2EX3A

Bacteriophage phi29 dna polymerase bound to terminal protein
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
570
structure length
570
Chain Sequence
b'RKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA polymerase
publication title The phi29 DNA polymerase:protein-primer structure suggests a model for the initiation to elongation transition
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transferase/replication
total genus 150
structure length 570
sequence length 570
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2ex3A04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ex3A01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2ex3A03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2ex3A02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2ex3A05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2ex3A06
1JLAA 4FW1A 2BGGA 4AH9A 4CJLA 4CEFA 1B9DA 1J9AA 2YKMA 4AHTA 5KRSA 4LH4A 1BCMA 1N5YA 4CGFA 4DQRA 4PQUA 2P5GA 2XHBA 3L3UA 3SZ2A 2HHXA 4CFAA 4DLEA 1IG9A 4KTQA 4DFKA 5FRMA 1QSLA 2IDOA 2F96A 4CFCA 1CZ9A 4I2PA 1TK8A 2X74A 3WNHA 2KZMA 1UA1A 3RMCA 3AVCA 3ZSVA 2HNZA 4CGHA 3K5NA 3VQ8A 1X1PA 4BACA 1FK9A 4CK3A 3PO5A 4CJPA 3D0PA 4CEDA 4PUOA 4M45A 3AA4A 3VQ7A 1L3TA 3MAQA 1DTQA 1GOBA 4KHWA 1HYSA 2IGIA 3QIOA 4Z4FA 1JLEA 4LH5A 2F8SA 4CJ4A 3MXJA 1VRTA 3MXMA 3NAEA 2E4LA 3UIQA 2R7FA 5CY4A 4FYDA 4B9LA 1CXQA 4NCAA 1UAXA 4PA1A 4FLYA 1S9EA 3NF8A 4DSEA 1QE1A 3RMDA 4N56A 1NOZA 3B6PA 3KLEA 1IO2A 1RDCA 1WAFA 1F21A 4OKKA 4CJTA 4M3YA 4OLAA 4DTUA 4CGGA 3ASMA 5C24A 1WSIA 1ASUA 1WSGA 1CXUA 3IRXA 3QLHA 4H4OA 4Y1DA 4LY7A 3OYJA 4M3TA 1KTQA 4DSFA 2P51A 1SUQA 1Q9XA 2ZQBA 1IH7A 3OVNA 3TAFA 3ZSXA 4KB0A 4KRFA 3LP2A 4FM2A 1NJYA 2G8WA 3OYHA 4FJJA 4FLWA 3AA3A 4BWJA 3DLRA 4FJ5A 1EXQA 1JKHA 3G0ZA 1NJWA 4KI4A 2PYJA 4CHNA 1NJZA 1LV5A 1JXEA 4C8OA 3NH0A 4FK4A 3QEIA 1VK0A 3TWHA 4FJNA 4F3OA 3KKRA 3OYIA 1Z25A 4J2EA 1RILA 1RBTA 4CIFA 4W5QA 3VA0A 4I9QA 3D45A 3DLGA 1ZBHA 3SYZA 2BE2A 2X6NA 3DRSA 3LP1A 4FVMA 3AVBA 4ZHRA 4DTRA 1NJXA 3O4NA 2KQ2A 4KAZA 4DWIA 1ASWA 3LPUA 4FJ8A 5J2MA 4CESA 2WONA 1HQEA 3EYZA 1UOCA 3AVIA 4HTUA 3THVA 1VSHA 1W0HA 1D8YA 5DK5A 2WOMA 4H4MA 4I2QA 4OJRA 1XWLA 4DFPA 4FLZA 3CFPA 5KTQA 3KLHA 4JRPA 3V9SA 4GMJB 4RW9A 4H8KA 4CJQA 1KFDA 2QXFA 3FFIA 3NF9A 3P5JA 3HPHA 1SL2A 3AVKA 4E19A 3OYFA 4Y1CA 4FM1A 1RBRA 2FBVA 3OYCA 3L2UA 3LDSA 4FLTA 1X9WA 1BI4A 4B08A 1HYVA 2RN2A 3MECA 2A1SA 1TK5A 4XIUA 4O0JA 2Z1IA 3G10A 3VQPA 3OYMA 4HUGA 4B8CA 1L5UA 3U3YA 3P1GA 2E6LA 4G1QA 3V81A 4K8XA 3HO1A 4F3TA 1S1XA 4CEZA 2B6AA 3PUFA 3KLIA 3KLFA 3OS2A 3ZSYA 3OYAA 4CF2A 3ULDA 5I42A 2FBTA 2G8HA 4OGEA 1RT6A 4ID1A 3ZCMA 4CFDA 3OY9A 1X9SA 3ITHA 2RPIA 4OPJA 4W5RA 4AHRA 3L2WA 4DSKA 3AVGA 1VSKA 1RDDA 4AILC 3CYMA 4NCBA 1YTAA 3T19A 2XY8A 1B92A 4OVLA 4ZTFA 3RRGA 5SWMA 4EZ6A 5J2QA 1NKCA 3PX0A 1DTTA 1RBSA 3AA2A 5I3UA 1NK0A 3AO5A 4KTWA 4E1MA 4FJIA 1SV5A 4KI6A 1S1UA 4W5TA 1U45A 4ELUA 4RW6A 1YTUA 2KFZA 4E0DA 3CM6A 3QNOA 3LALA 1RT3A 2YNGA 5HRRA 4CEEA 5SZTA 3S3OA 2HHQA 4PWDA 1QS4A 3CQ8A 1QTMA 3QETA 4B9SA 3QESA 1WLJA 3TR8A 4CJKA 1TKZA 4CJ5A 3SNNA 2VG5A 2IC3A 4Q0BA 3A2FA 3M8RA 2X78A 1VSDA 3O3FA 1RT1A 3OYDA 1GOAA 5HP1A 3V9XA 1L3UA 2OA8A 3F73A 2O4GA 2Y1JA 2XO7A 5CYMA 2PZSA 3ZT4A 1IKWA 1ZBFA 3SQ4A 1KVAA 4C8LA 3M8QA 4CEAA 4DU1A 4DTXA 1T03A 1A5XA 1BHLA 4NYFA 4OKEA 3I0RA 4CF9A 1VSLA 2OPSA 3I0SA 5CZ2A 1TK0A 4FJXA 1S6PA 3V1RA 3LAMA 3CG7A 3RRHA 4CECA 1TKDA 4RG8A 3K57A 3ZSQA 4QAGA 1TL1A 3VQAA 4BDYA 4HVJA 1SL0A 3HXMA 4C8KA 5C42A 3DLBA 4Z4CA 4I7FA 3LZIA 1D9FA 3AVNA 1JLFA 3QERA 4F2RA 2ZE2A 4FZXC 1BIUA 3ZSRA 2XY5A 1KRPA 4FCYA 1DLOA 3HYFA 2HVIA 3NGIA 4DQPA 3U3GA 3NGZA 2IOCA 2YV0X 4J2AA 1FXXA 2HB5A 3KKSA 4KFBA 1ZBIA 3AVJA 4IBNA 2D0BA 1I39A 4QCLA 4L8RB 4UQGA 3L2VA 2EHGA 3VQ6A 4DS5A 3LP0A 4IFYA 4NCGA 3RMAA 4DQIA 1XHXA 3T3FA 3IG1A 1S1WA 3ZSWA 4C8NA 3IAYA 1ZYQA 4HCCA 3QEPA 3S3NA 4RW8A 4OGCA 2QKBA 3AVMA 1RT4A 1BIZA 4B9MA 4Q5VA 4FZZA 2VG7A 3DRPA 2YNFA 1KVBA 4BWMA 3O3HA 1JL2A 1LWCA 3KD5E 4BE2A 1HQUA 2OYQA 1J54A 3KTQA 4CE9A 5KGWA 3TAEA 3TI0A 4E89A 3TABA 4JS4A 3HJFA 2D0CA 5JS1A 5HRSA 1VSJA 5E41A 4DSJA 2PY5A 1IKXA 2ZD1A 3HPOA 3SPZA 1W9HA 3TARA 4FJMA 3DLEA 5HBMA 4CHQA 3DYAA 3QEXA 2BANA 4BDPA 1RBUA 2VWJA 1WSJA 1HNVA 3NF7A 3OJUA 2E6MA 4KHQA 3CFOA 3HK2A 1RT5A 3AO4A 1NKBA 3RWUA 4EZ9A 1C6VA 2HMIA 4CJFA 3HP9A 4IDKA 3KK3A 4GVMA 5KGXA 2F8TA 3SUPA 1LAVA 3ISNC 3I8DA 2DY4A 4DTMA 4DFJA 1HMVA 3RMBA 4JS5A 1RT2A 3U6FA 4M3XA 4CERA 4KHUA 1HYZA 3TAQA 5JS2A 3NH1A 1NK7A 3V6DA 5FROA 1RTJA 4KKOA 2GV9A 1YVUA 3DMJA 3MEDA 4O44A 3VQ5A 3M8SA 4HUEA 4DS4A 3JSMA 1QSSA 3EY1A 3K58A 1A5VA 3CM5A 3AV9A 1A5WA 4W5OA 3KK2A 2P1JA 3HT3A 2OPQA 3NFAA 1KVCA 1RDBA 3M8PA 4E7JA 2PYLA 4IG3A 3ZSZA 3CFRA 4E1NA 1SL1A 5D3GA 4N76A 4TSXA 2DTUA 3PY8A 1S1VA 4O4GA 3EZ5A 1I3AA 2ATQA 2HNDA 2B5JA 2P5OA 5HROA 1XC9A 2IAJA 3OYNA 1WAJA 1X9MA 5K14A 1K6YA 1VSMA 1NK8A 1BI4B 1VRUA 3HVTA 4DTPA 4KHNA 3DI6A 2EX3A 3SJJA 1NK5A 1RTDA 5EU7A 3AO3A 4CGDA 4ICLA 3OJSA 3S3MA 3AVAA 4GW6A 4YFUA 1EETA 4BE1A 1L3VA 1J5OA 1D5AA 4O5BA 3OYEA 3SUQA 2OZSA 4LSLA 3KK1A 4CHZA 4E3SA 1QSYA 2X6SA 4CJRA 4PY5A 3K2PA 4B9TA 1SKSA 1T7PA 1HNIA 3QNNA 2G8FA 3NHGA 3V1QA 4OPKA 1T05A 4B8AB 1BQNA 3QO9A 1NK9A 3K5OA 3E01A 1HPZA 4DSLA 2OPPA 3TANA 4EP4A 1Q8IA 1VSIA 3IS9A 3SV4A 1S9GA 4Z0UA 3BDPA 4FM0A 3ZT3A 3L8BA 4JLHA 3VQEA 1LWEA 3V9WA 3RR7A 1HJRA 1S6QA 4C8MA 3S9HA 1NK6A 4QOZB 3AA5X 4Z4IA 1U48A 4CEBA 3VN5A 3O3GA 1UA0A 3LPTA 1WN7A 4BE0A 1ZBUA 4DFMA 2HHSA 3MEEA 1RBVA 4KPYA 4IG0A 4CJSA 4EP5A 4DG1A 2HNYA 1C1BA 1EP4A 4AHVA 4Z4EA 4WE1A 4M3ZA 2B4JA 2BDPA 4CJEA 3H08A 4F2SA 2HHTA 2G8KA 3ZT0A 5DMRA 1C1AA 4CCHA 4KV8A 2YHBA 3KIOA 1WSFA 4CEOA 3HM9A 4M3WA 4B3OA 4M3UA 2VWKA 2OZMA 3QIPA 2IS3A 1TKTA 3KJVA 5FDLA 1NKEA 2KW4A 1RCHA 4B9NA 3NGYA 3PX6A 3LANA 1TGOA 2YKNA 1D9DA 1UWBA 1TVRA 2Q3SA 4M3RA 2QK9A 4BDZA 1HRHA 2JLEA 3HP6A 1L3SA 4CF1A 1R0AA 4CEQA 1Y97A 3LWLA 1JLGA 2NUBA 1SKRA 3K5MA 4FLXA 3HSTB 5C25A 4DTOA 4F4KA 3VQCA 1BQMA 4CHOA 3V4IA 2FBXA 1U04A 4CIGA 4O0IA 4N41A 3RTVA 4DQSA 4DF4A 1S5JA 1XI1A 3V1OA 5T7BA 1ASVA 4NYNA 4FJHA 1QHTA 4CIEA 3FI7A 3ZSOA 4KO0A 4B9VA 1TL3A 4FLVA 1J53A 4FW2A 4KTZA 3DOKA 4FK0A 3TAMA 3OYGA 4FLUA 2LSNA 4CGJA 4CJVA 4HUFA 1SKWA 4KREA 4J2DA 1JLCA 3SPYA 2DFEA 5HRNA 4O55A 2G8IA 3DRRA 2HW3A 1C0MA 1GOCA 2YNIA 4E7HA 4LSNA 3C6UA 3BGRA 5CYQA 1ITGA 4KB1A 3C94A 1RNHA 2AJQA 1JL1A 3KD1E 4CJUA 4FJ9A 4CF8A 4MQ3A 3TAPA 2G8VA 3C6TA 3ZT2A 3WNFA 1Q9YA 4I9LA 3HVRA 4AHUA 2YHAA 3PO4A 3AO2A 3DLKA 2Z1GA 3VQ4A 3LAKA 4CJWA 3QEWA 1LAWA 4DTSA 4HHTA 5FRNA 1TAUA 1CLQA 4B9UA 3QINA 2I5JA 4DMNA 3SQ2A 2PW9A 1LW2A 1U49A 1IKVA 3OS1A 4FJLA 3WNEA 2HVHA 4E7LA 1LWFA 1C0UA 3L2RA 2A1RA 4DSIA 3WNGA 1TAQA 4MFBA 2ETJA 3VQQA 4IFVA 5CZ1A 1S1TA 4E7KA 4DTJA 1JXBA 4DLGA 3L3VA 3F9KA 3SQ1A 1WNSA 1CZBA 3MXIA 4KHSA 2D0AA 4JRQA 2QKKA 1KFSA 2XRIA 2DFHA 3SV3A 1RTHA 3NF6A 1KLMA 1BL3A 2FBYA 3MEGA 3T1AA 2GUIA 2VG6A 3KLGA 4ELTA 1G15A 4RW7A 3K59A 3B6OA 3AO1A 4CJ3A 4DTNA 1B9FA 2R7YA 1FKOA 1NOYA 5KRTA 4ELVA 1BISA 3PX4A 1RT7A 1TKXA 2GBZA 4HCBA 4Z4HA 1KLNA 1IKYA 4CF0A 1U4BA 2ITGA 2D5RA 1EX4A 3P83D 3JYTA 2XY7A 1RTIA 4CGIA 3RR8A 4IKFA 2W42A 1WSEA 4K8ZA 4J2BA 2KFNA 3ALYA 3NBPA 1YT3A 3LZJA 4E7IA 4DU3A 3SUOA 1ZBLA 2HHUA 3NE6A 1T8EA 3QEVA 2KTQA 3HPGA 3AVHA 1VSEA 4YNQA 1O1WA 3V9ZA 1NK4A 1KCFA 1BCOA 2OPRA 3L2QA 3OYBA 2G8UA 4FJGA 5J1EA 1RDAA 4DF8A 3NCIA 5J2NA 3LWMA 4F8RA 1C0TA 4LD0A 2Z1JA 4FZYA 2RKIA 1BGXT 1LW0A 3ZT1A 3TAGA 1C1CA 3OYKA 2O4IA 2DFFA 3K5LA 3VQBA 3HL8A 1XHZA 3DLHA 4M41A 2HHWA 4ZTJA 2HHVA 5HRPA 4OLBA 3VQ9A 4CK2A 3VA3A 4M42A 4CHYA 3PV8A 1Z26A 3OS0A 3LP3A 1VSFA 3SUNA 1QQCA 4ID5A 4FJ7A 3SI6A 5KI6A 4RW4A 4CFBA 1N6QA 2XY6A 4CK1A 4W5NA 3SQ0A 4OKJA 1WSHA 4N47A 3OYLA 1REVA 1TV6A 4R5PA 2YNHA 3C95A 4KHYA 3V9UA 4FXDA 3NH2A 2Z1HA 1U47A 3DM2A 4DU4A 3DOLA 4FK2A 4AHCA 3NDKA 5HLFA 4CHPA 1KSPA 2JGUA 2RF2A 2FC0A 4FJKA 1EKEA 3AVLA 5J2PA 3O4QA 4DQQA 4Z4GA 1FKPA 1MU2A 3VQDA 4N5SA 2KZZA 1JLBA 3SCXA 4AHSA 1JLQA 2Y1IA 3AVFA
chains in the Genus database with same CATH superfamily
1RUD4 3RYHA 3ZJZA 2FSNA 2BGGA 1B9DA 2CGJA 2OANA 5KRSA 4LH4A 1I94K 1P7GA 5JCOA 4Y0WA 3OGCC 4IL6Z 3L3UA 3SZ2A 3OGIB 2Q0RA 2Q9LA 4CFAA 4CZKA 5FRMA 3MHHC 2IDOA 3X2QB 1BZKA 1RP3B 3E8HA 4BC4A 4CFCA 1CZ9A 1TK8A 2KZMA 5AQRA 4NCBA 1YAGA 3CJCA 4LFBK 4YT0A 3L70H 2QWPB 5AQWA 5FLXO 3VOUA 3OD4A 4M45A 4K41A 3AEBA 1YQ4A 2QWQA 3TXSA 4ZIBA 5IWAO 1JX9A 3H1KH 1FJGB 4MT8A 1HYSA 4DV6B 2E3CA 4LH5A 5C10A 4HAMA 2Q0UA 3VBBA 4Z2WA 4YDUA 1BWFO 2Z3YA 4JKGB 3ZIAG 4WQ4C 4EHUA 4DV4O 4RQEA 1CXQA 4FLYA 1NS1A 3HKEA 3B6PA 5E26A 1N8RW 4GY2B 3TJTA 3LSUA 1EZVH 1RDCA 3FZFA 3JBG4 1GO3F 4CH4A 1E79G 2ZM6B 1O9HA 4MVRA 5C24A 3E9LA 4M3TA 4H4OA 4Y1DA 4LY7A 3L72H 4IYIA 2XOKG 5KA6A 2P51A 4B1YB 3ASOB 4DR3O 1SUQA 1WOQA 2NNWA 2ZQBA 3OVNA 4KB0A 1Q82W 1YXBA 4JKBA 3QG5A 3AG3C 4B1XB 1GM8A 1NKDA 3FB7C 4PELA 4LF5K 3APOA 5LOVA 4BRKA 4B3RO 1YJNV 2P9LB 1JKHA 3WXMB 2FXUA 2O8EB 1NJZA 5B1BB 2DW4A 3QEIA 4YXWG 4DV6K 3O1WA 5GONB 3CMEN 4UVBA 2B1IA 5FNVA 4CZFA 1Y66A 1RBTA 3VRAA 4JI3K 1ZBHA 3JD0A 1KKDA 1NJXA 3AVBA 4IJNA 4ZHRA 4DTRA 4JI8K 5HL7L 3FB6C 4KAZA 2KQ2A 2EILC 4BIUA 3RYCA 1BL8A 1RM1C 1Q7YW 1VQLV 3LPUA 5LHHA 5LYJA 5L3CA 1VQLN 3EYZA 1D2DA 3AVIA 1XL6A 1IBKO 2OTLN 1SA0B 1M5IA 1D8YA 4AQYB 3PSIA 2UU9B 4H4MA 4I2QA 4OJRA 3GOIA 1RPOA 4X1KA 3CD6N 1NGDA 4ZI7A 4X20B 5CB4A 2P9IB 3P38A 5ITZA 3P5JA 3HKDA 3FFIA 3NF9A 4MO4A 4G2KA 3OW2M 1SL2A 1JQ0A 1FXVA 4Y1CA 4PA7A 5BN9A 3CPWM 4FLTA 2VQEO 1BI4A 1IVSA 1IBLB 2FF3B 3N2GA 2RN2A 4HWIA 5M1QA 3N27A 2EIKB 4HUGA 4JD2A 1BS3A 4MS2A 3P1GA 2E6LA 2IM9A 4LF7K 2ASPA 4LR3A 3KLIA 3OS2A 3ZSYA 5F2VO 4CF2A 1XOUA 3W7SA 1NGIA 3SBGA 1QCEA 4OGEA 1RT6A 4CFDA 5LJVA 1S72V 1NZ6A 2W0FC 4W5RA 3AEAA 4AHRA 1N36B 4M7YA 1N34K 1VQ4N 3AE4A 1RDDA 5E79Z 1YHQN 1NBMG 3T19A 2HG5C 4OVLA 3RRGA 1E1RG 2DWDC 2E74B 3SYCA 5SWMA 5J2QA 5JJJB 1NH2B 1OCCC 3WQUA 2DOSA 3DC5A 4X62B 4KTWA 2CGKA 4M7XA 1ESVA 1K73O 1Z05A 4ELUA 2EJRA 1YTUA 4DQ8A 1U2VB 5KPZA 1VP7A 2B5UA 4XDLA 2BUPA 2ZQMA 5EYPA 4MVZA 4J42A 4O2AB 3ZHRA 3K0GA 2RE2A 3H6EA 4CEEA 4GKJK 4FFKA 2WFBA 3OTOO 3I55V 1NVPD 2ZD9A 3JCZA 5CA1B 1H2SB 1VHXA 1WLJA 3AK2A 3O9TA 1V4SA 4CJ5A 4Q0BA 2GBOA 1VSDA 3O3FA 4JKHA 1S77D 3GG4A 1L3UA 1RUJ4 1GN3A 1IJJA 5CYMA 3SJBC 3M8QA 3HSCA 4DTXA 1K8AO 4B7EA 1A5XA 2A0LA 1NWKA 3B40A 3DXMB 5EBMC 3I0RA 2WP9A 2NZTA 1TK0A 4BR2A 3CG7A 3CCQV 1IBMB 1S5LZ 1W0JG 1HNXO 1TKDA 3CCQN 1B06A 4WFNL 4RG8A 3ZSQA 4K0KK 3RYHB 3CRQA 3F5TA 4DV7B 3C6AA 4HVJA 4JI5O 3HXMA 1H1VA 4XBFA 1TUEB 2YSUB 5DM6L 3LZIA 1D9FA 4MSWC 5ADXA 2VQFB 3AVNA 3ETGA 1WP7A 1ZXOA 4FZXC 3ZSRA 2KHOA 1GN4A 2XY5A 4JKAA 1E3MA 4ISFA 2HVIA 1C0FA 3U3GA 4QE7A 4I50A 4KFBA 5AQVA 4FMTA 3THOA 3LDCA 2IIRA 4JI2O 3F5WC 1KECA 1FXKC 4B9QA 2WLHA 3WXLA 4RAIA 2UXCB 4NCGA 5IYDO 4BG9A 1XHXA 5JLFA 2ZWHA 3IAYA 3MX2A 4RW8A 2QJ1A 2YJFA 3JS6A 2WDVA 3CCJN 1FFTB 2ZT9B 3DRPA 1VBD4 5KAIZ 1JL2A 3MDSA 4BE2A 2WAMA 2F1MA 2EJ7A 2A40A 2H8PC 3FE1A 4E89A 4U3FH 1R59O 2F9WA 4LP8A 3HR0A 5CMUA 3TSUA 1BDGA 5HRSA 3CMAV 1VSJA 4PKIA 1THZA 5LHGA 1IZ3A 3MHSC 3CMAN 2HVJC 3SPZA 5FPMA 3J7AP 1YVNA 3DLEA 5HBMA 3HKBA 3DYAA 3N2KA 2BANA 4C1NK 5BPNA 2VWJA 4BDPA 1AL24 2E6MA 2ZM6O 2YXLA 3L73H 1SQFA 2WLNA 1D4XA 1RT5A 5HOOA 3AE3A 3RWUA 4WQ5C 4PA9A 3QBXA 4X66K 3X2QC 4D7SA 4L87A 2F7TA 4O4LA 3E1YA 4CJFA 2UXBB 2VYPA 5GTIZ 1LAVA 2DY4A 3BP8A 4Q4Y4 2KKZA 2LO1A 3MN7A 4TUYB 1NI8A 4JS5A 4M3XA 5FNVB 4CERA 2DMXA 1LOTB 3HOTA 2E1ZA 4JV5K 1HYZA 3TAQA 1NG9A 1WPBA 3EE9A 1NK7A 2JJ1G 3B77A 1G4YB 5FROA 3M8SA 4DS4A 5L3BA 1ZOYA 4HUEA 4X9QA 2WLLB 2HBMA 3EY1A 3K58A 3A8YA 5IY5B 3CWBH 3EKUA 2UXDO 1VEWA 4LWSA 3U8XA 4WF9V 1R3LC 4CH5A 3KK2A 5LYJB 5LY3A 4TV8B 3NFAA 1KVCA 1H2NA 2KB1A 4WQ4A 3CCEN 2ZJRL 4IG3A 3O08A 1KBHA 5EBLC 1SL1A 1SQXH 4X1YA 1YUWA 3PY8A 1YITV 3EZ5A 1I3AA 2WTUA 2ATQA 4ZI7B 1JMKC 5CB4B 3VR9A 4YJ3B 5ITZB 3HKDB 5J2TB 2HF4A 3ASOC 3E35A 1VSMA 1NK8A 3MMVA 1JJ2M 1BI4B 4KHNA 3HVTA 2R044 3N2GB 3QTCA 3OT7A 3SJJA 4JYBA 1NK5A 3VOVA 3OJSA 4JD2B 3S3MA 3AVAA 4BE1A 1L3VA 3SUQA 3KK1A 4CHZA 1DGKN 3VEOA 4NYKA 3UQ8A 1IBLO 3W3DA 2Q68A 5B1BC 4QGPA 2ZF5O 4IOXA 1BOTO 1HNIA 4J2BA 2V52B 2YIDA 4BRDA 1BQNA 3QO9A 1Q5OA 1HPZA 2LFSA 4DV0B 3RWRD 1DK1A 4GX5A 3AK1A 4I55A 2YI1A 1VQMV 3IS9A 4HTLA 5AQQA 4DUYB 1S0VA 1OVQA 2FMLA 2HHHO 2WQYA 4JLHA 3CF5L 1LWEA 3V9WA 1HJRA 3S9HA 1WJZA 1NK6A 4Z4IA 2L35A 1U48A 2OTJN 3LPTA 1WN7A 4EIAA 2HJDA 3DAWA 4BE0A 4X64B 3MEEA 3WEEA 1K5SA 1OCRC 4DG1A 4EP5A 4Z4EA 4JZGA 2CUGA 2GUZB 4AM7A 2CAZC 1VQPV 3H08A 3UB5A 4LC9B 1AB3A 3STLC 2G8KA 4F2SA 1HXS4 1C1AA 3SLCA 1G99A 4BRQA 4IHJA 3CPWU 1HNWB 1WSFA 5JICA 2KSDA 4M3UA 3RVCA 5LHIA 3QIPA 1TKTA 4CI6A 1NKEA 1VQ7N 4BY9C 5CBFA 3D6RA 4JAVA 4LH6A 4M3RA 2EIKC 2QK9A 4DR6B 5HFLA 1OJHA 1HRHA 1YI2V 2YIAA 3BRCA 3ASNB 1HNZB 4JYAK 2FKXA 2GSMB 4FLXA 5C25A 1H2GA 4NB5A 3O1BA 1VF6C 4X1IA 3ENOA 1U04A 4CIGA 4O0IA 1YQ3A 3CCLV 1J5EB 4DQSA 1S5JA 1R6KA 4DR4B 5LL6Z 1QHTA 3TCUA 4CIEA 4JK7A 3LSSA 2RR14 1J53A 2P9SA 3T1YB 2H94A 3OYGA 4FLUA 2RS54 1VQON 5KHIA 4BC5A 3E86A 3SPYA 2F43G 5HRNA 3WXIA 3JD74 3MCAB 3DRRA 1KXPA 3THWB 2HW3A 4E7HA 3CS5A 3C6UA 5I9EB 5B1OA 1OCOB 3ZN0A 4EKWA 4KB1A 5AQOA 2AJQA 4EHTA 2W0XA 4QS8A 2UUBO 1R094 2YHXA 2Q0AA 3N4PA 3U0ZA 3KK7A 5GTHZ 4CZMA 1W0KG 4BW5A 1N33O 3HTVA 4YSZA 1GM9A 2QI2A 3VQ4A 3QEWA 1K9MW 4DTSA 4JYYA 4B9UA 4WBNA 2UXCO 3M5RA 4DMNA 3OUFA 1NGJA 5AQIA 4FJLA 1N4CA 1NH2D 1XMQK 3R66A 1LWFA 1YCIA 1C0UA 4DSIA 2Q7GA 2ZIOA 3LUTB 3Q4HA 4JKCA 1S1TA 1JXBA 3NR7A 3L3VA 1VAZA 2VGMA 4B1WB 3CXHF 3MXIA 2D0AA 4JRQA 3HKBB 1M1KO 4R7CA 2R064 5A9GA 1RTHA 3NF6A 1KLMA 1BL3A 2FBYA 4X65K 2GUIA 3KLGA 4RW7A 3B6OA 5LMUO 3G4SV 4OXSA 3C3TA 1RUG4 1UPGA 4UCVA 4O4LB 3O65A 1OOPD 1KLNA 2O8CA 2X7RB 2A42A 2ITGA 3JSLA 3RYIA 3GBTA 5JVDA 3P83D 4CF0A 3JYTA 2E5LK 4J7ZA 1WSEA 3ALYA 4XEIA 5D5QA 1RUI4 1YT3A 3Q7CA 1R3IC 2JWKA 3SUOA 3A8TA 2HHUA 3NE6A 4NXNK 4DV3B 3K9SA 4F4LA 1FD9A 2ATKC 4WYBA 1VSEA 1AR64 4DR5K 3THYB 4P2ZA 4GLXA 1O1WA 3FLCO 1CXZB 1FXKA 3V9ZA 2OPRA 3O9UA 4FJGA 3OYBA 1H2KA 3TTCA 1M93A 4I0XA 4UFZA 3FFKB 4LF9K 1ZSPA 4JEPA 5J2NA 3CRAA 4P9PA 1NLVA 5GAEP 4QNHB 1TVKB 4DR7O 4U7BA 5KUMA 4JF3A 2XT9A 4H0YB 4TV9A 1XHZA 4AF1A 3IC7A 4M41A 3TK1A 4CZLA 5HRPA 2HP8A 2AZ0A 4GX1A 4CHYA 3PV8A 3CXCM 3OMIB 1XREA 2N04A 3T7ZA 3SUNA 5C15A 4B3MB 4CZZA 3SI6A 2UUCK 2QWNB 2HBKA 4CK1A 3SQ0A 2D0OA 4R5PA 4KHYA 2Z1HA 3FGUA 3DM2A 4DR1O 1NU1H 4DV3K 4CZIA 4WQ5A 2Q36A 4CHPA 2FC0A 1NGHA 4UVAA 2B76A 3KCXA 3AVLA 3O4QA 1MU2A 3GE1A 2E2NA 4PKHA 2KZZA 5EZYB 1COWG 5H6RA 4MTGA 4I55B 3K79A 4O2BB 4AHSA 1JLAA 1OVYA 2QWPA 3ZCCA 4V19S 4XH1A 5BY1A 3DTUB 4CEFA 1J9AA 3VESA 3ZLJA 3B8NA 3SJQC 4DV0O 4CGFA 4DV2K 2XHBA 3T1HO 5C2DA 2GTAA 3WEEB 4LF4B 1MMMA 3FB8C 2EILB 4DUYO 1QSLA 2YDEA 3WNHA 3F7YC 1SESA 2P6JA 4DR2O 1VQ5V 4FIPC 1UA1A 2NLJC 1NU0A 4GNIA 3ZSVA 1X9JA 4IHJB 4I6MA 4BACA 1FK9A 3AEEA 3DXKB 3ZBHA 4CJPA 4B3SK 1N32K 2BSKA 1KU9A 3JATB 3VQ7A 1K3EA 2Y69C 3ETQA 4NB4A 4BR7A 4NTXA 4WFAL 4BRLA 1LCUA 3QIOA 3J7YP 1XMOK 4JI6K 4KHWA 2F8SA 3RVYA 4GCZA 1WB7A 2BTQB 4KP4A 3MXMA 4KXRA 2AA4A 4UXNA 1HR0O 1HP8A 2HVKC 4FYDA 2R7FA 4BR6A 4TWKA 4QE9A 1NGEA 5FPNA 3NF8A 2UUAB 3SBTA 3SMPA 4DSEA 2OCHA 2GEMA 4ZHQA 5AQHA 1RFQA 3K0SA 4X1IB 3DLLL 2GWJA 1QR9A 5AQJA 4NXMB 4DTUA 4CGGA 3QB0A 1OH8A 2BCCH 3BCCH 2R72A 1ASUA 1WSGA 3QLHA 4FPBA 5AJ3K 4YSXA 3AG1C 2EULA 3F7VC 1BMFG 2X6CA 3C65A 4YOYA 3SFDA 1NR1A 2P9SB 1J5EO 3ZRXA 3N4QA 2E20A 3LP2A 2RS14 2PGGA 4UCUA 1NJYA 1OCCB 4K25A 2G8WA 1NT2B 5IWAK 3JSNA 5CBGA 3A0IX 5GADP 4BWJA 1QR8A 3S3XA 4MVMA 3G6EV 5LMNB 1EXQA 2JJ2G 3FZLA 3T1YO 3G0ZA 4YY3B 4CHNA 4KI4A 4DV4K 3NH0A 4JKEA 1VK0A 4JI7O 3CSXA 3KKRA 3ZS8C 1XQSC 1Z25A 5AQZA 4J2EA 5IYBO 4CIFA 3SYPA 3WB2A 4JI4K 3DLGA 3SJHA 2KQXA 3DRSA 4WBNB 3LDQA 3HKCA 4DWIA 1ASWA 4GB34 2P4KA 4J10A 4DR3K 2BTOA 3LNMB 3Q4HB 1QZ5A 3SYOA 2WONA 2OT5A 1XNQO 2F4VB 3GQKA 1YJ9N 2A7WA 3THVA 1VSHA 3FZHA 5CBHA 3M8AA 3OMNB 3LM2A 2E2QA 5EBWC 5DM6V 1SERA 1RPRA 5KHKA 4B3RK 3P4SA 5JWPA 1AJPA 1M57B 1VF6A 4RW9A 4H8KA 1KAXA 3AAPA 3EL2A 5AR0A 4CJQA 3HPHA 3AVKA 4FM1A 3J80N 3LDSA 2ZNJA 4JAAA 2IJJA 4B08A 1HYVA 3MECA 2XUMA 4XIUA 3RYIB 2Z1IA 3VQPA 3OYMA 5KQDA 4JI1O 5DM7L 2E8AA 1XNRO 3AG4C 3ZETB 2YHYA 3QMLA 1BGYH 1N5YA 3BDPA 3CHWA 4FVUA 3E8BA 5K1PA 1SZTA 1U2VA 4IIJB 1TUBA 4PDMA 3A5MC 3AGRA 4U67L 1QQMA 4BROA 3VERA 1FXKB 1IBKK 3L2WA 3H46O 2F93B 2FTKA 4JI0B 2CE4A 2CH5A 1YVWA 1DTTA 1RBSA 3AA2A 4BR5A 5I3UA 3AO5A 2CK3G 4KHPO 1NK0A 1SV5A 3NVMA 1QHAA 1U45A 4LFAO 2Q2RA 1S5HC 3CC2V 3AGKA 4RW6A 4WFEA 1AJNA 2ZXWC 3ABLB 3MD0A 4DV5O 2ZE5A 3CM6A 1EV14 1HRI4 3H1LH 4BIZA 1RT3A 3JARA 2J4RA 4EEQA 2ZE7A 3CCRV 1QS4A 3QETA 1B04A 1GLJO 2HMPA 3CCRN 3SNNA 2VG5A 4UY8O 2IC3A 3A2FA 2P9KA 1RT1A 3H45C 1WLEA 1GOAA 2AHZA 3SAGA 3F73A 2NRZA 4YTNA 3ZT4A 1IKWA 1PL0A 1MSWD 1KVAA 1POV0 1EZJA 1KQSU 3TPQA 2OIEA 4CEAA 1T03A 4DK0A 1MNGA 2VWBA 1GLLO 1VSLA 3EN9A 3AEDA 5CZ2A 1GLFO 3RRHA 4A5BA 4CECA 2R074 4LF5B 1Y64A 1RSOA 2Q73A 4JI0K 5FPRA 3DJCA 4QAGA 4DUZO 3VQAA 4BDYA 3BF3A 4OX9B 1VBC4 2QWRB 1QQNA 1XC3A 1R73A 4X8AA 5JVGL 4C8KA 3FB5C 3OTOK 3IMXA 3DLBA 2Y4UA 4Z4CA 3ABVA 1ATSA 2DJVA 5IDJA 4JI3B 1V4TA 2JDIG 2RCVA 5KX5A 1N0JA 2CTPA 4PDVA 1JLFA 2ZE2A 4RCHA 3IDHA 4XH5A 3QERA 4Z94A 4FCYA 5C8YA 1RMU4 4MDAA 1Y67A 2QTOA 4JI8B 2MW2B 4GKKO 5EK0A 3ZRWA 3CXCU 3P4IA 3NGZA 4UVCA 4LF4O 2IOCA 2KG7B 1YF5L 4I6MB 4BGBA 1ZBIA 4IBNA 3EXAA 3A0BZ 2PLV4 3T4DA 4JTDB 4WFHA 2Q69A 1YTFD 3PIPL 4QCLA 2BSKB 4DQIA 3L2VA 2XAGA 2EHGA 3VQ6A 4CH6A 4DS5A 4BC2A 2F66C 5BMVA 1Q81W 4BVPA 1F23A 1SS3A 1O13A 1HNXK 1NM1A 3IG1A 1ZYQA 4C8NA 4HCCA 3QEPA 3VQXA 3S3NA 3LDEA 3D3QA 3QBWA 3AVMA 4B9MA 1BIZA 1L0LH 4HNAB 2XAHA 2A3QA 3K3WA 3O3HA 4H0LB 4UCRA 4ZHQB 1XUQA 1LWCA 3KD5E 1KF6A 3U9DA 3KCYA 5KGWA 4UCOA 3TAEA 4OX9K 1QNMA 1YJNN 3B2EE 3TABA 3LDOA 3CX5F 1Q86W 1HUXA 4WFFA 1FFXA 1AR74 4TUYA 5E41A 4LF7B 1SZXA 3U11A 1IKXA 3HPOA 3BUZB 3TARA 5JJEB 4FJMA 4JKFA 4KL1A 3EO3A 3QEXA 1RBUA 3NF7A 1JCFA 1HNVA 5KPRA 3J81O 3OJUA 3CFOA 5BR8O 2RMKB 2WLLA 1NKBA 1P49A 2IJIA 4PA4A 1SQKA 1N34B 3CCVV 1EN4A 4FWKA 1PD3A 1OCZC 3IGAC 5K1XA 4TV8A 5KGXA 3KK3A 1OCRB 3SUPA 2UXNA 2EBOA 1MA9B 3U6FA 4UV9A 1ZP0A 1NR7A 3BA8A 4YY3O 2V51B 5JS2A 3NH1A 4DV1O 4IO9L 1RTJA 4YJ3A 5J2TA 3DMJA 3V6DA 5AFUA 3UO2A 2DWEC 1JA8A 2YEVA 4GKJB 2ACZA 3SUCA 3LSQA 3HKCB 1DF5A 3A0RA 3D8CA 4NKGB 3SDLA 1A5WA 3CM5A 3THXA 2W6LA 2P1JA 4CW7B 4O4IB 1H8TD 4M63C 1GK9A 3B8MA 1RDBA 3BA9A 1VARA 2YIBA 4BREA 3CFRA 4A5AA 4EFHA 1X3NA 3MX5A 4J41A 1BT8A 5FL7G 4YHHO 3KWGA 4XDJA 1BUPA 2F95B 3OFNG 3JASB 4FFBA 4BQZA 3OTFA 1GLAG 2B5JA 2P5OA 5EVZA 5HROA 3QO8A 4BC3A 5AQSA 3I5DA 4FWPA 2E1YA 5K14A 3O9SA 1S72N 3FKSG 2LW7A 4PI2A 1GRJA 3ZRVA 1BA1A 1VRUA 3GWKC 4FWMA 1U96A 3DI6A 3C6HA 4CBCA 1RTDA 4K0KB 1EN6A 3CE2A 2IVOA 1EETA 2OCCC 2OZSA 4O5BA 4FOEA 3UM7A 5DEDA 5AQXA 2JGDB 1QSYA 5JJNB 4PA3A 2X6SA 4CJRA 2UXDK 4PY5A 1TUBB 4I4TB 3K2PA 2O8DB 2G8FA 2GUZA 3V1QA 2CDYA 3NHGA 4B8AB 1I94O 3E01A 4JKDA 1NK9A 4D6TH 4DSLA 2OPPA 3I55N 1NJIO 1Q8IA 1YEWA 3ETEA 2ZE6A 1KFYA 3VQEA 3T69A 3RR7A 1RUC4 5LBQA 4CEBA 3O3GA 3BHPA 2HHSA 4KPYA 1RBVA 4LFBO 4IG0A 1JCEA 1Q18A 3AECA 4F6EA 4LF6O 3IC9A 3JARB 4M3ZA 4KBOA 2NLXA 2Q1NA 4DCHA 2HHTA 4J9YB 2QW9A 3LDDA 1M57C 4OGQB 3SPIA 2YHBA 3KIOA 4KV8A 2LGQA 2P9KB 5MLCQ 4M3WA 2VWKA 2OZMA 2GUPA 3G67A 1RCHA 2NRRA 4UCTA 3PX6A 3LANA 1TGOA 1ROPA 1M90O 1D9DA 3VGMA 2IBZH 1JJOA 2DE0X 1OHHG 4CC5A 3GB7C 5FPEA 1IV0A 2I7NA 2XNDG 1L3SA 4PKGA 4CF1A 2HHHK 1R0AA 2BH1A 4NVPA 2NRHA 2NUBA 5KHGA 1RSOB 4X66B 4DTOA 3THWA 4F4KA 4CHOA 4JK8A 4MW8A 1M56B 4TQFA 3DXRA 2W6IG 4DF4A 4H0TB 3QO5A 1J6ZA 2JEXA 1XI1A 4YIPA 5T7BA 3H9VA 1ASVA 1IG8A 4NYNA 4JNEA 1FAFA 3ZSOA 3R65A 5LA6A 4BAYA 4B9VA 3IFXA 4JV5B 2R9IA 5KX5B 5BR9A 1JCHA 2IJKA 3FX7A 5C8YB 5AZJB 2LP7A 4CGJA 4CJVA 1FJGO 3ABLC 3ZRWB 4DV6O 3OBYA 2G8IA 2BE3A 4O55A 2EZOA 5J2UB 4BRPA 1PV0A 3VGLA 3C94A 1L0NH 1RNHA 4FWOA 4FSVA 1I5YA 5BMVB 1U6ZA 4CF8A 4U3JB 1DKGD 3C6TA 2H89A 4J8FA 4AI8A 1Q3EA 4RTFD 3CJ7A 1RVF4 4O4JA 2EIJC 3AO2A 3DLKA 3LAKA 1LAWA 1ZWIC 4HHTA 1TAUA 3R3LA 2PW9A 2I5JA 3SQ2A 1Q6HA 1Y4MA 2WU2A 3CB2A 1LW2A 3BF1A 1KC8W 1IKVA 1AI6A 1U49A 1SQGA 2ADQB 4CS4A 1T6CA 3WNGA 1PO24 1I7FA 5GIPA 1KAZA 3C7NB 4MFBA 4O8KA 4IFVA 3VQQA 2ASOA 1FFXB 5CZ1A 3CJAA 4GV6A 4DTJA 3TSQA 3F9KA 1XILA 3C90A 3SQ1A 4CBWA 1CZBA 1RUH4 1Z6RA 3SV3A 3VETA 3MEGA 3THYA 1G15A 2XAFA 4YOXA 3K59A 3AO1A 2WPDG 4CJ3A 2UUBK 2R7YA 3AE7A 2WA3A 4ELVA 3PX4A 1NA1D 1I0HA 1WA8A 1MZFA 2PUSA 3UCSC 5AQTA 1URFA 1EX4A 3RR8A 1AVMA 1RTIA 2D2CB 2QKSA 2W42A 1TVKA 4E1JA 3JD2A 3G71V 3CQYA 3RSEB 1BEV4 3SAHA 1H8HG 3G6BA 1G6UA 3GWOA 3WU2Z 3K9AA 1S76D 1ATRA 2KTQA 3HPGA 1ATNA 5TISZ 4EFEA 5IJ0A 4JHDA 1YITN 1PO14 3AVHA 2YEVB 4AQYO 4YNQA 4C23A 2UU9O 4PI0A 1KCFA 2ZGZA 3THXB 2Y69B 1RDAA 2QWNA 2KKWA 3IFRA 4NTYA 3P32A 2FYUH 2Z1JA 3ZEDA 5IYZA 5LGUA 3KWIA 2Q4PA 3ZT1A 5LMUK 2O4IA 2DFFA 3J7AU 1SKVA 1YJWV 3VQBA 3CETA 1AJQA 4FFBB 2HBLA 3EE8A 3A5OC 5BN8A 1P90A 3DLHA 2HHVA 3VQ9A 1H8EG 2EZPA 3MDQA 1VSFA 5EZYA 3W7UA 4BVOA 1H38A 1WB8A 4DB3A 4CVNE 4ILJA 4O2BA 5KI6A 4FJ7A 4CFBA 3AG1B 1N6QA 4CD1A 4W5NA 1RFYA 1WSHA 4N47A 5B8HA 1VQMN 3S3WA 1TV6A 3AEFA 2YNHA 5M1PA 4FXDA 1N36O 3H1VX 3ZN1A 1SQBH 4AHCA 4DRXB 3J7ZO 1YZBA 1R084 4YTMA 1OH7A 4FJKA 4BW9A 3L71H 4X62O 1CZAN 5J2PA 3ZRSA 4DQQA 1TUYA 4Z4GA 3ZX2A 4N5SA 3ID8A 4JTAB 4DR7K 1VQPN 2OIGA 4O5FA 1FXHA 3DXKA 4FW1A 1XEQA 4DKWA 2YKMA 4AHTA 3JATA 1BCMA 4DQRA 4PQUA 2HWB4 4KTQA 2BTQA 4A62A 1S22A 3BVOA 4WCEL 1LUVA 4LFCB 4WFBV 4I2PA 3E8GA 1YI2N 2IH1C 3RMCA 5BPMA 2HNZA 4DR1K 1DEJA 4PV1B 1X1PA 3HM8A 4H0XB 4B3TB 1XMQB 4CK3A 4E2LA 1H2LA 4BRCA 1IBMO 4IFEA 5AZIA 3CCLN 2DPNA 3AA4A 4GT1A 1GOBA 5AQPA 3LDLA 2W41A 2IGIA 3RVZA 1EWRA 1N0NA 4DV7O 4CJ4A 3K06A 3MXJA 1QLEC 5EC1C 4PDLA 5BXZA 1RHI4 3CRRA 4O8UA 3FAVB 2E4LA 3UIQA 3CIRA 4B9LA 4NCAA 4X65B 4JTCB 4N56A 3T1HK 3AG4B 4BRNA 3KLEA 4FZ0A 1IO2A 2VQFO 3NXSA 3ENHA 2P9UB 4MVSA 1DLBA 3DXRB 3CCSV 3CCUV 4M3YA 1VRH4 3SR2C 3JAKB 4JAUA 3ASMA 5C3JA 1WSIA 3ZHVA 2E5LB 3IRXA 4DR2K 4K35A 3ML0A 1HNWK 5LA6B 3UKUA 4DSFA 5BRHA 4LFCK 1Q9XA 1AROP 4NXNB 1IH7A 1N8RO 1NCQD 1BO5O 3ZSXA 4KRFA 4FM2A 4DR5B 3RYFB 3OYHA 4BGAA 4B3TK 1YF2A 4FJJA 2YC0A 4FLWA 4CZJA 5B1AC 3AE2A 3DLRA 3L9DA 4FJ5A 1GLBG 3DSQA 4LF9B 1BQ0A 4IOAL 2ZXWB 2GELA 5EX5A 1LV5A 1JXEA 1HR0K 4C8OA 4Q4V4 5CA0A 1WB9A 1Q90D 3APQA 3TWHA 4FJNA 3SPHA 5AQKA 1XL4A 2DQ0A 5LGTA 1RILA 4O4JB 3O80A 3SYZA 2BE2A 2X6NA 2ODMA 3LP1A 1DTOA 4ISEA 3BAAA 1HKGA 4QS7A 1VMGA 2UUCB 3G4SN 4LH7A 1Z5VA 3D2EB 1EWQA 2BOCC 2RMU4 5J2MA 1R3KC 2QXLA 1T44A 1OV9A 3QFUA 1UOCA 1VQKV 3ZETA 1KQSM 1I5XA 1W0HA 1M56C 5DK5A 3CP1A 2W6KA 5LL6Y 1G8MA 4JASA 1E4GT 4J7JA 2RHKA 4UCSA 4IZ9A 1EN5A 4IIJA 3JALB 2UXBO 4FWQA 3CFPA 1Q7YO 1ORQC 4GMJB 4NTWA 5FPDA 2QXFA 2A5XA 3CC4V 2PI4A 4E19A 3OYFA 1RBRA 2FBVA 3L2UA 4JI7K 2Q97A 1X9WA 3FZKA 1WA8B 3TXQA 2YICA 1TK5A 4K43A 4H0OA 2E75B 4W4KA 2QWOA 4B8CA 1L5UA 4G1QA 5B3SB 3V81A 3W7WA 1S1XA 4DV2B 2B6AA 3PUFA 3JD4A 1NQTA 1CPYA 4IXCA 3ULDA 5I42A 5IJ0B 4ID1A 4JHDB 3OY9A 2ITDC 1K4DC 2V7YA 3ITHA 1XNQK 2O8BB 1ZUQA 1K73W 4LF8B 3UKRB 2WLJA 3BFRA 4AILC 1HW7A 4MVQA 1YTAA 3ULEA 2ZINA 1I08A 2HKOA 2XY8A 4NLCA 2ASMA 3KZBA 3BZKA 3ZHSA 3MWPA 3WB0A 3PX0A 5IYZB 4B3SB 4BQLA 1N32B 1O9GA 4E1MA 3PIOL 4FWSA 1YIJV 1S1UA 4W5TA 1HJOA 1NJIW 4JYAB 1XMOB 4JI6B 5L3GA 1YIJN 4E0DA 4OPAA 3CC7V 3CJHA 3LALA 4JK9A 5SZTA 3S3OA 4PWDA 3CQ8A 1XNRK 4B9SA 1K8AW 1EBOA 4CS2A 3QESA 4CJKA 1TKZA 5B5EZ 1IX9A 4FOIA 4IEEA 2RS34 3M8RA 3ZEUA 4R8CA 4CBXA 1RUF4 2OA8A 2QR4A 3SPCA 2QWRA 4KH6A 4A57A 4CS3A 3TETA 2O4GA 3JD1A 3FR0A 2XO7A 2PZSA 1WBDA 3AEGA 1ZBFA 1R1BA 4ZBMA 5B1NA 5JLHA 2WC9A 4R6ZA 1FKAO 3EHBB 3SJCC 1MA1A 1Y76B 3BEHA 1BHLA 4OKEA 4CF9A 2JRIA 1QQOA 2W40A 1OCZB 3I0SA 4LF8K 3JCUZ 3T1CA 1S6PA 2WU5A 3ABTA 3CYOA 1WP8A 4FJCC 1M90W 4KHPK 4X64O 1VQ5N 2KG7A 5IWAB 1VF5B 4LFAK 3T1YK 1D5NA 3UKMA 3K57A 2F9TA 1Z5WA 1GKFA 1VQ8V 4LBEC 2A3ZA 2D1KA 4DV4B 4CZHA 1SL0A 5C42A 1VQ9V 1VQ8N 2ITMA 1HNWO 5AQMA 3W7XA 2DN9A 4YOUA 3BABA 3DC6A 4JI4B 3AE5A 4B7KA 2YUAA 3ZYYX 4F2RA 4ILGB 1JCGA 2P9NB 1DLOA 1X3MA 4HNAA 3HYFA 3NGIA 5J9PC 4DQPA 1T5EA 2WS3A 4DR6O 2YV0X 1NNEA 4J2AA 2NNUA 2HB5A 3AVJA 3VF6A 2LJ2A 1V55C 4DR3B 4WF9L 1HNZO 2HEPA 4L8RB 5EIBC 5AZIB 3LP0A 2DYSB 3P31A 4IFYA 3RMAA 4TSFG 3ETDA 4U7OA 2R70A 1XBLA 1S1WA 3C3SA 5H5NA 2WBNA 4B3RB 4DUZK 1VQ6V 4GX0A 1W2BM 2QKBA 4C1NI 2CTQA 5KLVH 4Q4W4 2QDOA 4FPPA 2HF3A 4DR4O 3K0DA 2PI5A 2ZE8A 1NMNA 2VG7A 3JD3A 1KVBA 1VQ6N 2A6AA 2OCCB 2HFEC 1RUE4 1HQUA 1YSCA 1TA8A 3IKMA 1R6TA 3QVNA 3ID6A 3VMFB 2LQTA 3G6EN 3HJFA 1NVPB 1KP3A 3OAAG 4X65O 3SK3A 5GW7A 5LJWA 4DSJA 1VIBA 4GKKK 1PKXA 4OO1J 2ZD1A 3H1QA 4BR4A 3UKUB 1QVFM 1W9HA 4PDWD 4RWTA 2VGNA 4CHQA 5CR4A 1WSJA 4GV3A 4Q4X4 2F23A 2A79B 1CEZA 4O4HA 3SYAA 1K97A 4DXWA 2A41A 4EZ9A 1IBKB 5CN0A 3VENA 1MQTD 2RJZA 3I33A 3P4RA 4NO7A 1CP9A 4O4IA 4A5UB 2F8TA 4TQDA 4U7NA 3I8DA 5CA0B 2P4VA 4PHZA 3T2MA 5EXWA 4DFJA 4JYCA 2P9PA 3E9PA 2I7PA 2YXHA 3JASA 2VQEB 1MG1A 1ZAUA 4BRMA 2GV9A 4O44A 4F9OA 1KAYA 3BPZA 1RGIA 5A2QN 1P4RA 1PNLA 1BU6O 2VCPA 3EKSA 3D36C 3VGKA 4PHTX 4HBNA 1A5VA 1SQVH 5LGNA 3P30A 3AV9A 3H1IH 1F51A 3QDKA 1BHBA 4W5OA 1VQNV 4L3QA 3HT3A 2OPQA 2DQ3A 3OHRA 3LDNA 5BR8K 1EM1A 3ZSZA 2JGDA 1QLNA 3B09A 2DTUA 4ZKIA 4FL9A 1DF4A 1ZL8B 4NR1A 4I4TA 4B1UB 2O8DA 3HI0A 2HNDA 3AG7A 4IEIA 1XC9A 2B9ZA 3OYNA 1X9MA 2Y0PA 5KMGB 5IYCO 4DTPA 4DV3O 3K9JA 5EOYA 2EX3A 2BOBC 2QWOB 4ISGA 5EU7A 3M1FA 1B6QA 4DV1K 4IDHA 1J5OA 3AE9A 5GAHP 1D5AA 5BPLA 3LDPA 4LSLA 5A2QO 3ABMC 4E3SA 3OTOB 4N21A 2VQEK 2QEXV 3CC2N 4B9TA 4C7UA 2X5ID 3JYCA 3QNNA 4OPKA 2Q6AA 4BRAA 1K5MD 3A5LC 3ULEB 4EP4A 1QVGM 2QA4V 4YHHK 1JPXA 1S9GA 3UT5A 1KYOF 1FYJA 2EIJB 2N05A 4BRIA 4QOZB 4B3MO 2VS0A 4DW1A 3VN5A 1UA0A 3O9QA 4MO5A 2H3GX 3ZMSA 1ZBUA 3QNEA 1HNXB 3LM9A 2YI9A 4CJSA 1B3QA 3OM3B 1MWMA 1FPOA 3CJHB 1C1BA 1EP4A 1J95A 1HWYA 2Q31A 3CJBA 4B3SO 4WE1A 2B4JA 1N32O 3KKYA 3OR7C 3G25A 4JAXA 4CJEA 1SAZA 2WLIB 2CGNA 1GAXA 5AQUA 4G27B 3ZT0A 5DMRA 5C2FA 1FW6A 3HM9A 3T4ZA 3ZEUB 3CHXA 2O57A 2V4DA 2IS3A 5FDLA 1SQQH 2KW4A 4B9NA 4PA6A 3E22B 3G80A 2HOEA 3FD9A 1PIV4 2IU3A 1PL4A 4PL8A 2RN9A 3W7TA 5JH7A 4BDZA 3E2EA 3AY9A 5B3SC 4JI2B 2Q67A 3RT3C 5AZJA 3AK3A 5L3EA 4CEQA 2IJHA 3JAWA 1GH6A 4HZ3A 3HSTB 5GINA 1NMDA 3E8FA 5J2UA 3VQCA 1VBB4 5D5PA 2PBDA 3J81N 2AXTZ 2FBXA 4N41A 4QIWF 4LF6K 3MWTA 3V1OA 3H01A 2ZKOA 4U3JA 3VEWA 4FJHA 1KB9F 3FI7A 1PNMA 2FSJA 4FLVA 1TL3A 4FWRA 4FW2A 3IUCA 4JPRA 4JI5K 4YSYA 3TAMA 4J2DA 1JLCA 4NLBA 3WXJA 1PNKA 2X0LA 4YOVA 4IO8A 2B1GA 1C0MA 3IJ4A 2HBJA 4JI4O 2CH7B 3C7NA 5BREA 5CYQA 5M1FA 4BRFA 2GTSA 2MK3A 2UUAO 1JL1A 3KD1E 4CJUA 1ILYA 3TAPA 3ZT2A 4UB8Z 3B8AX 3TTFA 4MTXA 1Q9YA 2Q7HA 4I9LA 3HVRA 2YI8A 4JI2K 3VR8A 4NXMO 2ADPA 4KH5A 5KUKA 3F2KA 3Q7BA 2WLKA 2UYTA 4GV9A 4YIOA 1M1KW 4H5VA 3WNEA 2HVHA 4Z1MG 3O5BA 2A1RA 2QM8A 3CCVN 3VEVA 2N74A 1T3VA 3CMEV 4MVOA 4QJFB 3LNNA 1T6DA 2ZNIA 1DT9A 4E7KA 1K9MO 1FJGK 5KHHA 2FLOA 1YDXA 3RSEA 1LR1A 1NTZH 5IT9N 3AE8A 1RDUA 5LMNO 1WNSA 2FSKA 2P06A 4KHSA 2UXDB 2QKKA 2XRIA 4WCEV 3O9OA 3VTIA 5H9CA 4ELTA 2O8FB 4O4HB 4BRGA 4DTNA 2IU0A 1ZX3A 1B9FA 1FKOA 2VRZA 1NOYA 5CA3A 1BISA 4KFMA 4J9ZB 1VBE4 1RT7A 4HCBA 2GBZA 1IKYA 1U4BA 2OTLV 2ZM6K 2XY7A 4CGIA 3HBTA 2PFUA 1EAH4 3GL1A 2ZR3A 3EVKA 4D7TA 3CD6V 2P9PB 3NBPA 2D0PA 4FWLA 4DU3A 4X88A 1ZBLA 1T8EA 1K8KB 2DYSC 2F4VO 1L1FA 3L4IA 1W2BU 2G8UA 3P3NA 5J1EA 5IT9O 3WFVA 4DF8A 3NCIA 3VQVA 4F8RA 1C0TA 1QLEB 3EZWA 3E83A 1VBA4 1LW0A 3TAGA 3FFQA 1C1CA 3H1HH 3E66A 4DRXA 1QVFU 5BRDA 4RO2A 4ZTJA 4EB6B 4OLBA 1MDUB 3P4PA 2HHHB 3L74H 1VQ4V 1MABG 1Z26A 1XDCA 2EWSA 5EC2C 1YHQV 1TAEA 3PLAA 4MTOA 4ID5A 2G38A 3VQWA 2JVDA 5IJ9A 2Z5UA 4RW4A 2Y48A 3M7MX 3OYLA 4IJAA 1REVA 5M1OA 3P3PA 1NTMH 5CE3A 3C95A 3V9UA 4AQYK 3NH2A 1U47A 2UU9K 1W7AA 4LNUA 4TOIA 3DOLA 4JI0O 3NDKA 1KSPA 3R6MA 3I56V 5B1AB 3BY6A 3QF7A 1Y74B 2LFRA 4N23A 3I56N 1FKPA 5B66Z 5AQFA 3L75H 1A32A 3KHYA 1IBLK 3SCXA 5JQGB 5KQ8A 3E89A 4ILHA 4YTPA 1K34A 4J7KA 3SPJA 3UT5B 3WG7B 4AH9A 3HOSA 4CJLA 4UUJC 1ZBSA 1QU7A 5E1AC 2C2AA 2P5GA 1AP5A 1F7YA 2HHXA 4DLEA 1IG9A 3D36A 4IGGA 1BG3A 4DFKA 3FAVA 2F96A 5FPOA 1HKBA 3OA9A 3U4LA 2X74A 3CJ9A 1N36K 1NTKH 3AVCA 1HRV4 2GDSA 2JS5A 3OUSA 4ZOLB 3K5NA 3VQ8A 1AR4A 2RQ6A 4CGHA 3NVKA 3O9RA 5LP6B 2P9UA 3CQXA 3PO5A 1V54C 1X59A 3SJAC 3O4WA 3D0PA 3JAKA 4A59A 4CEDA 4PUOA 4X62K 2IW5A 4LF5O 3MAQA 1DTQA 1L3TA 4FZ1A 1BA0A 4Z4FA 5CHIA 2P22C 2AHYA 5JH7B 2QKCA 1JLEA 5TKYA 1VRTA 2W6JG 2A9HA 4OX9O 3HB3B 4CC6A 3NAEA 5CY4A 3OEHG 3JAWB 1UAXA 4PA1A 1S9EA 1QE1A 3RYFA 4MDBA 3RMDA 2UUBB 1NOZA 4JI3O 3K04A 2Q5ZA 1QVGU 3VRBA 1N33B 1WAFA 1F21A 4OKKA 1MWKA 4CJTA 4OLAA 4K3AA 1AI4A 4JI8O 3O8MA 3E9OA 1HKCA 4K42A 2QWQB 1CXUA 3AE6A 3UO3A 2IVNA 3OYJA 1KTQA 3ZX0A 3WXKA 2D4WA 2IVPA 4R79A 4B1ZA 3MN6A 2A06H 2K1EA 4DYLA 3CCJV 5ELZA 3TAFA 1US6A 1IBMK 2Q7EA 2GHYA 4E4EA 3HKEB 1HPMA 3AA3A 3M3ZA 4DV7K 3D2EA 1X4TA 1GMGA 2KFZA 5E84A 1NJWA 2HJFC 2PYJA 4FK4A 5M1NA 3B4SA 3VTHA 2NR5A 2NRTA 2YCHA 4F3OA 5LMUB 3OYIA 3A5NC 3J8AA 4I5SA 3WQTA 2XAQA 4FWNA 1NGGA 3P4QA 3JALA 4W5QA 2VQFK 4I9QA 3D45A 3VA0A 2HLDG 4HYOA 2ZJPL 2HR3A 1S3JA 4FVMA 4LF7O 3O4NA 3A0HZ 5LOVB 1PM9A 2RNBA 2GTDA 3R8EA 1N33K 2ZIMA 5F2RA 4FJ8A 1JFFA 5C93A 4CESA 1HQEA 4HTUA 3ATVA 2UXCK 4WFAV 1N34O 2BTFA 2WOMA 1W59A 2ZJQL 4H0VB 4H5TA 3G71N 1XWLA 4DFPA 2ITCC 4H5WA 4FLZA 1EFRG 2JWLA 5KTQA 3KLHA 4JRPA 3V9SA 2O8BA 1R6NA 1KFDA 3CIPA 3UKRA 2WDQA 4RHV4 1BSMA 2V7QG 3OYCA 4OPHA 3RYCB 4DR7B 4H5RA 1IURA 3VPZA 2AP1A 2A1SA 4O0JA 3G10A 3CEIA 3CCEV 1KD1O 4GKJO 3U3YA 3AAQA 3H3NO 3J8F4 4K8XA 2R9RB 3RBZA 4QS9A 4CEZA 3HO1A 4F3TA 3OEEG 3S41A 3KLFA 4F6RA 3SMSA 1Q6UA 3OYAA 3AEIA 1WAZA 2FBTA 4X1KB 1IXMA 3D2FA 1YJWN 3RGBA 3MK6A 2G8HA 1KMIZ 2PF4E 3ZCMA 1C0GA 1X9SA 2RPIA 1MOFA 1V55B 4OPJA 4DSKA 2ZCEA 3AVGA 3QO7A 1F4NA 4ASUG 1VSKA 3CYMA 4MVUA 4DR1B 3JXUA 1NEKA 1B92A 4ZTFA 3D7EO 2UXBK 3CCMV 4EZ6A 1NKCA 5AQGA 3I8BA 5DN6G 2PTMA 3CCMN 4FJIA 4KI6A 5L3DA 2WDRA 3OE7G 3R1XA 1SQPH 1Y76A 2P7TC 4K0KO 4MLHA 3P39A 1AILA 3O6WA 3QNOA 3RFRA 2YNGA 5HRRA 4FPAA 2HHQA 1AP6A 2XAJA 5LXTA 3ATUA 1QTMA 3ABKB 3EFFK 5IJ9B 1SETA 1ZLZA 3T1HB 3TR8A 2E2OA 2X78A 3OYDA 5HP1A 3V9XA 2Y1JA 5AFUH 3L4QA 1GN6A 2OTJV 1S3XA 3SQ4A 3ZMVA 4C8LA 4DR2B 4LNUB 4DU1A 4JGSA 4GYCB 3CPEA 5M1KA 1Z7S4 4NYFA 5F1XA 1AR94 2M6YA 1AI5A 4ICGA 5EYPB 2EIMB 3SPGA 2OPSA 2P9NA 5KHJA 4GVEA 3LAMA 3V1RA 4CD3A 4FJXA 1K33A 3MN5A 3OW2U 2JK5C 4H03B 1SS6A 4CBUA 1ASJ4 4A2BA 4YJ2A 1TL1A 1VQ7V 4YORA 1SC5B 4KH4A 1HR0B 1Y6XA 4TT3G 2AZ2A 2AGAA 1WUAA 3WT0A 1MZEA 3HPLC 2XTAA 2D3OW 4I7FA 1P7BA 5AQLA 3K08A 3PJSK 2FF6A 1AI7A 1BIUA 4BR0A 1KRPA 3SFEA 4DV0K 3WB1A 1GN2A 2QGNA 1FXXA 3KKSA 4XH4A 4KX6A 4XDKA 2ZDIC 2NN4A 4BIOA 1UFIA 4DUYK 5AG2A 1COV4 2WLMA 1HX1A 2D0BA 5JVHL 3AG2B 1I39A 3FYIB 4UQGA 3CCSN 3CCUN 2E2PA 4X66O 3T3FA 2DYRB 2QKAA 2FBWA 4X64K 5BZBA 3ZSWA 2V1DA 3FZMA 4OGCA 1VQOV 1LUWA 1Q43A 2P67A 4X89A 5H6QA 1AR1B 1RT4A 3MN9A 4FZZA 4Q5VA 4FO0A 2YNFA 4BWMA 4I50B 4JI7B 2Q0OC 1KP2A 4JV5O 3FYEB 2ZR2A 2OYQA 2AW9A 1J54A 1P84F 1SZ2A 5AQYA 4CE9A 3ABMB 5GAGP 3TI0A 3KTQA 2QTSA 4JS4A 2D0CA 1Q82O 5JS1A 3OMAB 4YXDA 2PY5A 4H5NA 5EY4A 4A61A 4DR6K 3WG7C 1QZ6A 1BQZA 3CRCA 1AR5A 5L3FA 3M6GA 2WWWA 4L8JA 3ABUA 4P9OA 4QPKA 1HNZK 4KHQA 3HK2A 5H2FZ 3AO4A 4DHYA 1Q86O 1XNQB 4PL7A 3NMUA 4H37A 2XASA 4P30A 1C6VA 2YHWA 3R9PA 1DGSA 3K9KA 1OKJA 4YOWA 2QM1A 2HMIA 5ADXH 1G1XB 1TUUA 4JN4A 3M99B 3KZIZ 1NGCA 3HP9A 3L6QA 3ZHTA 4GVMA 4IDKA 1J5EK 3ISNC 4DTMA 3MCPA 4DR4K 3EEQA 2EINB 5LP6C 4WFGA 1HMVA 3RMBA 1RT2A 1VQKN 4KHUA 1ZL8A 2NRVA 4MLEA 3ZMUA 1GLDG 3N2KB 4BG8A 2LW1A 5JCOC 4KKOA 3VQ5A 1GM7A 1YVUA 3MEDA 5KPTA 4QPJA 3JSMA 4JI1B 1QSSA 5KMGA 1XNRB 3PSFA 3HZ6A 2E76B 2HWC4 1KKCA 2WA4A 3CRMA 3CC4N 1WBBA 1JFFB 3TGUH 3CERA 5C0YA 2QTDA 5F0XA 3SGIA 3M8PA 3GVMA 3ZHUA 4E7JA 2PYLA 4MTFA 3KVGA 3HRGA 4RQFA 1HDJA 4E1NA 5D3GA 4N76A 1EO1A 4TSXA 2QE7G 1YTFB 4UB6Z 2CTWA 1S1VA 4O4GA 1AR84 3OR6C 2ZGYA 2HSTA 2Y0IA 3F9MA 2IAJA 1WAJA 4YDUC 1K6YA 2PAVA 4CJ7A 4KHPB 2OCEA 4LWSB 4LFAB 3W0LA 4BWAA 4DV5B 3AO3A 3BEXA 4ICLA 3TSPA 2V7ZA 1GTOA 4KUMA 5TKWA 3JAMN 4CGDA 4GW6A 4YFUA 3OYEA 1OH6A 4F6RB 3QFPA 1ENVA 1H2MA 4X1YB 1IDSA 3D2FB 1K7DA 1SKSA 1T7PA 1L8DA 1ZC6A 1BCCH 3RN4A 5AQNA 4JI1K 1T05A 3CC7N 2GWKA 2WLIA 3K5OA 1TYQA 3TANA 1VSIA 3H3OB 2Y4TA 3SV4A 3LL3A 4Q6GA 4Z0UA 3U9ZA 4FM0A 5IE9A 3ZT3A 3L8BA 1JVMA 4I9WA 3E22A 1PP9H 1S6QA 4C8MA 3PN1A 4CZGA 3AA5X 4H0PA 2OWOA 3ENBA 3TU5A 4DFMA 1BE3H 2RDCA 4PD4F 2KLAA 3AG3B 4LC1A 1YXQA 2Q8VA 2HNYA 4AHVA 1LNQA 4DUZB 2JEUA 2BDPA 5LXTB 2WUSA 4H13B 4J11A 3JAMO 1QBZA 1M4UA 1SF9A 4CCHA 4CEOA 4DV5K 4B3OA 4Z1VA 3KJVA 1Z2GA 5IY5C 3NGYA 4RUFA 1K92A 2YKNA 4J80A 2ILMA 1UWBA 4GKKB 1TVRA 2Q3SA 3ZX6A 4AM6A 4ABMA 1VQ9N 4DW0A 1OZ0A 2P90A 2JLEA 2YJEA 2YX6A 3HP6A 2X6AA 4JKGA 5C2TA 1RM1B 4EAHD 1Y97A 3LWLA 2QWMA 1JLGA 1SKRA 3D3IA 3K5MA 3GQHA 4B3MK 4W4LA 2QSAA 4DK1A 4YJ2B 1JJ2U 2CH7A 4LCUC 4LFCO 1BQMA 3V4IA 4GZRB 2QM4A 2R9AA 3RTVA 1PVC4 3CI5A 2CGOA 4B3TO 1GLCG 1XMQO 4KO0A 4IOCL 3VEZA 4G9ZA 5KAFZ 1EQYA 1NGAA 3DOKA 4KTZA 5H1SQ 4FK0A 1SKWA 4KREA 4H33A 2QM7A 4R50A 2LSNA 4HUFA 3ZX3A 3VF2A 2DFEA 4Q20A 3H1JH 1IXBA 5BRFA 1GOCA 3DWLA 2YNIA 1V9PA 1E4FT 2P9LA 2JS3A 2YIBD 1PPJH 3BGRA 4LSNA 1ITGA 2O8EA 2NRWA 3ABKC 4FK5C 4DO2A 1VF7A 4FJ9A 2G8VA 3SYQA 5BR8B 1K4CC 2M7WA 5GONA 3STZC 3U10A 1BHAA 4MQ3A 4LF4K 3WNFA 3BZCA 4AHUA 4BRHA 2YHAA 3PO4A 2Z1GA 4CJWA 5EIBD 3AE1A 2E5LO 1MSDA 5FRNA 2O8FA 1CLQA 3QINA 1D4M4 1ZTEA 2IH3C 4RWUA 3OS1A 4PJ0Z 2H3OA 4NXNO 2EIMC 4E7LA 3L2RA 4IYHA 1TAQA 2ETJA 4GX2A 4DR5O 4DV1B 1NGFA 3C0BA 4DLGA 2CGLA 1SA0A 1NENA 3ZMZA 3DGEA 4PDRA 4LF9O 1RDWX 1KC8O 1JOYA 1K8KA 1KFSA 4UV8A 2DFHA 3AARA 1R3JC 3T1AA 2WSSG 2P9IA 4X20A 2VG6A 1K5QA 1E1QG 2NRXA 2UUAK 3CJ1A 4BR9A 2Z0AA 1U97A 5KRTA 2GX9A 3ASNC 1GLEG 1Q81O 3BY5A 4YHHB 1TKXA 2YS8A 4Z4HA 2FB5A 1YJ9V 4NXMK 2D5RA 3VF4A 2Y1IA 3OBWA 4IKFA 1VQNN 4H44B 2K9PA 4K8ZA 2KFNA 5HFMA 5DECA 1UJWB 4YOTA 3LZJA 2UUCO 4GUNA 4E7IA 3AG2C 2ETNA 3QEVA 1M9NA 4EB6A 1KD1W 1XUPO 2DYRC 3VEXA 2ZDIA 1HLUA 1V54B 1FS0G 1SRYA 1WPXA 4WFBL 1NGBA 5C12A 1NK4A 1BCOA 3L2QA 3VEYA 5LMNK 2YXYA 1OH5A 2ARHA 1P8ZA 4YY3K 3LWMA 4LD0A 2O8CB 4JZ2A 3WUHA 4FZYA 4EFBA 2RKIA 5JVDB 2X6BA 4CZEA 1BGXT 1XQ8A 3ZMTA 3OYKA 1W97L 3K5LA 1I94B 1Q6IA 1OCOC 3RW0A 3HL8A 1NBWA 2H88A 2CH6A 2HHWA 2QEXN 2CTRA 2RM24 2L6LA 1Y74A 3KG2A 4M42A 4CK2A 1JR9A 4O2AA 3VA3A 4DV2O 1F4MA 3LP3A 3OS0A 5KA5A 1QQCA 3SAFA 5CA1A 4I7ZB 5JQGA 3QICA 2QWLA 4I0XB 2XY6A 4LFBB 4B1VA 2QA4N 4CH3A 4OKJA 5JMVA 2F4VK 3ICXA 4LF8O 4LF6B 3GDQA 4IT5A 2UXXA 3VQYA 2E88A 3ZHQA 3UE5A 4RUEA 4TV9B 3J80O 4DU4A 4FK2A 5HLFA 5FLXN 2JGUA 3K03A 2JIZG 2EINC 2RF2A 4G28B 4MW3A 4JI5B 3DXMA 4A2AA 5GIOA 1EKEA 1L0VA 1KUQA 3VQDA 1TYQB 4JYAO 2LGWA 3L0QA 4ZOLA 1XMOO 4JI6O 4IWVA 1JLBA 3TTDA 1JLQA 5LP6A 2FL4A 3AVFA
chains in the Genus database with same CATH topology
3RYHA 2BGGA 1B9DA 5KRSA 4LH4A 5JCOA 3L3UA 3SZ2A 4CFAA 5FRMA 2IDOA 4CFCA 1CZ9A 1TK8A 2KZMA 4M45A 4ZIBA 1HYSA 1FJGB 4DV6B 2E3CA 4LH5A 1CXQA 4FLYA 3HKEA 3B6PA 1RDCA 4CH4A 2ZM6B 1O9HA 5C24A 4M3TA 4H4OA 4Y1DA 4LY7A 2P51A 1SUQA 2ZQBA 3OVNA 4KB0A 3QG5A 5LOVA 1JKHA 1NJZA 3QEIA 5GONB 5FNVA 1RBTA 1ZBHA 1NJXA 3AVBA 4ZHRA 4DTRA 4KAZA 2KQ2A 3RYCA 3LPUA 5LYJA 3EYZA 3AVIA 1SA0B 1M5IA 1D8YA 4AQYB 2UU9B 4H4MA 4I2QA 4OJRA 4X1KA 4ZI7A 4X20B 5CB4A 5ITZA 3P5JA 3HKDA 3FFIA 3NF9A 1SL2A 4Y1CA 4FLTA 1BI4A 1IBLB 2RN2A 3N2GA 4HUGA 3P1GA 2E6LA 2IM9A 4LR3A 3KLIA 3OS2A 3ZSYA 4CF2A 4OGEA 1RT6A 4CFDA 4W5RA 4AHRA 1N36B 1RDDA 3T19A 4OVLA 3RRGA 5SWMA 5J2QA 5JJJB 4X62B 4KTWA 4ELUA 1YTUA 5EYPA 4CEEA 4O2AB 5CA1B 1WLJA 1H2SB 4CJ5A 4Q0BA 1VSDA 3O3FA 1L3UA 5CYMA 3SJBC 3M8QA 4DTXA 1A5XA 3I0RA 1TK0A 3CG7A 1IBMB 1TKDA 4RG8A 3ZSQA 3RYHB 4DV7B 4HVJA 3HXMA 3LZIA 1D9FA 2VQFB 3AVNA 4FZXC 3ZSRA 2XY5A 2HVIA 3U3GA 4I50A 4KFBA 3THOA 2UXCB 4NCGA 1XHXA 3IAYA 4RW8A 2QJ1A 3DRPA 1JL2A 4BE2A 2F1MA 4E89A 5HRSA 1VSJA 3SPZA 5HBMA 3DLEA 3HKBA 3DYAA 3N2KA 2BANA 4BDPA 2VWJA 2E6MA 2YXLA 1SQFA 1RT5A 3RWUA 4D7SA 4O4LA 4CJFA 2UXBB 1LAVA 2DY4A 4TUYB 4JS5A 4M3XA 5FNVB 4CERA 1HYZA 3TAQA 1WPBA 1NK7A 5FROA 4DS4A 3M8SA 4HUEA 3EY1A 3K58A 4CH5A 3KK2A 5LYJB 4TV8B 3NFAA 1KVCA 4IG3A 1SL1A 4X1YA 3PY8A 3EZ5A 1I3AA 2ATQA 4ZI7B 1JMKC 5CB4B 4YJ3B 5ITZB 3HKDB 5J2TB 1NK8A 1VSMA 1BI4B 4KHNA 3HVTA 3N2GB 3QTCA 3SJJA 1NK5A 3OJSA 3S3MA 3AVAA 4BE1A 1L3VA 3SUQA 3KK1A 4CHZA 3UQ8A 1HNIA 4J2BA 1BQNA 3QO9A 1Q5OA 1HPZA 4DV0B 3RWRD 4I55A 3IS9A 4DUYB 4JLHA 1LWEA 3V9WA 1HJRA 3S9HA 1NK6A 4Z4IA 1U48A 3LPTA 1WN7A 4BE0A 4X64B 3MEEA 4EP5A 4DG1A 4Z4EA 2CAZC 3H08A 4F2SA 2G8KA 1C1AA 4IHJA 1HNWB 1WSFA 4M3UA 3QIPA 1TKTA 1NKEA 4LH6A 4M3RA 2QK9A 4DR6B 1HRHA 2YIAA 3BRCA 1HNZB 4FLXA 5C25A 4X1IA 1U04A 4CIGA 4O0IA 1J5EB 4DQSA 1S5JA 4DR4B 1QHTA 4CIEA 1J53A 3T1YB 3OYGA 4FLUA 5KHIA 3SPYA 5HRNA 3DRRA 2HW3A 4E7HA 3C6UA 4KB1A 2AJQA 2Q0AA 3U0ZA 3VQ4A 3QEWA 4DTSA 4B9UA 4WBNA 4DMNA 4FJLA 1LWFA 1C0UA 4DSIA 2Q7GA 2ZIOA 1S1TA 1JXBA 3L3VA 3MXIA 2D0AA 4JRQA 3HKBB 1RTHA 3NF6A 1KLMA 1BL3A 2FBYA 2GUIA 3KLGA 4RW7A 3B6OA 4UCVA 4O4LB 1KLNA 4CF0A 2ITGA 3JSLA 3RYIA 3P83D 5JVDA 3JYTA 1WSEA 3ALYA 5D5QA 1YT3A 3SUOA 2HHUA 3NE6A 4DV3B 1VSEA 4GLXA 1O1WA 3V9ZA 2OPRA 4FJGA 3OYBA 1M93A 4UFZA 5J2NA 1TVKB 4TV9A 1XHZA 4M41A 5HRPA 4CHYA 3PV8A 3SUNA 4B3MB 3SI6A 4CK1A 3SQ0A 4R5PA 4KHYA 2Z1HA 3DM2A 4CHPA 2FC0A 3AVLA 3O4QA 1MU2A 2KZZA 5EZYB 4I55B 4AHSA 4O2BB 1JLAA 4CEFA 1J9AA 4CGFA 2XHBA 4LF4B 1QSLA 3WNHA 1UA1A 3ZSVA 4IHJB 4BACA 1FK9A 4CJPA 1KU9A 3JATB 3VQ7A 3ETQA 4KHWA 3QIOA 2F8SA 2BTQB 3MXMA 2R7FA 4FYDA 3NF8A 2UUAB 4DSEA 4ZHQA 4X1IB 4NXMB 4DTUA 4CGGA 1ASUA 2R72A 1WSGA 3QLHA 3LP2A 2PGGA 4UCUA 1NJYA 2G8WA 1NT2B 3JSNA 4BWJA 5LMNB 1EXQA 3G0ZA 4YY3B 4CHNA 4KI4A 3NH0A 1VK0A 3CSXA 3KKRA 3ZS8C 1Z25A 4J2EA 4CIFA 3WB2A 3DLGA 3DRSA 4WBNB 3HKCA 4DWIA 1ASWA 2BTOA 2WONA 2F4VB 3THVA 1VSHA 5KHKA 4H8KA 4RW9A 4CJQA 3HPHA 3AVKA 4FM1A 3LDSA 2ZNJA 4B08A 1HYVA 3MECA 4XIUA 3RYIB 2Z1IA 3VQPA 3OYMA 1N5YA 3BDPA 5K1PA 4IIJB 1TUBA 3L2WA 2F93B 4JI0B 1DTTA 1RBSA 3AA2A 5I3UA 1NK0A 3AO5A 1SV5A 1U45A 4RW6A 3CM6A 1RT3A 3JARA 4EEQA 1QS4A 3QETA 1B04A 3SNNA 2VG5A 2IC3A 3A2FA 1RT1A 1GOAA 3F73A 3ZT4A 1IKWA 1KVAA 4CEAA 1T03A 4DK0A 1VSLA 5CZ2A 3RRHA 4CECA 4LF5B 1RSOA 5FPRA 4QAGA 3VQAA 4BDYA 4OX9B 4C8KA 3DLBA 4Z4CA 4JI3B 5KX5A 3QERA 1JLFA 2ZE2A 4FCYA 5C8YA 4JI8B 3NGZA 2IOCA 1ZBIA 4IBNA 4QCLA 4DQIA 3L2VA 2EHGA 3VQ6A 4DS5A 4CH6A 2F66C 5BMVA 3IG1A 1ZYQA 4HCCA 4C8NA 3QEPA 3VQXA 3S3NA 3AVMA 4B9MA 1BIZA 4HNAB 3O3HA 4UCRA 4ZHQB 1LWCA 3KD5E 5KGWA 3TAEA 4UCOA 3B2EE 3TABA 1FFXA 4TUYA 5E41A 4LF7B 1IKXA 3U11A 3HPOA 3TARA 5JJEB 4FJMA 4KL1A 3QEXA 1RBUA 3NF7A 1HNVA 3OJUA 3CFOA 1NKBA 1P49A 1N34B 5K1XA 4TV8A 5KGXA 3KK3A 3SUPA 3U6FA 3BA8A 5JS2A 3NH1A 3V6DA 1RTJA 4YJ3A 5J2TA 3DMJA 4GKJB 3HKCB 3CM5A 1A5WA 2P1JA 4O4IB 1RDBA 3BA9A 2YIBA 3CFRA 2F95B 4FFBA 3JASB 3OTFA 2B5JA 2P5OA 5HROA 5K14A 4PI2A 1VRUA 3DI6A 1RTDA 4K0KB 1EETA 2OZSA 4O5BA 1QSYA 5JJNB 2X6SA 4CJRA 4PY5A 1TUBB 4I4TB 3K2PA 2G8FA 3NHGA 3V1QA 4B8AB 1NK9A 3E01A 4DSLA 2OPPA 1Q8IA 1YEWA 3VQEA 3RR7A 4CEBA 3O3GA 3BHPA 2HHSA 4KPYA 1RBVA 4IG0A 3JARB 4M3ZA 2HHTA 4KV8A 2YHBA 3KIOA 4M3WA 2VWKA 2OZMA 1RCHA 4UCTA 3PX6A 3LANA 1TGOA 1D9DA 1JJOA 4CC5A 1L3SA 4CF1A 1R0AA 4NVPA 2NUBA 5KHGA 4DTOA 4X66B 4F4KA 4CHOA 4TQFA 4DF4A 1XI1A 5T7BA 1ASVA 4NYNA 3ZSOA 5LA6A 4B9VA 4JV5B 5KX5B 5C8YB 4CGJA 4CJVA 2G8IA 4O55A 5J2UB 3C94A 1RNHA 4CF8A 5BMVB 4U3JB 3C6TA 1Q3EA 4O4JA 3AO2A 3DLKA 3LAKA 1LAWA 4HHTA 1TAUA 2PW9A 2I5JA 3SQ2A 3CB2A 1LW2A 1U49A 1IKVA 1SQGA 4CS4A 3WNGA 1I7FA 4MFBA 3VQQA 4IFVA 5CZ1A 1FFXB 4DTJA 3F9KA 3SQ1A 1CZBA 3SV3A 3MEGA 1G15A 3K59A 3AO1A 4CJ3A 1JLBA 2R7YA 4ELVA 3PX4A 2PUSA 1EX4A 3RR8A 1RTIA 2W42A 1TVKA 1G6UA 2KTQA 3HPGA 4EFEA 5IJ0A 3AVHA 4YNQA 4PI0A 1KCFA 1RDAA 2KKWA 2Z1JA 3ZEDA 5IYZA 3ZT1A 2O4IA 2DFFA 1SKVA 3VQBA 4FFBB 3DLHA 2HHVA 3VQ9A 1VSFA 5EZYA 4FJ7A 5KI6A 4O2BA 4CFBA 1N6QA 4W5NA 1WSHA 4N47A 1TV6A 2YNHA 4FXDA 4AHCA 4DRXB 4FJKA 4BW9A 5J2PA 4DQQA 4Z4GA 4N5SA 4FW1A 2YKMA 4AHTA 3JATA 1BCMA 4DQRA 4PQUA 4KTQA 2BTQA 4LFCB 4I2PA 3RMCA 2HNZA 1X1PA 4B3TB 1XMQB 4CK3A 3AA4A 1GOBA 2IGIA 4CJ4A 3MXJA 2E4LA 3UIQA 4B9LA 4NCAA 4X65B 4N56A 3KLEA 1IO2A 4M3YA 3SR2C 3JAKB 3ASMA 1WSIA 2E5LB 3IRXA 5LA6B 4DSFA 1Q9XA 4NXNB 1IH7A 3ZSXA 4KRFA 4FM2A 4DR5B 3RYFB 3OYHA 4FJJA 4FLWA 3DLRA 4FJ5A 3DSQA 4LF9B 1LV5A 4C8OA 1JXEA 5CA0A 3TWHA 4FJNA 1RILA 4O4JB 3SYZA 2BE2A 2X6NA 3LP1A 3BAAA 2UUCB 4LH7A 1Z5VA 5J2MA 1UOCA 1W0HA 5DK5A 4UCSA 4IIJA 3JALB 3CFPA 4GMJB 2QXFA 4E19A 3OYFA 3L2UA 1RBRA 2FBVA 1X9WA 1TK5A 4B8CA 1L5UA 4G1QA 3V81A 1S1XA 4DV2B 2B6AA 3PUFA 3ULDA 5I42A 5IJ0B 4ID1A 3OY9A 3ITHA 4LF8B 4AILC 4NCBA 1HW7A 1YTAA 2ZINA 2XY8A 3WB0A 3PX0A 5IYZB 4B3SB 1N32B 1O9GA 4E1MA 1S1UA 4W5TA 4JYAB 1XMOB 4JI6B 4E0DA 3LALA 5SZTA 3S3OA 4PWDA 3CQ8A 4B9SA 4CS2A 3QESA 4CJKA 1TKZA 3M8RA 2OA8A 4CS3A 2O4GA 2XO7A 2PZSA 1ZBFA 3SJCC 1BHLA 4OKEA 4CF9A 3I0SA 1S6PA 5IWAB 3K57A 1Z5WA 1SL0A 4DV4B 5C42A 3BABA 4JI4B 4F2RA 1DLOA 3HYFA 4HNAA 3NGIA 4DQPA 1T5EA 2YV0X 4J2AA 2HB5A 3AVJA 4DR3B 2HEPA 4L8RB 5EIBC 3LP0A 4IFYA 3RMAA 2R70A 1S1WA 4B3RB 2QKBA 2VG7A 1KVBA 1HQUA 1TA8A 3HJFA 4DSJA 2ZD1A 1W9HA 1WSJA 4O4HA 4EZ9A 1IBKB 2RJZA 4O4IA 2F8TA 4TQDA 3I8DA 5CA0B 4PHZA 4DFJA 2VQEB 3JASA 1ZAUA 2GV9A 4O44A 3BPZA 4HBNA 1A5VA 3AV9A 4W5OA 3HT3A 2OPQA 3ZSZA 2DTUA 4I4TA 2HNDA 1XC9A 3OYNA 1X9MA 5KMGB 4DTPA 2EX3A 5EU7A 1J5OA 1D5AA 4LSLA 4E3SA 3OTOB 4B9TA 3QNNA 4OPKA 4EP4A 1S9GA 3UT5A 4QOZB 3VN5A 1UA0A 1ZBUA 1HNXB 4CJSA 2YI9A 1C1BA 1EP4A 4WE1A 2B4JA 4CJEA 3ZT0A 5DMRA 3HM9A 3CHXA 2V4DA 2IS3A 5FDLA 2KW4A 4B9NA 3E22B 5JH7A 4BDZA 4JI2B 4CEQA 3JAWA 3HSTB 5J2UA 3VQCA 5D5PA 2FBXA 4N41A 3V1OA 4U3JA 4FJHA 3FI7A 4FLVA