2EX3A

Bacteriophage phi29 dna polymerase bound to terminal protein
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
570
structure length
570
Chain Sequence
RKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA polymerase
publication title The phi29 DNA polymerase:protein-primer structure suggests a model for the initiation to elongation transition
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transferase/replication
total genus 150
structure length 570
sequence length 570
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2ex3A04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ex3A01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2ex3A03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2ex3A02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2ex3A05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2ex3A06
3MECA 4MQ3A 5C25A 1ITGA 1X9MA 2HHTA 2YHBA 4QOZB 1WN7A 3WNHA 1JXBA 3LP2A 3K58A 2E6MA 1IG9A 1LWCA 2OPPA 1UA0A 1X9SA 1YT3A 4R5PA 1L3VA 3DOLA 4O5BA 4WE1A 4C8MA 2VG6A 1QTMA 1TKZA 4FJLA 3HL8A 4AHSA 3OYAA 2ZD1A 1NK0A 1CXQA 1U48A 1C0TA 4IG3A 1C1AA 3MAQA 1JLFA 1NK9A 1HJRA 2XRIA 4Z4IA 3L8BA 4DSEA 5C42A 3AO3A 3OYFA 3QNNA 2P5OA 4W5OA 1YTAA 1X1PA 4KI6A 4GMJB 4IFVA 4CHNA 3V81A 3VN5A 4CEEA 3ZSQA 2OZMA 1Z26A 4M3RA 4OKEA 3H08A 5CY4A 2IAJA 4BE1A 3HSTB 4M3YA 4FW2A 3PX4A 1JLAA 1S1UA 1JKHA 2FBYA 4CECA 1GOAA 1BQMA 3LAMA 2ATQA 4DLEA 3VQ4A 1WNSA 1WSGA 3OS0A 3DM2A 3VQ6A 3KLEA 2Z1JA 5J1EA 3HP6A 4FZZA 1LW0A 2HNYA 1SV5A 3NCIA 4ZTJA 5KTQA 2D0AA 1DTQA 3ZSYA 1N6QA 1UWBA 2G8WA 4DMNA 2O4IA 3QEPA 3LWMA 4LSNA 4DU3A 4KAZA 5I42A 4CJSA 2KZZA 4AH9A 4CJ4A 1SUQA 2XY7A 4KRFA 5E41A 4IG0A 4E7IA 3NAEA 4ELTA 1UA1A 4F4KA 2P51A 4I9QA 3NE6A 2Z1IA 2DFEA 1TAQA 4OKKA 3OY9A 5CZ1A 1S5JA 4IFYA 4KV8A 2JGUA 4FJHA 4CJWA 4Y1CA 1C0UA 1J9AA 1YVUA 4DU1A 2KTQA 4H4OA 3NBPA 3QERA 3TAGA 4KHSA 1RNHA 1WAJA 5J2NA 1RT3A 1Y97A 3L2VA 3RMCA 1BI4B 1QE1A 1C6VA 1RT4A 4CJUA 3P83D 4OPKA 2VWKA 2Y1IA 1L3TA 4CHYA 4HCBA 2WOMA 4M3XA 3BGRA 3EZ5A 4DSFA 5D3GA 2IGIA 2OPQA 3V4IA 1S6QA 1HQUA 5HRNA 3DOKA 2E6LA 2PZSA 1RT6A 2R7YA 5JS2A 2PYLA 4DQRA 2HHVA 3O3HA 1NK6A 4BWJA 3MXJA 4CCHA 1NK8A 1SL1A 1QQCA 4KREA 3HPHA 1S1VA 2HVIA 2IS3A 5HBMA 4DSJA 2FBTA 2DFHA 4HTUA 4KPYA 3NGYA 3AA5X 1B92A 3JYTA 3SV4A 3L2QA 3SZ2A 1TK5A 4B9UA 4B9MA 2YNFA 3A2FA 2HHSA 1C1CA 1TKXA 1VSEA 3OYDA 3CFRA 3L2UA 4F2SA 1EXQA 2W42A 3QINA 3K5OA 4DTMA 3RMDA 1BI4A 4PWDA 3KK1A 3RRHA 3AO5A 4O44A 4QAGA 3L2RA 1XHZA 3VQEA 1SL2A 4B9TA 4E1NA 1VSIA 3LPUA 1GOBA 4KHNA 3HT3A 5SZTA 1CLQA 3LZJA 2HW3A 4KTZA 5HRSA 3ASMA 4N5SA 3KTQA 5T7BA 3S3OA 4Z4GA 1JLEA 3B6PA 4FJ9A 3AVHA 1EKEA 2F96A 2O4GA 3OYLA 4JRQA 4HUFA 3MXIA 1XHXA 1XC9A 3CQ8A 1LV5A 4CEOA 1TKTA 3ZT1A 2BE2A 4DQIA 1QHTA 3CFOA 3I0SA 4CJKA 4N41A 4F8RA 3AVMA 5J2PA 4E19A 3LZIA 4DTOA 3DLHA 2KFNA 3C6UA 4HUGA 4DS5A 2RPIA 1I3AA 1IH7A 1RTJA 3KKRA 3DMJA 3HXMA 4CESA 3SQ1A 1KCFA 1TK8A 2OPSA 3LWLA 3VQ7A 4FLUA 3V9SA 1NKEA 4Z4FA 3NHGA 4ZHRA 4AHUA 2VG7A 1HPZA 3K5LA 3AVBA 4RW6A 5HRRA 1RTHA 4W5QA 4F2RA 5FRMA 4B3OA 3PV8A 4B08A 2GBZA 3DLEA 3NH0A 1BHLA 4IDKA 3WNEA 5HLFA 1KLNA 4FJMA 4GVMA 3M8RA 1VSLA 4FM1A 1Q9XA 1NKCA 3QIPA 2QXFA 4CGGA 1RDDA 2G8VA 5SWMA 2KQ2A 1ZBUA 4JLHA 2XY5A 4I2QA 4F3TA 3OS2A 3U3YA 3PUFA 4NCAA 1D9FA 2RKIA 3DLKA 4CFBA 4PUOA 3AA3A 5EU7A 4M3UA 1KVAA 4HCCA 1WSIA 3AVJA 1JLGA 2OA8A 1EX4A 1RT7A 2DTUA 1S6PA 3OYHA 3LALA 1TGOA 4CEFA 3AVKA 2YNIA 1T7PA 4LH5A 3ZSXA 4B8CA 4E89A 4M3WA 1J54A 4DSKA 4BWMA 2YHAA 3VQPA 1NJXA 2FBXA 1HYVA 4ID1A 1JLCA 3OYGA 3LP3A 2YKNA 5KGXA 4K8ZA 3ZCMA 3O4NA 4OVLA 1NJYA 1HYSA 3DLBA 4DSLA 3AO4A 3BDPA 4DQQA 1JL1A 3M8QA 4OGEA 4CJLA 4I7FA 1XI1A 4CJRA 3M8SA 1SL0A 2YKMA 5J2QA 2EX3A 4PQUA 3OYNA 1WSEA 4FJJA 3CFPA 3T1AA 2X6SA 2PW9A 4Z4HA 1FK9A 1VSHA 1HMVA 2E4LA 4DFMA 2HB5A 3ZSVA 1TK0A 4CEQA 4DTJA 4EZ6A 2XO7A 3EY1A 2YV0X 3NF7A 4CE9A 3MEEA 1KFSA 1S1WA 3SPZA 4EZ9A 4J2EA 1TL1A 1YTUA 4FYDA 1RBVA 2IOCA 1R0AA 1WSJA 3ZT3A 1LWFA 2B4JA 3TANA 1T05A 4O0IA 2OZSA 1QSYA 1TVRA 3HJFA 1ZBHA 3UIQA 5DK5A 4TSXA 2EHGA 3WNGA 4PA1A 3IG1A 4AHVA 2D0CA 1A5VA 3AA2A 3TABA 4CHOA 1RBTA 1W0HA 3IRXA 3JSMA 3OYIA 3S9HA 1NK5A 4DWIA 3OYCA 3AVLA 3KLFA 4FJXA 2HHXA 2A1RA 1CZ9A 4BDPA 3QNOA 3ALYA 4I9LA 1B9FA 3I8DA 4DU4A 3LANA 1FXXA 4LY7A 1NOYA 4PY5A 2XHBA 3B6OA 3F9KA 4CJPA 3VA3A 3OS1A 1RTDA 1HQEA 3O3GA 4AHRA 5KRTA 3WNFA 3AV9A 3SPYA 4O0JA 4M41A 3VQAA 1Q9YA 1G15A 3CG7A 2OPRA 1DLOA 4FLWA 3O4QA 3HPGA 3O3FA 1B9DA 4FJ7A 1VSDA 2I5JA 2FBVA 3CM6A 1ZBLA 3VQBA 4KKOA 4CIEA 3SUPA 3D45A 3F73A 3QEVA 3G10A 3AVFA 3PO4A 1RBRA 4KFBA 3MXMA 4CJTA 1KVBA 4E1MA 3SQ2A 1WSFA 3PY8A 4KI4A 4N76A 3AA4A 1RILA 4KTWA 2FC0A 4NYNA 1REVA 3CM5A 4IKFA 4Q0BA 3OYBA 5CYQA 4JRPA 3V6DA 4C8LA 3G0ZA 1S9EA 2RF2A 4OJRA 1ASWA 1Z25A 3ZSZA 4W5RA 3V9UA 4ZTFA 1TL3A 3K59A 3OJUA 2DFFA 3ISNC 4JS4A 2HMIA 4CF1A 2QK9A 1D8YA 2QKBA 3SI6A 4FK2A 3KLGA 4O55A 1X9WA 3ZT4A 1F21A 5C24A 4N47A 4KB1A 1BISA 2ITGA 1A5XA 4GW6A 1A5WA 2KW4A 3QO9A 3T3FA 3SUOA 5FRNA 1NOZA 1JL2A 3LAKA 3ZSOA 4E7KA 3HO1A 2G8UA 1BL3A 3IAYA 4KO0A 4LSLA 4CJFA 3HVRA 1WLJA 3RR7A 1S1TA 3HM9A 3QESA 1SKRA 3RR8A 1U04A 1IKVA 3TAPA 4FLYA 1RDCA 4C8NA 4CHPA 2X78A 3DRRA 4HVJA 4OKJA 4L8RB 1RBUA 1QS4A 3KIOA 3KJVA 4DTPA 4B9LA 4KHUA 3VA0A 1SKWA 4CF0A 1I39A 1HYZA 5KGWA 2G8KA 1EETA 4HUEA 4E0DA 3HP9A 4DTSA 1HNIA 1RT1A 3S3MA 1J5OA 4J2BA 1Q8IA 1N5YA 3TR8A 4RW4A 2VG5A 1BCMA 1VSMA 4KB0A 3VQQA 4DTXA 4DF4A 2Y1JA 2YNHA 3V9WA 1U4BA 2R7FA 4Z0UA 4FLTA 1XWLA 3NH1A 4OGCA 3LP1A 1KRPA 3KK3A 4H4MA 4DLGA 4C8KA 4FW1A 5CZ2A 4BE0A 3V1QA 3U6FA 2XY8A 1UOCA 2Z1HA 4J2DA 2PY5A 1RT5A 4FJKA 4CK3A 2Q3SA 4DQSA 1VRTA 1KVCA 5KI6A 4C8OA 4W5TA 1QSLA 4CHZA 2LSNA 3RTVA 4DF8A 3FFIA 1WAFA 3SQ0A 4ELVA 2B6AA 1JLQA 2IDOA 3AO1A 1HNVA 1U47A 3K5MA 3NF9A 2GV9A 3S3NA 3OYMA 4B9SA 1LW2A 1JLBA 1WSHA 5FROA 4XIUA 4ID5A 4Z4CA 3TWHA 3TAEA 3PX6A 1KTQA 2Z1GA 2BANA 4CFCA 3QETA 1RBSA 4KHWA 1RDBA 3V1OA 4IBNA 1ZYQA 3AO2A 3VQDA 2BGGA 4FM2A 3KD5E 2YNGA 1LAVA 5J2MA 4CGIA 1KSPA 4J2AA 4KTQA 2QKKA 4CJQA 4FJ8A 2KFZA 3TAFA 3VQ5A 3C6TA 4DSIA 3C94A 3KKSA 4FZXC 4UQGA 1D9DA 2G8FA 3SYZA 3VQCA 3OJSA 3V9XA 4ICLA 1JXEA 4CGHA 4CHQA 3OYKA 3DYAA 3EYZA 3MEDA 4ELUA 3L2WA 1TV6A 1U45A 2G8IA 4OLBA 1BQNA 3TI0A 3DI6A 4DG1A 4FJNA 4CJVA 1MU2A 1RTIA 3ITHA 4CF9A 2HNDA 2IC3A 2F8SA 1L5UA 1LWEA 3LPTA 4CK2A 3SNNA 3THVA 4OLAA 3LDSA 4CJ3A 3PO5A 4CJEA 4AHCA 3QLHA 1NJZA 4DQPA 3QIOA 4E7HA 3AVNA 2PYJA 1RCHA 4DTUA 1SKSA 3OYJA 4FLXA 1W9HA 4CFDA 3KLHA 4CEAA 1U49A 3NFAA 3AVGA 2NUBA 3SCXA 1J53A 4RW8A 5HROA 3DRPA 3ULDA 4M3ZA 1DTTA 1NJWA 4CF8A 4BDZA 3OYEA 1RDAA 1S9GA 3RMBA 1RT2A 3MEGA 4DS4A 2ETJA 3HK2A 4M45A 1LAWA 3U3GA 4FLVA 3HPOA 4E3SA 3QEWA 4FJIA 4CGJA 4FK0A 4M42A 2AJQA 5CYMA 2HVHA 4B9NA 5JS1A 4Q5VA 4DFJA 2RN2A 4E7JA 1UAXA 1O1WA 1ZBIA 1TAUA 3K57A 3TAMA 3KLIA 5FDLA 3SUQA 1GOCA 2HHUA 1CZBA 3V1RA 3AVAA 4RW7A 1VSKA 1VK0A 5DMRA 3TAQA 4CFAA 3VQ8A 3T19A 4HHTA 1VSJA 4FZYA 3AVIA 4YNQA 4FCYA 4FXDA 1L3SA 3P5JA 4QCLA 3QEXA 2ZQBA 2BDPA 4CK1A 1FKPA 2VWJA 2X74A 4FJ5A 1IKWA 1IO2A 2A1SA 3NH2A 3QEIA 3PX0A 1IKYA 2DY4A 1QSSA 4W5NA 3NGZA 3RWUA 3FI7A 1VRUA 1HRHA 4I2PA 5K14A 3ZSWA 4B9VA 3RMAA 3NDKA 2D5RA 3P1GA 3I0RA 1ASVA 4KHYA 4Z4EA 3KD1E 4H8KA 1S1XA 4RW9A 1T03A 3SV3A 4OPJA 3LP0A 4BACA 1K6YA 1T8EA 2G8HA 4F3OA 4YFUA 2F8TA 3D0PA 2WONA 3OVNA 4NCGA 3SQ4A 3E01A 4CGFA 2XY6A 3TARA 1TKDA 4FK4A 4B8AB 3DLGA 3K2PA 4CJ5A 3HVTA 3IS9A 1KLMA 2OYQA 3AVCA 3ZT0A 1BCOA 4CIGA 1CXUA 4CEBA 1C1BA 5KRSA 3ZT2A 4KHQA 4DTNA 4FLZA 1FKOA 4MFBA 4LH4A 5I3UA 1L3UA 2ZE2A 3L3UA 4LD0A 3DRSA 4CF2A 1NK4A 2D0BA 4CGDA 3SUNA 4K8XA 3KK2A 2P5GA 2HHWA 2HHQA 3L3VA 3NGIA 3CYMA 4EP5A 1IKXA 1BIUA 4DFKA 4DTRA 4FVMA 1C0MA 4E7LA 2B5JA 1NKBA 4FM0A 4DFPA 1KFDA 4G1QA 3V9ZA 4Y1DA 4RG8A 1NK7A 5HP1A 4AILC 1D5AA 3NF8A 3C95A 1BGXT 4CEDA 4BDYA 3RRGA 4JS5A 4N56A 2X6NA 4NCBA 4AHTA 4NYFA 2JLEA 4CERA 3VQ9A 3SJJA 1VSFA 4FJGA 1ASUA 4EP4A 4CIFA 3K5NA 1BIZA 1EP4A 1ZBFA 3NF6A 4M3TA 3M8PA 3DLRA 4O4GA 5HRPA 2HNZA 2KZMA 3ZSRA 3HYFA 2P1JA 2GUIA 4BE2A 4CEZA
chains in the Genus database with same CATH superfamily
3QFPA 5JH7B 2A3QA 3LDPA 1SQVH 3AAQA 5EIBD 3WNHA 1JXBA 2IH3C 4JF3A 3H3NO 2OPPA 3ZX0A 2O8DA 2WLMA 4P30A 1YT3A 1F7YA 5AJ3K 4R5PA 3ABVA 1N8RO 4WE1A 3IKMA 3RYHA 4JI5B 2E1ZA 3HL8A 1VQ8V 4FMTA 1NK0A 3TJTA 4IO8A 1WP7A 1C0TA 4IG3A 3MAQA 4YSZA 3MDQA 1MA1A 2A42A 3CRQA 3ZX3A 4J7JA 3FZKA 4PJ0Z 4TOIA 2IVPA 3CMAV 1MZEA 1VIBA 5M1PA 1K7DA 3VTHA 5M1FA 4OXSA 4WFHA 5AZJB 3S3WA 4RQFA 3CP1A 1X1PA 4KI6A 4IFVA 4CHNA 1MZFA 3V81A 3ZSQA 3C6HA 1Z26A 1KAZA 4X1KA 3CYOA 2CGNA 4FJCC 4B7KA 3HSTB 4M3YA 2E8AA 2KKZA 4BW9A 2N05A 3UO2A 4WQ4A 2WSSG 5AQFA 1OVQA 4RUFA 2YIBD 2P6JA 1W0JG 4ILJA 3OHRA 2Q0OC 3DM2A 1VQ4N 5AQHA 1URFA 2HNYA 1LNQA 3O65A 2P9PB 5KTQA 3A0RA 2NN4A 2D0AA 3ZSYA 3JCUZ 3S3XA 3DXMB 5C2FA 1UWBA 1AR4A 2YS8A 4DMNA 2O4IA 5JQGB 3OM3B 3QEPA 4LSNA 2UUBO 4KAZA 2KZZA 2BSKB 1K73W 1SUQA 4UCRA 4KRFA 5E41A 4I0XB 4IG0A 4JI2B 1C0GA 2DFEA 4JK9A 4QS9A 5CZ1A 1OV9A 1S5JA 4NKGB 4DR7B 5LOVB 2JGUA 4H33A 2KG7B 4P9PA 4CZKA 1C0UA 1J9AA 4H4OA 3BEXA 3NBPA 3D8CA 2GHYA 1EN4A 1B06A 4DYLA 1Y97A 2KHOA 3WXJA 4OO1J 3OW2M 2YJEA 2HP8A 5K1XA 3CCRV 2Y1IA 1MG1A 5BPNA 4HCBA 1VQ7V 3E9OA 5IWAK 4YSYA 3ETGA 3AARA 1S6QA 1KP3A 3CHWA 4YJ3A 4PKGA 4EIAA 4RWUA 3CJCA 3L4IA 4FWPA 1NM1A 2O8EB 2E6LA 4JK8A 3UCSC 4BR6A 2Y48A 1RT6A 1K3EA 4GX1A 2AZ2A 4XBFA 5JS2A 4U67L 1VQ9V 3OBWA 2HHVA 3MXJA 4KREA 2QTDA 3JD0A 4JI5O 2IS3A 5HBMA 2E2OA 4KPYA 2DFHA 3DXKA 3ZETB 2HVKC 1M56B 4UCSA 1B92A 3SZ2A 4B9UA 4DR2B 1C1CA 4CH5A 1TKXA 1VSEA 3OYDA 4F2SA 1F51A 4CBCA 4JAVA 1Q86W 3THWA 5CA0A 3MN7A 1NTKH 4YSXA 2CE4A 3PJSK 4UVAA 2XAQA 4PWDA 1BEV4 1GLEG 4DV4K 3AO5A 1XQSC 3L2RA 2EILB 1XHZA 4B9TA 2UU9B 4WBNA 3LPUA 4WCEL 2GBOA 5B8HA 3B77A 4YOVA 1TVKB 1FXKC 2RS34 1XOUA 1OH7A 1CLQA 2HW3A 4O4JA 1RUD4 5M1NA 2FSJA 3S3OA 4FSVA 4E1JA 1OH5A 5C15A 3G6EN 3OMAB 1FXHA 3H1VX 2K1EA 5E1AC 1EKEA 2F96A 4JKGB 4EHUA 3J81N 3OYLA 1LV5A 1ILYA 1ZBSA 1GRJA 3P4RA 4CEOA 4LF9B 1NGDA 1TKTA 3CFOA 4CJKA 1IBLB 2Q97A 5AQGA 5BR8B 2HF4A 3AVMA 3EKSA 2VYPA 3LZIA 2VQFK 3DLHA 1NKDA 2KFNA 4MW3A 4HUGA 1CZAN 5ELZA 4DUZB 3DMJA 1KCFA 3R1XA 3VQ7A 3IFRA 3ZMVA 5IYZA 3CCUV 1TUYA 4LWSA 4JI2O 2NNUA 3CRAA 4ZHRA 2QKAA 2CTWA 2QTSA 3K5LA 4RW6A 4DR7O 4B3OA 1RUE4 4FIPC 1EN5A 4GVMA 1HR0B 4I6MA 4CGGA 1OZ0A 3OR6C 3A0IX 2Q0UA 4PHTX 4F3TA 3OS2A 2F9WA 3SPHA 1G6UA 3LDNA 2FF6A 2YIDA 3AA3A 4E2LA 4RAIA 4DV7K 3I55V 1KVAA 3UKMA 3AVJA 2OA8A 1GLBG 1KQSU 3JBG4 1S6PA 3VQVA 4QPKA 3JAKB 1QQNA 2A79B 4UV8A 3VEVA 2HBLA 4PDRA 2QWRA 1ZWIC 4M3WA 3ML0A 3CRRA 3OE7G 1J54A 3H6EA 3L72H 4BWMA 4MO5A 4DSKA 1FAFA 5J2TA 2QM8A 1JLCA 3CMEN 3E35A 2JVDA 3ZHTA 1P4RA 1RMU4 4K8ZA 5IT9O 4BRDA 3UKUA 4DR4B 3O4NA 1N32B 2E20A 1HYSA 3T4ZA 2WC9A 3BDPA 4DR2O 2HWC4 1JL1A 3DAWA 1CEZA 3KZBA 1XI1A 4CJRA 2YKMA 2GSMB 1OCZC 3CCLN 1X3NA 2LQTA 4MTFA 3P31A 2Q31A 4DFMA 1W2BU 4CEQA 2UU9O 1N34B 4MDAA 1KFSA 4J2EA 1YTUA 4FYDA 1RFYA 3OAAG 1NGGA 1TL1A 4K35A 4RWTA 4YY3K 4CZHA 4DSJA 5KHIA 1LWFA 2RJZA 3TANA 5B1BC 1BOTO 4O0IA 1QSYA 4IZ9A 4TQFA 2W6JG 2GTAA 3AEGA 1H2GA 3FAVA 4JYAK 3K03A 4JKBA 2PLV4 5EYPA 1I08A 2EHGA 5AQRA 4PA9A 3IG1A 1A5VA 4JAAA 4LF9O 4Z94A 3E8FA 5AZIA 3VEZA 1IBLO 2XAGA 1BO5O 2HBJA 3JAWA 4PV1B 2LFRA 5BR8O 4JKHA 3KLFA 1NK5A 4DWIA 4DUZO 1B9FA 2PI4A 1GLLO 1FXKA 4HBNA 4TQDA 2ZE6A 4JI8B 3CPWU 5CN0A 5AQSA 5FPDA 3HKEB 2E2NA 1XBLA 4LNUB 4CBUA 1Q9YA 3KCXA 3CCJV 3O3FA 1MABG 2W41A 1I7FA 3QDKA 2HJDA 4DV1B 3SUPA 3BF3A 3QEVA 2LJ2A 1DGKN 2W6IG 1HR0O 1RBRA 4KFBA 1MQTD 4FWKA 1NEKA 3JATB 3BF1A 3AA4A 4U7OA 1TYQB 2FLOA 3V6DA 1MWMA 2UXCB 5H2FZ 5EXWA 2YXHA 1N33K 4I55B 2Q69A 3SBTA 2RF2A 4W5RA 4LC1A 1KB9F 2Q9LA 4ZTFA 1TL3A 4B1WB 1RHI4 2YJFA 4ZOLB 3RWRD 4UCOA 3SI6A 1B6QA 3KLGA 4O55A 1X9WA 3T69A 1FJGB 1V4TA 4N47A 5BR9A 2EIJC 4CBWA 1BISA 4DV2K 4KB1A 1K92A 4GW6A 4WF9L 3QO9A 2PBDA 5I9EB 3MHSC 1JL2A 3LAKA 3ZSOA 2ZJQL 5DM6V 3A5MC 5BY1A 4DR4O 5CMUA 3IAYA 1N32O 5CBFA 4KO0A 3HVRA 5KAFZ 3AE5A 1SQGA 3QESA 2IVOA 1WB8A 3FGUA 1L8DA 4CCHA 5DECA 3CC4V 4FLYA 1IKVA 4C8NA 3JD4A 3MN9A 1YCIA 3ICXA 1SQKA 3KIOA 2XASA 1XMQB 3ASOC 2QDOA 2OIGA 2FF3B 1I39A 1JR9A 2Q7EA 1N34O 2WLJA 3UM7A 1F4NA 4BRKA 3C7NB 1Z2GA 3VRAA 3HRGA 2P06A 2R9RB 2R72A 1Q8IA 4P9OA 1PP9H 4YOWA 1N5YA 2VG5A 2ZKOA 1BCMA 3ZS8C 3VQQA 3TTDA 5B1AB 4LF4B 3RSEA 4Z0UA 1WUAA 2Q1NA 3ZN1A 2WUSA 4DLGA 1NTMH 1BUPA 2XY8A 4NTXA 3CJAA 3SUCA 4IHJA 4J2DA 4QE9A 4QJFB 4JI8O 1H2KA 3AG4B 2BTFA 5LA6A 1VRTA 5KI6A 1HXS4 4W5TA 4DF8A 1K73O 3BABA 3O8MA 4PKIA 2WLIA 5LY3A 2F7TA 3A5OC 3L9DA 5EBWC 2IU0A 3G67A 4DV1O 1HNVA 4IYHA 1UJWB 3S3NA 3CCMN 1SZTA 2DYSB 3HB3B 4J7ZA 3OYMA 3J7AP 5FROA 3TAEA 2F4VB 2HKOA 4IIJA 2JGDB 3FFKB 1PL0A 3JSNA 1VQLV 4IBNA 1ZYQA 3AO2A 5C8YB 2UXCO 4CHOA 4FM2A 3ENHA 4K43A 5EBLC 1H38A 2CTRA 1LAVA 3N4PA 4TUYB 3CCSN 4GCZA 5HFLA 4KTQA 4DUYB 2YC0A 4CVNE 4FZXC 3M3ZA 1BA1A 4UQGA 4BQLA 1M57C 5LHGA 5LP6B 3SYZA 1FJGO 1PVC4 2I7PA 1VQNN 3ZHQA 5FPOA 3CEIA 4FXDA 3MEDA 3RT3C 1YJ9N 1U45A 2G8IA 4OLBA 5LXTB 5KLVH 1BQNA 4CZGA 3AK2A 1L0VA 1RTIA 1BQZA 4BC4A 1VQMN 2EINB 4BROA 3IGAC 1RSOB 1T6CA 1BHAA 4KXRA 3LDSA 1WPXA 4JTCB 4E4EA 4AM7A 2OANA 4DR5B 3PO5A 1Q3EA 3OR7C 4DR1B 1RCHA 4DTUA 4LC9B 2P9IB 3J7YP 1XMQO 2X6CA 3SR2C 3CQYA 3G80A 3KLHA 4JYCA 1U49A 3FX7A 5KHJA 5CA1A 2QGNA 1TUUA 1EO1A 5HROA 4IL6Z 2UUBK 4M3ZA 3SFEA 3N2KB 2NRTA 3ZMSA 1EWRA 1RT2A 1S9GA 2W40A 3MEGA 2AGAA 2Y4TA 3JYCA 4JD2B 4E3SA 4FK0A 3VF2A 5CYMA 4B9NA 4Q5VA 4HZ3A 4TV8B 1YJNN 2QKSA 3KLIA 1ZXOA 2D0OA 4YXDA 3H1LH 3I56V 2IM9A 2HHUA 3A8TA 3SBGA 5AQLA 3P38A 5DMRA 4QS7A 3TAQA 3Q7CA 4HHTA 5F0XA 4FZYA 4YNQA 1YQ4A 3JARA 2YXYA 3D2FA 4O4IA 1S72V 2ZF5O 2ZQBA 3RVCA 4X1IA 3K04A 1FKPA 2X74A 4CZMA 3ZRVA 3CB2A 3ZEDA 1IKWA 2O57A 1MMMA 5LMNO 1VRUA 3FYIB 4I2PA 3VETA 4BR0A 1AI4A 1Q81W 3ZSWA 4B9VA 3SAGA 5KHKA 2F4VO 1ASVA 1OH8A 4H8KA 3TK1A 1T03A 1SC5B 4DR3B 4JI5K 1T8EA 3LP0A 3HKBA 1PM9A 4A62A 3D0PA 3SQ4A 4JI4B 2Z3YA 3APOA 4DUYO 2XY6A 3CD6V 3TARA 3OUFA 3DLGA 3K2PA 1NS1A 4CJ5A 1NCQD 2OYQA 3IC7A 1ZTEA 3AVCA 4CIGA 4KHQA 3OMNB 2XAJA 3LUTB 3K06A 3ETEA 1FKOA 3K9KA 5I3UA 1WB7A 4G28B 1L3UA 3E83A 5J2UB 3C3SA 3X2QC 4CBXA 5BRDA 3ASNB 1P7GA 4PI0A 4JV5B 1NK4A 1S5LZ 4BVPA 3KK2A 2CH7A 3B8MA 2AP1A 3L3VA 1BZKA 1AR74 3VF4A 2O8DB 4DR5O 4CH6A 1R6NA 2VS0A 1XL6A 4EKWA 3K08A 4DR1O 4DTRA 2YUAA 4YHHB 4FM0A 3O5BA 3OT7A 1D4XA 4H13B 4RG8A 4AF1A 2F95B 4Q4V4 4AILC 2ZJPL 3RRGA 3JD2A 4YOTA 1NLVA 4U7BA 2UXNA 4N56A 2X6NA 4WFGA 4NYFA 3K79A 4JI2K 4CIFA 1BU6O 1OJHA 3K5NA 4M3TA 5TKYA 2HLDG 3ZN0A 3M8PA 1P49A 4DR7K 2QWOA 2HSTA 2F8TA 3C3TA 3WXMB 4X1KB 2RR14 3E86A 4OGQB 4MQ3A 5C25A 1RUI4 2B1GA 3TXSA 1ITGA 2NLJC 4UXNA 3AEDA 1SRYA 4G2KA 3ZYYX 2ADQB 3PSFA 3LP2A 1WLEA 4IGGA 4PA3A 5C2TA 1LWCA 2A5XA 2L6LA 1Y4MA 1L3VA 1U6ZA 4O5BA 4C8MA 5C12A 1XC3A 2X6AA 2ASPA 4MDBA 4BR5A 1QTMA 3CC2V 4Q6GA 3ID8A 4CS4A 3GOIA 4GNIA 3OYAA 4IXCA 3A0BZ 3OFNG 3CHXA 1CXQA 3QBWA 2ILMA 5CB4A 1JLFA 5AQWA 1VQKV 3NR7A 1HNXB 1HJRA 4EB6A 1XDCA 1NR7A 4O4HA 2XRIA 4YIPA 3UQ8A 3ABMC 3UO3A 1LUVA 2QA4N 4BW5A 1Q82W 1AR5A 4ZHQA 1FFXA 2BGGA 3QNNA 4QNHB 1HDJA 4DR3O 4GKJO 4EHTA 2HHHB 3U0ZA 4GUNA 3G71V 4JI4O 3CE2A 4MVRA 3JAMO 3GL1A 1GLDG 3W3DA 5F1XA 4DR2K 3G25A 1WB9A 1QR9A 3PX4A 3T1HB 1JLAA 1S1UA 1TUEB 1JKHA 4CECA 3MX5A 3ZHVA 2B9ZA 3CC7V 3SJCC 5IJ0A 4CZLA 2MK3A 4H0XB 4BG8A 4CZJA 4YDUC 2ZR3A 3TSUA 2UU9K 3VGMA 3BY5A 3F5TA 3HKDA 3D2EB 1Z05A 4JV5O 1SZXA 4YJ3B 1AVMA 4YJ2A 1N6QA 5LBQA 5AQZA 4KFMA 3ABLC 4GKKB 3VGKA 3BPZA 1VQ5N 1R3JC 5I42A 5AQKA 5B1OA 3O9OA 4V19S 1IBMB 2CH6A 3NAEA 3O9RA 4LF9K 4I9QA 3AG3C 5L3EA 4YHHO 1IBLK 4DR6B 3DXKB 5BR8K 3THOA 1ESVA 4IFYA 4UB6Z 4IO9L 4CJWA 4W4KA 1JA8A 3HZ6A 4Y1CA 4FJHA 3R8EA 4DUZK 2KTQA 3SDLA 4BAYA 1RP3B 2D4WA 3TAGA 3CXHF 1LCUA 1RNHA 3THWB 5CA0B 2RE2A 1WAJA 5J2NA 3OEEG 3L2VA 2OCEA 1VQON 3K9AA 4CJUA 4GV9A 2KKWA 2EJ7A 5J9PC 3JALA 2WOMA 4M3XA 4WBNB 2XUMA 4O2BA 3D3IA 1V54C 3TTFA 2OPQA 3V4IA 4NYKA 2H8PC 1W59A 5KA5A 2OIEA 1SZ2A 4FO0A 1HR0K 4O4JB 2YHWA 5HRNA 3DOKA 4FOIA 3UKRA 3FKSG 3DXRA 3WB0A 2PAVA 4DQRA 2HWB4 1YHQV 4DV2O 3AE7A 4WFBV 3HPHA 4IYIA 2ZM6B 1Y76A 3T7ZA 1NG9A 3MD0A 1C0FA 3NXSA 3WXLA 1TK5A 4X66B 1K5QA 2HHSA 1JCEA 1HNXO 2ZE5A 3JASA 3L2UA 4I5SA 2E1YA 2W42A 4GB34 3QO8A 3QINA 5IYZB 3DJCA 1YTFD 4LWSB 4H0VB 5AFUH 3JD1A 2HBKA 3RMDA 4FPBA 5KX5A 1ZOYA 1WA8A 3M7MX 2UUAB 4QAGA 5DM6L 1KC8O 1SL2A 1QU7A 3AK3A 4PL8A 2HHHO 4DR4K 3HPLC 1N32K 1VBA4 3O4WA 2D0PA 4KTZA 4I6MB 4N5SA 4Z4GA 1HX1A 2LFSA 1DTOA 3DSQA 3R65A 3LDOA 3CCQV 2ZNIA 3TSQA 3AVHA 2O4GA 1XC9A 3FD9A 4H44B 3ZT1A 5AQXA 1AR64 1N34K 3I0SA 4N41A 1HKBA 3EKUA 2IVNA 4PELA 4F8RA 5J2PA 2F93B 4E19A 4DTOA 1AJPA 3CPWM 1IH7A 2KSDA 4GKKO 2O8CA 4A2BA 5E26A 4K0KO 1KKDA 3VQXA 3C6AA 2QWRB 3V9SA 1NKEA 1NBMG 1IBMO 5J2TB 4F4LA 2VG7A 3O1WA 4H0OA 4AHUA 1QVGM 2WDQA 2B1IA 4CH3A 5HRRA 3GBTA 4JN4A 4DR6O 1FD9A 4W5QA 3UKUB 3DLEA 3PIPL 2E88A 2ZXWC 5E79Z 4YDUA 1KLNA 5IJ9B 1KAXA 1VSLA 4FM1A 3ZMZA 4BRMA 1M90O 3QIPA 3OUSA 1QLEC 2XNDG 2DMXA 2G8VA 5SWMA 2KQ2A 4JI8K 3MDSA 2J4RA 3E89A 3PUFA 1D9FA 3J81O 5IY5C 1AI5A 1WSIA 3ENOA 4DV1K 3BA9A 3OD4A 5H1SQ 2HG5C 2E5LB 5BN8A 1E1QG 3EZWA 2A7WA 2BCCH 4EAHD 4WFEA 3ZSXA 4B8CA 4E89A 5EYPB 2PGGA 2UXCK 3FB5C 2FBXA 2WA4A 1HYVA 2H3OA 3F2KA 2GUPA 3OYGA 2ZM6O 1R59O 2YKNA 3RYCA 5AZIB 2PF4E 2P9SA 3JAWB 5KHGA 4ILGB 1ATNA 3P4SA 4FWQA 2A06H 4X66O 3H1KH 4DSLA 4NTWA 1FXKB 4YTNA 2HEPA 3M8QA 5JJNB 4YTPA 5JJEB 4I7FA 1SL0A 1PNKA 1WBDA 1FJGK 4H5VA 5GTHZ 2EX3A 2W6KA 1VBD4 4X65O 4IJNA 3MMVA 2X6SA 4Z4HA 3BFRA 1VSHA 2YCHA 1HMVA 3A8YA 2UUAO 3G6BA 5LL6Z 3ZSVA 3SMPA 2ARHA 3G6EV 3NF7A 4CE9A 1NI8A 3RVYA 3CCVN 3SPZA 4BRGA 4DQ8A 1VQ6N 4C1NK 4HNAA 3ZCCA 4X89A 2IOCA 1ZL8A 2AA4A 5ADXA 5TKWA 4BVOA 2O8BA 2YEVA 1FYJA 1TVRA 3HKCA 3R6MA 4Z1MG 1ZBHA 2Q0RA 5KMGB 1HJOA 3UIQA 3VMFB 1OKJA 4TSXA 1XMQK 1PV0A 1IBKB 1YI2N 3H1HH 4AHVA 2KQXA 1MOFA 1W0HA 3FZMA 4FJXA 4H0TB 3SAFA 1P8ZA 1D5NA 3LSSA 2A1RA 4BDPA 3R9PA 3LANA 4LY7A 3AG2C 4PY5A 2JWKA 2XHBA 2UXBB 4JAXA 3P32A 4CJPA 1BDGA 5CR4A 3OS1A 3O3GA 1EV14 1I94B 2YIAA 2LGQA 2P9LA 2LGWA 3AV9A 3WNFA 2WQYA 3VQAA 3W7SA 5L3FA 3CG7A 2OPRA 3HPGA 5EOYA 3QB0A 5KQ8A 4LF8B 4KKOA 4CIEA 3P30A 4IT5A 2K9PA 4JI7B 3D45A 3G10A 3KHYA 3AVFA 3VEXA 3MXMA 1KVBA 3SQ2A 3KWGA 3PY8A 1X9JA 4N76A 1VBC4 1SA0A 4NYNA 4EFHA 5HL7L 1REVA 4DV3B 4Q0BA 3JCZA 4BRFA 5KPTA 4B3MB 1G1XB 2A9HA 3SPGA 4GLXA 2HVJC 3H1JH 2QWQA 2OCHA 1GO3F 4JKEA 5JLHA 4OJRA 4RTFD 4RCHA 1EZVH 5LMNK 4BC2A 3V9UA 4JI3B 4MVUA 4JHDA 3WEEA 5KHHA 2E5LO 2QK9A 4CF1A 1IXBA 3FYEB 2F4VK 3VQYA 4JYYA 4AQYB 2F66C 1IVSA 4O8UA 4DRXA 2GEMA 5C93A 3ZT4A 5C24A 5EX5A 1RM1B 3RSEB 3OBYA 1JPXA 1YUWA 4R8CA 1OCZB 2Q68A 4JK7A 4KH4A 3OTOB 5FRNA 2ZGZA 4DUYK 2ASOA 3HO1A 4WYBA 3CMAN 3AG7A 3CCLV 4LSLA 4CJFA 4EEQA 1HPMA 3HM9A 1BCCH 4IHJB 2HF3A 4BGAA 2W6LA 1E1RG 3TAPA 3U11A 2R064 3OTFA 4HVJA 3DRRA 1QZ6A 2JDIG 4LBEC 5B1BB 4OKJA 4L8RB 5LA6B 4X62B 1RBUA 3KJVA 3GQHA 5IDJA 2HR3A 2UUCB 1K8KA 4MVSA 1NQTA 4JTDB 2G8KA 4BIOA 5B3SC 4BRHA 3CCEV 1US6A 4DTSA 1HNIA 3FB8C 1J5OA 4DR5K 4RW4A 1OCRC 4DR1K 1GLJO 2Y1JA 3LDDA 2YNHA 2D1KA 5BRFA 2R7FA 3EVKA 1IBKO 4O8KA 1NR1A 4X1YA 2WA3A 1XWLA 1AL24 4AM6A 3LP1A 1D4M4 1M5IA 2RS54 3AE1A 3GWOA 3KK3A 4H4MA 4QE7A 1KRPA 1QVFU 1R084 5CZ2A 1CXZB 1BQ0A 4O2AB 3QO7A 1Q6UA 2Y69B 3H9VA 2UXBO 2PY5A 1I94O 3VOUA 4FJKA 4KL1A 1T5EA 4BC3A 4L3QA 4C8OA 3RTVA 1P7BA 2N04A 2Q8VA 3FFIA 3SQ0A 4H37A 2B6AA 4LF8O 4ILHA 2IDOA 4DB3A 3CCRN 3NF9A 4JI7O 1XILA 3QNEA 2BTOA 4BC5A 1U47A 2WPDG 4WQ5C 2P7TC 1JLBA 1WSHA 3PX6A 4JKCA 1UA0A 3VOVA 3TWHA 2E76B 2YI8A 1E79G 3CJHA 3OA9A 4JNEA 3QF7A 4CFCA 4DV3O 3V1OA 3VRBA 4MW8A 3GDQA 1JJ2U 4B3MO 3VQDA 1ZUQA 5J2MA 1KSPA 2EIJB 5CA1B 2QEXN 2GWKA 2GUZA 3O6WA 3UB5A 2QKKA 2AHZA 4JI3O 1VQ9N 2WDVA 3L74H 3TAFA 3RN4A 3C6TA 3KKSA 3SLCA 3W7XA 4AQYO 4TSFG 1UPGA 3ZMUA 4DR3K 2H88A 3VQCA 2QM4A 3OJSA 3V9XA 1JXEA 4CGHA 4CHQA 4GKJK 3DYAA 4TT3G 3GG4A 3L2WA 4NB4A 5HOOA 4JI4K 1K9MO 2QJ1A 3OTOO 3HBTA 1NGJA 3R3LA 1MU2A 4CJVA 3ASOB 4CF9A 2YXLA 3LPTA 5JH7A 3THVA 4OLAA 1KECA 4M7XA 4CJ3A 3IC9A 5JCOC 4AHCA 3KG2A 4Y0WA 1EN6A 2XTAA 4CZEA 3AVNA 3JARB 4HAMA 3D2FB 1SKSA 4O4IB 5GADP 4X62O 2EILC 3OYJA 4X1IB 4G9ZA 2UUCO 1K5MD 4JV5K 1Z6RA 3NFAA 2A3ZA 4JGSA 3I5DA 3SCXA 3ZLJA 1JVMA 1QCEA 4OX9B 1HKCA 1NGEA 2NRRA 4RW8A 3ULDA 1S0VA 2VQEB 1NJWA 1V55C 1RPOA 2OTJV 2H89A 1O13A 4CF8A 1S76D 3H01A 3F9MA 3GQKA 3VTIA 3BP8A 2Y0PA 4LFAB 4DS4A 3NMUA 4YHHK 3U3GA 1H2LA 3HPOA 3THXB 1R6TA 3SJAC 3ZX2A 2AJQA 1YDXA 2HVHA 1ZBIA 3K57A 1Z7S4 2EJRA 3SUQA 3CCUN 3KZIZ 2QWPA 2YSUB 4UCTA 3VERA 5E84A 3ULEB 1VK0A 3VQ8A 3ABKC 2D3OW 1VSJA 4FZ1A 3PIOL 4B3RB 2WS3A 4FCYA 3QMLA 4JEPA 1L3SA 3P5JA 1LR1A 3QEXA 3QTCA 4GV6A 1U97A 1HWYA 1IO2A 3SJHA 3NH2A 3QEIA 3OGCC 3RWUA 1UFIA 3I8BA 3EE8A 3MN5A 3J80N 4A5AA 3J7ZO 3I55N 3SPIA 4WFBL 4MT8A 4JKFA 3KD1E 5ADXH 1JFFA 1NH2D 4R50A 2G8HA 4IFEA 4HTLA 5AQIA 4YFUA 1R3LC 4NCGA 2QM7A 2NRWA 3H45C 4BQZA 4DV0B 3BZKA 1HNXK 2GTDA 1HNWB 3ATUA 3HVTA 1HLUA 5CA3A 3ZT0A 5EZYA 1VF7A 5KRSA 1CXUA 4CEBA 1GM9A 4W5NA 4DTNA 1PO14 3E8HA 4MFBA 2V52B 4WQ5A 1Q6HA 2QWOB 3RYIA 1YSCA 4ZI7A 2HHHK 2HFEC 4GZRB 4DHYA 1MA9B 3AGRA 2D0BA 1U96A 2P5GA 2HHQA 3K0SA 3SYAA 2ZE7A 5AQYA 4X9QA 3CYMA 4BRCA 1GLCG 1W0KG 1BIUA 4YTMA 1K5SA 4FVMA 5KA6A 3WT0A 4GY2B 4ASUG 2B5JA 4DXWA 1NKBA 1HNZB 4BRLA 3APQA 2Q36A 1R6KA 2WWWA 1JJOA 3B40A 5KPRA 5HP1A 1FS0G 5CB4B 1D5AA 3NF8A 2FB5A 4GKKK 1OVYA 4WFFA 4QIWF 4EB6B 4K0KK 4I4TA 1NGAA 2M7WA 4O4HB 4RUEA 1M4UA 2VQEO 3BUZB 1AR1B 1IBMK 4ZHQB 3VQ9A 1VSFA 4UVCA 2WBNA 2HBMA 4EP4A 4LFAO 4FJNA 2ZIMA 4JZ2A 2YI9A 3M99B 1VARA 1BIZA 5AQPA 3DLRA 1YTFB 4JI1B 5JCOA 2HNZA 5HRPA 4DR6K 4LCUC 1IZ3A 2Q7HA 3HYFA 1L3TA 1KMIZ 4C23A 4C7UA 1QQMA 1X9MA 2E2QA 2R70A 2YHBA 4B1YB 1TVKA 3AY9A 4BRQA 1YITN 4F6RA 3K58A 1Q7YW 2E6MA 3ZHUA 1X9SA 2OCCB 3CCJN 3CS5A 3DOLA 4B3RO 4FJLA 3QO5A 2BOCC 3HKDB 2P9KA 3JSLA 1MSDA 4AHSA 1IDSA 3U4LA 2DYRC 3OW2U 1ASJ4 2B5UA 1C1AA 2V7ZA 1AP5A 3ZJZA 1U2VB 3CQXA 1HP8A 1PL4A 3RFRA 4B7EA 4GYCB 5IYCO 3L8BA 4DSEA 2ZE8A 2OT5A 3OYFA 1OOPD 3P39A 2P5OA 2R9IA 4W5OA 2GWJA 3SPCA 1YTAA 2ZM6K 2X5ID 3AE6A 3QFUA 4GMJB 5CHIA 3P3PA 1COV4 3VN5A 1K8AW 3JS6A 1H2MA 4X66K 1PNMA 2QWLA 5H5NA 3SGIA 4M3RA 4DV0O 2IAJA 3N27A 4BE1A 4FW2A 4BREA 3B8NA 1EAH4 1KP2A 1HNWO 2ATKC 2FBYA 4X65K 1BQMA 3VQ4A 2EBOA 1WSGA 3CETA 5FLXO 3WG7C 3JALB 4CJ7A 2Z1JA 1Q86O 2UUAK 4FZZA 3N2GA 1AI6A 4O2BB 4ISFA 3NCIA 4X64B 4CH4A 4BR2A 2ZJRL 1RUG4 3Q7BA 1BHBA 4CC6A 2JS3A 1DTQA 4YOXA 4H0YB 5GAEP 5AQJA 1L0LH 2G8WA 2X0LA 2HJFC 3UKRB 5GAHP 3LWMA 4EFBA 3UT5A 2EZOA 5F2VO 2W0FC 4AH9A 1FXVA 1S3JA 1DF5A 4BIZA 1YJWV 4LF4O 4E7IA 4ELTA 4F4KA 3FR0A 2AHYA 3BY6A 2P51A 2WU2A 1TAQA 1Y76B 4BWAA 1ZAUA 3SK3A 4ICGA 4KH6A 3BRCA 1SF9A 4GV3A 3JASB 4MSWC 3T1CA 1DEJA 5AQOA 2QSAA 3RVZA 2BTQA 2ITCC 3RMCA 1MNGA 3SJBC 1C6VA 5AQNA 1WA8B 1V4SA 5IE9A 3O08A 4OPKA 4CHYA 4JI1O 3EZ5A 5D3GA 2R074 2FTKA 4B3SB 1HQUA 4BRIA 1ZLZA 1TAEA 3TETA 2PZSA 2ASMA 4LFCB 2PYLA 5JMVA 1NK6A 3IDHA 3ABMB 3ZEUB 5FL7G 2FXUA 3PLAA 1NK8A 1OCOB 1S1VA 5LYJA 3LSQA 2HVIA 5KPZA 3AEFA 2FBTA 5JWPA 3ZRWA 2QA4V 3AA5X 2E5LK 2P9UA 3A2FA 2O8CB 2DYSC 1VQLN 2LW7A 3CFRA 4NTYA 1AR84 3H46O 5L3CA 3K5OA 4IOAL 4NVPA 4ZIBA 1BI4A 3KK1A 4WFNL 2ETNA 1QR8A 1QQOA 4O44A 3ZX6A 4MVQA 4O4LA 1VSIA 4E1NA 2F1MA 1IG8A 3FB6C 2QW9A 4LNUA 3HT3A 1JCFA 3HOTA 2I7NA 1PD3A 5LGUA 3CXCU 4LR3A 5AQVA 2HMPA 4B9QA 1IJJA 3KTQA 1XNQB 5BRHA 3CJ7A 3NVMA 4NO7A 4PL7A 3GVMA 5T7BA 4FOEA 1QZ5A 1JLEA 1KUQA 3ABLB 3B6PA 3AG1B 3BZCA 3RYHB 3TTCA 1IV0A 3HI0A 3MXIA 3JATA 1XHXA 3M6GA 3CQ8A 3LL3A 1FFTB 3GWKC 1K4CC 1NT2B 4K41A 2RDCA 4X64O 1VQ5V 2PI5A 2EINC 3B2EE 3MCAB 4I55A 3M8AA 1BS3A 4DS5A 1I3AA 3KKRA 4CESA 5EIBC 3SQ1A 1TK8A 2ZQMA 3C90A 4TV9A 2OPSA 2IU3A 3LWLA 4FLUA 1IBKK 3NHGA 3ZHRA 1QNMA 3FZFA 1HPZA 4MS2A 3RYCB 3AVBA 4PA4A 2P9SB 4J11A 1RTHA 5HLFA 4B08A 2GBZA 4BIUA 3ATVA 1BHLA 4IDKA 3WNEA 4FJMA 2DWDC 1VQOV 4KX6A 4K42A 1HUXA 4MVMA 2QXFA 1RUF4 2UXBK 1RDDA 1I94K 3E1YA 1ZBUA 2NLXA 1NVPB 3I56N 4NCAA 2V7QG 4JKAA 4CC5A 5M1QA 4CFBA 4PUOA 4LF8K 2RMU4 2NRVA 5LL6Y 1X59A 4JI7K 4B3SO 3MWPA 4HNAB 5AQUA 1TGOA 1VQPN 1S72N 2O8BB 2ZD9A 2YEVB 1T44A 5LMUB 3HKCB 1W97L 3AVKA 4LFCO 4LH5A 4DV3K 1T7PA 2L35A 2Z5UA 2ZNJA 4B3MK 2QI2A 1NJXA 1OCCB 3VQPA 1YIJV 3MK6A 1H2NA 2PFUA 3LP3A 2MW2B 4B1UB 5KGXA 4NXNB 2EIMB 4JI3K 4LFBB 3ZCMA 2Q4PA 4OVLA 1NJYA 3DLBA 3AE8A 3AO4A 1K34A 2FMLA 4DQQA 1SS6A 5LJVA 4AQYK 2Y4UA 4OGEA 4A61A 3M8SA 1L1FA 5AQMA 2H3GX 1KD1W 3WQUA 5J2QA 4PQUA 3G4SV 4KHPB 1WSEA 2P9LB 3T1AA 4FJJA 2PW9A 2ITDC 3CD6N 1BA0A 2E4LA 3OTOK 1M9NA 2HB5A 4PA6A 4J8FA 1YZBA 4A5BA 1XREA 3KWIA 3MEEA 1GMGA 3P4IA 1PKXA 2FBWA 1S1WA 5A2QN 2FKXA 1XNQO 3ZT3A 2B4JA 2KLAA 2OZSA 1KKCA 2OWOA 1SA0B 3HJFA 4X62K 1HRV4 5DK5A 4CZZA 3IJ4A 1NMDA 3WNGA 2UUCK 4H5WA 2QWQB 2D0CA 4Q4Y4 4I50A 1B3QA 4LF6B 1RFQA 1RBTA 3JSMA 4XH4A 3OYIA 3L73H 3AVLA 4JHDB 3WEEB 3OYCA 2A41A 3QNOA 3LM9A 4I9LA 4PDWD 3LDEA 1FXXA 1BL8A 2V1DA 3U10A 2P9NA 3B6OA 3F9KA 4DRXB 1NOYA 2V51B 3VA3A 1HQEA 1QLEB 3S41A 2JS5A 4X8AA 3MX2A 1KQSM 3SPYA 1W7AA 4O0JA 4M41A 2QR4A 4J10A 5IYDO 1G15A 1DLOA 2JJ2G 2BE3A 1B9DA 4FJ7A 1NMNA 2FBVA 2I5JA 3CM6A 4DV6B 5JICA 1NWKA 4ZBMA 3F73A 1YF5L 4DCHA 1BSMA 1I5XA 5IY5B 3PO4A 4CJTA 2Q73A 4H0LB 1GN3A 1RSOA 5CE3A 1RILA 4KTWA 2FC0A 4IKFA 3CM5A 2WLLA 1ZX3A 5CYQA 4IDHA 2G38A 3G0ZA 4R79A 4H5RA 3PN1A 1Z25A 3OJUA 2DFFA 1AR94 1W2BM 1TUBA 4FK2A 3DGEA 5LMUO 5B1NA 4FWRA 1F21A 4X1YB 2FL4A 2ITGA 2CUGA 1A5XA 2ZINA 1FKAO 1A5WA 4JASA 2CH5A 3RGBA 2KW4A 3D7EO 5JVGL 3T3FA 4NXNO 3SUOA 4QS8A 4LFBO 4QPJA 4E7KA 2G8UA 1JMKC 3T1HO 2ZIOA 1VQ4V 4CW7B 3RR7A 4WF9V 1WLJA 3RR8A 3CJBA 1NGBA 4MVOA 3HM8A 4IOXA 1SKRA 2Q7GA 1IG9A 5EVZA 4J42A 1RDCA 4CHPA 2X78A 1G8MA 5IYBO 3O9SA 4KHPO 1GN6A 4L8JA 2UXDB 3HTVA 5A9GA 3CCVV 1QS4A 5GTIZ 1GN2A 4CF0A 1AILA 2YIBA 2YHYA 3CC7N 5LHIA 1T6DA 4E0DA 2IW5A 2A0LA 1I0HA 4NR1A 5JVDA 3S3MA 1RT1A 3AEAA 4RHV4 4Q4X4 1NGHA 4J2BA 2KB1A 3TR8A 4CZFA 1VSMA 4UB8Z 4H5NA 3VENA 4R6ZA 4DF4A 2WAMA 3AG2B 2Q5ZA 3V9WA 4DW1A 3NH1A 3EXAA 1CPYA 4OGCA 1NH2B 2GUZB 3E9LA 4LF6O 4C8KA 4FW1A 4MLEA 2VQEK 3CWBH 5AR0A 1KF6A 1RGIA 3U6FA 3A5LC 4B3TB 4K3AA 1VBB4 3NVKA 2DW4A 2Z1HA 3EEQA 4LFAK 4P2ZA 3E66A 3AE9A 3OEHG 1RT5A 2HOEA 1DF4A 2Q3SA 4DQSA 1YXQA 2CGOA 1KVCA 4CI6A 1QSLA 4JI6B 4CHZA 2LSNA 1WAFA 4BR4A 5J2UA 1JLQA 4DV6O 3AO1A 2P4VA 1MSWD 4FWOA 3K5MA 2QM1A 2GV9A 2XOKG 3FAVB 2XAHA 2FSNA 4CZIA 4B9SA 4ID5A 4B3RK 4J7KA 3N4QA 1KTQA 2Z1GA 2BANA 3QETA 4JI0B 5GAGP 2ZR2A 1SESA 3K9SA 2YNGA 4FWSA 4CGIA 1O9HA 1J5EB 3C0BA 4HYOA 3DWLA 3H1QA 2QWNA 3VQ5A 1YHQN 3CIPA 4JYBA 1SQFA 4DSIA 2D2CB 3CJ1A 1D9DA 4FPPA 2WLNA 4F9OA 2G8FA 3T1YB 1Q81O 4ICLA 1TA8A 4ELUA 1OHHG 2LW1A 2ZCEA 2EWSA 3TI0A 3D6RA 2V7YA 5M1OA 4DV0K 3VEWA 2EIKC 2HNDA 3BEHA 1HNWK 2QWPB 1LWEA 3SNNA 3LNMB 5B3SB 2GDSA 1E4FT 4FWLA 1G99A 1NJZA 4DQPA 3QIOA 3AE3A 2PYJA 2UXDO 1R73A 2R9AA 3UE5A 1OCRB 3Q4HA 4FLXA 4CFDA 5H6QA 1XEQA 2OTLN 1H8HG 1KXPA 4EFEA 4CEAA 1Y64A 3TGUH 2O8FA 1B04A 3CCQN 1J53A 1SQXH 3DRPA 5CBHA 3SPJA 4NXMB 1SAZA 4LF4K 5GW7A 4A59A 4BDZA 1RDAA 2CAZC 1G4YB 3RMBA 5HFMA 1JFFB 1SQQH 1ZC6A 2ETJA 4M45A 5BMVA 1LAWA 1HNZK 4FLVA 4FJIA 2P67A 4FPAA 4CGJA 5JS1A 4WFAV 3LNNA 4DV5B 1S77D 2ZWHA 1NA1D 1UAXA 4DKWA 2EULA 1TAUA 5L3GA 5FDLA 1GOCA 2JJ1G 5FNVA 5BREA 4RW7A 4MTOA 4B3TO 1VSKA 4KH5A 5EZYB 1GKFA 3E22A 5DEDA 3SYOA 3WXIA 4OPHA 1S5HC 3LDLA 3AVIA 2DJVA 4JI1K 1JX9A 5KUMA 3RYIB 1S3XA 4ZI7B 3J8AA 4CK1A 2BDPA 2AZ0A 5FPNA 4JI6O 4OPAA 1XMOB 4ZKIA 2A1SA 3SYQA 2DY4A 3D2EA 3L70H 4TWKA 3W7UA 2Q67A 5B66Z 3CMEV 3E8BA 3CF5L 1VQ8N 1YEWA 1KYOF 2D5RA 3P1GA 4J41A 2P4KA 3BAAA 4Z4EA 2E3CA 4FFKA 2QEXV 2FSKA 1XNRB 1S1XA 4JI0O 3SV3A 3W7WA 4M63C 2FYUH 4PKHA 4BACA 4F3OA 3BCCH 3VESA 1E3MA 4YT0A 2RM24 1HW7A 1J5EO 4I4TB 4UFZA 5KAIZ 2CGJA 1TKDA 4FK4A 3AE4A 4B8AB 1NVPD 3IS9A 2GELA 4I7ZB 1BCOA 1C1BA 3ZT2A 3CI5A 3T1YO 5BXZA 3P4QA 2ZE2A 3L3UA 1Q82O 2WLIB 2F43G 3DRSA 3GE1A 4CF2A 1GH6A 3AGKA 4CGDA 3EO3A 3SUNA 4K8XA 5GONA 2WLHA 4F6RB 3NGIA 4R7CA 4IIJB 4Z2WA 4KBOA 5EK0A 4DFKA 3B4SA 4X20A 4H0PA 1PIV4 1Q18A 1V55B 3WB1A 5BZBA 5L3BA 1C0MA 2NRXA 3J80O 4X64K 1EFRG 2P9KB 3VR8A 4FL9A 4DFPA 1KFDA 3C65A 1KD1O 2F23A 4Y1DA 1NK7A 2YI1A 3RBZA 1H8TD 5EC2C 2ODMA 1HKGA 2RHKA 3WQTA 3OGIB 4NXMO 2NR5A 4Z1VA 2CTPA 4JTAB 3FE1A 3SJJA 3LM2A 4JPRA 1ZBFA 3NF6A 3A0HZ 3ABKB 3BHPA 2KZMA 3ZSRA 2QE7G 1NZ6A 4DV5O 2P1JA 3RYFA 5EY4A 5GIPA 4PI2A 3MECA 4U3JA 1PPJH 2JIZG 1BWFO 2HHTA 1YVNA 1VQ7N 4QOZB 1WN7A 3U9ZA 1Y74A 1XL4A 3RW0A 1NJIW 3THYA 1AROP 2VG6A 3N2GB 1TKZA 4PDMA 3VQWA 4H03B 2IIRA 3K9JA 2E75B 4LF5B 4B3SK 2ZD1A 1XMOO 2BOBC 1U48A 3F7YC 4FFBA 5ITZA 1NK9A 4O5FA 5BPMA 3UT5B 4Z4IA 1Z5WA 4LFCK 2JRIA 2IBZH 1Q43A 2WLKA 5C42A 4GVEA 3AO3A 4GX0A 1SKVA 1XNRO 3CXCM 3CSXA 1IXMA 1M56C 1F23A 2VCPA 3FZLA 3HOSA 5JLFA 4CEEA 2Z0AA 2OZMA 4A2AA 4OKEA 1ROPA 3H08A 5CY4A 1RUC4 4UCUA 3T2MA 2IH1C 1LOTB 4J9ZB 5IJ9A 1GOAA 2BTQB 4LF7B 3LAMA 4N21A 2ATQA 3STZC 4DLEA 3HR0A 1WNSA 1RM1C 2M6YA 4J80A 3OS0A 2BUPA 1XUQA 4FWNA 1N36B 4FK5C 3VQ6A 5FPEA 5J1EA 3KLEA 1LW0A 3HP6A 1SV5A 4ZTJA 3AE2A 4B1ZA 2RS14 5LGTA 3E2EA 1EBOA 3IUCA 2E2PA 3WB2A 1XNQK 3R66A 4DU3A 3SAHA 4CJSA 4CJ4A 3HKBB 2XY7A 4HWIA 1UA1A 4XEIA 3NE6A 5LYJB 2Z1IA 4OKKA 3OY9A 4MO4A 3CCEN 5AZJA 1BMFG 5JVHL 2GX9A 3ZRWB 1RPRA 4KV8A 1VF5B 1YVUA 2P9UB 1NNEA 1K4DC 4DU1A 3QERA 3CPEA 4KHSA 4YOYA 1RT3A 5GINA 4F6EA 1ORQC 1BI4B 1QE1A 1RT4A 4PD4F 3P83D 2ACZA 2VWKA 3CCMV 4O4LB 3EE9A 1YITV 3BGRA 2CH7B 4DSFA 1GAXA 2IGIA 2P9PA 1Q5OA 3DXMA 3IFXA 3ABTA 1SQPH 2DYRB 1QVGU 1YAGA 4NLCA 1K97A 1XQ8A 2Y69C 3BVOA 3ZBHA 5JQGA 3CCSV 2IJHA 1KFYA 2R7YA 1M57B 2BSKA 3O3HA 4BWJA 4CD3A 4I0XA 1H1VA 3EN9A 1BE3H 1Q90D 1QQCA 4J9YB 1SL1A 5KMGA 4BR7A 1H2SB 2LP7A 4HTUA 4LF5O 3NGYA 5LOVA 3JYTA 3SV4A 4B9MA 2KG7A 3L2QA 1VQNV 2YNFA 4UCVA 2QWMA 2CDYA 1YJ9V 5LMUK 2JEXA 1NU1H 2CGLA 3L0QA 3L71H 4TV9B 1EXQA 3LDCA 1VQMV 1VF6C 1J6ZA 4DTMA 4G27B 1BG3A 3RRHA 2UYTA 2VGNA 3VQEA 4NXNK 4KHNA 4LFBK 5C0YA 3WG7B 1GOBA 2X7RB 3T1HK 4BR9A 1DT9A 4BRNA 5SZTA 3LZJA 5HRSA 3ASMA 1M1KW 2O8EA 4M7YA 4LF7O 4KHPK 4FJ9A 2ZGYA 2XAFA 3CJ9A 4HUFA 3DC5A 4JRQA 5BN9A 1AJNA 1N36O 2YHXA 3TXQA 2BE2A 4DQIA 3O80A 1QHTA 4OX9O 4KP4A 3ZETA 1QLNA 3D36C 3C6UA 1RDUA 4H5TA 2RPIA 3HXMA 1RTJA 3IMXA 1FFXB 4CS3A 1YJNV 2X6BA 4BGBA 1Y6XA 3CX5F 4LH7A 4Z4FA 3VPZA 4U3FH 5IT9N 1YXBA 2RQ6A 3W0LA 1SS3A 2P90A 1I5YA 4F2RA 4LF6K 5FRMA 2OTJN 5IWAB 3PV8A 3NH0A 5MLCQ 3M8RA 2IJJA 3K0DA 1Q9XA 1NKCA 1NU0A 5IJ0B 2R044 1R3IC 3ENBA 2EZPA 3VEYA 4JLHA 1YQ3A 2XY5A 4I2QA 3U3YA 3SJQC 1VP7A 4JKGA 4M3UA 2DE0X 2RKIA 3DLKA 4YJ2B 5EU7A 3EFFK 4DV6K 1GLAG 4HCCA 3MWTA 1JLGA 4BRPA 1EX4A 1RT7A 2DTUA 1RDWX 2CGKA 2UXXA 2DQ0A 4MTXA 3LALA 5LMNB 3OYHA 1P90A 4CEFA 3DC6A 2YNIA 1PO24 1KC8W 5C2DA 4IOCL 5DN6G 4D7TA 2YHAA 4B1VA 4I50B 2ADPA 4ID1A 2NNWA 4DV4B 5EC1C 3X2QB 5CBGA 3HSCA 2Y0IA 4DW0A 4UY8O 5LJWA 5GIOA 1OH6A 5FPMA 2PUSA 3ZRXA 2P9NB 4JZGA 3LDQA 4CJLA 2A40A 3OYNA 3CFPA 4O2AA 2WDRA 3ID6A 4RQEA 1FK9A 1T3VA 3VBBA 3CC4N 1Q6IA 4DTJA 4ISEA 1TK0A 2XO7A 4EZ6A 1RVF4 3EY1A 2YV0X 4EZ9A 3J8F4 3WFVA 1E4GT 2VQFB 1RBVA 3DXRB 1R0AA 1WSJA 1T05A 3JAKA 3FZHA 3SYCA 3KVGA 2UXDK 4LF7K 2WLLB 4YORA 1HNZO 4MLHA 4IJAA 4PA1A 3TABA 3AA2A 1VEWA 3BA8A 1VF6A 3AK1A 3JD3A 4IWVA 3U8XA 1M90W 4BRAA 3IRXA 3S9HA 2HHXA 1N8RW 1CZ9A 3ALYA 3ETQA 1TUBB 3I8DA 4DU4A 3P4PA 5B1AC 4LP8A 4GX2A 1GM8A 1RTDA 1H8EG 5AFUA 5KX5B 2ZDIC 3F7VC 4I9WA 1COWG 4AHRA 3STLC 5KRTA 4WFAL 3TPQA 2QKCA 4YOUA 4XH1A 1RUJ4 1QBZA 3M5RA 4FLWA 4GT1A 3O4QA 2IJKA 1SERA 5IWAO 1NENA 1AP6A 1YVWA 4DV7B 1O9GA 1VSDA 1ZBLA 3VQBA 4B3TK 1R1BA 1Y66A 3ZRSA 4E1MA 3WXKA 3D36A 4X88A 3AG4C 1WSFA 1ENVA 3L4QA 5A2QO 4KI4A 1VBE4 5AQQA 4NB5A 1XUPO 1ATSA 3OYBA 5EBMC 3TCUA 2VRZA 4JRPA 4C8LA 4JI6K 4CD1A 1VQPV 1S9EA 4RO2A 2A6AA 1DGSA 1ASWA 1JOYA 3ZSZA 4XH5A 3AAPA 5JVDB 3K59A 4FWMA 2B76A 4JS4A 3ISNC 2HMIA 1D8YA 4XDLA 2QKBA 1R094 2OCCC 2JWLA 3ABUA 4JI0K 2RNBA 4XDKA 5H9CA 2WU5A 2P22C 1WJZA 5FPRA 3HKEA 4NLBA 4DV4O 1NOZA 3THXA 4GKJB 4B1XB 1KAYA 1NJIO 1J5EK 1BL3A 3FB7C 4WCEV 1CP9A 4BG9A 2DOSA 1S1TA 4Q20A 5LP6C 4YY3B 3TSPA 4GX5A 1U04A 3CERA 3U9DA 3T1YK 4PDVA 3ULEA 1GK9A 1TYQA 2VWBA 4JYAB 2Q6AA 2AW9A 3E9PA 4DTPA 3GB7C 4B9LA 4KHUA 2DQ3A 3AG3B 1RUH4 4UUJC 3VA0A 1SKWA 2W0XA 1HYZA 5KGWA 1LUWA 4FZ0A 1IX9A 1S22A 1FW6A 1EETA 5KQDA 4HUEA 4FVUA 5D5PA 1NGFA 5B5EZ 1EZJA 2XT9A 2VQFO 3HP9A 3K3WA 3EHBB 4ZOLA 1IURA 1VRH4 3O9QA 4DO2A 4KB0A 4DTXA 3FLCO 2F9TA 1U4BA 4FLTA 1GN4A 5H6RA 4PA7A 5K1PA 3DTUB 1V54B 1YJWN 2QWNB 1SQBH 4BE0A 3V1QA 4NXMK 3O9TA 3QICA 1UOCA 2AXTZ 3I33A 2JEUA 1VAZA 5LGNA 3VR9A 1N0JA 2RN9A 4CK3A 4IEEA 4DV5K 1WBBA 1KBHA 1N33B 2LO1A 3TU5A 1QHAA 4ELVA 4DV7O 1ZL8B 3H3OB 3C7NA 5LHHA 3E8GA 3QG5A 4W4LA 2WTUA 3WU2Z 3SYPA 1LW2A 4XIUA 1M93A 4UV9A 3ZIAG 4Z4CA 1GM7A 5FLXN 1POV0 1ZSPA 4AI8A 1RBSA 2GTSA 3EL2A 4KHWA 3Q4HB 1RDBA 1R3KC 1X3MA 2ZDIA 4DV2B 1MWKA 3KD5E 4J2AA 1XMOK 2O8FB 4L87A 5D5QA 1WPBA 1GLFO 1Y67A 4QGPA 4CJQA 4FJ8A 1DK1A 2KFZA 3C94A 4N23A 4D7SA 2DN9A 1VHXA 2N74A 1EWQA 1XNRK 5BMVB 4KUMA 1OCOC 3OYKA 4MTGA 3VGLA 3EYZA 1TV6A 4K25A 3CRCA 4YXWG 3J7AU 2CK3G 1NGCA 3DI6A 4DG1A 2QTOA 3QVNA 3ITHA 3F5WC 2IC3A 5C10A 3JXUA 1EM1A 5FNVB 3PSIA 1L5UA 2F8SA 2ZT9B 1JCGA 4CK2A 1WOQA 3FFQA 3E22B 4YY3O 3AEBA 4CJEA 3QLHA 1PNLA 1QVFM 4E7HA 3DLLL 4JYAO 3KCYA 2JGDA 3ASNC 2NRHA 1A32A 1MDUB 1W9HA 5C8YA 4TUYA 3AVGA 2NUBA 1WAZA 4DK1A 4DK0A 2ZXWB 5L3DA 3KKYA 5TISZ 1N0NA 1DTTA 2VGMA 2WFBA 5F2RA 3B8AX 3H1IH 2NRZA 3AG1C 3OYEA 1U2VA 4K0KB 5KUKA 2DPNA 4JKDA 3A5NC 3HK2A 5LP6A 1N4CA 3QBXA 4PHZA 3AEIA 1EQYA 3QEWA 1WP8A 1M1KO 4M42A 3SMSA 4JAUA 4LH6A 3CIRA 4DFJA 2RN2A 5M1KA 3MN6A 5LXTA 1O1WA 4E7JA 2CTQA 3TAMA 5BPLA 1NBWA 2RMKB 1AI7A 1L0NH 2WP9A 3K0GA 5DM7L 3L75H 1CZBA 1P84F 4PDLA 3W7TA 2PTMA 3AVAA 3V1RA 1JJ2M 4Q4W4 4CFAA 3T19A 3O1BA 1VMGA 1K8KB 3MCPA 3WUHA 3M1FA 3LSUA 1BT8A 4QCLA 2P9IA 1BGYH 1V9PA 2VWJA 1N33O 4FJ5A 2C2AA 4WQ4C 1AJQA 3PX0A 1IKYA 1QSSA 5GONB 4U7NA 1DKGD 4ISGA 4A57A 1HRHA 3NGZA 3CC2N 3FI7A 1X4TA 5K14A 3RMAA 4X20B 3NDKA 5AG2A 3SFDA 3N2KA 3I0RA 4KHYA 2DWEC 1K9MW 1DLBA 1VQKN 3D3QA 1Q7YO 4CS2A 4RW9A 2YX6A 1ZP0A 3AEEA 1K33A 4JD2A 4A5UB 1K6YA 4OPJA 3MHHC 4LF5K 2WONA 3OVNA 4IEIA 3E01A 1THZA 4TV8A 3L6QA 4CGFA 4MVZA 1SETA 3ETDA 3VF6A 1FPOA 2EIKB 3O9UA 1YIJN 3G71N 1KLMA 3AECA 5AQTA 1ATRA 1OCCC 1JQ0A 1VQ6V 4FLZA 2H94A 4X65B 1JCHA 1NGIA 4LH4A 2IJIA 4LD0A 5JJJB 2EIMC 3RYFB 4YIOA 3ZHSA 1D2DA 4U3JB 3B09A 2NZTA 3OMIB 3G4SN 1YI2V 2HHWA 2V4DA 3KK7A 1K8AO 2RCVA 2Q2RA 1J95A 1Y74B 3CJHB 3CRMA 1Z5VA 2UUBB 1IKXA 2Q0AA 4EP5A 4BY9C 2OTLV 3T4DA 3THYB 3ZMTA 1N36K 4E7LA 4UVBA 1HRI4 4D6TH 3JD74 4XDJA 3VEOA 1YF2A 3V9ZA 4G1QA 2ITMA 3ZEUA 2YICA 2JK5C 1F4MA 4OX9K 2YDEA 1KU9A 3P3NA 4FFBB 5ITZB 2E74B 3C95A 1BGXT 2BH1A 4CEDA 1GTOA 4BDYA 4JS5A 4NCBA 4AHTA 4C1NI 2JLEA 4CERA 4FJGA 1AB3A 1ASUA 1EP4A 5C3JA 4O4GA 3JAMN 1NTZH 2GUIA 2QXLA 4BE2A 4ABMA 4CEZA
chains in the Genus database with same CATH topology
5JH7B 5EIBD 3WNHA 1JXBA 2OPPA 1YT3A 4R5PA 4WE1A 3RYHA 4JI5B 3HL8A 1NK0A 1C0TA 4IG3A 3MAQA 4TOIA 1X1PA 4KI6A 4IFVA 4CHNA 3V81A 3ZSQA 1Z26A 4X1KA 3HSTB 4M3YA 4BW9A 2YIBD 3DM2A 2HNYA 5KTQA 2D0AA 3ZSYA 1UWBA 4DMNA 2O4IA 5JQGB 3QEPA 4LSNA 4KAZA 2KZZA 1SUQA 4UCRA 4KRFA 5E41A 4IG0A 4JI2B 2DFEA 5CZ1A 1S5JA 4DR7B 5LOVB 2JGUA 1C0UA 1J9AA 4H4OA 3NBPA 1Y97A 5K1XA 2Y1IA 4HCBA 1S6QA 4YJ3A 2E6LA 1RT6A 2HHVA 5JS2A 3MXJA 4KREA 2IS3A 5HBMA 4KPYA 2DFHA 4UCSA 1B92A 3SZ2A 4B9UA 4DR2B 1C1CA 4CH5A 1TKXA 1VSEA 3OYDA 4F2SA 5CA0A 4PWDA 3AO5A 3L2RA 1XHZA 4B9TA 2UU9B 4WBNA 3LPUA 1TVKB 1CLQA 2HW3A 4O4JA 3S3OA 1EKEA 2F96A 3OYLA 1LV5A 4CEOA 4LF9B 1TKTA 3CFOA 4CJKA 1IBLB 5BR8B 3AVMA 3DLHA 3LZIA 2KFNA 4HUGA 4DUZB 3DMJA 1KCFA 3VQ7A 5IYZA 4ZHRA 3K5LA 4RW6A 4B3OA 4GVMA 1HR0B 4CGGA 4F3TA 3OS2A 1G6UA 3AA3A 1KVAA 3AVJA 2OA8A 1S6PA 3VQVA 3JAKB 4M3WA 1J54A 4DSKA 4BWMA 5J2TA 1JLCA 2JVDA 4K8ZA 4DR4B 3O4NA 1N32B 1HYSA 3BDPA 1JL1A 1XI1A 4CJRA 2YKMA 4DFMA 4CEQA 1N34B 1KFSA 4FYDA 4J2EA 1YTUA 1TL1A 4DSJA 5KHIA 1LWFA 2RJZA 3TANA 4O0IA 1QSYA 4TQFA 5EYPA 2EHGA 3IG1A 1A5VA 4CHOA 4DWIA 3JAWA 1NK5A 3KLFA 1B9FA 4HBNA 4TQDA 4JI8B 3HKEB 1Q9YA 4LNUB 3O3FA 1I7FA 4DV1B 3SUPA 3QEVA 1RBRA 4KFBA 3JATB 3AA4A 3V6DA 2UXCB 4I55B 2RF2A 4W5RA 4ZTFA 1TL3A 4ZOLB 3RWRD 4UCOA 3SI6A 3KLGA 4O55A 1X9WA 1FJGB 4N47A 4KB1A 1BISA 4GW6A 3QO9A 3LAKA 1JL2A 3ZSOA 3IAYA 4KO0A 3HVRA 1SQGA 3QESA 1L8DA 4CCHA 1IKVA 4FLYA 4C8NA 3ICXA 3KIOA 1XMQB 1I39A 2Q7EA 2R72A 1Q8IA 1N5YA 2VG5A 1BCMA 3ZS8C 3VQQA 4LF4B 4Z0UA 4DLGA 2XY8A 4IHJA 4J2DA 5LA6A 1VRTA 5KI6A 4W5TA 4DF8A 3BABA 1HNVA 3S3NA 3OYMA 5FROA 3TAEA 2F4VB 4IIJA 3JSNA 4IBNA 1ZYQA 3AO2A 5C8YB 2BGGA 4FM2A 1LAVA 4TUYB 4KTQA 4DUYB 4FZXC 4UQGA 5LP6B 3SYZA 4FXDA 5FPOA 3MEDA 2G8IA 1U45A 4OLBA 5LXTB 1BQNA 1RTIA 3LDSA 3PO5A 4DR5B 1Q3EA 4DR1B 1RCHA 4DTUA 3SR2C 3KLHA 1U49A 5KHJA 5CA1A 5HROA 4M3ZA 3N2KB 1S9GA 1RT2A 3MEGA 4E3SA 4FK0A 5CYMA 4B9NA 4Q5VA 4TV8B 3KLIA 2IM9A 2HHUA 5DMRA 3TAQA 4HHTA 4FZYA 4YNQA 3JARA 4O4IA 2ZQBA 4X1IA 1FKPA 2X74A 3ZEDA 3CB2A 1IKWA 1VRUA 4I2PA 3ZSWA 4B9VA 5KHKA 1ASVA 4H8KA 1T03A 4DR3B 1T8EA 3LP0A 3HKBA 3D0PA 3SQ4A 4JI4B 2XY6A 3TARA 4CJ5A 3DLGA 3K2PA 2OYQA 3AVCA 4CIGA 4KHQA 1L3UA 1FKOA 5I3UA 5J2UB 4PI0A 4JV5B 1NK4A 3KK2A 3L3VA 4CH6A 4DTRA 4YHHB 4FM0A 4RG8A 2F95B 4AILC 3RRGA 4N56A 2X6NA 4NYFA 4CIFA 3K5NA 4M3TA 3M8PA 1P49A 2F8TA 4X1KB 5C25A 4MQ3A 1ITGA 3LP2A 1LWCA 1L3VA 4O5BA 4C8MA 1QTMA 4Q6GA 4CS4A 3OYAA 3CHXA 1CXQA 5CB4A 1JLFA 1HNXB 1HJRA 4EB6A 2XRIA 4O4HA 3UQ8A 4ZHQA 1FFXA 3QNNA 2HHHB 3U0ZA 3PX4A 3T1HB 1JLAA 1S1UA 1JKHA 4CECA 3SJCC 5IJ0A 3HKDA 4YJ3B 4YJ2A 1N6QA 4GKKB 3BPZA 5I42A 1IBMB 3NAEA 4I9QA 4DR6B 3THOA 4IFYA 4FJHA 4CJWA 4Y1CA 2KTQA 3TAGA 1RNHA 5CA0B 1WAJA 5J2NA 3L2VA 4CJUA 2KKWA 3JALA 2WOMA 4M3XA 4WBNB 4O2BA 2OPQA 3V4IA 4O4JB 5HRNA 3DOKA 3WB0A 4DQRA 3HPHA 2ZM6B 1TK5A 4X66B 2HHSA 3JASA 3L2UA 2W42A 3QINA 5IYZB 3RMDA 5KX5A 3M7MX 2UUAB 4QAGA 1SL2A 4KTZA 4N5SA 4Z4GA 3DSQA 2ZNIA 3AVHA 2O4GA 1XC9A 3ZT1A 3I0SA 4N41A 4F8RA 5J2PA 2F93B 4E19A 4DTOA 1IH7A 3VQXA 3V9SA 1NKEA 5J2TB 4AHUA 2VG7A 4CH3A 5HRRA 4W5QA 3DLEA 1KLNA 5IJ9B 1VSLA 4FM1A 3QIPA 2G8VA 5SWMA 2KQ2A 3PUFA 1D9FA 1WSIA 3BA9A 2E5LB 3ZSXA 4B8CA 4E89A 5EYPB 2PGGA 2FBXA 1HYVA 3OYGA 2YKNA 3RYCA 3JAWB 5KHGA 4DSLA 2HEPA 3M8QA 5JJNB 5JJEB 4I7FA 1SL0A 2EX3A 2X6SA 4Z4HA 1VSHA 1HMVA 3ZSVA 3NF7A 4CE9A 3SPZA 4HNAA 2IOCA 1TVRA 3HKCA 1ZBHA 3UIQA 5KMGB 4TSXA 1IBKB 4AHVA 1W0HA 4FJXA 2A1RA 4BDPA 3LANA 4LY7A 4PY5A 4CJPA 2XHBA 2UXBB 3OS1A 3O3GA 1I94B 2YIAA 3WNFA 3AV9A 3VQAA 3CG7A 2OPRA 3HPGA 4LF8B 4KKOA 4CIEA 3D45A 4JI7B 3G10A 3AVFA 3MXMA 1KVBA 3SQ2A 3PY8A 4N76A 1SA0A 4NYNA 1REVA 4DV3B 4Q0BA 4B3MB 4GLXA 4OJRA 3V9UA 4JI3B 5KHHA 2QK9A 4CF1A 3VQYA 4AQYB 2F66C 4DRXA 3ZT4A 5C24A 3OTOB 5FRNA 3HO1A 4LSLA 4CJFA 4EEQA 3HM9A 4IHJB 3TAPA 3U11A 3OTFA 4HVJA 3DRRA 4OKJA 4L8RB 5LA6B 4X62B 1RBUA 3KJVA 2UUCB 2G8KA 4DTSA 1HNIA 1J5OA 4RW4A 2Y1JA 2YNHA 2R7FA 4X1YA 1XWLA 3LP1A 1M5IA 1KRPA 3KK3A 4H4MA 5CZ2A 4O2AB 2PY5A 4FJKA 4KL1A 1T5EA 4C8OA 3RTVA 3FFIA 3SQ0A 2B6AA 2IDOA 1U47A 3NF9A 2BTOA 1WSHA 1JLBA 1UA0A 3PX6A 3TWHA 2YI8A 4CFCA 3QF7A 3V1OA 3VQDA 5J2MA 1KSPA 5CA1B 2QKKA 3TAFA 3C6TA 3KKSA 3VQCA 2QM4A 3OJSA 3V9XA 1JXEA 4CGHA 4CHQA 3DYAA 3L2WA 2QJ1A 4CJVA 1MU2A 4CF9A 2YXLA 3LPTA 5JH7A 3THVA 4OLAA 4CJ3A 5JCOC 4AHCA 3AVNA 3JARB 1SKSA 4O4IB 3OYJA 4X1IB 3NFAA 3SCXA 4RW8A 4OX9B 3ULDA 2VQEB 1NJWA 4CF8A 4LFAB 4DS4A 3U3GA 3HPOA 3SJAC 2AJQA 2HVHA 1ZBIA 3K57A 3SUQA 4UCTA 1VK0A 3VQ8A 1VSJA 4B3RB 4FCYA 1L3SA 3P5JA 3QEXA 3QTCA 1IO2A 3NH2A 3QEIA 3RWUA 3KD1E 1JFFA 2G8HA 4YFUA 4NCGA 4DV0B 1HNWB 3HVTA 3ZT0A 5EZYA 1VF7A 5KRSA 1CXUA 4CEBA 4W5NA 4DTNA 4MFBA 3RYIA 4ZI7A 2D0BA 2P5GA 2HHQA 3CYMA 1BIUA 4FVMA 2B5JA 1NKBA 1HNZB 1JJOA 5HP1A 5CB4B 1D5AA 3NF8A 4EB6B 4I4TA 4O4HB 1M4UA 4ZHQB 3VQ9A 1VSFA 4EP4A 2ZIMA 1BIZA 2YI9A 3DLRA 4JI1B 5JCOA 2HNZA 5HRPA 2Q7HA 3HYFA 1L3TA 1KMIZ 1X9MA 2YHBA 2R70A 1TVKA 4F6RA 3K58A 2E6MA 1X9SA 3DOLA 4FJLA 3HKDB 3JSLA 4AHSA 1C1AA 3RFRA 4GYCB 3L8BA 4DSEA 3OYFA 2P5OA 4W5OA 1YTAA 4GMJB 3VN5A 4M3RA 3SGIA 2IAJA 4BE1A 4FW2A 2FBYA 1BQMA 3VQ4A 1WSGA 3JALB 4FZZA 2Z1JA 3N2GA 4O2BB 3NCIA 4X64B 4CH4A 4CC6A 1DTQA 2G8WA 3LWMA 4EFBA 3UT5A 4AH9A 4E7IA 4ELTA 4F4KA 2P51A 1TAQA 4BWAA 1ZAUA 3BRCA 3JASB 2BTQA 3RMCA 3SJBC 1C6VA 4OPKA 4CHYA 3EZ5A 5D3GA 4B3SB 1HQUA 1TAEA 2PZSA 4LFCB 2PYLA 1NK6A 1NK8A 1S1VA 5LYJA 2HVIA 2FBTA 3AA5X 3A2FA 3CFRA 3K5OA 4NVPA 4ZIBA 1BI4A 3KK1A 4O44A 4O4LA 1VSIA 4E1NA 2F1MA 4LNUA 3HT3A 4LR3A 3KTQA 1XNQB 5T7BA 1JLEA 3B6PA 3RYHB 3MXIA 3JATA 1XHXA 3CQ8A 1NT2B 3B2EE 4I55A 4DS5A 1I3AA 3KKRA 4CESA 5EIBC 3SQ1A 1TK8A 4TV9A 2OPSA 3LWLA 4FLUA 3NHGA 1HPZA 3RYCB 3AVBA 1RTHA 5HLFA 4B08A 2GBZA 4FJMA 1BHLA 4IDKA 3WNEA 2QXFA 1RDDA 1ZBUA 4NCAA 4CC5A 4CFBA 4PUOA 4HNAB 1TGOA 5LMUB 3HKCB 3AVKA 1T7PA 4LH5A 2ZNJA 1NJXA 3VQPA 3LP3A 5KGXA 4NXNB 4LFBB 3ZCMA 4OVLA 1NJYA 3DLBA 3AO4A 4DQQA 4OGEA 3M8SA 4PQUA 5J2QA 1WSEA 4KHPB 4FJJA 3T1AA 2PW9A 2E4LA 2HB5A 3MEEA 1S1WA 3ZT3A 2B4JA 2OZSA 2OWOA 1SA0B 3HJFA 5DK5A 3WNGA 2D0CA 4I50A 4LF6B 1RBTA 3JSMA 3OYIA 3OYCA 3AVLA 3QNOA 4I9LA 1FXXA 1NOYA 3U10A 3B6OA 3F9KA 4DRXB 3VA3A 1HQEA 2JS5A 3SPYA 4O0JA 4M41A 1G15A 1DLOA 4FJ7A 1B9DA 2I5JA 2FBVA 3CM6A 4DV6B 3F73A 3PO4A 4CJTA 1RSOA 1RILA 4KTWA 2FC0A 4IKFA 3CM5A 5CYQA 3G0ZA 3PN1A 1Z25A 3OJUA 2DFFA 1TUBA 4FK2A 1F21A 4X1YB 2ITGA 1A5XA 2ZINA 1A5WA 2KW4A 3RGBA 3T3FA 3SUOA 4E7KA 2G8UA 1JMKC 2ZIOA 3RR7A 1WLJA 3RR8A 1SKRA 2Q7GA 1IG9A 1RDCA 4CHPA 2X78A 4L8JA 2UXDB 1QS4A 4CF0A 2YIBA 4E0DA 5JVDA 3S3MA 1RT1A 4J2BA 3TR8A 1VSMA 4DF4A 3V9WA 3NH1A 4OGCA 4C8KA 4FW1A 3U6FA 4B3TB 2Z1HA 1RT5A 2Q3SA 4DQSA 1KVCA 1QSLA 4JI6B 4CHZA 2LSNA 1WAFA 5J2UA 1JLQA 3AO1A 3K5MA 2GV9A 4B9SA 4ID5A 1KTQA 2Z1GA 2BANA 3QETA 4JI0B 2YNGA 4CGIA 1O9HA 1J5EB