2EWHA

Carboxysome protein csos1a from halothiobacillus neapolitanus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
92
structure length
92
Chain Sequence
GIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of CsoS1A and the Protein Shell of the Halothiobacillus neapolitanus Carboxysome.
pubmed doi rcsb
source organism Halothiobacillus neapolitanus
molecule tags Carboxysome
molecule keywords Major carboxysome shell protein 1A
total genus 26
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2005-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ewhA01
3BN4A 3SSRA 3NWGA 3PACA 3SSSA 5L38A 4RBUA 4OLPA 3I96A 4P7VA 4P2SA 4OX6A 3MPYA 4RBVA 2G13A 4OX7A 2A10A 4AXJA 5DJBA 2A1BA 3DN9A 4QIVA 3MPWA 4QIGA 3CGIA 3NGKA 2A18A 2EWHA 3CIMA 3N79A 3H8YA 3I6PA 4OLOA 4OX8A 4QIFA 4RBTA 4AXIA 4DDFA 4PPDA 4P7TA 3IA0A 3SSQA 4QIEA 4LIWA 3DNCA 3VCDA
chains in the Genus database with same CATH superfamily
3HHDA 4PG4A 2NUUG 3FUYA 5KOXA 4LRFA 2VONA 4OZ2A 3BPDA 3Q8YA 4ZA1A 1YRXA 3N4WA 3JAMU 3KLFA 4KQZA 1VCTA 2LXUA 5L1LA 2PMWA 3H2VE 1U47A 3T41A 2CJQA 2ROGA 3ZNUA 4BLGA 2W25A 5EWGA 5D77A 3OTBA 5HMZA 3GG1A 2DEJA 2DHGA 4C11A 5J2MA 5A0YA 3OR2A 1T8EA 2LKZA 2ZNYA 5L9XA 4DG1A 5BYSA 4ZN1A 3QRRA 1GH8A 2OHDA 3QZ7A 1RTDB 2MKHA 1T9UA 1S0OA 2MLZA 4OMFG 1X4CA 3R5GA 4P74A 1WC5A 2A18A 2C3YA 2YNIA 2WTFA 1WUUA 4CNYA 3BYPA 4ID5A 1VC5A 1FNMA 2XMAA 1IBLJ 2HZVA 4ILLA 1KVKA 2AJ2A 1ZZFA 1S7IA 2BKPA 2DNLA 3GFZA 3MDFA 2K3KA 4OQJA 4F4AA 3OTOF 3T3FA 1Q81T 1LWXA 1GMWA 3IS9B 2W9CA 1SL1A 4Z7CA 4ECWA 1BC6A 3PACA 4K2XA 2KM8C 1FWLA 3I5AA 2ZJPQ 2CQGA 2B9XA 3CCJS 3KOAA 2DXEA 4CLUA 2BW2A 3R2DJ 3M4XA 3GV7B 2LYVA 2VG7A 1HPZB 5J1EB 2QO3A 2B51A 2VC0A 1HWKA 1VK3A 5L9NA 2RH3A 1HWJA 3GYXB 5JJBA 2LQ9A 5LSLA 4ZHRA 1IKVA 4OYAA 7FDRA 3HPOA 3OSNA 5J2QB 1ROFA 2YKNB 4KRWA 4QIFA 4OX9F 4X66J 1DZ5A 1FERA 5KTQA 3BGUA 1SI9A 3PNIA 3MD3A 2E5JA 1BQMA 4QCLA 1Q78A 2DGWA 5DLGA 2ZOGA 3E01B 5HVHA 4HI1A 3W5ZA 1U4BA 2HIYA 4ED2A 2ZKTA 4J90A 1NNDA 2MHEA 2HS3A 3HSDA 1RWXB 5G4DA 3A4TA 3MMBA 4B3MF 1LWFB 1N6QB 1RAHB 3MM6B 5LOQA 3OXGA 2CZVC 4B3RF 1LWEA 2L41A 2D69A 1XC9A 4ITSA 5E2QA 5BYRA 2WB4A 1BHNA 2IM3A 2R7WA 2IBOA 4KAIA 4RUHA 1MW7A 2D9PA 3IM9A 1NAQA 1SKUB 3SQGA 4WBFA 2BW7A 1VR6A 1WF0A 3G96A 3VAKA 2XSJA 1AZSB 2QC3A 4PXCA 1N88A 2VBXA 3AFGA 4B9UA 1S0MA 4P7TA 1N8RT 3M2UA 1QSYA 3HULA 1EP4B 2VPZB 3OQ2A 4NRUA 2K8GA 5AT1B 2BKOA 2IAJB 3DGPA 4FDFA 5AJ3J 1VLYA 2D74B 2WVEA 4NLTA 2E1PA 4NWBA 3UR3C 3HKZD 4OJ1A 3I87A 2MGZB 4O3NA 1R0AB 5J1NA 2KZZA 1JNRB 2PIIA 2C2MB 1NSQA 2VF3A 3J7YU 4JI6F 3TW0A 4BC9A 5A2QU 3GQCA 3ZTOA 2IMWP 1P27B 5E0OA 1BGXT 2GIRA 5F8HA 5E3PA 4KV8B 1IVZA 3AHPA 2ZVSA 3K7RA 3WQPA 3WC2A 4LF7F 3M2RB 4IKAA 4O44A 3DLLQ 4F25A 1HD0A 4J9LA 1LW0A 1Y00A 3PCOB 1UZHA 2BRKA 2ALYB 2NYHA 3HSZA 3PM9A 2C2RA 3HMJG 3MM9A 1FI4A 3JQMA 1C4CA 1SJRA 5DG9A 4LF1A 4QWEA 3G4SS 1N5YA 1JJ2R 5HJXA 1TU0B 3OL8A 4MIAA 2Q3PA 3M8PB 4TY8A 2QE5A 2EK1A 3BSCA 3C16B 5DDPC 3AH6A 3MPVA 5CZXA 4AL6A 1Q8KA 5ETPA 4IG0B 2XS5A 1RTHA 1AFJA 1Q5VA 1RWVB 3GR1A 1B0PA 1D9FA 3D0GE 3QZ8A 3FCWA 2V94A 4B3TJ 2MB0B 2O3DA 1R0AA 2FDNA 2F4VJ 1K1QA 3R7SB 2B4VA 2JX2A 4PEOA 1VK8A 2BE7D 2BJ1A 2C3OA 4Z2XA 4WK1A 3AODA 3PRVA 2POKA 4RW8A 3G8QA 1HBNB 3ZXWA 1RCOB 1TKTA 1WSVA 2V0NA 3IR5B 2ZH5A 2L3MA 3CCWA 5LJ5Y 2LLZA 3HK2A 3FRZA 2XULA 4CO3A 1RJJA 2NXCA 1RT5B 3KK2B 1J5OA 2KFZA 1IKWB 2LXFA 4UTGA 2NZ4A 1WDTA 1I94F 4A8SA 2K06A 4Q45A 3D1HA 2FJAB 5CABA 3K0JA 3SMZA 1SPBP 2QRRA 3KLGB 2JEIA 3PO4A 2BJ7A 5CXTA 2QLBB 3QT6A 2CAJA 5ETTA 4JV5F 2AJQA 2Y0BB 4NLOA 5HBMA 1HMVB 4JI7F 2J0XA 4I4BA 1JKHA 5IC6B 2IDLA 3QRPA 3AXMA 3O5TB 2HHHJ 3OL6A 4DV7F 1O8BA 3OVBA 1S79A 1BQMB 2GVZB 3LTOA 4YEAA 1XR6A 2ROEA 1VQKS 3LALA 1NHUA 3RU0A 2OIHA 1V5VA 1IKVB 4AXIA 2EKYA 4OYWA 3CE8A 3PRBA 2EG2A 2MQPA 4QWCA 3QAUA 1ZM9A 3DLBA 3NS6A 5J1EA 1Q16B 4EMDA 3I0RB 3T1YJ 1L3SA 2AKWB 3KUGA 4LF5F 3MM7A 1FD2A 3MOJB 2CZ4A 2GMLA 4R25A 2OSRA 1JWWA 5ETOA 1KVJA 4IG3B 4X4TA 1JLEA 4DUYJ 4CH1A 2Q66A 4ED1A 1FRLA 2MQLA 3UVJB 3NOGA 2IRUA 4USKA 4Y34A 3W5YA 2WCXA 2ZKUA 3HVAA 3RW7A 3M1VB 4AT1B 2UUWA 2VQFJ 4JI1J 4WZQA 4RO0A 3ZO7A 3UDCA 4X4SA 4J9OA 5KFWA 3GIKA 4OZNA 2DRBA 3CUNA 3FC9A 2W2OP 4YMEA 3GCWP 3BQ2A 5E5NA 4ID5B 3RB0A 1CQMA 2J5AA 3TAMB 4OLOA 1REVA 1D9DA 1NDKA 3R5AA 4QWBA 1B7YB 3QGPA 4OHVA 3FDSA 4ANDA 3B8HA 3I0SA 1VFJA 1RAFB 3OXFA 5J1PA 4G1IA 2W2QP 1VGYA 3NY0A 3PTWA 2IVFB 1Q79A 4DG1B 4DV3J 3UQSA 2N3LA 1AXQA 4A8QA 4B9VA 4H4MB 2KXFA 4H4MA 5DDRC 2IJRA 3KLEB 2VQEJ 4U7UD 3TQ1A 1QAYA 3MMJA 4NCGB 4F36A 4ZLPA 4NLXA 2V2QA 3F41A 1H2UX 2GMHA 4P71A 1NEEA 3I0SB 1FA0A 4ZVQB 3GILA 1XK8A 1N4LA 2DTJA 2K2PA 1KLMA 2PT0A 4OZ1A 3BH6B 2OEMA 1LW2B 3CJRA 4I1TA 4WTYA 5MAOA 1XMOF 4ER8A 1WOSA 1VQ4S 1LXJA 3MPWA 5FLXU 2W7PA 2WK4A 4DFMA 3E2EA 5D4OA 1XMOJ 3U7JA 3CIMA 3RAXA 1FESA 2B4OA 4OYZA 2C3UA 2JHEA 2YKAA 4CRJA 3KHGA 3H5SA 3MXHP 2J7UA 3CJ3A 3QLHB 4DSFA 2OJ3A 2QLJB 3I9V9 1C0UA 1UVJA 1AW0A 2DHXA 2QSFA 5CAAA 1TL5A 4QQBA 1VS3A 4UQGA 1H74A 1TK0A 2VODA 3Q0AA 4M8LA 2FQQB 3KKFA 3FK4A 2J9EA 3NMRA 3AJ1A 4I6AA 4OYXA 4DUTA 5JXSA 1U8WA 1R31A 2EPIA 3I96A 3VF0B 4XO0A 4LRCA 2RSQA 2B6AB 2IDEA 1WOOA 3RRKA 3H90A 4JP8A 4LVNP 1VBXA 5KG1A 4CO4A 2XMJA 3CW2C 1RWOB 1UAWA 1TL7A 1MU2B 2OI2A 3LPEA 3W9HA 3VGVA 3NBPB 4ZCLA 2I8EA 3HDSA 3KLHA 1V9OA 3I5BA 3CJ2A 3N6LA 5KFPA 2MZTA 3DXBA 2MQMA 5D4LA 2KHCA 2EG1A 1MWYA 1HHQA 3MM8A 2HK2A 3BZQA 3DU5A 2DNQA 3EICA 4CIOA 3EXCX 2H51B 2AYGA 3GG0A 4AD6A 3KLGA 1ZPWX 1Q86T 4KGMA 4AE5A 2HQCA 3IXQA 2CPFA 3HVRA 1SV5B 2HQDA 2ZBQA 3TVKA 3CC2S 5HMWA 1H2TZ 4GO5X 4ECSA 2ADCA 4LF5J 6FDRA 4C48A 5KFTA 1FKAF 4EI2A 4KKOB 3RTVA 3LH2S 2DCLA 1ZM4A 4PKDB 1LKZA 3K89A 4LR7A 3GTYX 5EX3A 2OPRB 4YDXA 1NSAA 5DG7A 3DRYA 4URGA 2ASDA 5KFSA 2MQQA 2GHWA 3JTNA 3JSMB 5LM7E 1RLCL 4NMLA 4ILRA 3T6BA 5DM6Q 3VAGA 4LFAF 1S57A 2ZJRQ 2W4DA 3M8SA 5LMUF 2M7SA 1M90T 3J7A1 1IM4A 3DLKA 2FHJA 3BGLA 4QU6A 3QO9B 3EGWB 2F65A 3D6MB 3DRPB 3MOZA 2DHSA 2QLXA 4LRDA 3MTJA 4O3RA 2W2MP 3OUYA 2MLXA 3DOKA 1U49A 2E7VA 3C16A 2YQ1A 4Y2KA 5IV3A 4A8KA 2Q1LA 3UW1A 2RMLA 3BKUA 1GMVA 4ANEA 1SH2A 5T7LB 2DITA 3MM9B 3BO3A 5IC4B 3M7VA 1YRTA 5E3QA 5LSRA 1KP6A 2Z2LA 4JI3F 2BMBA 4ZPTR 2HMIA 2V63A 1RU2A 3DN9A 3QT7A 3R3TA 5KFFA 2FVQA 4B9MA 4NXMJ 3CJTA 3JTPA 4I2QB 4FYYB 4DV7J 2CDQA 3I6PA 3UO0A 2OO4A 3E51A 1HQEA 4OYPA 2NXEA 4FXDA 3OSPA 4MTPA 4OI4A 2A6OA 2F4VF 1GX6A 3D6HB 3CXCR 2VFTA 3CPWR 3CIZA 3LGNA 2NREA 1S76D 1WEZA 5HAOA 4PR6A 1WSRA 2J8AA 3M8QB 2XM3A 4LJMA 4NLQA 1U26A 3R6LB 2KVIA 1X9SA 1RYRA 2LU1A 5K14A 1KHVA 1S4FA 4UUXA 4ECRA 4C9DA 2DGXA 3H5YA 2XNQA 3CJKB 3BKTA 3H2UB 1Z2LA 3SQGB 1N33F 1B0VA 2AIRB 3I5CA 4NLRA 4CM2A 1S1WB 4HT5A 1Q8IA 3HHKA 2DHAA 3OVAA 4UZCA 1JLAA 2LQ5A 3TZWA 3H8YA 5KT5A 1HBOA 2CADA 4M5DB 3MEGA 3BSOA 3J7AN 1OY6A 2V8VA 4Q7AA 3D3CJ 4ETZA 3AJ2A 3MMBB 3MF5A 3RB4A 1N56A 1C2PA 1ZBTA 2W24A 2W4CA 3HT0A 4ZP7A 5D4NA 2HHUA 2ZH9A 4JI4F 5JVGQ 3SIPB 2EKNA 3UN2A 2HNYA 1HNIB 1P9QC 3IBFB 5CHCB 4N5SA 1XR5A 2V8HA 3IC1A 3GIIA 5HATA 3TANA 3FMWA 3GIMA 3H5UA 3S8SA 2BABA 4NXNF 2OGUA 2ZC4A 3HI9A 5E41A 3AB4B 1S1WA 4I6YA 1L3UA 4DJBA 2CXEA 5J2QA 4RNHA 4L3KA 5C2CA 4ZLJA 4NA2A 4WFBQ 2LFVA 2RRAA 1AROP 5C25B 5GAHI 4EYIB 3EGVA 4H54A 3GZ7A 1NHKL 1TVRA 3THPA 3OHAA 4Q8EA 4K4SA 2EK6A 2BANB 1ACMB 3FBFA 3R5BA 3AQOA 3IWLA 4PCQA 2FZGB 2HHXA 2DBBA 4MYTA 2IY5B 3PFOA 3IA0A 4LSLA 3UDLA 1CEZA 2HHVA 1RDRA 2HNZB 2WSCC 1O6XA 3D68A 1D8YA 4GVLA 2KDOA 4WJBA 1SB6A 4NEZA 4FF1A 4L74A 3DDIA 4WPAA 4PG8A 3GYNA 2RQCA 5EGYA 1L5UA 2D1CA 3KHRA 1FKPB 3FKBA 1EX8A 3G8SA 2OLWA 4R5PB 2Q79A 2XZTB 2HQ3A 2V4QA 3TUIC 1YZ7A 5GADI 5KG2A 5C5JA 2V2KA 4JYAJ 1X4EA 3GP9A 1SIWB 1WC6A 2CQCA 5HQLA 1FDNA 3PW4A 3MM5B 1RAAB 1Q53A 3OL7A 1Q8LA 2UUBF 1HYSA 4JV1A 1OPZA 1QLNA 4MK7A 4LF2A 3PKYA 2R7RA 2AWZA 1VQNS 2GJIA 3K5PA 4Y2CA 5IT0A 4YB1P 1EARA 3PDNA 4HI2A 4L3NA 4RWXA 1KQKA 2ZJQQ 5FIIA 2FC9A 3C19A 2CRLA 5KFMA 4A8XA 4LIWA 2OTJS 3NOCA 2HLUA 3PW0A 1FFSB 1KSPA 3BN4A 3JQKA 1RABB 3QO9A 5K9FA 1F9EB 2GO9A 2RILA 3L9ZA 2H4WB 4WFNQ 1PGZA 2BDPA 1J27A 1H7WA 3BBCA 5DM7Q 1YJNS 2JLFA 4ZITA 1TKXB 2ZITA 4EBDA 2OMOA 1YX2A 1FDBA 4PWWA 4OI2A 2UU9F 1TL1A 1XEZA 4ZP6A 4CT8A 4LF4J 2PSZA 2YNFA 5B0EA 4DR6J 3CNQP 2X3DA 3Q8VA 1KEKA 1U02A 1K44A 5ETLA 1RT2A 3AY0A 1LK7A 3FEZA 2WVCA 2YNGB 4RWWA 1H72C 4TU9A 3BF4A 1HWUA 2QYCA 1UWBB 4B3OA 3M32A 4NI2A 3RG6A 1JLBA 2EWHA 3DI6A 2DNPA 1HHSA 1KDNA 5A6PA 2XZDB 5K8PA 3D28A 2XY5A 3H42A 1WHWA 1YJTA 2Z56B 1YZ6A 2DRDA 4HH1A 2MJNA 3MUVP 2ZBRA 4RNNA 1YBUA 3QIPA 3HHNB 1S6QB 4NX9A 2HWTA 3HZEA 3D9BA 3W63A 1XWLA 2R2TA 3BN7A 1SIZA 1JQGA 1M0SA 1Y9OA 3MR6A 3V6JA 4KO0B 5CYJA 2VICA 1U6BA 1OSCA 1W2IA 1RT3A 3ETMA 5CCLA 4FKXA 4QYZJ 2UXCJ 4UF4A 5SUHA 1VISA 2CFXA 2Z4PA 7AT1B 1WORA 3LA0A 2IHR1 3DDKA 4J9QA 1TKZA 1UETA 3HVTA 4OZ3A 4GVBB 4DL6A 1S7HA 2RU9A 1T03B 2ASJA 1UVKA 1XERA 2DPIA 4DWIA 2SXLA 4NPOA 2DNOA 2PD1A 3AOAA 3V4IA 3ELHA 3GE9A 5D0RA 2CZ9A 1AB8A 3AQPA 5HVFA 2KFNA 1NK6A 1LXNA 3DRSA 4OYOA 3OTCA 3MAQA 1MMDA 2CPEA 1IBKJ 3MTKA 5D3GA 1HL6A 1C1BA 1HQUB 3F56A 1R8BA 1FWKA 3AA9A 3GYGA 2XY7A 1RAOA 3M2VA 1SJ1A 1F5AA 1IWAA 5EWEA 2NSBA 3GFHA 4MAKA 2HNDB 2QL9B 1LV5A 3OJUA 5IV4A 2L08A 2CJ9A 2OAUA 2YX1A 3SV3A 4C8YA 4LRAA 2UVRA 3PYEA 4HACA 4ED3A 3IRWP 2HHTA 1EZZB 3A8EA 4B17A 1K1SA 4X4OA 1K0VA 3CJ5A 3HT3A 2VFUA 3KNAA 1DBDA 3K2YA 4NCGA 5C42B 1U1KA 2MKYA 4M5MA 2CQ3A 4YB6A 4X65F 2FJBB 3EGZA 2VJVA 2D3O1 2XO7A 4LFCJ 2FLLA 2DGVA 2YH0A 4L75A 2EFPA 2NUHA 4BC7A 1T05B 2ZE2A 4ELVA 1CULB 1DAXA 2XTJP 2ZBCA 3UNGC 3KK3B 2KO1A 5L1IA 1ZZNA 3PW2A 2DXFA 2F9JA 3FZ2A 2QLWA 3G87A 3OFHA 1NK5A 4DN0A 2Z2YB 1VBYA 4NCAA 4X4VA 4P7VA 4KC5A 1VQMS 4JI5J 3DRRA 2VL1A 4F0HA 4K8RA 2RRBA 2KTQA 1FE0A 2N3OA 4U6PA 1T95A 5ETKA 3FVYA 3KFWX 2CVEA 1Q8BA 4JI8F 2H9ZA 3B82A 3VGTA 1WTFA 1CSJA 2VG5B 5JVHQ 1FK9B 1S1XA 2GV1A 4OX8A 2O01C 5G0RA 5B0GA 3K8VA 1N5SA 2HZCA 3BPSP 1JLCA 3DMJA 4UT4A 2E1CA 2Y8YA 3MM7B 3M32B 3ONQA 1UWBA 2M8DB 2F4FA 3I0RA 4C6AA 3NKYA 5H9EK 3HXMA 4TVAB 4ECZA 1RT2B 4KBIA 1TMMA 1OIAA 1HLWA 3U1MA 4AL7A 1NK8A 4URQU 2AJFE 3FCHA 4IR1A 3CCTA 3SCKE 2BRLA 3LPYA 1DRZA 2MZ1A 2VZ9A 1TKXA 3ENAA 3KJFB 3KLVA 4DSKA 2G13A 3EPIA 2I5JA 2NXNA 3M30A 4FF3A 1RT4A 1A6LA 5H9FK 2J0WA 4QU7A 1X4AA 4IO1A 1IBMJ 2GQ2A 3EZ5A 2E5LF 1DY3A 3F44A 1NSPA 2Z2ZA 3KJVA 4EYHB 2MPUA 5ITHA 5F3TA 3W2WA 3HHLC 5HBMB 3R1HA 3MCOA 1M1KT 2B43A 3MCNA 1B7FA 1PJ6A 3H25A 2CQHA 4IQMA 2W2NP 3JS9A 4YR3A 1N33J 1RT1A 1FVSA 1XJWB 2B8PA 2DCUB 1UFKA 3HVWA 3ZZRA 5I3QA 4N8OA 5KFQA 1ZTTA 2FY1A 5KT2A 3N01A 1PYTA 1QUPA 4ILMA 4DR6F 1FJ7A 1X0FA 4DV0F 1WG4A 5KFOA 1YRUA 2IMOA 4LF6F 1IKWA 5CCMA 2C1EB 3BR9A 1BXNA 2IJNA 3G2XA 1VJWA 1Y5NB 2DGOA 2MZQA 2BOPA 1YJ9S 4YDDB 4IRDA 3RRGA 1S9FA 4J9SA 4RW8B 5F41A 2GMJA 1RBAA 1S6PA 4DEZA 2QGFB 4Y28C 1DQ8A 2NQPA 3TOQA 2EBEA 2QYGA 5ETMA 2I9SA 4C2MA 3OHBA 1ICEB 2PN6A 4OZLA 3UDVA 2J9DE 2FIUA 2GC8A 3DOLB 2FC8A 3V5RA 5A8KA 2E1AA 2XGPA 4ZLLA 3T5KA 4DF4A 3OJSA 2W9AA 2BJ3A 2CNKB 2FGOA 5IFMA 4W92B 2HS0A 4DHVA 1SJ4P 1NK9A 1WI8A 4QZVB 4ED0A 1H98A 4RNMA 1Q82T 5GAGI 4JYAF 1FXLA 5DQGA 3P49B 5KG6A 3EZUA 4CM0A 3PEJA 3W66A 4IRCA 1YJ7A 2B4PA 2HFNA 1HI1A 3M8WA 3PJWA 1RAJA 3FBBA 5HANA 5M2PA 2HFVA 3SCIE 5M2UA 4OLPA 4EFAC 1RHQB 1FNOA 4ES3A 2BZ2A 2KVQE 4KYZA 4EBEA 1CPZA 2B5JB 1SL0A 3IFEA 2K3IA 1HNIA 1M1HA 3SCLE 4Y65A 3KYLA 5KFHA 2DR5A 2FZKB 2B8QA 2Y1RI 5K8MA 4TU8A 2I1RA 2UZAA 4KV8A 5KFZA 2IA0A 3KDNA 4OYIA 4IOAQ 2QT7A 3O1LA 2DY9A 3QWUA 3CC7S 3IWNC 1C1CB 2AW0A 3T1AA 1VC0A 5IT9Y 3LW5C 4NLDA 2FVSA 4GO7X 3ENWA 4CYUA 5D6GA 1HNWJ 4ZVRB 3DGPB 5L1KA 1KFSA 4F4KA 2G0CA 4U8VA 4W90B 2HAFA 4ED8A 4C0HA 3S6EA 4FS2A 4NXNJ 1S5ZA 3MMCB 2GO8A 2VPYB 4PWUA 2C28A 2BA9A 5KG5A 1J5EF 2G0JA 2HHWA 1JXEA 4ZJOA 2LMIA 4EWTA 3G6VA 5AE1A 4NCBA 1CJVA 1S4EA 4QPTA 1UP1A 3LAKA 3QGIA 3DOMB 3Q8QB 3C6TA 5HI7A 4GKKF 2AF6A 2HBYB 4FBTA 4EO6A 1NU4A 2FHMA 2LP4A 2RQMA 3DOMA 3OFGA 2RDJA 3V2UC 3I82A 1NK7A 4DQIA 2C2OB 4JI1F 1UPMB 4M5NA 1CJVB 4M1KA 3W2VB 4C8KA 4KFBB 4RUBA 1WHVA 4I68A 5F8GA 4KTQA 1UVLA 3AD9C 4C0OC 1RLDA 3GLJA 1U45A 4XDDA 1B4SA 3MMCA 2XC9A 3CDWA 3IR6B 3MD1A 3VCDA 3TA2A 4DF8A 2HMIB 3LAMA 2I2YA 1LWCA 4DR3F 3KTQA 2KYZA 1TV6A 3ZZPA 1I6JA 4HL9A 4WP9A 4CLKA 1SKWA 2LQJA 1AFIA 2EFVA 5KG7A 1E6YA 1RACB 3S7RA 2DR9A 2FJVA 1HNWF 1S72S 2HURA 3G71S 2ZOFA 3A8JA 2R7SA 4KE5A 5D0GA 3I56S 4Y2MA 3WX4A 2DY1A 1NJYA 1KVIA 1EHWA 2VHGA 3SDEB 2GCFA 2KG0A 4MH8A 1FX2A 3QYYA 4URSA 1CBKA 1H7XA 2QA4G 4XTTA 1X5PA 3CCES 2E9ZA 3HLUA 3SSQA 1A0OB 1S6PB 3IP0A 3BYRA 2YY3A 1ELOA 5F8MA 2MKIA 3CCVS 2CVIA 3D6FB 3QQCD 4X62J 3BQ0A 1MROB 3HZGA 4WP8A 5T41A 4KY3A 5ETRA 2YNIB 1JLFB 4OI6A 2GW8A 2P2CB 2QMWA 3FCVA 1UWAA 3QMQA 3EXYA 3CMQA 2K7JA 4ENOA 3IR7B 3DLJA 2JFDA 2ZWOA 4KGVB 3Q8RB 4S0MA 3AXKA 1Z4UA 3TRGA 3TUPA 4HDGA 2DGTA 5J2MB 2UXBJ 4CZCA 2MKSA 4ALZA 3MM8B 2KYXA 4OJHA 2RKIA 2IFXA 4HYKA 1FNXH 3KJVB 4LFBJ 3KLFB 3VVTA 2JLGA 1U2FA 2P9EA 4P75A 2KT2A 2UV8G 4WE1B 1F6TA 2RJZA 2W7AA 5LMNJ 3MR7A 3N6MA 2AJ4A 3NGTA 1IJEB 1OO0B 4PYDA 4CLFA 1MWZA 3UNYA 2AHOB 1TFYA 2EEYA 2M2BA 1KONA 4MIWA 2BQ3A 2VDHA 1FRMA 4AFFA 2K7KA 5J2NB 3FEXB 3TEGA 2EC0A 4GC6A 1MN7A 1QAIA 3ISND 2FVPA 1N0VC 1R0BG 1UL3A 2XMKA 3N0VA 2YWHA 2KXNB 3PW5A 1L3TA 2ATCB 2OUGA 4Z37A 4K4YA 3C6UB 1E6VB 2QN6B 1WI6A 2RF2B 3BH7B 3P5TL 4WFYA 4CO2A 1RT7B 5KFVA 2IM0A 5GAEU 5K20B 3G8TA 4JI8J 4LF7J 3QLHA 5DGBA 3K58A 2X1AA 2C2ZB 5A8WA 1VIXA 3HF5A 3GSDA 1G3OA 4B9NA 1WOPA 2OPQA 5BJRA 4OZJA 3R8YA 2GFFA 2L9DA 3G86A 2YWEA 2VD3A 1LW2A 5J2PA 4EZ9A 1WHXA 3R6GB 3NGDA 3LWMA 1BUXA 1NZ8A 4G1PA 4ZOSA 4WTOB 1S6UA 2FHOB 2J76E 3OR1B 2W8KA 3R5JB 1HFEL 3Q83A 2RDIA 3BGRB 2ZFHA 4DFJA 4FXWA 1EKRA 3FFIA 1TUWA 4NYOA 4RNOA 1B3TA 2EI5A 1D1UA 1I1GA 3LUYA 2R2SA 3V6HA 4F50A 5HROA 4XAKA 3M9MB 4GRSA 2ZDOA 4Q8FA 2C2NA 2H5IB 4YN3B 2DNNA 4QWDA 3X1LB 3FGVA 1JLGB 4QR0A 4YR2A 4JI5F 5D8HB 1JIHA 3I32A 1C0TB 3CDBA 3P45B 2H5EA 3SXLA 2CYYA 2XLKA 1MSWD 3PVXA 3ILJA 1IBKF 3ZZUA 3MPUB 4Y2AA 2D3ZA 2FLOA 2YBVA 3UVJA 4CT9A 4C8LA 5LSOA 2OD4A 1KD1T 4LFCF 3M6VA 4X66F 4OX9J 2HHPA 5HQ8A 2PEBA 3CB4A 4Y0FA 4U67Q 4P52A 4IH7A 3OFFA 3VQTA 1W2BR 1FXRA 3AA8A 3HHLD 3I9ZA 5KFYA 1O5JA 3IG1A 4I7FB 4UOCA 3MR5A 2HSEB 1PILA 3FQLA 2G1DA 4NOHA 3TA1A 4M5JA 1QVFR 1FRIA 3W61A 5IT9U 2DNYA 3K5NA 2XWXA 3MHYA 4RKUC 5AE3A 3MFHA 2UUCJ 3TI0A 4Q0BB 4DPTA 3GB0A 1DARA 1CVJA 3GJTB 3KMQA 2IVMA 1WDDA 4USIA 1WNEA 2CPIA 3PX6A 3PIOQ 2MZRA 3EZOA 2PDAA 4KHMA 4N8NA 1YJRA 1FJEB 4JI6J 1F2HA 3GIRA 2QV6A 2DNKA 5DQHA 1JLQB 5I3UB 1Q7YT 1Y3KA 2Z2MA 3I31A 3QIDA 4DZDA 1PJ7A 4RNFA 1RK8A 5KFGA 1NJIT 4KJIA 1UW4A 4ZPBA 5CYMA 1N52B 4O4RA 4O4GB 2CWKA 3NNAA 2UVVA 1EQ0A 1X4FA 4NMXA 2BKNA 2CUYA 2M0GB 2NLWA 1L3VA 4DPWA 2D3OR 3B6BA 4MK8A 1G7CB 2GIQA 2YNHA 1GXTA 1RT3B 3DDNA 4OYBA 4U8YA 2YNGA 3HJFA 4NEYA 3PR5B 2XMWA 3KXDA 4B3RJ 3PKMA 4IFYA 8AT1B 1IBCB 1QD1A 1GAOA 2UU9J 4OV1A 3SSRA 3D67A 4DR2F 1VQ6S 3MI7X 4P72A 5KFNA 5E3CA 2FUG9 4DBQA 4ZJQA 5IM0A 2FPHX 1CQNA 1I5OB 2HAIA 2QSWA 2HFUA 2HFZA 2QA2A 4NYZA 1RT7A 2GAGC 3K5LA 3PX0A 2PFFB 2UUCF 4LMZA 4I2PA 5CZVA 4OZ5A 4LFBF 3FBCA 3EMTA 5EX0A 5C24A 3EVMA 1R6YA 2C2DA 4L76A 1U1NA 2FJEB 4WZMA 2R9LA 3DLEA 2X51A 1CC7A 3TX8A 5ETSA 4DOZA 2V4JB 4PXDA 3ENQA 1WEYA 2JC1A 2QTWA 4LR8A 1W7WA 3FRYA 5DZ7A 2Y1JA 1Y3JA 4DU8A 1XR7A 3OLAA 2JEFA 2YNFB 2DH9A 4U9RA 3LP0A 4DDFA 4JV2A 1S9EA 2VA2A 2ZD1A 4TYAA 4LF4F 3RBEA 3MEKA 1LW0B 2Y1LB 3KG1A 3PG9A 4QR1A 2N7CA 2XY6A 3TO8A 4L72B 4JB8B 4CDIA 2YWKA 1T94A 3CD6S 1XTZA 4NLPA 1V3ZA 2DNHA 2DXDA 1Q95G 4PG7A 4BCAA 4CLTA 3J7YI 4DSIA 3R2CJ 1RQ0A 3IGVA 2ASLA 3UPFA 1DQ9A 2JH3A 5HP1A 3NG8A 1EB0A 1TP7A 1T9VA 4TY9A 4O3PA 4DR2J 1HNZF 2YWGA 2QFIA 4MMOA 2HNZA 3GFYA 2GJ2A 1KN6A 4H4OB 1RB0A 2MGZA 1HW8A 1YK9A 3TA0A 3IBWA 3WHIA 4FBUA 3MEEB 5KT6A 4JI3J 2XS2A 2GNKA 3DC2A 1NUEA 1RWNB 3ZNJ1 1WELA 4G6VB 3M05A 2MQNA 3BBBA 4NZ7A 2NYIA 4O3QA 1R6VA 4X4NA 1SXLA 5C25A 2XSJB 3I4HX 4DFKA 4NYPA 4G1QB 1KFDA 3RBDA 2NXJA 4BS2A 1FX4A 3WIVA 2CJBA 2N82B 5GADU 1XN9A 2GQCA 2HRUA 4XPEA 4TYBA 2MQ8A 1TAUA 3VZIA 2IVYA 4HH0A 4USUA 1S1TB 1REGX 2VV5A 3FNNA 1UA1A 2M70A 2LEAA 3MM6A 5B0FA 4OIXA 3T1HJ 3UCGA 1W25A 2Z8QA 5IZHA 4A47A 1S0NA 3G6ES 2N7YA 1RU1A 4ZVHA 4J37A 1HARA 2DT9A 4AL5A 2WRMA 4DS4A 1GT8A 8RUCA 4A4JA 3EYZA 3THTA 3BSAA 4QIGA 5DRKA 3S1TA 1AUSL 2XHWA 4ELUA 1OMSA 2UUTA 5ETNA 2BJ8A 4IOBA 1TV6B 3NP5A 1RTZA 2M8HA 3FBEA 3TJ8A 4E2FB 1ZAVA 3ILLA 1VRTB 1S1VB 2WW8A 4DX5A 4W4MA 3CJKA 5KT4A 1SC4B 2CKWA 2EC2A 4Y00A 2R7QA 2MYFA 4USJC 1YDLA 1HNVA 2GVDB 1NM2A 1SH3A 3W2VA 1F9FA 5HLFB 1N5QA 1RUSA 2WSFC 1NCLA 4PYAA 2E7WA 1UTAA 4M63A 3OLBA 4ZMMA 1TUVA 2HVDA 1S1TA 2YKOA 1G4CA 3DKDA 3OD2A 3Q8UA 1OYDA 4ZCKA 1PYSB 3NMAA 1MLAA 5ETQA 5HMXA 1KQFB 3CJ0A 3R5CA 4EU0A 1NLKL 4AQYF 3EDQB 3WDOA 3RUBL 5GMEA 2N4CA 4C98A 3ULHA 2OSQA 4I2QA 2E5GA 3QT8A 3QGHA 5A6WA 4RLEA 3T6JA 2ZZNA 4B08A 1U1LA 1XMQJ 1GXLA 2L9WA 4P2MA 5M2RA 1HI0P 4RX6A 4WU2A 4ELTA 2COLA 3MEEA 9RUBA 1L3KA 2J7WA 4CYUB 1D9AA 2R7VA 3MGJA 4CI0B 3PJ9A 1FD8A 4NASA 4F0KA 3KLIB 1PJ5A 4C11B 3POTB 1IQTA 4IQXA 2F8EX 3VVUA 2KM8B 3J81j 1R7IA 3N9UC 2LA6A 1VQLS 5JMNA 1S9GA 2CG8A 3JTOA 1IKXB 1F1BB 3Q2TC 5EN1A 2DGUA 2VFRA 3CO9A 3AD8C 2C3PA 2F8HA 3DLKB 3Q8PB 1S97A 4DXLA 1VOMA 4B9SA 1LEOA 4ECVA 4P2FA 5KOWA 4JV0A 4YY3J 1OYEA 2V9KA 3A8KA 3ITHA 1S99A 3LP0B 5AXLA 4HEA9 5BYQA 4J9NA 3SV4A 4C3LA 1FJCA 2KG1A 2E5HA 4HHUA 2LXIA 1DTTB 2ZZTA 1YQHA 3DOKB 2HHSA 1D3WA 1CG2A 3M6WA 3RAMA 4PRFA 2C42A 4ZVPB 4DV3F 5C24B 3DRPA 4DV5F 1SQFA 2AGQA 1U7LA 2RDDA 4N7TA 4DN9A 3UR0A 5FLXY 2RS2A 4MIBA 4DX7A 1YJWS 5KT7A 3CSKA 3T9NA 2ZBIA 4DI6A 1SQGA 2DYAA 3SEOA 4CLWA 5AXNA 2A10A 2DNGA 2HVZA 3LP1A 1SCJB 4ICLA 5LMUJ 3UD3P 5GAHU 2ZH8A 2CJKA 1NH8A 3B54A 3BGFA 4ZVSB 2X7IA 2LVWA 1RBLA 5L46A 4IFYB 2X1GA 5B0DA 4WFAQ 1T3NA 2XMUA 2MDAA 3QJJA 2OH2A 2DB1A 2QG9B 3R5DA 3NBPA 4FF4A 3TJAA 3C8YA 3F73A 3P6YC 1TL7B 3QRQA 3A13A 4F02A 3C2PA 4QYZK 2V2VA 3AD7C 2F7VA 5GVQA 1TAQA 4CH7A 1UMJA 3TUZC 1U24A 2XO6A 4ZPWR 1EETB 1FFGB 2XMVA 4NLUA 2M88A 3QJLA 1RT6A 3H0PA 4O4GA 5CYMB 1RI7A 1RSCA 2UVWA 4YQWA 1FHTA 3VV2B 2VA3A 2LDIA 2W2PP 3JSBA 1D09B 1SKSA 3GWCA 1RT4B 1PIEA 3ET6B 2B9YA 1MU2A 1S59A 2YXLA 4P10A 3H20A 4EGLA 2BJDA 4DSJA 1BQNB 3BBFA 4OI0A 1ZAWA 2RRNA 1N36J 4X84A 3M6XA 1YTYA 4KB7A 2F40A 1SC1B 5HL7Q 5BR8J 4NXMF 1TR0A 2AEJA 2E5IA 3D6TB 1KLMB 4C3MA 2X3GA 2M3DA 1JLCB 1O51A 2MEWA 1G2EA 4TNOA 4DR4F 2P9CA 4Q44A 1R0CB 5D0EA 2G0IA 2E1MC 1XMQF 2HBQB 3MPYA 1IM6A 3W9JA 4F2SA 2NS1B 1HBUB 2QMXA 2ZHAA 4N77A 1QUVA 2WVDA 3GPAA 2VPXB 1D8ZA 2WOMB 1EQMA 1REVB 2F5GA 3CDEA 3MUTP 3B78A 1VBZA 4RW6A 1PSDA 1P9YA 3QGGA 2VBZA 3D54A 4AUKA 1CULA 1U0SA 1UJ5A 2CQDA 2ZE2B 3KK3A 4B3TF 4GKKJ 3ENVA 4QIEA 2RQKA 1RE1B 2AEFA 1HBMA 4K0KJ 1RHUB 4DCJB 4DUYF 1YVFA 4A8MP 4OHXA 3W60A 4ZK7M 5F8IA 1NBEB 2HIQA 2W4PA 1FVQA 1UKUA 4ZLNA 4DV0J 3UN5A 5DLFA 2V69A 1BLUA 1J5EJ 4B9TA 2M5YA 4TXSA 4E0DA 1T9YA 1VQSA 4CWBA 1TL4A 1ZM3A 2W1BA 3T1YF 1N34F 1SC6A 1WACA 2IYIA 4TKTA 2C3MA 2GZOA 4NE9C 2DHHA 3KUHA 3BJYA 1T9TA 2IA6A 1Z1ZA 1EJ7L 4B3SF 2GGPB 1TELA 4LF8F 1PBAA 3J80U 1BD6A 4J5OA 2OPQB 1PO6A 1M1GA 4IO9Q 3C46A 2O5DA 5KFEA 1FJGF 4DSEA 5F0WA 1JXVA 2VQFF 4Y6IA 1VIOA 4N76A 4YB5A 5D3GB 3EDRB 1Y11A 3ZZYA 1NPKA 2ACYA 1QJHA 2IPOB 1IUJA 2YX4A 2RF2A 2VU5A 1E6VA 1RKIA 2H4YB 2WVFA 2YPZA 3QFWA 3W8GA 1WKJA 3U1LA 2RS8A 3J7Z5 3MUMP 4ED7A 4F7VA 5KFDA 3NEKA 2GAHC 3BO2A 1PC4A 2R7UA 1GXUA 2B0GA 4GVBA 2XGQA 1VQ5S 2WONA 3RYLA 2W9BB 4WK3A 3BR8A 2OPPA 5IWAJ 1NB7A 1EETA 2RB7A 2ZH3A 3MAAA 3BQ1A 3MCSA 2GHPA 2XYGB 1CJTB 3K57A 4DSLA 2FHKA 1RAEB 4ZVTB 2HYIB 2J0SD 1AYEA 1IR1A 3NGRA 2EVZA 1VQYA 2CPYA 2HEKA 3K5OA 1KC8T 4Z7YA 2MQOA 1SL2A 4BWJA 2KU7A 3TARA 3W3SA 1Y4ZB 2HGMA 2AGOA 1S6QA 2HHHF 3RR8A 2RKIB 2CQIA 3PO5A 2JWNA 1WF1A 4C97A 3W7BA 1F3FA 1HWLA 5IQQA 4ZP9A 1X4BA 2QIFA 2W01A 3DRXA 5HN0A 3KMSA 2RD5C 2KH9A 1FRHA 2JVRA 1FDDA 1KWMA 1MG7A 3O44A 4MT1A 2ZHBA 1TKDA 5CD4H 3IAM9 5CH7B 2HVEA 4OHZA 5D0HA 1NKCA 4A8YA 4B3OB 1RAIB 1ITPA 2CNOB 3WBZA 2VQEF 1ZYQA 2Z0GA 4TU7A 5KAKA 3RW6A 3TX0A 1RT5A 1NXIA 2V6AA 2Z30B 4FP9A 3W1YC 4X65J 1PYOB 1NK0A 1J5OB 3JAMY 1VBKA 2VFSA 1S48A 1HBNA 2BX6A 1IR0A 5H9EJ 4BDPA 4KH0B 2DH7A 3O8WA 3Q24A 5KFLA 2M4MA 5KFRA 4EUVA 1Y0HA 1TK8A 1U25A 2XSFA 2A2DA 2CPZA 2V68A 4JI2F 1YGYA 2BJEA 1OQ6A 2X1BA 1NRKA 2F8MA 2DVIA 2V67A 1X60A 4CLPA 1XBWA 3KHHA 3CT9A 3IO1A 2HK3A 5F0UA 1RTHB 5LT5A 1S49A 4I0WA 3IAS9 2AQ4A 2JEGA 1S9GB 2G2ZA 1S10A 4X64J 1WG5A 3SSSA 1FRJA 2KFYA 3M8PA 3AOBA 4TY8B 5L38A 1RHKB 3V6DB 3G9CA 3BDEA 3L7PA 1HYSB 4A8OA 3BGOP 2PA8D 4QIWD 7FD1A 1G6BA 4DPOA 4ECUA 3D3BJ 2XWYA 4WF9Q 3D1OA 1XNQJ 3SFUA 4WXWA 4QIVA 3VAFA 1NJXA 4CQ1A 2XLIA 2DR8A 2R7TA 1YBAA 3TR5A 3T5LA 5DS7A 4WCEQ 3UD4P 4NLYA 1DJ0A 3QT5A 3RZAA 4KFBA 4KGXB 2PA3A 2GX8A 4IH5A 1SH0A 4NLVA 4FN5A 2OPSB 3MR3A 4LBIA 2HWHA 2XG8A 4A8FA 3CMES 4F04B 2FD2A 3C6TB 4DX6A 4DV1F 4ZVGA 4LSLB 4MKAA 1LWFA 2OTLS 1IXKA 1RTJA 1LQ9A 2JL9A 2CQ2A 2IYGA 2EW9A 2IAJA 2BANA 1V3RA 2BE9B 3P5BP 4P73A 2GVDA 4BBYA 2RHQB 1TVRB 2QLFB 5KT3A 4NA1A 5AJ3F 2ZH2A 5DGAA 4NLWA 4JV5J 5THWA 2ATLA 3H5XA 1NPRA 3UI3A 1AZSA 4YHHF 1FE4A 5GMDA 3U02A 2VOPA 1VRTA 4OHYA 4DQSA 3H4DA 2P6SA 2XHCA 4E98A 2WBRA 4LSNB 3RRHA 2FJWA 2LA4A 4B9LA 3SQOP 4FPIA 4DV6F 3DLHA 3NS5A 3QFHA 1CJTA 2E44A 3CCRS 3A8IA 1XNRJ 3BB5A 2RUGA 5CD4A 2FJDB 1N5VA 3GJRB 2IBKA 3QWPA 2HNYB 1TFWA 2W9BA 1KR4A 2QA1A 2KT3A 2WONB 4WIIA 4F3MA 3W65A 2XYPB 1KKHA 2V5HG 4U7CA 3CCLS 1IBLF 1HPZA 2OELA 2VG7B 3UWTA 3R1LA 2M9KA 4K4ZA 3E01A 2NSCA 2YPYA 1NH7A 2HHQA 4H4KC 2VASA 1V3SA 3NL0A 1RGVA 4DR7F 4TN2A 2IC3B 1MNEA 2CIMA 4DMZA 4DLEA 3HX9A 1K0TA 3IS9A 1VC6A 1GMUA 4M5KA 4KPYA 2G4BA 3LF0A 2Z58B 1GFWB 2LQ8A 3MPDA 3AAWB 4YP3A 2G9OA 4Y3CA 1T11A 2GGPA 2MHNA 5D4PA 4DR5J 2I38A 2XI3A 3HSJA 2HKEA 3DM2B 3MR2A 3BDPA 1RTDA 2L9NA 4UY8T 2JJ4D 2A2CA 3PZPA 4OI3A 2O66A 4U7UK 4H4OA 3UN3A 1MWQA 4CH0S 5DG8A 2UXCF 4USVA 5CA5A 5L1JA 4MFBA 2ILZA 3OR2B 3PX4A 3DXSX 5A0YB 1UVMA 2U2FA 2CQ0A 4DX8H 4RZRA 1HBMB 1VDHA 4RW9B 3CD5A 4DR1F 1H73A 1P1TA 1WC4A 1HHTP 3QBCA 1RHRB 1DQAA 4DV1J 4EBCA 1X9MA 4P2SA 3UD5A 2C2KB 3BREA 3NCQA 4PXEA 4WYLA 5H9FJ 1S0VA 1DURA 3FEYB 1B64A 1CC8A 3OT9A 2WOMA 1RADB 3ZZOA 3AT1B 1JMTA 1LFPA 2OD6A 3LP2B 3PYGA 1OWXA 4WKYA 4O0IA 3D66A 2FVRA 2C2EA 1TTHB 1Y5LB 2FTRA 4P6QA 4HR2A 1HBUA 1I51B 5T7LA 3HFZB 3FJ2A 3H2LA 3N79A 5A2QY 1VLOA 5DZ6A 3CCQS 1XNQF 4K5RA 3R7NB 5JUMA 1U1MA 4PWDB 1VQ7S 3OUYB 1N34J 4DQPA 1KOOA 2HQIA 1XMBA 2YKPA 2ZNZA 2YWFA 4OV6A 3CCSS 4MJKA 3ILOA 4WP3A 4ZPDA 1GMWD 4I2PB 2FZCB 3UDEA 4YB7A 1HNXJ 1VQ8S 1FDAA 5IM0B 2DRAA 1NB2A 4B3MJ 5HJYA 4R8UB 1HIYA 4RW7A 4I69A 3EVOA 1WKKA 1CJKB 1FEEA 4I64A 2I6WA 1YJUA 5DDQC 1P8GA 2CQPA 4BWMA 1WC1A 4ES2A 2OPRA 3BO4A 4JI2J 4LQ3A 3VTIA 1S77D 2E1RA 1VHIA 1FCAA 2XZWA 3N5BA 3P96A 2H1YA 4FVCA 4CNZA 5B0CA 2KI2A 2YNHB 2YX7A 3GSIA 1EAYC 3DMJB 1DHMA 2K1RB 1I3OB 4ZJLA 2MXYA 1UEUA 5G0RB 1NKBA 4IRKA 2VOOA 1LNQA 1UPPA 1ZOTA 2CQ4A 1FK9A 1S1XB 1WG1A 4NZ0A 4KGKA 3PRDA 2V2ZA 3DNCA 4ZVFA 1XQIA 2BV3A 2DGSA 2HRTA 2Q43A 2UV8A 3NAHA 5GMKa 2MSTA 3JXOA 4K4TA 1U48A 4M5LA 2HRYA 3MEDA 4YS2A 4FF2A 2U1AA 3ZTRA 4JI0J 3DRRB 3RGIA 2R42A 2HW3A 3KLHB 3JB9k 4QWAA 1P1LA 2RQ4A 1Q1KA 2AX0A 2WVBA 4PZVA 1U1OA 3T5JA 5F8JA 1Q7LB 2XNRA 1M5HA 3DLGB 3OTOJ 5IQ6A 3CULA 4M5GA 3RB6A 4OI1A 4K4VA 2HVIA 4DL3A 3IG1B 4I7FA 1ZA2B 3SCJE 2VG6A 4DV4F 1K9MT 1FRXA 3KDOA 5C42A 4LIRA 2ZZMA 2B7BB 3BV8A 1JNZB 5KFIA 2A0FB 5HSPA 2B9WA 4DL2A 1AA1B 2P6TA 1JXLA 4HACB 1QVGR 1RTIB 3IRXA 5IWAF 2KJVA 5F8LA 4LRBA 3AOCA 5HQMA 4ED4A 4DR3J 2J7KA 3TAQA 3A3PB 4RUAA 1X5TA 1FF2A 1GTEA 1VRUA 1APSA 2P8IA 5KFBA 1NJZA 4CLLA 2UVUA 1BY9A 3DYAA 1VQOS 4JI4J 2W8LA 1X9WA 1N36F 2RIJA 4HHHA 2DISA 2LCWA 3CVKA 1NPPA 4OX7A 3L95X 3TZYA 4XIUA 1NDLA 3DRSB 1SVDA 1NHVA 3M8YA 3UFCX 1M5VC 4NZ6A 1SJQA 3H7HB 3L7UA 4ERDA 4F2RA 2P9GA 3ZC4A 3IWXA 2DNRA 2MMYA 5D78A 5HROB 2IM1A 4V19J 2CNLB 3ICLA 3S01A 1OY8A 4RW9A 1FXDA 2PO4A 3KLEA 4G3IA 4IR9A 2Y9HA 1NKEA 4PUOB 4J9MA 4MFBB 2P5VA 4F4XA 2JVOA 3L3CA 1U1QA 2QZ8A 4EK2A 3C3LA 3DM2A 5DETA 1RCXB 4NRTA 4OJ3A 4C8MA 1X5SA 2PMHA 3JYTA 2MJUA 2YTCA 3D0IE 5J2PB 3J81U 1YI2S 4IUFA 4K50A 2OFGX 3JSYA 2BUNA 1WJ9A 1QE1B 4ETXA 5LMNF 1N32F 4TLRA 1TQLA 3NGSA 3PHTA 2RNEA 1PC5A 2BM0A 2RE1A 3I55S 2MZSA 3PIPQ 4FS1A 4KPCA 5SZTA 1UJ4A 2FVCA 2CQBA 1IJFB 4V1Ak 1KRPA 2UXBF 3TP2A 1JLEB 2VFVA 3A1YG 3V81B 2L48A 3ZZ0A 3M9NB 5KFCA 4M95A 5HLFA 2EFGA 1TMJA 1X5OA 1ZAXA 2KXHA 2VPWB 2CPDA 3IM8A 4QYRA 4R0JA 3RJMB 5DDOC 2LECA 3ZTQA 2ADBA 2WW4A 1WEXA 5J2NA 4KHRA 5T14A 3M8RA 4X4RA 1PG5B 3RAQA 4LUBA 3H59A 4ECYA 5A76A 2AYEA 5A8RA 3VZHA 5F9LA 3CEDA 2KHDA 5ADZA 3G6XA 1KHWA 1UCNA 4J9KA 3AB2B 2EBGA 4LSNA 3UCZP 3PY8A 3TQEA 4P9SA 4TQSA 1RHJB 3BSNA 4WE1A 1G1XA 5KFAA 3MMAA 3QPIA 3G82B 1PAEX 4HVZA 4PG5A 5CYQA 3US5A 1DLOB 2GIFA 1JKHB 1T9XA 2KT5A 3T19A 4UOFA 4KH1B 4WXOA 3C14B 4KT0C 5E3AA 3WIUA 1RTJB 2AJ0A 3HHEA 4J91A 4ZN3A 1YITS 2C22A 3VALA 4MYUA 2IIHA 2RUSA 3BM7A 3HD1A 2KJWA 3MM5A 3NLCA 4GC7A 4DL0C 1WWHA 2CPHA 3CJSA 2ZH7A 3TEHB 4ECXA 2CJXB 2LDYA 4XPCA 1MN9A 4K2JA 1HWIA 5I4MA 1IKYB 2XYHB 2X1FA 1U0HB 2NZCA 4ED6A 1QTNB 4G1QA 1MMLA 3HFVA 4AYBD 2RHSB 4M5IA 4WIQA 1T0TV 5EHHA 2RAQA 2QL7B 2J0QD 3KK1A 2EFQA 1XIQA 1FKPA 3HD2A 2DD8S 2A6MA 1KBRA 4AQYJ 2Y1IA 3SI8A 2CPJA 1FWPA 3TUJC 2QEXS 2VH7A 3RR7A 1S1UA 2PI5A 4KHPF 1B0TA 3OTDA 3SDEA 4C8OA 4RUCA 3V6DA 4GKJF 2IRYA 4KHPJ 1U6ZA 2R7OA 4IG0A 3C14A 4OYMA 4HTJA 2H3EB 2WZ1A 2ZM6F 1UEVA 5F3ZA 2WSEC 5I3PA 5DQIA 2MTLA 4IFVA 2OP5A 3CDAA 3MMAB 4ZDNA 5KG0A 2VB6A 1LOUA 5B09A 3GFXA 1YKWA 2F9DA 1ZPVA 3NNHA 1E6YB 4RU2A 4OZ0A 3C15A 1EIYB 3CD0A 1VMBA 4LF9F 2V34A 2ZD1B 4RL1A 3I4PA 1X0PA 1S9EB 1LWCB 3IGNA 3UE2A 1VQPS 5A8RB 2MZJA 1NDCA 4P2XA 3L7OA 5IOLA 4HHJA 1R43A 2W7OA 3O3LA 3OV7A 3CWJA 3M2RA 5HK4A 4DFPA 4K7QA 4O3SA 4QW8A 1BE4A 2VUGA 3DLEB 4BHQA 4OL8A 3HJVA 1QY7A 3DFEA 3TZZA 2AU0A 2XS7A 3MEGB 3M6UA 2E66A 2NCKL 3ISZA 3LANA 2D41A 3C66A 1B70B 3NXZA 1RWWB 4M5DA 4YFUA 3SYZA 3D2WA 1GK8A 2VC1A 1S12A 3M9OB 4WU3A 3EPGA 2HWIA 3Q86A 1QAXA 3SBMA 2A3JA 4X2BA 1WF2A 3M2UB 2HQGA 4C0BA 2ZH4A 4FYXB 3PYDA 3ZZZA 3VAHA 2R8IA 4EZ6A 2JOQA 3DU6A 4K4UA 4OJGA 2ASYA 1RBOB 1VRQC 1RP5A 3W62A 1FKOB 2KKHA 2Y3YA 3VQSA 5K14B 1VQ9S 2XBPA 2ERRA 2RU3A 1U2CA 3GCXP 1WTBA 1CLFA 4J9UE 4DL4A 1OSDA 2FJXA 3MCMA 3EUNA 1QTMA 1CJUA 1RHMB 1URRA 4UOHA 2N4DA 4ZPVR 4X4PA 4PUOA 2JC0A 1UW9A 2Y0SD 1N6QA 4EO8A 4RBTA 2I0XA 2ZUAA 1DFDA 1F9HA 4QJVA 4ZP8A 2Q6BA 3T5HA 2J6SA 2D3UA 2KRRA 2MSSA 4FKYA 1ZH5A 5I3UA 1JLQA 3GR0A 2XQCA 3VWSA 2R8KA 2WBMA 3Q8SB 3A3OB 2IM2A 3HCXA 1KQGB 4WWSA 2ZWPA 3FSYA 3WC0A 4H4KA 2YKNA 3DYAB 3VGUA 3CJQA 1VRUB 3PR4A 1JX4A 4F4WA 1IN0A 2XMMA 3EM1A 1YG0A 2AP6A 4USWA 4DUZJ 1DTQB 2O67A 4MK9A 5CQGA 4TLQA 3G6YA 1NMEB 3OPKA 4F3OA 2ACMA 2RT3A 2HVHA 2XMTA 4YHHJ 3DOLA 3PYFA 2Z57B 2MY8A 3K17A 3MURP 2VG6B 3UCUP 2GHVC 2W9CB 1EKSA 3PJXA 3JSMA 4K59A 2AT1B 4UQTA 4CTAA 3FQKA 5B08A 4Q5VA 4LQ9A 4DL5A 1AT1B 3EVWA 4C4WA 3DHXA 4CO0A 3OW2R 1M5OC 2GA7A 3ZZTA 3MECB 5I42B 4USMA 3VAIA 4RBUA 4RW6B 4KKOA 2XI2A 2ALZA 1RZMA 4HTIA 3LQVA 2PC6A 3CD7A 3IBCB 3OBIA 4U96A 2PMZD 5GAEI 2KL8A 3N5FA 1VI7A 2VKZG 3Q2SC 4C8NA 2V9WA 1SV5A 3CC4S 4PABA 4I67A 3KJQB 2HGNA 4M5HA 3MEDB 1I94J 1PBUA 3HKWA 2UP1A 4JBCA 1RT1B 1X8DA 1O0PA 4PQUA 4MKVA 4IYQA 4F0MA 5K5MA 4HDHA 3FFIB 4HT7A 1R8HA 4YUDA 1ULRA 3D5MA 2GS8A 2AX1A 3BGRA 2BBEA 5ETVA 5MLCV 1P6TA 4DV4J 2CA9A 2HLTA 4EEYA 1RKJA 3LWLA 2CJAA 1N0UA 3D4JA 1KTQA 1U09A 2JNJA 2BR0A 2BE2A 3B4DA 2I5JB 1HKAA 2DJWA 2HBZB 1H0HB 4YOEA 3K59A 1BWEA 2J8SA 1TL3B 2RVJA 2J6UA 2AEMA 1PCAA 2DKOB 4R0EA 1GNKA 2BQRA 2ZOMA 4Q2MA 5EDWA 2AD9A 2B6AA 1RWPB 1CJKA 2VJUA 1F5BA 3TJ9A 2AGPA 4ECQA 1GQEA 2CJYB 4DCPB 2KN4A 4JUZA 3ILIA 2WHOA 2D9OA 5C7PA 4WYWA 1KLNA 2APOA 4ZVEA 3K5MA 4Y2IA 3R97A 1Q0NA 2LEBA 3H98A 1XNRF 2ZH6A 4WFZA 1HR0J 2F3JA 1RT6B 4ZVUB 4PPDA 3CCZA 4CLYA 4FNIA 2G1HA 4XDCA 3B4MA 1FEHA 2BYCA 3FMBA 3U27A 3QNWB 3WZ0A 4RJVA 2R8GA 2Y8WA 2BE2B 5I42A 5KFUA 1JJ4A 2BOAA 3NNCA 3SZ2A 1BWVA 2B56A 5C2GA 3NAIA 2GQQA 1RA6A 3SFGA 5AXMA 3RBXA 4CTAB 2NPIA 3D0HE 2XLJA 1LK5A 2VBYA 3EWGA 3VAMA 4F8RA 4C8ZA 4RR5A 1MMNA 3J7ZT 3DGVA 1TZ0A 1Q5YA 1U8SA 1UEKA 2DNMA 3EJMA 4F4YA 3QJPA 3LGMA 2HS4A 4NLGA 4PQUB 2R7XA 1UVIA 4XK8C 3QATA 5IXUA 1JK9B 4JOUA 3TAMA 1JLFA 1Y5IB 3H4BA 1K73T 4ZPAA 3MECA 1DTTA 1MROA 1HA1A 3N28A 3GONA 3M8ZA 2JRSA 1SQEA 2F63A 2BJ9A 2PGCA 3V4MA 4K4WA 3TAPA 3ITHB 3M1VA 2EFNA 2R2UA 2KZMA 2G2OA 3DCAA 1Y7PA 2PE8A 1C1BB 4G65A 3MZIA 4DR1J 2IC3A 4E8UA 3R7BB 1H2VZ 3OTEA 3QSIA 2MKJA 4IG3A 1BMQB 4RBVA 4ANCA 3HM9A 4ES1A 2AV5A 3E3XA 5DJBA 4ZKAA 3P3DA 2BM1A 3TWZA 4DQQA 1IKXA 2ZHOA 2VIHA 1KNZA 3CGIA 1DTQA 1T03A 4B3SJ 1X31C 1HR0F 3HVTB 4LT6A 3OXLA 3POTA 2MKCA 1HD1A 3KLIA 4Q2LA 4Q43A 3NRBA 3BS9A 1FT8A 3N6NA 3NS7B 4UW2A 2ZVIA 5KFKA 4W98A 2XB2D 1OPIA 3PW7A 4FNHA 2GVZA 2DPJA 2UXDJ 1RWKB 4KO0A 1SUQA 3NWGA 4RW4A 3GV8B 4DL7A 4OHWA 1M5PC 3T9ZA 4K0KF 5B0BA 2J9DA 4ZPCA 1X4DA 1YWXA 2R4FA 1NDPA 4ZIWA 3A3NB 2HZAA 3ISNC 3QIPB 1HMVA 1NSKL 3HSGA 5FJ4A 1IQZA 3T1HF 3CJ4A 5HMYA 1HQ2A 4PQAA 1URNA 2QMUB 3ADAC 4HLBA 9ATCB 1CJUB 4K4XA 1C4AA 2YH1A 2KRBA 3GJQB 1WC0A 3L4BC 2BQUA 2OPSA 4IDKB 2UUBJ 4C3KA 3DI6B 3H40A 2ZH1A 4DV6J 1H3DA 1HNVB 3CDUA 1RISA 1FKOA 1GEHA 2ZC3A 5E33A 1NK4A 3KK2A 4U95A 1SJFA 4DR4J 1R8CA 3IMQJ 2PFDA 4CLZA 1U1PA 2NR0A 1S1VA 1TKTB 5EUHA 5GAGU 1ZETA 2R3VA 2V4RA 3OFEA 4N41A 1TL1B 4X4QA 4J9RA 1N5TA 1V6HA 5AXKA 2OMLA 1CS4A 1UA0A 3CF5Q 2LEPA 5BR8F 1H6KX 2UUAF 1T9WA 2HBRB 4KR0B 5L39A 2MLYA 2DO4A 5KG3A 1C1CA 5LXYA 2ZM6J 4M94A 2ABYA 1KOHA 3E8OA 3TZXA 4FZVA 3RBZA 3QSYB 1R3NA 2R8JA 2VKRA 1R89A 4N47A 2R8HA 2QA4S 2B5JA 3CCUS 4DS5A 2DR6A 1N54B 2DIVA 1YIJS 1N5YB 1N32J 1F2GA 4MKBA 4LF8J 3P4UB 1Q4RA 1K8AT 2OEJA 4USHA 2CG4A 3C15B 6FD1A 1WC3A 2AMCB 4DUZF 4JI7J 2DR7A 2KB2A 2OFHX 3NWRA 3KK1B 4O44B 2HFOA 1ZTWA 1AUDA 3ZFVA 4IFVB 3P8BB 5IS2A 4R5PA 4DQRA 4QR2A 4LBPA 1U0HA 2V8DA 1M5SA 3LGHA 2BEFA 3TYTA 3EX7B 4MKYA 1S6OA 4F4ZA 2GJFA 5FDLA 4X64F 3F0NA 1R27B 1X4HA 2B7CB 2OKQA 3GU0A 3HFKA 4KGZB 4OX6A 2FYXA 4QBUA 2HG4A 4AXJA 4DZ6A 1JB0C 1S1UB 5A8KB 2J6TA 4KIAA 1T3OA 4A8WA 2LU2A 4J9PA 2JLEA 5HP1B 2H65B 4WFXA 4YR0A 3J81Y 5FDLB 4PPZA 4CP5A 1EP4A 2FHJD 3ZTSA 2QL5B 3V6KA 2XCAA 3Q89A 2UUAJ 1HI8A 5CYQB 4RU9A 4UZBA 2ILYA 4DV2F 1IKYA 3PEHA 2BXJA 1R8AA 3KG0A 3GJSB 2DK2A 4N56A 2VBWA 4TQRA 4KSEB 2NPFA 4CLSA 1KTVA 4LSZB 1R8PA 3CJ8A 5KFJA 1NO8A 1YBTA 2CDRB 1LWEB 1FRKA 1M5KC 4X62F 3KWMA 1FTCA 3MAAB 3PXGa 5K8NA 2QFJA 1JJCB 3KG4A 2OPPB 2F1FA 1K47A 2BACA 4ID8A 2V4JA 2CQ1A 3D7SB 4J9VA 6AT1B 4YY3F 3W2WB 2JZ5A 5B7WA 3KNGA 3PHEA 8ATCB 1DLOA 4J7CA 3MFIA 1RAGB 2PEHA 1VYAA 3A12A 3DHWC 3G82A 4GMKA 5U47A 2PI4A 3D1QA 1HBOB 2R2RA 1FO1A 1YSJA 1JLAB 3M30B 4ATNA 4C7QA 4F3QA 1CS4B 3CTRA 1YHQS 3W8PA 1WHYA 5KFXA 4UOGA 1F0XA 2H48B 4OFZA 3J80Y 2WAQD 1F60B 4UUWA 4A48A 3BEGB 2MKKA 1FTRA 5B0AA 3TVZA 4ZHRB 4JI0F 3OL9A 3NCPA 1QE1A 5LJ3Y 4LF6J 4LREA 1RXOB 2JSXA 4CCHA 3EGNA 3TNVA 2XCPA 1JJHA 2DGQA 1KQSR 1RYSA 4LF9J 1UVNA 4FYVB 2DNZA 4IDKA 3THVA 4D3HA 4DV2J 3VAJA 3M8QA 1F5CA 1U6FA 5RUBA 3V81A 4WKRA 3GV5B 3CCMS 2HFSA 2VG5A 3ETOA 3W5XA 2E9RX 1GTHA 1RWUA 1YLXA 4IH6A 4DLGA 1YJVA 2QX0A 1N48A 1T7PA 1B99A 4FXVA 4NL5A 3MWBA 4LFAJ 1HQEB 1NZAA 2V8GA 4FPRA 5AE2A 1SJ3P 1QM9A 1FJGJ 4GKJJ 2MY7A 3Q22A 2YQ0A 4F67A 1PAUB 2LQBA 2ROPA 1BQXA 5F8NA 1LFWA 1SBRA 4RW4B 1OJ4A 1SUQB 4IOCQ 1QDUB 3O2IA 3JYTB 5DO2A 3Q23A 2B3TB 1TK5A 4NA3A 1QSLA 1WKLA 3W64A 5E7OB 4X4UA 1HNXF 4Q0BA 1T05A 4ED5A 4DV5J 1X4GA 2O1PA 3LO3A 3MAHA 3JSRA 2Q6CA 5KG4A 3VHQA 5LXRA 2JEJA 2DIUA 3PFEA 2DEIA 3KJNB 2CWXA 3IRXB 1T02A 2BVZA 1QAJA 5HVGA 3QAEA 2A1BA 1QSSA 3W9IA 4V19X 2H54B 1IBMF 4I56A 4CO1A 4LVOP 2AYMA 3KHLA 2HNDA 4DPXA 2WB1D 3BKFA 4UY85 5FD1A 2FGCA 4PXBA 4O3OA 4USTA 2G2YA 4FYDA 1RA7A 1SC3B 3OVSA 3FZBA 2B4UA 5EWFA 1KS2A 3M2VB 2IRXA 3JQJA 1BQNA 1H38A 1C0TA 2FLPA 1TUGB 1VJQA 1HQUA 2HGLA 2FB0A 2V50A 1RWMB 4LBHA 2HQFA 1JLGA 2AZ3A 4I6WA 3ET6A 3TVYA 1VHFA 1RTIA 2XEXA 1A7GE 4DPYA 2E9TA 3EE3A 4HKQA 2EXUA 1HW9A 4ZCIA 2M52A 5E3RA 3CMAS 3V4IB 1F3VA 1X7VA 4RPFA 3X3UA 2DH8A 4CO5A 1A9NB 2FY8A 3FSIA 2YKMA 3HO1A 4DR5F 3HHLA 3NGUA 1FFWB 1TKZB 5BXIA 4QW9A 3HP6A 3LOUA 2J9CA 3GIJA 3PV8A 2IJFA 2FLNA 2QJ3A 1GX5A 1V5IB 2B9EA 2V8PA 5L8RC 3OR1A 3RB3A 1D0EA 2E29A 4DPUA 3ZTPA 3DLGA 2K1RA 3NGKA 2VDIA 1HNZJ 4L73A 4LR9A 4D3GA 4FYWB 4K5SA 3GMGA 5IT4A 3NCRA 4DR7J 2EFOA 1ZS6A 3AJDA 1U2RA 4NLSA 1ZM2A 4ZIVA 4ZCMA 1NJWA 1U1RA 3R27A 2NXUA 3R9LA 1W26A 4ICLB 1J2VA 3LP1B 2JFKA 3IN5A 2AJ1A 4ZVOB 2ZEJA 4L6V3 2YQ3A 3HHLB 4A46A 4RW7B 5A8WB 2UXDF 5LL6d 1Z2ZA 2ZDPA 2YKMB 2DO0A 3U1NA 2E7XA 1PKUA 4PAAA 4DU7A 2YVSA 1Y10A 2YKQA 3CO0P 1UZDA 4FVMA 4PG6A 3C6UA 4ECTA 1OS5A 1IWGA 3O6QA 4QPXA 1JLBB 1C0UB 1OQ3A 2OEKA 2YWWA 4NI2B 2AYBA 1ZA1B 1IR2A 5HO4A 3WX8A 4O0NA 3FSXA 2HPUA 4F26A 2JDJA 4DCOB 4PWDA 3KUEA 2H5JB 4QOTA 2ZBPA 1UFLA 5D15A 2E5LJ 1UJ6A 2AZ1A 2CNNB 4ZS6A 2CPXA 3VGSA 3VR1A 1UFWA 2D7SA 4B02A 5K8OA 3K8WA 3LP2A 1TL3A 5H1SV 1SKRA 1WD6A 3L09A 1OY9A 4R8UA 4O23A 5F9NA 2ZUGA
chains in the Genus database with same CATH topology
3HHDA 4PG4A 2NUUG 5KOXA 2VONA 4ZA1A 1YRXA 3N4WA 3KLFA 5L1LA 4KQZA 1U47A 2LXUA 3H2VE 2CJQA 2ROGA 5EWGA 2W25A 5D77A 3OTBA 5HMZA 3GG1A 2DHGA 5J2MA 4C11A 5A0YA 3OR2A 1T8EA 2LKZA 2ZNYA 5L9XA 4DG1A 5BYSA 1GH8A 3QZ7A 1RTDB 2MKHA 1S0OA 4OMFG 1X4CA 2A18A 2C3YA 2YNIA 2WTFA 4CNYA 4ID5A 1VC5A 1FNMA 4ILLA 1ZZFA 2DNLA 3MDFA 3GFZA 4OQJA 2K3KA 3OTOF 1Q81T 3T3FA 3IS9B 2W9CA 1SL1A 4ECWA 1BC6A 3PACA 4K2XA 2KM8C 2ZJPQ 3I5AA 2CQGA 2B9XA 3CCJS 3KOAA 2BW2A 3M4XA 3GV7B 2LYVA 2VG7A 1HPZB 5J1EB 2QO3A 2B51A 2VC0A 1HWKA 1VK3A 5L9NA 2RH3A 1HWJA 3GYXB 5JJBA 2LQ9A 5LSLA 4ZHRA 1IKVA 7FDRA 3HPOA 3OSNA 5J2QB 1ROFA 2YKNB 4KRWA 4QIFA 4OX9F 1DZ5A 1FERA 3BGUA 1SI9A 3PNIA 3MD3A 2E5JA 1BQMA 4QCLA 1Q78A 2DGWA 5DLGA 2ZOGA 3E01B 4HI1A 1U4BA 4ED2A 2ZKTA 1NNDA 2MHEA 2HS3A 5G4DA 3MMBA 4B3MF 1LWFB 1N6QB 3MM6B 3OXGA 2CZVC 4B3RF 1LWEA 2L41A 1XC9A 4ITSA 5E2QA 5BYRA 2WB4A 2IM3A 2R7WA 2IBOA 4KAIA 4RUHA 1MW7A 2D9PA 1NAQA 3SQGA 3VAKA 1WF0A 3G96A 2XSJA 4PXCA 1N88A 2VBXA 4B9UA 1N8RT 4P7TA 1QSYA 3M2UA 1EP4B 2VPZB 3OQ2A 4NRUA 2K8GA 2IAJB 3DGPA 1S0MA 1VLYA 2D74B 4NLTA 4NWBA 3UR3C 2MGZB 3HKZD 4OJ1A 3I87A 1R0AB 4O3NA 2KZZA 5J1NA 1JNRB 2PIIA 3J7YU 4JI6F 3TW0A 4BC9A 3GQCA 2IMWP 1P27B 5E0OA 1BGXT 2GIRA 5F8HA 5E3PA 4KV8B 3AHPA 2ZVSA 3K7RA 3WC2A 4LF7F 3M2RB 4IKAA 4O44A 3DLLQ 4F25A 1HD0A 4J9LA 1LW0A 1Y00A 2BRKA 3PM9A 3HMJG 3MM9A 4QWEA 5DG9A 1C4CA 1SJRA 1JJ2R 3G4SS 1N5YA 3OL8A 4MIAA 2Q3PA 3M8PB 4TY8A 2QE5A 2EK1A 3BSCA 5DDPC 3AH6A 3MPVA 5CZXA 4AL6A 2XS5A 4IG0B 1RTHA 1AFJA 3GR1A 1B0PA 3D0GE 3QZ8A 2V94A 2MB0B 2O3DA 1R0AA 2FDNA 1K1QA 2B4VA 2JX2A 1VK8A 2C3OA 4Z2XA 4WK1A 2POKA 4RW8A 3G8QA 1HBNB 1TKTA 2V0NA 3IR5B 2ZH5A 1IBLF 3HK2A 2L3MA 3CCWA 5LJ5Y 2LLZA 3FRZA 2XULA 4CO3A 1RJJA 3KK2B 1RT5B 1J5OA 2KFZA 1IKWB 2LXFA 2NZ4A 1I94F 4A8SA 4Q45A 3D1HA 2FJAB 3K0JA 3SMZA 3KLGB 2QRRA 2JEIA 3PO4A 5CXTA 4JV5F 2AJQA 4NLOA 5HBMA 1HMVB 4JI7F 2J0XA 4I4BA 1JKHA 3O5TB 3OL6A 4DV7F 1O8BA 3OVBA 1S79A 1BQMB 4YEAA 1XR6A 2ROEA 1VQKS 3LALA 1NHUA 3RU0A 2OIHA 1IKVB 4AXIA 2EKYA 3CE8A 3PRBA 2EG2A 2MQPA 4QWCA 3QAUA 1ZM9A 3DLBA 3NS6A 5J1EA 1Q16B 1L3SA 3I0RB 4LF5F 3MM7A 1FD2A 3MOJB 2CZ4A 2GMLA 4R25A 2OSRA 1JWWA 1KVJA 4IG3B 4X4TA 1JLEA 4CH1A 2Q66A 4ED1A 1FRLA 2MQLA 2IRUA 4Y34A 2WCXA 2ZKUA 3HVAA 3RW7A 3M1VB 4WZQA 2UUWA 4X4SA 3UDCA 4J9OA 5KFWA 3GIKA 4OZNA 2DRBA 3CUNA 4YMEA 3BQ2A 5E5NA 4ID5B 3RB0A 1CQMA 2J5AA 3TAMB 4OLOA 1REVA 1D9DA 3R5AA 4QWBA 3QGPA 4OHVA 3FDSA 3B8HA 3I0SA 1VFJA 3OXFA 5J1PA 4G1IA 2IVFB 1VGYA 4DG1B 2J6SA 1Q79A 4B9VA 3UQSA 2N3LA 1AXQA 4A8QA 4H4MB 2KXFA 4H4MA 5DDRC 3KLEB 3TQ1A 1QAYA 3MMJA 4NCGB 4ZLPA 4NLXA 3F41A 1H2UX 2GMHA 1NEEA 3I0SB 1FA0A 3GILA 1XK8A 1N4LA 2DTJA 2K2PA 1KLMA 2PT0A 4OZ1A 1LW2B 4I1TA 4WTYA 5MAOA 1XMOF 1VQ4S 1LXJA 3MPWA 2W7PA 3E2EA 2WK4A 4DFMA 5D4OA 3U7JA 3CIMA 3RAXA 1FESA 2B4OA 2C3UA 2JHEA 2YKAA 3KHGA 3MXHP 3H5SA 2J7UA 3CJ3A 3QLHB 4DSFA 2OJ3A 1UVJA 3I9V9 1C0UA 1AW0A 2DHXA 2QSFA 4UQGA 1TL5A 4QQBA 1VS3A 1TK0A 2VODA 3Q0AA 4M8LA 3KKFA 2J9EA 3NMRA 3AJ1A 4I6AA 5JXSA 1R31A 2EPIA 3I96A 3VF0B 4XO0A 2RSQA 2B6AB 3RRKA 4LVNP 1VBXA 5KG1A 4CO4A 2XMJA 1UAWA 1MU2B 3NBPB 4ZCLA 2I8EA 3HDSA 3KLHA 1V9OA 3I5BA 3CJ2A 3N6LA 5KFPA 2MZTA 3DXBA 2MQMA 5D4LA 2KHCA 2EG1A 1MWYA 3MM8A 3BZQA 3DU5A 2DNQA 4CIOA 3EXCX 2AYGA 3GG0A 3KLGA 1ZPWX 1Q86T 4KGMA 4AE5A 3IXQA 2CPFA 3HVRA 1SV5B 3CC2S 3TVKA 4ECSA 5HMWA 1H2TZ 4GO5X 2ADCA 6FDRA 5KFTA 1FKAF 4KKOB 3RTVA 3LH2S 2DCLA 1ZM4A 4PKDB 1LKZA 5EX3A 2OPRB 4YDXA 5DG7A 3DRYA 4URGA 2ASDA 5KFSA 2MQQA 2GHWA 3JTNA 3JSMB 4NMLA 4ILRA 3T6BA 5DM6Q 3VAGA 4LFAF 2ZJRQ 2W4DA 3M8SA 5LMUF 2M7SA 1M90T 3J7A1 1IM4A 3DLKA 2FHJA 3BGLA 4QU6A 3QO9B 3EGWB 3DRPB 3MOZA 2DHSA 2QLXA 3MTJA 4O3RA 3OUYA 1U49A 3DOKA 4Y2KA 4A8KA 2Q1LA 3UW1A 2RMLA 1SH2A 5T7LB 2DITA 3MM9B 3BO3A 1YRTA 5E3QA 5LSRA 2Z2LA 4JI3F 4ZPTR 2HMIA 3DN9A 3R3TA 5KFFA 2FVQA 4B9MA 3JTPA 4I2QB 2CDQA 3I6PA 2OO4A 3E51A 1HQEA 4FXDA 3OSPA 4MTPA 4OI4A 2F4VF 1GX6A 3CXCR 3CPWR 2VFTA 3CIZA 3LGNA 2NREA 1S76D 1WEZA 4PR6A 2J8AA 3M8QB 4LJMA 4NLQA 1U26A 2KVIA 1X9SA 1RYRA 2LU1A 5K14A 1KHVA 1S4FA 4UUXA 4ECRA 4C9DA 2DGXA 3H5YA 2XNQA 3CJKB 3H2UB 1Z2LA 3SQGB 1N33F 1B0VA 3I5CA 4NLRA 1S1WB 4HT5A 1Q8IA 3HHKA 2DHAA 3OVAA 1JLAA 2LQ5A 5KT5A 3H8YA 1HBOA 4M5DB 3MEGA 3BSOA 2V8VA 4Q7AA 4ETZA 3AJ2A 3MMBB 3MF5A 3RB4A 1N56A 1C2PA 1ZBTA 2W24A 2W4CA 4ZP7A 5D4NA 2HHUA 2ZH9A 4JI4F 5JVGQ 2HNYA 1HNIB 1P9QC 5CHCB 4N5SA 1XR5A 2V8HA 3IC1A 3GIIA 3TANA 3FMWA 3GIMA 3H5UA 3S8SA 2BABA 4NXNF 3HI9A 2ZC4A 5E41A 3AB4B 1S1WA 4I6YA 1L3UA 4DJBA 5J2QA 4RNHA 4NA2A 4WFBQ 2RRAA 1AROP 5C25B 5GAHI 4H54A 3GZ7A 1TVRA 3THPA 3OHAA 4Q8EA 2EK6A 2BANB 2HHXA 3R5BA 3AQOA 3IWLA 4PCQA 1CEZA 2DBBA 4MYTA 3PFOA 3IA0A 4LSLA 3UDLA 2HHVA 1RDRA 2HNZB 2WSCC 1D8YA 2KDOA 4WJBA 1SB6A 4FF1A 4PG8A 2RQCA 3GYNA 1L5UA 5EGYA 2D1CA 3KHRA 1FKPB 3G8SA 2OLWA 4R5PB 2Q79A 2HQ3A 2V4QA 3TUIC 5GADI 5KG2A 5C5JA 2V2KA 1X4EA 1SIWB 2CQCA 1FDNA 3PW4A 3MM5B 3OL7A 1Q53A 2UUBF 1Q8LA 1HYSA 4JV1A 1OPZA 1QLNA 4MK7A 3PKYA 2R7RA 2AWZA 1VQNS 2GJIA 3K5PA 4Y2CA 5IT0A 4YB1P 2ZJQQ 3PDNA 4HI2A 4L3NA 4RWXA 1KQKA 5FIIA 2FC9A 2CRLA 5KFMA 4A8XA 4LIWA 2OTJS 2HLUA 3PW0A 1KSPA 3BN4A 3QO9A 5K9FA 2GO9A 2RILA 4WFNQ 1PGZA 2BDPA 1H7WA 5DM7Q 1YJNS 2JLFA 1TKXB 2ZITA 4EBDA 2OMOA 1FDBA 4OI2A 2UU9F 1TL1A 1XEZA 4ZP6A 4CT8A 2PSZA 2YNFA 5B0EA 1KEKA 1RT2A 3AY0A 1LK7A 3FEZA 4RWWA 2YNGB 4TU9A 3BF4A 1HWUA 2QYCA 1UWBB 4B3OA 3M32A 1JLBA 2EWHA 3DI6A 2DNPA 1HHSA 5A6PA 5K8PA 3D28A 2XY5A 1WHWA 1YJTA 4HH1A 2MJNA 3MUVP 3QIPA 3HHNB 1S6QB 4NX9A 2HWTA 3HZEA 2R2TA 1XWLA 3BN7A 1SIZA 1M0SA 1Y9OA 3V6JA 3MR6A 4KO0B 5CYJA 1U6BA 1OSCA 1W2IA 1RT3A 5CCLA 4QYZJ 5SUHA 2CFXA 2Z4PA 2IHR1 3DDKA 4J9QA 1TKZA 1UETA 3HVTA 4DL6A 1S7HA 2RU9A 1T03B 2ASJA 1UVKA 1XERA 2DPIA 4DWIA 2SXLA 4NPOA 2DNOA 2PD1A 3V4IA 3GE9A 3AQPA 2KFNA 1NK6A 1LXNA 3DRSA 3OTCA 3MAQA 1MMDA 2CPEA 5D3GA 3MTKA 1HL6A 1C1BA 1HQUB 3F56A 1R8BA 3AA9A 2XY7A 3M2VA 1SJ1A 1F5AA 5EWEA 2NSBA 3GFHA 4MAKA 2HNDB 1LV5A 2L08A 2CJ9A 2OAUA 2YX1A 3SV3A 4C8YA 2UVRA 4ED3A 3IRWP 2HHTA 3A8EA 4B17A 4X4OA 1K1SA 1K0VA 3CJ5A 3HT3A 2VFUA 3KNAA 1DBDA 3K2YA 4NCGA 5C42B 1U1KA 4YB6A 2CQ3A 4X65F 3EGZA 2FJBB 2XO7A 2FLLA 2DGVA 2YH0A 2EFPA 2NUHA 4BC7A 1T05B 2ZE2A 4ELVA 3KK3B 1DAXA 2ZBCA 1ZZNA 3UNGC 5L1IA 2KO1A 3PW2A 2F9JA 3FZ2A 3OFHA 2QLWA 1NK5A 1VBYA 4DN0A 4X4VA 4P7VA 4KC5A 1VQMS 3DRRA 2VL1A 2RRBA 2KTQA 1FE0A 2N3OA 4U6PA 1T95A 3FVYA 3KFWX 2CVEA 1Q8BA 4JI8F 2H9ZA 3B82A 1WTFA 1CSJA 2VG5B 5JVHQ 1FK9B 1S1XA 2GV1A 4OX8A 2O01C 5G0RA 5B0GA 3K8VA 1N5SA 2HZCA 1JLCA 3DMJA 2E1CA 3MM7B 3M32B 3ONQA 1UWBA 2M8DB 3I0RA 3NKYA 3HXMA 4ECZA 1RT2B 4KBIA 1OIAA 3U1MA 4AL7A 1NK8A 4URQU 2AJFE 3FCHA 4IR1A 3CCTA 3SCKE 2BRLA 3LPYA 1DRZA 2MZ1A 2VZ9A 1TKXA 3KLVA 4DSKA 2G13A 3EPIA 2I5JA 3M30A 4FF3A 1RT4A 1A6LA 2J0WA 4QU7A 1X4AA 4IO1A 2GQ2A 3EZ5A 2E5LF 3F44A 3KJVA 4EYHB 2MPUA 5ITHA 5F3TA 3W2WA 3HHLC 5HBMB 3R1HA 1M1KT 2B43A 1B7FA 3H25A 2CQHA 4IQMA 4YR3A 1RT1A 1FVSA 2DCUB 3ZZRA 5I3QA 3HVWA 4N8OA 5KFQA 1ZTTA 2FY1A 5KT2A 3N01A 1QUPA 4ILMA 4DR6F 1FJ7A 1X0FA 4DV0F 1WG4A 5KFOA 1YRUA 2IMOA 4LF6F 1IKWA 5CCMA 3BR9A 2IJNA 1VJWA 1Y5NB 2DGOA 2MZQA 2BOPA 1YJ9S 4YDDB 4IRDA 3RRGA 1S9FA 4J9SA 4RW8B 5F41A 2GMJA 1S6PA 4DEZA 4Y28C 1DQ8A 2NQPA 3TOQA 2EBEA 4C2MA 2I9SA 3OHBA 2PN6A 4OZLA 2FJWA 2FIUA 2GC8A 2J9DE 3DOLB 2FC8A 3V5RA 5A8KA 2E1AA 2XGPA 3T5KA 4DF4A 3OJSA 2W9AA 5IFMA 2FGOA 4W92B 2HS0A 4DHVA 1SJ4P 1NK9A 1WI8A 4QZVB 4ED0A 1H98A 4RNMA 1Q82T 5GAGI 4JYAF 1FXLA 5DQGA 3P49B 5KG6A 3EZUA 3PEJA 4IRCA 2B4PA 2HFNA 1HI1A 3PJWA 1RAJA 5M2PA 3SCIE 5M2UA 4OLPA 4EFAC 1FNOA 4ES3A 2BZ2A 4EBEA 1CPZA 2B5JB 1SL0A 3IFEA 2K3IA 1HNIA 3SCLE 4Y65A 3KYLA 5KFHA 2DR5A 2Y1RI 5K8MA 4TU8A 2I1RA 2UZAA 4KV8A 5KFZA 2IA0A 4IOAQ 2QT7A 3O1LA 3CC7S 3QWUA 3IWNC 1C1CB 2AW0A 3T1AA 1VC0A 5IT9Y 3LW5C 4NLDA 2FVSA 4GO7X 3ENWA 5D6GA 5L1KA 1KFSA 4F4KA 2G0CA 4W90B 4ED8A 4C0HA 3S6EA 4FS2A 4PWUA 3MMCB 2GO8A 2VPYB 2C28A 2HHWA 2BA9A 5KG5A 1J5EF 1JXEA 2LMIA 4EWTA 3G6VA 5AE1A 4NCBA 4QPTA 1UP1A 3LAKA 3QGIA 3Q8QB 3C6TA 5HI7A 4GKKF 2AF6A 4EO6A 1NU4A 2FHMA 2RQMA 3DOMA 3OFGA 2RDJA 3V2UC 3I82A 1NK7A 4DQIA 4JI1F 3W2VB 4M1KA 4C8KA 4KFBB 5F8GA 1WHVA 4I68A 1UVLA 4KTQA 4C0OC 1U45A 4XDDA 3MMCA 2XC9A 3CDWA 3IR6B 3MD1A 3VCDA 3TA2A 4DF8A 2HMIB 3LAMA 2I2YA 1LWCA 4DR3F 3KTQA 2KYZA 1TV6A 3ZZPA 1I6JA 4HL9A 1SKWA 2LQJA 1AFIA 2EFVA 5KG7A 1E6YA 3S7RA 2DR9A 2FJVA 1HNWF 1S72S 3G71S 2ZOFA 4KE5A 3I56S 4Y2MA 3WX4A 1NJYA 1KVIA 3SDEB 2GCFA 2KG0A 4MH8A 3QYYA 4URSA 1H7XA 2QA4G 1X5PA 3CCES 2E9ZA 3HLUA 3SSQA 1S6PB 2YY3A 1ELOA 5F8MA 2MKIA 3CCVS