2EWHA

Carboxysome protein csos1a from halothiobacillus neapolitanus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
92
structure length
92
Chain Sequence
GIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of CsoS1A and the Protein Shell of the Halothiobacillus neapolitanus Carboxysome.
pubmed doi rcsb
source organism Halothiobacillus neapolitanus
molecule tags Carboxysome
molecule keywords Major carboxysome shell protein 1A
total genus 26
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2005-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ewhA01
4OX6A 4RBUA 4QIFA 4P7TA 3I96A 2A1BA 3CIMA 3MPWA 3NGKA 4P2SA 3NWGA 2A18A 4P7VA 3BN4A 5DJBA 4AXJA 2A10A 3VCDA 4OLPA 2G13A 4QIEA 2EWHA 4PPDA 4RBTA 3H8YA 3SSRA 3PACA 4DDFA 4OLOA 4AXIA 4QIVA 3I6PA 4OX7A 3DNCA 3IA0A 3SSQA 5L38A 4LIWA 3DN9A 3CGIA 3MPYA 3N79A 4RBVA 4QIGA 3SSSA 4OX8A
chains in the Genus database with same CATH superfamily
2DIVA 2UUAJ 2YNIB 4ZVGA 4BHQA 1FEEA 1X60A 2QTWA 3ILLA 4RUAA 1HPZB 5HAOA 1ZM9A 2K1RB 1RP5A 3T9NA 5GADI 4DF4A 4DR5J 4C97A 2YKAA 1HD1A 1R8HA 4DV0J 1UW4A 3RBEA 3NL0A 2LVWA 4ITSA 3CD5A 4NA2A 2FJAB 3SQGA 1WKLA 1VBKA 5LM7E 5C5JA 1UJ4A 1IBLJ 2JHEA 4I0WA 4FBUA 5LOQA 2XCPA 2B3TB 1BWEA 4NEZA 2B43A 5J2PA 2C3UA 4B3SF 3N01A 2ZC3A 3O8WA 5KFXA 5IXUA 3IWNC 3V4IB 2BANB 5KFLA 1HBNB 1JLAB 3LTOA 1VISA 2LQJA 4F3QA 1WC3A 5ETRA 3TVYA 1CEZA 3HHLC 2WVCA 2XMVA 3OFGA 4DR3F 5HP1A 3QRPA 1U8WA 2E7XA 4OZ1A 1JXLA 2I1RA 3LH2S 2PFFB 1JJHA 4BCAA 2R7SA 3A4TA 2BX6A 2CQIA 4IDKB 3ZZOA 3BM7A 4DN9A 4B3TF 3DLHA 4NRTA 2E5HA 1UEUA 4DV0F 4OI1A 2G2ZA 1Z2LA 4NOHA 5KT3A 3MFHA 4LF5F 4U96A 3IP0A 1NDKA 4K7QA 4JYAJ 5CA5A 1VFJA 3AD9C 4QIVA 5LMUJ 4CRJA 4QIWD 5KG4A 4ZCIA 2XY6A 3BKUA 5D4PA 3G9CA 1X9WA 2XNRA 1CJUB 1J27A 1HQEB 2XHCA 4LT6A 3OFFA 3NGDA 2E1MC 2ZNZA 1WJ9A 5DZ7A 3J7Z5 3TZXA 4DV2J 3WC0A 2PSZA 3TZWA 3GWCA 3THPA 3TAQA 1S7IA 3NKYA 3QRQA 2FLLA 3OL6A 4ZPWR 4KGVB 1J5EJ 2V69A 1YBUA 1YJRA 3H4DA 3NWGA 4ZIVA 1M0SA 1N5SA 1M5KC 2CQDA 2NUHA 2EG1A 4PUOB 2V2KA 3B6BA 1Y3KA 2HQDA 3PG9A 4BWJA 4IH6A 4KHPJ 4YDDB 1P1LA 1RT7A 5D77A 4A48A 1KFSA 1IKYA 3HHLA 1MROA 2J9CA 2FD2A 1WHYA 2D1CA 1N5TA 1SPBP 4WXWA 5IWAJ 4H4KC 1S10A 3R1LA 4OHYA 3R5GA 2O67A 3B54A 4ECSA 3GIMA 1MN9A 3QFHA 3DOLA 3CCES 2AHOB 2B7BB 3IWXA 2GJFA 5CYMA 2R8GA 4HLBA 3IGVA 5KFFA 1MN7A 5CD4A 3UQSA 2R7OA 2BJ1A 3I32A 2F8HA 1A7GE 3DRSB 3WDOA 5HQMA 4L75A 3R2DJ 1H7XA 4PEOA 2PEHA 5E0OA 4AL6A 2QN6B 1RE1B 3IWLA 3U1MA 1G1XA 3JTNA 2VONA 2QJ3A 1TV6A 5A8KB 4E0DA 1AB8A 2H9ZA 2ROEA 4NCBA 4H4MA 3EJMA 2OPPB 1T95A 2RB7A 3IG1B 2F7VA 2IJFA 4ED0A 3OBIA 4PPZA 2BJEA 5EX3A 2GAGC 5FIIA 3RUBL 1JKHA 2AEFA 1QDUB 5D15A 3UWTA 2I2YA 5F8NA 2DK2A 1GH8A 2WBMA 2AGQA 3JYTA 2GMJA 2KTQA 3BSAA 4ZKAA 1IJFB 4KGMA 1SKUB 2MZJA 3VHQA 4B9VA 1RUSA 3JSBA 2VQFJ 2G2OA 2RIJA 2IPOB 2WOMB 4R0JA 5HLFA 2OFGX 1C0TB 1SI9A 2ZOMA 2GQCA 2IVYA 5AE3A 1MU2A 1RB0A 5D0RA 5HN0A 3V6JA 2VASA 2JLFA 2AP6A 2K3KA 3UFCX 2EFVA 3D0GE 4ELUA 4RNOA 3CCMS 1LWFB 2VG6B 4NZ0A 4WIQA 3MPVA 3OHAA 2UU9J 3QNWB 2RS2A 1VQMS 1WF0A 4FXWA 4IO1A 4PZVA 5DRKA 2XC9A 2W7OA 4NZ7A 1M5OC 2F3JA 3FGVA 1HHTP 1U02A 1TUVA 3AOAA 2LMIA 3EWGA 2O3DA 3PRVA 1KP6A 2B9YA 4DOZA 3T1HJ 1HR0J 5M2RA 2BE7D 5BR8J 3ISZA 4N7TA 4TU7A 2QLWA 2Z2LA 2KYZA 5F8IA 5CABA 4DUYJ 2HRYA 3KJNB 1GNKA 1OYEA 2JEGA 2HS3A 4DR6F 1WI6A 2HNDA 7FD1A 1N32J 5KOXA 3BQ2A 1XNQJ 3PW7A 4P2MA 2XS7A 2H48B 1Q7LB 3NRBA 3PJ9A 4WFNQ 2J8AA 3OXFA 5BR8F 3FJ2A 3PW2A 1S7HA 2K2PA 1AUDA 1T7PA 3HP6A 4X62J 3AODA 4WTYA 2OGUA 1DBDA 4CLYA 4DV7J 1IKXB 1WF2A 1FRJA 3EDQB 2HHHF 3CMES 2GO8A 4DV3F 2HHUA 2GQ2A 3M8PA 3AD7C 2FQQB 3BREA 2ZH2A 3ET6B 4IR9A 3M9NB 3Q83A 2B6AA 2QYCA 4IH7A 3IBWA 3Q22A 3OLAA 1RWPB 1VRTB 2E44A 3PJWA 1U6ZA 2HWTA 3SSQA 1KOOA 3GFYA 5JXSA 2MQMA 1S1VA 2V8DA 3BGUA 1TV6B 2B4VA 1HLWA 2YQ3A 3NCQA 1RT6B 4OYIA 3W63A 3OUYB 3M8SA 4LREA 1HI8A 3K59A 1REVA 3RB0A 3D3BJ 4WFZA 1G6BA 4EZ9A 3ILOA 3TUIC 3LW5C 4LQ3A 4OHXA 1K73T 1HNZF 4CM2A 1N4LA 1I1GA 3MECB 1X9SA 2AV5A 4P10A 2F9DA 2BQ3A 3NGTA 3LP0A 4NI2A 3VF0B 1JXVA 4EU0A 3LP2B 3NGSA 3M30A 3CCRS 3NS5A 4KH1B 4HTIA 3GILA 1HI1A 1VCTA 1VIOA 4WP3A 1CS4A 4DV7F 2YPZA 3TAMA 1YHQS 2MB0B 4ILMA 4DV6F 3GCXP 1ZPWX 4GC7A 2DD8S 3IRXA 3R1HA 5BYSA 1F3FA 2QE5A 3KUHA 1YTYA 1UEKA 2W2NP 2XWYA 2EI5A 1X4HA 2P2CB 5MLCV 5CHCB 3PCOB 2VICA 4ECXA 1W26A 4DQQA 1IM4A 4URGA 1SH0A 2QL7B 4HI2A 4OI2A 3TJ9A 1T05B 2BEFA 2L3MA 5ETOA 1UWAA 1TL3A 4H4KA 1B4SA 4KR0B 4LVOP 4FP9A 4Q7AA 1ZTWA 1S6UA 4CI0B 4ECUA 5H1SV 1XNRF 2UU9F 4AXJA 4A8WA 3AT1B 1Q78A 1ZA2B 3A12A 1JXEA 2VKZG 1FRKA 3TUJC 1RLCL 4NLVA 3PX0A 3R7SB 4DMZA 4G1QB 2RNEA 1J5EF 1X4BA 2PEBA 1UZHA 4Y0FA 2KRRA 5C7PA 2CQHA 3DLJA 4I2QB 2X1BA 4OHVA 4XDDA 5IV4A 3SZ2A 3HKWA 1FJEB 1QE1A 1LW0B 4KHMA 3CTRA 4RR5A 1PKUA 4QZVB 3J81U 2OPPA 2HIYA 1OJ4A 2HEKA 3ENAA 3ET6A 3ENVA 1Q86T 4F3OA 3A8EA 1APSA 3C16B 2EKYA 5IC6B 4YY3F 1ZTTA 2J9DA 3WZ0A 1V9OA 4ZPTR 5F3TA 5CYJA 2XSFA 3QATA 1QSLA 2M5YA 4ID5A 2R7QA 3TUZC 2WW4A 4HTJA 2WOMA 5IZHA 5J2PB 2R7WA 2R7UA 2CQ1A 5A8RB 1JNRB 3HSJA 2N82B 2NPIA 2DNRA 2KXHA 2FJXA 2RDJA 4CQ1A 2DIUA 3I82A 4DR3J 1Q8IA 3QPIA 1JMTA 5F8JA 7FDRA 3BDPA 3SXLA 2GIFA 1FD8A 2WSCC 5ETTA 5KG3A 4FKXA 1OWXA 3LP1B 3PYGA 4A8SA 2P9CA 1HKAA 5E41A 3RB3A 3DRYA 2XYGB 1B0VA 1GEHA 4CO4A 1RDRA 3HZEA 1RT5B 2Q1LA 4WIIA 3G82A 2ZUAA 2BJ8A 5E2QA 5L1KA 4LF2A 1M1HA 1S48A 1JLBB 3HVAA 5KFNA 4RZRA 4KHPF 2M4MA 4PQUA 5KG2A 2HKEA 2ADBA 1B0PA 2CZVC 2OD4A 4L73A 2AJFE 3AQOA 3MF5A 4YMEA 2CJXB 1U0HA 2BABA 5HMXA 9ATCB 5JVGQ 3IRWP 3VGVA 4NYZA 2BOAA 3AFGA 1Q8KA 1OQ6A 3M9OB 3JAMU 2IJNA 4CP5A 2EK1A 3PACA 2ZH5A 4K4XA 4DV2F 1FEHA 1B7YB 1ZBTA 2VHGA 4XDCA 4C98A 5KFJA 4ZDNA 1Q16B 4I56A 1IR1A 2DB1A 3W9IA 1R31A 4F4WA 2DNPA 1SC1B 1KRPA 4JI5F 5IT4A 4J9RA 4JI4J 4BLGA 4PUOA 3V6DB 1FVQA 1H2UX 1P8GA 1WG4A 2MJUA 4ID8A 4J9OA 4JYAF 4YOEA 4P7TA 3KK3B 4U7UK 3E01A 2AYEA 4E8UA 2D74B 1IN0A 2DHXA 1KFDA 3SFUA 2Y1IA 2HURA 4LRAA 3SCKE 4PWDA 2V94A 1X4AA 2HFSA 1R89A 3W2VA 2IM2A 5I4MA 3KJVA 5KG6A 4F4KA 2DY1A 1SC6A 5F9LA 2VG7B 3EXYA 1NDCA 4M5DB 5GAHU 3CJKA 1RHJB 3GG0A 4DSLA 4Z7CA 1HBOA 1SC4B 3KK1A 1T03A 1LOUA 1U25A 3RBDA 3MM8A 3CULA 1NJWA 2MDAA 3G2XA 2J76E 3WBZA 5B0CA 1ZAXA 2QL5B 1Q53A 4IG3B 4ERDA 4GRSA 2ROPA 4F25A 5HMYA 1YKWA 2Z56B 3QRRA 1AFIA 3EZOA 4XAKA 1PILA 1N5YA 3IRXB 3BSCA 4QWCA 3M6XA 2P8IA 4L6V3 1H38A 3I31A 2DHHA 1WI8A 2DH9A 5KOWA 5IFMA 3CCJS 2G9OA 1L5UA 4USVA 3LP0B 4NI2B 2XCAA 2J0WA 4YS2A 1IBKJ 2B4OA 2P9EA 3MDFA 2NZCA 4FYVB 1RACB 3JYTB 2RQCA 1J5OA 1QSSA 3MZIA 2A2DA 1X9MA 3F44A 3MWBA 2R7RA 3SSRA 5KFPA 3FRZA 4M5NA 2CNOB 4HACA 4LUBA 1FK9A 1FXDA 4NLDA 2V2QA 4U67Q 5DLFA 3JB9k 3VR1A 3SV3A 4FDFA 1X0PA 1D9FA 4NX9A 2KL8A 5FLXU 1BWVA 2ALYB 3AJDA 4A8MP 1WWHA 3NP5A 4QIGA 2EEYA 5CXTA 2FHKA 2MZ1A 2HVIA 2ASYA 5T41A 4N77A 4ELVA 5T7LA 2E7VA 1X8DA 1X4DA 2HS0A 3H5UA 4I2QA 3POTB 1W2IA 5KFTA 3CIMA 1RTJA 3BGLA 1NK0A 1RWOB 3KG4A 2GMLA 5L9XA 4X64J 2ZBQA 1S1XB 3J80U 2CQ2A 2KVQE 3H25A 3L7PA 3T1YJ 2CJYB 1HNXF 1XNRJ 4DL0C 2B5JB 4J9NA 2HHSA 1EETA 3M8RA 4YR2A 3M7VA 3KXDA 1RT4A 2QLFB 2PT0A 1VBYA 4EUVA 4C8KA 1N36J 2C3MA 4M95A 8RUCA 1ICEB 3B78A 4GKKJ 1MWQA 1PSDA 2JVRA 4U7CA 2B0GA 2YX1A 5F8HA 2L41A 2MKIA 2H65B 4X66J 2CPFA 1FE0A 2XGPA 1TL4A 1HNWJ 3KLEB 3NAIA 4DV6J 3M8PB 4Q43A 3KHGA 4OX6A 2KO1A 4ZVQB 2QA4G 1TAUA 4KO0A 2KM8C 3MD3A 1LWEA 4ZN3A 2PMWA 1ZS6A 2BKNA 1OPZA 3JQJA 1MMNA 3GYGA 3NOGA 5D0EA 5FDLB 1T9XA 3R7NB 4X4VA 1TMMA 3ENQA 1D1UA 3D68A 2F4VF 1O5JA 2KT3A 2DNKA 4ETXA 1J2VA 2O1PA 4OI3A 3H8YA 5FD1A 5I3UA 4B3SJ 3OTDA 4JV5J 3OUYA 3T9ZA 3D2WA 2Z2YB 2XZWA 4USKA 1Q5VA 3SCIE 4DX5A 1MU2B 4R25A 1Y10A 3N28A 1RT3A 5G0RA 1OS5A 3W8PA 2ZBIA 2WSFC 2ZH8A 3LQVA 4X65J 4F7VA 5MAOA 2E9RX 1RADB 3D6FB 4RBVA 2XGQA 2DEIA 2R8HA 3A8KA 4C8OA 3KTQA 2QZ8A 1VLOA 3GONA 3UR3C 1HBMB 3D1HA 3GU0A 1PJ6A 4CLTA 3M30B 2BQUA 1L3KA 5EUHA 3F56A 3PEHA 3OTOJ 4A8FA 4F2RA 1NHVA 1X5PA 5K5MA 4JV1A 3ZO7A 1VBXA 1O8BA 3FCHA 5J2MB 1M90T 2BE9B 5KFMA 3OVBA 2WAQD 2V9KA 2B7CB 2VFTA 2IDLA 4J37A 1RT2A 3MCNA 2KZMA 1NBEB 2HQ3A 1KKHA 2CRLA 3CJ0A 4X62F 4K50A 3OTBA 2W4CA 4TQRA 2KI2A 3N4WA 1UWBA 2EWHA 3HF5A 1HNVA 2HNDB 3TO8A 1GXUA 1WDTA 3K58A 4ECVA 3OSNA 3UCZP 2UXBJ 2ZOGA 3R5JB 4P73A 5JJBA 4KB7A 1GXLA 1KONA 4OX7A 4ZVUB 4WCEQ 3GYXB 3LUYA 5IOLA 5CCMA 1R0AA 3SFGA 3OL7A 2XO7A 3VGTA 2ZUGA 3NLCA 2NYIA 4B3RF 2IC3A 2W25A 4U8YA 3SIPB 5B08A 3KK1B 2ASLA 2E1PA 3EXCX 4MYUA 3R7BB 3M9MB 1N34J 2XO6A 5GAGI 1Q8LA 2XMMA 1DY3A 2KYXA 5GVQA 2VPYB 3AJ1A 5U47A 3W9JA 2QFJA 2JL9A 3H4BA 3AA9A 3H2LA 1CJKA 4N5SA 3AOCA 4URSA 1P6TA 4NWBA 2CQ3A 1QY7A 4B08A 2VG7A 4PPDA 4M5DA 4ZVOB 1CJTA 1D09B 1FESA 1NPPA 1YDLA 2PD1A 4Q45A 2GAHC 2QMXA 2VDHA 4QOTA 3G6XA 1WNEA 3C6UB 3GG1A 3RZAA 2X3GA 7AT1B 3F73A 4M5KA 4EEYA 4OX9F 2WRMA 2RHSB 1SKWA 1Y0HA 1O51A 1TR0A 4JI8J 1OY6A 2KH9A 1HNIA 4LR9A 3K5MA 2QGFB 3GV5B 2QMUB 2GHPA 3VQSA 1N5YB 4QPTA 2W9CA 5AT1B 2VOOA 2E9TA 1KLMA 2IBOA 2W2OP 2YY3A 5DM6Q 3OJSA 3LALA 2W7PA 3MURP 4K4TA 4TQSA 4JI6F 1V5IB 2M2BA 2P6SA 2CQGA 4J9PA 2NREA 1NK7A 3MPUB 1TL1A 3BGRA 2QX0A 4O44A 1RTDB 3MOZA 2VUGA 1K1QA 1K0VA 2CPJA 3MTKA 4LRBA 1PO6A 1JJ2R 2LQBA 2VC1A 2NQPA 4B3MF 1IQZA 2M0GB 1LK7A 2VA3A 1V3ZA 1IKVA 4FYXB 3PZPA 1SCJB 1X4FA 2QRRA 3KUGA 4W90B 1NZ8A 1UJ6A 1CC7A 3Q8PB 3CJ4A 4ED8A 5EDWA 3TVKA 3KLFA 1Q82T 4O3SA 3DGPA 4ES2A 1U1PA 2X3DA 2COLA 5B0GA 1QVFR 5IM0A 1KQGB 3MEDA 1JLEA 5D6GA 4YP3A 4NASA 2JJ4D 2MTLA 3D4JA 4UOHA 3R5BA 5F0UA 1LW2A 2LLZA 3TX8A 2E1AA 5J1NA 4W98A 4OZ3A 1DQ8A 1SJ1A 2QEXS 1RBAA 2VJVA 1XR7A 2Y1JA 1U8SA 2GW8A 4KBIA 4O0IA 4OLPA 2FJWA 4NLOA 1Q81T 2XQCA 3ZTPA 3KLIB 3UD4P 1S77D 1NK5A 3NEKA 4DDFA 1M5SA 1WOPA 3JSYA 1URNA 3V6DA 4F50A 2DGUA 1RHRB 2XG8A 3Q8RB 1HQUB 2N3LA 1HMVA 4K59A 2BXJA 4O4GA 4ALZA 4ES1A 3JQMA 3OL9A 3FZ2A 2GJIA 3G8TA 1BQMA 2BA9A 2RSQA 3PV8A 5D4LA 5A8RA 2R7VA 2K8GA 3KJVB 2FJDB 2BQRA 1S6PA 2VFSA 3UDCA 4RNFA 4QWBA 4QIFA 1O0PA 1T9UA 1U0SA 5EGYA 3CJQA 4UOGA 4KRWA 1XMQJ 2DPIA 4ILRA 3GJRB 1YRTA 2U2FA 2JX2A 3MPWA 4WFXA 1XTZA 4N76A 1EP4B 3HPOA 4OZ0A 2NXCA 4Y2CA 1EAYC 2B6AB 2FHJD 2BM1A 1UPPA 2L9WA 4I7FB 3PM9A 4Y28C 1XMQF 4K0KJ 1U24A 1ZZNA 4D3HA 1V3RA 3M1VA 1WHVA 4NLPA 3CD0A 3HFZB 1ZM4A 3HMJG 2VOPA 4QQBA 3OHBA 4HH1A 4NLUA 1Y11A 3FK4A 2BUNA 5ETVA 2HQGA 3MAAA 4OX8A 3QQCD 4WYLA 1I51B 3DC2A 3B82A 1HW9A 1R0BG 2VBYA 4RBUA 2Y3YA 9RUBA 4LF8F 4GKJJ 4KFBB 4WJBA 4OL8A 3QO9B 3SCJE 1SXLA 1UKUA 2CPYA 1IBMF 3CNQP 1RI7A 3UN3A 3LP2A 1SIWB 2XM3A 2FGOA 1NK6A 5KFAA 3FCWA 4OZLA 3MM5A 3MAQA 1HNVB 2YKMB 4XIUA 2D3OR 4B3OA 4G1QA 3GFXA 4JV2A 1IBMJ 2V8VA 4IOBA 4IUFA 2HS4A 1LKZA 1X4GA 1Z2ZA 1R0CB 1YWXA 4LFBF 4DPTA 4HHJA 2A3JA 4ZP7A 2RQ4A 3FVYA 4M5IA 3SSSA 1RHQB 4NLWA 3RBXA 2EFPA 3BZQA 3M05A 3UW1A 1NSAA 4RJVA 1RKJA 2Q66A 6FD1A 2HBRB 1K47A 4OZ2A 4WWSA 2XHWA 4DV5F 2DNLA 4LSNB 2XLIA 3N5FA 4RW9A 4QWAA 5DG7A 1B3TA 1OSDA 3PHEA 1EQ0A 4OJ1A 3KOAA 4USIA 5DG8A 5GMDA 4YFUA 2VFVA 2CYYA 2R4FA 5J2QA 1RSCA 4RL1A 3OVSA 3JQKA 3C6TA 3T5KA 3H5SA 4NL5A 4ECWA 5IT9Y 3D1QA 1Q5YA 4IFYB 3VTIA 3PY8A 2OD6A 2BVZA 3P8BB 1QE1B 4DSIA 1XR6A 2OO4A 2YXLA 2ZC4A 4HT7A 5L38A 3MAHA 1X7VA 2D3O1 1KS2A 3K5PA 1NSKL 2J7UA 4QYRA 3ISNC 1TVRB 5ETSA 2M8DB 4L3KA 4YR3A 6FDRA 2W8LA 3DOMA 4HI1A 3J80Y 5HK4A 4JI8F 2G1HA 1K9MT 1S6QB 3HO1A 1OYDA 4DV4F 2CWKA 2BZ2A 5H9EJ 3TI0A 3A3NB 5CAAA 1FX4A 3DRRA 1PJ7A 1T3OA 1VK3A 1XBWA 2H5EA 2LQ8A 3M8YA 3ZFVA 3ZZYA 4C0OC 4IOCQ 2ZDOA 2E1CA 2MLYA 4OYXA 3JSMA 2BMBA 2M7SA 1H6KX 2NCKL 3CDAA 1S1TB 3NWRA 4JI1F 2I8EA 4Y34A 1SJQA 2AZ3A 3IC1A 3QIPB 5F8LA 2ASDA 1U48A 4NCAA 2EBEA 3M6UA 2DGTA 2XMUA 4EO6A 1HHSA 3POTA 2DNQA 2XY7A 2QL9B 1RHKB 2H5JB 3RRGA 2Q79A 2H3EB 1IXKA 2FDNA 3GJQB 2RT3A 3W9HA 3NOCA 4DEZA 4EGLA 2LEBA 2R2TA 3KNAA 4P52A 2AJ2A 3M2UA 4R0EA 4TY9A 1RT2B 4CO1A 1L3SA 5K8NA 1GQEA 2CVEA 4C3KA 3E2EA 4GVBA 4P72A 4DFMA 1VQKS 4RUCA 2PFDA 4F8RA 4EMDA 1OIAA 1UA0A 3L09A 1EKSA 1WOOA 3GMGA 3M2VB 2JH3A 4WFBQ 2UXBF 2WZ1A 4NA1A 2A18A 4DPUA 4F0KA 2J6SA 2LEPA 2YH0A 3GJTB 3MMAA 2C3PA 2ZZTA 1H2VZ 4CTAB 4ETZA 1YG0A 3J7YU 1L3UA 4CT8A 2UUBJ 2ATCB 2G0JA 1RISA 4J7CA 3I56S 3AJ2A 5B0AA 1T94A 2O01C 4ED2A 4AE5A 4AXIA 2MQLA 3DRSA 5C2GA 4LIRA 3MUTP 2BRLA 3IN5A 2EBGA 4DL2A 4DX8H 2UXCJ 3DM2B 4DR4J 3MGJA 3CJRA 1RWNB 3EGNA 4LQ9A 1E6VA 3CJ5A 1QUPA 3DCAA 3H0PA 5DS7A 3V4IA 3KK3A 2KG0A 4F3MA 5B09A 1CJVA 2GO9A 3HVWA 2DCUB 3BH6B 3CT9A 4PG4A 3MI7X 2QC3A 4TVAB 4X84A 3KDOA 5GAEU 3ZTOA 1HHQA 2HSEB 1YQHA 3NNAA 1C1CA 1F5CA 3DOMB 4PXBA 1F5AA 4YB5A 1IWAA 4X4TA 5HLFB 5A8WA 1UVLA 5H9FJ 1U1LA 1M1KT 5HQ8A 2DHSA 3HHDA 3IR5B 2DYAA 3W1YC 5KTQA 2OKQA 3AAWB 2UV8G 4PQAA 2AJ0A 3EM1A 4MYTA 3GQCA 1LWCA 2IAJB 3Q23A 2H5IB 3KLGA 1RT3B 5ETPA 5G0RB 1S0NA 4B9UA 1RGVA 2MLXA 4CH1A 1XMBA 3FBBA 5K9FA 1HWLA 2IM0A 3AD8C 1TFWA 2UXCF 4JP8A 1F5BA 2JEFA 2FZKB 1K44A 1VC6A 1HWJA 5JMNA 1MW7A 4O3NA 4CLSA 1T05A 1X5TA 2AEMA 2CJ9A 1C0UA 2ZH6A 4B9LA 2D9PA 3F41A 1S9FA 2B9XA 2YWGA 1M5VC 1Y3JA 2XULA 2UUTA 3D67A 1J5OB 3SEOA 2V5HG 1B7FA 2DXFA 2VIHA 2CG4A 4Y2AA 1LNQA 2KB2A 2XNQA 2I6WA 1IQTA 1XWLA 4RO0A 3DHWC 1ZM3A 2ADCA 1HBUA 3D6HB 3IAM9 2FVPA 1H98A 3KK2A 4W92B 4DG1B 4LF4J 4A46A 2C3YA 4G1PA 4RWXA 4UQTA 2A6MA 2DNZA 4C6AA 3W5YA 5EHHA 3H40A 4DXLA 2AQ4A 2OHDA 2N7CA 2J7WA 1VDHA 2EKNA 3D7SB 2VZ9A 5IV3A 1KTVA 3QYYA 2X51A 2PDAA 3I9ZA 1W7WA 1TFYA 2LA4A 4J9VA 1QJHA 1HPZA 2ZHBA 4C8NA 4G3IA 2VODA 1SB6A 2IFXA 3MEEA 2I5JA 2XZDB 4KO0B 1PGZA 4KAIA 4N8OA 1FRXA 1ZZFA 4PYAA 3MR5A 2DHAA 4DS4A 2QLXA 1QSYA 2ZVIA 1NO8A 2LXFA 3DDKA 5HANA 5KFSA 5EWFA 4IRKA 1WD6A 5AXNA 2NSCA 3QT7A 4OV6A 4QW9A 1A6LA 2BW7A 1DTQB 2CJBA 2WHOA 3PW0A 1BUXA 2Y1RI 4PXDA 4F04B 2VBWA 4O3QA 4NE9C 3V81A 3SMZA 1MLAA 3AB4B 3BO3A 4DFJA 4RPFA 3CF5Q 4EI2A 5HBMB 1VQ5S 1S1TA 1HNWF 4RU9A 1YBAA 1NDPA 2C2MB 2HRTA 5I3QA 1SL2A 1CVJA 2XEXA 1DLOA 1RTHB 5D3GB 1KHVA 3BGRB 4WF9Q 1HBMA 2P9GA 4GKKF 1C4AA 1LWEB 1E6YA 1WG1A 2N7YA 1SQFA 1D9DA 3PR4A 3C46A 4IQXA 4CT9A 2ZITA 1C0TA 4JB8B 2R8IA 4PKDB 1N36F 4HL9A 2LU1A 4HT5A 3OTEA 2IVFB 1IKVB 1UPMB 3PYDA 4USWA 1HYSB 1YSJA 4OI4A 4TYBA 1D0EA 4X4RA 3TA1A 3BYPA 4JV0A 4F4AA 4LFCF 2AIRB 4UZCA 1T0TV 2QLJB 2V0NA 2GVDA 2WW8A 2WONB 3PYFA 1UCNA 4A8XA 1JLEB 2YWHA 2IHR1 4FZVA 3RG6A 2HFZA 3JAMY 3VAHA 4FBTA 3LWMA 1YI2S 2V6AA 3DN9A 1CPZA 1VI7A 2RU9A 2V4RA 2MSTA 3CDEA 4AT1B 3I5BA 2W9AA 1H0HB 3S7RA 4C8LA 2CQ0A 4NA3A 2B4UA 5IT0A 4YQWA 2E5GA 3KK2B 1ZAVA 5LJ5Y 3H42A 1KN6A 3V6KA 1LW0A 1LW2B 2VBZA 4P2SA 4ELTA 1IKWA 1JLCA 1TKTA 2V50A 3MMAB 4LRDA 5D78A 4P2FA 3W5XA 2CKWA 1F60B 1FFSB 1Q79A 3CJTA 1NKEA 5I3PA 3R5AA 2OJ3A 3MMCB 2GX8A 2HWIA 2V2VA 1UL3A 2Z8QA 2QA4S 1NK9A 1CJTB 4ZJLA 5HMZA 4LF8J 2ZFHA 5KFBA 1HBOB 4EZ6A 2ZM6F 3US5A 3KKFA 1V3SA 1R0AB 4Q44A 2YNHB 1ZH5A 3BN7A 2GHVC 3FNNA 1RWWB 4V19X 4KYZA 3LGNA 2HGLA 5IQQA 3GFHA 2NXNA 2Y9HA 1HNIB 1LQ9A 2GIRA 2ZBRA 1R8PA 3DLGA 4IG0A 1VQ6S 4DUZF 5HO4A 4O23A 4PYDA 1H73A 3PR5B 3BKFA 3NBPB 2GVZB 2R42A 3HK2A 1AZSA 2ZBCA 2DISA 3QT8A 2KFZA 1MNEA 3ZZRA 4X4OA 3J81Y 1SL0A 2KZZA 4EO8A 2AMCB 4KV8B 1M1GA 3DXSX 4FPIA 5BYRA 4DSEA 4I69A 1DRZA 2B4PA 1C1BA 3C6UA 2JFDA 3H20A 3QGPA 4L76A 5ADZA 1NDLA 4DQSA 2AGOA 2ZWOA 1RU2A 3NS6A 2WK4A 4CO0A 2AX0A 4DPOA 3KHLA 3PHTA 3PX6A 2D41A 4YB7A 3DLKA 4X4SA 2FLNA 2G2YA 1Y00A 3RW7A 2F65A 5EN1A 4U7UD 3OXGA 4EYIB 2MLZA 1SH2A 2G0IA 3I0RA 5L1LA 3VVUA 1JX4A 3RR8A 4WZQA 2B51A 3DLEA 3M8QA 5KFUA 3P6YC 1HQ2A 1UVIA 2MY7A 3AH6A 4DPWA 3M8ZA 1TMJA 3HHLD 3KJFB 1YJVA 3LANA 1G4CA 2XI3A 2ZH7A 2MKYA 4KSEB 2ACMA 2JEIA 1EETB 2VL1A 1S79A 2NLWA 4FVCA 4RW6A 5IQ6A 4DV1F 4K4VA 3LWLA 2MXYA 2BM0A 2RH3A 1B64A 4Q8FA 2UVVA 3MM5B 4YEAA 3J7A1 3Q24A 4JI2J 2HFOA 4GVBB 3CEDA 1KNZA 2IYGA 3DLLQ 2NPFA 3HSDA 1TTHB 3EICA 2HWHA 2CQPA 2OP5A 1S1VB 3MFIA 1NM2A 3QZ8A 1TZ0A 2YVSA 1RAOA 2H51B 2HPUA 2LCWA 1H7WA 2DR8A 4ATNA 3TZZA 4B3MJ 5BYQA 4CNYA 1RK8A 1VOMA 1RWUA 2DGQA 2I5JB 1KHWA 2BOPA 1EX8A 5AJ3J 1IKXA 2CNLB 2CQCA 3RYLA 2GC8A 1QUVA 4X4QA 1HI0P 4GMKA 3CMQA 3JS9A 3MM9A 1VQ4S 1FXLA 1NNDA 1R6VA 2J8SA 2VD3A 3MM7B 2MQQA 2HQCA 3CPWR 1FKOB 1KQSR 3EVOA 5T14A 4R8UA 1LFWA 3CCLS 2JWNA 5B7WA 3SDEA 3J81j 2OPRB 1VIXA 3LPEA 5DDQC 3UE2A 2C1EB 2ZH4A 2B9WA 3HULA 5LSLA 4J9MA 1DAXA 3EDRB 3FC9A 2RF2B 3NGUA 1WEYA 3G86A 4MJKA 3MMBB 2J0XA 5HATA 4E98A 5A2QY 2YBVA 4RW7B 2ERRA 3ENWA 3UDVA 1G3OA 5C42B 3I4PA 4EBCA 2YWKA 4ED7A 2APOA 2JRSA 3MAAB 1F9EB 5DG9A 2G0CA 1RWMB 1VJQA 3TNVA 3THVA 4G65A 1PJ5A 2W01A 4M5JA 1N54B 1A0OB 4ZPDA 4ZCLA 2PGCA 5A6WA 2YX7A 5C24A 1U1NA 1GX5A 1UAWA 3GSDA 3K2YA 2LECA 3DDIA 3A1YG 3TANA 2DGVA 2JNJA 1BXNA 1GMVA 1IR0A 4U8VA 3CCZA 1S1WA 1N34F 4F02A 5C2CA 2FJEB 1VRUB 5I42A 1NHKL 1JWWA 1T9VA 3M8WA 1TK0A 2UVWA 4B3RJ 3CGIA 2FC9A 3IO1A 4TXSA 2IMWP 2B5JA 4OYPA 4ZIWA 1F1BB 5KG0A 1S76D 4O3PA 1P9YA 2RDDA 2MY8A 3KFWX 2ZH9A 1S9EB 1C4CA 2HMIB 4DL4A 4AYBD 3Q2SC 5CH7B 1S4EA 2D9OA 3VGSA 4ILLA 4Y2IA 1SBRA 4KHRA 4KH0B 5KG1A 1OMSA 2VJUA 4DL3A 2RQMA 4HDGA 4PWUA 2HGMA 2AX1A 2RQKA 2DRDA 2H4YB 1X4CA 1SV5B 4FYWB 2MMYA 2Q6BA 3W64A 5KFWA 3PIOQ 4ZVTB 2WVDA 1TL7B 3A8JA 4M5LA 3OVAA 3KG1A 2XSJA 1KQFB 1UFKA 4H4OA 2N4CA 4OHZA 3KYLA 1IVZA 2ZZMA 1RTIA 2AJ1A 5KFCA 2VF3A 2YNGB 1VHFA 2H54B 2CNNB 2Z30B 3MPYA 1FJ7A 5GAGU 4WE1B 3BR8A 3GE9A 5C25B 4ID5B 4ZITA 4X65F 1C1BB 3R5CA 3HD1A 4IG3A 3TEHB 3G4SS 3U02A 2HW3A 4RW4A 5A0YB 3IS9A 3BBBA 3UDEA 4LSZB 3G71S 4IR1A 1F0XA 1RXOB 1WC5A 4KE5A 2LXUA 4KGXB 3WIUA 1HW8A 1YVFA 1FT8A 2IM3A 2RF2A 3QGIA 2BRKA 4GO7X 1LWCB 1RAEB 2IAJA 4ZOSA 5L39A 3I0RB 4M5MA 2DR6A 3PKMA 2UVUA 3EE3A 1WC4A 4OZJA 1H3DA 2CVIA 3HCXA 5SZTA 3EGZA 2KFNA 5D3GA 1UZDA 1ZOTA 3L7UA 5D4OA 3V2UC 3RTVA 1SH3A 1QTMA 2E5LF 2M8HA 3HSZA 5ETLA 4Q2LA 4ZK7M 2FZCB 2PA8D 3J7YI 2F63A 1N32F 4KQZA 4AQYF 1RA7A 5GMEA 5CYQB 2CUYA 3KLGB 1RA6A 4J9LA 3C14A 4DUYF 5E3PA 1RT5A 3KNGA 3ITHB 3MCMA 4MK8A 1KWMA 4WK1A 1RT1A 4C7QA 1EQMA 3QJPA 5DM7Q 3M4XA 3OR1A 4ZJQA 4ECQA 2RUSA 1HR0F 2W1BA 4XTTA 3T1HF 2FLPA 4K4WA 3E01B 4MK9A 4ECZA 2DGOA 3OTCA 5JVHQ 3DMJB 3V4MA 1LFPA 4U95A 4N8NA 5M2UA 1CJUA 1S9GA 4RNHA 2V68A 4BWMA 3T41A 5A2QU 3X3UA 2QA2A 1DTTB 3CCWA 4CLLA 4NLXA 1S12A 1NH7A 1TL3B 2KM8B 1WSRA 2CPZA 4L74A 3PIPQ 1O6XA 1IWGA 4ZCMA 2VQFF 1GMWA 5A8KA 3NG8A 3R9LA 4NLQA 3HXMA 3LA0A 2D69A 3W8GA 4JI7F 5J1PA 4RW8B 3VAKA 2LDIA 2Y0BB 2EK6A 4F36A 3CJ3A 3CUNA 2UUCF 4H4OB 3M32A 3D1OA 1SC3B 5HVGA 5AXMA 4DJBA 4CCHA 4PG7A 2F5GA 5AE1A 4P7VA 2NXEA 5HMWA 1N6QA 1IBKF 4AFFA 1SKRA 3KHRA 3DOLB 4NLRA 2A10A 3KWMA 4LSLB 1LXJA 4HDHA 4AL5A 3O3LA 2CFXA 2R2RA 1VQ9S 4GC6A 3W2WA 3CDBA 3D0HE 4X66F 3N0VA 4KKOB 4R5PB 1TU0B 3KHHA 3T5LA 1Y5LB 4WKRA 1S59A 4G6VB 4ED1A 4C4WA 4UF4A 4TKTA 4FF2A 4N56A 3HKZD 1N8RT 3LGHA 1MMDA 2CXEA 2WVFA 3H59A 3QMQA 3OD2A 5KFGA 1YJNS 2RKIB 2RDIA 3Q8UA 2MGZB 3OW2R 1FKPB 1GTHA 3GIJA 5IWAF 3GYNA 2DR9A 2DGWA 1FF2A 4DU8A 3ZZZA 3CCUS 4K4ZA 2POKA 2OPSA 1IBLF 1HNXJ 3NNHA 3HX9A 4ICLA 3T1YF 3SI8A 4KPYA 3VGUA 1AA1B 3ONQA 4Q0BB 1OY8A 1S9EA 2EW9A 2Q6CA 2DEJA 3D28A 5KFVA 2YKMA 3UCGA 1UVMA 4LBPA 5KFOA 4B3OB 1RT4B 1TQLA 3CDWA 1NAQA 1F2HA 3Q8QB 1NEEA 2WONA 4FVMA 3G8SA 4OYBA 4MKYA 4JI4F 2YQ1A 1JJCB 2BJDA 3ZZUA 2GHWA 2LKZA 3K89A 4DZDA 1U4BA 2QA1A 4JI5J 2HBZB 2Y8WA 4ZLNA 1WG5A 3O44A 5LXYA 1JLGB 1VC5A 3ZZ0A 2B8PA 3BF4A 5T7LB 4DWIA 4RW6B 5DDPC 4HEA9 4K2XA 2JC0A 1RTJB 4OMFG 2DR5A 4I6WA 2HHWA 3MEEB 1U1RA 1BLUA 1TK8A 3MR7A 3NY0A 5GAHI 2LU2A 4TLRA 2ZD1A 3BS9A 4USHA 3CJ2A 3HFVA 4D3GA 4KJIA 4W4MA 2C2ZB 2FHJA 4HYKA 4PG5A 1CULB 1KSPA 4PXEA 2HHTA 5I3UB 4I2PA 2DNOA 2C22A 5CZVA 4DG1A 1U47A 4DR1F 4LF9J 2IY5B 2XSJB 1BMQB 1VR6A 3JXOA 4MH8A 2KHCA 4DX7A 2XLJA 3I6PA 2AF6A 4PWDB 5FJ4A 2OELA 1AZSB 5E3AA 1AT1B 3MUMP 3EVWA 1NKCA 1K0TA 3NGRA 3IBCB 3PJXA 2HNYA 3MM9B 5CZXA 2V9WA 2MHNA 3HZGA 2OSQA 1FKOA 1TKZA 4X4PA 3DLGB 4KPCA 2XYHB 4C0BA 1BC6A 3I96A 1T9YA 3W61A 4Y2KA 4BS2A 1YJUA 2GCFA 3PDNA 1U1KA 5BJRA 3DLKB 1SIZA 3KMSA 2V8PA 2HQFA 1FO1A 2OTJS 4I6YA 5H9FK 1EARA 3NMRA 4JI0F 2RKIA 3KUEA 4L3NA 2FVQA 1RBOB 5HVFA 1R8BA 2K7KA 2ZOFA 3CIZA 3QT5A 1UP1A 1ZA1B 5A76A 3HVRA 2IA6A 2XS5A 1WELA 2JC1A 2LQ9A 2W24A 3GP9A 3LPYA 3ZNJ1 4F26A 4UOCA 2G1DA 4LVNP 1TAQA 2GNKA 2MQNA 2OPSB 5KG7A 4DF8A 2UUAF 4ZA1A 4X4UA 4NXNF 2OLWA 1X5SA 2UP1A 2CAJA 2EFNA 2OPQB 2XMKA 2R2UA 2OEJA 3R5DA 2HK2A 1E6YB 2PI4A 2CPIA 3DXBA 1FD2A 1LK5A 3DRPA 3FSYA 4Y6IA 2EVZA 2ZKUA 3OR1B 2AZ1A 1KEKA 2HLTA 4XO0A 3CCQS 2YNIA 2VV5A 3ILIA 2DR7A 3N9UC 4OYOA 5KFEA 3MPDA 1GX6A 5L8RC 1VLYA 5K8PA 3CXCR 4LF7F 3M2RB 4MKAA 4ZPVR 1S9GB 1JLQA 4RW8A 1PBUA 2GVDB 3FSXA 4ZLJA 1U2FA 3EMTA 4GO5X 4ZPCA 1H2TZ 4AD6A 2AU0A 3FBFA 2K3IA 5LJ3Y 1LWXA 2HVHA 4RUHA 1XMOJ 4NXMF 3CCSS 1FERA 1PC5A 2B56A 2F8EX 2BJ9A 2JDJA 2JOQA 3IA0A 4N47A 5ETMA 1REGX 2HFUA 3P96A 2SXLA 5HQLA 5EX0A 1OSCA 4MT1A 5J1EA 4OIXA 4RUBA 3MM7A 1BHNA 1HMVB 2PIIA 3M6WA 4O4GB 4CNZA 4USMA 3I87A 2C2OB 2GZOA 1WACA 2V4JA 3HVTB 4YUDA 4Z2XA 2BDPA 2DJWA 4FNIA 3IAS9 1JLAA 1HBNA 1VQYA 4FKYA 4B17A 2E5LJ 1BQNB 1G7CB 1NJZA 1VRQC 2MKHA 4OI0A 1IKWB 1JLCB 3P5TL 2GVZA 3LAKA 2PMZD 1UETA 1WSVA 1RTIB 3MMCA 2OSRA 5C42A 5F41A 3BQ1A 3OFHA 3OQ2A 5FLXY 2HBQB 4EWTA 1HWUA 1QAXA 2YNHA 2M3DA 3G82B 3PO4A 3W2WB 5BXIA 2Q43A 4RW4B 5A0YA 4AUKA 2MKCA 4XPEA 2BE2B 1MMLA 1U26A 1V5VA 4ZVRB 4QCLA 2YQ0A 3H2VE 4TU9A 4KT0C 3FBCA 2AEJA 1BE4A 4Z7YA 4IRDA 2XI2A 2LEAA 1XN9A 4CH0S 5HVHA 4O3RA 2ZZNA 3BKTA 3KJQB 4YHHF 1URRA 3E8OA 1KLMB 2JSXA 3PTWA 2NYHA 3NCPA 1VQLS 5K20B 1XK8A 3B4MA 3W3SA 1I6JA 2F4FA 1AYEA 4DQIA 3W62A 1QM9A 5LMNF 1NCLA 2HHPA 4ZVFA 1JLGA 3BN4A 4DV3J 4C11B 2Y8YA 4EBEA 3EPGA 2DXDA 2OI2A 3CJSA 4V19J 1S72S 4CLUA 4P71A 3KLFB 4QR2A 3BGFA 2ILYA 4TLQA 4PABA 3DRXA 2BJ3A 8AT1B 3MCOA 1RT1B 4ED3A 3HHNB 5KT2A 1XNQF 2RRNA 4IOAQ 1FHTA 3G8QA 4WYWA 3MXHP 4IH5A 3CJ8A 3D5MA 1FJGF 4AQYJ 1HQEA 1AXQA 1FKAF 3T5HA 1Y5IB 3VZHA 3MEDB 1ZPVA 2MKKA 3J7ZT 4DQRA 1P9QC 3IXQA 3ELHA 1AFJA 5HJYA 4I68A 2NS1B 2MZRA 5LL6d 3D9BA 2K1RA 2ATLA 2C28A 3DGVA 3CO9A 3Q89A 2ZJQQ 1S0MA 1D8ZA 3VALA 5LMNJ 3AOBA 2ZE2A 5K8MA 5DDOC 4B9MA 5DDRC 2AJQA 1RAGB 2NR0A 1FRIA 5F8GA 5KG5A 3O2IA 3SBMA 1S97A 1ZM2A 4YHHJ 1PG5B 4O3OA 3MOJB 2OPRA 3AB2B 3CD7A 1DURA 2LP4A 1HQUA 2F40A 4U9RA 1G2EA 1VQSA 3QJLA 5E3QA 2UUCJ 4DSFA 4LF7J 2AKWB 2YTCA 2O66A 2CQBA 1YZ6A 2RD5C 1BQXA 2OUGA 3M6VA 3C8YA 5KFDA 3C3LA 4ED6A 3H90A 1BGXT 4DBQA 1PBAA 1TKZB 1DQ9A 2I9SA 3WC2A 2DY9A 2E9ZA 2AYBA 3MHYA 4WTOB 3BPSP 3U27A 2UXDF 1IUJA 2PA3A 3HJVA 4LF6F 1S5ZA 3EUNA 2M70A 5JUMA 3PW5A 2V8GA 4F4YA 2AYGA 4R8UB 1VHIA 2C2KB 4UZBA 4LR7A 4QYZK 1WC6A 3DRPB 1AUSL 1NHUA 3MEKA 2MZTA 3SDEB 1HARA 3HT0A 3ITHA 3W60A 1EKRA 2NSBA 4B3TJ 1S99A 2FIUA 4FF3A 3VQTA 5GADU 3CC7S 4ZPAA 2QV6A 1LWFA 2YKOA 1YX2A 3UN2A 1KC8T 3W5ZA 2YWFA 2VG5B 2FYXA 1KR4A 3BBCA 2J0SD 4ZS6A 4J9KA 2CZ4A 1M5HA 4OJHA 5HROB 1PCAA 3HLUA 2LXIA 5L9NA 1CBKA 3BH7B 3GR1A 1YITS 4QU7A 4KGKA 1Q95G 3NS7B 4MFBA 1WTBA 3Q86A 1XQIA 3OLBA 2V34A 3OSPA 3K7RA 3TZYA 5AXLA 1FVSA 3TOQA 2O5DA 2C2NA 1GMWD 3I4HX 2MEWA 2MKJA 1IBCB 4H54A 2FC8A 4ER8A 2G4BA 2PN6A 4NCGA 3QLHB 1X5OA 1FI4A 5RUBA 2LYVA 5G4DA 2BYCA 4DV1J 3TUPA 1NK4A 1JLQB 4UY8T 2J7KA 1ITPA 5IM0B 2KT5A 1DJ0A 2EXUA 2FGCA 2ROGA 2DNMA 4LRCA 3GV8B 3RB4A 3C6TB 4JI1J 2LFVA 3DDNA 2EFGA 2DCLA 3GCWP 4F67A 1NK8A 1CLFA 1YJ7A 4OYZA 3P3DA 2GJ2A 3BJYA 1KDNA 2N3OA 2NXUA 1L3TA 2VC0A 5FDLA 3UNGC 1S1XA 1PYSB 1NMEB 1SUQB 3LF0A 3QAUA 4NXNJ 2R9LA 4C9DA 3R3TA 2IRXA 5ETQA 4UOFA 2GFFA 3PRBA 3SQGB 1H72C 3Q8VA 4IG0B 2GA7A 2XBPA 3CW2C 4NYPA 5CQGA 4EYHB 3QSYB 1YGYA 3LAMA 3PYEA 2OTLS 2QSWA 4OYAA 4JI0J 4LF5J 4OYMA 2QSFA 2OH2A 2DITA 3H2UB 5J2NB 1CJVB 1KQKA 3RRKA 3BO2A 1JJ4A 4WZMA 4KV8A 2HVDA 2E5JA 3QGGA 2JLEA 3QIPA 5D0GA 5EWGA 1NKBA 4DX6A 1D3WA 3IGNA 1RAFB 3HHKA 1HFEL 4QR1A 5F0WA 5KFHA 4DUZJ 1Q7YT 4B9TA 3ICLA 4E2FB 4DV5J 2CWXA 2IBKA 4B02A 3H5YA 3D6TB 1X0FA 1RWKB 4CO2A 2MZQA 2J9DE 4DQPA 3TAMB 1N5VA 4DCPB 1UWBB 1Q4RA 2QMWA 4CLFA 1R8AA 4DR1J 3DLEB 3M8QB 1I94J 4LF9F 1XR5A 4WU3A 4JI2F 3Q0AA 2VFRA 3OJUA 3CE8A 3QJJA 4UUWA 2KFYA 1YK9A 3MECA 3M2VA 1FDNA 3JTPA 2E66A 4J9UE 2L9NA 3NGKA 1NSQA 3TJAA 1WOSA 1QTNB 1SVDA 1UVKA 5DGBA 3HFKA 3EX7B 3TA0A 1VGYA 4DU7A 4B9SA 4MFBB 1FRHA 5SUHA 3EGVA 4MK7A 1KVJA 4NPOA 1VQOS 4NEYA 4J90A 2FY8A 5F3ZA 1NU4A 2FJVA 2J0QD 1WC1A 5K14A 4JUZA 3C19A 2OIHA 4I1TA 4NCGB 4J9QA 4GKJF 2F9JA 2DBBA 1B99A 4RNMA 4C8YA 3FFIA 3T6BA 1JLFA 1NZAA 2F1FA 4O0NA 5LMUF 3M2RA 2C2EA 3G96A 1FRLA 2U1AA 1WUUA 4DN0A 4P75A 3TVZA 3MEGB 4GVLA 4ANDA 5GAEI 1HIYA 2W9BB 4N41A 1IKYB 1FWPA 3HHLB 4USUA 3T6JA 4ENOA 3CJKB 1NSPA 4I4BA 3C16A 5DETA 1H74A 3K8WA 1RU1A 3ULHA 2XS2A 4USTA 1NXIA 2H4WB 3I0SA 3S6EA 3ZC4A 1F9FA 3ILJA 5F9NA 3A3OB 2K06A 1NPRA 5DZ6A 4TY8A 1DTTA 3OPKA 3RR7A 5GMKa 1R6YA 3IM9A 3VVTA 1X31C 1VMBA 2I38A 1OPIA 3CWJA 4LSNA 4ZP9A 2YKNB 3NBPA 2HFVA 6AT1B 1RJJA 1FDAA 2FZGB 4BBYA 3QZ7A 3NXZA 4B9NA 3OR2A 3BB5A 1DARA 2D3ZA 2HNZB 3L7OA 3BQ0A 2VBXA 4PG8A 2IYIA 5J2QB 1BD6A 3G6VA 3N6MA 2J9EA 1CJKB 3UNYA 4CZCA 5CCLA 4QWDA 1P27B 2L08A 3TA2A 5B0FA 4F0MA 1PIEA 1PAEX 4YN3B 4IKAA 2AYMA 3EPIA 3E3XA 3UN5A 1RTHA 2P5VA 4FS2A 3VAMA 2UZAA 2CPEA 4WPAA 3IG1A 2YWEA 3H5XA 3VWSA 5HP1B 4LMZA 1AROP 3QGHA 1S1UB 3RAMA 5DQHA 4ZHRB 1FDBA 1NJIT 1N6QB 2CDRB 4I6AA 2DNYA 2YNFB 4DR5F 4RLEA 4WBFA 2K7JA 4I64A 1CG2A 3I55S 3VCDA 2C2DA 1IR2A 1S6QA 1U0HB 4O4RA 4URQU 4UW2A 4RBTA 4QU6A 1R7IA 1RHMB 1MWZA 3VV2B 1W2BR 2KRBA 2Z2ZA 4M5HA 3MUVP 3TARA 1S0OA 4PQUB 4JI7J 1A9NB 3WIVA 3C15B 3VAGA 1RYSA 4Q5VA 4S0MA 3EYZA 1Y5NB 2KVIA 3FBEA 3QFWA 4JI3F 1U1QA 4MIAA 1VQ7S 4HHUA 3K5NA 2FLOA 2IRYA 4DL7A 2FPHX 3DOKB 4ZLPA 2HYIB 5DO2A 4DR7F 1DFDA 2DNNA 3IM8A 4V1Ak 4LF4F 3QAEA 2VKRA 2YPYA 4FXVA 3RBZA 3QSIA 1CQMA 2CDQA 3T1AA 5L1IA 3UD3P 3A13A 3HD2A 2ZHAA 1QLNA 3OL8A 1UFWA 3AXKA 3W7BA 2DRBA 4NLTA 4DL5A 1Z4UA 2KXNB 2MQPA 1SV5A 3NNCA 2IA0A 3V6HA 2LDYA 4JI6J 2XTJP 2HIQA 1GT8A 5KT4A 3GV7B 4JOUA 1U6FA 3S01A 1FDDA 2D3UA 3CMAS 2IJRA 4DCOB 2FB0A 3O6QA 1VK8A 2IRUA 2WVBA 4ZJOA 1U1OA 2HAFA 2CPDA 2MPUA 1HWIA 2WVEA 3KG0A 3VAJA 2J6TA 2R8KA 4K4UA 4LFBJ 2Q3PA 4Z37A 5E5NA 2FTRA 5J1EB 2YWWA 2RS8A 2DO4A 2VFUA 4PR6A 1Q8BA 1N0UA 2RU3A 4C2MA 4OX9J 1NJYA 1UMJA 2M52A 3TR5A 3TQEA 4ECYA 4CLPA 2HRUA 3HM9A 3ISND 3WX4A 2WSEC 3CDUA 4DL6A 1E6VB 2M9KA 4JBCA 4IFVB 1DHMA 3TX0A 2JEJA 3ZTSA 4M1KA 1EZZB 3FEXB 2MZSA 5H9EK 1MWYA 1JIHA 2XWXA 3FDSA 1D9AA 4NMLA 1RQ0A 1FNOA 5IC4B 4K8RA 3V81B 3X1LB 2DNGA 5HBMA 2C42A 4DUTA 2VQEF 3DNCA 1FX2A 2ZWPA 3Q2TC 5E33A 2HHXA 2YNFA 3L95X 4KIAA 2DGXA 3FZBA 2BE2A 2HZAA 3PXGa 4A4JA 4WFAQ 1DZ5A 4CH7A 4CYUB 2OPQA 2YKPA 2GV1A 5A8WB 2YH1A 4ANCA 3I5CA 1NB2A 1S49A 2IIHA 2OAUA 2XLKA 4CM0A 3GPAA 3P49B 1X4EA 1UTAA 3C15A 3R8YA 3DLBA 4ZVPB 5DLGA 1FA0A 1QVGR 2W4PA 3R97A 3FSIA 2ZJRQ 4G1IA 3ZNUA 3J7AN 4TU8A 2UUBF 2QLBB 4EFAC 2MHEA 1UA1A 2HHQA 2W8KA 3UR0A 2W9BA 2E1RA 2G13A 1FFGB 3DOKA 4P6QA 2KJVA 3OXLA 3SYZA 4FN5A 2HMIA 2LQ5A 2B8QA 1C0UB 4ED4A 1FNMA 5KFRA 1RBLA 4OQJA 4FS1A 3VAFA 4IYQA 1XIQA 5K14B 4PRFA 1XJWB 4RW9B 1MG7A 1XEZA 3JTOA 4MIWA 1ACMB 1FWLA 3P4UB 3BR9A 3JSRA 4LR8A 1RHUB 1UW9A 4WXOA 2ZE2B 2VB6A 4DR7J 2PE8A 1TKTB 1VS3A 4DFPA 1OY9A 2X1GA 2V63A 4ZP8A 3U7JA 3MEGA 5HJXA 3GZ7A 3QT6A 4OYWA 1YJWS 4JI3J 3E51A 4C8MA 2VPZB 3EVMA 3PKYA 1VQPS 5CD4H 4KY3A 3EZUA 2GS8A 4LF1A 2FUG9 3D54A 1FWKA 3I0SB 3BGOP 4WU2A 2NXJA 1SJ4P 5F8MA 3B4DA 4P74A 1TVRA 5LSRA 4QJVA 2ZH1A 4NMXA 3GB0A 2W2MP 1RABB 2FVRA 2UVRA 2CQ4A 2X7IA 4LSLA 4MKBA 8ATCB 2HVEA 2F4VJ 2MJNA 4ZPBA 4DR2F 2E5IA 3BDEA 2J5AA 2YKNA 3THTA 1JQGA 1TKXB 2DHGA 2ZVSA 4ZCKA 5DQGA 3FMWA 2P6TA 1I5OB 2PMHA 5LSOA 3GIKA 2CNKB 3MMBA 3W66A 3ZTRA 2JZ5A 1U49A 3HSGA 2DRAA 3KLEA 2BJ7A 1REVB 2VA2A 2B9EA 4WKYA 2PC6A 2DNHA 3L9ZA 3PNIA 3DI6B 4QYZJ 2BW2A 1RWVB 3HDSA 4OHWA 2V67A 3BV8A 2DVIA 1WEXA 1GXTA 2OEMA 2DH8A 2RRAA 5DJBA 1DLOB 3LOUA 1LXNA 2RILA 3GFZA 3N6LA 5CYQA 3DKDA 3LP1A 5HROA 2AGPA 2HHVA 3ZZTA 2KN4A 5AJ3F 2H1YA 4QW8A 3V5RA 2F8MA 1TL5A 3GLJA 2WBRA 5J2MA 1SL1A 4LFAF 4P9SA 4KC5A 1HYSA 2KU7A 1IM6A 3K5LA 4K4YA 2DH7A 1F6TA 2FHMA 2EG2A 2ACYA 2D7SA 1EJ7L 5AE2A 4Y65A 1XC9A 1VQNS 2HAIA 2V4QA 4ECRA 2MQ8A 1GK8A 1Q1KA 4LJMA 1GMUA 2FVCA 3TP2A 5KT6A 4A8QA 2HQIA 5HI7A 4A8KA 4DSJA 3T19A 3PX4A 2MQOA 1OO0B 2A0FB 2ZD1B 1V6HA 4C48A 3GJSB 4M63A 3HI9A 4USJC 3UVJB 3ZXWA 5ETKA 1NPKA 2DO0A 2CZ9A 2Z57B 4C0HA 4DLEA 1KBRA 2ILZA 1S0VA 1U09A 3RAXA 2ZHOA 3C2PA 2WCXA 4RWWA 3TEGA 1MROB 4DV4J 1TUWA 1GTEA 3M32B 5E7OB 2KG1A 1P1TA 2ZKTA 4HR2A 1KVIA 2DT9A 1R3NA 4UUXA 3IR6B 4TNOA 3FUYA 3W2VB 5KFQA 1SUQA 3HHEA 4K5RA 4OFZA 4K5SA 1HA1A 2C2RA 1FNXH 2EPIA 3R27A 4ZLLA 4LBHA 3OV7A 3K0JA 1T02A 4FF4A 4OJ3A 1TK5A 2BR0A 3AHPA 3G6ES 2IDEA 3I5AA 3IBFB 4J5OA 2EC2A 2Z58B 2ALZA 2W4DA 4IFVA 1WHWA 2W7AA 3B8HA 1F9HA 3PFEA 3FEYB 3PRDA 3OFEA 3RU0A 3CSKA 4K2JA 2MGZA 2HFNA 4YB6A 1TL1B 3C66A 1FKPA 3O1LA 3L3CA 1SKSA 1PAUB 1RAIB 3UD5A 3S1TA 1QAIA 2BKOA 4IQMA 4RX6A 3TWZA 4IRCA 3A3PB 5B0EA 2VG5A 5M2PA 3QWPA 4DZ6A 4ZHRA 4CWBA 4ECTA 4QPXA 4IDKA 3D3CJ 2C3OA 3N5BA 4FF1A 4Q0BA 1N33F 1SQEA 2GMHA 2KT2A 1NRKA 3K8VA 4F0HA 4RU2A 3FEZA 3GR0A 3GTYX 2ZM6J 4FYDA 1NJXA 1I3OB 3C14B 3LGMA 2CJKA 2X1FA 1YBTA 4XK8C 4ES3A 3AQPA 2DXEA 4HACB 1N0VC 1YJTA 4LRFA 2VU5A 4Y3CA 1FRMA 4OI6A 1VRUA 5I42B 4A8OA 2I0XA 3MCSA 5D8HB 3FFIB 4J91A 3MR3A 4M94A 1RAAB 4LFAJ 4F2SA 1S1WB 2V2ZA 3ADAC 4A47A 1PYTA 1TP7A 3KMQA 1ROFA 3A8IA 4OZ5A 2V8HA 2RJZA 4MKVA 2QYGA 3MR2A 2VPXB 2QG9B 1WTFA 4CDIA 4ED5A 3QBCA 3HT3A 1N33J 2R2SA 4KTQA 2XMAA 3SQOP 3G6YA 5KFKA 2X1AA 3H98A 1N56A 1I94F 1B0TA 2Y0SD 3BPDA 3DFEA 4M5GA 2JLGA 3QWUA 2ZBPA 1S57A 4WE1A 2ZH3A 2XB2D 4QWEA 4TYAA 4CO5A 5K8OA 4K0KF 2WB1D 4DS5A 1HBUB 1BQNA 1RKIA 5A6PA 4DSKA 3CD6S 4WFYA 2VPWB 4DPYA 4LFCJ 1HL6A 1VYAA 1TL7A 3QLHA 5KT7A 3TQ1A 3PO5A 1U2RA 1U45A 2HNZA 2J6UA 1R43A 1FXRA 3MMJA 5DQIA 3BEGB 2FJBB 3SCLE 1KOHA 3GIRA 3WQPA 1S6PB 5CYMB 1ZAWA 3KLIA 5C25A 2WTFA 4YR0A 1T11A 4Q8EA 4M8LA 1WF1A 1EIYB 3WX8A 4CIOA 4BC7A 2YNGA 5D4NA 1K1SA 2BV3A 2HGNA 2XYPB 3TRGA 2R7TA 3MM8B 1N5QA 4YY3J 4LIWA 3CC4S 4R5PA 4BDPA 3UDLA 1BQMB 1F3VA 1YZ7A 4YDXA 5AXKA 2W9CB 1B70B 4X4NA 1C2PA 2AW0A 1S4FA 4ZN1A 4H4MB 4NLGA 1FJCA 3DYAB 1QD1A 1DTQA 3DI6A 5HL7Q 4DR2J 1N48A 2CADA 1RTZA 2XMWA 3IR7B 1GFWB 2HBYB 2QO3A 4RW7A 1Q0NA 1S1UA 3KDNA 3QO9A 2CPHA 2IM1A 3CO0P 1YRUA 4TN2A 4C11A 5B0BA 1YIJS 3KLHB 2GQQA 1WKJA 1ULRA 3GIIA 2AD9A 1L3VA 3UI3A 4QIEA 3FMBA 1XERA 2CG8A 2N4DA 4HVZA 2JFKA 2W2PP 3PEJA 4CO3A 2FVSA 2E7WA 2OMLA 3UPFA 2JVOA 5IS2A 4ZVHA 4NRUA 2LA6A 4NYOA 4OZNA 3VAIA 3T5JA 2GGPA 1K8AT 2QFIA 3M1VB 3D6MB 4DLGA 3G87A 1AW0A 3EZ5A 2NUUG 2CJAA 3DGPB 1NLKL 1PC4A 3RW6A 5LT5A 4K4SA 1WC0A 1JLFB 4ZVSB 3K57A 1RT7B 1ZYQA 1EHWA 4OV1A 2V4JB 1HWKA 3MTJA 1U6BA 3BO4A 5DGAA 1UFLA 3BYRA 4KFBA 2UV8A 2OMOA 3NAHA 4L72B 3PVXA 1N88A 2HK3A 3DMJA 2PI5A 1UJ5A 1WHXA 2WB4A 1OQ3A 1EB0A 1HD0A 2A2CA 3FCVA 5THWA 4EBDA 2Y1LB 1NH8A 1WDDA 2Z2MA 4I67A 2IC3B 3CCTA 2AWZA 4HH0A 3FRYA 4WK3A 1TELA 1FE4A 2HLUA 1T9WA 2L9DA 5KFIA 5E3RA 1U1MA 4LF6J 3AXMA 3R6GB 1UVJA 4HKQA 2UXDJ 3MM6B 4UTGA 1DQAA 1T9TA 2CIMA 2KKHA 4IO9Q 1RAHB 3OTOF 1M5PC 1HNZJ 3OR2B 3TYTA 2NZ4A 1RT6A 2CPXA 4PWWA 1SQGA 1TKDA 2KHDA 3U1LA 5ITHA 2CA9A 2ZDPA 3TAPA 2ASJA 1VC0A 3D0IE 4HHHA 5LXRA 1C1CB 1SJRA 1FFWB 4OJGA 4FNHA 3BSNA 1T8EA 2A1BA 4MMOA 1U2CA 4FPRA 3TW0A 3RAQA 4JV5F 3RJMB 4TY8B 4KKOA 1JLBA 3EGWB 4DCJB 1TKXA 1Y7PA 3BSOA 4F4ZA 1VBZA 2XY5A 3R2CJ 3WHIA 3R6LB 4YB1P 3IS9B 3FQLA 3JSMB 1YJ9S 2DGSA 2EFQA 3ETOA 2DKOB 2BANA 2HVZA 3FKBA 2HHHJ 3DRRB 3UCUP 2OEKA 5HSPA 4CLZA 3RGIA 2ZNYA 5IT9U 1W25A 2RHQB 5KAKA 1Z1ZA 2KXFA 4DR4F 2Z4PA 3IMQJ 3ZTQA 1RYRA 2OFHX 3KLHA 1ELOA 2MKSA 4PAAA 4ICLB 1YLXA 1RWXB 1FJGJ 2BKPA 4DR6J 4C3MA 1CS4B 2HG4A 4AL7A 1RTDA 1JB0C 3VZIA 4Y2MA 3PW4A 2RE1A 2RMLA 3DU6A 1LEOA 1CSJA 2L48A 2AJ4A 3U1NA 2HZVA 3NMAA 2QT7A 2AT1B 2EC0A 2XMJA 4ZVEA 1N52B 3QIDA 4LBIA 3DHXA 3AA8A 3SV4A 2VH7A 1SJFA 2DTJA 1R8CA 3P5BP 3MD1A 1KTQA 1KLNA 1KD1T 3IFEA 3TJ8A 4CLWA 1IJEB 4ANEA 3D66A 1WORA 3FQKA 4RKUC 1U7LA 3I9V9 4Q2MA 3CC2S 3LO3A 5EWEA 1RCOB 1UVNA 3H7HB 1QAYA 1FCAA 2XMTA 2RVJA 5B0DA 3KLVA 1WKKA 1VQ8S 2YX4A 3N6NA 2CJQA 1S6OA 4CTAA 2BBEA 3M2UB 4FXDA 3F0NA 5ETNA 2VQEJ 3UVJA 2DPJA 3DU5A 4X2BA 4NZ6A 2M88A 1KVKA 1VRTA 1MSWD 3BBFA 2R8JA 4UT4A 3MM6A 4I2PB 1D8YA 4MAKA 4ZMMA 5L46A 1F2GA 2PO4A 5J2NA 3RRHA 4C3LA 4WP9A 4ZP6A 2ABYA 1CULA 4Y00A 4XPCA 3AY0A 5KFYA 3CVKA 4DFKA 1NUEA 2RAQA 4IFYA 1NB7A 4DPXA 1Y4ZB 2HNYB 1RLDA 4PG6A 2YKQA 3CB4A 4QR0A 4J9SA 2FY1A 2ZEJA 4NLSA 3HJFA 1T03B 3ZZPA 1JNZB 3Q8YA 5L1JA 1LV5A 1JKHB 1VJWA 3DM2A 3ETMA 4EK2A 1FK9B 3K17A 4UQGA 4NLYA 2BACA 3RB6A 4U6PA 4DHVA 1EP4A 1FTRA 2GIQA 3P45B 4CYUA 4QBUA 4F4XA 4A8YA 2R3VA 2HZCA 1UEVA 2VDIA 3L4BC 4FYYB 3DYAA 1RZMA 2W2QP 3UO0A 1Y9OA 4I7FA 5KT5A 3CCVS 3NCRA 3GSIA 1XMOF 4NXMJ 1T3NA 2IVMA 3MR6A 2RRBA 2KJWA 4P2XA 1QAJA 2VG6A 1RCXB 2MYFA 4C8ZA 1SJ3P 5D0HA 5KFZA 3O5TB 2Z0GA 3W65A 1CQNA 1YRXA 4BC9A 1R27B 1BY9A 4O44B 2XZTB 2EFOA 1WEZA 2E29A 4X64F 1ZETA 1CC8A 2RUGA 2IMOA 4MIBA 1JK9B 4OLOA 4RNNA 4UY85 2MSSA 2UUWA 2GGPB 1GAOA 5E3CA 4CLKA 2ZJPQ 2R7XA 1PYOB 1RAJA 4PXCA 4MTPA 4DI6A 1FTCA 3S8SA 4KGZB 3Q8SB 3N79A 3K5OA 4WP8A 2FHOB 2QIFA 3OT9A 5C24B 2A6OA 3T3FA 4PCQA 1TUGB 3PFOA 3HVTA 2KDOA
chains in the Genus database with same CATH topology
2DIVA 2YNIB 4ZVGA 4BHQA 1FEEA 4RUAA 1HPZB 1ZM9A 2K1RB 1RP5A 3T9NA 5GADI 4DF4A 4C97A 2YKAA 1HD1A 1R8HA 3RBEA 1UW4A 3NL0A 2LVWA 4ITSA 3CD5A 4NA2A 2FJAB 3SQGA 5C5JA 1UJ4A 2JHEA 4I0WA 4FBUA 2XCPA 2B3TB 1BWEA 5J2PA 2B43A 2C3UA 3N01A 2ZC3A 3O8WA 5KFXA 5IXUA 3IWNC 3V4IB 2BANB 5KFLA 1HBNB 1JLAB 2LQJA 4F3QA 3TVYA 1CEZA 3HHLC 3OFGA 2XMVA 4DR3F 5HP1A 2E7XA 4OZ1A 1JXLA 2I1RA 3LH2S 2PFFB 1JJHA 4BCAA 2R7SA 2CQIA 4IDKB 3ZZOA 3BM7A 4DN9A 3DLHA 4NRTA 2E5HA 1UEUA 4DV0F 4OI1A 4NOHA 1Z2LA 5KT3A 3MFHA 4LF5F 5CA5A 1VFJA 4QIVA 4QIWD 5KG4A 4ZCIA 2XY6A 5D4PA 3G9CA 1X9WA 2XNRA 1HQEB 4LT6A 3OFFA 3NGDA 2E1MC 2ZNZA 3J7Z5 3WC0A 2PSZA 3TAQA 3GWCA 3THPA 3NKYA 3OL6A 4ZPWR 1YJRA 3H4DA 3NWGA 1M0SA 1N5SA 1M5KC 2CQDA 2NUHA 2EG1A 4PUOB 2V2KA 1Y3KA 4BWJA 4IH6A 4YDDB 1P1LA 1RT7A 5D77A 4A48A 1KFSA 1IKYA 3HHLA 1MROA 2FD2A 2J9CA 1WHYA 2D1CA 1N5TA 4WXWA 4H4KC 1S10A 3R1LA 4OHYA 4ECSA 2O67A 3GIMA 3DOLA 3CCES 2B7BB 3IWXA 5CYMA 2R8GA 4HLBA 3IGVA 5KFFA 3UQSA 2R7OA 3I32A 2F8HA 1A7GE 3DRSB 3WDOA 1H7XA 2PEHA 5E0OA 4AL6A 3IWLA 3U1MA 1G1XA 3JTNA 2VONA 1TV6A 5A8KB 4E0DA 2H9ZA 2ROEA 4NCBA 4H4MA 2OPPB 1T95A 2RB7A 3IG1B 2F7VA 2IJFA 4ED0A 3OBIA 4PPZA 2BJEA 5EX3A 5FIIA 5F8NA 1JKHA 3UWTA 2I2YA 2DK2A 1GH8A 2WBMA 2AGQA 3JYTA 2GMJA 2KTQA 3BSAA 4ZKAA 1IJFB 4KGMA 2MZJA 4B9VA 3JSBA 2RIJA 5HLFA 4R0JA 2WOMB 2OFGX 1C0TB 1SI9A 2ZOMA 2GQCA 2IVYA 5AE3A 1MU2A 5HN0A 3V6JA 2VASA 2JLFA 2AP6A 2K3KA 3UFCX 2EFVA 3D0GE 4ELUA 4RNOA 3CCMS 1LWFB 2VG6B 4NZ0A 3MPVA 3OHAA 1VQMS 2RS2A 1WF0A 4FXWA 4IO1A 5DRKA 2XC9A 2W7OA 1M5OC 4NZ7A 2F3JA 3FGVA 1HHTP 1TUVA 2LMIA 2O3DA 2B9YA 4DOZA 5M2RA 4TU7A 3ISZA 2QLWA 2Z2LA 2KYZA 5F8IA 2HRYA 1GNKA 2JEGA 2HS3A 4DR6F 1WI6A 2HNDA 7FD1A 2XS7A 5KOXA 3BQ2A 3PW7A 3PW2A 1Q7LB 3NRBA 1Q81T 4WFNQ 2J8AA 3OXFA 5BR8F 3FJ2A 4B3TF 1S7HA 2K2PA 1AUDA 1T7PA 3HP6A 4WTYA 1DBDA 1IKXB 1WF2A 1FRJA 2HHHF 3CMES 2GO8A 4DV3F 2HHUA 2GQ2A 3M8PA 3BREA 2ZH2A 4IR9A 3M9NB 2B6AA 2QYCA 4IH7A 3IBWA 3Q22A 3OLAA 1VRTB 2E44A 3PJWA 1U6ZA 2HWTA 3SSQA 1KOOA 3GFYA 5JXSA 2MQMA 1S1VA 2V8DA 3BGUA 1TV6B 2B4VA 2YQ3A 3NCQA 4LF7F 1RT6B 3OUYB 3M8SA 1HI8A 3K59A 1REVA 3RB0A 4WFZA 1G6BA 4EZ9A 3TUIC 3LW5C 4LQ3A 4OHXA 1K73T 1HNZF 1N4LA 1I1GA 3MECB 1X9SA 2AV5A 2F9DA 2BQ3A 3LP0A 3VF0B 4EU0A 3LP2B 3M30A 3CCRS 3NS5A 4DV7F 4HTIA 3GILA 1HI1A 1VIOA 4ILMA 1YHQS 3TAMA 2MB0B 4DV6F 1ZPWX 4GC7A 2DD8S 3IRXA 3R1HA 5BYSA 2QE5A 1YTYA 2XWYA 2EI5A 1X4HA 5MLCV 5CHCB 4ECXA 4DQQA 1IM4A 4URGA 1SH0A 4OI2A 4HI2A 1T05B 2L3MA 1TL3A 4H4KA 4Q7AA 4KR0B 4LVOP 4FP9A 1ZTWA 1XNRF 1S6UA 4CI0B 4ECUA 5H1SV 2UU9F 4AXJA 4A8WA 1Q78A 2VKZG 1JXEA 3TUJC 1FRKA 4NLVA 3PX0A 4DMZA 4G1QB 2RNEA 1J5EF 1X4BA 4Y0FA 2KRRA 2CQHA 3DLJA 4I2QB 2X1BA 4OHVA 4XDDA 3SZ2A 1FJEB 3HKWA 1QE1A 1LW0B 4KHMA 3CTRA 4QZVB 2OPPA 1Q86T 4F3OA 1APSA 3ENVA 3A8EA 2EKYA 4YY3F 1ZTTA 2J9DA 3WZ0A 1V9OA 4ZPTR 5F3TA 5CYJA 2XSFA 1QSLA 2M5YA 4ID5A 2R7QA 3TUZC 4HTJA 2WOMA 5IZHA 5J2PB 2R7WA 2R7UA 2CQ1A 5A8RB 1JNRB 2N82B 2NPIA 2DNRA 2KXHA 2FJXA 2RDJA 4CQ1A 2DIUA 3I82A 1Q8IA 3QPIA 1JMTA 5F8JA 7FDRA 3BDPA 3SXLA 2WSCC 1FD8A 5KG3A 1OWXA 3LP1B 4A8SA 2P9CA 5E41A 3RB3A 3DRYA 1B0VA 4CO4A 1RDRA 3HZEA 1RT5B 2Q1LA 4WIIA 5L1KA 5E2QA 1S48A 1JLBB 3HVAA 5KFNA 4RZRA 4KHPF 2M4MA 4PQUA 5KG2A 2ADBA 1B0PA 2CZVC 2OD4A 4YMEA 2AJFE 3AQOA 3MF5A 5HMXA 3UCUP 2BABA 5JVGQ 3IRWP 4NYZA 1OQ6A 2IJNA 2EK1A 3PACA 2ZH5A 4K4XA 4DV2F 1FEHA 1ZBTA 4XDCA 4C98A 5KFJA 4ZDNA 1Q16B 4I56A 2DB1A 1R31A 4F4WA 2DNPA 1KRPA 4JI5F 5IT4A 4J9RA 4PUOA 3V6DB 1FVQA 1H2UX 1P8GA 1WG4A 2MJUA 4ID8A 4J9OA 4JYAF 4YOEA 4P7TA 3KK3B 4U7UK 3E01A 2AYEA 4E8UA 2D74B 1IN0A 2DHXA 1KFDA 3SFUA 2Y1IA 4PWDA 3SCKE 2V94A 1X4AA 1R89A 3W2VA 2IM2A 5I4MA 3KJVA 5KG6A 4F4KA 1SC6A 5F9LA 2VG7B 3EXYA 4M5DB 5GAHU 3CJKA 3GG0A 4DSLA 1T03A 1HBOA 3KK1A 1LOUA 1U25A 3RBDA 3MM8A 3CULA 1NJWA 2MDAA 2J76E 3WBZA 5B0CA 1ZAXA 4ERDA 1Q53A 4IG3B 2ROPA 4F25A 5HMYA 1AFIA 4XAKA 1PILA 1N5YA 3IRXB 3BSCA 4QWCA 3M6XA 4L6V3 1H38A 3I31A 1WI8A 2DH9A 5KOWA 5IFMA 3CCJS 2G9OA 1L5UA 2XCAA 3LP0B 2J0WA 2B4OA 2P9EA 3MDFA 3JYTB 2RQCA 1J5OA 1QSSA 3MZIA 2A2DA 1X9MA 3F44A 3MWBA 2R7RA 3SSRA 5KFPA 3FRZA 4LUBA 1FK9A 1FXDA 4NLDA 4U67Q 3JB9k 5DLFA 3VR1A 3SV3A 1X0PA 1D9FA 4NX9A 4A8MP 1WWHA 3NP5A 4QIGA 5CXTA 2FHKA 2MZ1A 2HVIA 2ASYA 5T41A 4N77A 4ELVA 5T7LA 2HS0A 1X8DA 1X4DA 3H5UA 4I2QA 5KFTA 3POTB 1W2IA 1VQ7S 3CIMA 1RTJA 3BGLA 1NK0A 3KG4A 2GMLA 5L9XA 1S1XB 2CQ2A 3H25A 3L7PA 1HNXF 4DL0C 2B5JB 4J9NA 2HHSA 1EETA 3M8RA 4YR2A 1RT4A 2PT0A 1VBYA 4EUVA 4C8KA 2C3MA 4M95A 3B78A 1PSDA 2JVRA 4U7CA 2B0GA 2YX1A 5F8HA 2L41A 2MKIA 2XGPA 2CPFA 1FE0A 1TL4A 3KLEB 3NAIA 3M8PB 4Q43A 3KHGA 4OX6A 2KO1A 2QA4G 1TAUA 4KO0A 2KM8C 3MD3A 1LWEA 1S0VA 1OPZA 5FDLB 1MMNA 4X4VA 3ENQA 2F4VF 1O5JA 2KT3A 2DNKA 4ETXA 1J2VA 2O1PA 4OI3A 3H8YA 5FD1A 5I3UA 3OTDA 3OUYA 3T9ZA 3D2WA 3SCIE 2XZWA 1MU2B 4R25A 3N28A 1RT3A 5G0RA 1OS5A 2ZBIA 2WSFC 2ZH8A 3LQVA 5MAOA 2E9RX 2XGQA 4RBVA 2R8HA 4C8OA 3KTQA 2QZ8A 3UR3C 1HBMB 3D1HA 2BQUA 3M30B 1L3KA 5EUHA 3F56A 3PEHA 4A8FA 4F2RA 1NHVA 1X5PA 5K5MA 4JV1A 1VBXA 1O8BA 3FCHA 5J2MB 1M90T 5KFMA 3OVBA 2WAQD 2V9KA 2B7CB 2VFTA 4J37A 1RT2A 2KZMA 2HQ3A 3CJ0A 2CRLA 4X62F 4K50A 3OTBA 2W4CA 4TQRA 2KI2A 3N4WA 1UWBA 2EWHA 3HF5A 1HNVA 2HNDB 3TO8A 1GXUA 3K58A 4ECVA 3OSNA 3UCZP 2ZOGA 3RRGA 5JJBA 4KB7A 1GXLA 1KONA 4OX7A 4WCEQ 3GYXB 3LUYA 5CCMA 1R0AA 3SFGA 3OL7A 2XO7A 2ZUGA 3NLCA 2NYIA 4B3RF 2IC3A 2W25A 3KK1B 5B08A 2ASLA 3EXCX 4MYUA 3M9MB 5GAGI 1Q8LA 2XMMA 2KYXA 5GVQA 2VPYB 3AJ1A 5U47A 2QFJA 2JL9A 3H4BA 3AA9A 3H2LA 4N5SA 4URSA 1P6TA 4NWBA 1QY7A 2CQ3A 4B08A 2VG7A 4PPDA 4M5DA 4Q45A 1FESA 2PD1A 2QMXA 4QOTA 3G6XA 1WNEA 3C6UB 3GG1A 3RZAA 2X3GA 3F73A 4EEYA 4OX9F 2WRMA 1SKWA 1Y0HA 1O51A 1TR0A 2KH9A 1HNIA 3K5MA 3GV5B 3VQSA 2GHPA 1N5YB 4QPTA 2W9CA 2VOOA 2E9TA 1KLMA 2IBOA 2YY3A 5DM6Q 3OJSA 3LALA 2W7PA 3MURP 4K4TA 4TQSA 4JI6F 2M2BA 2NREA 2P6SA 2CQGA 4J9PA 1NK7A 1TL1A 3BGRA 4O44A 1RTDB 3MOZA 2VUGA 1K1QA 1K0VA 2CPJA 3MTKA 1JJ2R 1PO6A 2LQBA 2VC1A 2NQPA 4B3MF 1IQZA 2M0GB 1LK7A 2VA3A 1V3ZA 1IKVA 3PZPA 1X4FA 2QRRA 4W90B 1UJ6A 1CC7A 3Q8PB 3CJ4A 4ED8A 5EDWA 3TVKA 3KLFA 1Q82T 4O3SA 3DGPA 4ES2A 1U1PA 1QVFR 2COLA 5B0GA 5IM0A 1KQGB 3MEDA 1JLEA 5D6GA 4YP3A 5F0UA 2JJ4D 2ASJA 1SL2A 1VQKS 3R5BA 4QU7A 1LW2A 2LLZA 3TX8A 2E1AA 5J1NA 1DQ8A 1SJ1A 2QEXS 1XR7A 2Y1JA 1U8SA 2GW8A 4KBIA 4O0IA 4OLPA 2FJWA 4NLOA 3KLIB 3UD4P 1S77D 1NK5A 4DDFA 1M5SA 3JSYA 1URNA 3V6DA 4F50A 2DGUA 2XG8A 3Q8RB 1HQUB 2N3LA 1HMVA 4K59A 2BXJA 4O4GA 4ALZA 4ES1A 3OL9A 3FZ2A 2GJIA 3G8TA 1BQMA 2BA9A 2RSQA 3PV8A 5D4LA 5A8RA 2R7VA 2K8GA 3KJVB 2FJDB 2BQRA 1S6PA 2VFSA 3UDCA 4RNFA 4QWBA 4QIFA 1O0PA 5EGYA 4KRWA 2DPIA 4ILRA 1YRTA 2U2FA 2JX2A 3MPWA 4WFXA 1XTZA 4N76A 1EP4B 3HPOA 4OZ0A 4Y2CA 2B6AB 2FHJD 2BM1A 2L9WA 4I7FB 3PM9A 4Y28C 1XMQF 1U24A 1ZZNA 4D3HA 1V3RA 3M1VA 1WHVA 4NLPA 3CD0A 1ZM4A 3HMJG 2VOPA 4QQBA 3OHBA 4HH1A 4NLUA 2BUNA 4OX8A 4WYLA 3DC2A 3B82A 1HW9A 2VBYA 4RBUA 4LF8F 4KFBB 4WJBA 4OL8A 3QO9B 3SCJE 1SXLA 1UKUA 2CPYA 1IBMF 1RI7A 3LP2A 1SIWB 2FGOA 1NK6A 5KFAA 4OZLA 3MM5A 3MAQA 1HNVB 2YKMB 4XIUA 2D3OR 4B3OA 4G1QA 3GFXA 4JV2A 2V8VA 4IOBA 4IUFA 2HS4A 1LKZA 1X4GA 1Z2ZA 1YWXA 4LFBF 4HHJA 2A3JA 4ZP7A 2RQ4A 3FVYA 3SSSA 4NLWA 2EFPA 3BZQA 3M05A 3UW1A 1RKJA 2Q66A 6FD1A 4DV5F 2XHWA 2DNLA 4LSNB 2XLIA 3N5FA 4RW9A 4QWAA 5DG7A 1OSDA 3PHEA 4OJ1A 3KOAA 4USIA 5DG8A 4YFUA 2VFVA 2CYYA 2R4FA 5J2QA 3OVSA 3C6TA 3T5KA 3H5SA 4NL5A 4ECWA 5IT9Y 3D1QA 4IFYB 3VTIA 3PY8A 2OD6A 2BVZA 1QE1B 4DSIA 1XR6A 2OO4A 2ZC4A 4HT7A 5L38A 3MAHA 1X7VA 1KS2A 3K5PA 2M8DB 2J7UA 4QYRA 3ISNC 1TVRB 4YR3A 6FDRA 2W8LA 3DOMA 4HI1A 3J80Y 4JI8F 3HO1A 1K9MT 1S6QB 4DV4F 2BZ2A 5H9EJ 3TI0A 3DRRA 1T3OA 1VK3A 1XBWA 2H5EA 3ZFVA 3ZZYA 4C0OC 4IOCQ 2E1CA 2ZDOA 3JSMA 2M7SA 1H6KX 3CDAA 4JI1F 1S1TB 2I8EA 4Y34A 1SJQA 3IC1A 3QIPB 5F8LA 2ASDA 1U48A 4NCAA 2EBEA 3M6UA 2DGTA 2XMUA 4EO6A 1HHSA 3POTA 2DNQA 2XY7A 2Q79A 1IXKA 2FDNA 2LEBA 2RT3A 3KNAA 4DEZA 4EGLA 2R2TA 3M2UA 4R0EA 4TY9A 1RT2B 4CO1A 1L3SA 5K8NA 1GQEA 2CVEA 4C3KA 3E2EA 4DFMA 4RUCA 4F8RA 1UA0A 1OIAA 3L09A 3GMGA 3M2VB 2JH3A 4WFBQ 2UXBF 4NA1A 2A18A 2J6SA 2LEPA 2YH0A 3MMAA 2C3PA 1H2VZ 4CTAB 4ETZA 1YG0A 3J7YU 1L3UA 4CT8A 1RISA 3I56S 3AJ2A 5B0AA 1T94A 2O01C 4ED2A 4AE5A 4AXIA 2MQLA 3DRSA 4LIRA 3MUTP 2BRLA 3IN5A 2EBGA 4DL2A 4DX8H 3DM2B 3MGJA 3EGNA 4LQ9A 1E6VA 3CJ5A 1QUPA 3DCAA 5DS7A 3V4IA 3KK3A 2KG0A 4F3MA 5B09A 2GO9A 3HVWA 2DCUB 3CT9A 4PG4A 3MI7X 4X84A 5GAEU 1YQHA 3NNAA 1C1CA 1F5CA 4PXBA 1F5AA 4YB5A 4X4TA 5HLFB 5A8WA 1UVLA 5H9FJ 1U1LA 1M1KT 5HQ8A 2DHSA 3HHDA 3IR5B 5KTQA 2OKQA