2EWHA

Carboxysome protein csos1a from halothiobacillus neapolitanus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
92
structure length
92
Chain Sequence
GIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of CsoS1A and the Protein Shell of the Halothiobacillus neapolitanus Carboxysome.
pubmed doi rcsb
molecule keywords Major carboxysome shell protein 1A
source organism Halothiobacillus neapolitanus
molecule tags Carboxysome
total genus 26
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2005-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ewhA01
4RBUA 3VCDA 4DDFA 4OX8A 3NWGA 3MPYA 3H8YA 3MPWA 4QIEA 3I96A 5L38A 3NGKA 4QIGA 3SSQA 3CGIA 2A1BA 4OLOA 3DN9A 5DJBA 2A10A 4LIWA 4OLPA 2A18A 4AXJA 4P2SA 3BN4A 4OX6A 3DNCA 4QIFA 4OX7A 3SSRA 3SSSA 3CIMA 3IA0A 4PPDA 4RBVA 3PACA 3N79A 4RBTA 2EWHA 3I6PA 4P7TA 4P7VA 4QIVA 2G13A 4AXIA
chains in the Genus database with same CATH superfamily
1RWVB 2KXHA 3U1MA 1FJGJ 5F0UA 2J6UA 4F3MA 5KG6A 1UVMA 2L9NA 4LFBJ 3AA9A 4DS5A 2UUAJ 3RRKA 1Q7LB 1J5OA 4QWCA 2WSCC 2VFRA 1FNOA 1EB0A 3QATA 3KK2B 1XR6A 4DBQA 2GAHC 2MZQA 3EWGA 2IRUA 3CUNA 2J9CA 4OFZA 3H2VE 1NPPA 3KHRA 4JI8J 2K2PA 2J76E 2NLWA 2XZDB 4QWBA 5ETTA 2J0SD 1OS5A 1DTTA 4ID5A 4EUVA 3RW7A 5IT9U 3CD7A 3ZO7A 5LOQA 3W8GA 4ZVFA 1SB6A 1Y9OA 1REGX 5E2QA 3DDKA 2EI5A 2W2OP 2E44A 2GW8A 2ZDPA 4ATNA 2FHOB 1K0VA 3VAGA 3JQKA 1S0VA 5HVFA 3BF4A 5HATA 2HFNA 3D6FB 2NYIA 1Y5NB 1HQUA 4N41A 4B9LA 2YH1A 3RAMA 3UCGA 4NLWA 4K50A 2LMIA 3R1HA 3Q24A 4DI6A 4OYBA 2UXDF 1RAJA 4A8OA 1VR6A 1LKZA 1UFLA 4I69A 2MZJA 1P9YA 5I4MA 3AAWB 2MQQA 4X4SA 4C0OC 4KB7A 4DN0A 1FESA 2VB6A 4TVAB 1RI7A 5CA5A 2R7SA 2PEHA 4RJVA 4Z2XA 1PSDA 4ZCLA 4P73A 2COLA 2QA4G 1TKXA 1BD6A 1X60A 3IA0A 1S5ZA 3RTVA 2Z4PA 3H59A 3HP6A 2RQ4A 4GO7X 3SXLA 4NLUA 1L3TA 4ZVEA 3DLGB 2AZ1A 5ETSA 3BZQA 4WTYA 4HYKA 1H2VZ 3KUEA 1FXLA 2W01A 2UXDJ 2ZZMA 2H4WB 4DR7J 3PYFA 4AL7A 4ILLA 5GADI 2JVRA 3RR8A 3TA1A 2G0CA 2W2PP 4FXWA 3VAMA 1UEKA 4RWWA 1QE1A 1NBEB 4ZLPA 3H7HB 3OTDA 2IBKA 5EDWA 4TNOA 5FJ4A 4RW9B 4FYVB 1SVDA 1WC1A 3OVSA 5CXTA 2DHAA 3UD4P 1Y10A 2FY1A 1WD6A 2W1BA 4NPOA 3OVAA 2OUGA 2LLZA 1X4EA 5K8MA 1FWLA 3JAMU 1YBUA 4QYRA 4F50A 3KFWX 3EX7B 2R42A 3LPYA 2UUCF 2KFNA 2I8EA 1F6TA 2KHDA 1WTFA 5DG7A 5L9NA 1MMDA 4F02A 5F0WA 1EETA 1HBUA 3R6GB 3J81Y 5HLFA 2ZUGA 4CQ1A 2DNYA 3LAKA 3GLJA 3BGFA 1FTRA 2CXEA 3CNQP 1NSQA 3WX8A 1I3OB 1YSJA 1D8YA 2W7OA 2H48B 1QAXA 3V4IA 3D0HE 3I9V9 1N0UA 4DL6A 4LF6F 3LP0B 4GVBA 5KFZA 3MTJA 1HYSA 2I2YA 4I2PB 2GFFA 4KBIA 2DTJA 4UOGA 4BLGA 3BR8A 2HQ3A 2BV3A 1NSKL 4GC6A 1VOMA 4WJBA 4ITSA 4CDIA 1KOHA 2UUCJ 2OSQA 4ZVQB 2YKPA 4NXMF 1WTBA 3VVUA 2ZWPA 5DS7A 1WJ9A 1XMBA 1Z4UA 4HI2A 1MROA 1JLQA 2R8KA 3RB6A 3PO5A 3H5XA 3W3SA 3CPWR 1X4BA 3IWLA 1FRIA 1AW0A 3W9HA 2B56A 3DCAA 2B7CB 2VBXA 1X0PA 1YJUA 4RZRA 4X84A 2JWNA 1WELA 3N5FA 4WFXA 4LF6J 1WACA 2HZCA 2CZ9A 3BKUA 3DLBA 4TKTA 1CJUB 3E3XA 2C42A 1VRTA 3QFHA 1FDDA 2J9DA 3ONQA 4NXMJ 2KTQA 3Q0AA 2RKIA 1RWKB 1LV5A 1TK0A 3W1YC 1U1RA 5FD1A 1DURA 4B3MJ 4RW6A 4FYYB 4EU0A 3SBMA 2AIRB 3J7YI 2VPYB 4EWTA 1F60B 4C98A 3T5LA 3UW1A 2QX0A 5E0OA 2OPRB 3SQGA 1M5HA 2FZKB 5F8NA 4U7CA 5CD4H 4P10A 1KLMB 2VF3A 5B0DA 4OZ0A 1WC6A 3IAM9 2HNDB 3VAJA 4UQTA 1JLGB 5B08A 3R1LA 2H54B 2MGZB 3JQMA 2E5JA 3HFVA 2VONA 3I4PA 4JI2F 5KAKA 2NREA 4ELUA 1RT3B 4UZCA 4OJ3A 2VD3A 1WUUA 1S12A 4KPYA 5M2UA 4WU2A 2UXBF 1KN6A 5ETNA 3KYLA 2L48A 1X9MA 5D4LA 3N01A 4C3KA 4LRBA 4CM2A 5KFRA 1RTHA 2LXFA 4XDCA 2YKMA 2BQRA 1GXUA 5T41A 4I7FA 2R9LA 3BS9A 5A0YA 1T3OA 2HIQA 2GHPA 2FC9A 5BYRA 3JSYA 4ZDNA 2VOOA 3OJSA 5KT6A 1N6QA 2AEFA 3M2VA 5L1JA 3EZOA 4ZK7M 4BC7A 1Q16B 3CJ5A 4J5OA 1OMSA 4CLYA 4DR3F 4JV0A 3CJTA 4JP8A 2LEAA 4U9RA 2V8GA 1AUSL 1ZA2B 2N4CA 1Y3JA 4AL6A 1S6PA 1WSVA 5A8RB 3BB5A 4HTJA 4DV3F 2UXBJ 3FNNA 1CBKA 2E5IA 4DR5F 1LWFA 5DGBA 1U24A 2XSJA 2ZVIA 5SZTA 4QIEA 3QJPA 3KLEB 3AD9C 4Q5VA 2JC1A 5ETMA 1YRTA 1OQ3A 1XC9A 4WTOB 3HJFA 1WI8A 2UVUA 1C4AA 2XYHB 3J81j 3FCVA 1JLBB 4ZP7A 2UXCF 3JSRA 4Z7YA 1IM6A 2Z2MA 2HHUA 1XK8A 2QYCA 4DR3J 2V8DA 2R7VA 1RACB 1REVB 3CCZA 3NGTA 1S97A 5GAHU 2IVMA 4IFYA 4DV3J 3G96A 4DR5J 1N32F 2N82B 2QV6A 3QWUA 4IFVA 5AE2A 4KHPF 3GILA 4OL8A 1FFGB 3LF0A 5HAOA 5CQGA 5HBMB 2XO7A 4RU2A 4WBFA 5DGAA 5HL7Q 1H6KX 2DKOB 4DUTA 1NK5A 1N5YA 2VG7A 4DN9A 2JEJA 4CNYA 3MUVP 4KIAA 3Q8YA 1U1LA 2D3OR 7AT1B 2EKNA 2XM3A 2U1AA 1HHSA 1X5OA 1X5PA 3IGVA 4RBTA 1ZA1B 3CCTA 3PM9A 4DR6F 1J27A 1X0FA 3X3UA 1N32J 3R7SB 2QLBB 2IFXA 3DKDA 2JX2A 2BABA 3DGPA 1Z2LA 4GMKA 4XDDA 4RW7A 3LGNA 4I64A 1NM2A 2EFQA 2E1PA 2XHWA 3TAQA 1MLAA 3ET6A 3OR1A 3CXCR 5D4PA 4ZVTB 1JKHA 4WE1B 4E8UA 3H5UA 3L9ZA 3ISZA 2XWYA 4ZOSA 2FQQB 1CG2A 3PX4A 4KHRA 3VQTA 1X5TA 2JEGA 2OJ3A 3I31A 4ZLNA 1JK9B 4DR6J 2WVBA 4OMFG 2KDOA 2ILYA 2Z56B 3OTOF 3GONA 3HVTB 3IM8A 2HFSA 2FJVA 4ES3A 3TZXA 4PCQA 5J1EB 1U1PA 4OX7A 3VALA 3OLAA 2JDJA 2GMJA 3FRZA 2VFVA 1HI8A 2B51A 1RWWB 4QW8A 4OZ3A 1UZHA 3C19A 3A3NB 3SFGA 1M90T 4YB6A 1HBMA 5IQ6A 5CYMA 4IG0A 4DG1A 4KKOB 1HQEA 4ED8A 1XMOF 3M2UB 2KO1A 5AJ3F 2PFFB 4E98A 2FVRA 1Q53A 3MPWA 1TP7A 5M2PA 1TFYA 4I2QA 2EBEA 4ZJOA 3GZ7A 4OLPA 1TELA 2ZM6J 2R7RA 1B3TA 1VQ9S 4CH7A 4I6WA 4YB7A 3OTOJ 2A6OA 1RTZA 2HVEA 1GMUA 2E1MC 1Y7PA 2OLWA 4ALZA 5GAEI 3A3PB 5L1IA 3DRSA 4IO9Q 2BANB 4DX6A 4NEYA 1Q78A 1KQSR 2YNFA 1M5KC 1WC5A 5GAGU 4NRTA 2ZHBA 3FFIA 1YJ7A 4N76A 3C6UA 4JBCA 2HS3A 4U67Q 1J5OB 1XMOJ 1WNEA 5AJ3J 1LK7A 1BQNA 1FT8A 1LWCA 2CPXA 1AA1B 1S1UA 3DRXA 1NK7A 4CNZA 4OZ2A 3FDSA 2OSRA 2ALYB 3RGIA 3GJQB 2IM2A 1FNXH 1XNRF 3PTWA 4ID5B 2CJAA 3OHBA 1U45A 1NKEA 1C2PA 4EMDA 2YX4A 1VMBA 1YJVA 1BMQB 4LSLB 2HHHF 3G6XA 1N33F 4XAKA 4Y28C 2HFZA 4NA2A 1HQUB 2J0XA 1R43A 4ZP9A 2RHSB 3CT9A 5DRKA 3ZTQA 2IIHA 2AX1A 3TEGA 3BGUA 4OX6A 3EPIA 4EZ6A 3MM7A 3I56S 2R8GA 2B9YA 2XI3A 1HI0P 3HZEA 4QIWD 1XNRJ 4DF4A 2DEJA 1YBAA 3D3BJ 2B8PA 4DL5A 5DDRC 1VISA 4ICLA 3UN3A 2W4CA 2CG8A 3NAHA 2KM8B 2XNRA 1UW4A 4DFKA 2ZD1A 5MAOA 2WZ1A 1QVFR 2QMWA 2DHHA 1YDLA 4B9UA 4ZPVR 1TKXB 3HKZD 1H7WA 3BSOA 2DO0A 3RG6A 3G6YA 1CEZA 2IRXA 3KG1A 4RNMA 1RHKB 4MK9A 2BANA 3Q86A 2VBYA 2HHQA 4PWDA 5J2QA 1X4FA 1CQNA 3VQSA 3KUGA 5I3PA 1KNZA 1UCNA 1N34F 1NZ8A 1FERA 2C2NA 2PMWA 1BWEA 5HJXA 2IRYA 3TAPA 1QE1B 2GVDB 2NQPA 2VA2A 5E3AA 4C3LA 2B9XA 5IC6B 1T9VA 4DV7F 2DR5A 2QL5B 5IZHA 5DQHA 3I5BA 4KQZA 2W7PA 4FVMA 3NWGA 2AGOA 1OYEA 1RWXB 4CZCA 4YHHF 4KRWA 1WEXA 2XS2A 2IVFB 4WF9Q 1PBUA 2XEXA 3FC9A 3NP5A 4PG4A 5B7WA 5AT1B 1EZZB 4F0MA 2ZBPA 4C8KA 2DPJA 2QEXS 3BBBA 5DLFA 1D9DA 5KFBA 4YS2A 1VS3A 3NY0A 3HPOA 3T1YF 1O51A 2O66A 3EUNA 4YR3A 2C2EA 1N36J 4TQSA 2CQ4A 2PEBA 3OR2A 4YUDA 3P5BP 4CI0B 4K2XA 1EETB 1HBUB 5HLFB 3G6ES 3MCSA 4U7UD 4DV7J 2AEJA 1ZTWA 1Q4RA 2KT5A 3T6BA 3ENQA 2PSZA 3IO1A 5IT4A 1WWHA 4UZBA 2PFDA 4KJIA 4GVBB 3R3TA 1RHQB 4YHHJ 1U4BA 2M88A 2XULA 2XMVA 4KO0A 1VQNS 4WP8A 2FJWA 4ZVOB 2H5EA 3TUZC 3KLIA 4NZ6A 1HMVA 3KDNA 3T1YJ 4ZVSB 2VPZB 1TL7A 2MZTA 2B9WA 3GYNA 3WDOA 2AHOB 5HROA 1HBOA 5BR8F 2VKRA 2XMJA 2C3YA 1T9XA 3T19A 4Y6IA 2R7QA 1MROB 1JLQB 2IM3A 2X1AA 1DY3A 3WHIA 2IHR1 2K3IA 1NK4A 4LJMA 4DV1F 3PYEA 4NOHA 2G2ZA 2LQ5A 5BYQA 3TUJC 4OHZA 1T05A 3QYYA 3A3OB 2BYCA 1LW0B 4YB1P 1VLOA 4X4OA 2AJQA 4A8YA 3IR6B 2P6SA 5B09A 3GYGA 1R3NA 1OY9A 4A47A 1VRTB 4O3QA 2E7VA 2H3EB 4UF4A 4JYAF 2XI2A 3J7Z5 5K14A 1RT7A 3RBEA 4O3PA 4RKUC 3T5JA 3BO2A 3TVYA 5BR8J 3GJRB 4Y2CA 1VK3A 2RKIB 1RAFB 3QT7A 1NKCA 4TXSA 1KBRA 3MWBA 4AT1B 1DTQA 2KZMA 1RTJA 3QAEA 2QL7B 2B7BB 2OIHA 4I68A 1X7VA 2LXUA 4X4TA 4FZVA 4QIVA 4RW6B 1S79A 7FD1A 3OXFA 4QWAA 4C8MA 4K8RA 3C6TA 1BQMA 3I96A 4PRFA 5KG7A 2J8SA 2LDYA 3V6KA 4LF8J 2OP5A 3ZZPA 2FLLA 2C28A 1C1CA 3SQGB 4UY8T 2P9EA 4WFAQ 3FEYB 5U47A 4JYAJ 1D8ZA 4WZQA 4KY3A 1JXLA 5KG2A 4LF9F 2OTLS 1DQAA 3RB4A 4IH5A 4JI4F 5E3RA 3P6YC 2KT3A 3W62A 1DLOA 5D6GA 1U1QA 4RNHA 2LP4A 2D74B 1URRA 3DU5A 2EC0A 3ENWA 4IG3A 4B9TA 1D0EA 1HWIA 3BYPA 1JXVA 3N6LA 3LAMA 1RTHB 1V9OA 2YKMB 2K7KA 3NCPA 3WC2A 2RQKA 2VASA 1S0MA 4I7FB 2N4DA 5A0YB 1Q5YA 5IT9Y 4X4VA 1WC4A 2V34A 1N6QB 1S77D 1BUXA 3M2VB 3L3CA 2DRBA 2P2CB 5D0RA 2DH7A 4LIWA 4LF9J 3D0GE 3PV8A 4JI6J 4G6VB 1S6PB 2L9DA 3VAIA 4LF5F 1KVIA 2DXEA 4KR0B 1UPPA 2FY8A 2IY5B 1LWFB 3NMRA 1YIJS 3L09A 2XSJB 2FD2A 4ECSA 2R7OA 3O5TB 2HQFA 1GMWA 3J80U 2AJ1A 2PD1A 4M5GA 1IBMJ 4CLSA 3PW5A 1VBXA 2E9RX 5DQGA 4NLYA 4OYAA 3J7A1 5KFMA 2KKHA 1RCXB 1RUSA 2CNLB 3DLHA 4FKYA 4PAAA 5DDPC 2V68A 5F3ZA 3V81A 2ZHOA 1ZAWA 2XG8A 2B9EA 4LBPA 3B6BA 4LF5J 4IFYB 2W8KA 5F41A 4ELVA 2DNNA 2FJAB 1OYDA 2RRAA 1F5AA 4IKAA 2XYPB 1K73T 2AX0A 5DM7Q 2YWEA 3GPAA 3GIKA 2F8MA 2JLEA 2W2MP 2J9DE 4FF3A 3OQ2A 1YJRA 2YTCA 4RUAA 5EWFA 2G0JA 3G4SS 1VC6A 3E01A 2VC1A 1L5UA 4K7QA 3RAQA 5CZVA 3HT3A 2KJVA 3KMQA 3KG0A 2DCUB 1FHTA 1N5YB 1WHYA 2VG7B 2JLGA 2CWKA 2I38A 2CG4A 1FRKA 3NOGA 1CVJA 1DRZA 3ZTSA 2CA9A 1GXTA 3L7PA 2GJFA 3K59A 3D66A 3UO0A 1ZPVA 4CM0A 5E7OB 4URSA 4AXJA 2OMOA 4P9SA 2IA6A 2GAGC 3D6TB 4ZVUB 2HWIA 5KFJA 4USVA 1TFWA 1QUPA 1MWQA 2F9DA 3MCMA 4RW7B 3MFHA 3JAMY 2ZC3A 1CS4A 4M1KA 2VOPA 1S4EA 4L3NA 4NL5A 3ET6B 3OR1B 2XHCA 3UDCA 1DAXA 1JKHB 3NS7B 1LQ9A 4XPEA 2OEKA 2DR8A 1M1HA 1H7XA 5ETRA 2YQ0A 1VQKS 3NNHA 2J7KA 4W92B 3M8QA 4OHVA 1BGXT 2B4VA 2VUGA 3CJ4A 3HFKA 3W5YA 3ETOA 1TK8A 2ZITA 4JI1F 1DBDA 3PHTA 4XK8C 1R8CA 2FJEB 4Q43A 3O8WA 2MB0B 1R7IA 4ZA1A 4OI4A 5C25A 2IAJA 3GCWP 3BN7A 3UCUP 2R7WA 2CQ1A 3CEDA 4X4RA 1XMQF 4FS1A 1U6BA 4AQYF 3HVAA 4QWEA 1IR0A 3P96A 5IQQA 4KT0C 3THTA 3TZWA 5A8WB 4OYIA 1N54B 1HBMB 4MH8A 4IG0B 3B8HA 1HQEB 1JB0C 3PY8A 3ZFVA 1I6JA 1WG1A 3TVKA 3QJLA 1WC0A 3MEDB 4M5JA 4OI6A 4HKQA 4I2QB 2ZZNA 5KOWA 2DK2A 5GADU 2DXDA 3QWPA 4O44A 3KK1A 2ZH6A 5LSOA 3D3CJ 1TUWA 2M0GB 3CC2S 1KHVA 3OLBA 3R5AA 1XMQJ 5MLCV 1YRXA 2ACMA 4ZIVA 3D2WA 4AQYJ 3DRSB 1HI1A 2L3MA 5DM6Q 1YJTA 4DQPA 1HQ2A 2KN4A 3PX6A 3QSIA 4RPFA 2IVYA 4C8YA 1U1OA 1AT1B 4OYZA 2YNFB 2GJIA 4ZPDA 3R7NB 2HQDA 5E41A 3C6UB 1SH3A 4KV8A 4F4YA 3HHEA 1BQNB 1LWCB 2DNKA 2MDAA 4KGMA 1S1UB 3Q2SC 3MCNA 1EQMA 3DOLA 1TKDA 2HAIA 3AOAA 3KJVB 4N5SA 3F44A 3PRBA 3W64A 1ZS6A 2VC0A 3OVBA 4XTTA 1C0UA 4FPIA 3NNAA 2QJ3A 2UV8A 2EG2A 4J91A 4ZITA 5T14A 3H5YA 1U48A 2MLZA 4FDFA 2N3LA 3FQLA 3US5A 3EM1A 1GXLA 4D3GA 2WONB 2RILA 5HSPA 2B8QA 4KC5A 3KHLA 3R6LB 4USTA 2F63A 2C3UA 1S1VB 1X4GA 2ZEJA 2ZOFA 4ZLJA 3DLLQ 1HHTP 5B0GA 1TZ0A 2PT0A 2G1HA 3MM7B 4X4NA 2MY7A 3ZXWA 1I1GA 1YTYA 4CCHA 1WC3A 2AYGA 4QYZK 1SI9A 4ICLB 3OL9A 4BS2A 2QGFB 2DNZA 5KG3A 3CCJS 3I55S 2DR7A 2XY5A 3HKWA 4DWIA 2ZD1B 1Q8IA 2JH3A 3DLEA 3LUYA 1NKBA 3D68A 1JLEA 4IYQA 3JSBA 3H8YA 1VI7A 1FRLA 3FRYA 3RB3A 3HSJA 5LM7E 2BJDA 4PWDB 5J2QB 1IN0A 3DLJA 1QJHA 5HANA 4ER8A 1RSCA 1YRUA 3NEKA 4EBEA 3M2RA 1VJWA 3M4XA 3CCUS 4QR0A 4ZPTR 2RSQA 5K5MA 1UMJA 1PGZA 5KFEA 1KP6A 3D1QA 3ENAA 3IWXA 5D77A 2CNKB 3B54A 5JJBA 1WOOA 3KLVA 1ICEB 2DY9A 3UDVA 2FTRA 5E33A 4U8VA 1RT4A 3D6HB 1IKXA 4B3SF 4U6PA 3T9NA 3NXZA 2VQFF 3GV7B 3QPIA 2R7UA 2RDJA 4EFAC 4M63A 4TQRA 2EKYA 1M5PC 1VRUA 5FLXY 1U2FA 4YDDB 2HS0A 3PRVA 3OXGA 3V4MA 1R89A 1KQFB 4ZPWR 4EO8A 1T7PA 4PWUA 1UFWA 2CRLA 5K20B 3HM9A 3UNYA 3BQ0A 3OR2B 3C15A 2DHXA 2UUBJ 3Q89A 4J9KA 1VHFA 4YOEA 4DSJA 1ULRA 5IXUA 1XTZA 2GC8A 5L46A 2QYGA 4B3SJ 4DSKA 2V9KA 1O0PA 1R27B 2VQFJ 3W61A 4KO0B 3LH2S 1YQHA 3HCXA 2MQOA 4LSNA 1QM9A 3TARA 3KLIB 1IWGA 2ASDA 1KR4A 4Q7AA 4DV0F 4FS2A 5HMWA 1HMVB 1U8SA 3KK3A 3GE9A 1TL7B 5LSLA 4G1QA 5HROB 1HBOB 4FF4A 4HI1A 1T9TA 3QJJA 1KS2A 3CJ3A 1PCAA 5G0RB 2JJ4D 2PGCA 3UCZP 1S72S 5LSRA 4UOFA 5L1LA 5ADZA 3K5OA 1T05B 4KHMA 1TU0B 1SUQB 2HRTA 4WKYA 2CDQA 5KFVA 1YG0A 2HVIA 2F1FA 4U95A 3HHDA 3D28A 4RL1A 3FQKA 3VGSA 1FX2A 1RU1A 5K14B 1RT7B 1KTVA 3JQJA 2W25A 1T94A 4PZVA 2PE8A 2FVCA 3VR1A 2W2NP 1DTQB 3M6UA 2NPFA 1RTJB 2YX1A 3MMJA 1G2EA 4FNIA 1IBLF 4GKKF 2CPJA 1EKSA 1N8RT 2LECA 1F5BA 1RTIA 3RBDA 2Q43A 3C6TB 1BQMB 4IO1A 3SFUA 1T3NA 2DGSA 2C2RA 2QA1A 2MQNA 2W4PA 4XO0A 2NS1B 5KFLA 3H2UB 1WOPA 3VWSA 2MZ1A 1IVZA 3MUMP 1RQ0A 1C1CB 2JSXA 1H72C 2CQDA 3R27A 1XJWB 2EFVA 3ILLA 2CPYA 5EX0A 4RLEA 3W9JA 1SIWB 4R25A 2CJBA 3UVJA 1DLOB 1IBLJ 4GKKJ 4J9OA 9ATCB 2DD8S 3CJKA 1Q7YT 3DN9A 5K8OA 3M8ZA 1SJ4P 2DGXA 3Q83A 4IG3B 3GG0A 3DNCA 5E3PA 4LIRA 3MR3A 4NCGA 1RWUA 1KVKA 2RJZA 1YLXA 3M9NB 1KEKA 4U96A 1IBCB 1ZOTA 1HFEL 2EFNA 4AD6A 1UA1A 1WKKA 3M8PA 2F8EX 2RRNA 4WIQA 2JZ5A 2X1FA 2XCAA 3SV3A 4ZN3A 1S10A 4R8UA 1S6UA 3GSIA 3GV8B 1NUEA 2NXCA 4NLSA 3LP2A 3GSDA 5T7LA 3OV7A 2RUSA 1LXJA 2DNMA 3H40A 2IJNA 5E3QA 3A13A 2Z57B 3UNGC 2NCKL 2FGOA 3BV8A 5C7PA 4K4ZA 2OHDA 4F3OA 2E9TA 1VDHA 3W7BA 2OI2A 3QSYB 2WCXA 3N6MA 4PQAA 5IWAF 5KFQA 1DZ5A 2FVPA 4H4MA 4RBUA 1R0BG 3VZHA 1LK5A 4O3OA 2MKKA 1J2VA 1VIOA 2MKSA 1KD1T 3PHEA 3NBPA 2E29A 1SQGA 3RRGA 2WSEC 2VQEJ 3EGNA 4XPCA 4I4BA 2BE2A 2BBEA 3OTCA 5IS2A 3V81B 1GH8A 4W4MA 4P6QA 5KFCA 4WIIA 3MAAA 4LF2A 1UEVA 3MI7X 1Q5VA 2AP6A 3BH6B 1E6YB 3CCLS 3MOJB 3D54A 2UV8G 1V5VA 5BJRA 3QT8A 2QL9B 5DDOC 3E01B 4O0IA 4OHWA 2O5DA 2HIYA 2AJFE 5ETVA 1PJ6A 2WAQD 4A8WA 4DSLA 2DB1A 2E7WA 3CCVS 5H9EK 1S99A 4OZJA 2DGWA 2YVSA 1RYRA 6FDRA 2D69A 3I32A 2LU1A 1FJCA 4J9NA 2HWHA 1H2UX 1XN9A 3AJDA 2GQ2A 3GYXB 5FDLA 1WHVA 3PNIA 4F0HA 4WYLA 3HVRA 1UJ5A 2V0NA 2GMHA 2J9EA 3W65A 4DR2F 3BBCA 4P72A 1EP4A 2XY7A 3MM5A 1CS4B 3MDFA 2E1RA 3MOZA 3DYAA 4X4PA 3GMGA 4DPWA 4P71A 3MR7A 2LXIA 3Q8QB 4WCEQ 2HNYB 3A8EA 3M6XA 2HHPA 4OYPA 5D4OA 3ILOA 4CLKA 3CSKA 2IDLA 5LXYA 4HLBA 3GIJA 3M8SA 4J9RA 2JC0A 2LEPA 2QC3A 4WWSA 3T5HA 3I4HX 2BJ3A 4ECWA 3KG4A 2ZH1A 3VV2B 3K7RA 1KKHA 4K2JA 3IXQA 2BKPA 2BRLA 3GJTB 1X8DA 1VHIA 4DR2J 3SYZA 4M8LA 5C25B 3BGLA 3QT5A 1UTAA 4B3OA 2IYIA 1BQXA 1HNZF 3EDQB 1TMMA 2B3TB 3IWNC 3ICLA 4CTAA 2ASLA 2MKCA 2M5YA 2VFTA 1LEOA 2HRYA 1HHQA 1CJVA 5F8JA 4QBUA 4ED3A 2DNLA 3PZPA 3PVXA 3PW4A 1Y3KA 2BJ1A 2MMYA 1TTHB 3FKBA 4Z7CA 3ETMA 1CQMA 3KKFA 3GFZA 4EBDA 9RUBA 1FVQA 3MR5A 5EHHA 2CQ0A 3VZIA 3MEKA 1EJ7L 4ES1A 2NUHA 3C3LA 4O44B 3KK1B 1MU2A 5CCMA 1AFIA 4UQGA 4LBIA 4WK3A 2UUWA 1K9MT 4J9VA 4BC9A 3I5AA 2ZH5A 1HNZJ 2Y1RI 2P8IA 2Q79A 4MFBA 4JI0J 4F0KA 2EXUA 1W26A 4F26A 1NDCA 4ZPBA 1QY7A 4Q8FA 4KV8B 3JSMA 3BH7B 2CJ9A 1FVSA 4FVCA 4PKDB 2H4YB 4RUHA 3FZBA 4NRUA 1FJEB 2APOA 3DOLB 3CC4S 4LBHA 3FBBA 1PAUB 3KLFA 1VK8A 2GS8A 4O23A 3T1HF 2A1BA 4DL3A 1C0UB 3CCES 5AXKA 4F36A 5HJYA 3CCMS 3EVOA 6FD1A 3AOBA 2DNRA 3CJRA 1MNEA 2V6AA 4KGKA 4O4GA 3IBCB 4KE5A 2V8PA 3O3LA 1U2RA 4PXCA 3PJ9A 1NB2A 2XWXA 3A8IA 2DCLA 1EAYC 3TX0A 2BX6A 4FKXA 1S1WA 3F56A 3CD0A 4UTGA 3N5BA 4RUBA 3EMTA 7FDRA 3IM9A 4ZN1A 1FKOA 3CJ0A 2XS5A 4CWBA 4ZHRB 2RHQB 3M1VA 1Q81T 3CIMA 4KFBA 1GT8A 1FXRA 3T1HJ 3D1HA 5F8IA 2BVZA 2H5IB 2V9WA 1RWMB 4K0KF 1UP1A 3IS9A 2HBQB 1DFDA 4DJBA 2K8GA 1RLDA 2DNHA 3PFEA 3M6WA 4PR6A 3N79A 3IAS9 2AGQA 3AHPA 1VLYA 4FN5A 1NJIT 3DLEB 8ATCB 1P8GA 4HT7A 2W7AA 1JLEB 3ZTPA 4NASA 3GCXP 3L7UA 5BYSA 4F25A 4ECRA 1WEYA 5DETA 2QZ8A 3FMWA 2GIFA 1RA6A 1FWKA 4AUKA 3J81U 3M2RB 4J9MA 2R7TA 1FDBA 4KAIA 2HS4A 4B9NA 3MURP 4OI1A 3EGVA 2MJUA 2VDHA 3J80Y 1L3KA 3UD5A 1M0SA 1PYOB 2C3MA 1F3FA 2Q3PA 3NCRA 1EQ0A 1RAGB 1HNIA 4NMXA 3CJSA 5KFTA 1H38A 3H98A 3V6JA 4ID8A 2VZ9A 2ILZA 1FKAF 3D1OA 2Q66A 4CO2A 1D09B 1RT4B 1K0TA 1B7FA 1JLFA 1P9QC 1FFSB 5I42A 3G86A 3K89A 3R7BB 3HHNB 1RT5A 2B5JA 4WU3A 3PCOB 2JEIA 2OKQA 3P8BB 1XQIA 1SQFA 4C0BA 5GVQA 1VRUB 4LMZA 1KONA 1HBNA 1QLNA 4LRAA 2QLWA 4AE5A 3G71S 1HD1A 1UVNA 3C15B 1WSRA 2W2QP 2AMCB 2RS2A 1YITS 1YWXA 4ANCA 1UKUA 2AF6A 4X66F 2QE5A 2W9BA 2Z2ZA 4QOTA 3UN2A 3RR7A 2B4PA 2I9SA 1H74A 4X2BA 1R8HA 2ADCA 2ZJPQ 1M5VC 1GAOA 1ZM9A 2CYYA 4LSNB 4ERDA 2OEJA 4XIUA 2UP1A 3H4DA 4NLDA 1FJ7A 1AFJA 3EDRB 3KK3B 1WHWA 2Y1JA 3BEGB 2CKWA 3UI3A 4G1QB 4JI7F 4DPYA 4R5PA 5HVHA 1R31A 1HPZA 2MYFA 4YFUA 1V3ZA 3RU0A 3K17A 4IRDA 5KFFA 2LDIA 2W24A 4RW4A 2E66A 4B9SA 3MR2A 2WVCA 3CTRA 3TQEA 2AW0A 4NYZA 2HZVA 1MMNA 1BE4A 1ACMB 2HURA 3BM7A 4F04B 3THPA 1IQTA 4Q0BA 2F40A 2XO6A 4FBTA 2XZTB 3W60A 1JJ2R 2BQUA 4JI7J 1TVRA 4I1TA 4NX9A 2J6TA 3N28A 4TN2A 3TZYA 1RTIB 3NS6A 3ZZZA 5CH7B 2NXEA 4FP9A 3DRPA 5CYQA 3UFCX 1U0HA 2RF2A 3I0RB 1FDAA 3C14A 2VHGA 5IM0A 3VAHA 3BPDA 2EFGA 3ADAC 1TMJA 2MKIA 4IUFA 1KFSA 2XB2D 1HL6A 1FFWB 3KUHA 2AWZA 2HHVA 2E5GA 2CADA 4KSEB 2MZSA 2AGPA 1S59A 2WW4A 2IM0A 3UVJB 3H25A 1FCAA 4P52A 1G6BA 3BSAA 3CJKB 3C8YA 4N7TA 4O3RA 4K4SA 4LR7A 2MSSA 4J9LA 4TY8A 2FYXA 1HNVA 2IJFA 2KJWA 4NCGB 3G8TA 1Q1KA 5KFIA 2C2MB 3EE3A 2VDIA 1M1GA 4DCJB 3FJ2A 3C16B 3K5LA 5GMEA 1PC5A 4OHYA 3M8PB 2HEKA 3HHLC 2NXUA 4DFPA 4I6YA 3UQSA 3EPGA 1NJXA 4DEZA 3BQ1A 1SJ3P 1OY8A 4WFNQ 4OJ1A 1BY9A 3CE8A 3LP2B 4ZIWA 5T7LB 3GFYA 4WP3A 1ELOA 3X1LB 2JHEA 2YNIA 5L39A 5ETLA 2WOMA 1A7GE 2WK4A 3K5NA 1MSWD 4EI2A 3NL0A 1ZH5A 3K8VA 4H4MB 4UT4A 1K47A 3AY0A 2W8LA 2PC6A 3NBPB 1RDRA 5GAGI 2YKAA 4CLFA 4Y2KA 2GQQA 2BE2B 5C2CA 1SJRA 4EEYA 1MWZA 1B99A 2PI4A 1SH0A 4F4ZA 1KFDA 1VQ6S 1SKSA 4K4TA 5IT0A 2V69A 5ETPA 4ZLLA 3MAAB 3HI9A 3R5JB 2KZZA 3KLGA 1IR1A 4B9VA 5J2NA 3MM6A 1NB7A 2LU2A 4DF8A 4NLOA 3KNAA 4DPTA 1H3DA 2VBZA 2YWGA 2VPWB 3M7VA 1YJWS 1JJCB 2HGNA 4ZVGA 1FEHA 3D4JA 1Q86T 1YZ7A 3CDBA 1VFJA 3KJQB 1FD8A 4ZS6A 2E1AA 1YI2S 1RKIA 3ZTOA 2BDPA 3N0VA 3HD1A 4Y0FA 4ANDA 1TAQA 3Q23A 2GMLA 3R5GA 4B9MA 2X3GA 1OQ6A 4JUZA 3FUYA 1X5SA 4DQSA 2D7SA 4OLOA 4OI0A 2VFSA 1FF2A 5KT2A 4M5NA 2ZJQQ 3G9CA 2HHTA 5FDLB 4ECVA 1OSDA 1U6ZA 2WW8A 2M8DB 5AE1A 2M3DA 2HSEB 5THWA 5IV3A 4JI2J 1V3RA 3RUBL 1PJ7A 1IQZA 2XTJP 2HQIA 4FYXB 1G7CB 4J9SA 1EP4B 3RJMB 1NPRA 4K4XA 3MM5B 4O4RA 3CWJA 1NDKA 4A8QA 2E5LF 3DYAB 1VYAA 3L95X 3DXSX 3T41A 4USWA 2CQIA 2DO4A 3EGWB 4B3TF 1MG7A 3AB2B 5F8GA 3QO9A 2UVWA 1TKZA 4ZMMA 3IBWA 4JV1A 2L9WA 1R8AA 2NSCA 4ECUA 1FK9A 4NEZA 3P45B 5AXNA 1VIXA 4WK1A 3KDOA 2CPEA 5KT3A 4IDKA 2N7CA 4PXEA 5KT5A 1T8EA 1KRPA 1UFKA 5KFHA 3J7AN 4B3OB 2E5LJ 4BWJA 2ZWOA 5J2PA 4M5KA 5A2QU 1RU2A 2Y1IA 4CTAB 5A76A 4N47A 4B3TJ 2K06A 1CJVB 2ZH7A 1SJFA 2Z2YB 5KFYA 4X4UA 2HFUA 4CO3A 2V2KA 2UXCJ 3BDEA 5KFAA 2AYMA 3ZC4A 4PPDA 4V19X 1XR7A 4P2FA 2YWFA 3CF5Q 4DCOB 5LMUF 3ZZRA 1MU2B 2BJ8A 3MMAA 1B0TA 1NLKL 2HNDA 2WB4A 4H4KA 4GRSA 5F9NA 4LR9A 2Y8YA 3V5RA 4ELTA 2X3DA 4MFBB 3IR7B 2GZOA 4KHPJ 1VQ7S 4GC7A 4F8RA 3SSRA 4CLPA 4B02A 2FUG9 3PW7A 3JSMB 3AQOA 4USMA 1EARA 3HDSA 2BMBA 1NHKL 4C6AA 3GIIA 1VQYA 3KLFB 5FIIA 5LT5A 3PIPQ 3QRPA 4LFCF 1F2GA 5LMUJ 3SIPB 3RRHA 4DOZA 5GMDA 3FVYA 3M9OB 2LEBA 2HQCA 2D3O1 4ED0A 2Y9HA 2RQCA 2JLFA 2ZBQA 2QO3A 4O4GB 2FLNA 1KWMA 2E9ZA 1S1WB 4DSIA 3HSZA 2DISA 1T03A 4NCAA 1FKOB 3V6HA 1W2IA 5JVHQ 4Y00A 1HKAA 1WF2A 3DOMA 1YKWA 3IRXA 4LF4F 2NXNA 3KTQA 2BUNA 3KNGA 3M1VB 4ZJLA 1YJ9S 4KFBB 5E5NA 4UOCA 3TA0A 4LFCJ 2GJ2A 1XWLA 3QT6A 2XY6A 3IS9B 4FYWB 1N4LA 3I5CA 2HGMA 1DJ0A 3PFOA 3TR5A 2AJ0A 4TY9A 3TWZA 4UUXA 1X9WA 5K8NA 1H73A 5I3QA 4ANEA 5AE3A 1R0CB 4QWDA 2M9KA 1TL1A 3OL7A 4ES2A 4DZDA 4DR1F 1PO6A 4DL0C 1RXOB 4ED5A 4J9PA 1MN9A 4OI2A 1VQPS 4C3MA 3PW2A 4A8KA 4LF4J 3R5BA 5D15A 1SXLA 5HQ8A 1FNMA 1IBKF 1RP5A 3AFGA 2HGLA 5HP1A 4QU7A 3QGIA 2YNHA 5D0EA 3AD7C 1PC4A 2LA6A 4EGLA 4QR2A 3T1AA 4X65F 1C0TA 4L76A 1Q8KA 3OSNA 1S4FA 3BYRA 4HH0A 2BA9A 1ZM4A 2XNQA 2PDAA 5IV4A 2AQ4A 3F41A 2HVDA 1TL3A 4DS4A 3TANA 2EK6A 1GX6A 3W2WA 3MPUB 1DTTB 1SL2A 1HNIB 4DR1J 1VQ4S 5AXLA 2AEMA 1T9UA 3G82A 2B0GA 5HQMA 2WVFA 3FCWA 1S76D 1JLFB 4I56A 2Z30B 1IBKJ 1RT5B 3TI0A 1UVLA 1XBWA 4X65J 1U1NA 4DV4F 1RADB 1RBLA 1Q82T 1HBNB 4OX9F 4YB5A 3IR5B 1C4CA 3GR1A 3GU0A 1EX8A 2VJVA 2CWXA 1T11A 2OTJS 1VQSA 1HIYA 2VA3A 3AA8A 2UU9F 4M94A 5KFGA 4C0HA 2DEIA 3R8YA 2X1BA 3DDIA 1FRJA 4M95A 2W9BB 1PJ5A 1PBAA 4CO1A 4HL9A 4P2MA 1U02A 4OQJA 2ABYA 3FCHA 1D3WA 4LRCA 1U1KA 2HHHJ 2KYZA 3QNWB 1NCLA 1N33J 3GIMA 3K57A 2HVZA 5B0AA 3NMAA 1FX4A 1QAJA 3N6NA 4NYOA 5EN1A 4DV4J 4OYMA 2CPZA 1YK9A 4HHHA 2HLUA 4OX9J 5HVGA 5B0FA 4U8YA 4EBCA 4DX5A 1NK8A 1VCTA 3P49B 1AB8A 2K7JA 4R5PB 2QMXA 2KRBA 2MHNA 5KG1A 3BKFA 4NLGA 2UU9J 1RBAA 1HPZB 4DHVA 3FSYA 2KVIA 3Q8VA 3B82A 4WPAA 2MTLA 1S7IA 3LALA 2DNGA 2QSWA 3NAIA 4AYBD 4DR4F 1S1XA 4PG6A 4RW4B 1VQMS 4PUOA 1QTMA 4K4YA 1LFWA 4AL5A 1NXIA 4QPTA 4MIBA 1RKJA 3M30A 4RU9A 4C8ZA 3MM9A 4AXIA 2ZDOA 3UN5A 4C2MA 3NRBA 2CUYA 3Q22A 1K1QA 2YBVA 4Q0BB 3OT9A 5JVGQ 3DOKA 5C24A 3M32A 2B6AA 3OJUA 1TVRB 1RK8A 2AYBA 1KLNA 1LXNA 1UEUA 4OYWA 1N34J 2WVEA 2AJ2A 1KC8T 2JEFA 2CQ3A 5HI7A 1NNDA 1YBTA 1ZM3A 1RABB 1TV6A 4YQWA 5CD4A 4DR4J 3HF5A 3DRPB 3KHGA 1S6OA 5CYQB 2X7IA 1U0HB 2RF2B 8RUCA 3WIUA 5H9FJ 1B4SA 2OPPA 3C14B 4LSLA 5IM0B 4WXWA 4KH0B 3V4IB 3ILIA 1QSSA 5KFKA 1CJTA 1HYSB 2HW3A 2G9OA 3R97A 2AYEA 1G4CA 1CPZA 1RYSA 3FBEA 2ASYA 1F9HA 1NJZA 1M5SA 4PEOA 3L4BC 4ZJQA 1WF0A 3T3FA 1KQKA 2B4UA 4DR7F 5B0BA 1AZSA 4F2RA 1S7HA 4ED2A 1F5CA 1H2TZ 3TX8A 2EG1A 2KI2A 4NMLA 4TY8B 1S9EA 1CULA 1RE1B 1GTHA 1HNVB 3S1TA 3QGHA 2DR9A 3LPEA 4KGZB 4L74A 2MPUA 1U09A 2H51B 3NGRA 3O6QA 2ASJA 3PX0A 1U2CA 4EZ9A 5KFNA 3JTOA 4M5LA 1OIAA 1SKRA 4P74A 1V3SA 4DQRA 3HVWA 4F4AA 2RRBA 2YNIB 2WOMB 3CJ2A 3UD3P 3LANA 4HHJA 4OIXA 3IFEA 4DMZA 2M8HA 2GVDA 4DV1J 4MTPA 5CCLA 2H5JB 3D0IE 1KOOA 3NGKA 2HVHA 2XLKA 2Z0GA 5CZXA 4ZCIA 2QFJA 1SQEA 3LWMA 2V4QA 4CLZA 2V4RA 4YP3A 2KU7A 3TJ8A 2R8JA 4ECYA 4USUA 3MPVA 5D0HA 3W8PA 3KLGB 2V94A 4A8MP 5J2NB 3MM6B 2F65A 4NI2A 2XMMA 1Y11A 1GFWB 2HYIB 1S6QA 1D9AA 3AT1B 2UVVA 1IKVA 3HHLA 5B0EA 2EBGA 3AJ2A 2JRSA 2HBZB 3MECA 4W90B 4M5HA 2DR6A 4USKA 4G1IA 1B0VA 4OV6A 1U0SA 1LWXA 1S0NA 2CJQA 4TLRA 1JWWA 3ITHA 1PAEX 4TYAA 1EHWA 1QSLA 2KFZA 4G3IA 2J8AA 4CO4A 1N5TA 2AZ3A 1R6VA 1T9YA 2POKA 1S9GA 4MJKA 4OI3A 5K8PA 5L38A 3K58A 4L73A 2YWWA 4JI4J 2M2BA 2R3VA 1GQEA 2RH3A 2NUUG 1UVJA 2XMWA 1NHUA 4Q8EA 3QIDA 1FEEA 1W7WA 1RHJB 4WXOA 3A8JA 4B3MF 3EZUA 3HHLD 2M52A 3NLCA 3CMES 2QA2A 3Q8PB 3QO9B 4KTQA 4UW2A 1RAAB 1OPIA 4RW8A 1TKZB 3T9ZA 1JJ4A 2DIUA 1LW0A 3TYTA 1Y5LB 4WFZA 2O1PA 2B43A 4A48A 1NO8A 3LTOA 3P3DA 1FK9B 4F4WA 2MQMA 4YDXA 4IDKB 3JYTA 1OJ4A 2PA8D 3F0NA 2KVQE 3EJMA 4CRJA 3CCQS 4NZ7A 4MKVA 3EGZA 4WZMA 3FEXB 4TU9A 1S49A 5J2PB 2ZJRQ 4IFVB 1SV5A 1F3VA 2D9PA 5LJ3Y 2JL9A 2QRRA 2VIHA 2Z2LA 2FIUA 4K4VA 5F9LA 3SSSA 2BRKA 1WHXA 1W25A 2XLIA 3MF5A 2CPFA 2A6MA 1XR5A 2IPOB 4KGXB 3HSDA 4H4OA 2FVSA 4C97A 1F9FA 4QIFA 3TUIC 3GB0A 5DZ6A 1LWEA 2MSTA 1VC5A 4ENOA 3MTKA 1IWAA 4DV2F 3HHKA 4IQMA 3MMAB 1PYTA 3B78A 1U1MA 1LNQA 3HO1A 4LRFA 1E6VA 2RT3A 2C2ZB 1PILA 3DGPB 3LW5C 3HLUA 1PIEA 1SJ1A 1JNRB 2SXLA 2GX8A 1FDNA 1NPKA 1I94F 2F7VA 3ILJA 2U2FA 2DXFA 1UWBA 2OPQA 4M5DA 3K0JA 2BACA 1NSPA 2XGQA 1IKYA 4DPOA 2HQGA 2UZAA 4C9DA 5HQLA 1U25A 2OELA 5JMNA 4RUCA 4DV2J 2C3PA 3G87A 4CH0S 4NZ0A 2D41A 4RNOA 2MLYA 3BQ2A 2N3OA 2YWHA 4N56A 4TYBA 3TNVA 2JOQA 4CT9A 4JV5F 1Q95G 3PG9A 5I3UA 2BQ3A 1KTQA 1AUDA 3NS5A 2FDNA 1I94J 4JB8B 2CJYB 3GG1A 1T03B 3I9ZA 3IRWP 3LA0A 1RAOA 4DPUA 3MEEA 4IR9A 3DOMB 3IRXB 2KFYA 2BXJA 3U1LA 4ETZA 3H5SA 3PYGA 4PQUA 2QFIA 2RDDA 2G13A 2ZOMA 5CYMB 4DG1B 1SKWA 2FHMA 1SIZA 4S0MA 4MIWA 4OZ5A 3E8OA 4DL2A 1K1SA 3MCOA 4JI1J 4JV5J 1RJJA 3CCRS 3CB4A 3KLHA 2DT9A 1N5SA 4Y2MA 5CAAA 1TL1B 3DM2A 1RT1A 2CNOB 2ZC4A 2CNNB 2R4FA 5FLXU 3PO4A 3MAQA 4K4UA 1XIQA 2ROPA 3CD5A 1O6XA 5HP1B 4DU8A 2WB1D 2YNHB 3FFIB 1BLUA 1TQLA 5EX3A 2JFDA 1C0TB 2F8HA 2VBWA 4TU8A 4E0DA 1NEEA 2ATLA 2A18A 3OW2R 5KG0A 2YKQA 1B0PA 1TL3B 2HRUA 3CDUA 3W2WB 3Q8SB 4RX6A 1XNQF 4HT5A 2R8IA 3G82B 4QCLA 2CJKA 5EGYA 3VTIA 3U7JA 5A6WA 2KH9A 3OUYA 3H42A 4NA3A 4F2SA 1UZDA 2XMUA 4V19J 4IOCQ 1CJKA 2OFHX 2D3ZA 3V6DA 2HBRB 2BKNA 2RU3A 2HKEA 3MPDA 1RWOB 1O5JA 1QDUB 1IM4A 2GGPA 3HXMA 2J6SA 3BDPA 1XNQJ 3MZIA 5G4DA 4HTIA 2ZM6F 3U02A 2K3KA 5CABA 1RCOB 3M9MB 2HPUA 4Z37A 5EUHA 3QLHA 3GFXA 4X64F 1FRMA 4DLEA 1B7YB 4C48A 2YQ3A 2V5HG 3VAKA 4HACA 1NDLA 1RTDA 1ZTTA 3IP0A 4ZVRB 4MMOA 2OPSA 4OX8A 2ZH4A 3MMCA 2EW9A 5A8WA 2FLPA 3OFHA 5DO2A 2DHSA 1H98A 2NYHA 3RW6A 4IH6A 4NLQA 1EIYB 2ZNZA 3MEDA 5D78A 2D1CA 1NK9A 5DQIA 1UETA 2KYXA 2G0IA 3VGVA 1WF1A 4H54A 3I0SA 2MZRA 4X64J 2IA0A 2PI5A 1S1XB 3QGPA 3SCKE 2VODA 4PUOB 2XCPA 3M8WA 3F73A 1RWPB 1Q8BA 2NXJA 3M30B 2V67A 3MM9B 4J7CA 1U7LA 1UAWA 2LQBA 3J7YU 1VBYA 2VG5A 2EWHA 1RAHB 5C2GA 3Q8RB 1KSPA 4TLQA 3WBZA 2CJXB 3DOKB 5C24B 3QRQA 3M32B 2B6AB 2EK1A 2GA7A 5CYJA 2GQCA 2ZFHA 4URGA 2HMIA 2DH8A 5A2QY 1UVIA 3UE2A 4HR2A 3KJVA 1NHVA 5C42A 4U7UK 5H1SV 2EVZA 1TV6B 1QAIA 3R5CA 4GKJF 3KXDA 2RUGA 4HDGA 2OPPB 2BOAA 3BGOP 1RGVA 5LMNF 5L8RC 1SJQA 2WONA 4UUWA 1CJTB 2RNEA 4P2XA 1F9EB 2DPIA 1S1VA 1U6FA 4N77A 1OPZA 4DV6F 4IQXA 5GMKa 2X1GA 3ZNUA 3K2YA 1RHMB 3HULA 3MM8A 1BWVA 4FXVA 2EC2A 2XGPA 3QGGA 2XMAA 1SPBP 2V2VA 3GIRA 2WBRA 4LQ3A 2J7UA 1AZSB 4ZP8A 3PXGa 1C1BA 1HARA 2P6TA 3MGJA 1OO0B 4O3SA 5KFSA 2IBOA 1S9EB 1CULB 1P6TA 3RZAA 2IMOA 4GKJJ 1FTCA 4LQ9A 2MLXA 3PRDA 4F67A 3DC2A 4J37A 5LMNJ 4QPXA 2GHWA 4NXNF 3QFWA 1JXEA 3PJWA 3HSGA 4G65A 4DXLA 3CD6S 5DG8A 4DV6J 3GV5B 2OH2A 3S8SA 3W5ZA 2DHGA 4DV0J 4DUYF 3WIVA 1MMLA 4P2SA 3KJNB 2HHWA 2PA3A 2I5JA 2QG9B 1TAUA 1WDTA 1JQGA 1ITPA 1N36F 1ZM2A 5DZ7A 1RBOB 2BEFA 4NXNJ 4CYUA 3GQCA 2YH0A 3OHAA 3OTBA 4DFMA 3SI8A 2IJRA 2K1RA 1KHWA 3ZTRA 4DDFA 3QBCA 2KT2A 4FBUA 1CC8A 5DJBA 1N5QA 5LL6d 4FYDA 3ZZUA 2DJWA 1T0TV 1N0VC 4DUYJ 3NGDA 3N9UC 3OTEA 5J2MA 4MK7A 3CVKA 3NCQA 3S7RA 4CP5A 2CQCA 2W4DA 2V50A 3D9BA 4NI2B 2H65B 2CQ2A 1OY6A 3TP2A 2CQHA 3LGMA 4DFJA 3H20A 1S6QB 1R0AA 1IKVB 3HHLB 2ADBA 1GNKA 3BGRA 3CDEA 2ACYA 1M5OC 1YX2A 1JJHA 3MEGA 2VG6A 3MECB 1SCJB 3NGSA 2Z58B 2FHJA 4B3RF 1X9SA 2YKNA 4RBVA 4CH1A 2HHXA 5HMXA 3CO9A 3QIPA 3CJ8A 3ITHB 1DQ9A 4NWBA 1AXQA 1HWJA 4LR8A 4Y2IA 3KMSA 2DYAA 2CVIA 4JOUA 1S9GB 3WC0A 1FKPA 1JMTA 1APSA 2XSFA 4DU7A 4MKBA 2D3UA 4QU6A 5F8MA 4DSEA 1TL5A 3H90A 4OYOA 4NE9C 1GEHA 3IG1A 4DCPB 5KT4A 2ZBIA 5EWGA 3BO3A 1FE4A 3D5MA 2ZE2A 2FJXA 3T6JA 5G0RA 2ZHAA 3KJFB 3EXCX 4CLLA 4B3RJ 1L3UA 3P4UB 1MW7A 4ZPAA 2IM1A 3RBXA 2HHSA 4QIGA 1S9FA 2GHVC 3K8WA 3TUPA 2I0XA 5JXSA 4RW8B 3SQOP 2FHJD 1SUQA 1GMVA 2FC8A 3QZ7A 5ETOA 4USJC 4LF8F 4WP9A 3SZ2A 3BSNA 2H9ZA 1RLCL 2M7SA 2DGQA 3NOCA 2DITA 4QJVA 4DQIA 2B4OA 4TU7A 2Q6CA 1HNXF 3JYTB 5CHCB 2CQGA 3SSQA 2V63A 5RUBA 1A0OB 1U49A 2ZVSA 2DY1A 4A8SA 1Z2ZA 2QLJB 4LVNP 5KG5A 3FBFA 1SV5B 3DRRA 4YEAA 3NG8A 2IC3A 1U8WA 2QLXA 4J9QA 2G2OA 4CLTA 4C8OA 5E3CA 5GAEU 1NJWA 5IWAJ 3DMJA 1IXKA 2MQLA 2L41A 2YXLA 1IUJA 2Y0SD 2DRAA 3UDLA 2YX7A 1YHQS 4PXBA 1S57A 4H4OB 1CSJA 1RHRB 4M5IA 1W2BR 4WFYA 2LVWA 1LWEB 4HEA9 5KFUA 1OWXA 1HNXJ 2YPYA 4BCAA 2PIIA 4P7VA 1SC1B 2HLTA 3PEJA 3G2XA 4JI6F 6AT1B 1E6VB 2RIJA 3CGIA 1JX4A 4DQQA 1SC6A 2WRMA 2R7XA 1VJQA 3VF0B 2XLJA 1WKLA 2CQPA 2HZAA 3ISNC 2DBBA 1UWBB 2V2QA 1JIHA 2OPQB 4M5DB 2UVRA 1ZPWX 4B17A 4QQBA 2NSBA 1IKYB 4KPCA 2CQBA 2LCWA 1IBMF 1X4AA 3EZ5A 4P7TA 1JLAA 2OO4A 4ILMA 2ERRA 3NKYA 3M8QB 4DL7A 3D7SB 3ZNJ1 2XZWA 1Q0NA 4NLXA 2O01C 1HA1A 4Y34A 2BE9B 2YKOA 1B64A 2CZVC 2ROGA 5I3UB 4ECQA 3DXBA 3UR3C 2IAJB 4D3HA 2MHEA 3FSIA 2A2CA 1HNWF 5F3TA 1X4DA 1X4HA 3LGHA 1Y00A 3GTYX 3MEEB 3TAMA 1Y5IB 2VKZG 2QN6B 4PQUB 3U1NA 2AD9A 2OD6A 4LREA 2NR0A 2HBYB 4ED1A 5M2RA 4DPXA 3DHWC 2R2UA 1ROFA 2AV5A 5B0CA 2LKZA 3LWLA 1UW9A 2DRDA 3EVWA 3W63A 3SDEA 3JS9A 2XBPA 3RYLA 3KLHB 3MHYA 4LSZB 3DFEA 2H1YA 1Y4ZB 3DM2B 1RT1B 1IR2A 1E6YA 2ZH3A 4LUBA 1HWKA 2DGVA 1HNWJ 2VL1A 1SL0A 3M8YA 2J7WA 1PKUA 3HX9A 4G1PA 5IOLA 3BBFA 2YWKA 4ED4A 3QRRA 5D8HB 3BJYA 2MQPA 1UA0A 1KQGB 3BKTA 1GTEA 1A9NB 3LOUA 3LO3A 4F4XA 3IGNA 3DRYA 2F4FA 5KFWA 1GMWD 4YY3F 2HK2A 3OFEA 3GP9A 1FA0A 4YR0A 3OFGA 1ZZFA 1EKRA 1MWYA 3OBIA 4C4WA 2BZ2A 5K9FA 2RD5C 1F1BB 1FE0A 3CCSS 4NLRA 1PG5B 2JVOA 3NWRA 3A12A 1Q8LA 1S0OA 3H2LA 3JTNA 1V5IB 4OJGA 4A8XA 4Y2AA 5HK4A 2VV5A 3OUYB 5EWEA 5A6PA 2J0QD 5IC4B 1N5VA 2DGUA 4KGVB 4ZCMA 3CC7S 1CJKB 4IRKA 3V6DB 2HNYA 4RR5A 4FXDA 1ZAVA 4YY3J 1X4CA 2GO9A 2Y3YA 2Y8WA 4J9UE 3S6EA 3I6PA 3PIOQ 3HZGA 2KRRA 2GGPB 4LRDA 4MAKA 1JLCA 2ROEA 2V8HA 5SUHA 4WKRA 3QLHB 4OZNA 3MD3A 5DLGA 2V2ZA 4BHQA 1TKTA 2CZ4A 3MMBA 4YR2A 2OEMA 3G8QA 3D67A 2C2DA 4HACB 1RT2A 4CO5A 1VGYA 3TRGA 1RTDB 2RS8A 2LQ9A 1WORA 3U27A 3OFFA 2E1CA 1WOSA 3QMQA 4PWWA 3I87A 2OPSB 1RHUB 3MMCB 4IRCA 1ZETA 4I67A 1QD1A 1F2HA 2Z8QA 1SL1A 3R2DJ 1QUVA 4C11A 5A8KA 3POTA 3TEHB 2YNGA 4PYDA 1ZAXA 4B08A 3AD8C 1S1TA 1NAQA 4K0KJ 2HWTA 4Q2LA 1RA7A 3M05A 2V8VA 3BSCA 5L9XA 1VC0A 3I0SB 1DQ8A 1U26A 2RVJA 1KVJA 2V4JA 2DVIA 1NH8A 2VU5A 3CIZA 3SEOA 3FZ2A 4O0NA 4R0JA 4MK8A 5BXIA 4FPRA 2VH7A 1NJYA 2EFPA 5J1NA 2CPIA 3OSPA 2VG5B 1BHNA 1VBKA 1GK8A 2F5GA 1IKXB 4DLGA 5HMZA 3A8KA 4C8LA 2RQMA 5AXMA 1IKWA 3V2UC 3CCWA 3KHHA 3IBFB 3VCDA 2KXFA 2Y1LB 4MYTA 2HMIB 1RISA 4A4JA 1UWAA 2NPIA 2W9CA 3DI6A 5D0GA 1VQ8S 3B4DA 5D3GA 4RO0A 3UDEA 5C42B 4HHUA 2VFUA 1PYSB 3FSXA 4JI5F 4DL4A 4PG8A 1SC4B 3H0PA 3LQVA 3AJ1A 2J5AA 4OYXA 3W2VA 2NZ4A 2MKHA 3WZ0A 4RNFA 3BREA 3G6VA 5DG9A 3E2EA 2N7YA 3ULHA 4UY85 2XQCA 2QSFA 3MM8B 1RT6A 4DSFA 1NK6A 2JFKA 2Q1LA 2X51A 3MFIA 1J5EF 2MEWA 2BR0A 4ZHRA 4BWMA 3CULA 4GO5X 1Y0HA 2R2SA 2GCFA 4F4KA 2GVZA 3ZZOA 3E51A 1C1BB 1UJ6A 2HNZA 4DUZF 3W66A 3O2IA 3R9LA 4LVOP 3FK4A 5GAHI 4JI5J 3ZZYA 4K5RA 4CLUA 3DHXA 2KXNB 4URQU 2FJBB 3LP1A 3W9IA 4X66J 4I6AA 2BE7D 4K59A 1LW2A 4C7QA 3B4MA 4DX8H 4PPZA 2KB2A 3CO0P 3T5KA 4L75A 1RZMA 1NK0A 3DLKA 1J5EJ 1NDPA 3JTPA 1KDNA 2FB0A 5KTQA 1NH7A 1FXDA 1QTNB 4Q45A 2ZZTA 2BJ9A 2KM8C 3AQPA 1AROP 3C46A 3KK2A 4DUZJ 1HD0A 3O1LA 3BN4A 2I5JB 3NNCA 3TW0A 2Q6BA 4GVLA 3IC1A 3PYDA 1T9WA 4ED7A 3TO8A 1WG4A 5KFDA 4USIA 3H4BA 4CYUB 2ZH8A 2PMHA 2UUBF 2A3JA 2KG0A 2Y0BB 2K1RB 2CIMA 2GNKA 2HFOA 3SCLE 5HMYA 4ZVHA 2XYGB 1QSYA 1X31C 5J2MB 2FGCA 2QLFB 1BC6A 1OSCA 1P1LA 4NLVA 4R0EA 3MPYA 4JI3F 1NRKA 2CAJA 1FD2A 3L7OA 1SKUB 1R0AB 2LA4A 1SC3B 3BGRB 1TUVA 3PKYA 3MEGB 2VG6B 4LFAF 1IJEB 2PN6A 2IYGA 2DIVA 2CFXA 4QYZJ 2YKNB 3EYZA 1LOUA 3QIPB 3TZZA 1WKJA 2RB7A 2R8HA 3C66A 2CVEA 1FWPA 4F3QA 3PJXA 4L3KA 2R2RA 3PDNA 4PXDA 4W98A 1R8BA 4ETXA 1G3OA 2W9AA 1FKPB 2WBMA 1Q79A 2QA4S 3WQPA 2QIFA 2E7XA 4R8UB 1I5OB 1JNZB 3DLGA 3VHQA 4JI3J 1P27B 3D6MB 4X62F 2DGOA 3OL8A 4ZP6A 3IG1B 2KG1A 4IR1A 2ZE2B 2FPHX 4LFAJ 3JXOA 5D4NA 2BM1A 2BJEA 5HN0A 3OD2A 3SMZA 4OV1A 1YZ6A 2MJNA 2OD4A 1VBZA 4RW9A 5HO4A 4ZKAA 3VGTA 2YQ1A 4O3NA 1TK5A 5LJ5Y 4OZ1A 3THVA 4RNNA 5KG4A 4USHA 4X62J 1HWLA 1R6YA 1VQOS 3GR0A 4MT1A 2YPZA 1HR0F 1G1XA 5JUMA 3DDNA 1ZZNA 1RWNB 4DZ6A 4JV2A 2MKJA 4YMEA 3VAFA 3DRRB 1D1UA 2ZKUA 3DU6A 2IC3B 4DV5F 3G8SA 1HW8A 4PYAA 2MY8A 3CDWA 3DMJB 3FMBA 4OZLA 3MAHA 4CO0A 2BM0A 3CDAA 4BDPA 2BW2A 2FZGB 4KH1B 2IMWP 3I0RA 3Q8UA 2M4MA 4Q2MA 2GV1A 3PR5B 1XEZA 3LP0A 2ALZA 4I2PA 2HFVA 2DNOA 1YGYA 3EXYA 5J1PA 2CPDA 2KL8A 4FF1A 3MR6A 4F7VA 4ZPCA 3AB4B 1HR0J 1ZBTA 3UR0A 2BOPA 1H0HB 4M5MA 3TVZA 4NLTA 1TL4A 4MKAA 3N4WA 3C2PA 4DV5J 1TR0A 4Y65A 3IN5A 5ETQA 3OPKA 1V6HA 2R2TA 1VRQC 4ZVPB 4LF1A 2A2DA 2O67A 8AT1B 3HT0A 4NYPA 3CMAS 1A6LA 1FO1A 1NZAA 3RBZA 3C16A 2OFGX 4NLPA 1JLAB 3UWTA 3WX4A 2XC9A 3GWCA 2VQEF 4C8NA 1CJUA 2VPXB 1O8BA 4OHXA 2XMTA 3TA2A 2F4VF 3QAUA 1DHMA 2QMUB 2WSFC 1WDDA 2LQJA 3I82A 3AXMA 2BW7A 2ZUAA 3AH6A 4MKYA 2EPIA 2DNPA 2ZOGA 3HMJG 1I51B 3OL6A 3S01A 2EEYA 4V1Ak 3TAMB 4AFFA 1MN7A 3ELHA 2QT7A 2F3JA 4MIAA 5F8HA 2A0FB 3W5XA 2G2YA 4HVZA 4KYZA 4Y3CA 1N52B 3PR4A 2C2OB 1L3SA 2NZCA 4PG5A 2OPRA 1U47A 2EFOA 3PEHA 3PKMA 2F4VJ 3SDEB 3SV4A 5KT7A 1KLMA 1SH2A 2P9GA 4ILRA 5KFPA 2ZH9A 1QAYA 4CIOA 2ZH2A 1JLGA 3A4TA 2MGZA 1B70B 2DNQA 4OJHA 1URNA 2KHCA 1CLFA 3MUTP 1RT3A 1WEZA 2ATCB 3EVMA 3K5MA 2MKYA 2IDEA 1LFPA 2GO8A 2LFVA 3BPSP 1HW9A 3GJSB 1N88A 3VVTA 3K5PA 2D9OA 5DDQC 3R2CJ 3PW0A 2DGTA 2PMZD 1QVGR 3EICA 2MXYA 1L3VA 2LYVA 3FBCA 3CMQA 3CW2C 3HK2A 1P1TA 4P75A 1RAEB 4N8NA 2ZNYA 1NSAA 4QR1A 2AT1B 1UJ4A 1T95A 4E2FB 3J7ZT 4FF2A 2LQ8A 3VGUA 1HWUA 3ISND 4IOAQ 2WHOA 2DH9A 2XS7A 5A8RA 3TQ1A 4DX7A 2GIRA 2GIQA 1N48A 2I6WA 3RAXA 3ZZ0A 2AJ4A 4K4WA 3KLEA 4EK2A 2WVDA 4H4KC 1XERA 2RDIA 5ETKA 3HJVA 1IJFB 1JLBA 3AOCA 2FHKA 4PABA 2P5VA 1Z1ZA 3IMQJ 4FNHA 1RAIB 3PACA 4J90A 1JLCB 1REVA 2XMKA 3DGVA 4ECXA 2FZCB 2I1RA 1UL3A 4NA1A 1TKTB 3OXLA 3MMBB 3TJ9A 1RT2B 5IFMA 3SCJE 1VQLS 2C22A 2MQ8A 4HDHA 2FLOA 2ZBRA 4JI0F 3KOAA 3A1YG 4ED6A 3MD1A 3NGUA 4IOBA 3M6VA 3BR9A 1FRXA 3QQCD 4L72B 5HBMA 4C11B 5A8KB 4Q44A 3POTB 2G4BA 2J0WA 4K5SA 1HLWA 2BKOA 2YNGB 4QW9A 3SCIE 2O3DA 4A46A 4YN3B 3FEZA 4HH1A 1S1TB 4IH7A 5H9EJ 2G1DA 4QZVB 1N56A 4CLWA 1FRHA 1VQ5S 4LF7F 4PG7A 2YY3A 1UPMB 4CT8A 1K8AT 2V4JB 1M1KT 4ZCKA 1DARA 3P5TL 3AODA 2VICA 3RB0A 2HK3A 2PO4A 2ZKTA 1K44A 3CJQA 3M8RA 4RWXA 1BXNA 3MXHP 2RAQA 1CC7A 2OMLA 2RE1A 3HFZB 3ENVA 4EYHB 2M70A 4EO6A 4LT6A 2CPHA 5KOXA 5ITHA 5I42B 2B5JB 3KWMA 3JB9k 1IKWB 3TOQA 2VJUA 1GX5A 1WG5A 2W9CB 3DI6B 4WE1A 4ECZA 4LF7J 4WFBQ 2BJ7A 5D3GB 2FJDB 4N8OA 2F9JA 1FI4A 3BO4A 2RMLA 4MYUA 4UOHA 3UPFA 2L08A 2JNJA 3TJAA 3O44A 5H9FK 2OGUA 1T02A 2RU9A 3W2VB 5C5JA 2P9CA 4NCBA 3HVTA 5KFXA 2WTFA 5J1EA 1S48A 1D9FA 1ZYQA 4L6V3 1F0XA 4A8FA 1AYEA 1RT6B 4EYIB 2A10A 1YJNS 1FJGF 2C1EB 2CDRB 5L1KA 4ECTA 3QZ8A 1NU4A 3HD2A 2AU0A 1RB0A 4LFBF 4BBYA 3AXKA 5KFOA 2UUAF 2HG4A 4KKOA 4WYWA 3Q2TC 2AKWB 2GVZB 2QTWA 3M2UA 3GFHA 2E5HA 2HNZB 2HAFA 4I0WA 1UVKA 2C3OA 3ZZTA 2FVQA 4JI8F 1NMEB 3LP1B 5F8LA 1SBRA 2C2KB 5LXRA 1WI6A 2ZBCA 1LW2B 2UUTA 1TUGB 4X4QA 1YVFA 2OAUA 3FGVA 1R8PA 3R5DA 3DLKB
chains in the Genus database with same CATH topology
2KXHA 1V3RA 3U1MA 3BN7A 3UCUP 5F0UA 2R7WA 2CQ1A 3CEDA 4X4RA 1IQZA 4FS1A 1XMQF 1U6BA 2J6UA 4F3MA 2HQIA 4AQYF 5KG6A 2CQCA 2W4DA 1UVMA 3HVAA 1G7CB 4J9SA 2L9NA 1EP4B 4K4XA 2CQ2A 3AA9A 3MM5B 4O4RA 4DS5A 3CWJA 4QWEA 3RRKA 1Q7LB 3TP2A 4QWCA 1IR0A 2CQHA 2VFRA 1FNOA 2WSCC 3LGMA 3P96A 4KT0C 5IQQA 3THTA 4DFJA 3DYAB 3H20A 5A8WB 3KK2B 1S6QB 1XR6A 3L95X 1R0AA 1IKVB 3DXSX 4DBQA 1N54B 1HBMB 3HHLB 2ADBA 1GNKA 2CQIA 2MZQA 3BGRA 3CDEA 2ACYA 4IG0B 4MH8A 1M5OC 2IRUA 3CUNA 2DO4A 2J9CA 1JJHA 3MEGA 2VG6A 3B8HA 1HQEB 1JB0C 3MECB 4OFZA 3PY8A 3ZFVA 1I6JA 3H2VE 3KHRA 1WG1A 2K2PA 3EGWB 2J76E 3TVKA 4B3TF 3QJLA 2FHJA 2NLWA 3AB2B 4B3RF 5F8GA 3QO9A 3MEDB 4QWBA 2UVWA 2J0SD 1X9SA 1TKZA 2YKNA 4RBVA 4CH1A 2HHXA 4OI6A 4HKQA 4ZMMA 5HMXA 3IBWA 4I2QB 3CO9A 3QIPA 4JV1A 1OS5A 1DTTA 3ITHB 1DQ9A 4NWBA 2ZZNA 4ID5A 4EUVA 5KOWA 3RW7A 1AXQA 2L9WA 1R8AA 2DK2A 3CD7A 5GADU 3QWPA 1HWJA 2NSCA 4O44A 1SB6A 4ZVFA 3KK1A 1Y9OA 4Y2IA 3KMSA 5E2QA 3DDKA 2ZH6A 4ECUA 1FK9A 5LSOA 2EI5A 2E44A 2M0GB 2GW8A 3CC2S 1KHVA 3OLBA 3R5AA 2ZDPA 4ATNA 2CVIA 2FHOB 4JOUA 1S9GB 3WC0A 5AXNA 1K0VA 1VIXA 1FKPA 4WK1A 5MLCV 2CPEA 1YRXA 1JMTA 3VAGA 2XSFA 1APSA 5KT3A 3D2WA 4IDKA 2N7CA 3DRSB 1HI1A 4MKBA 2D3UA 4PXEA 5KT5A 2L3MA 5DM6Q 1T8EA 1YJTA 4DQPA 1KRPA 1S0VA 2KN4A 4QU6A 3PX6A 3BF4A 5F8MA 4DSEA 2HFNA 1TL5A 2IVYA 5KFHA 4B3OB 2NYIA 1Y5NB 1U1OA 4C8YA 4BWJA 2YNFB 2GJIA 1HQUA 4ZPDA 5J2PA 3IG1A 5E41A 5KT4A 3C6UB 2ZBIA 5EWGA 1SH3A 4KV8A 2YH1A 3BO3A 2Y1IA 4B9LA 1FE4A 3D5MA 4NLWA 3RAMA 2LMIA 3UCGA 3R1HA 2ZE2A 3Q24A 4F4YA 4CTAB 2FJXA 3T6JA 2UXDF 3HHEA 1RAJA 5G0RA 2ZHAA 1BQNB 4N47A 4A8OA 1LKZA 1LWCB 1UFLA 2DNKA 2MDAA 3EXCX 4I69A 4KGMA 2ZH7A 2MZJA 1L3UA 1S1UB 1MW7A 4ZPAA 3Q2SC 1SJFA 2IM1A 5KFYA 2HHSA 4X4UA 4QIGA 3DOLA 1TKDA 5I4MA 2HAIA 3AAWB 1S9FA 2GHVC 2MQQA 4CO3A 3K8WA 3KJVB 2V2KA 3F44A 4X4SA 3BDEA 3PRBA 5KFAA 4N5SA 4C0OC 4KB7A 4DN0A 1FESA 2AYMA 2VB6A 3ZC4A 2VC0A 4PPDA 3OVBA 2I0XA 5JXSA 1RI7A 4RW8B 5CA5A 4V19X 1C0UA 2R7SA 1XR7A 1SUQA 2FHJD 2FC8A 2PEHA 3NNAA 2YWFA 3QZ7A 2UV8A 4USJC 4LF8F 4Z2XA 2EG2A 3CF5Q 3SZ2A 5LMUF 3BSNA 3ZZRA 1PSDA 1MU2B 4ZCLA 5T14A 3H5YA 1U48A 2H9ZA 3MMAA 2N3LA 1B0TA 2COLA 2HNDA 2QA4G 1TKXA 2M7SA 1BD6A 2WB4A 3FQLA 2DGQA 3IA0A 3US5A 1GXLA 4D3GA 4H4KA 3RTVA 5F9NA 2Z4PA 2WONB 3H59A 2DITA 4QJVA 2RQ4A 4GO7X 3SXLA 2B4OA 3V5RA 4TU7A 3HP6A 4DQIA 4ELTA 2Q6CA 1HNXF 3JYTB 4NLUA 2RILA 4MFBB 4KC5A 5CHCB 3IR7B 1L3TA 3KHLA 4ZVEA 3DLGB 2CQGA 2C3UA 3SSQA 1S1VB 1X4GA 3BZQA 4WTYA 4HYKA 1U49A 2ZVSA 1H2VZ 4GC7A 1VQ7S 1FXLA 4F8RA 4A8SA 2ZZMA 2ZOFA 1Z2ZA 3SSRA 4B02A 2FUG9 4AL7A 3PW7A 4LVNP 3JSMB 5KG5A 3DLLQ 1HHTP 3AQOA 5B0GA 1SV5B 3HDSA 4ILLA 3DRRA 4YEAA 5GADI 3NG8A 2JVRA 1TZ0A 2IC3A 2PT0A 2QLXA 3RR8A 4J9QA 3MM7B 4C8OA 5E3CA 3TA1A 3GIIA 5GAEU 1NJWA 4X4NA 2MY7A 3DMJA 1IXKA 2G0CA 1VQYA 2MQLA 2L41A 4FXWA 3VAMA 1I1GA 3KLFB 1IUJA 2Y0SD 4RWWA 1YTYA 2DRAA 4CCHA 1QE1A 2YX7A 5FIIA 3UDLA 4ZLPA 3OTDA 2IBKA 5EDWA 5LT5A 1YHQS 3PIPQ 4LFCF 4TNOA 4PXBA 2AYGA 1F2GA 5FJ4A 1SI9A 4H4OB 4ICLB 3OL9A 3RRHA 4DOZA 1CSJA 4BS2A 4RW9B 2DNZA 5KG3A 3CCJS 3I55S 1W2BR 2XY5A 3HKWA 2DR7A 4DWIA 3FVYA 3OVSA 3M9OB 5CXTA 4WFYA 2LEBA 2ZD1B 2LVWA 1Q8IA 2DHAA 1LWEB 3UD4P 4HEA9 5KFUA 2JH3A 2FY1A 4ED0A 1OWXA 1WD6A 3DLEA 3LUYA 3V81A 4NPOA 3OVAA 2RQCA 2JLFA 1NKBA 4BCAA 2LLZA 2QO3A 4O4GB 2PIIA 4P7VA 1X4EA 1JLEA 2HLTA 4IYQA 5K8MA 3JSBA 3PEJA 2FLNA 3H8YA 1VI7A 4JI6F 2E9ZA 1FRLA 3FRYA 1E6VB 2RIJA 1S1WB 4DSIA 3CGIA 3RB3A 1JX4A 4QYRA 4DQQA 4F50A 3KFWX 2DISA 1T03A 2BJDA 3EX7B 4PWDB 1SC6A 5J2QB 3LPYA 2UUCF 4NCAA 1IN0A 2KFNA 2WRMA 1FKOB 3DLJA 1QJHA 3V6HA 1W2IA 2R7XA 5JVHQ 2I8EA 4Y00A 1WF2A 2KHDA 3DOMA 1WTFA 3IRXA 3VF0B 5DG7A 2XLJA 4LF4F 1YRUA 3KTQA 2BUNA 3KNGA 4EBEA 5L9NA 2CQPA 3ISNC 2DBBA 1UWBB 1VJWA 3M1VB 3M2RA 1YJ9S 1JIHA 3M4XA 3CCUS 1MMDA 2OPQB 4M5DB 4KFBB 5E5NA 4UOCA 3TA0A 4QR0A 4F02A 2UVRA 1ZPWX 4B17A 4ZPTR 5F0WA 2RSQA 1EETA 4QQBA 1HBUA 2GJ2A 2NSBA 3J81Y 5HLFA 2ZUGA 1XWLA 5K5MA 1UMJA 2DNYA 1IKYB 4CQ1A 1PGZA 3LAKA 5KFEA 2CQBA 3D1QA 2LCWA 1IBMF 2XY6A 1X4AA 3BGFA 3EZ5A 4P7TA 3IS9B 1FTRA 1JLAA 1N4LA 2OO4A 3I5CA 3IWXA 4ILMA 2HGMA 1DJ0A 1YSJA 2ERRA 5D77A 1D8YA 2W7OA 3NKYA 3PFOA 3TR5A 3M8QB 2AJ0A 4TY9A 4DL7A 1QAXA 3V4IA 3D0HE 1X9WA 4UUXA 3I9V9 1N0UA 4DL6A 4LF6F 3LP0B 5K8NA 5KFZA 5I3QA 3MTJA 5JJBA 2I2YA 5AE3A 1HYSA 2XZWA 4I2PB 4QWDA 2M9KA 2GFFA 4KBIA 4NLXA 1TL1A 2O01C 1HA1A 3OL7A 2DTJA 4ES2A 3KLVA 3BR8A 4Y34A 2HQ3A 2YKOA 2FTRA 5E33A 4DR1F 2BV3A 4GC6A 1RT4A 1VOMA 1IKXA 4WJBA 2CZVC 4DL0C 1PO6A 1B64A 4ITSA 4U6PA 4B3SF 3T9NA 4ED5A 4J9PA 2ROGA 1KOHA 4OI2A 5I3UB 1VQPS 4C3MA 4ECQA 2VQFF 3GV7B 3DXBA 3QPIA 3PW2A 3UR3C 4A8KA 2IAJB 2R7UA 2OSQA 2RDJA 4D3HA 2MHEA 3FSIA 2A2CA 3R5BA 4EFAC 2YKPA 1HNWF 1SXLA 4M63A 5F3TA 4TQRA 2EKYA 5HQ8A 1M5PC 4NXMF 1VRUA 1WTBA 1X4DA 5FLXY 1U2FA 1X4HA 4YDDB 1FNMA 2HS0A 1Y00A 3OXGA 1IBKF 1RP5A 3V4MA 2HGLA 5DS7A 1R89A 5HP1A 4QU7A 3MEEB 3QGIA 2YNHA 1XMBA 1Z4UA 1KQFB 3TAMA 1PC4A 2LA6A 4HI2A 4QR2A 4EGLA 4ZPWR 4EO8A 1MROA 1JLQA 1T7PA 3RB6A 2R8KA 4PWUA 1Y5IB 2VKZG 3T1AA 3PO5A 3H5XA 4X65F 1UFWA 2CRLA 1C0TA 3OSNA 3W3SA 3CPWR 3HM9A 1X4BA 4PQUB 3U1NA 3BQ0A 3OR2B 1S4FA 1FRIA 3IWLA 1AW0A 2AD9A 2B56A 2OD6A 3DCAA 2B7CB 2NR0A 2VBXA 1X0PA 4ED1A 1YJUA 4RZRA 5M2RA 4HH0A 2DHXA 4X84A 2BA9A 2JWNA 1WELA 1ZM4A 3N5FA 2XNQA 4WFXA 2PDAA 3DHWC 2R2UA 1WACA 1ROFA 2AQ4A 2AV5A 4J9KA 3F41A 5B0CA 1VHFA 4YOEA 1TL3A 4DS4A 3TANA 2EK6A 2LKZA 1GX6A 3LWLA 4DSJA 1ULRA 3W2WA 2HZCA 1DTTB 5IXUA 1SL2A 1HNIB 3SDEA 3DLBA 4TKTA 1VQ4S 3E3XA 2XBPA 5AXLA 3RYLA 1XTZA 2GC8A 3KLHB 3MHYA 4DSKA 3DFEA 2V9KA 2B0GA 1O0PA 2C42A 1R27B 1Y4ZB 3DM2B 1RT1B 1VRTA 4KO0B 1FDDA 2J9DA 1E6YA 2ZH3A 4LUBA 3LH2S 1HWKA 1YQHA 1S76D 2DGVA 2MQOA 4LSNA 1JLFB 1QM9A 3ONQA 3TARA 2VL1A 1SL0A 2KTQA 3KLIB 2ASDA 1KR4A 4Q7AA 4DV0F 2J7WA 3HX9A 4FS2A 4I56A 5HMWA 1UVLA 1HMVB 1RT5B 4G1PA 3TI0A 3Q0AA 1XBWA 1U8SA 2RKIA 3KK3A 3GE9A 2YWKA 1LV5A 1TK0A 5D8HB 1U1NA 4DV4F 3BJYA 1U1RA 5LSLA 4G1QA 5HROB 2MQPA 1HBOB 5FD1A 1UA0A 4FF4A 1KQGB 1Q82T 1HBNB 1DURA 4HI1A 4OX9F 4YB5A 3QJJA 1GTEA 1KS2A 1A9NB 3LOUA 3LO3A 4F4XA 3IR5B 3CJ3A 4RW6A 3IGNA 1C4CA 3GR1A 3DRYA 5G0RB 2JJ4D 4EU0A 2PGCA 3UCZP 5KFWA 3J7YI 2VPYB 1S72S 2OTJS 1VQSA 5LSRA 4YY3F 2VA3A 5L1LA 4EWTA 3AA8A 1F60B 2UU9F 4C98A 3T5LA 4M94A 3OFEA 5ADZA 3K5OA 5KFGA 3UW1A 4C0HA 1FA0A 4YR0A 3OFGA 1ZZFA 1T05B 1MWYA 2OPRB 3OBIA 5E0OA 2BZ2A 4C4WA 5K9FA 2RD5C 2X1BA 1FE0A 3CCSS 1FRJA 4KHMA 4NLRA 4M95A 2W9BB 1SUQB 4CO1A 3SQGA 2JVOA 1M5HA 4HL9A 4WKYA 5F8NA 4OQJA 4U7CA 2ABYA 2CDQA 3FCHA 5KFVA 1Q8LA 1D3WA 5CD4H 1U1KA 1KLMB 1S0OA 3H2LA 1YG0A 3JTNA 2KYZA 5B0DA 4OZ0A 3IAM9 4OJGA 4A8XA 2HNDB 4Y2AA 3VAJA 2F1FA 4UQTA 2HVIA 1JLGB 3GIMA 3HHDA 3D28A 5B08A 3K57A 3R1LA 2HVZA 5B0AA 3NMAA 2MGZB 1QAJA 2E5JA 3N6NA 2VV5A 3OUYB 5EWEA 3FQKA 3I4PA 5A6PA 4JI2F 2VONA 5K14B 4NYOA 5KAKA 5EN1A 1RT7B 2NREA 2J0QD 4ELUA 1KTVA 1N5VA 2W25A 1RT3B 2CPZA 1T94A 2HLUA 2DGUA 2PE8A 4OJ3A 2FVCA 2VD3A 3VR1A 5B0FA 4EBCA 4ZCMA 1DTQB 3M6UA 1NK8A 3CC7S 2NPFA 1RTJB 4KPYA 4IRKA 3V6DB 5M2UA 2HNYA 4WU2A 2UXBF 1KN6A 2YX1A 3KYLA 3P49B 2L48A 3MMJA 1G2EA 1X9MA 4FNIA 1IBLF 4GKKF 2CPJA 4FXDA 2K7JA 4R5PB 1ZAVA 2KRBA 2QMXA 3N01A 5D4LA 2MHNA 5KG1A 1N8RT 4C3KA 2LECA 1F5BA 1X4CA 4NLGA 1RTIA 2GO9A 3RBDA 1HPZB 4DHVA 2Q43A 3C6TB 1RTHA 3FSYA 5KFRA 2LXFA 1BQMB 4IO1A 4XDCA 3SFUA 2KVIA 3S6EA 3I6PA 1T3NA 2YKMA 2DGSA 3B82A 2BQRA 2C2RA 3PIOQ 1GXUA 2QA1A 3HZGA 2KRRA 2GGPB 5T41A 2MQNA 2W4PA 4XO0A 4I7FA 2R9LA 2NS1B 3LALA 4MAKA 5KFLA 1JLCA 2ROEA 2V8HA 3BS9A 5A0YA 3H2UB 2DNGA 3VWSA 1T3OA 2QSWA 3NAIA 4AYBD 2HIQA 2GHPA 2FC9A 2MZ1A 5BYRA 4DR4F 1S1XA 3JSYA 4PG6A 4ZDNA 3MUMP 4RW4B 1VQMS 5SUHA 4PUOA 2VOOA 3OJSA 5KT6A 1RQ0A 1N6QA 1C1CB 2JSXA 3QLHB 4K4YA 3M2VA 1LFWA 4OZNA 5L1JA 1QTMA 4ZK7M 4AL5A 3MD3A 4QPTA 4BC7A 1Q16B 4MIBA 3CJ5A 2CQDA 4J5OA 5DLGA 1RKJA 3M30A 4RU9A 4JV0A 4DR3F 4C8ZA 3MM9A 4BHQA 1TKTA 4AXIA 2LEAA 2CZ4A 2ZDOA 3MMBA 3R27A 4U9RA 2V8GA 4YR2A 3G8QA 4C2MA 2C2DA 1RT2A 3NRBA 4CO5A 1VGYA 3TRGA 2N4CA 2EFVA 3Q22A 1K1QA 1RTDB 2RS8A 2LQ9A 3U27A 4Q0BB 1Y3JA 2CPYA 5EX0A 4RLEA 4AL6A 1S6PA 3OFFA 2E1CA 1SIWB 5A8RB 4R25A 3QMQA 2CJBA 3I87A 2OPSB 3DOKA 5JVGQ 3BB5A 3MMCB 5C24A 3M32A 4IRCA 1ZETA 4I67A 4HTJA 2B6AA 4DV3F 3OJUA 1TVRB 3FNNA 1DLOB 1RK8A 2Z8QA 2E5IA 4J9OA 4DR5F 2AYBA 1LXNA 1LWFA 1SL1A 1KLNA 5DGBA 1U24A 1UEUA 2XSJA 5SZTA 1QUVA 4C11A 4QIEA 3QJPA 2DD8S 5A8KA 3CJKA 3KLEB 4Q5VA 3POTA 2JC1A 1Q7YT 3DN9A 1YRTA 5K8OA 1OQ3A 1XC9A 1KC8T 2JEFA 2YNGA 1SJ4P 2DGXA 2CQ3A 1ZAXA 4IG3B 4B08A 3GG0A 3HJFA 3DNCA 5HI7A 1WI8A <