4A 4J9RA 1YBUA 3SSRA 2I9SA 2DXDA 4C0OC 3ITHB 4J9LA 2NUHA 2I5JB 2Z8QA 2CPFA 2YX4A 1NSAA 2KM8B 3MM8A 3SI8A 1TAQA 3E01A 2QSFA 4NMXA 4R0JA 2M8HA 1EARA 3S7RA 5KFPA 1B99A 1GTEA 4Q7AA 2LQJA 2CRLA 3EZ5A 4M5JA 1XBWA 1HBMA 4DR2F 4M94A 4JI2F 5LSLA 4LIWA 4H4KA 1URNA 1Q4RA 4O23A 2U2FA 2YX7A 4UOFA 4ICLA 3VZHA 2OIHA 2XNRA 1N5VA 4GKJJ 4TQRA 3ONQA 3TAMB 4E8UA 1LXNA 3AA9A 4USMA 4U96A 4JI4F 4H4KC 2ZD1A 5E3AA 1M5OC 4WFNQ 3W60A 2HLTA 2HG4A 3VGSA 1UEUA 2YWFA 2BQ3A 2Z2ZA 2J6SA 1SIWB 5HSPA 1EP4A 3WBZA 4C11B 2CJ9A 3DLGB 3VGUA 3FRZA 3QT8A 2DKOB 4N8NA 3W5YA 2Q66A 4NCGA 3SDEB 2EBEA 1FA0A 2F65A 2RUSA 1JLQA 1R6YA 3GMGA 1YJNS 4ED5A 3FDSA 5G0RA 3M2VB 5DDOC 4DR5J 4AE5A 4MMOA 3CJKA 2UVUA 1LV5A 4JB8B 3OTOJ 1NSPA 1RJJA 5LMNF 2IMWP 4AQYF 3PW4A 5DO2A 4PYDA 2GHPA 3CB4A 2C3OA 1CJUB 1YHQS 4F4XA 2C42A 2JDJA 1FEEA 5L46A 2GVZA 4U9RA 4DX8H 1OQ6A 2JEJA 4FZVA 2KHDA 2CPZA 5DRKA 3WQPA 5KT2A 4HHJA 1KVKA 3EE3A 1FJGJ 3Q8RB 2NXUA 3LANA 2FJAB 2NXNA 2OPQB 3IRXB 1DQAA 5ETSA 1FVQA 2E1PA 3R7SB 2BABA 1PYTA 3LO3A 2DGOA 3CGIA 4RW7B 2IM2A 5EDWA 1LK7A 4F36A 4MK9A 3FBCA 1IKXA 2GVDB 3JTNA 3KLEB 1OSDA 2OPSB 2DNNA 2XWXA 1BE4A 2DBBA 1I1GA 2XSJA 4ZVEA 4DV5F 5J2PA 1N0VC 2W9AA 3MDFA 1HBUA 4LR9A 1T9XA 3I0RA 3IO1A 3GFXA 1VC5A 2V63A 4G6VB 4RL1A 5GMKa 4DV1J 3CDEA 1T9YA 2J0WA 3MOZA 3H42A 5IXUA 3D1HA 4ECUA 5KFTA 1TK0A 1N5YB 4DR6J 2NQPA 3VZIA 3PYEA 1OY9A 2ZBCA 3TQEA 4H4OB 1N5SA 3DRSA 3RB6A 4ES2A 1T05B 2CJYB 2CZ4A 1WHVA 4C98A 3A8EA 2CQ2A 3OLAA 1TK5A 1GNKA 1RAEB 5DG7A 3LP1A 1JKHB 5KFFA 3OL9A 2QGFB 2LQ8A 1BWVA 3IBWA 3GPAA 1OIAA 2CZ9A 2HEKA 1MN9A 4IG3A 1UJ6A 4CI0B 3CUNA 1NJYA 2DCLA 1ZPWX 2LEAA 3RAXA 1XERA 4WU2A 4FF4A 2LQ5A 1TL1B 2FHOB 4URGA 5H9EJ 3R6LB 1LWFB 2IBKA 4ZJLA 4ANDA 2ZH1A 1N4LA 2FVSA 2JEIA 1PJ7A 2CPJA 2BKNA 2K2PA 1SQEA 4HYKA 1BY9A 3K58A 3VVUA 3OTCA 1H2VZ 1RXOB 3MAAB 1KHWA 2KJWA 4DG1B 4GKKJ 1S1VA 4X64F 2DH7A 3MM6A 2V68A 4M5DA 4YN3B 2H1YA 1R0CB 1CS4B 2BOAA 5D78A 3QSIA 2YQ3A 5CD4H 5H9FK 5KG7A 1F9FA 3HHLD 3KKFA 2HHUA 3G9CA 3EGWB 3IXQA 2H9ZA 4JP8A 3KOAA 3N5FA 4H4MB 3OL6A 2Y8WA 3AD9C 4JI3J 3QFWA 2UVVA 3B82A 4ILLA 1YVFA 3LTOA 1TTHB 4LFCF 3K57A 1Y4ZB 1N5YA 1R3NA 3CCJS 2H5JB 3PFEA 3BQ0A 2BJ3A 1NZ8A 4P9SA 3HXMA 5KFXA 3DRSB 4C6AA 3QQCD 1NKEA 2GHVC 2Y1JA 3PEHA 3M1VB 2HS3A 3E3XA 1JKHA 5IV3A 2LA6A 4KGXB 4ZVPB 3RW6A 1OMSA 1UP1A 1RK8A 2ZVIA 2CQ4A 4XAKA 3ILLA 2MLXA 4UOCA 3SXLA 4DUTA 2ZBRA 1GMUA 1A0OB 3EGNA 4OZ5A 2G0IA 2CNLB 4ZMMA 3OSNA 2G2YA 2YTCA 3CJ4A 3FBBA 4DV7F 1DJ0A 1X5SA 3EGVA 4CLUA 1VCTA 5EUHA 3PX4A 1ZETA 4K8RA 1HNZJ 1RT5B 2AJ4A 3FZ2A 4O3PA 4QWAA 1YJWS 3T3FA 2H54B 3O1LA 4OX9F 3GIJA 1DTTB 1XR7A 1ZAXA 2K7KA 1Q5YA 4K4WA 4NX9A 3AOBA 1RUSA 3CJSA 3CT9A 3F73A 4XO0A 4WXWA 2XLIA 4PABA 1S1WA 4Y2MA 4J9UE 1JMTA 2IC3B 2C3YA 3OR1A 3K5NA 4C7QA 2B3TB 3OD2A 3OUYA 4CLSA 2DISA 1O5JA 1DFDA 1YRTA 3ISZA 2O01C 3IR5B 4ZITA 1ZM9A 3IG1A 4O0NA 2FPHX 2MLZA 5L39A 3V4MA 2V8DA 4FXWA 1OQ3A 4QWCA 2CJXB 4BC9A 3I87A 4ELVA 4YB5A 3CC7S 1HWLA 1YRXA 4BC7A 2D3ZA 2DRAA 4IO9Q 5J2MA 3KJVB 1S9GA 1RT2A 2C2MB 4JI6J 2X51A 2W9CA 2KVQE 3OTEA 5SZTA 3AB4B 2DIVA 2NSBA 2FZKB 4KV8B 3US5A 4DS5A 2I6WA 3TA0A 2OH2A 1RAAB 1AFIA 4LF4F 3BBCA 4HDGA 4IOAQ 4C3KA 4HI2A 3KDNA 3GYNA 3AA8A 3FBEA 4USUA 2R4FA 5B0GA 4XTTA 3CC2S 2CQBA 3CDWA 5CD4A 4TYBA 1KFDA 2QMUB 4WE1A 3SV3A 3SQGA 4M5HA 4WK1A 4ZP8A 2MZ1A 4DV0F 2CA9A 2F1FA 1FWLA 2QMXA 3MTKA 1UZDA 3W5XA 2DNKA 3PIPQ 4CLPA 1UFLA 1RLDA 2KG0A 3KK3A 1FJEB 1YJTA 3BQ2A 4W92B 2IPOB 1IKWB 3D1OA 1RAIB 2MQ8A 4NLYA 2PMHA 1RE1B 1YSJA 3M30A 2KI2A 2FHMA 3BKUA 2AEFA 2QFIA 4QBUA 4ECSA 3IS9B 3D6FB 3JYTA 4RO0A 4ECVA 1WSVA 4OJGA 5FDLA 3V6JA 2CPYA 4CNZA 2YWHA 1U02A 4J9MA 2XS2A 3NXZA 5LSRA 1T7PA 3QRRA 1F3FA 2YQ1A 4G65A 3K2YA 4JV2A 4ID5A 2Z30B 1IQZA 4KY3A 4OX8A 2FLNA 3TA2A 3LPEA 1QVGR 1H74A 2WONB 4LVNP 2HMIB 2F40A 5ITHA 1B0VA 2EKNA 2IDLA 3BGLA 2ZITA 1R31A 1QY7A 1FERA 3HSDA 4UQTA 5GMDA 3LGHA 3VV2B 3MPWA 5I4MA 3D28A 5CHCB 3WDOA 3J81Y 1P27B 3MGJA 2LU1A 1EETB 3UDVA 5D6GA 3MXHP 2J7WA 2HWIA 4DFMA 3NKYA 3OJSA 1HBMB 2VG6A 2BJ7A 2G9OA 4EO8A 2R7UA 3GJRB 1WC1A 3M2VA 1SJFA 1BQXA 1JJCB 5GADU 4LUBA 3V5RA 4Q44A 3CJ3A 5AE1A 3H25A 3UDCA 3M2UB 3X3UA 4PRFA 1FDAA 3KUEA 1D3WA 3TAMA 4FS1A 4YDXA 3H20A 1DHMA 3BGFA 3ILOA 3G4SS 1AA1B 1PC4A 2GVZB 4O3RA 2A1BA 4ZDNA 3FZBA 4O3SA 4DZ6A 1FCAA 1IKWA 5HP1A 1A6LA 3SSSA 4C97A 2A3JA 2G4BA 4KHRA 4LR8A 1WEZA 4ZPVR 4QQBA 2PEHA 3G8SA 3QRPA 3IS9A 2DJWA 1S1XA 2WVCA 2GHWA 5IS2A 4NCAA 4NCGB 4LBHA 3DLBA 1JJ4A 2YH0A 2VFRA 5B0CA 1NRKA 4IH7A 4WFAQ 1IKXB 1KWMA 1MW7A 2GVDA 4DN9A 3J80Y 3KLEA 3MUMP 3OW2R 2L9DA 1XQIA 2B51A 2X3DA 3DM2B 5IFMA 4K59A 1R8AA 5SUHA 4DX7A 1AT1B 1MN7A 2YKNA 3QGIA 3UNGC 1BQMB 4JI7J 2B0GA 2DNYA 1PYOB 2HGLA 2MTLA 3GV7B 1U1MA 4TN2A 4HDHA 3J7ZT 1KSPA 3JSMB 3KTQA 4CWBA 5DG8A 1L3VA 3AJ2A 3KFWX 2YKPA 2F8HA 2JJ4D 2AV5A 1AB8A 2HVDA 2PMWA 1JLGB 1UZHA 2LVWA 3CCUS 1I94F 4EZ6A 4YQWA 6FD1A 2XMAA 5THWA 2KZMA 5IC6B 3ETMA 2JL9A 3SQOP 2WVEA 5A6PA 1L5UA 2AYEA 1UVJA 2X3GA 2J5AA 4FYDA 5JXSA 2GZOA 4Y65A 4XDDA 1VBYA 2CVEA 3KUGA 3TUJC 5KFWA 3GSIA 2VHGA 2P6TA 4WIIA 2KL8A 3ET6A 3W9JA 3NY0A 3WC0A 4BLGA 1K0TA 5LXYA 4WPAA 1KD1T 2KN4A 2YNHB 1IR1A 2ZFHA 5F3ZA 2CQCA 4DV7J 4ES3A 3HFZB 2QL7B 2VG5B 1CG2A 3D3CJ 2LFVA 4FNHA 4DI6A 3R2DJ 2Z2YB 4P7VA 3H5SA 5K20B 1QAIA 2GFFA 1APSA 1RAOA 5L1LA 1WACA 1S1VB 2VFSA 1VRTB 3MR7A 4ZK7M 4RNOA 1EZZB 2N4DA 4UF4A 3F44A 1VQKS 1FRJA 2QC3A 2UUAJ 3CE8A 2HZAA 4NMLA 4DR3J 3THPA 4USTA 2BRKA 2ZH3A 1H0HB 2EFQA 1KLNA 4ER8A 2DO4A 4P10A 1RT3B 5A0YA 1Y10A 4CTAA 2DGQA 2GX8A 4Q2LA 1U6FA 3A12A 3MM5A 2MSSA 3HD1A 3MHYA 3CPWR 4RKUC 3Q8UA 5HN0A 4RLEA 1M5KC 2X1AA 3MPYA 3M7VA 1XNRJ 3N79A 4JV1A 2W24A 3DOKB 4NLQA 1TMJA 4U95A 3KMQA 2IA6A 1CJKB 3FVYA 4HHUA 1VQMS 1T8EA 4X4NA 3R1HA 4LSLA 3ISNC 2E7XA 4ANCA 4NYZA 2FGCA 2BA9A 2DH9A 5L1KA 2HHHF 3RGIA 4MT1A 4PG4A 2XTJP 4QZVB 4ZLPA 2FJXA 2CNOB 2DD8S 2VDHA 3ZTPA 5JMNA 1U2CA 3TP2A 3L3CA 3A3NB 3MMBB 4A8QA 4GKKF 2HZCA 2OUGA 3JAMY 1Z2ZA 1FRHA 1E6YA 2WVFA 3LWLA 3CXCR 4DL6A 2Y1LB 4PCQA 2RQCA 3KHLA 1YJ9S 1V5VA 3SZ2A 1WF1A 1L3KA 2CQ0A 4DR4F 2EFVA 3JSYA 4CLFA 1URRA 2QIFA 5J1NA 3J7A1 2HRYA 1NBEB 3PFOA 3BSCA 5E33A 1XMOJ 2NREA 1LNQA 1H7WA 3CCSS 3RRKA 1Q7LB 3TX8A 5RUBA 4ZN3A 3GJQB 1S77D 2ZJQQ 4WKRA 1TL5A 3MD1A 4F4YA 4FBTA 4RW8A 2HK2A 2KU7A 2LLZA 4P2XA 3VTIA 3ZTSA 4ZLLA 3MZIA 2AYGA 1UA0A 5F8MA 1JJ2R 3K5OA 2YNFA 3T5HA 3MM8B 4UOHA 1DTTA 2LA4A 1RACB 4IKAA 4OI4A 3PHTA 3DDNA 2ZNYA 2VPWB 4WXOA 5B0FA 3R7BB 3SDEA 2CG8A 5ETLA 4M8LA 3KWMA 2ZH8A 1LOUA 3VGTA 3DOMA 3KLHB 2IFXA 5T7LB 3R9LA 2QFJA 5DJBA 4KGZB 1HNZF 3C3LA 1SKSA 3PRDA 3DLJA 5F0WA 4KPYA 4ICLB 2DNRA 4TQSA 2RDIA 1TELA 2EK1A 3MOJB 5A2QY 1IM4A 3JQJA 5KTQA 4HH1A 1KBRA 1VS3A 2AJFE 1KOHA 2W2MP 3P45B 1Q79A 4OYIA 4ECZA 2Q3PA 2VU5A 3K8WA 4RW4B 2DNMA 3R1LA 3U1MA 3PTWA 1U4BA 4RUHA 3KJVA 1TUWA 1WNEA 2M4MA 2P6SA 3GU0A 3N5BA 3AY0A 1X4CA 3G2XA 4DL0C 1RWOB 1G3OA 2OPRA 3DLGA 1Q8LA 5L1IA 4IFYA 2N82B 2ABYA 5T14A 1YJRA 3TA1A 4X65J 4RNFA 2RRBA 3HX9A 1S6UA 3BN4A 2DNHA 4Y2IA 2DVIA 1IWAA 1NDKA 1TQLA 4WU3A 3IWLA 4LQ9A 2YKMA 4QIWD 3H5UA 3H90A 1VFJA 4LSNA 1RAJA 2QMWA 2XO7A 5M2RA 1EAYC 2FJBB 4X66J 1NKCA 5EHHA 2WONA 4ILMA 1VQ8S 5AE2A 4WZQA 2FLPA 3IMQJ 4I2QB 3TJ9A 4TKTA 5H1SV 1ACMB 2EG1A 2IBOA 4NOHA 1YITS 1NDCA 5KFHA 1JJHA 2YNFB 2GIFA 3DCAA 3QZ8A 1TZ0A 1FRXA 3H5YA 4P71A 5ETPA 3MM9A 3BSNA 1WHYA 3G82B 3KK1A 4JI2J 5L1JA 1NO8A 2DCUB 2IRYA 3NNCA 2JLEA 2QEXS 3PEJA 4GVLA 4USKA 3DGPA 4GC6A 4E0DA 4O3QA 2ZH4A 4IRCA 2UXBF 4OX7A 3ZZPA 5HQMA 2E9TA 1PBUA 5J2PB 2D9OA 1B64A 1FRIA 2CUYA 4USHA 1FFSB 1FKOB 2E9ZA 4F3MA 5EWEA 4MAKA 3UD3P 1VJWA 4TU9A 5H9EK 2KXHA 1HQ2A 4CH0S 2DHGA 2DNOA 4TVAB 4LFAF 1Y9OA 1WDDA 1VK3A 1WHXA 3OV7A 3KLVA 4JV5F 5HROB 9ATCB 2W7OA 2BJDA 4NZ6A 3M8PA 4DG1A 1ZS6A 3UCZP 2OHDA 4PXEA 1LKZA 2KJVA 3S01A 4LF9F 4CT8A 1T11A 1RWNB 5D3GA 1ZBTA 4X84A 1VQ4S 1RTIB 4N77A 3I0SA 2K3IA 2PMZD 3SCLE 5CCLA 3RRHA 1G6BA 1U09A 4FYVB 4DFKA 1NLKL 5A8KB 4NA3A 3M2RA 3OHBA 2DNZA 2YKNB 5U47A 2XYPB 5KFJA 4DUZJ 1TMMA 2CJBA 4CYUA 3NRBA 4CP5A 3BZQA 1KEKA 4NASA 2MQQA 2BJ8A 3BF4A 4PKDB 1JQGA 2B4PA 3SCIE 2HHVA 2RB7A 4OZJA 5HQLA 4X2BA 3KLIB 1UETA 2AJ0A 1M5HA 3N01A 3LPYA 4MIBA 2QE5A 1VDHA 3KLGA 4JI0J 1U0HB 2HQ3A 2FVQA 4NLSA 5I42B 3ENAA 2YWEA 1Y7PA 4KGVB 5KFQA 1VISA 3RW7A 2VQEJ 3I5BA 5J2NA 2WTFA 3JSRA 1TKZB 5C24A 4ZJOA 2Z0GA 4M5LA 3DLLQ 3N6NA 5J1PA 2I1RA 4CIOA 1W26A 3N4WA 3QYYA 5AT1B 5A6WA 3TVKA 1WOOA 3LF0A 3TZZA 4GVBA 1VQ5S 5HVFA 3ZO7A 1Q1KA 2KH9A 1RT7A 2CZVC 1V5IB 2E7VA 2WSEC 4FNIA 4WTYA 5C25B 4EEYA 4BBYA 2KVIA 4ENOA 4L75A 1VK8A 5F9NA 5AXLA 2X1BA 3IBFB 3HP6A 3LWMA 1OPZA 4NZ0A 4OIXA 1I94J 4P52A 3I0SB 4NE9C 2DHAA 5CYQB 5IC4B 4DPXA 3FKBA 1IWGA 1K44A 2UUBJ 1HL6A 3G6XA 4K2XA 3M32A 4LRAA 1C1CB 2ZBIA 2D3O1 4MYUA 3KMSA 1WSRA 5DLGA 4DFJA 4V19J 4RUAA 2ALZA 1HNXF 2FTRA 4OHVA 1H2UX 1BC6A 3ITHA 5IV4A 4B17A 1SCJB 5D4PA 1LW0B 1HWIA 2JH3A 2LXFA 2RKIA 1UCNA 4R5PA 4WP9A 4M5MA 1VRTA 4KHPF 1MLAA 1Z1ZA 3BGRA 2ZM6J 3TI0A 3HVWA 1F2HA 5KFUA 3BREA 3OTDA 5E41A 1NZAA 1V3RA 3OFFA 1SL0A 1RU2A 4J9SA 1W7WA 3NGTA 1Q78A 3HHLC 1IQTA 3NNAA 3AODA 1SQFA 3MMAA 4H54A 1YZ7A 2DK2A 4YS2A 4NLXA 2UUTA 5I3PA 5LM7E 2WOMB 2ZD1B 1YWXA 3DLKB 1SJQA 1TL3A 3AJDA 3AQPA 4TY8A 4DPUA 5EWGA 3O3LA 3KHGA 4CO4A 3THTA 1R43A 1VBXA 5BR8F 2VJUA 4X66F 2J7UA 2I38A 1CPZA 1VQ7S 4YY3F 1XR5A 4YB6A 3L09A 2CKWA 4E2FB 1U47A 4DFPA 1RI7A 2XO6A 3N6MA 2PD1A 4N8OA 1F60B 5G0RB 3HPOA 3NS5A 4NLWA 4HL9A 2YQ0A 2HFZA 1MMNA 2W1BA 4Y6IA 2I8EA 1C1CA 1WG4A 2KFNA 1NSQA 2HVZA 1QUVA 3KXDA 3OVAA 3T6JA 4B9LA 1MSWD 1GQEA 1OY8A 3PY8A 5BYRA 1VQNS 5LMUJ 4ZIWA 4U7UK 3MAQA 3J7AN 2ZBPA 4FDFA 4P2MA 3PKMA 3VQTA 4FF2A 4I2PA 4F4WA 3AXMA 2OKQA 2HQDA 3C6TB 4LF1A 2HQIA 3HVRA 1UA1A 1Q82T 1TFWA 4DX6A 3IGVA 2HAIA 3W8GA 4ECWA 1S9FA 1QAJA 4K0KF 1NDLA 2RKIB 3IA0A 4R5PB 1VOMA 1IJEB 5KG0A 3Q8QB 4BWJA 2J6UA 3V2UC 1RAHB 2DO0A 2W2PP 3I32A 5F3TA 2DRDA 2W7AA 3B4DA 4IQMA 1LQ9A 5E2QA 3OSPA 4NYOA 4DQIA 5HBMB 2HLUA 5FLXY 2G2OA 3GWCA 2YVSA 3HMJG 4WCEQ 4DV2J 1F9HA 1X9SA 2J9DE 2DHSA 2QZ8A 2VG7B 4O44B 3D66A 1NXIA 4ZP6A 4ZN1A 3Q22A 1N36J 4B3RF 2E66A 7FD1A 1R6VA 1V6HA 1VMBA 5IQQA 1HHTP 4YDDB 3CDBA 1HI1A 3DOLB 2JEFA 2K3KA 1WOPA 4QPXA 4EZ9A 5IT9U 3WIVA 1EJ7L 2W2QP 3CMAS 2H65B 1DARA 1X4GA 2EPIA 4RUCA 1SC3B 2EFPA 2FLOA 5C7PA 5HVGA 4NXNJ 2QA2A 3MM7B 4DL2A 2IAJA 1X5OA 2CVIA 3W66A 3UVJA 2VFTA 2VFUA 3IP0A 3IFEA 1OWXA 3MTJA 2F8EX 1FK9B 4ELUA 3SSQA 4I64A 1RKJA 2JHEA 3A8KA 2C3MA 3DDKA 3M2UA 4F26A 4C8LA 1Y3KA 2E1RA 2UZAA 2XC9A 4N76A 1JX4A 3VGVA 2CAJA 4GKJF 2FY8A 2P2CB 3FMBA 4AL6A 3O2IA 3GILA 4DPWA 1FE0A 1EB0A 4ZVOB 4Z7YA 3VWSA 4GO5X 3FEYB 2B56A 5KFIA 2XMKA 3K7RA 1SKRA 1VRUB 3RBDA 3CDUA 3KK1B 2W7PA 4DR2J 1RWKB 4K4UA 3ELHA 1VIOA 3EDQB 3A3OB 1R0AA 3M8WA 4GO7X 3M6UA 4KH0B 3C14A 4ED0A 1RTZA 1FDNA 1BLUA 3CJQA 3TO8A 2QO3A 2HFNA 2AJ1A 4N56A 2LQ9A 2ZNZA 3ENQA 4EBDA 4F4KA 2CQHA 2YNGB 4UQGA 2VG7A 3V6KA 3GR0A 5F8JA 2W9BA 1FJCA 2F4FA 2HBRB 1N52B 2OPPB 3TAPA 3K8VA 1S6QA 4MKYA 3R27A 2L9WA 1P1TA 2YNHA 3P5BP 3OR2B 4QR1A 2AX0A 2P5VA 3IWNC 2DPJA 1J27A 4KAIA 4U6PA 3JSMA 1HQUA 3DC2A 3RBZA 3M8PB 2YX1A 1I6JA 5IT0A 1WKJA 4UZCA 4NXNF 1HNXJ 2GS8A 1WJ9A 1S4EA 2M88A 2V4JB 3HT0A 4A4JA 3G8TA 4FS2A 2O1PA 3PW0A 2BQRA 2AHOB 2VBWA 2CPIA 2HAFA 3UVJB 4OYAA 5A76A 2MJNA 1XNQJ 2PO4A 5D0HA 4HR2A 4HH0A 4LIRA 4F67A 4QYRA 3BO3A 4ECRA 5E3RA 4DV5J 1X5PA 4Y2CA 1IBMF 2V9WA 5CZXA 1X7VA 2H5EA 2XG8A 4ZP7A 2HHHJ 3F56A 4Y2AA 3E51A 4FKXA 5C42B 2Y1RI 3JB9k 4WK3A 1SL1A 4ECQA 5A8RB 2AGQA 3RTVA 1T94A 3V81A 1O8BA 1IBLJ 4YP3A 3I55S 3IBCB 1RHQB 3UI3A 1DZ5A 3BPSP 1LWXA 2UUWA 4EBCA 3L7UA 3M6WA 2HFOA 3VR1A 1WC6A 3CJTA 2VV5A 4LMZA 1F3VA 3PW5A 3PRVA 4K2JA 1FD8A 1MROB 1TKTA 1R0BG 1NAQA 4DL7A 5D15A 3W9IA 2MXYA 2HW3A 7FDRA 3RZAA 1WWHA 5GMEA 1VQ6S 5FJ4A 2XY7A 5KFOA 1RQ0A 1OO0B 4OZ0A 3MEGA 2IRUA 2PDAA 3DFEA 1GXLA 1S0NA 1S6QB 4WKYA 1NPKA 3MM5B 4CO0A 4PXDA 4I6WA 1Q81T 5D8HB 5F8NA 1DBDA 2BANA 2EKYA 5KFVA 5C2GA 1FKPA 3T5JA 3VQSA 5J2MB 3BDPA 2A2DA 3C19A 2HNDA 3FRYA 1CVJA 5D0RA 1PO6A 3P6YC 1N5QA 3KUHA 2JEGA 5BXIA 4Y00A 3I4HX 1VQ9S 4YY3J 4UTGA 1D1UA 3PO4A 4LSLB 3OQ2A 2IHR1 4DUZF 3GCWP 3GCXP 3CJ2A 3KDOA 4FN5A 3GIMA 4FKYA 3R6GB 3Q8SB 2W4PA 5J2QA 5ETOA 1RT1B 4P75A 3O6QA 1RTDB 2HVEA 3MEKA 4DU7A 3SCJE 3M9OB 2MQLA 1TKZA 3Q24A 2PI5A 3EM1A 3L9ZA 4PWUA 3SQGB 2PE8A 1N0UA 3S1TA 1S6PB 1GMWD 1B7YB 2XMVA 5LJ5Y 2PEBA 2G13A 3BYRA 3CO9A 3EVWA 2R7TA 3HJFA 2OMLA 2V4QA 5KOXA 1LW0A 4C3MA 4DOZA 2MGZB 2J0SD 2EFGA 1U1KA 1D9DA 4DDFA 3OVSA 1N6QA 4B9MA 4YMEA 3DRYA 2E7WA 3D5MA 1GMVA 2CQPA 3ZTQA 5DDRC 3JXOA 4NEZA 2YXLA 2FVPA 1KLMB 3RAQA 1UVMA 5DM6Q 3Q0AA 4DR1J 2HNYB 3HVAA 3EZOA 1X9WA 1RU1A 2GGPB 1HWKA 1RKIA 5EX3A 4CH1A 3OBIA 4FVMA 2DEIA 3T9ZA 2V8HA 2KRRA 4USVA 1X0FA 1S57A 1VIXA 3CTRA 5A8WB 2LYVA 4RW8B 3MFHA 1N36F 3BS9A 2QLFB 4EFAC 1XC9A 2JVOA 2MKYA 5HQ8A 3I6PA 4F3QA 1HBOA 2NZ4A 3T6BA 2RS8A 1NB2A 1GXTA 1WHWA 1DTQB 2JZ5A 4I68A 4RW6B 4IG0A 4UUWA 2OP5A 3KG1A 3NGSA 4CH7A 5KG2A 3QO9B 2BUNA 3VAGA 1RHJB 4A8KA 2KRBA 2CQDA 4ZPTR 2VG6B 5BYQA 1X4BA 3WIUA 4JI1J 4OYBA 2AWZA 2HNZA 2WBMA 2ROPA 3MEDB 3FSIA 3PXGa 3RR8A 4HT7A 4P6QA 1N48A 4XDCA 1AYEA 3D3BJ 1G4CA 4X4VA 1N34F 1T9UA 1HI0P 4P74A 3CCQS 3TRGA 2VOOA 3C6UA 3P96A 4IFVA 1JLFB 4I2PB 2NYHA 2H51B 2R8KA 4Y28C 1GAOA 5D0GA 5KFYA 4EGLA 2MGZA 3CD6S 2UU9J 4Q8EA 3W7BA 5BR8J 2HRTA 3MM9B 3G6ES 2MDAA 3OFHA 4A8XA 2AJ2A 1ZPVA 4HI1A 1S1UA 4ZPBA 3QRQA 3OTBA 4ANEA 1XMOF 2H3EB 2HKEA 4ILRA 3KG0A 2RAQA 4YR3A 2JFKA 3MCOA 2F7VA 2DR5A 3NLCA 2UVWA 3MR3A 4LQ3A 1R7IA 4KRWA 1FF2A 1ICEB 5D0EA 2XY5A 2ZVSA 4KYZA 3KJQB 4I4BA 1FKOA 1HR0F 1RCOB 4NLGA 2FIUA 1LWEB 4NCBA 4WFZA 3FFIB 1BQMA 3FSXA 3PACA 4C8NA 4AT1B 4CZCA 1SJ4P 4DV0J 2JLFA 2Y9HA 2M70A 2HHXA 2R7RA 3D6MB 4KB7A 1QUPA 4TLQA 3TQ1A 1WDTA 4JI6F 1OYEA 2FVRA 2GO8A 5LT5A 4IRKA 1XJWB 2ALYB 1EP4B 1X4HA 3DI6A 4C11A 4NA2A 4X64J 2KFZA 1JB0C 1WEYA 3PX6A 1S9EB 2VC0A 1RABB 2JWNA 1E6VB 1RWXB 2FZCB 3BSAA 3MD3A 1JLGA 2AW0A 4ZPDA 3H8YA 3MM7A 5F41A 5D4NA 2F8MA 3QWPA 3W2VB 4CO2A 1YBTA 2IYIA 1Y5NB 5CAAA 1J5EF 1WTBA 4U67Q 1VQPS 3MUTP 2W4DA 1MMLA 5A8KA 4DPTA 1VLYA 3QJPA 3CJRA 4Q0BB 4NLUA 1U8SA 1VQSA 3H7HB 3I5AA 5B08A 3UE2A 3GYXB 3RU0A 4OI3A 1FESA 3MR5A 3U02A 1RYSA 1CEZA 3BEGB 2PA8D 4U8YA 3TR5A 5KG3A 4PWDA 8AT1B 3DU6A 1M1GA 2OD4A 1ZA1B 3SIPB 3IRXA 2UUBF 1YG0A 2VL1A 4QPTA 1SUQB 2IRXA 4USIA 3QIPB 3VAHA 3TARA 1FRMA 1N56A 5GAHU 4ZPWR 3LOUA 1SL2A 4DWIA 1P8GA 1WC0A 2OO4A 1J2VA 2IAJB 1HPZB 2R42A 4PXBA 4A8SA 1KOOA 3R5JB 1P6TA 1RTIA 5D4OA 2KXNB 1UWBA 2Z58B 2UXBJ 2GV1A 1IKVA 3NOGA 1BWEA 4OHYA 1YDLA 2V6AA 4DSLA 4IQXA 4DL4A 1B0PA 4MKBA 2Q43A 3AD8C 2XS5A 1C0UB 2FHJD 2R2UA 2MPUA 4WP3A 3V6DB 3VVTA 4OX9J 4URSA 4BHQA 1NK8A 3N6LA 4HKQA 4DL3A 3HKWA 2XZTB 1T9WA 1HQUB 2H5IB 3KJNB 4F50A 2GMLA 2VC1A 1VC6A 4M95A 3DOKA 4AXIA 1T02A 5AXMA 1J5OA 2BOPA 1U24A 3NG8A 5KG1A 3W2VA 1VHFA 2LQBA 2AQ4A 3TJ8A 1TFYA 2VICA 2NXEA 2RILA 2F4VJ 3LAMA 5KT7A 1AUSL 3ZZZA 2XHWA 4ZVHA 2KXFA 2C2RA 1SJ1A 1RB0A 4LSZB 1TV6A 1RLCL 3M4XA 1RT4A 1HYSB 1KONA 3GFHA 2QYGA 3D67A 4QR0A 3G6VA 4M63A 2ASDA 4NXMF 1JXVA 3LUYA 2B9XA 2X1GA 2BW2A 2AZ1A 4OHXA 1WI6A 2IVYA 3UW1A 1RHUB 1NKBA 2L3MA 2DR6A 1HARA 1Q16B 2XMWA 1P9QC 3PJ9A 3PYGA 5KFEA 2ERRA 3K0JA 1PBAA 1X31C 3AOAA 4K4VA 3J7Z5 4CM2A 3MCSA 5DGAA 5CYQA 1D0EA 2R7VA 5LMUF 2VOPA 4KC5A 5JVGQ 3OL7A 2AU0A 3R97A 5LOQA 4M5KA 2YWWA 1AFJA 3R5GA 2B7BB 2VODA 1KC8T 3DLKA 1C0TB 1JLAA 2RH3A 4TY8B 3TEHB 3U7JA 4ED3A 3M8QA 2LECA 3TAQA 4WF9Q 1K0VA 1YRUA 2MKHA 3DN9A 2OTJS 2C2NA 2C1EB 5KT6A 4DF8A 2QLWA 4X62F 1JLBA 4KBIA 1U1PA 4G1QA 1TK8A 2M8DB 4FXDA 2RRNA 3D68A 3DRRA 3LAKA 3QLHA 3RR7A 2EK6A 2KHCA 1HIYA 4RNMA 3LP2B 2XGQA 2XWYA 3RAMA 3CJ0A 3GLJA 1Y00A 1N8RT 2RF2B 4QWEA 5T7LA 2QX0A 3I9ZA 2LXIA 3JQKA 4J90A 1RTDA 1XN9A 1YJVA 2EXUA 2KFYA 3QT6A 1N32F 3GIKA 4ECYA 3MMAB 3PYDA 3UFCX 6AT1B 1KS2A 1SJ3P 5T41A 1SV5A 2A18A 2PFFB 1RTHA 1XIQA 4WJBA 2CFXA 1QAXA 4OV1A 4DV2F 4OMFG 4WFYA 5HMWA 2XS7A 4RBUA 3AAWB 4ZLJA 4K50A 1SPBP 2XBPA 1Y0HA 3HM9A 2R7OA 2MMYA 4ZVSB 2M9KA 2HFVA 4ED4A 1S1WB 6FDRA 2Y8YA 2DNPA 4R8UA 4B3RJ 1EIYB 3UWTA 4DHVA 2QJ3A 2O3DA 2GGPA 3Q89A 1Q53A 2N3LA 2AZ3A 1SKWA 2DNGA 2V2QA 4LF7F 2C2ZB 2CNNB 1DAXA 1WF0A 5GAGI 3T1YJ 1SB6A 5DETA 2Z2MA 1FNOA 1S6PA 2IM3A 1RBOB 5LL6d 1X4DA 2MQNA 4Y2KA 2R8JA 2NR0A 3FUYA 3MURP 2XYHB 1FDDA 3CD5A 1UJ5A 2R2TA 4LF8F 2HHSA 3OXLA 4FBUA 1QTMA 2J6TA 1S99A 3MPDA 1MG7A 3CCZA 3G82A 3QIDA 8RUCA 4C8KA 4QJVA 2V67A 4Z37A 2ZOGA 3SFUA 1V3ZA 4ALZA 1PG5B 1CC8A 2UXDF 1F5BA 2RQMA 1T9TA 2EWHA 2SXLA 2QLJB 2H4YB 2J76E 5E3CA 4EUVA 3J81j 2MKKA 1D09B 5EN1A 2XMTA 2XZDB 2ZWPA 4D3HA 4X4TA 5KG6A 2DNQA 4LJMA 2W8KA 3RBEA 3QAEA 4J9OA 1O0PA 3IR6B 1UAWA 2CADA 1NPRA 3L95X 1RZMA 2E1CA 2V34A 1K1QA 3NOCA 2IJRA 4MKVA 4OHWA 3DOLA 4K4XA 1V9OA 2M2BA 1GH8A 2ZH9A 1DTQA 2J7KA 2HHTA 4JI7F 1KTVA 4DL5A 3SMZA 3H98A 1TL7B 3ZZ0A 2DT9A 4KGKA 1P1LA 5K8NA 5D3GB 1HHSA
chains in the Genus database with same CATH topology
4G3IA 3I82A 4IOBA 5IT9Y 2BQRA 4A8WA 2MZTA 1BD6A 1MU2B 3MMJA 3D54A 4MIAA 1RA7A 1R27B 1U1LA 4ETXA 4AUKA 4CT9A 2E29A 2M5YA 1KQGB 2QT7A 5IWAF 2FLLA 4OI0A 1K1SA 2GIRA 3PHEA 3U27A 4A46A 2NSCA 1TAUA 4O4GB 3D0GE 5DLFA 4ED7A 2E5LF 5CCMA 4ZCIA 4ZOSA 3DU5A 2O67A 2FC8A 2CJKA 4DBQA 3BQ1A 2ILYA 2FC9A 3EGZA 3SEOA 3KLGB 4JYAF 5DQIA 1AXQA 3NMAA 3CJ5A 4GC7A 3UCUP 2ZC3A 2WAQD 3DLHA 1QVFR 5KFCA 4G1PA 1XEZA 5J2NB 2XSJB 3CCES 1TR0A 2F4VF 2YNGA 1U1QA 3NBPA 5DDQC 1W25A 3HHKA 2EG2A 2OMOA 1KQFB 4PG8A 3EPGA 5C42A 1OPIA 4X4RA 1XNRF 4ITSA 4KT0C 2ZHAA 3V81B 3LW5C 4KGMA 1U48A 4H4OA 1T05A 1U6ZA 1E6VA 4BWMA 1JLEA 2CIMA 2YNIB 1M5PC 3MUVP 5KFGA 1H98A 3FSYA 2WSCC 1QSSA 1SJRA 4UUXA 4AL5A 3CD7A 2XMMA 3T1AA 4ZCKA 3BN7A 1G7CB 3I96A 3TNVA 3TVZA 3K5LA 4O4GA 5GAHI 1C4CA 3GV5B 3OLBA 2C2EA 4I0WA 1QLNA 3V6HA 1M0SA 2FY1A 2BDPA 3TOQA 1J5OB 4CNYA 1RWUA 3TW0A 4ECXA 4FF3A 2BE2A 1S0MA 4OL8A 4ZKAA 1RT6A 1VQOS 2ZHOA 3DRPA 1MROA 3VALA 3UDLA 1Q8BA 2ROGA 3RB4A 5J2QB 1HNVA 3T19A 2ZJRQ 2V4RA 4TLRA 4R0EA 1L3TA 3PKYA 4DSFA 3JTOA 3U1LA 1R8HA 5IM0A 3BGUA 4L3NA 1IXKA 3UD4P 1FXRA 2OSRA 2JOQA 3MPVA 1ROFA 1FKPB 1NK4A 3T5LA 5EX0A 4DPOA 1SH2A 3M8RA 1REVA 1S1TB 2MQOA 1Y3JA 2E1MC 4FXVA 4OZ1A 5FD1A 4ZHRA 2R8GA 2CQGA 3DNCA 2Z4PA 2CPEA 2D3UA 3IG1B 5A8WA 4J9QA 1MMDA 2CYYA 1RT4B 4F4ZA 2EFOA 2RMLA 5KFLA 3C46A 4ED2A 3CEDA 2VD3A 5K8MA 1ZH5A 4ED6A 5L9NA 1S76D 1VI7A 3HHLB 3BR9A 3C6TA 3NGDA 4YB7A 5KFRA 1CLFA 4JI0F 3DRRB 1ZZFA 4Q45A 5E5NA 2BE2B 3HDSA 4NRUA 1FRKA 4IH6A 1NB7A 4YR2A 2DRBA 2GQQA 2ROEA 3I31A 4QR2A 1NJXA 2JLGA 4C9DA 3OUYB 3G71S 3DRXA 5GVQA 4YFUA 1RDRA 1C0TA 1JLAB 2FVCA 3M8SA 1ELOA 4G1IA 2YKOA 3M6XA 1CC7A 2DHXA 1V3SA 5MLCV 2B6AB 4MTPA 2LKZA 3P3DA 1U2RA 4FPRA 5L9XA 2KM8C 4IG0B 1X9MA 4YB1P 5GAGU 1NJWA 3BSOA 4U7CA 2OJ3A 3PDNA 2DH8A 2MZQA 5L8RC 2XMUA 2R2RA 4IR9A 1FTCA 1B0TA 3U1NA 4RBTA 3GB0A 5HI7A 2XB2D 3NWGA 2CQIA 2HNZB 3H2UB 5CYMB 4AXJA 4YHHF 4YR0A 1SC6A 3Q23A 2J0QD 3NS6A 1IJFB 1VQLS 3CMES 2Q6BA 4HTJA 3NAHA 2VONA 1HD0A 1IUJA 5D77A 2ADBA 3L7PA 3HT3A 4OI6A 2YWKA 3QAUA 2E44A 1VRUA 2OPQA 5JUMA 4C8OA 3NMRA 1S1UB 4KIAA 1FXDA 4O3NA 4R8UB 3H4DA 4K4TA 2W4CA 1S72S 4I6YA 3CDAA 3H4BA 2R7QA 2DPIA 4B3OB 2OPSA 5CYJA 1ZZNA 1UFWA 2BYCA 1D8YA 1D9AA 4Q0BA 2BVZA 1A9NB 3OVBA 1NHVA 1WELA 4ZVGA 4CO5A 1UVKA 1M5VC 2UP1A 4LF6F 2CDQA 1GTHA 3WZ0A 4BS2A 1H6KX 5CH7B 2QA4G 3KK2B 3DI6B 1BQNA 2ZH7A 3PM9A 1SUQA 2MQMA 2V4JA 5KFNA 2EI5A 2WB4A 4C8YA 4MFBB 3W2WB 1HPZA 2VASA 2ZH2A 2RRAA 2DGUA 2WK4A 1CQMA 3MI7X 2XCAA 5HO4A 4LSNB 2QRRA 2JSXA 1ZM2A 4X65F 1IBLF 1FRLA 2Y0SD 1D8ZA 3ENVA 5K8OA 2MZRA 3CCMS 3VAJA 3VAKA 3BDEA 2J0XA 1IR0A 1RA6A 3E2EA 2RS2A 4ZA1A 5J1EA 5E3QA 2EVZA 1FTRA 3PR5B 2PC6A 2ACYA 2GA7A 2RUGA 2G1DA 2NYIA 4NLDA 1XMQF 1TKDA 3C2PA 4M5DB 1SI9A 4PG5A 1S79A 1D9FA 5CZVA 1IBKF 5M2UA 1VBZA 5KOWA 2VBXA 2VA2A 5HMYA 2PI4A 1LW2A 4ID8A 4M1KA 3NBPB 4QWDA 2DB1A 1S48A 5KFBA 5GAEU 4DSKA 2EW9A 5K14B 2JC0A 2HRUA 3SCKE 3V6DA 2PSZA 2BJEA 2WW8A 1R8BA 1R8PA 3LQVA 4F3OA 2FJWA 3ENWA 3IC1A 2ZM6F 1OSCA 1Y5LB 4RW9B 2RSQA 2CPHA 3VAMA 4EYHB 3EXYA 1RGVA 2LXUA 4ATNA 1XMBA 4TNOA 1HWUA 5FIIA 2GJ2A 1DRZA 5KG5A 4KTQA 2K8GA 4UY8T 4K5SA 2C3PA 4KSEB 4IH5A 4NRTA 2AF6A 3QGGA 1X4AA 2VZ9A 3M8QB 3CSKA 1IKYA 2D41A 2VG5A 2RE1A 4MK8A 4DQRA 3AJ1A 1HBNA 4C3LA 5J1EB 2B4UA 1N6QB 3GG1A 3QLHB 2K7JA 1ZM3A 3JSBA 3LP2A 1JLEB 2OTLS 4Y34A 4RU2A 3I5CA 1JIHA 3TYTA 1CSJA 2DNLA 3ZZOA 3N9UC 4EBEA 3OHAA 1HD1A 3H40A 2HNYA 2E5HA 4WFBQ 4PQAA 3M9MB 4KO0A 1TP7A 4A8YA 4DV4F 4ELTA 1PSDA 4URQU 1RTHB 3FNNA 2XLKA 5JJBA 4ED1A 3V4IA 4J9KA 2B5JB 1HBOB 2L48A 2MHNA 5I3QA 1MWZA 4IOCQ 4K4SA 1X8DA 3WC2A 4KV8A 2BM1A 2GMHA 1MNEA 2F9JA 4RW9A 2D3OR 1HI8A 2Z2LA 1X5TA 2F9DA 2APOA 3HKZD 2RF2A 3UR3C 1OS5A 3ZZTA 1HNVB 4TU7A 4ZHRB 1SKRA 4ERDA 4F25A 2RU9A 5E0OA 2BV3A 2E1AA 2WBRA 3OTOF 1S0VA 3FQKA 4NLVA 1K9MT 5KFSA 4RNHA 2DGWA 2KTQA 4DSEA 1QAYA 1JLFA 5EGYA 2ASJA 4L6V3 4N47A 2N3OA 3T9NA 2VPZB 1HFEL 2V5HG 2GMJA 4P7TA 1FJGF 2V8VA 4BCAA 3GIIA 3JYTB 3HI9A 3PJXA 2C22A 3BGRB 1FNXH 5FDLB 2DR8A 4NL5A 3NAIA 3KLHA 4BDPA 3KNAA 1B7FA 4YUDA 5HLFB 2M7SA 3PO5A 4AFFA 4B9NA 2L41A 1S6OA 4ID5B 1NNDA 4DQSA 2U1AA 3KYLA 2HHPA 2JRSA 3HK2A 2BQUA 2WOMA 1FO1A 2OSQA 3ZZUA 3TUZC 3SYZA 2O5DA 1XWLA 2D9PA 3DLEA 3QZ7A 2V2KA 2IJNA 3HHLA 2R2SA 2EBGA 4OFZA 1UJ4A 3SFGA 4QW9A 1EETA 1WG1A 2ZJPQ 4PUOB 2KZZA 2ZUGA 1S9EA 5DQHA 2BXJA 2YH1A 2RQ4A 3R5CA 1VC0A 1ZTTA 4L72B 3BM7A 3PVXA 3N0VA 1MU2A 2ZKUA 2M3DA 4Q5VA 5ADZA 1YGYA 1FJ7A 1YI2S 3H2LA 4CCHA 4DN0A 2XNQA 3HFKA 2VKZG 2UXCF 1U7LA 3EPIA 4MKAA 2NPIA 4QU7A 2MKCA 2ATLA 1YTYA 2ZDOA 5F8HA 5E3PA 2B6AA 3IWXA 3QPIA 1T03A 4V19X 2R7XA 2E9RX 3KG4A 3MMCB 4E98A 3B78A 1S10A 4F8RA 3WX4A 1U1NA 3GFYA 4NPOA 3AHPA 1N5TA 3DXSX 2L9NA 3DM2A 3ISND 1KRPA 1GX5A 1VGYA 3CWJA 1H7XA 2B7CB 4I2QA 2HS0A 2C3UA 2RIJA 5DGBA 3J7YU 3PZPA 4Y0FA 4NWBA 4Q8FA 4QIEA 2ZC4A 2FUG9 3G96A 2VQFF 1K8AT 1TUVA 4HEA9 2MZSA 4FF1A 2YY3A 4Z2XA 1HA1A 3FEXB 4KJIA 1FT8A 5I3UB 3OL8A 1X4FA 1GXUA 2YNIA 2NS1B 3ZFVA 1FK9A 4MK7A 5DQGA 4B08A 2HHQA 1HW8A 2O66A 1LWCB 1UW4A 2M52A 1LFPA 3KHHA 1ZYQA 4XPCA 1PGZA 1TV6B 1NHUA 3CCRS 4N41A 5EWFA 2HIQA 3RB0A 3H2VE 2J9EA 2MY7A 3GE9A 2ZHBA 2EC0A 4DR3F 1C1BA 5HROA 4K4ZA 3FGVA 2X1FA 1TKXA 2GO9A 2PN6A 2A2CA 1X4EA 2IA0A 3PR4A 4PG7A 4RW7A 3PW7A 5F0UA 3IR7B 5I42A 3KLFB 1DLOB 3GR1A 3DRPB 3G86A 3DYAB 2UUCF 2P9CA 2PIIA 1XTZA 3S6EA 1HNWF 2KT5A 3MEEB 1L3UA 1YJUA 3BB5A 2ADCA 5CXTA 1LW2B 5C24B 3M2RB 1NK7A 1S7HA 2QA4S 4I56A 3RB3A 2B9WA 2LMIA 4X4SA 4NLPA 4LF5F 1H3DA 4Y3CA 3PRBA 3OR2A 3OXGA 5C25A 1KHVA 2LU2A 4F2SA 1JLBB 3MR6A 3M9NB 2HGNA 3PNIA 3QMQA 4RWWA 4O0IA 1U1OA 2MSTA 4ZS6A 3LP1B 3FCHA 2P9EA 2PGCA 2FHKA 3CIZA 2UV8A 3LALA 1G2EA 1NH8A 1KR4A 4NLOA 2XMJA 3D2WA 1G1XA 2VFVA 3I4PA 2N7YA 2BRLA 3MMBA 5E7OB 5IM0B 2KG1A 1VQYA 1SH3A 3S8SA 4DLEA 5K9FA 2R7SA 3IAM9 1UVLA 1U26A 1HNIB 4KQZA 3U1MA 2DTJA 4QIGA 3BO2A 2B4OA 2XLJA 3ETOA 3FEZA 5BJRA 4B02A 1PILA 2GW8A 1T95A 3L7OA 2QYCA 5AXKA 4NLRA 3KLFA 3B4MA 2FD2A 2GNKA 2F3JA 1C4AA 4IO1A 3R5AA 4AYBD 1QSYA 2RNEA 3CIMA 3M32B 3R3TA 2MKIA 1SH0A 3CCVS 2HVHA 1JNZB 2DGSA 3TANA 4ZCMA 4B9TA 5B7WA 3EXCX 2VQEF 4XIUA 1NJIT 2BANB 3TVYA 1FXLA 1T3NA 2GJIA 2B5JA 2Q6CA 2UUAF 4JUZA 3I56S 1U49A 1R89A 1CQNA 4KFBB 1Z4UA 3P5TL 1W2BR 2QA1A 1NJZA 1NEEA 1KN6A 3O8WA 2UU9F 5B0EA 2A10A 5AXNA 3CVKA 4B9VA 4OZNA 1DQ9A 3J7YI 5GAEI 4I7FB 4N5SA 3AQOA 1TL3B 2BBEA 1IN0A 2FB0A 2WHOA 5KT5A 2J8AA 3V4IB 5KFMA 4YOEA 4O3OA 3MWBA 3NP5A 4PPDA 2XI3A 2I0XA 2OPRB 3NCQA 1AUDA 4IFYB 4DR7F 2V94A 3UPFA 2ZOFA 3ZZYA 2FHJA 2L08A 3POTA 2J9CA 4J37A 1NK0A 2DGVA 1SXLA 2YKMB 1F5CA 4ETZA 4DEZA 1NH7A 1U25A 2ASYA 2BM0A 4XPEA 4PR6A 2DGXA 2MKJA 4DR1F 5CQGA 4J5OA 4DUYF 1NK5A 4QWBA 3IGNA 2FJDB 3CCTA 1DQ8A 3TUIC 5M2PA 1NK9A 5KFKA 4RW6A 4TXSA 4OJ3A 3KK2A 3DHXA 3E01B 1H38A 4KFBA 4KE5A 4RNNA 3QO9A 3UCGA 1FD2A 1UMJA 2VBYA 1C2PA 4KHMA 4QIFA 1WD6A 2NPFA 3VAFA 1RP5A 1ZOTA 3GG0A 5KT4A 3FQLA 3ZC4A 5HLFA 1U1RA 1TVRA 5HBMA 5K8PA 4B3OA 2OLWA 3DHWC 3K59A 4O44A 2LEBA 1WTFA 2FDNA 4WZMA 2CPXA 4DF4A 4A8OA 3KNGA 3MECA 1JNRB 3OFGA 5JVHQ 1YIJS 3HZGA 1H2TZ 3OXFA 3Q2TC 3CCWA 2W25A 2KYXA 2OFGX 5DS7A 1BQNB 3HVTB