2EWHA

Carboxysome protein csos1a from halothiobacillus neapolitanus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
92
structure length
92
Chain Sequence
b'GIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major carboxysome shell protein 1A
publication title Structural Analysis of CsoS1A and the Protein Shell of the Halothiobacillus neapolitanus Carboxysome.
pubmed doi rcsb
source organism Halothiobacillus neapolitanus
molecule tags Carboxysome
total genus 26
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2005-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ewhA01
2A10A 3NGKA 4RBTA 4QIVA 4P2SA 3CGIA 4QIEA 3SSRA 3CIMA 4RBUA 3NWGA 5DJBA 2A18A 4OLPA 3BN4A 3H8YA 4LIWA 3I6PA 4OX6A 3MPYA 2A1BA 3I96A 3PACA 4P7TA 4RBVA 4P7VA 3VCDA 4OLOA 4AXIA 4DDFA 3DN9A 4QIGA 3DNCA 3SSSA 4OX8A 5L38A 2EWHA 2G13A 3N79A 4OX7A 3MPWA 4PPDA 3SSQA 4AXJA 4QIFA 3IA0A
chains in the Genus database with same CATH superfamily
4CYUA 4QWDA 5ETSA 3SSRA 3TOQA 4KE5A 1RABB 3JYTB 3KLVA 4KAIA 4KR0B 3TWZA 3CF5Q 1RWVB 2HHXA 1JLEA 2MQOA 3MEKA 2BA9A 4L74A 1UEKA 2GZOA 2Y9HA 3OFHA 3ZTRA 3TAMB 3AY0A 1YLXA 2DR7A 1RT3A 1Q78A 5H9EK 1TL4A 3K8VA 5D6GA 4Z2XA 2V68A 3GV7B 4DSJA 3OXFA 5B0FA 5L1JA 3W8PA 3U1MA 3SI8A 3MAAB 3V2UC 4O0NA 1IUJA 3MCMA 2VBZA 4ZVHA 3OSNA 1AZSA 2HEKA 3DLEA 2ZH8A 4KGVB 4X4QA 1TL5A 3HLUA 2EVZA 3HVRA 4LF6J 4YR0A 1S1TA 1HWJA 2FJEB 1LQ9A 4ZJOA 3AH6A 2HS3A 4B17A 2NUUG 3M6VA 3N6LA 3MCNA 4RNNA 5C7PA 5GMDA 1BMQB 2RDDA 2QA4G 3HJFA 4MKVA 2BJ8A 4DLEA 3JQJA 2HHTA 4LT6A 1B0VA 3NXZA 4DZDA 3MGJA 2I1RA 3W5ZA 3NWGA 3Q8PB 3DGPA 4X4OA 2Y0SD 2C42A 4NA3A 1SXLA 2E7XA 5K8PA 2V2ZA 2ZVSA 3DOKA 3CJKB 3LGHA 2PEBA 4A4JA 1UA0A 5GAEI 1J5EF 2H4YB 1T95A 3AOCA 4XK8C 1S9EA 4UOFA 3Q24A 1ZAWA 1CSJA 4KFBA 1XR6A 4A8FA 2DD8S 4F26A 1HBUB 5J2MB 4XIUA 4DN9A 2G4BA 3BSCA 3M8QA 4ANEA 3TVYA 2I5JA 2VFVA 5LL6d 3F73A 1S48A 4F02A 1IVZA 1HD1A 4UUXA 5FDLB 5IQ6A 4J9RA 5IWAF 4Q8FA 4ZHRB 4L75A 4D3GA 1PGZA 3TP2A 4QWCA 4OI6A 1K9MT 3DXSX 2GJFA 1U49A 1FDDA 1T05A 2IBOA 2QA2A 3KNGA 4CH0S 2EFNA 1VQMS 1CULB 3MWBA 2WBMA 1B0PA 4OI0A 2HG4A 3O5TB 2GX8A 2HPUA 4OX7A 1Y3JA 5JJBA 3ZZPA 4IQXA 1PC4A 4IO9Q 5KFEA 4HT5A 1PJ6A 4OLPA 3BKFA 3MECA 4TU9A 2ZM6F 5IT9U 2QSFA 3QJLA 3J81Y 4NLWA 4XPEA 2KXHA 5A2QY 2PC6A 3BH7B 3I9ZA 3HHEA 3PR4A 2FD2A 2PMZD 1XQIA 1YJRA 1UZDA 1AB8A 4ILLA 1Y4ZB 2CKWA 4RNMA 4M5MA 3VAGA 1FJEB 2XZTB 3S8SA 1VC6A 3DN9A 3VAHA 1C0TA 4YB7A 1LEOA 1KP6A 1OSDA 5AXMA 1BE4A 3BBBA 2RHSB 2JZ5A 1HHTP 2CQPA 4EBDA 2OSQA 2O3DA 2D74B 2OTJS 3RB6A 3CDUA 3CC4S 2ILYA 3JQKA 2HHVA 3BKTA 4ECYA 2KI2A 2GHWA 2B9WA 3GIKA 3CJ3A 1RLDA 5HANA 2IJRA 2LQ5A 1QTMA 4HI2A 1HWIA 1R6VA 3JXOA 4YDDB 4O23A 3BF4A 3DRRB 2GIQA 1ZBTA 3SQGA 3FDSA 4K4WA 1VJWA 4P7TA 2W9BA 3NNHA 4USKA 3IGVA 2RE1A 1A6LA 3PHEA 2R7UA 4LFAF 1X4GA 1UTAA 3DMJA 2ZH1A 1QSYA 1NJYA 1FA0A 1LKZA 4NEZA 5D0HA 2FY8A 2ZH4A 5M2PA 3R5JB 2RB7A 2PA8D 2KRRA 3GYGA 1REGX 3GYXB 1TKTA 4R0EA 2JVOA 2F4VF 3CW2C 1YX2A 3GZ7A 2HMIA 2I0XA 4KJIA 3FC9A 4F3OA 2QRRA 4LF8J 2UUCF 2MY8A 3T5JA 4B9VA 4RJVA 1TFYA 3DHXA 3DLGB 1W2IA 3VF0B 3U02A 4W98A 4Q2LA 3RBDA 1IM4A 4PXBA 3HHLD 4DV5J 4JI1F 1NSKL 2WW4A 3O6QA 4LRAA 5T7LA 3MMJA 3VR1A 3TZZA 1LW0B 2H5EA 4ZN3A 3PTWA 3MTJA 4N47A 3MEGA 1Q8LA 2AJ1A 4DV2F 1HKAA 4DR2F 2DNHA 2VV5A 1RCOB 3M2UB 4LRBA 1KC8T 3KJVA 5H9FK 1Z4UA 3DI6B 4M8LA 1IKYA 2R7OA 1RADB 4QR1A 1KKHA 1Q8KA 4K2JA 1FWKA 1K1SA 1QDUB 3H8YA 4EEYA 3KMQA 2EG1A 5GAHI 2H5IB 1UKUA 4C0BA 1ZAXA 4OLOA 4Y00A 2W7OA 5DDRC 2QC3A 1MSWD 3W5YA 2FJAB 3MFHA 4DL5A 4HVZA 1T9YA 1XN9A 1D8ZA 1MWYA 2HVZA 4C2MA 1NO8A 1PIEA 4YQWA 3Q8QB 1SH3A 5J2QA 4PQUB 1N33F 4PZVA 1U1RA 1VBKA 2GVZB 3BYRA 2O66A 2J76E 1L3UA 1R8CA 2XEXA 4QOTA 3LP1A 2ATLA 1XMQF 1LK5A 2UVVA 2FUG9 2VUGA 4IG0A 3RB0A 1Y5IB 5D78A 2RILA 1XNRJ 3PJXA 3FZBA 2BM1A 1VIXA 5ETPA 1OJ4A 3P6YC 2GA7A 3H20A 4LIWA 3MM9B 1SI9A 5GAEU 1U0SA 5K5MA 1NPPA 2XC9A 2X1FA 1FE0A 5D4NA 4CQ1A 3OJSA 2W8KA 2ASJA 4AL6A 4U9RA 3HD2A 4QQBA 4DV7J 5I3PA 1F0XA 1TKZB 2W2QP 5JVHQ 3VALA 1TKDA 1PJ7A 2LYVA 4ZVFA 2XMUA 2QYGA 5F8MA 3PRBA 4ZVSB 2K7JA 4FF3A 2V0NA 2EW9A 2KVQE 5CCMA 1YG0A 3AQPA 4PXDA 1YJTA 3EE3A 3SV3A 2B4VA 3C6UA 2FTRA 4KPYA 3FJ2A 4ID5B 3N01A 1B99A 2W1BA 4MYUA 2B0GA 3IC1A 5ITHA 4K2XA 4OX6A 4F04B 2GO8A 1D3WA 4DN0A 4V1Ak 5IT9Y 1M1HA 1FXRA 3V6JA 2MQLA 3I0SA 5CYJA 2IIHA 1HPZB 4PEOA 4LMZA 1CS4B 1EP4A 4ED6A 4C8LA 2QIFA 1VOMA 3M2RA 3TA1A 5L38A 4IG3A 1CJKB 4LQ9A 3OFGA 4ELVA 4PXCA 4JYAF 5C24B 1FFSB 4J5OA 5HSPA 3T1YJ 2JWNA 4UZBA 1JB0C 1NPKA 5K14B 2FJWA 3MMCB 2DIUA 3HDSA 1NPRA 6FD1A 4GVBA 4PYAA 2OP5A 4TYBA 4L76A 3UI3A 1FX2A 2V2VA 1BY9A 3V5RA 2G9OA 4FBUA 1ZETA 3GFZA 3K8WA 2CWXA 3W62A 2W2OP 4O3NA 2RKIA 2NYIA 2BQRA 5B0CA 2IVMA 4C4WA 2JVRA 4F4WA 5A0YA 2JC1A 4X65J 1GAOA 2H3EB 4CLSA 1M5HA 5A8KB 3BJYA 2V2QA 1VRUB 1SH0A 2B43A 1A0OB 1NDKA 1MROA 1YWXA 1CC8A 2KO1A 2CQDA 2JL9A 3GR1A 3DDKA 5KFQA 2DNZA 4BWMA 1TKXB 4DUYF 1DHMA 1M5PC 2YTCA 4NYOA 5EWEA 4QYZK 2IMOA 4JV0A 3ETMA 2DNQA 2E5HA 4EYIB 1IN0A 3HVAA 1N5VA 2RQCA 4NLXA 3HFZB 5CH7B 2QLJB 2ZD1A 3EGZA 1UVKA 3BEGB 2LA4A 4AYBD 2VQFF 3LGMA 2E9TA 3LP0B 1F9EB 3MAHA 1KS2A 2C2OB 1RWMB 2XCPA 4DLGA 2Q6CA 2KHCA 2W8LA 5KT7A 3KLIA 2B8PA 5DO2A 3FFIA 3POTA 3KUGA 4DL6A 1GMVA 4WCEQ 1JJ4A 4ZPWR 2QG9B 5E3AA 4DG1B 1VIOA 2O5DA 3MPUB 1T02A 3ZFVA 4LF5J 2B3TB 3VQTA 2OPRA 4ITSA 4ZLLA 2A10A 3A1YG 1RT7A 1OPZA 2QLBB 4P10A 1XMOF 1I6JA 1QSLA 5HO4A 2JEFA 1HQUA 4BBYA 3CDWA 3GFHA 1AUDA 3W63A 1JLQA 4PG5A 2WK4A 4M5DA 5F9NA 2ZDOA 1M5VC 4DL0C 3EYZA 2ZJRQ 2DNOA 1RU1A 3HVTA 5GAHU 5D4OA 3PFOA 2ROPA 5C42A 2RVJA 2CADA 2DR5A 3BGUA 4WFAQ 3IS9A 3H5YA 3M05A 4JI8J 2BE9B 2MGZA 4FF2A 4DU7A 4I68A 2IMWP 4Q0BA 2HVHA 3KDNA 1CQNA 4OI2A 5C25B 2XMWA 3TNVA 4YHHJ 1R8AA 4Y2MA 3SZ2A 3KFWX 3G8QA 3I0RB 3C16A 1ICEB 4B08A 4NX9A 4EGLA 4KRWA 4LREA 4QU6A 1XERA 3O44A 2DO4A 4UUWA 1ZTTA 4UY85 1RTHB 2HAFA 4ZVRB 3K58A 4RKUC 2YNIB 1SJRA 3TAMA 4DR4F 4NXMF 2FJXA 1H7XA 1Q0NA 1ZAVA 3FRZA 1QLNA 3KK3B 2JFDA 5EX0A 5F8NA 1U1NA 2ZE2B 4M5GA 3CXCR 3CJ8A 3PYEA 4ED0A 3TJ9A 2YX7A 1TMMA 2KHDA 3TYTA 3MAAA 3TAPA 3AXKA 4NLDA 2HRUA 4DPXA 3UW1A 3TZXA 4ILRA 5DG7A 4WKRA 3TJ8A 2CVIA 4DCJB 2QX0A 3CJ4A 4JI5F 4OMFG 3MR6A 1V5IB 2EG2A 3BGLA 2XLIA 2YNGB 2I9SA 2EBGA 2ZOMA 4HKQA 4YY3J 1K47A 2M70A 4ATNA 1BQXA 3KK1B 4RL1A 4AQYF 4ZPBA 3R5BA 1ZS6A 3D54A 4CO5A 1WJ9A 4QYRA 1Q8BA 1EB0A 4LJMA 3HZEA 4CO3A 3PX0A 4WPAA 4LQ3A 3UDCA 3SIPB 2BZ2A 3BBFA 4OHVA 5KG5A 3PZPA 2BV3A 3CJKA 4C9DA 2PI5A 1S7HA 1IKXA 2Q79A 1QE1B 2FPHX 3D3CJ 2C3YA 3IRWP 2MLYA 1D0EA 2VG5B 2BQUA 5KG2A 2DGOA 4ID8A 3B82A 1GX5A 3OLBA 2XHCA 1UVJA 3K89A 5FDLA 3QGIA 3MXHP 1HNWJ 4DQSA 4HTIA 2R2SA 3NWRA 2JEIA 2RD5C 3PYDA 2L9DA 3DRPB 1XNQF 2YKNA 5E0OA 4F3MA 4FYWB 3MR3A 3KHRA 4IKAA 4DL2A 2FHJA 2F9DA 1CULA 1S1VB 2ZHOA 2QT7A 2VJUA 4NZ0A 1JIHA 3UNGC 1R31A 4X4PA 2XSFA 4DS5A 1NDCA 1KOOA 1X8DA 2HNYB 5HMXA 2DH9A 1PJ5A 1XJWB 1LWFB 1D09B 3VQSA 1S0NA 2E7VA 1FDBA 5LOQA 1SH2A 2DR9A 3NLCA 2XZWA 2PD1A 2RF2B 1UFWA 1AT1B 1C1CB 1WKLA 5E2QA 1QAIA 4C8MA 3QT5A 3QIPB 4LBIA 2KRBA 2Q1LA 4MKBA 1IXKA 1OO0B 5DJBA 1YJWS 2CZ4A 2FJDB 4P72A 1E6VA 5E41A 2VPZB 1RSCA 5KT5A 5KG1A 1WHXA 2M8HA 2ZITA 1TP7A 3NAIA 4ICLA 2HFSA 3CCRS 4RU2A 3CD6S 4DR6J 2P9EA 3M1VA 3MM8B 4TNOA 4URGA 3OT9A 1E6YB 1SKRA 3BPDA 3P4UB 4A8QA 3AQOA 1Q1KA 3H7HB 3MD3A 1RWNB 4OYOA 1RT5B 2E5LJ 4OFZA 5HVFA 2UUBF 3PW7A 1U45A 4DPUA 2W2PP 2ZKUA 2AYMA 2BRKA 3I82A 1HNXJ 1HARA 5AXLA 3QNWB 1X60A 3LP2A 3ZNUA 4PYDA 4FXDA 4JI2J 2E66A 5B0DA 3DRRA 3FQLA 1FE4A 1AW0A 3FSIA 3F56A 1F3VA 4TKTA 2DVIA 4YR3A 2E1PA 5CYQB 5KFAA 4RNOA 1JNRB 4DX6A 4OZ3A 2WSEC 1BUXA 1Q82T 3ZTQA 1KSPA 1EQMA 2VJVA 2Z56B 4Q8EA 3R6LB 2ZHAA 3I56S 2EI5A 1L3TA 2QE5A 4QCLA 3BQ0A 2VICA 2AU0A 2Z2LA 3QWUA 2HNDA 2Q6BA 3NGKA 5A8WB 3TQ1A 4I6YA 2COLA 1P8GA 2AJ0A 2ZH6A 5DDOC 5LSRA 2VBYA 1FD2A 3A8EA 1HI0P 1QAXA 4OZLA 1LXJA 1DAXA 2E5GA 5DS7A 1NMEB 1VQ8S 2Q3PA 2W9CA 2CNNB 5D15A 2XGQA 2WONB 3TRGA 5B0GA 3KUEA 3NCQA 1RTJA 3R27A 3CT9A 2UUTA 2K3KA 2XY7A 4AD6A 5LMNJ 4B9MA 1FKAF 2I38A 4KGZB 4AQYJ 1LW0A 4QW9A 3R7NB 4P74A 1UEUA 2A2DA 2WSCC 2H51B 2E7WA 1HIYA 2A0FB 2GMLA 3ENAA 1WEZA 3D67A 2DITA 1F2HA 3M2UA 4Q45A 2MKCA 1NK4A 2C1EB 3R5GA 4MMOA 2EFOA 4MJKA 4RNFA 3A8IA 1N0UA 1C2PA 4FNHA 1F5AA 4KPCA 3KDOA 5CZVA 1SC6A 2N4CA 4TY9A 3QRQA 4MK8A 4CH1A 1KD1T 1TFWA 2IPOB 2DHHA 1NCLA 1XR5A 1SJ3P 4NI2B 4UY8T 4JUZA 4F67A 2GFFA 3NOCA 1FDNA 4DL4A 3JAMU 4KHMA 4PG4A 1UAWA 3C2PA 4DV6J 1XEZA 5K8MA 2VPXB 4RW8A 5IZHA 1XWLA 2RDIA 3JQMA 3NOGA 1K0VA 4NLGA 2GVZA 5HJXA 2D3ZA 4C3MA 2HK3A 5L1KA 3T1HF 3D9BA 3B78A 2XY5A 1AROP 4J7CA 1P6TA 4M5HA 3TX0A 2KL8A 1KONA 1REVB 2WAQD 1FRHA 5LT5A 2HGNA 1NK0A 2KYZA 5IM0B 1Y5NB 1CJVB 1RT4B 4PPZA 3M8WA 4PG7A 4OYAA 4K4XA 4I6AA 3KG0A 1IBMJ 3OTOJ 1X4AA 2AP6A 3DLKB 2FLLA 2X1AA 4P75A 4C8ZA 1TKZA 2LP4A 1AYEA 4UTGA 1RT2A 3MMBA 2YQ0A 3FBCA 4J9MA 4RO0A 3M8RA 5F9LA 4LBHA 1YBUA 1M5SA 3PX4A 2FYXA 2MZQA 3IO1A 4NCBA 1I5OB 4RUBA 2GMHA 2OELA 3CD7A 3OXLA 4MT1A 3UDLA 2XMMA 4ID5A 4WIQA 5DGAA 2CQ2A 2BJ1A 1RAHB 1MLAA 2KYXA 4LR9A 4YDXA 2R7TA 3SEOA 2H1YA 1Q81T 3H0PA 1JLFB 3AD9C 2A1BA 2CJAA 2CQ1A 3ET6B 3W8GA 1R8BA 2P8IA 1WKJA 1BWVA 1CS4A 1IM6A 4RZRA 2V4QA 1OY9A 3THTA 2NR0A 3KHLA 1R43A 1CJKA 4HDGA 2B56A 4ED2A 1P9QC 5C24A 2NUHA 5HVHA 5KFNA 3DLBA 3V4MA 2DGUA 3LOUA 5K14A 4OYWA 2J8AA 3IWNC 3HKZD 4WK1A 4E98A 4DZ6A 1GK8A 4NLSA 2ROEA 2AGQA 2NXJA 4FNIA 3TO8A 2RU3A 4Q2MA 2N7CA 4BC7A 4ETXA 1EKSA 4RBTA 1UETA 5KG4A 4PWDB 3ZZRA 1YTYA 4RWXA 4ZP7A 1NH7A 4CH7A 2MQPA 2YNHB 5EUHA 3HM9A 2LCWA 4KYZA 1S9GB 4EZ9A 4WYLA 3N4WA 2ZKTA 4B02A 4K0KF 4B3RF 3P49B 4DV4F 1Q5YA 2AV5A 2CVEA 3OXGA 2R7WA 1KHWA 3D7SB 2BR0A 3CO0P 3HHLA 4RNHA 5MAOA 1WKKA 2MKHA 3UE2A 3KUHA 1TKXA 3FVYA 1HHSA 1N0VC 2CAJA 3NEKA 4LF9F 3RRKA 4R8UB 2HQCA 4F3QA 4X62F 4OV1A 1FK9B 2X3DA 4Q44A 3CCMS 3J7YI 3JSBA 2BDPA 1HBMB 2KJVA 2ZEJA 1FFGB 4DFMA 2RUSA 3LP0A 3E2EA 1FKPB 2LA6A 5E3RA 1FRKA 3ZZYA 4G1QB 4RUAA 1M5OC 3VVUA 2A18A 3BR9A 4UOCA 2PMHA 3LAKA 1AFJA 4MK7A 4P52A 4RW9B 2HHHJ 4KTQA 2LDYA 1CJUB 1KQKA 2BOPA 3CCVS 2Z2MA 1RB0A 4F50A 4DUZF 4U7UD 1NK7A 2NREA 4LRDA 2YBVA 4EO6A 5IT4A 3G8TA 2DCLA 1VQKS 2BJ7A 3R5CA 3M2VB 4LSZB 4DF4A 4ZVPB 1OSCA 2DEJA 3OUYB 1G1XA 3H40A 1FI4A 2L9WA 4HDHA 3EZUA 3UWTA 3OL6A 2IAJB 3ILIA 2DPIA 4OX9J 2HZCA 4JI7J 2W2NP 2IRYA 1IWAA 1N56A 2HRYA 3ZZZA 3HPOA 3AB4B 3KOAA 2VL1A 5KT3A 3TEHB 2WB4A 2DKOB 2HQDA 1YIJS 2R8KA 4I6WA 4JI6J 5KFDA 1GXLA 4F4KA 3NNAA 4JB8B 1X0FA 3FQKA 1IBKF 5LJ5Y 2R7QA 3SV4A 3JAMY 4LBPA 2P9GA 3JS9A 2V6AA 3I96A 1RU2A 4ETZA 3I0RA 2OPSB 3W5XA 2CQBA 1TV6B 2QO3A 3UNYA 5DQHA 1MMNA 1RACB 2IYGA 3ISZA 2XO6A 2AMCB 4C11B 2CDRB 1JLBB 5BR8J 1X9WA 3AD7C 4WFZA 2D9OA 1HBNB 2F9JA 3D6FB 1S6OA 4DR5F 3PVXA 5F3ZA 3EZ5A 1NDPA 1W2BR 2D69A 4HHUA 3KK3A 1L5UA 5I3QA 4J90A 1VQSA 2AX0A 2ZE2A 3P3DA 1S1WA 4ZCKA 3W61A 3RTVA 2MQ8A 2OUGA 5CD4H 1WEYA 5D77A 1T3NA 2F7VA 3IM9A 1UPMB 3OTBA 3OSPA 1T11A 3TI0A 4KH0B 2GVDA 2YNGA 4USTA 2MHNA 2YWHA 4NZ6A 2IJFA 2DGWA 4PWWA 3MCOA 5G0RB 3MD1A 1G2EA 4L3NA 4OI1A 1S1UA 3KK1A 1WF2A 4PXEA 4USVA 4MKYA 2YWGA 4QR0A 1EJ7L 4YB1P 3Q0AA 1RTDB 3K59A 4ECXA 3OR2B 2X7IA 4DR3J 3UFCX 1UVMA 1FD8A 3IN5A 5L8RC 2UXDF 2IDLA 1U26A 3F41A 3CIZA 4NLTA 3G2XA 3EPGA 1K44A 1UL3A 2G1HA 3MAQA 3V4IB 1WHVA 3CO9A 1QE1A 3KLGA 3R2DJ 3OJUA 3GG0A 3ADAC 3OVSA 3BDPA 5KFRA 2R2UA 1VK8A 1CBKA 3QGGA 3I5AA 4JI4F 2AEFA 1A9NB 2D1CA 2HNZA 3WHIA 2BE7D 1T03B 3DRPA 1NK8A 2Z2ZA 2C3OA 1S97A 5DM6Q 3WQPA 2NPIA 3C15A 4KO0B 2I2YA 1UW9A 2HK2A 2FHKA 1S1VA 3NGUA 3DRYA 3HXMA 4ED3A 1KOHA 2HKEA 1FHTA 4B3SJ 4RWWA 3LH2S 5KFZA 1H7WA 1IBLJ 1HR0F 3X3UA 3HHNB 3FNNA 1HNZJ 3HHLC 1Y0HA 2DR8A 1LWCB 2BBEA 2Y8WA 4O4GA 4X66F 3KG1A 1LWFA 2UXBF 3CJ0A 2ACMA 1S99A 1P9YA 4ZIWA 1F5CA 1PSDA 4Q43A 4J9QA 4IUFA 1ZM3A 4E2FB 2L48A 2R8HA 3QIPA 1SPBP 1YZ6A 5DGBA 2OH2A 1UVIA 2EK6A 2FJVA 1URRA 3MEEB 4X2BA 2OO4A 2WVDA 4OZ2A 1NJIT 2V63A 1TQLA 3WZ0A 1OYDA 2E9RX 2MJNA 3J7YU 1RK8A 1H2UX 3IWXA 1E6YA 4WP8A 1WG4A 5K20B 2XM3A 3VAJA 1Z2ZA 2BJDA 2J6UA 1PILA 1SL2A 1M1GA 2G0IA 4GKJF 4C8NA 4DPYA 4ELUA 3ILLA 1OMSA 4FZVA 3Q2TC 4LSNB 2CNLB 4CO4A 3QWPA 5CYQA 3EUNA 2FZCB 3M6UA 4CIOA 3K2YA 2BJ9A 4LF2A 3QATA 3ZTPA 2WBRA 3NBPB 1JKHB 1FTRA 1N5YB 2XMVA 3BO4A 3T19A 1RTIB 3PW0A 1X5SA 1XK8A 5ETKA 2H9ZA 4I2QB 1NJXA 3NG8A 2OIHA 3EVMA 2AKWB 2DXFA 1RT6B 4DFKA 1S5ZA 5IS2A 3OR1B 4ZP6A 4QJVA 2KDOA 1VBZA 1VISA 5A8WA 5KG7A 4TXSA 1X4BA 3W2WB 1K1QA 3ELHA 4UOGA 1Z1ZA 3PIPQ 1GMUA 1PC5A 5HMZA 3CD0A 2GGPA 1TVRB 2YWFA 2WONA 3PRVA 2J7WA 1N5QA 3O2IA 2WB1D 3A3NB 5KFUA 5L9NA 4DV1J 3S01A 3UD3P 2UV8G 1R3NA 2IM2A 4C97A 1EARA 1UWAA 2Z30B 1IBCB 5CYMB 5EDWA 2D7SA 5K8NA 2Y1IA 2W4PA 1RBLA 3IM8A 3BSNA 5CHCB 1TK5A 2OAUA 4NWBA 1RWKB 1UWBB 4IFYB 4WJBA 4AXJA 1Q53A 1YQHA 3N0VA 2AYBA 3A3OB 1XC9A 4R25A 2B51A 3CVKA 1U02A 4E0DA 4S0MA 4KT0C 2GW8A 2UXCJ 4NA2A 2JEGA 1ZPVA 3CCQS 2HBYB 4A8OA 3LF0A 1K73T 4NI2A 4MIWA 1WHYA 3D6MB 4KSEB 2ZHBA 3RRGA 3ZZ0A 4LVOP 3AJDA 3W2VB 3M8YA 4USUA 5KT2A 4A47A 2D9PA 3RBXA 3MCSA 3OL9A 3TVKA 4CP5A 3P5TL 4QPXA 3FEZA 3M8ZA 3SYZA 4CWBA 2CNKB 4EU0A 2QMXA 4MYTA 2J9DE 4NRUA 4ZK7M 1GTHA 3HHKA 5IM0A 1HR0J 1CJVA 1RT4A 4FYYB 1GQEA 2CFXA 3TZYA 2O01C 2W24A 1NHUA 5EGYA 4JI3J 1WC6A 1U1PA 3DOLB 3BQ1A 3DLKA 3C66A 1HWUA 4C48A 1G4CA 4BC9A 3I32A 3WX4A 1C4AA 2ALYB 3G4SS 2SXLA 1PG5B 1VQNS 2ZC3A 1VQ7S 2YPYA 2IC3A 4ES2A 3D68A 3GIJA 4IOAQ 4ZDNA 4URSA 1U7LA 4NLOA 3E3XA 2YH0A 3QAEA 4LF6F 1N36J 4TYAA 3CC7S 1SL0A 1IKVB 3KK2B 1RWUA 2YY3A 3QZ8A 1RKJA 2D41A 2HZVA 3G87A 3WIUA 5HQLA 4LIRA 3LO3A 1GX6A 3ZZUA 3M6XA 3ITHB 2DRBA 3PKMA 4EWTA 4GKJJ 3F0NA 4R0JA 1N48A 1F3FA 3NMAA 3MUVP 2F40A 3C19A 2MKIA 1HNVB 3K5PA 3ET6A 3D5MA 5HATA 5JXSA 4J9UE 2CXEA 1RHJB 3KJFB 3O3LA 4L3KA 1BXNA 1UCNA 1ZZNA 4H54A 1VQLS 1LFPA 3ETOA 2HBZB 5KOWA 4Z7CA 1OY8A 1RWPB 1NSPA 4ED1A 4IFVA 2M52A 3KLFA 1SIWB 3GWCA 3EGNA 4USMA 3V81B 3NGRA 2QMUB 3TARA 4KHPJ 2Z57B 3ZXWA 1WOSA 1MU2B 2B9EA 2OMLA 5ADZA 2AT1B 3Q23A 4UOHA 2L3MA 1YJ9S 4A8YA 4TVAB 3L7PA 1Q16B 1DRZA 4I67A 3SDEB 1ELOA 2HGLA 4PWDA 2FLOA 2HHPA 2JEJA 2FHJD 3EM1A 4NLUA 1KLMB 1VCTA 2YNHA 3CCTA 4CDIA 1WHWA 1S9GA 1F60B 3KHGA 4NLYA 8AT1B 2WTFA 4B9SA 2AD9A 3MPWA 3RB3A 3W65A 1XIQA 1HQEB 1U09A 3PY8A 5LSOA 5A6WA 2OPPB 1FWPA 2FHOB 2OHDA 4PKDB 1R0CB 1X4FA 3KYLA 4KV8B 2B4OA 4IH6A 3NL0A 4YP3A 4QWBA 4DSIA 2EFPA 5HLFB 4J37A 3OPKA 2DNRA 4R8UA 2HBQB 2IHR1 1W26A 5I42A 1HBMA 2F63A 2VDIA 4OHYA 3BR8A 1YJUA 2KFZA 1FKPA 4ED4A 4OQJA 2BKNA 2HIYA 3GU0A 1ITPA 3D1QA 3Q86A 2FLNA 4RW9A 1YVFA 4OZNA 1L3VA 2MEWA 3I6PA 2DHXA 5EX3A 4KB7A 1S6QB 3NS7B 3H25A 3HX9A 2B5JB 3W1YC 3AFGA 3M2VA 2G0CA 1NXIA 4R5PB 3SCIE 4OZ0A 5DDPC 1MN9A 3E51A 2LMIA 4DPTA 1HQ2A 4Y2IA 2IAJA 3IA0A 3EDRB 5HI7A 1S4FA 1VQPS 3N6NA 2LQJA 4OZ5A 2MSTA 2QLFB 9ATCB 3TAQA 3FCVA 4B9LA 1TZ0A 1UA1A 3EMTA 1M90T 4AE5A 5CD4A 2HQ3A 4LR8A 2QL5B 4W90B 5IV3A 2J0WA 3SCJE 2IM1A 4H4MB 1WSRA 2J6SA 5ETVA 1LFWA 1B70B 4ANDA 4LVNP 2CZ9A 2IFXA 2QFIA 2QGFB 2X1BA 4CLKA 4LF7J 2QLXA 4LF8F 5BYRA 2P2CB 1TV6A 2XS7A 3ZZTA 1CJTA 2VC0A 3N6MA 2RDJA 1MMLA 3MMAB 4FBTA 1UJ4A 2LDIA 4DV5F 1RBAA 4C11A 2XWYA 1VHIA 2G2ZA 1JLBA 4TQRA 2ERRA 3SFGA 2QEXS 4K4SA 1M5KC 1HBNA 2BVZA 4P7VA 1T9UA 1D9FA 3LPEA 1FVSA 4RU9A 2EK1A 4QIFA 3ISNC 3BV8A 1WI8A 1OIAA 1IKWB 4N8OA 5IC4B 2YKQA 3VGSA 4OV6A 2WOMB 2CPEA 4ZVUB 2CA9A 1HLWA 3W9JA 5DZ7A 2GO9A 4KIAA 2N3LA 4DSEA 2LXFA 1DJ0A 2APOA 3QAUA 5HL7Q 5B7WA 4M5KA 1APSA 1RHRB 2DYAA 4FXVA 1N6QB 1R0BG 4KQZA 4MFBB 4EK2A 2IA6A 2VFRA 1FNOA 1V5VA 5AE2A 2ADCA 2EFQA 1C1BA 4M5NA 1VQ6S 2G2OA 5G0RA 4OYZA 4X4RA 4FYDA 3M4XA 2IRUA 1RAJA 3TR5A 2KT2A 1WG5A 1VLOA 4J9SA 5HQ8A 1WF1A 1TL3A 3PYGA 4Y2CA 2DNLA 1RTDA 3R6GB 4L73A 4O4RA 3ZTOA 3OR2A 2C3MA 3AXMA 1RCXB 3R7BB 2DNGA 2OEMA 3LGNA 3M7VA 5GAGI 2LQ9A 4BWJA 5DRKA 2HZAA 1XNRF 2V4RA 4ECUA 3V4IA 3T41A 4X84A 4N56A 1U24A 1T3OA 3NMRA 4ES1A 1WDDA 3CMAS 4U7CA 1I94J 4XPCA 1SKUB 2Y8YA 3DLLQ 1T7PA 3P8BB 1R8HA 4DV7F 2MPUA 5D4PA 1FEHA 1TUGB 1T03A 3GG1A 4ALZA 1YSJA 3PCOB 2VASA 3AODA 2UUAF 2FB0A 4RW7A 4B3MJ 4KO0A 1KNZA 2CJYB 3GB0A 2ILZA 2MQMA 2V4JA 2Y3YA 3DOKB 3VGUA 4TU8A 4GMKA 1EIYB 1UW4A 2MZJA 1QVGR 3S7RA 1LWCA 4KFBB 3R1LA 3IBFB 1FRXA 5U47A 4IRKA 4YS2A 3MM6A 3M8QB 4ZCLA 1RHKB 2D3O1 1O51A 2DO0A 2E1AA 3OHAA 1N8RT 1YRUA 2Z58B 5FIIA 4K5SA 4WXWA 2DCUB 1T05B 4M5JA 2ZBCA 3QT6A 2A3JA 2HVIA 1U6ZA 1QTNB 2JDJA 2CJQA 2ASDA 4QIVA 1FVQA 3T1YF 1N88A 3C14B 5L1IA 3UR0A 2GIFA 2DBBA 1TUVA 4IYQA 4J9OA 2LEBA 5LMUJ 3UQSA 4HYKA 1N54B 3R2CJ 2FGOA 2BM0A 3PV8A 3MECB 2JLGA 1HNIB 1U8SA 2H54B 3EDQB 3FMBA 2H4WB 2OTLS 1NNDA 4LSNA 3KJNB 5B0EA 5GADI 3PXGa 1WACA 3LANA 1C0TB 2OEKA 4LR7A 3GJTB 4X65F 4KKOB 2RUGA 1JKHA 3ZO7A 2ASYA 4O3RA 5KFGA 4B9UA 3HZGA 3RR7A 3J7ZT 1RTIA 1I1GA 1NKCA 4OZJA 2XB2D 2XI2A 2PEHA 1RGVA 4I2QA 1BC6A 2UU9J 4K4YA 3M32A 1SL1A 1QD1A 3U1NA 3N5BA 1RT6A 1SJ4P 1FESA 5E7OB 3OR1A 4USWA 3IBWA 1KTVA 5IQQA 2BRLA 1HL6A 2MZRA 1VRQC 2L9NA 2RT3A 1VK3A 2VH7A 2UZAA 3ONQA 1QUVA 4KGMA 4XTTA 2K06A 5BYSA 1HBOB 1RAOA 2W9BB 1DY3A 2LU1A 4ZVTB 3W60A 3TUZC 1CLFA 5FD1A 1RJJA 2FVQA 2EC2A 4WFNQ 3RJMB 1OY6A 4BS2A 4EI2A 2PSZA 2VBXA 4FN5A 3E01A 2AYGA 1TL1B 4NLQA 4DFJA 3V6KA 1UVNA 1Y10A 3R3TA 3QLHB 2Q66A 2MMYA 7FDRA 1MG7A 1PYSB 2ZH5A 3MZIA 2FVPA 4LF5F 2F8MA 4CTAB 5DM7Q 3V6DA 1U2CA 3PO4A 2E1CA 5C2GA 3QRRA 4QBUA 1UWBA 4NASA 4U95A 4IFYA 3DFEA 4PG6A 4FF4A 2GQCA 1FTCA 1YHQS 3Q83A 1NDLA 2GCFA 2JSXA 2YVSA 3VZIA 3A8JA 4RUHA 3EZOA 2J8SA 1S76D 1WNEA 1NU4A 2CQCA 4KY3A 1OS5A 4F0KA 1TU0B 4I2PA 1KVIA 3IAM9 1FERA 2X1GA 4JI8F 4DR7J 3MURP 2VG7A 2BQ3A 3CTRA 3T5HA 3C46A 3MEGB 4QIGA 2GHPA 2UUAJ 1D1UA 1G3OA 3HSJA 3RGIA 4YHHF 4ZKAA 3MTKA 2GS8A 3KJVB 1IKYB 2PMWA 3DGVA 3D66A 2ZBIA 3BPSP 3CWJA 1R27B 1N32F 2NPFA 4TY8B 5GAGU 3KTQA 2GHVC 2DGTA 3BSOA 2CZVC 2WZ1A 3H5UA 3RAXA 1SQGA 3T9NA 3PR5B 4FPIA 4LF4J 2F4FA 3RZAA 3NS6A 4NA1A 4NXNJ 2KU7A 4I0WA 2DRAA 5IFMA 3T3FA 3CULA 3THVA 1RAAB 2CQ4A 1S7IA 2MZSA 4DXLA 3PEJA 3MUMP 2FQQB 5GVQA 3QGHA 4EYHB 2GNKA 1X0PA 3CDEA 2A6OA 1VQ9S 3LP1B 1NJZA 2DNPA 3K57A 4MIBA 1B64A 4IO1A 1KHVA 1P1TA 1HYSB 3OL8A 3KK2A 2NS1B 4HH0A 2LQ8A 1KRPA 3DM2B 1VRTA 2KFYA 2QLWA 2GJIA 4YY3F 2CG8A 3ITHA 2KH9A 4ED8A 4M1KA 4NE9C 2RAQA 3R9LA 1H72C 4AXIA 1NRKA 2DPJA 5DQIA 1BD6A 4ZA1A 5HROB 2PN6A 1WC4A 2XMTA 2XWXA 2PDAA 1B4SA 2ASLA 1RAEB 4WYWA 2U1AA 4CO0A 3CCUS 4TU7A 3VAIA 4PR6A 3LW5C 5ETMA 1DQ9A 3S6EA 1VJQA 4CZCA 2HHQA 1IR2A 1IJFB 1S59A 1B7FA 2ZOGA 1HA1A 3OQ2A 2EXUA 1MW7A 1BGXT 3V81A 3CEDA 1FRMA 2AEJA 4ZVEA 1X9MA 1MU2A 1UEVA 4I64A 1AUSL 1TL7B 3T6JA 1HNWF 2W4CA 5BXIA 2DXDA 4A46A 1F9HA 2DB1A 1XTZA 2KKHA 3EWGA 4G3IA 2Y1RI 3Q8UA 3SDEA 2HVEA 4HACB 3N28A 4Y2AA 1KLMA 5D0GA 2BW7A 2HHWA 3M2RB 1WDTA 5KFTA 3NRBA 5GADU 4CCHA 1NZ8A 1Q79A 4F4ZA 2RH3A 5HP1A 4OJHA 4FKXA 2K3IA 4X64J 4P2FA 1HW9A 4ES3A 1GMWD 3B6BA 2OPPA 4P2SA 3HVWA 2JH3A 4DL3A 3OFEA 5DG8A 2OD4A 4DPWA 1D9DA 2J5AA 4F4YA 3NGSA 3IWLA 4C0HA 5HLFA 2FZKB 4LFBJ 3AHPA 3EXCX 2FJBB 5ETQA 1Q8IA 1QM9A 3X1LB 3VAKA 3PW4A 1T0TV 1ZM2A 1Y3KA 3HD1A 2VKRA 2HSEB 4DR6F 1FO1A 3IGNA 1T9TA 3M8SA 2RRAA 5K9FA 4RBVA 5E33A 3IP0A 2E5LF 3D2WA 3BN7A 3DKDA 3WC0A 3QIDA 5G4DA 1SJ1A 4CLYA 4AT1B 1S6QA 1HNXF 2ABYA 4B3TJ 5E3PA 1JLCA 1VI7A 1IR0A 4JI2F 2ACYA 5D3GB 2B5JA 5HMWA 1FNMA 1S0OA 8RUCA 2ZJQQ 2IBKA 4R5PA 4ECWA 3JYTA 4C8YA 4F0MA 3KG4A 3QJPA 1N32J 2BJ3A 2ZD1B 1U1QA 5F8LA 2XS2A 3N79A 4OYPA 5DLGA 4WXOA 2P9CA 4WK3A 5KT4A 2DXEA 3KLIB 3KJQB 2AYEA 1EHWA 2BABA 3FFIB 2OGUA 1DFDA 4NZ7A 5MLCV 4ZCIA 4FS2A 2L08A 1UMJA 3E8OA 2O1PA 1SIZA 4H4MA 1S79A 2WW8A 4ZPAA 1RZMA 4QPTA 1FDAA 3LWMA 3SQOP 1LW2B 4OX8A 2EWHA 5H1SV 2BJEA 3T1AA 2XLJA 3OD2A 3R5AA 2BYCA 5H9EJ 3D0IE 3W7BA 3QFWA 3ENQA 1R0AB 4A8WA 1WTBA 3T6BA 2CRLA 4WU2A 4YMEA 4JI0J 4K4TA 5AJ3J 5LMNF 3OBIA 1GFWB 3HVTB 4KC5A 4WFYA 4C8KA 3CCWA 3US5A 3IS9B 1YI2S 4C6AA 3CDAA 2HWIA 1IKWA 3IR5B 4ZIVA 4M94A 2M9KA 4NRTA 2WOMA 4DV0J 3VAFA 2MJUA 2W4DA 2B9YA 1U0HB 1FRIA 4EUVA 4JV1A 4ZVGA 3C16B 2DNKA 2IY5B 4DV3J 2PIIA 1N6QA 3GJRB 2GMJA 4ECZA 3AJ1A 3LPYA 3RUBL 1EETB 4MFBA 4Y3CA 4LSLB 1HBUA 5J2MA 2QTWA 4IH5A 1H0HB 4UT4A 1RISA 2QSWA 5KFVA 1BWEA 2ATCB 2KJWA 4DMZA 4P2XA 4DSFA 4ZHRA 1DQAA 2IRXA 4CT8A 4PQAA 4DV6F 3H4DA 1URNA 4EFAC 1T8EA 1WORA 5GMEA 2Y1JA 3Q2SC 4Q5VA 4EBEA 4U96A 3NKYA 2K1RB 4BHQA 1Y11A 4GKKJ 1PYTA 4H4OB 1VS3A 3M30B 5B08A 4DQQA 2VF3A 3WIVA 3IAS9 1RUSA 3GSIA 1FJCA 1RHMB 2HLTA 1JNZB 5DQGA 1IBMF 1XMBA 3OTOF 3D3BJ 3D0GE 2B6AB 3ISND 4DUTA 2BKPA 5A8RB 3GLJA 4CLTA 4K5RA 3PFEA 4JV5J 3FCWA 5L1LA 3DRSB 4V19J 1KWMA 4OI3A 3I4HX 2MZ1A 1UZHA 1L3KA 3UCGA 4YEAA 1GH8A 3I87A 2XY6A 1J5OB 3MUTP 2ZJPQ 4PABA 2CPHA 1IKXB 2VODA 3GMGA 3OVBA 3K17A 4IOCQ 1HW8A 1A7GE 1YJNS 3FSXA 1WELA 2YWKA 3JSRA 4HI1A 3ICLA 2NZCA 4QR2A 3GQCA 1N34J 1FJGJ 3PM9A 1RYRA 2RHQB 2OMOA 5KG6A 4JOUA 2RQMA 4K4VA 2YKNB 3G86A 2VBWA 5HVGA 1OQ3A 2DT9A 2IM0A 5J2NB 5DG9A 3OW2R 4LRFA 2JFKA 2BE2B 5KFMA 3UDVA 2LVWA 1SKSA 3J7A1 1PKUA 3ZTSA 4F0HA 3C14A 2MY7A 2XYPB 3G6YA 2E29A 2XZDB 4KBIA 2VQEJ 3QQCD 1RT1B 4X4VA 2WVFA 2YKPA 2MKJA 1HNIA 2MLZA 3MEDB 1R8PA 2W25A 4O3OA 4LFCJ 4DU8A 1Q7LB 1RDRA 2NZ4A 4AL7A 2AW0A 3T5LA 3WBZA 1Y00A 2V34A 2KB2A 1NB2A 4WP9A 7FD1A 2OFHX 4FP9A 1YJVA 4Z7YA 1E6VB 4F4XA 4C0OC 3EGVA 4KKOA 1JLGB 3DLGA 4N76A 2FHMA 3PDNA 4ICLB 3H2UB 3MR7A 2NYHA 2V67A 3D1OA 3M1VB 3UN3A 3IR6B 4KH1B 2DNNA 1ZH5A 4NLRA 1SB6A 3MF5A 2Z0GA 1ZA1B 4YN3B 3NP5A 4RX6A 2ALZA 1L3SA 4CM0A 3AOBA 1U8WA 1X5TA 1SC3B 4HLBA 3LP2B 3RU0A 2PE8A 3TA2A 2IJNA 4ZPDA 3M9NB 5EWFA 3DI6A 3SXLA 4X4SA 1HBOA 1UFKA 4OYMA 1F1BB 5EN1A 3K5MA 5ETOA 1MMDA 4J9LA 4KHRA 1KQSR 1KFSA 3DRXA 1N52B 2CJ9A 3GIIA 2KT3A 2HHHF 2DTJA 3QSIA 1TL1A 3SCKE 2BXJA 5F0UA 2G13A 3DOMB 5H9FJ 2E9ZA 3LA0A 3QLHA 5IT0A 3GCXP 4PQUA 2KG0A 1NK5A 1WI6A 3UVJB 1DURA 5KFCA 2VA2A 4CTAA 1NH8A 2HNDB 1T9WA 1LWXA 5RUBA 2QYCA 2AX1A 1X31C 2VD3A 5GMKa 4HEA9 5HK4A 2UVRA 4KGXB 4OX9F 2W9CB 3OTEA 4JI7F 5IXUA 1RYSA 4ILMA 5FLXU 3IMQJ 3MM9A 4PPDA 1RTJB 4CM2A 2E5JA 4UW2A 1JWWA 2NXCA 3BQ2A 3RR8A 2DGXA 3HI9A 3QFHA 4JI6F 3NGDA 3HULA 4P6QA 4Y65A 4PUOB 1SQEA 2HFOA 2FVSA 1U6BA 1O0PA 4O3QA 2O67A 4N5SA 1U2RA 4UF4A 1LNQA 2CQIA 4CLZA 2NXNA 3W3SA 3JTPA 1U48A 2R42A 1EAYC 1TTHB 2P6SA 1DBDA 3TJAA 4J9NA 3UO0A 4GRSA 1JJCB 2DRDA 2VIHA 5KG3A 4TY8A 1HD0A 4I1TA 5KFKA 1SJQA 1J5EJ 5L39A 2VHGA 3T9ZA 2EEYA 2GQ2A 3CC2S 4DF8A 5BR8F 5HQMA 2RSQA 2V8GA 1OPIA 2J0XA 3QSYB 3B54A 1WC0A 4FVCA 3TUIC 4RW6B 5IWAJ 4EZ6A 3TEGA 2F8EX 1OQ6A 1HPZA 5CQGA 2XCAA 4O3SA 1TK8A 3L9ZA 4CO2A 4RW8B 1CG2A 1LWEB 3DC2A 1SC1B 4MH8A 1ZPWX 1NHVA 3DHWC 4ZPCA 4DSKA 1AA1B 3C6TB 3K0JA 3T5KA 1HYSA 4F4AA 3MMCA 5ETTA 4DEZA 4UQGA 1EKRA 3DM2A 3BBCA 2FGCA 3I5CA 2ZM6J 1ULRA 1Q95G 2XI3A 2XG8A 4YB6A 2AQ4A 1I3OB 3QO9B 5KOXA 4ECRA 1KLNA 1RT2B 5HROA 4DR3F 3MMBB 3LQVA 2QV6A 2CPZA 3CSKA 2V94A 3L09A 4NOHA 4BDPA 1H73A 5A8KA 1VRUA 2PFFB 2V8DA 3MM7B 4IR9A 2ZNZA 1HI1A 4A8SA 4XAKA 1Z2LA 1WEXA 3PG9A 4EBCA 1DTTB 2C28A 1UJ5A 1R6YA 3AJ2A 3ZC4A 1TL7A 4PAAA 4NLPA 1KTQA 5IOLA 1Q7YT 2GIRA 4HACA 3BO3A 3CMES 4K8RA 1MWZA 5HBMB 4OYIA 5D0EA 2DJWA 2XS5A 8ATCB 4J9VA 1Q86T 3TX8A 3DDIA 4B3SF 3UDEA 4FYVB 1U2FA 4QYZJ 2JRSA 4DSLA 4OHXA 2R7SA 1IBLF 2U2FA 4I56A 1HNZF 2CPIA 4P73A 1BQNB 4LFAJ 1RE1B 3DU6A 5SUHA 1S0VA 4MTPA 3L95X 5CAAA 4GO7X 1V6HA 3A8KA 2E5IA 2WVBA 3GFXA 2QA1A 4DG1A 4XDCA 1EX8A 1QVFR 2QFJA 5KFPA 2YX1A 4HL9A 4CI0B 2F4VJ 1SUQB 2R8GA 2YKMB 1C0UB 1VHFA 3DNCA 1RWXB 2KN4A 4HR2A 4DFPA 3O1LA 2QL9B 2X3GA 2HW3A 2G0JA 1JQGA 4X4NA 5HAOA 3RBZA 2CPXA 2UUCJ 2BANB 3KLHB 1CC7A 3FBBA 1KBRA 3H5SA 1ZZFA 2F65A 3VGVA 2NLWA 3CCZA 4JI1J 3D6HB 3HHLB 4AUKA 4A48A 4Y0FA 3CB4A 2VONA 2C2KB 3TZWA 4CLPA 3RAQA 3EPIA 1V3SA 3RAMA 3PO5A 4A8XA 3I9V9 2GJ2A 4U8VA 2VG6B 4MKAA 3QYYA 4QU7A 5D3GA 4A8MP 4DV2J 3MR5A 4DR2J 5HN0A 3UD5A 5C25A 4W4MA 2GQQA 2CDQA 4Y28C 3D4JA 2OD6A 3DCAA 2HHSA 1SC4B 2C2EA 3SSSA 5B0AA 2M2BA 2XNRA 3FUYA 2W2MP 5C5JA 2KFNA 5A76A 5CABA 2ZBPA 4OL8A 4YFUA 1VQ4S 2HQFA 1BQMB 2NSCA 1RTHA 1JXEA 1IWGA 4DQPA 2YQ3A 2FDNA 2YNIA 3OV7A 5FLXY 3HF5A 3S1TA 2QMWA 1YBTA 1S6PB 1GTEA 2DGSA 2DNMA 1YJ7A 2VPYB 3KWMA 2GV1A 2N3OA 3CPWR 1IQTA 5L9XA 1RAIB 1NZAA 2UP1A 2QJ3A 2YQ1A 3VAMA 5CXTA 4DQRA 1N33J 1QSSA 1RP5A 2RJZA 4NMXA 3MM5B 4RW4B 1NJWA 1XMQJ 4ZITA 1LW2A 5ETNA 2BKOA 3CUNA 4M5IA 2V9KA 1R0AA 3FZ2A 2MXYA 1FRJA 2C3PA 3QMQA 4QIWD 2VU5A 4DV1F 3VTIA 4WIIA 3DLJA 3VCDA 2RS8A 1RLCL 4L6V3 2XLKA 4USHA 3MPVA 1HI8A 1H2VZ 4YR2A 3A12A 2MB0B 2UV8A 2EKNA 4DS4A 4C3KA 3G9CA 2ZUGA 3EVOA 1KQFB 5B09A 1U0HA 2I6WA 4ZVQB 4TQSA 3H42A 2UXCF 4L72B 4FDFA 2VG5A 1EETA 4LSLA 5F41A 2GAGC 4DI6A 2M3DA 1K0TA 4CNYA 5LSLA 5M2RA 2ZZTA 1VC0A 2N7YA 2OKQA 4DWIA 3GR0A 4IOBA 4K50A 2WVCA 1JJ2R 4NL5A 2A2CA 2MYFA 2VFTA 2XULA 3FSYA 3PJWA 2LXUA 3UCZP 3IBCB 4GC6A 2JC0A 5JVGQ 2KM8B 2EFGA 5F8IA 1S1WB 3FKBA 1J27A 2K1RA 3HCXA 2VOPA 1ZA2B 4H4OA 1IJEB 4JYAJ 5KFIA 3M30A 2ZUAA 2DY1A 2F5GA 1S77D 2DNYA 2HNYA 3TUPA 2V69A 1DTQB 1WSVA 4JI3F 1GMWA 2GVDB 4AL5A 4JV2A 4P2MA 2V2KA 2VB6A 1N4LA 1VQYA 4EMDA 5KAKA 4PCQA 3THPA 2C2RA 2RF2A 1X4HA 2B6AA 5I3UB 1S1UB 1FCAA 1C1CA 1PYOB 3HSDA 1WD6A 5A8RA 2PO4A 1T9VA 1Y9OA 4I7FB 2K2PA 3DRSA 4ECQA 3QRPA 1U4BA 3ILJA 3Q8SB 2QA4S 4IR1A 1HWKA 1N36F 2W7PA 1B7YB 4ZPVR 2VKZG 4E8UA 1J5OA 1NM2A 5DETA 3MM8A 4V19X 2CPFA 3KLGB 2HYIB 5F8GA 4AFFA 2HLUA 1JXLA 1KDNA 2IM3A 1RT5A 4Z37A 3SCLE 3VHQA 3MOZA 4WP3A 1NBEB 1PBUA 4DCPB 2B4PA 4N7TA 2B7CB 4YOEA 3BO2A 3FK4A 4DUYJ 2IVFB 3ZZOA 5J1NA 5EWGA 2IVYA 4F36A 2KVIA 4MAKA 2HNZB 5K8OA 2XMKA 1WF0A 2CJKA 2J0SD 2B7BB 2HWHA 4C7QA 4IQMA 2YNFB 3PACA 2F1FA 2YKOA 5J2NA 4ZOSA 5AE1A 2HGMA 1NHKL 2EC0A 3C15B 2LFVA 2BE2A 3GV5B 1WOPA 1M1KT 2LLZA 2R3VA 1YBAA 3U27A 3M6WA 2VQFJ 1TUWA 4ZN1A 1H98A 3QJJA 2OPQB 1RT1A 4D3HA 2FIUA 4KHPF 2HS4A 4O4GB 1FKOB 3MEDA 2XO7A 4YB5A 3J80U 1ROFA 3OVAA 4GVLA 2CIMA 2QN6B 1XMOJ 3GJSB 5D4LA 2HFNA 2F3JA 2KZMA 3PX6A 5KFHA 1U25A 2H5JB 2BMBA 4MIAA 2KTQA 1JLGA 1CPZA 5T14A 1MWQA 5LJ3Y 2EPIA 2JLFA 1NK6A 4HTJA 4CNZA 2ZDPA 1RAGB 1VQOS 3IG1B 1U47A 3HJVA 1LK7A 2PI4A 2N82B 1GEHA 1X9SA 2DR6A 3BM7A 1JJHA 4F25A 2DGVA 3PRDA 1SCJB 3OTDA 4IH7A 3RB4A 3FBEA 2AWZA 1NAQA 1JLAB 3FMWA 1GXTA 2ZOFA 1FWLA 1JXVA 4FYXB 1V3ZA 2GC8A 3NS5A 2ZWPA 2UVUA 3FEYB 2AJ2A 2CG4A 3N5FA 5F0WA 1ACMB 3K7RA 3MPYA 2DHGA 4PRFA 3L7UA 3EX7B 1OWXA 1WUUA 3R7SB 3QGPA 4WTOB 2R2RA 4OIXA 5DZ6A 3QZ7A 1WC3A 2NCKL 2AEMA 4DR4J 3DOMA 4NXMJ 3H2VE 3CJTA 1QAYA 5J1EB 3I55S 2ZBRA 1H3DA 1FRLA 2DY9A 2AZ3A 4N77A 1H38A 3UVJA 1KVKA 2J7KA 4GO5X 1IQZA 4PG8A 1RBOB 2DK2A 1REVA 4ERDA 2F8HA 2ZH9A 4C3LA 4K7QA 4OHZA 1H6KX 4NYPA 1Y7PA 5D8HB 2GGPB 4JI5J 4BLGA 4RBUA 2PFDA 2V8PA 3VGTA 2WCXA 3G82B 3DYAB 4FKYA 5M2UA 2CPYA 1S12A 1QY7A 3M8PB 4TLRA 2CQGA 2R8IA 2DISA 4PUOA 2UVWA 2HQGA 2Q43A 4NYZA 3JB9k 2RNEA 5A6PA 4OJGA 2CJXB 3U7JA 4ED5A 2YX4A 4WZQA 2HWTA 1UFLA 4CRJA 2V9WA 1FXLA 1TR0A 4B3OB 4LF7F 1JMTA 3BYPA 4ZLJA 4ZJQA 2CNOB 4ANCA 2QZ8A 1FXDA 3UD4P 1H2TZ 1YGYA 1OYEA 1PBAA 1YKWA 3BGOP 4QIEA 2CQ0A 4M5LA 3QT8A 3JSMB 3IRXB 1R89A 4ECTA 1CVJA 3OFFA 3NNCA 4U8YA 4RW6A 4WE1B 3F44A 2KZZA 1ZM9A 1JLFA 2ZBQA 5AE3A 1CQMA 3IXQA 3PW5A 3AA8A 2C22A 3DXBA 2ZNYA 1XNQJ 1LWEA 2ADBA 3D0HE 1JK9B 2M88A 5AXKA 2WHOA 3KXDA 4IRDA 1MN7A 1DQ8A 5J2PB 2D3OR 3C6TA 4CO1A 2AHOB 4O44B 5ETLA 1LXNA 2HFZA 1VLYA 5BJRA 3GJQB 3GPAA 2HFVA 4B9NA 2M4MA 2C2DA 3KLEB 2NXUA 2ROGA 1S1XB 2OJ3A 5CZXA 1EQ0A 4NCGB 1YDLA 4G1IA 4F8RA 1SBRA 2R8JA 1F9FA 3QO9A 3MR2A 2XSJB 2ZH2A 1ZYQA 4OYXA 5KG0A 4U7UK 2MHEA 3AAWB 2IC3B 4DOZA 1S49A 2A6MA 4N41A 2R7RA 4K4UA 1UPPA 3JTNA 3MM7A 1NB7A 2NSBA 2YWWA 4YUDA 1RA6A 3MI7X 2J9DA 2AJQA 5FJ4A 1DTTA 1SKWA 1I94F 2FY1A 4I69A 3MFIA 1S6UA 1U1MA 2HS0A 1HMVB 2AZ1A 3G6ES 3Q89A 3HO1A 4QWEA 1YITS 2UUBJ 3BREA 1LOUA 3VVTA 2KT5A 1KFDA 4DJBA 4Y34A 5HBMA 3BDEA 1R7IA 3J80Y 1FK9A 2HRTA 4B3MF 2ZH7A 1F6TA 2MLXA 1SV5B 4KGKA 1GNKA 4DR1F 2MDAA 4NPOA 1U1OA 4JP8A 4G1QA 2EFVA 4IFVB 3KLFB 3HMJG 1BQNA 3AT1B 5SZTA 1CJUA 3L4BC 2M8DB 3UPFA 3BSAA 4K4ZA 4WFBQ 4DQIA 2BX6A 2YWEA 3TANA 1AXQA 1VGYA 2BOAA 3PEHA 4NEYA 3UCUP 4FS1A 2XBPA 3VV2B 2RQ4A 3R5DA 1NSQA 3BS9A 1SUQA 2YKMA 1C0UA 2B4UA 3HK2A 5CA5A 3CJSA 2CUYA 1RQ0A 3OUYA 3PW2A 4F2SA 3PHTA 3BGRB 5F3TA 1NKBA 1DLOB 2BANA 3KLHA 3B8HA 3UR3C 1FEEA 1VBXA 5LMUF 5KT6A 3FCHA 4ZJLA 2JHEA 3KMSA 4J9KA 1W25A 3UN5A 1FT8A 2UUWA 1SQFA 3WX8A 1HFEL 2C3UA 2VG6A 3LAMA 3CJQA 3WDOA 2LU2A 2VC1A 2BW2A 3CIMA 2RIJA 2AF6A 3CNQP 2OPSA 1RI7A 2C2MB 1S9FA 5I42B 2V50A 3O8WA 4WF9Q 5L46A 1TAUA 3M9OB 1BQMA 3EJMA 2R7VA 3HP6A 5JMNA 2UU9F 2VA3A 3NAHA 1S6PA 3VZHA 3BKUA 4HHHA 3H4BA 1ZM4A 5CCLA 1RHUB 4IDKB 4G1PA 4GC7A 2BEFA 4RLEA 5EHHA 2EKYA 1FJ7A 2DGQA 1YZ7A 1Q5VA 4C98A 4QWAA 4CYUB 1NK9A 3MM5A 4CLUA 3C8YA 2YPZA 4RW4A 1U1LA 4ZCMA 1D8YA 2NXEA 2MKSA 1QJHA 4J9PA 3T1HJ 5DDQC 1FX4A 4ER8A 3I31A 4B9TA 2YXLA 3GCWP 5KTQA 1XBWA 2PT0A 1JLEB 1RXOB 5KFOA 4CLWA 3K5OA 4BCAA 4PWUA 3ILOA 1PAUB 3Q8YA 2K8GA 4C8OA 3AD8C 3M9MB 5THWA 4DBQA 1RT3B 2FVCA 3R1HA 1S57A 3PJ9A 2AJFE 3AOAA 1G6BA 2E1MC 3ZNJ1 1RWOB 1MNEA 3W66A 3C3LA 4EO8A 2MKYA 3I4PA 1KQGB 4ED7A 1N5SA 1AZSB 2FZGB 3DLEB 4FF1A 3Q22A 1XR7A 4UQTA 1K8AT 1S1TB 1NSAA 4N8NA 5KFYA 2J0QD 4X4TA 1CJTB 4RPFA 3LTOA 2CYYA 2MKKA 1KVJA 1UVLA 1VDHA 2OEJA 4DR7F 1BLUA 1P27B 1VYAA 4ZMMA 4LRCA 2LQBA 5F8JA 3SFUA 4MK9A 1S10A 1SVDA 3DGPB 1ZOTA 5I4MA 1FNXH 3CD5A 3H2LA 2ZC4A 1T94A 1X4DA 2JOQA 4DR1J 2H48B 2IDEA 2DHSA 3PNIA 1S9EB 5AXNA 2B8QA 3Q8VA 3PKYA 1DTQA 3CMQA 4OHWA 3L3CA 2H65B 4M95A 3RRHA 4LF4F 4Y6IA 2I5JB 1YK9A 1C1BB 3D28A 2XQCA 4NXNF 5I3UA 1T9XA 4DPOA 2POKA 1KN6A 1X4EA 1TL3B 5D0RA 3B4DA 2ZZMA 3FEXB 2Z4PA 3EGWB 4G65A 4I7FA 3KKFA 6AT1B 3MEEA 4USJC 2HVDA 3Q8RB 2IA0A 2CQ3A 4NLVA 2DH8A 4K0KJ 4X4UA 2CJBA 4B3RJ 1V3RA 1N5TA 4DV4J 3H59A 3AA9A 3U1LA 3G8SA 1Q4RA 4TN2A 1O8BA 1IR1A 2VZ9A 3MPDA 2WVEA 4H4KA 3P5BP 2DIVA 3V6HA 4UZCA 3JSYA 4LF9J 4U6PA 2YNFA 4ZLNA 2EBEA 2V8HA 1RAFB 2CPDA 4X62J 4RW7B 4ZP8A 3NBPA 1N5YA 3GYNA 4P9SA 4XO0A 2V4JB 2E44A 1V9OA 2OPQA 3LUYA 2XYGB 5AT1B 2XGPA 1FFWB 2PA3A 3W9HA 1FKOA 3EICA 3BZQA 3MM6B 4CLLA 3KHHA 2PGCA 3HSGA 4OJ3A 4DUZJ 1U6FA 4ZPTR 2XTJP 4U67Q 3W2WA 3NY0A 3R97A 3GILA 3G6XA 2V8VA 5HMYA 3SQGB 2CWKA 1FF2A 2BUNA 1PAEX 3TUJC 4HT7A 4F2RA 2AIRB 1DZ5A 1NLKL 4K59A 4LF1A 2FVRA 1TVRA 3QPIA 5KFXA 1HHQA 2J9EA 1VC5A 4P71A 4X64F 2X51A 3EXYA 5T41A 2LKZA 2ZWOA 3DMJB 3CCJS 3IG1A 3QT7A 1SJFA 2CPJA 5CYMA 2RQKA 1VR6A 4ZS6A 1U1KA 3P45B 1TKTB 2CQHA 4LFBF 1IBKJ 4QZVB 2YKAA 3CDBA 3CCLS 2MTLA 5F8HA 1RTZA 5KFLA 3RW7A 3GIRA 1JLAA 3GTYX 2HMIB 2AGPA 5E3CA 4DCOB 4DL7A 5KFFA 3RW6A 2M0GB 5B0BA 2MQQA 4TLQA 2P6TA 4CT9A 2NQPA 1O6XA 2L41A 1VMBA 4J91A 5KFJA 2OSRA 3H90A 1F5BA 3IR7B 2JLEA 3BB5A 1TELA 3OL7A 3UN2A 2J9CA 5KFSA 3M32B 5T7LB 2J6TA 3EVWA 3HHDA 5J1EA 2HURA 3W2VA 4OI4A 1YRTA 4DR5J 4B3TF 4CLFA 1X4CA 4HHJA 1WOOA 1B0TA 3G96A 1X7VA 2KXFA 2OLWA 4Y2KA 3RYLA 1HWLA 1WC5A 3L7OA 4DX7A 4DHVA 3J81j 2HBRB 3TVZA 2ZFHA 5KFBA 2N4DA 4NCAA 2C2ZB 2VFSA 2R4FA 4ZLPA 5J1PA 2AJ4A 3PYFA 1W7WA 1BHNA 3CGIA 3G82A 3DYAA 2FC9A 3DOLA 4WKYA 2Z2YB 3E01B 3M8PA 3GV8B 2HFUA 3LALA 1O5JA 7AT1B 1S0MA 2ZZNA 1WTFA 1YRXA 2XHWA 5J2QB 1GXUA 3WC2A 3JTOA 2WRMA 3QBCA 3NCPA 1D9AA 4JBCA 4FVMA 3V6DB 2KM8C 3G6VA 5HJYA 3HKWA 3PIOQ 4DX5A 2UXDJ 4B3OA 2Y0BB 4A8KA 4IG0B 1J2VA 4WFXA 4OZ1A 3SMZA 1IKVA 3BN4A 3FBFA 4WWSA 3ULHA 1KEKA 2LXIA 3W9IA 1WG1A 1GT8A 4JI0F 3ENWA 3JSMA 5AJ3F 3IRXA 2HQIA 4I4BA 1G7CB 1KR4A 1ZTWA 1AFIA 4JI4J 2RMLA 4WE1A 3GP9A 4I2PB 4ENOA 2VFUA 3A3PB 1WWHA 1HNVA 1NEEA 4WZMA 2VG7B 3GIMA 4DV0F 3NGTA 4ECVA 3OTCA 3J7AN 2BACA 3CE8A 5J2PA 3RBEA 5ETRA 4M63A 4O44A 1NUEA 4DV3F 3LWLA 1VQ5S 1S72S 3GE9A 2B9XA 3HFVA 3OHBA 3C6UB 4X66J 3KLEA 2UXBJ 1S1XA 4QW8A 3CJ2A 4H4KC 1PCAA 4NCGA 1H74A 2V5HG 4XDDA 3H5XA 2LEAA 2K7KA 4NMLA 2G2YA 4F7VA 3TQEA 3I0SB 2XSJA 3FRYA 2LEPA 2MQNA 4ZP9A 3SBMA 1EP4B 4Q7AA 2XYHB 3NCRA 2W01A 4GKKF 4IG3B 5LM7E 2Y1LB 3MDFA 1EZZB 1HQEA 5JUMA 2D3UA 2DEIA 4ZVOB 2FC8A 2R7XA 5DLFA 3DLHA 4GVBB 1VRTB 4KV8A 5E5NA 1HMVA 4RUCA 3CJ5A 4G6VB 4DX8H 2M5YA 2AGOA 1TK0A 1QUPA 1M0SA 5LXRA 4URQU 4JV5F 2RKIB 3K5NA 2MSSA 5BYQA 3BH6B 5A0YB 3GONA 2JJ4D 2RRNA 1SV5A 3RG6A 1TMJA 3MOJB 3CCSS 1RA7A 2OFGX 3P96A 3D1HA 2R2TA 9RUBA 2KXNB 2WSFC 1MROB 3BGFA 1X5OA 3A13A 3G71S 1UP1A 2Z8QA 2W7AA 3J81U 1P1LA 5A2QU 3HT3A 2IYIA 2OI2A 2JX2A 3GSDA 4WU3A 2DHAA 1N34F 3A4TA 1FJGF 4FPRA 2RRBA 4DDFA 1B3TA 2C2NA 1DARA 3D6TB 2XMAA 2P5VA 1NKEA 5C2CA 4HH1A 4W92B 3DU5A 3FGVA 3CJRA 3IFEA 5IC6B 3R8YA 2E1RA 5LXYA 3BGRA 4OJ1A 2RU9A 3MHYA 2ZH3A 1DLOA 4ELTA 2R9LA 5HP1B 4OYBA 2VQEF 5IV4A 2J7UA 1LV5A 1F2GA 2M7SA 1RHQB 2FLPA 1VBYA 3POTB 2VPWB 2YH1A 1I51B 3N9UC 1WC1A 2GAHC 2VDHA 4LFCF 1CEZA 4IRCA 2RS2A 3TW0A 2XNQA 2ZVIA 1JX4A 2G1DA 1TAQA 1RWWB 2W9AA 2OPRB 3OLAA 1C4CA 3VWSA 1RT7B 4USIA 3AB2B 3I5BA 1HQUB 1QAJA 1S4EA 3KNAA 3H98A 2QL7B 2I8EA 1UJ6A 3B4MA 3TA0A 4WTYA 6FDRA 3J7Z5 2LECA 1JLQB 2HAIA 1PO6A 4M5DB 3HSZA 3MMAA 2JNJA 3DDNA 1RKIA 4LUBA 2VOOA 5E3QA 3GFYA 1VFJA 3ENVA 2DH7A 3HFKA 5KFWA 2HHUA 5C42B 3K5LA 2KG1A 4ECSA 1X5PA 4RR5A 4WBFA 4IDKA 4O0IA 4FXWA 2XMJA 3W64A 3HT0A 3CCES 4O3PA 2HIQA 2MGZB 1JLCB 3SSQA 2MZTA 4Q0BB 1Y5LB
chains in the Genus database with same CATH topology
5K14A 3V6DA 2HYIB 2J8AA 4QWDA 3IWNC 5F8GA 4AFFA 2HLUA 1JXLA 3HKZD 4WK1A 3SSRA 3TOQA 2IM3A 3PO4A 2E1CA 1RT5A 4KE5A 4QBUA 4Z37A 1UWBA 3SCLE 4E98A 4IFYA 3JYTB 3DFEA 3MOZA 4PG6A 4FF4A 2B4PA 2GQCA 3KLVA 1FTCA 4NLSA 2ROEA 2B7CB 4YOEA 4KAIA 3BO2A 2AGQA 1YHQS 4FNIA 3TO8A 2IVFB 3ZZOA 5J1NA 5EWGA 2IVYA 2RU3A 2GCFA 4Q2MA 2JSXA 2N7CA 2YVSA 4BC7A 4KR0B 3VZIA 4ETXA 3CF5Q 2KVIA 4RBTA 2HHXA 1UETA 1JLEA 4MAKA 5KG4A 2HNZB 4RUHA 5K8OA 2XMKA 1WF0A 2MQOA 2CJKA 2J0SD 2B7BB 2HWHA 2BA9A 3MEKA 4PWDB 3ZZRA 1S76D 1YTYA 1WNEA 4RWXA 4ZP7A 4C7QA 4IQMA 1NH7A 2YNFB 2F1FA 3PACA 4CH7A 1NU4A 3OFHA 2MQPA 2YKOA 3TAMB 2YNHB 5EUHA 2CQCA 3HM9A 2LCWA 5J2NA 4ZOSA 3AY0A 5AE1A 1OS5A 1S9GB 2HGMA 4EZ9A 4WYLA 3N4WA 2ZKTA 4B02A 2DR7A 2EC0A 1RT3A 1Q78A 4K0KF 4I2PA 4B3RF 2BE2A 3GV5B 3IAM9 3P49B 1KVIA 1FERA 4DV4F 1M1KT 2X1GA 1TL4A 2LLZA 4JI8F 3K8VA 2AV5A 5D6GA 2CVEA 4Z2XA 1YBAA 3MURP 3OXGA 3U27A 3M6WA 3GV7B 2VG7A 2R7WA 3CTRA 3T5HA 2BQ3A 1H98A 4DSJA 3MEGB 3C46A 3QJJA 2OPQB 1KHWA 2BR0A 4QIGA 1RT1A 2GHPA 3HHLA 3OXFA 5B0FA 5L1JA 1D1UA 1G3OA 4RNHA 4YHHF 4D3HA 5MAOA 2MKHA 3U1MA 4ZKAA 2FIUA 3MTKA 3SI8A 4KHPF 2HS4A 4O4GB 3V2UC 1FKOB 1IUJA 2VBZA 4ZVHA 3UE2A 3OSNA 3KJVB 3DLEA 2ZH8A 1IKYB 4X4QA 1TL5A 3HLUA 1TKXA 2ZBIA 2EVZA 3CWJA 3MEDA 1R27B 1N32F 3HVRA 2NPFA 3FVYA 4YR0A 1S1TA 1HWJA 2XO7A 4TY8B 2FJEB 1LQ9A 1HHSA 5GAGU 3KTQA 1N0VC 2GHVC 2DGTA 4YB5A 3BSOA 2CZVC 3H5UA 4LF9F 1ROFA 3AH6A 3RAXA 3OVAA 2HS3A 4B17A 3RRKA 2NUUG 2CIMA 4R8UB 3M6VA 3N6LA 3T9NA 3PR5B 5D4LA 4F3QA 2HFNA 2F3JA 2KZMA 4X62F 4OV1A 3PX6A 5KFHA 1FK9B 4RNNA 1U25A 4Q44A 3CCMS 3RZAA 4MIAA 3J7YI 3JSBA 2KTQA 3NS6A 2BDPA 4NA1A 1JLGA 1HBMB 2QA4G 3HJFA 2KJVA 1CPZA 2KU7A 4DLEA 4DFMA 4I0WA 2DRAA 5IFMA 3T3FA 3CULA 3LP0A 3THVA 2CQ4A 3E2EA 5T14A 2HHTA 1FKPB 2MZSA 4LT6A 2LA6A 1B0VA 5LJ3Y 3MGJA 2I1RA 5E3RA 2EPIA 1FRKA 2JLFA 3PEJA 4G1QB 3ZZYA 3NWGA 4RUAA 2A18A 3Q8PB 1NK6A 1M5OC 3BR9A 3DGPA 2PMHA 4HTJA 4UOCA 5GVQA 4X4OA 2Y0SD 2C42A 3QGHA 3LAKA 3MUMP 1AFJA 4NA3A 2GNKA 4EYHB 1SXLA 1X0PA 4MK7A 4CNZA 4RW9B 3CDEA 2E7XA 2ZDPA 4KTQA 1VQ9S 5K8PA 3LP1B 2LDYA 1KQKA 2BOPA 1VQOS 3IG1B 3CCVS 1U47A 2DNPA 1NJZA 1LK7A 2Z2MA 3K57A 2PI4A 2N82B 1X9SA 2ZVSA 3DOKA 3CJKB 4MIBA 1B64A 4F50A 4DUZF 3BM7A 4IO1A 1NK7A 1JJHA 1KHVA 4F25A 2DGVA 2NREA 1P1TA 3PRDA 4A4JA 1UA0A 5GAEI 1HYSB 3OL8A 1J5EF 3OTDA 4IH7A 1T95A 4XK8C 4EO6A 5IT4A 3KK2A 3RB4A 3G8TA 1S9EA 2DCLA 2NS1B 1VQKS 4HH0A 3Q24A 1ZAWA 1CSJA 3R5CA 4KFBA 1KRPA 1XR6A 4A8FA 2AWZA 3M2VB 1NAQA 2DD8S 4DF4A 3DM2B 4F26A 1VRTA 1JLAB 2KFYA 1HBUB 5J2MB 4XIUA 1OSCA 4DN9A 3FMWA 2G4BA 2QLWA 3BSCA 1GXTA 2ZOFA 3OUYB 3M8QA 2GJIA 1G1XA 3TVYA 3H40A 2I5JA 2VFVA 5LL6d 3F73A 4YY3F 1S48A 4F02A 1V3ZA 1HD1A 2L9WA 2GC8A 3NS5A 4HDHA 3ITHA 4UUXA 2KH9A 5FDLB 5IQ6A 2UVUA 3FEYB 2CG4A 3N5FA 4J9RA 5F0WA 5IWAF 4ED8A 3EZUA 4Q8FA 3UWTA 4ZHRB 3OL6A 2IAJB 4M1KA 3K7RA 4D3GA 1PGZA 2DPIA 3TP2A 3MPYA 4QWCA 4OI6A 2DHGA 2HZCA 4AXIA 4PRFA 1K9MT 3DXSX 1NRKA 3EX7B 2IRYA 1N56A 2DPJA 1OWXA 2HRYA 5DQIA 1BD6A 3ZZZA 4ZA1A 1U49A 1FDDA 2PN6A 3QGPA 5HROB 3HPOA 2R2RA 3AB4B 2XMTA 2XWXA 2PDAA 3KOAA 1T05A 4OIXA 2VL1A 3QZ7A 2IBOA 5KT3A 2QA2A 2ASLA 2WB4A 4WYWA 3KNGA 3DOMA 2EFNA 4CH0S 1VQMS 4I6WA 1YIJS 2R8KA 3H2VE 2U1AA 4CO0A 3MWBA 2WBMA 3CCUS 4TU7A 3VAIA 1QAYA 5KFDA 1B0PA 5J1EB 4OI0A 4PR6A 3LW5C 1GXLA 3I55S 1DQ9A 2HG4A 3O5TB 3S6EA 1H3DA 4CZCA 2GX8A 2HHQA 4F4KA 3NNAA 2HPUA 4OX7A 1FRLA 1IJFB 1Y3JA 4N77A 1H38A 1X0FA 3FQKA 5JJBA 1IBKF 5LJ5Y 2R7QA 3ZZPA 3SV4A 4IQXA 3JAMY 1B7FA 2ZOGA 1PC4A 4IO9Q 5KFEA 4HT5A 1HA1A 3OQ2A 2P9GA 4OLPA 1MW7A 1BGXT 2J7KA 4GO5X 3V81A 3CEDA 1FRMA 1IQZA 3I96A 4PG8A 3MECA 4ZVEA 1X9MA 4TU9A 1MU2A 2DK2A 1REVA 2ZM6F 4ERDA 2F8HA 4ETZA 2QSFA 3QJLA 1UEVA 4I64A 4C3LA 2ZH9A 3I0RA 3J81Y 2OPSB 4NLWA 2CQBA 4OHZA 1H6KX 1TV6B 4NYPA 1Y7PA 2QO3A 3T6JA 4XPEA 1HNWF 2W4CA 5D8HB 2KXHA 5DQHA 5A2QY 2PC6A 4A46A 2GGPB 2DB1A 1XTZA 2KKHA 1MMNA 3I9ZA 2Y1RI 4G3IA 3HHEA 3SDEA 4RBUA 3PR4A 2FD2A 2IYGA 3ISZA 2PMZD 1YJRA 4ILLA 1Y4ZB 2CKWA 4RNMA 4C11B 3N28A 2WCXA 3VAGA 1FJEB 3DYAB 3S8SA 1VC6A 3DN9A 1JLBB 5M2UA 3VAHA 1C0TA 4Y2AA 1KLMA 2CPYA 1X9WA 1QY7A 3M8PB 4YB7A 4WFZA 4TLRA 2D9OA 2HHWA 1HBNB 2F9JA 3M2RB 1OSDA 5KFTA 2CQGA 5AXMA 2R8IA 3NRBA 2DISA 5GADU 4CCHA 1S6OA 4PUOA 2UVWA 4DR5F 3PVXA 5F3ZA 2Q43A 3EZ5A 4NYZA 1Q79A 4F4ZA 3JB9k 2RH3A 1W2BR 2RNEA 5A6PA 4OJGA 5HP1A 2JZ5A 3KK3A 1L5UA 1HHTP 5I3QA 2CQPA 3U7JA 4EBDA 2OSQA 4OJHA 4ED5A 2YX4A 4WZQA 2K3IA 2O3DA 2HWTA 1VQSA 1HW9A 2D74B 1UFLA 2AX0A 2ZE2A 4ES3A 2OTJS 3RB6A 3CDUA 3P3DA 1S1WA 4ZCKA 3CC4S 2OPPA 2V9WA 2ILYA 1FXLA 2HHVA 3RTVA 4P2SA 1TR0A 4ECYA 2KI2A 5CD4H 4B3OB 4LF7F 3HVWA 1JMTA 2JH3A 1WEYA 4DL3A 5D77A 1T3NA 3OFEA 2F7VA 5DG8A 2OD4A 2GHWA 2B9WA 3GIKA 3OTBA 1D9DA 3CJ3A 2QZ8A 3OSPA 1FXDA 2J5AA 1H2TZ 4F4YA 3UD4P 3IWLA 1YGYA 2LQ5A 4C0HA 5HLFA 1QTMA 4HI2A 1HWIA 4YDDB 3AHPA 4O23A 3BF4A 3EXCX 4QIEA 2CQ0A 3DRRB 3TI0A 3JSMB 2GIQA 1ZBTA 2FJBB 2YNGA 3IRXB 3SQGA 2MHNA 2YWHA 4NZ6A 1Q8IA 1QM9A 1R89A 3FDSA 2IJFA 4K4WA 4ECTA 1VJWA 2DGWA 3X1LB 1CVJA 4P7TA 2W9BA 5G0RB 3MD1A 3NNHA 3OFFA 1G2EA 4L3NA 3VAKA 4OI1A 3PW4A 2CPFA 1ZM2A 3IGVA 1Y3KA 3NNCA 1S1UA 3KK1A 2RE1A 2VKRA 1WF2A 4RW6A 4PXEA 4WE1B 3F44A 2KZZA 4MKYA 1ZM9A 1JLFA 2YWGA 5AE3A 1CQMA 3IXQA 4QR0A 4DR6F 1FO1A 3IGNA 3PW5A 4YB1P 3AA8A 1A6LA 2C22A 3DXBA 2ZNYA 3M8SA 3Q0AA 2RRAA 5K9FA 1RTDB 3K59A 4ECXA 3PHEA 1LWEA 3OR2B 4RBVA 2ADBA 2R7UA 3D0HE 4LFAF 1JK9B 3UFCX 2M88A 1X4GA 5E33A 1UVMA 1FD8A 3IN5A 5L8RC 3DMJA 5AXKA 2WHOA 2E5LF 2UXDF 3D2WA 3BN7A 4IRDA 2ZH1A 1QSYA 1NJYA 1FA0A 1DQ8A 1LKZA 5J2PB 3WC0A 2D3OR 3C6TA 2ZH4A 3QIDA 1U26A 5G4DA 1SJ1A 3F41A 3CIZA 1S6QA 4NLTA 4CO1A 1HNXF 2ABYA 5M2PA 2RB7A 4O44B 3EPGA 1LXNA 2PA8D 1UL3A 2HFZA 2KRRA 5E3PA 1JLCA 3MAQA 3V4IB 1WHVA 1VLYA 3CO9A 3GYXB 1VI7A 1IR0A 1QE1A 1TKTA 4JI2F 2ACYA 4R0EA 2B5JA 5BJRA 5HMWA 3KLGA 3OJUA 2JVOA 3GG0A 5D3GB 2F4VF 1FNMA 3OVSA 3BDPA 1S0OA 5KFRA 2ZJQQ 3GZ7A 2R2UA 2IBKA 4R5PA 1VK8A 3JYTA 2I0XA 4ECWA 2M4MA 2HMIA 4B9NA 2C2DA 4C8YA 4KJIA 3KLEB 4F3OA 2NXUA 2ROGA 3KG4A 3QJPA 3QGGA 1S1XB 3I5AA 2OJ3A 5CZXA 4NCGB 2QRRA 4JI4F 4G1IA 2UUCF 2MY8A 3T5JA 4F8RA 2ZD1B 1U1QA 4B9VA 1A9NB 2D1CA 5F8LA 1TFYA 2XS2A 2HNZA 3DHXA 3DLGB 1W2IA 1SBRA 3VF0B 2R8JA 1F9FA 3QO9A 3MR2A 3N79A 3U02A 2XSJB 4Q2LA 1T03B 5DLGA 3DRPA 2ZH2A 3RBDA 4WXOA 1IM4A 4PXBA 1ZYQA 1NK8A 2C3OA 3HHLD 5KG0A 4U7UK 1S97A 4JI1F 2MHEA 2P9CA 4WK3A 5KT4A 3AAWB 5DM6Q 2IC3B 4DOZA 3KLIB 2AYEA 2NPIA 3O6QA 2I2YA 4KO0B 2BABA 1S49A 3FFIB 5T7LA 2FHKA 1S1VA 4N41A 4NZ7A 3DRYA 2R7RA 1DFDA 3HXMA 4K4UA 3MMJA 3VR1A 4ED3A 1LW0B 1KOHA 2H5EA 1FHTA 5MLCV 3JTNA 3MM7A 4ZCIA 3MTJA 4FS2A 2L08A 4RWWA 1NB7A 2NSBA 4N47A 3LH2S 1UMJA 4YUDA 3MEGA 5KFZA 1Q8LA 3E8OA 2O1PA 2AJ1A 1RA6A 4DV2F 1SIZA 4DR2F 4H4MA 1H7WA 1S79A 2WW8A 3MI7X 2DNHA 1HR0F 3X3UA 4ZPAA 3HHNB 3FNNA 3HHLC 1Y0HA 2J9DA 2VV5A 2DR8A 2AJQA 1LWCB 2BBEA 4QPTA 5FJ4A 1DTTA 1FDAA 3M2UB 1SKWA 3LWMA 4O4GA 1I94F 4X66F 1KC8T 2FY1A 3KJVA 3KG1A 1Z4UA 4I69A 3DI6B 4M8LA 1LWFA 1LW2B 4OX8A 1S6UA 3MFIA 1IKYA 2EWHA 2UXBF 5H1SV 2R7OA 3CJ0A 1U1MA 1S99A 2HS0A 1HMVB 3G6ES 3HO1A 2BJEA 4QWEA 3T1AA 1YITS 1F5CA 1PSDA 4Q43A 4QR1A 2XLJA 3BREA 1LOUA 4J9QA 3R5AA 2BYCA 2KT5A 5H9EJ 3D0IE 3W7BA 4IUFA 1K1SA 3H8YA 3ENQA 4EEYA 1R0AB 1KFDA 3KMQA 4DJBA 1ZM3A 4Y34A 2EG1A 5GAHI 4A8WA 2L48A 1UKUA 3QIPA 2R8HA 4C0BA 1WTBA 1ZAXA 4OLOA 3T6BA 4Y00A 2W7OA 5DGBA 5HBMA 5DDRC 2CRLA 1MSWD 4WU2A 3BDEA 2FJAB 1R7IA 5DM7Q 4YMEA 2OH2A 1UVIA 4K4TA 2EK6A 3J80Y 3MFHA 4DL5A 2FJVA 1FK9A 4HVZA 5LMNF 4B3MF 3OBIA 2ZH7A 1URRA 3HVTB 1XN9A 3MEEB 4KC5A 4X2BA 1SV5B 4KGKA 1D8ZA 4WFYA 1MWYA 1GNKA 2HVZA 2OO4A 4C2MA 4DR1F 4C8KA 3CCWA 1NO8A 3US5A 4YQWA 2MDAA 3IS9B 1NJIT 3Q8QB 4NPOA 1YI2S 1TQLA 3WZ0A 2E9RX 2MJNA 1U1OA 1SH3A 3CDAA 5J2QA 4PQUB 1N33F 4G1QA 2HWIA 3J7YU 1IKWA 1RK8A 1U1RA 3IR5B 1H2UX 2EFVA 4IFVB 3IWXA 3KLFB 4M94A 1E6YA 2M9KA 2O66A 2J76E 4NRTA 3HMJG 1BQNA 1L3UA 1R8CA 1WG4A 2XEXA 2WOMA 4QOTA 5SZTA 3LP1A 2ATLA 1XMQF 3VAFA 1LK5A 2UVVA 2MJUA 2M8DB 3UPFA 2FUG9 3VAJA 2W4DA 2B9YA 3BSAA 4WFBQ 4K4ZA 2VUGA 4IG0A 4DQIA 2YWEA 3TANA 3RB0A 1FRIA 1Z2ZA 1Y5IB 5D78A 4EUVA 4JV1A 1AXQA 4ZVGA 1VGYA 2BJDA 2RILA 2J6UA 1PILA 1SL2A 2DNKA 3PJXA 3FZBA 3PEHA 4GKJF 3UCUP 4FS1A 2PIIA 2XBPA 1N6QA 2GMJA 4C8NA 2RQ4A 4ELUA 3R5DA 4ECZA 2BM1A 1VIXA 3AJ1A 3BS9A 3P6YC 2GA7A 4FZVA 3H20A 3LPYA 1SUQA 3Q2TC 4LSNB 1EETB 1C0UA 2YKMA 4MFBA 4LSLB 4Y3CA 1HBUA 2B4UA 5J2MA 3HK2A 4LIWA 5CA5A 3MM9B 4IH5A 1H0HB 1RQ0A 1SI9A 5GAEU 3OUYA 5K5MA 4CO4A 3PW2A 3QWPA 2XC9A 1RISA 2QSWA 1FE0A 5KFVA 4F2SA 2X1FA 5C