2EX3A

Bacteriophage phi29 dna polymerase bound to terminal protein
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
570
structure length
570
Chain Sequence
RKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA polymerase
publication title The phi29 DNA polymerase:protein-primer structure suggests a model for the initiation to elongation transition
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transferase/replication
total genus 150
structure length 570
sequence length 570
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2ex3A04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ex3A01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2ex3A03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2ex3A02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2ex3A05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2ex3A06
2XY8A 3PV8A 3BGRA 1YVUA 3V4IA 1KLMA 4L8RB 1RBVA 2HNZA 3HPHA 3SPZA 3VQEA 3OYFA 1NK0A 4M3WA 4OLAA 4IG0A 2YKNA 3AO1A 4G1QA 4KTZA 4CF0A 3C6UA 1TV6A 2O4GA 4BWJA 3AVIA 3EY1A 5J2QA 3HO1A 1BGXT 3HK2A 4E7KA 4M41A 1WSHA 2G8KA 3DRPA 3AVFA 2QXFA 1TGOA 1RILA 2HB5A 3K2PA 4KFBA 4LD0A 4ZTFA 4M3XA 1T05A 4CFCA 4KTWA 3LPUA 3LZIA 1TKZA 3V9UA 3TAMA 4Z4IA 3NGZA 4DWIA 4CJKA 2F96A 4FJ5A 4KI4A 3LZJA 1VSDA 2G8IA 1SL0A 4KHSA 1VSLA 1NJZA 3T19A 4CGIA 1YTAA 4FM0A 3D45A 3LP3A 1IKWA 5KGXA 1RT2A 4B9MA 3ALYA 4CGGA 2P5GA 5HRRA 1EP4A 4DQIA 4W5NA 1CZBA 1GOAA 1C1AA 3NF9A 3RRGA 1ZBLA 2IS3A 3OYKA 3KJVA 3L8BA 4KHUA 5I42A 4W5QA 4B9VA 4J2BA 4H4OA 1I3AA 1QSLA 2GBZA 4MFBA 3SUPA 1WAJA 4NCGA 4Z0UA 4OPJA 4FJXA 3UIQA 1RTJA 3OS0A 5CZ2A 1J5OA 3RWUA 1FKPA 4CJVA 5K14A 3SZ2A 4HHTA 4FJJA 2BGGA 1YT3A 4IFYA 5CZ1A 5C24A 1L3VA 4KHNA 1SKSA 1BCMA 4NYFA 3ZT1A 5HLFA 2DFHA 3DLEA 5HBMA 4IG3A 3VQ4A 3PY8A 2ATQA 3O4QA 3K58A 3ZSXA 2RPIA 3DRRA 4C8MA 4JRQA 4PY5A 1C1BA 2EHGA 4B9SA 1A5VA 2YNIA 3VA3A 3G0ZA 4OKKA 3QETA 3P1GA 3OYLA 1SL2A 3VQQA 4J2AA 1DTQA 4CHOA 4DTXA 4CF1A 1ASVA 2XRIA 5FRNA 4CIFA 4FCYA 2OPPA 3NBPA 3SUOA 3S3MA 3SJJA 2HHWA 4DU3A 1UAXA 2X6NA 2RF2A 3IS9A 4B9LA 4OLBA 4KB0A 4DQQA 1XWLA 1JL1A 4M3RA 3M8PA 3OYEA 3NF6A 1L3SA 2PYLA 3FI7A 3RMDA 4E7JA 4N76A 4Z4FA 5J2PA 5FRMA 1X9MA 3OS2A 4FZYA 4KB1A 3KLGA 4FXDA 3OYBA 2IC3A 2ZE2A 1JL2A 1T7PA 3L2RA 2YV0X 2ITGA 3TANA 4KPYA 1IKYA 1RT7A 4ZTJA 1RT1A 4DG1A 3VA0A 4FK4A 1QSYA 3NH1A 3LWMA 1LAWA 4O4GA 1X9SA 4CE9A 4IKFA 3AO2A 3DM2A 4DTRA 4CGHA 1T8EA 1RDCA 3AVAA 2P5OA 2Q3SA 5J2NA 2WOMA 5DK5A 1ZBIA 1IG9A 1XHXA 4HCBA 1HRHA 2Z1GA 4YNQA 4F3TA 1NOZA 1KLNA 2VG7A 4CEOA 1UWBA 4OGEA 2HHSA 3ZT3A 3IRXA 4W5RA 1EX4A 3CG7A 4M45A 3DLKA 4CJPA 3ASMA 4E1NA 4CJUA 3ZSWA 4CJ4A 5SZTA 4DTMA 3KK1A 3JYTA 3QIOA 2R7FA 4M3YA 3AVNA 2FBXA 3KK3A 5JS2A 1HYZA 3LWLA 4DTNA 1F21A 1RT5A 3L2WA 2LSNA 4CK1A 3K59A 4CIEA 1UOCA 1HNVA 4YFUA 4O5BA 4FJKA 3HSTB 4CF8A 1JLFA 4DFJA 4J2EA 4ICLA 4CJTA 4QOZB 2B5JA 3CM5A 2KQ2A 1TVRA 4CEBA 1NK5A 2E6MA 2FBYA 4CEDA 3SUQA 3QLHA 5KI6A 3M8QA 4DU1A 3L2QA 1NK7A 3ISNC 4CERA 3BDPA 4E0DA 1TK0A 1JKHA 3DI6A 4N5SA 4FLZA 2P51A 1NJXA 4FJ8A 4E3SA 4Z4CA 4B08A 2HHVA 1IKXA 4PA1A 1BQMA 3SPYA 2OZSA 4Z4HA 1A5XA 4BACA 4DTUA 3KLEA 4OGCA 4HUEA 1RBTA 1NK9A 2RKIA 4KHQA 3OYMA 3CQ8A 4E7IA 4B9NA 4FJHA 3IG1A 3VQPA 1RTHA 3THVA 4GMJB 4QAGA 3RR8A 3KK2A 1FXXA 3KKSA 3VQAA 2E4LA 2BE2A 2XY5A 1L5UA 1T03A 4ELTA 4FLXA 2JGUA 1RT6A 2VG6A 3HVTA 4EZ6A 3QEIA 2VWJA 4DSIA 1S9EA 5JS1A 5I3UA 4DSJA 3CFOA 5D3GA 4FJNA 1TAUA 3H08A 4CJSA 3QEWA 1D9DA 3TR8A 4I2QA 4DTOA 4OKJA 2X6SA 3RMCA 3ZSVA 3V6DA 1JLQA 3CYMA 4FLVA 1BIUA 5CY4A 4CEEA 4ID1A 1VK0A 1FKOA 3WNFA 1WSIA 4BDYA 3WNHA 3LANA 3SNNA 4PQUA 1HYSA 4Y1CA 4AHUA 1U45A 3SI6A 1L3TA 1VSEA 3C94A 1HMVA 1MU2A 3VQ9A 2G8FA 1CXQA 4DSEA 4F3OA 1J53A 5KRSA 2KFNA 4C8NA 4DSLA 4OKEA 2JLEA 4DSKA 1KSPA 1TKDA 3KLIA 4FJMA 1HYVA 3RMBA 4CEFA 4CJ5A 3VQ7A 2KTQA 1HJRA 3MXJA 3V1OA 3OYDA 4CESA 4B8CA 2KZMA 3O3FA 1FK9A 1W9HA 4DS5A 3PO5A 4CHZA 4CK2A 4BDZA 4FJLA 4IBNA 1Q9YA 3VQ5A 4ZHRA 1R0AA 3OVNA 2F8TA 3HVRA 4B3OA 4KV8A 3NGIA 1JLAA 3DOKA 4CHNA 3ULDA 1B9FA 3KTQA 4CIGA 5HRNA 3SQ2A 1JLEA 1HPZA 4CJWA 2HMIA 3OY9A 2QKBA 1BL3A 3O3GA 4FM2A 4FW1A 3G10A 1Z26A 1NJYA 2D0CA 4FZXC 3ZCMA 2Y1JA 3FFIA 1C0MA 1BHLA 2VG5A 1WLJA 3P5JA 2RN2A 4KAZA 1X9WA 3QESA 3V9SA 4MQ3A 2NUBA 3PUFA 1KVCA 2IDOA 1GOBA 3VN5A 4M42A 1BCOA 4E7HA 1EETA 1REVA 1VSMA 4IFVA 1Z25A 4RW6A 4EZ9A 4DTJA 4BE2A 1S5JA 5KTQA 4AHCA 1KFSA 4H4MA 2HNYA 4E89A 2PW9A 1JLCA 4I7FA 4I9QA 4FVMA 5FROA 4HVJA 3KLFA 3PX6A 2YHAA 4DQRA 3LAKA 4DFKA 3AO3A 3AA5X 4ID5A 3AV9A 2IAJA 1A5WA 1C0TA 1KFDA 2P1JA 2YHBA 3I8DA 5HRPA 4O0IA 1D8YA 2A1RA 3ZT0A 1RT4A 2KW4A 3KD5E 1BI4A 3KLHA 1CXUA 5T7BA 2OPSA 4BE0A 1JLGA 1S1VA 4CEQA 4JLHA 3HXMA 2IOCA 4I2PA 4DFMA 4AHSA 4EP4A 4CK3A 4W5OA 4HCCA 2X74A 2EX3A 4B9UA 3HP9A 2DTUA 1QE1A 3RTVA 1C0UA 3OS1A 5C42A 3HPOA 3O4NA 4PUOA 4EP5A 1EXQA 3AA4A 3S3OA 1VRUA 4F8RA 1WSFA 4M3TA 1HQUA 1SUQA 3V9ZA 4K8ZA 3VQDA 4I9LA 1EKEA 3ZSQA 4DFPA 4KHYA 1RTDA 4C8LA 3RR7A 3OJSA 4W5TA 1QSSA 4CJRA 4FYDA 1VSIA 3HL8A 3AVBA 2HHXA 3VQCA 1RNHA 4AILC 1B92A 1GOCA 3SV4A 3K5OA 4HUFA 3MECA 3NF8A 3QEVA 3OYHA 1LW2A 1VSKA 4DTPA 3VQ8A 3KD1E 4OVLA 1VRTA 1SKWA 5CYMA 4CGDA 4BE1A 1J54A 1YTUA 2VWKA 4HTUA 3K5NA 1LAVA 1S6PA 1ZBFA 1TL1A 3WNEA 3OYNA 3OYGA 2HW3A 1C6VA 2X78A 4O44A 1TK5A 2BDPA 3DLHA 1BI4B 2B4JA 4H8KA 1NKEA 4FJ9A 3F9KA 3NDKA 4DF8A 5KRTA 3M8SA 4B9TA 4CEZA 3AA2A 3V9XA 1B9DA 3MEEA 4N56A 2G8WA 4F2SA 2ZD1A 3CM6A 4FW2A 4C8KA 2XO7A 3F73A 4FJIA 2HVIA 1IO2A 3KIOA 4XIUA 3TAPA 1K6YA 2D5RA 1RTIA 4O0JA 1U47A 1X1PA 3ZT2A 1U04A 4CJ3A 4CFAA 4CHPA 1U4BA 4FJ7A 3MXMA 4AH9A 1U48A 1WSEA 2D0AA 1XC9A 3NFAA 1SKRA 3P83D 4M3ZA 3U3YA 4JS4A 4LSLA 1ZBUA 4CCHA 5HP1A 2R7YA 3SQ4A 5CYQA 4CJEA 3V9WA 3HYFA 1L3UA 1WSGA 2A1SA 3QEPA 4M3UA 4KREA 4AHVA 2OZMA 2IGIA 3TI0A 3SYZA 3ZSOA 2XY7A 2Z1IA 4DLGA 2G8VA 4Q0BA 4DS4A 4CJQA 3MAQA 1S1WA 2XHBA 3CFPA 1VSHA 4O55A 4F2RA 2OPRA 1ITGA 3EYZA 1ZYQA 3V81A 1S9GA 3QNNA 3E01A 4WE1A 3DOLA 4AHRA 1S1XA 5FDLA 4RW8A 4KO0A 4CGFA 4JRPA 2B6AA 4Q5VA 3OYAA 4LSNA 3S9HA 2GUIA 3LP2A 3PO4A 4CJFA 1W0HA 4DLEA 3NF7A 3VQBA 3ZT4A 1RT3A 4GW6A 4RW9A 1DTTA 1TK8A 2KFZA 1C1CA 5J1EA 4R5PA 3L2UA 3SUNA 3AVGA 4LH5A 2W42A 2HHUA 1XI1A 3AA3A 4DTSA 4KI6A 3LP0A 1JXBA 4N47A 1SV5A 2E6LA 1RDDA 4FLYA 3RMAA 3DLBA 1WAFA 3AVLA 3V1RA 3TWHA 3I0SA 4B8AB 4FM1A 2YNHA 3LP1A 4UQGA 1ZBHA 2O4IA 3SQ1A 3AO4A 3QO9A 3AVMA 4CFDA 1SL1A 2HNDA 1Q9XA 2HVHA 4ELVA 3ZSRA 3MXIA 3SCXA 4KKOA 3QINA 1S1TA 4CF9A 4FLWA 1QQCA 3U3GA 3ZSZA 2QK9A 3C6TA 2PZSA 3JSMA 1IH7A 3O3HA 4CFBA 4C8OA 1NK8A 1RBRA 1D9FA 2Z1JA 4IDKA 4DSFA 1NK4A 1TKXA 3OYIA 4CJLA 3L3UA 4JS5A 4FZZA 4RW7A 3TAEA 2DFEA 1KVAA 2GV9A 3QNOA 3HT3A 3NAEA 4CGJA 4Y1DA 3K5LA 3T3FA 5HRSA 4RG8A 4PWDA 2I5JA 1RDAA 1RBSA 1J9AA 2YKMA 3A2FA 3K5MA 4ELUA 1WSJA 3LALA 4CF2A 3TAQA 4F4KA 2ZQBA 4AHTA 4FLTA 1RBUA 5DMRA 1NOYA 3QERA 1KRPA 3NGYA 3CFRA 1CZ9A 1G15A 3WNGA 5C25A 1TKTA 1D5AA 3HPGA 2FC0A 4CHYA 3PX0A 5SWMA 4FLUA 1WNSA 1O1WA 2PYJA 3T1AA 4LH4A 2HHQA 3NCIA 4K8XA 4BDPA 3ZSYA 1QHTA 1Y97A 2DFFA 3DLGA 3I0RA 2YNGA 3M8RA 3LDSA 5J2MA 1TL3A 2YNFA 3SQ0A 4NCBA 4CECA 3LAMA 3RRHA 2D0BA 3NHGA 4TSXA 3V1QA 1I39A 4DQPA 2PY5A 3IAYA 3LPTA 1N5YA 2G8UA 1S1UA 4CHQA 3TABA 1ASUA 1BIZA 1U49A 5KGWA 1LWCA 2AJQA 1CLQA 1IKVA 3QIPA 1ASWA 2OPQA 3OYJA 1NJWA 1LV5A 3DYAA 4KTQA 3HJFA 3OYCA 1LWEA 1HNIA 3QEXA 1QS4A 1KCFA 4OPKA 3SV3A 4E7LA 4FK0A 1JLBA 2BANA 2WONA 3TAGA 4N41A 4KRFA 1LWFA 4CEAA 1WN7A 2HHTA 2G8HA 4QCLA 4GVMA 4Z4GA 1N6QA 3NH2A 1S6QA 3B6OA 3S3NA 2OA8A 4DF4A 1XHZA 1VSJA 3TAFA 3AVHA 1UA1A 1Q8IA 1QTMA 4HUGA 3MEGA 3AO5A 2KZZA 2Y1IA 4DQSA 5HROA 1RDBA 4FJGA 1KTQA 5E41A 4NYNA 3DMJA 2QKKA 1TAQA 1NKCA 3L2VA 3L3VA 3U6FA 2OYQA 1NK6A 3HM9A 3ITHA 2FBTA 2XY6A 1DLOA 1JXEA 2Z1HA 3DLRA 4E19A 5EU7A 4KHWA 3K57A 2FBVA 3OJUA 3NH0A 3C95A 2ETJA 1LW0A 4BWMA 3TARA 4OJRA 3D0PA 1HQEA 3AVCA 1VSFA 4RW4A 3PX4A 3AVJA 4NCAA 1BQNA 1RCHA 3NE6A 1UA0A 4DMNA 4Z4EA 4FK2A 2DY4A 4J2DA 4DU4A 1NKBA 2F8SA 4E1MA 3HP6A 1KVBA 3MEDA 3AVKA 1BISA 3EZ5A 3B6PA 3DRSA 3VQ6A 4LY7A 3KKRA
chains in the Genus database with same CATH superfamily
4MSWC 5IJ9B 1SS3A 3BGRA 3I56V 3OBYA 1JR9A 4F6RB 1Q81W 1KLMA 1N36K 2HNZA 3D2FB 3LNNA 2NRRA 2Y0IA 3HPHA 4YOVA 2CDYA 2ZD9A 1I94B 1QQNA 3FZLA 5M1OA 3OYFA 5CN0A 3SPZA 4LH6A 4IG0A 4M7YA 4G1QA 4KTZA 3QFPA 4BWJA 2QA4N 3AVIA 2HFEC 3NVKA 2Q0UA 4P30A 3QB0A 2WDVA 4JYAK 4X66B 4GX2A 2Q97A 1BWFO 4NXMK 4JKCA 3OHRA 3BA8A 5J2UB 1QR8A 1RILA 4PL7A 4GCZA 4CD1A 1P49A 1V4TA 1OH6A 3CMAV 2HJFC 3N2GB 3SJCC 4KX6A 4X8AA 1NR7A 4B1YB 4FWQA 3O9QA 3NGZA 1NZ6A 4CJKA 1J5EK 2D3OW 3LZJA 1BE3H 5LYJB 3G6BA 1KKDA 1VSDA 3W7XA 4MLHA 2G8IA 1PIV4 2WUSA 2ITDC 2H8PC 1P4RA 1YTAA 5M1NA 1NGAA 1HKBA 4M3ZA 5KGXA 1RUJ4 4J41A 3QDKA 1BUPA 1EP4A 2LW1A 1GOAA 4ZOLA 1ZBLA 2Y69C 3KJVA 1XMOO 4J2BA 2VQFO 2P9KB 3D2EB 2Q7EA 2F4VO 2IVOA 1JQ0A 2QXLA 4MDBA 4GV6A 1P90A 3SUPA 4K43A 4A5BA 5KMGB 1SQGA 3JCZA 4OPJA 3UCSC 3UIQA 4PKGA 1RTJA 4ILHA 3CCVN 1VQMN 5CZ2A 3RWUA 5IT9O 4UV9A 1RHI4 4EB6B 3OEEG 3C90A 4YJ3A 1YT3A 2UU9K 1GN2A 2P9PA 1PO14 2WU2A 4B3TO 1YF5L 2XAGA 4NYFA 1AL24 4BRMA 5HLFA 4WFBV 4JD2B 1O9GA 1KAZA 5HBMA 4B3SK 4WFBL 1GN3A 1L8DA 2EILB 2ATQA 5BRHA 4ISGA 5LMUK 1OH5A 4KH4A 4BRIA 5IDJA 1IBMB 3LSQA 3N4QA 4PY5A 3MD0A 4DV7B 4PA6A 5CMUA 2EHGA 4B9SA 4H0LB 4IXCA 1A5VA 3VA3A 4TT3G 3UKRA 1EQYA 3OYLA 5C0YA 3D3QA 4X62K 4DR4O 1ASVA 4FCYA 3NBPA 4DCHA 2E3CA 5LMNK 3SJJA 2HG5C 3RYCB 3IS9A 4FWOA 4ABMA 1R1BA 5AQYA 4KXRA 3N2KA 1UJWB 2YCHA 4MLEA 5C15A 3CCJN 2QW9A 2UUAB 3VGKA 3M8PA 4DV1O 5F1XA 3OYEA 3FI7A 3GE1A 1E4GT 2QWNA 4FWNA 4UVBA 3WQUA 3HKEA 4E7JA 5J2PA 4FZYA 1PO24 1RSOA 3CCQV 3OYBA 3R1XA 3E35A 1JL2A 4PHZA 1I5XA 2YV0X 4IO9L 3VQYA 1OH7A 1IKYA 4ZTJA 5GONB 1EV14 3H6EA 4DG1A 2QM8A 1QSYA 3NH1A 1LAWA 4CE9A 2WLIA 3E2EA 4IKFA 2ZGZA 2C2AA 3CC7N 1RDCA 2LGWA 3OFNG 2Q3SA 1KXPA 5DK5A 2VQEO 4CS3A 1XHXA 4HCBA 3WB0A 4EHUA 2YICA 4KHPB 1NOZA 3SYPA 4RHV4 2V51B 3LDCA 5IT9N 3QG5A 1N34B 4JI3K 2JJ1G 4DV3K 5CBHA 5B1BC 1VQ9V 4M3YA 2VYPA 3KK3A 2Y4TA 1PNMA 3CXCU 1IBKB 1RT5A 3L2WA 2HOEA 1L0LH 1HNVA 2O8DA 1GLJO 4O5BA 4IHJB 3JD0A 1JLFA 4DFJA 2R064 4JI2O 1BEV4 4X20B 5KPTA 3T1YB 1E1QG 1Y76A 2B5JA 2E1YA 3S41A 1YJNV 2E75B 3OGCC 2HJDA 1IX9A 3K08A 1YVNA 1Q6IA 1N33O 1M57B 1K73O 4PA4A 3KKYA 3SUQA 4DU1A 3ICXA 3M8QA 5B1OA 4BRKA 3IJ4A 4FO0A 1FXKA 2ZE6A 4TQFA 4MW8A 4A2AA 1N36O 1NJXA 1EFRG 4Z4CA 4Q20A 1RUF4 5E79Z 4WCEV 4BR9A 3G6EN 1TVKA 2WU5A 4B3RB 1NK9A 2VRZA 2RKIA 4WCEL 4N21A 1NBWA 5AQJA 2JK5C 2P22C 3OUFA 4JYAO 2IIRA 4GMJB 2BCCH 1FXXA 4CI6A 1T03A 1VBB4 4LCUC 4MVOA 4Z1VA 4ZI7B 1RT6A 3HVTA 1K92A 4UUJC 4WFAL 1Z2GA 3E8BA 1FPOA 4LF4O 3ABKC 1L1FA 5JS1A 3WU2Z 4BRNA 3ZS8C 1V9PA 2QJ1A 3VEWA 1J5EO 2CE4A 3AAPA 4CJSA 3CXCM 3QEWA 3BF1A 1KECA 2HHHB 1C0FA 1V55C 5TISZ 4FLVA 2JDIG 3CRMA 1VQNN 1WSIA 4GX0A 3SYOA 1HYSA 4Y1CA 2IM9A 1U45A 1ZUQA 5AQRA 1VSEA 2EBOA 3AK3A 1HMVA 2G8FA 1CXQA 3K9JA 3LDOA 1GKFA 2PI5A 3UKUA 3P30A 4C8NA 4DSLA 1AR5A 1ZLZA 1TKDA 1HNWK 4CEFA 1Q86O 3R9PA 1E79G 5JJJB 3L4IA 4DHYA 4EEQA 1K8KA 3OYDA 5F2VO 4KH6A 1S5LZ 3JD4A 2DMXA 4CESA 3O3FA 2RS54 4GX1A 1W9HA 1ATSA 2NNUA 4IBNA 4ZHRA 3A0RA 1YIJN 1OH8A 4B3OA 2QE7G 4KV8A 1KMIZ 3KWGA 3ULDA 1B9FA 4CIGA 3SQ2A 3D3IA 1JLEA 3ABMB 5C93A 3AEFA 3UB5A 4FZXC 3ZCMA 4YSXA 2P9IB 1WLJA 5IYZB 1H2GA 4X62O 3J7YP 1E4FT 5IYCO 1FYJA 2RN2A 3HKDB 3H1JH 5LMNO 1X9WA 4B1ZA 3V9SA 2NUBA 2GWJA 3RW0A 4IJAA 1SQVH 2JRIA 3VN5A 1BCOA 3KZBA 3LSUA 1I7FA 1MNGA 4BVPA 2EIKC 1VSMA 5FNVB 4IFVA 1SQXH 2ZIOA 1DKGD 5FPMA 2E5LB 4BE2A 1HPMA 1SZXA 4JI0B 2UUCB 4E89A 3THOA 1JLCA 4I4TA 4FVMA 1US6A 4I9QA 2YS8A 4HVJA 2I7NA 1TA8A 4L87A 3AO3A 3SPIA 4P9PA 4FSVA 4BRAA 1A32A 1KFDA 1OCCC 4DV5B 3I8DA 2AZ2A 3WB2A 1SETA 4JI1B 4LR3A 2KW4A 3QBWA 3KLHA 4BE0A 5T7BA 1JLGA 1S1VA 3HBTA 3APOA 1S22A 4DFMA 4PA3A 5GINA 4W5OA 4O4LA 1U2VA 4DR3K 5B8HA 4HCCA 4DV6K 3GVMA 1OVYA 4H13B 3QFUA 3K9SA 1QE1A 2P9SA 3WEEB 3RTVA 1K5SA 3OS1A 4RCHA 4DKWA 3OBWA 2JGDA 2FKXA 4YJ2B 1EXQA 3IC7A 4EP5A 3BCCH 4PUOA 3S3OA 3BP8A 4JI3O 1S0VA 1VRUA 3P39A 2WAMA 1AP5A 3RVZA 4K8ZA 3VQDA 2OANA 3ZSQA 3D36A 4PHTX 3AEDA 4DV2K 3O08A 1YQ4A 4W5TA 3G4SV 4FYDA 1VSIA 2FSNA 2HHXA 3QF7A 5GAGP 4E2LA 2XUMA 3UT5A 1B92A 4DR7O 4UB8Z 3RYFB 5HFMA 4F6RA 2KLAA 3LDNA 4DQ8A 3QEVA 1G6UA 2Q0AA 3FB8C 3VQ8A 1F23A 2ZM6B 1VRTA 1XMQK 1SKWA 2WS3A 2K1EA 1J54A 2QWPA 2Y4UA 1XNRB 3K5NA 4YDUC 3OYNA 5EBMC 3LSSA 4JHDB 2EJRA 3DGEA 4O44A 1KUQA 1BI4B 5EZYB 3F9KA 1PKXA 5ITZA 1BU6O 3NDKA 4J7JA 4YY3B 1OVQA 2CGKA 1YTFB 1B9DA 2QWMA 3MEEA 3BABA 1M9NA 1MWKA 2FB5A 1AR74 5J2UA 3H45C 3F73A 2ZR2A 3VOUA 3SMPA 4CH4A 1X1PA 3ZT2A 4FJ7A 1PNLA 2O8FA 4CHPA 4ZKIA 3F7YC 4X64K 1U4BA 4WF9V 1WSEA 1XC9A 3AEEA 5JH7A 3J7ZO 1VQLN 3OA9A 1FJGB 3P83D 1AJNA 2CGLA 5AQQA 4WF9L 1ZSPA 4JYYA 3U3YA 1YXQA 4P9OA 3ZCCA 2P9NB 1OCZB 1IBLK 2R7YA 4PKIA 5CYQA 3W0LA 4Q4X4 1NI8A 4M3UA 2R9RB 4YTNA 3VETA 4AHVA 3UO3A 3O65A 3TI0A 4TQDA 1TAEA 4WQ4C 2Z1IA 4BC5A 4DR5K 4DLGA 3CXHF 2P9KA 3A8YA 3D2EA 2DPNA 1VQ7N 4JYCA 3THYA 4HZ3A 2UUBB 4GYCB 5KMGA 2P9LB 1Q6HA 4JKDA 2YJEA 3V81A 5J9PC 1S9GA 2YHYA 4FJLA 4JRPA 4CGFA 4YSYA 4KO0A 4PDWD 4Q5VA 3OYAA 1KP2A 2QTSA 3LP2A 5BPMA 4CJFA 1ZL8A 3VQBA 4JD2A 1Z5VA 3ZT4A 3IKMA 4GW6A 4JNEA 1H1VA 1TK8A 1TUBB 1NGIA 1K33A 3OR6C 2PI4A 3S3WA 2VGNA 2ITMA 2RNBA 2ILMA 3FZMA 4Q4V4 3LP0A 4N47A 2EINB 3N27A 2PAVA 4DV4B 3JD2A 4ILGB 4B8AB 4UXNA 1NVPD 2O4IA 3EL2A 4BVOA 3VGLA 3RYCA 2RR14 3L74H 4KKOA 4PD4F 3MN6A 2HEPA 3QINA 1S1TA 3EZWA 3M6GA 5BY1A 2E1ZA 1SRYA 3O9SA 3U3GA 3C6TA 5EX5A 3OGIB 4C1NI 4DK1A 2QKAA 3B09A 4B3MO 2CH5A 5AQMA 4CW7B 4DUYK 4C8OA 2BOCC 1Q43A 4IDKA 4C1NK 4QPJA 3ZEDA 2EIMC 4JS5A 4JI8B 4LF5K 4RW7A 2R72A 2DFEA 2L35A 5KPZA 2FF6A 5ADXA 3DJCA 4UCRA 4CGJA 3BVOA 4FPAA 4J42A 5GONA 2I5JA 4PWDA 4DK0A 2QWRA 3CSXA 1Y74A 3A2FA 3ZMZA 3K5MA 2BTFA 4WYBA 4NTWA 4C23A 2W41A 4FLTA 5CHIA 3SR2C 3BUZB 2PTMA 1XL6A 2V7QG 4DV0K 3I8BA 3U0ZA 3HB3B 4CHYA 2FC0A 2HWB4 1MA1A 1O1WA 3T1AA 2HHQA 3LUTB 1UFIA 4PV1B 3CC4N 4DR1K 4DV6O 4RQEA 4NXNO 4BDPA 3LDSA 4DWIA 1BMFG 3UO2A 2YNFA 3CI5A 3CIRA 1HR0B 1Y67A 4LF9B 1VQ5N 4IHJA 1X3MA 2XASA 2Q31A 3U10A 4TSXA 3V1QA 2WFBA 2OCCC 2PY5A 4WFHA 1K8AW 2EZPA 2PGGA 4DV2O 4IEEA 3P4PA 3TABA 1ASUA 1U49A 2D4WA 3A8TA 1IKVA 1NJWA 4RQFA 4CH6A 3DYAA 1MSDA 4MVMA 3JBG4 2P90A 4Z2WA 4OPKA 3SV3A 1E3MA 4KRFA 3G71V 3TAGA 5AR0A 5M1PA 2G8HA 1XMQO 4E4EA 1IXMA 4I50B 3SPCA 1G1XB 3HZ6A 3B6OA 4ILJA 2OA8A 4DF4A 1XHZA 2GUPA 1OHHG 1P7GA 4NKGB 3WFVA 3AVHA 5LY3A 4PDRA 3TAFA 1UA1A 4JI5B 1G4YB 1YHQN 5GTIZ 1EZJA 2KQXA 5KAIZ 1YSCA 5M1QA 1KTQA 4CBXA 3HTVA 1RDWX 4FJGA 1CP9A 3BEXA 1QU7A 2FXUA 2P4KA 2QGNA 2NRZA 3JAMO 3O6WA 2IJKA 4BRLA 2OYQA 4H0TB 1N32K 4X64O 2ITCC 2Y69B 1DLOA 3F5TA 1SQKA 3OE7G 1ZXOA 2Z1HA 3BY6A 1FXHA 4KHWA 2FBVA 4AF1A 3SBTA 3EKUA 3NH0A 1IBLO 3C95A 2ETJA 1LW0A 1H2KA 3J8AA 4OJRA 3M8AA 5TKWA 1Q7YO 4O4HB 3AVJA 2GHYA 4QS8A 1UA0A 3SJHA 3B2EE 1HJOA 4H0PA 4CH3A 4BC3A 4DU4A 1NKBA 4LFAK 4FK2A 1H8EG 4DR5O 4E1MA 4RUFA 1KVBA 3MEDA 3DRSA 1FXVA 4BIUA 1YVWA 3CJBA 2JVDA 4UCVA 3OTOK 2IJIA 2UYTA 1NGJA 5C8YA 4CZJA 3VERA 3QICA 1THZA 3PJSK 1BQ0A 5EC2C 1JFFA 3GQHA 3TXSA 4KP4A 3ZN0A 4MO5A 3CF5L 1AR1B 4IDHA 4R7CA 5E26A 4M3WA 1NLVA 1O13A 4CF0A 5JCOC 3C6UA 4KBOA 4FOIA 1NMNA 5H9CA 3CJ7A 1BGXT 2E74B 3BA9A 3HK2A 5BMVB 5GAHP 1WSHA 4GKKB 2G8KA 3AVFA 3JXUA 1EBOA 1IDSA 4KFBA 1ASJ4 4LD0A 3IUCA 1WBBA 1VQLV 1RUH4 4M3XA 4CFCA 2A40A 1YXBA 3LPUA 3LZIA 2GTSA 3V9UA 3P38A 3TAMA 4E1JA 2P9IA 5DM6V 4FWMA 1ENVA 3A0HZ 2ASMA 5FL7G 4FJ5A 1O9HA 2Q68A 4WFNL 2YUAA 1BHBA 1VQ8N 1NJZA 3HOSA 3T19A 2BSKB 1AB3A 3SAHA 1VQKN 1SF9A 2OCEA 2R044 3JARB 2P5GA 4B9MA 1Q5OA 4DR2B 2NLXA 4BRFA 4DQIA 4EAHD 4W5NA 1CZBA 3NF9A 3JAMN 3TU5A 4W5QA 4CZIA 3T7ZA 2WTUA 4B9VA 2F8SA 1I3AA 4DUZO 4MFBA 4LF5O 4LF7B 4JK9A 1MMMA 2F4VK 4JGSA 1J5OA 1FKPA 1PL4A 3L6QA 5K14A 3SZ2A 4FJJA 3SJBC 2QEXV 1VF6C 2GELA 3HSCA 3HI0A 4IFYA 5CZ1A 4DB3A 1HNXK 1EM1A 1BCMA 1WP7A 3STZC 3VEYA 2GUZB 2DFHA 4N23A 3SPGA 4K42A 3OR7C 1LUWA 3B40A 1RM1C 4BY9C 3TETA 3PY8A 3CCEV 3O4QA 3K58A 4WBNB 5LHIA 3CCRV 1NGEA 3DRRA 3ETQA 4YJ2A 4JRQA 1C1BA 4DR1O 4O4IB 3QETA 3P1GA 5EC1C 5J2TB 4JKFA 5JJNB 5F2RA 3VQQA 1NQTA 4J2AA 4CF1A 2HSTA 4JV5B 3LM2A 4LBEC 3LNMB 2X6NA 4BQZA 4DU3A 4B9LA 4OLBA 5H6QA 1NNEA 2AXTZ 5LP6C 4DR4K 2D0OA 1JL1A 4DW1A 1B3QA 4M3RA 5I9EB 4JZ2A 3CCLN 4DXWA 3RYFA 2GTAA 1GLBG 1XC3A 2QTDA 2UXNA 1XQSC 1N0JA 2WA3A 3JALA 2WC9A 2F93B 3F5WC 4OX9B 2XY7A 4N76A 4Z4FA 5B1NA 1XUPO 4W4KA 3ATVA 4DV1K 4KB1A 1H2MA 2XOKG 4JHDA 3VESA 4AM6A 3U9ZA 3GWOA 3AE1A 3L2RA 3CMEN 1KQSM 4CZZA 1RT7A 2EWSA 1RGIA 4FK4A 3ASNC 1K73W 2HBKA 2B76A 2YJFA 1NS1A 4CZMA 3LWMA 4X65B 1X9SA 2IW5A 3AO2A 3DM2A 4CJ7A 4DTRA 5K1PA 4A59A 3RWRD 3CIPA 2P5OA 3DXKB 4IJNA 2WOMA 3AE8A 1RFYA 1IG9A 5AZIB 2Z1GA 4YNQA 1NJIO 1HP8A 3K3WA 1V55B 2HHSA 3ZT3A 3IRXA 3C3TA 1QVFU 3ETDA 3CG7A 4M45A 4LF8B 3AEIA 5EK0A 4CJPA 3ASMA 5DEDA 2FTKA 2P9NA 3CCMN 4TUYB 5AQZA 1N32O 3LM9A 5KHHA 3DXMB 1XUQA 3E8FA 4CJ4A 1VQ5V 5SZTA 3JYTA 2WLMA 5JS2A 3KWIA 4DTNA 3AG4C 4OPAA 4IIJA 4CK1A 3K59A 4CIEA 1SESA 4IYHA 2ZJQL 5HFLA 1AVMA 3HSTB 1IBMO 4CF8A 1IV0A 2E2PA 1T3VA 4ICLA 4CJTA 3FR0A 5LA6B 1PL0A 1TVRA 5AQFA 5IY5C 3T1HB 5DN6G 4X89A 1NK5A 3CX5F 4CEDA 1NK7A 2HP8A 3M5RA 3BDPA 3OTOO 4JF3A 1JKHA 4CC6A 5BR8K 1YAGA 5IWAB 2P51A 1NWKA 1D4M4 4BG8A 4PA9A 1TUBA 5BR9A 2YIBD 2Q67A 4Z4HA 3AE3A 4DUYB 1X59A 3L73H 1RBTA 1DK1A 5HL7L 1VIBA 3OYMA 5LGTA 4FFBB 4E7IA 4FJHA 3VQPA 1RTHA 3THVA 4QAGA 1Q86W 1C0GA 3ID6A 5KAFZ 4BC2A 1Q82O 3KKSA 1YI2N 3CRCA 1L5UA 2E20A 5JICA 4FLXA 3CETA 1QVFM 3MK6A 2VG6A 3EO3A 1VQ4N 4EZ6A 3QEIA 2EIKB 2P4VA 1S9EA 2WP9A 1YUWA 5J2QA 2F66C 1VP7A 3M99B 4LY7A 4FJNA 3H08A 1TAUA 2CTPA 1BZKA 5BXZA 1D9DA 4LF4K 3E22A 4KHPO 3MCPA 4OKJA 4DTOA 1YITN 2CUGA 3CS5A 2Q7GA 2WLKA 4X1KB 3ZSVA 1I0HA 4ID1A 3ZRVA 4BDYA 3WNHA 3OEHG 3LANA 4PQUA 4YT0A 1K5QA 4WFGA 1VQOV 1SAZA 4J8FA 1R3KC 3VQ9A 1MU2A 3VF6A 3L75H 4DSEA 1KF6A 1NGCA 2RS34 2ZF5O 4MVUA 4FJMA 4UCTA 3EE9A 1HJRA 1AI5A 3MXJA 4LFBK 1HNXO 1BGYH 1NR1A 4B8CA 3ZMTA 5KX5B 1KC8O 5JVGL 1YJ9V 4CK2A 1S3JA 4MW3A 5CA1B 3VQ5A 1R0AA 2YX6A 3OVNA 3SJAC 2CTQA 1NU1H 3CJCA 1HNZK 2UXDO 3KTQA 1XOUA 3CRRA 4BRPA 5CE3A 3ZLJA 1BT8A 2ADPA 4CJWA 2HMIA 2QKCA 1X9JA 1TYQA 4LF6B 1XREA 4FW1A 3HRGA 1QQOA 2D0CA 2OTJN 1R73A 4PI2A 3RYIB 1HKCA 3TSQA 1TUEB 2LFSA 4GV9A 3H1QA 4G9ZA 4ISFA 4MQ3A 3JCUZ 2ZE5A 3J81O 4LC1A 3MDSA 1REVA 2R074 4JAUA 5LGUA 1Z25A 4DR6K 3FYIB 1PP9H 4I50A 1MOFA 3NR7A 1BG3A 4I7FA 3VEOA 2CH7B 3ATUA 4XDLA 4DQRA 3LAKA 3AA5X 1GAXA 2DQ0A 1A5WA 1C0TA 2E8AA 3JS6A 1D8YA 5HRPA 2ZKOA 3ZT0A 1RT4A 4I0XB 1VAZA 3ABLB 5C10A 3ULEB 1KYOF 3JAKA 1FXKC 1NG9A 4I2PA 2CTRA 5H6RA 4AHSA 4CZLA 1VQPV 4EP4A 3HOTA 4CK3A 1AR94 5L3EA 3VEVA 1I08A 2X74A 4B9UA 3HP9A 4JI7K 3FFQA 3ETGA 3VOVA 4CS2A 1GMGA 3HPOA 1NGFA 2H3GX 2CAZC 1BL8A 1YJWV 4G27B 4M3TA 1HQUA 1SUQA 3CD6N 3BRCA 4I9LA 4O4HA 4Q4W4 3MCAB 4KHYA 4C8LA 2ASPA 2BTQB 1GN6A 4CJRA 3HL8A 3AVBA 4H0VB 2YIBA 2P7TC 3VQCA 3E1YA 1MQTD 4QE9A 1RNHA 2FYUH 3K5OA 1NBMG 4K0KK 2D2CB 3A5MC 1YF2A 3OYHA 4MT8A 4XDJA 1P7BA 2YXYA 2IJHA 2GEMA 4O2BB 3SBGA 4CGDA 4BE1A 2F23A 3BY5A 4CBUA 2VWKA 3QO8A 4I5SA 2ZNJA 3AGKA 1TL1A 3P4RA 5BR8O 1QNMA 1C6VA 1TK5A 2B4JA 5D5QA 1QZ5A 1NKEA 4YHHK 1VMGA 4B9TA 4JPRA 2E5LO 4CEZA 3J81N 4JI0O 5BMVA 2UUCO 4TOIA 2ZD1A 3CM6A 3ENHA 4JTCB 4FPPA 3CCUV 4JN4A 5C2FA 3L72H 4A62A 4LFCO 4FJIA 4BR6A 2HVIA 4XIUA 3MN7A 1S5HC 4LWSA 1ZX3A 1RTIA 4O0JA 1XMOB 4JKAA 1U04A 4EFHA 4CFAA 3B8NA 2VQFB 4I7ZB 4MVSA 2F4VB 2D0AA 3QO7A 3C7NB 4AH9A 1SKRA 4UCOA 5FPEA 2EIMB 3ENBA 3LL3A 1ZBUA 2BSKA 5HP1A 2JS3A 2GBOA 1L3UA 3JARA 3QEPA 1F4MA 2ZXWC 4B3TB 2NRHA 2IGIA 5KA6A 3ZSOA 3H01A 1LNQA 2Q69A 1AJPA 2QM4A 4DS4A 1R6KA 2P67A 5ELZA 2UXBK 2Q4PA 2OPRA 1ITGA 2G38A 2Y48A 3X2QC 1ZYQA 4BRQA 4CZHA 3QNNA 4AHRA 3JAWB 5KHGA 5L3GA 1S1XA 4RW8A 4AQYK 3S9HA 3H1KH 3PO4A 2GUZA 1DGKN 3AG2C 4YIOA 4RW9A 4DR4B 1DTTA 3A5LC 4JASA 4LFBO 3P4QA 3SUCA 3SUNA 3PIPL 2W42A 2QWLA 4KH5A 2HHUA 1XNRO 4MTXA 2QA4V 2AZ0A 4CC5A 2CGJA 1SV5A 2E6LA 1HNZO 2GX9A 1OCOC 3AVLA 3TWHA 3HKBB 3CYOA 3FAVA 4O4IA 4YY3O 3I0SA 2YNHA 3DSQA 3LP1A 1M56B 1AROP 4JI6K 3R65A 4UQGA 4ZHQA 2DYSC 3APQA 3QO9A 3E8HA 2UXCO 3DXRB 1SL1A 2CK3G 2HVHA 2RS14 3ABVA 1WA8B 3MXIA 4H5RA 2EJ7A 3I55N 3PLAA 1R3JC 2BOBC 1QQCA 4FLWA 3C6HA 2RMU4 4H5NA 1YZBA 2PZSA 1COWG 3JSMA 1P8ZA 4K3AA 4CFBA 1SS6A 2H94A 2YDEA 2E88A 2Q1NA 5E84A 1D9FA 5B5EZ 2Z1JA 4JAXA 2VQEB 2Q6AA 4B3MK 1F4NA 2X6BA 3D36C 3TAEA 1KVAA 2GV9A 5JQGB 3QNOA 4DR6O 3NAEA 2Q2RA 1BO5O 4Y1DA 3K5LA 2XTAA 1W0JG 1ZWIC 1GN4A 5AQPA 1J9AA 1HRI4 1SQBH 2EIJC 5H5NA 4RWTA 5C12A 1Y6XA 3CCVV 2GSMB 1VQMV 3LALA 4JI4K 4CF2A 1DF5A 5IE9A 2ZQBA 2UUBO 3ZX6A 4CZGA 4F9OA 1RBUA 3CJHA 4YIPA 1WLEA 1NOYA 3QERA 1KRPA 3NGYA 5AZIA 2RE2A 4BAYA 3IGAC 4JI2B 1TKTA 1D5AA 1K9MO 1NGGA 5AQHA 3PX0A 5HOOA 2IVNA 4JKGA 1XL4A 2A79B 2PYJA 5TKYA 4LH4A 1OCRB 4MTGA 1N33B 3DXMA 2A06H 5C3JA 4JI7O 2WLLA 3ZSYA 3I0RA 2ZCEA 1HKGA 3A0BZ 1K4CC 2YNGA 3SFEA 1TL3A 4QIWF 5AQWA 3BF3A 4NCBA 4NXNK 1N36B 3E8GA 3OTFA 3LPTA 3IAYA 1N5YA 2G8UA 3AG3B 4IFEA 4G2KA 1SA0B 2B1GA 1BIZA 1N8RO 5GIPA 1QLNA 1LWCA 2DW4A 3FZFA 1CLQA 3QIPA 3JASB 3HJFA 1DEJA 2WDQA 2YEVB 3BAAA 3CCJV 4JYAB 3QEXA 2P06A 1Q7YW 3OMNB 1KCFA 4U7BA 4NXMB 1JLBA 4N41A 1MABG 4K0KO 2QSAA 4X1YB 4CEAA 1WPXA 1WN7A 3WG7B 5IJ9A 1ZAUA 3B4SA 4BROA 1N6QA 1EZVH 3SYCA 4LF4B 4MO4A 3S3NA 3ZMVA 3D2FA 5AFUA 4PA7A 4JI8O 3IFRA 1J5EB 3FFKB 1GO3F 4YHHO 4FFBA 3MEGA 2HBLA 2QM7A 4HAMA 4DQSA 1NEKA 4NB4A 1RDBA 3P32A 3QO5A 3CC7V 1HW7A 3L2VA 1SQFA 5EYPB 3STLC 2AGAA 2A7WA 4R8CA 2YIAA 2FBTA 3CP1A 1R6TA 3N2GA 3DLRA 1XNQK 3C0BA 3K57A 4X1KA 3TK1A 5EY4A 2PUSA 4BR7A 4MVZA 3THXB 2W6JG 1S72N 1QCEA 1HQEA 5LYJA 2Z3YA 1JJ2U 1VF5B 3WT0A 1NMDA 2UU9B 3D0PA 3AE4A 4Z4EA 2DY4A 3SAFA 3H1VX 4J2DA 3EXAA 4LNUB 1P84F 1Y66A 3GL1A 3ABTA 1HR0O 4B3SB 2UXBO 4Y0WA 4LF9O 3VQ6A 3KKRA 3PV8A 1RM1B 5LMUB 3Q7CA 4FMTA 1YVUA 4CD3A 1XQ8A 4L8RB 4NB5A 2A42A 4AQYO 2HVKC 4K35A 4IO8A 3VQEA 3R66A 3UQ8A 2W6LA 2YXLA 1OJHA 5KX5A 1LUVA 2DQ3A 3B77A 1CEZA 1QLEC 2YKNA 4EB6A 3AO1A 2KSDA 1K3EA 3L70H 4X62B 4NLBA 4XH4A 5AQOA 2O4GA 4FK5C 1RUG4 3EY1A 1GM7A 3JSLA 5CA1A 3J80N 1SQQH 3G6EV 5LMNB 1VHXA 4H5TA 5BN9A 3ZRSA 4U67L 1HDJA 3K04A 4M41A 4E7KA 3DRPA 3L4QA 1TGOA 2DE0X 5LP6B 2PFUA 3K2PA 4FWLA 1T05A 3SDLA 2ODMA 4JI5O 4Z4IA 5A2QO 4MS2A 3RYIA 5LOVB 4JI6O 5EIBD 2D0PA 2NRVA 4CZEA 3DC6A 1OKJA 3KHYA 3UE5A 3VENA 4KHSA 5AQIA 1VSLA 4HWIA 3CC2N 2IH3C 2HBMA 2NRTA 1GLEG 1IVSA 4NVPA 5L3FA 4FM0A 1JJ2M 2OT5A 2AHYA 4YTMA 5HRRA 1C1AA 2QTOA 3ZMSA 4KHUA 3L8BA 4BRDA 1VQNV 1S77D 1QSLA 2GBZA 1WAJA 4GKJK 2CH7A 3RYHB 4FJXA 3GB7C 3OS0A 4DUZK 1WBDA 3BPZA 4HHTA 4JI3B 4I0XA 1L3VA 4DV3B 3DLLL 2BGGA 3ULEA 4ICGA 3NVMA 4JI4O 1SKSA 1M93A 4AM7A 2F9WA 1Q6UA 3DLEA 4OXSA 3AG4B 3TGUH 3CCSN 3VF2A 4KHNA 3FE1A 3CJ1A 3FZHA 4D7SA 2KKZA 5L3CA 4C8MA 1YIJV 1S3XA 5KHIA 1I94K 3HPLC 2YNIA 3SK3A 3G0ZA 4OKKA 4ZBMA 1NJIW 5IYDO 1DTQA 4CHOA 4GKKO 2XRIA 4CIFA 3SUOA 2OPPA 2BTQA 5FRNA 1R3IC 1UAXA 4X66K 5LHHA 4BR4A 4DQQA 1XWLA 3K06A 1H8TD 2HMPA 1L3SA 1ESVA 4X20A 2PYLA 3RMDA 2K9PA 4YOXA 4O2BA 5A2QN 3OS2A 1X9MA 1AR84 1RPRA 2DYRC 2QWOB 3KLGA 2CGOA 2F9TA 5AZJB 4YJ3B 1T7PA 2AP1A 2P9PB 4BR0A 4MDAA 2ITGA 3TANA 1Z7S4 1RT1A 2XAJA 3O1WA 4O4GA 3FZKA 2Q8VA 3O1BA 4GZRB 4CGHA 4LF7O 3AVAA 4WQ5A 1ZBIA 2HLDG 3H3OB 4CS4A 5EIBC 3JD74 4V19S 1NGHA 2HWC4 4FIPC 1KLNA 4CEOA 4OGEA 3C7NA 4W5RA 3VTHA 3QNEA 1EX4A 3F7VC 4E1NA 1QBZA 3GDQA 4H03B 2A3ZA 4CJUA 4DTMA 3THWB 4ZI7A 1Q82W 3N4PA 3ZHSA 1XNQO 3AVNA 3QIOA 4FL9A 3LWLA 2O8CA 1V4SA 2LSNA 4QNHB 3SPJA 3ABMC 1NH2B 1YTFD 2A3QA 1UOCA 3I33A 4YFUA 1HNWB 4FJKA 4HTLA 3SAGA 2OTLN 4QOZB 2QWNB 2A5XA 2GTDA 2QI2A 3CM5A 5H1SQ 5B1AC 1GLAG 1IBMK 4DV7K 4CEBA 1RSOB 3I56N 5KI6A 3JAWA 2OIGA 3L2QA 2B9ZA 1FKAO 1JOYA 1GLCG 4J10A 3IMXA 4PKHA 4N5SA 1TK0A 1R084 1W0KG 5JMVA 1KFYA 1HXS4 3DTUB 2V7ZA 1JMKC 2OZSA 4BACA 3C6AA 5CBGA 3O80A 3ASOC 3KLEA 2UUAK 2QR4A 2UXXA 3E89A 3ZHQA 2FSJA 4KHQA 4B9NA 4B3MB 4ISEA 1SERA 3IG1A 1NENA 3CMAN 2L6LA 2RHKA 3CPWU 3MX5A 1M90O 5BZBA 3HKBA 2E4LA 4ELTA 1WP8A 1KC8W 3U11A 3DWLA 3U8XA 3Q4HB 4DSIA 3DXRA 3DC5A 5KQ8A 2H88A 1FAFA 5B66Z 5AJ3K 3TR8A 1OOPD 2X6SA 4TSFG 3LDPA 3RMCA 4B7KA 5IYZA 2EZOA 3V6DA 1SKVA 4CEEA 4KHPK 1JX9A 3HKDA 5DM6L 1GK9A 1GRJA 2Z0AA 3AE7A 1VK0A 1FKOA 3E9PA 3H3NO 3WNFA 4GY2B 1Z6RA 4AHUA 3SI6A 1N34K 1VQ7V 1FXKB 3C94A 5FNVA 4F3OA 3LDEA 1J53A 4DR3B 2WBNA 3G67A 2ZJRL 1IBKK 4GKJO 2KFNA 4DV6B 3GQKA 1W2BM 4NXNB 4OKEA 3ZETB 2JLEA 3SYQA 1HYVA 3RMBA 4DRXB 3K9AA 4Z94A 2BTOA 3MHHC 2GDSA 3S3XA 3T1YK 1KQSU 4F6EA 3T4DA 4DV2B 3B8AX 2RMKB 4CHZA 4BDZA 2O8EB 4JAAA 2F8TA 3LDDA 3HVRA 5B1BB 4XBFA 3NGIA 3CPWM 3FYEB 3G25A 4CHNA 4W4LA 1M1KO 1KP3A 5HRNA 5KHJA 4ZIBA 2UXDK 2QKBA 3WEEA 1I94O 1BL3A 3O3GA 4LP8A 4FWPA 1VRH4 1NJYA 1Z26A 2Y1JA 3RN4A 1XMQB 1BHLA 3FFIA 4CBWA 1AI4A 4B3RK 1SZTA 3P5JA 1SA0A 2N74A 2YXHA 4TV8B 3QESA 1AR64 4X66O 5JJEB 3PUFA 1KVCA 1VBE4 1OCZC 3JASA 1GOBA 2PBDA 4M42A 5JCOA 1HUXA 4I9WA 4EZ9A 1ROPA 1IJJA 4X1YA 3K0DA 3CCQN 5GIOA 1S5JA 3ZHVA 5KTQA 4DTJA 2DJVA 2DWEC 4H4MA 3KVGA 2PW9A 4RAIA 2YI8A 3PIOL 3PX6A 3KLFA 4X64B 4ID5A 3PN1A 2IAJA 2HHHK 5AG2A 2VWBA 5BPNA 2WQYA 5JWPA 2P1JA 2YHBA 4FJCC 2ZDIA 4O0IA 4FOEA 5AQTA 4CZFA 1IBLB 4O4JB 1BI4A 5KHKA 5EZYA 2OIEA 2P6JA 3L71H 4JLHA 5AQGA 3HXMA 3VQWA 1BSMA 5EYPA 3ABKB 3E83A 1LCUA 4DR5B 3ZHRA 1D4XA 2EX3A 5IJ0B 4PELA 1VBC4 4JZGA 1VQ9N 1IXBA 3QVNA 1MA9B 5C42A 3O4NA 1QQMA 4OGQB 3AE5A 3CC4V 4I6MB 5CA3A 2EINC 3A0IX 2FF3B 5DM7L 4PDVA 1WSFA 3THXA 4F8RA 1H2SB 1EKEA 4DFPA 2P9UB 1RTDA 4CZKA 3WXMB 4JYBA 5BRFA 2LQTA 1QSSA 1D5NA 3MDQA 1YJNN 3M3ZA 1VBA4 4LNUA 1HX1A 3AG2B 3A5OC 5LGNA 1NM1A 4AILC 1KD1O 4O8KA 3UKMA 1K97A 4YOUA 3OAAG 4DV7O 3W7UA 3AGRA 4I4TB 4DTPA 1LW2A 1VSKA 2P9LA 3KD1E 1CPYA 2VCPA 5CYMA 1YDXA 2HW3A 1NT2B 1LAVA 1S6PA 1ZBFA 5EOYA 3WNEA 3AE2A 3DLHA 4H8KA 1DT9A 4IOXA 5AQSA 1AJQA 4A57A 3AA2A 5KRTA 3AEBA 1Z5WA 2M7WA 3V9XA 1V54C 4I55B 3O8MA 4H37A 4UB6Z 2UUAO 2QWQB 4FW2A 1U2VB 2J4RA 3ENOA 2XO7A 2E5LK 4JI0K 2UUCK 2XAFA 1YHQV 1IO2A 3K0GA 1K6YA 2P9SB 3TAPA 1U47A 2X5ID 2Q0OC 2JGDB 4CJ3A 3VBBA 4LFCK 3WXKA 3MXMA 1U48A 2NLJC 5LOVA 4IEIA 4QE7A 4LF5B 3NFAA 3O9UA 4K41A 1BA1A 4UFZA 4DV5K 4KL1A 4LSLA 4FZ0A 4JI1K 1ZP0A 1KAYA 3T4ZA 3L0QA 5K1XA 1YCIA 3HYFA 2YHXA 1WSGA 2A1SA 3T69A 1XBLA 4KREA 2EIJB 5AQVA 3UT5B 4F4LA 3HM8A 1EN4A 3AK2A 3C65A 3SYZA 4J7ZA 2ETNA 3HR0A 3CQXA 3MAQA 4BR2A 4DV0B 1S1WA 1VSHA 4O55A 3EYZA 3H1HH 3RYHA 2QWPB 4KFMA 1N34O 1PNKA 5JVHL 5MLCQ 1OCCB 2JIZG 2YC0A 1XILA 4WE1A 3DOLA 4GNIA 1IBKO 2B6AA 4DR1B 1VQ6N 5ITZB 2JS5A 2GUIA 3VF4A 1W0HA 3FLCO 3NF7A 4O5FA 4DLEA 1J95A 2YSUB 1RT3A 3T2MA 3AG1C 1C1CA 1WUAA 4QS7A 3T1YO 3F9MA 3WQTA 3WUHA 4B1XB 1R094 4GB34 1XI1A 4KI6A 3W7TA 2O8FB 1JXBA 4R6ZA 2ZM6K 5JH7B 4XDKA 3RVCA 4EFEA 3DLBA 1XNRK 1WAFA 4QJFB 4WFFA 1K9MW 2VS0A 1ZBHA 3AO4A 3KZIZ 4YY3K 4CFDA 2E2NA 2HNDA 4Q6GA 5LL6Y 5AQNA 3ZSRA 3SCXA 3R8EA 4B3RO 4B9QA 4X9QA 2UXCK 4CF9A 3ZSZA 4BRHA 2QK9A 1VQ8V 3O3HA 3MWPA 4BR5A 1VQKV 3THYB 1NK8A 1RBRA 4DSFA 1DTOA 2ZR3A 1NK4A 4GV3A 1FFXB 2LGQA 1T6DA 2QWOA 1FJGK 1RUC4 3KG2A 5AZJA 3AG7A 1N8RW 3HT3A 3T3FA 2M6YA 1VARA 1X3NA 1ZL8B 1RBSA 1FD9A 1RDAA 1YEWA 4IT5A 2YKMA 1N32B 1BHAA 5CR4A 1RUI4 4ELUA 3H9VA 3TAQA 4F4KA 3ZX3A 2HHHO 4AHTA 5KA5A 2GWKA 5DMRA 5JVDB 1ZTEA 3CRAA 4A5UB 1CZ9A 1G15A 3QTCA 3WNGA 2UUBK 2DWDC 3IDHA 5C25A 3SYAA 4DO2A 5FPRA 3HPGA 3PSFA 3BFRA 4FLUA 5SWMA 5LL6Z 3ML0A 4LFAB 3EHBB 2OWOA 3NCIA 1LR1A 3THWA 4K8XA 2DFFA 5EBLC 3DLGA 2HKOA 2W0FC 4JKHA 3OTOB 5J2MA 1BA0A 3O9TA 4FWSA 4GX5A 4CECA 3LAMA 4HNAB 2D0BA 4DQPA 4B7EA 3G4SN 1GLFO 2BH1A 1NTZH 2RDCA 4O2AB 3TSUA 1AP6A 3GWKC 4NTXA 4JAVA 4O8UA 2ZJPL 5KGWA 1KKCA 1LV5A 3P4SA 1QLEB 4DV4K 4KTQA 1PM9A 3MN5A 3CCLV 4D6TH 1LWEA 2F95B 4TWKA 4E7LA 2DN9A 2BANA 2WONA 1WB9A 1ZOYA 2QWRB 1Y74B 1LWFA 2HHTA 4LC9B 3OT7A 3WXJA 1S76D 4QCLA 5LHGA 2Z5UA 4WFEA 1HLUA 1T44A 3AEAA 4BWAA 4MVRA 4NO7A 1U96A 3CMEV 1QTMA 1GTOA 1Q18A 2D1KA 2NNWA 2YIDA 1L0NH 3CB2A 4JI8K 1RMU4 2V52B 4NYNA 3DMJA 3FKSG 3ZEUB 5FPOA 4YOYA 1NKCA 4Z1MG 1SQPH 2N04A 2PF4E 2W6KA 3L3VA 3Q4HA 3U6FA 1BOTO 1NK6A 3HM9A 3ITHA 4BW9A 4MVQA 1Q90D 4A2BA 4E19A 3IC9A 3CCMV 4DV5O 4JI1O 3AE9A 1PV0A 4EKWA 5BREA 3EN9A 4NTYA 4RTFD 4BWMA 3VEXA 4IOCL 3P3NA 4UV8A 4RW4A 4NCAA 1FS0G 1HNXB 1BQNA 1RCHA 3NE6A 1GM9A 2JWLA 4MTFA 4UY8O 4AI8A 3HP6A 4A5AA 3K79A 1TUUA 1BISA 3AVKA 3EZ5A 3SPYA 3RGBA 4IYIA 2A9HA 3WB1A 2X7RB 2XY8A 2ZE7A 2UXDB 3ZETA 3V4IA 1HR0K 3RSEB 1ZBSA 4LF9K 1RBVA 2O57A 1QZ6A 4R50A 2N05A 4DRXA 1KAXA 1F51A 3D7EO 4EHTA 4B1WB 1MZEA 2XNDG 4NR1A 3D6RA 4JKEA 1NK0A 4OLAA 1JVMA 1K5MD 1WB8A 3P3PA 4PDLA 3CWBH 1TV6A 4NXMO 3VPZA 2X0LA 4WFAV 2O8EA 3HO1A 3K9KA 1K4DC 4TV9B 3IFXA 4JKBA 4M63C 3W7SA 2QXFA 2HB5A 4ZTFA 2ZM6O 4WBNA 1YI2V 4KTWA 3AECA 4IOAL 2OCCB 1TKZA 1LOTB 1U6ZA 3SJQC 2Q7HA 4DV1B 1VQ4V 2F96A 4KI4A 2B1IA 4HYOA 4JI5K 4TV8A 1SL0A 2DYRB 5J2TA 2AHZA 3EFFK 2YI9A 3ABUA 5B3SC 4UVCA 2E2QA 4YOTA 4CGIA 1ILYA 3D45A 3LP3A 1YITV 1IKWA 1RT2A 3ALYA 4CGGA 4CH5A 1Q81O 1R6NA 3RRGA 4BRCA 2IS3A 3OYKA 5I42A 3SLCA 4FVUA 4H4OA 5C8YB 1VEWA 1QVGU 4NCGA 1FJGO 4Z0UA 1JFFB 2ZIMA 2W40A 1VQ6V 1W97L 1EWQA 1QR9A 3BZCA 2UU9O 4CJVA 1NVPB 4H5VA 1JCFA 4O4JA 5C24A 2KG7B 4B3SO 3ZT1A 5LJWA 4FPBA 5LMUO 1JA8A 2WLJA 1N4CA 4IG3A 2X6AA 3VQ4A 2BUPA 4BRGA 3QBXA 3DXKA 1GLDG 5IJ0A 3ZSXA 5AQXA 3TJTA 2RPIA 3FB7C 3E86A 4YOWA 5KUKA 4U7OA 4I6MA 5B1AB 1FFTB 3W7WA 5KQDA 1SL2A 2P9UA 3WXLA 4TUYA 3CHWA 5E1AC 4DTXA 5BR8B 3S3MA 2HHWA 3VR8A 2OTJV 2RF2A 2HF3A 4FFKA 4KB0A 1WAZA 3ZRWB 3R6MA 4GKKK 3AAQA 2IVPA 3FGUA 4IGGA 3UM7A 3NMUA 3NF6A 4A61A 3G71N 1N0NA 3ASOB 4PDMA 4LFCB 1DF4A 5LA6A 4DV4O 1GLLO 4JK8A 1POV0 5FRMA 4PI0A 1QVGM 4FXDA 2IC3A 3J80O 2ZE2A 2O8CB 2KKWA 4KPYA 1AI7A 3VA0A 4BREA 2KB1A 1K34A 1H38A 3O9OA 4I55A 4DR2K 5BPLA 4DYLA 1T5EA 2QWQA 2NR5A 1T8EA 5J2NA 4BW5A 3H1LH 1MWMA 3AK1A 4P2ZA 1HRHA 3TSPA 4LF7K 4F3TA 5BRDA 2VG7A 1RDUA 1AR4A 1UWBA 4DV3O 4YXWG 5AQKA 3ZJZA 3DLKA 4GVEA 4U3JB 2HR3A 4BG9A 3ZSWA 2R7FA 3KK1A 4IL6Z 1M90W 2FBXA 3HKCB 1HYZA 3CERA 2QKSA 1F21A 4X1IB 2EILC 4EIAA 1GM8A 3CD6V 3SFDA 5GAEP 2QM1A 4LFBB 2WA4A 4J2EA 3J8F4 2A6AA 2O8BB 5D5PA 3CQYA 3JALB 3MX2A 2KQ2A 2E6MA 2FBYA 2NRXA 3QLHA 2ACZA 4E0DA 4FZ1A 5F0XA 1HNZB 3ISNC 4CERA 3Q7BA 3DI6A 4FLZA 3ETEA 4JV5K 1X4TA 4MTOA 1RUD4 5LXTB 4E3SA 4FJ8A 1WJZA 3AEGA 4B08A 2HHVA 5C2TA 1IKXA 2UXCB 1BQMA 4PA1A 4RO2A 1RVF4 1A5XA 4DTUA 2IH1C 3T1CA 1DLBA 4OGCA 4HUEA 5JLHA 2RN9A 4HBNA 5CA0B 3BZKA 1AILA 1U97A 2B5UA 3CQ8A 2EULA 4PJ0Z 3F2KA 2W6IG 3JATB 1IG8A 3RR8A 2XAQA 4OX9K 1YQ3A 3KK2A 1JCHA 5BN8A 5CB4B 4K25A 3ABLC 2BE2A 3VQAA 2XY5A 2X6CA 5L3DA 2PLV4 2JGUA 2RCVA 4QS9A 2ARHA 4ASUG 1EWRA 1XDCA 3BEHA 2VWJA 4DR6B 1G99A 1KU9A 1MDUB 2ZWHA 4IIJB 4B1VA 5I3UA 4DSJA 4X65K 3CFOA 5D3GA 5DECA 4BQLA 1M1KW 3ZX2A 4I2QA 3JYCA 3VQVA 2ASOA 1JLQA 4J80A 3CYMA 4JK7A 1BIUA 5CY4A 4RUEA 2A0LA 4BIZA 1NU0A 1FFXA 4YDUA 1FW6A 4QGPA 1E1RG 2LO1A 4UVAA 3O4WA 3GOIA 3SNNA 4LF8K 4H0OA 2FLOA 3OUSA 5EBWC 4NLCA 1L3TA 3ASNB 1K7DA 2JWKA 2HBJA 1HNWO 5KRSA 3ZYYX 4JI7B 2QEXN 4J11A 4GUNA 3CE2A 4U3FH 3ZMUA 4DSKA 4BC4A 1KSPA 3KLIA 1B06A 4UCSA 4CJ5A 3B8MA 5JVDA 3CJ9A 3VQ7A 3W3DA 2KTQA 1BCCH 3ZHUA 3V1OA 2KZMA 3CCEN 1FK9A 1M57C 4DS5A 3T1HK 3PO5A 3CCRN 3BHPA 4X88A 3VEZA 1D2DA 2JEUA 1Q9YA 2BE3A 2JJ2G 2F7TA 2Q9LA 2Q5ZA 1WPBA 3VQXA 1JLAA 4CBCA 3DOKA 5IWAK 3PSIA 4DR7K 4D7TA 1HPZA 4WQ5C 3OY9A 4K0KB 4FM2A 2HVJC 1Z05A 4WQ4A 4HNAA 3E22B 1SC5B 3OMIB 4JTDB 4KUMA 4U7NA 1RPOA 4DR7B 1C0MA 1IZ3A 3FD9A 4O2AA 2VG5A 4IWVA 5LJVA 2WLNA 4KAZA 5IY5B 1NKDA 2Q73A 1F7YA 1NGBA 1ZC6A 4DW0A 3DAWA 2IDOA 4YHHB 3I55V 1W7AA 4E7HA 1EETA 4H0XB 3EEQA 3SPHA 4RW6A 2ZE8A 1V54B 4ZOLB 3O9RA 4J9ZB 1KFSA 4AHCA 1M5IA 2LFRA 2HNYA 1EAH4 5KPRA 3FX7A 2H3OA 5FROA 4YXDA 2YHAA 2WWWA 1KD1W 3E9LA 4DFKA 3AV9A 3JD3A 3J7AP 2XAHA 1WB7A 4M7XA 1XEQA 2A1RA 3KD5E 4LH7A 4DR2O 1CXUA 2OPSA 2R9AA 1CZAN 4CEQA 4DR3O 3ZEUA 1MG1A 2IOCA 2FBWA 1SZ2A 3QMLA 2NRWA 1G8MA 3P4IA 4GLXA 1TYQB 2NZTA 2DTUA 2UXBB 3VGMA 4EFBA 1C0UA 3OMAB 5FPDA 3E66A 3AA4A 3TTDA 1OZ0A 1B6QA 2LP7A 5LBQA 2LW7A 1RUE4 3V9ZA 3UKRB 4AQYB 3D8CA 2AA4A 3GG4A 2DOSA 5IYBO 2ATKC 1M56C 5CBFA 3MHSC 3CJAA 3OJSA 2IJJA 3J7AU 3RR7A 4OO1J 2IU0A 2W0XA 1JPXA 3N2KB 4RWUA 2H89A 2V1DA 3AG1B 1GOCA 1R3LC 3SV4A 3G80A 2R9IA 4HUFA 4LF6K 3RSEA 3MECA 1T6CA 3NF8A 4OPHA 2ZNIA 3HKEB 4OVLA 1YTUA 2ZQMA 2F43G 4HTUA 3TPQA 3OYGA 4J9YB 4BIOA 4JV5O 2X78A 2BDPA 4JI6B 4FJ9A 1GH6A 1W2BU 3JAKB 3M8SA 4DF8A 4R79A 4F2SA 2I7PA 2V7YA 5KLVH 4TV9A 5JLFA 1BS3A 2WLIB 5M1KA 1TUYA 4N56A 3H46O 2G8WA 4C8KA 2CH6A 3ZX0A 3LDLA 1HWYA 3EKSA 3KIOA 4OX9O 2D5RA 1Q3EA 1DGSA 3KK7A 4BGAA 3I5DA 2Q36A 2NN4A 2WSSG 3RVYA 2FL4A 3CEIA 5EXWA 2A41A 1VF7A 3OW2U 3M1FA 3FB6C 1H2NA 3O5BA 4JS4A 4JEPA 1OCRC 4CCHA 2LJ2A 4X65O 3SQ4A 3CHXA 1BQZA 4CJEA 3V9WA 3M7MX 3G10A 1WA8A 2CGNA 1JJOA 1NTKH 4JI4B 2OZMA 2G8VA 4Q0BA 1RP3B 1S72V 3EE8A 1VQON 2JEXA 5FPNA 4CJQA 1IURA 1Y76B 3AG3C 2XHBA 3CFPA 3P31A 2E2OA 4LF8O 4F2RA 1I5YA 3U4LA 2ZGYA 3MMVA 3E01A 4CVNE 5JQGA 3NXSA 5FDLA 3TTFA 1EN5A 4H44B 4LSNA 3VTIA 2KG7A 2WLHA 5FLXO 3K03A 1ATNA 1PPJH 2KFZA 1JCEA 3WG7C 1YJ9N 5J1EA 1MZFA 1WOQA 4R5PA 3L2UA 4L8JA 1TVKB 1MSWD 3AVGA 5H2FZ 4LH5A 4LWSB 4YORA 3T1HO 2FSKA 3AA3A 4DTSA 2V4DA 1H8HG 1NGDA 3AE6A 2ZDIC 4FLYA 1RDDA 5EVZA 3RMAA 1URFA 3RFRA 3KCYA 3V1RA 2IBZH 5GTHZ 4FM1A 2Q0RA 5IWAO 3U9DA 1KBHA 3SQ1A 1QHAA 3VR9A 3AVMA 1NTMH 4NYKA 2E76B 3RBZA 5AFUH 2CTWA 3OW2M 4DUYO 1Q9XA 4ELVA 1UPGA 3ZRWA 1ATRA 1M4UA 4UCUA 5C2DA 1J6ZA 1AI6A 5A9GA 4FWKA 1IH7A 3CC2V 5AQUA 2AW9A 2YI1A 3WXIA 1XMOK 2RQ6A 2VQFK 1TKXA 3OYIA 3E9OA 3L3UA 4CJLA 4YTPA 4FZZA 1EO1A 3R3LA 2YEVA 3K0SA 1HRV4 5HRSA 4RG8A 4XH5A 3MN9A 3UKUB 3TXQA 3MWTA 3OM3B 1WSJA 4B3TK 1W59A 1XNQB 4DV0O 1JCGA 2KHOA 4H33A 2ZT9B 1PVC4 2RM24 2QDOA 1VQPN 5GADP 1CXZB 3ZBHA 3CFRA 2OCHA 1K8KB 5M1FA 4L3QA 3CPEA 3VRBA 4C7UA 2HF4A 3AY9A 3FAVB 2WPDG 1WNSA 3CCSV 1Y4MA 2Y0PA 3H1IH 4U3JA 4ZHQB 4J7KA 3M8RA 1QHTA 1ORQC 1Y97A 2ZXWB 3HKCA 1YJWN 1COV4 5FLXN 4X1IA 3SQ0A 1B04A 3RRHA 5GW7A 3NHGA 1I39A 2F1MA 2O8BA 1S1UA 4CHQA 4YSZA 3X2QB 1RFQA 3VRAA 3TCUA 3LDQA 2FMLA 2MK3A 2R70A 2AJQA 1ASWA 2OPQA 3OYJA 4Q4Y4 4B1UB 1VF6A 2MW2B 3EVKA 1HNIA 2ZINA 1QS4A 4QPKA 3AARA 3OYCA 4FK0A 2IU3A 4BGBA 1H2LA 4LF6O 1L0VA 5LXTA 3RT3C 3TTCA 4GVMA 4XH1A 4Z4GA 3ZHTA 3NH2A 3A5NC 3JSNA 3CJHB 1NH2D 1S6QA 1Y64A 1NCQD 1VSJA 3C3SA 5KUMA 5CA0A 1Q8IA 3GBTA 3ZIAG 1OV9A 2YHWA 1PD3A 3CCUN 3AO5A 3JATA 2RJZA 3OD4A 2VQEK 4HUGA 1OCOB 2Y1IA 2KZZA 4PL8A 4JKGB 5HROA 5CB4A 4H5WA 5E41A 1NA1D 2QKKA 5B3SB 1TAQA 2DYSB 2ADQB 4JTAB 5AQLA 2WLLB 3CRQA 4H0YB 4O4LB 3SMSA 1K8AO 5LP6A 2XY6A 4G28B 2O8DB 1JXEA 4GT1A 1VBD4 1R59O 3ID8A 4GKJB 4FWRA 5EU7A 5ADXH 3OJUA 3ZN1A 2WDRA 2VGMA 4DUZB 3L9DA 3TARA 4LFAO 4JI2K 3AVCA 1VSFA 3VMFB 3PX4A 3JD1A 1BDGA 4IZ9A 3KCXA 3SGIA 4XEIA 4DMNA 3ZRXA 5L3BA 1EN6A 1N33K 2OTLV 3B6PA 3FB5C 1KB9F 2XT9A
chains in the Genus database with same CATH topology
5IJ9B 3BGRA 4F6RB 1KLMA 2HNZA 3LNNA 3HPHA 1I94B 3SPZA 3OYFA 4LH6A 4IG0A 4G1QA 4KTZA 4BWJA 3AVIA 4X66B 3BA8A 5J2UB 1RILA 1P49A 3N2GB 3SJCC 3NGZA 4CJKA 3LZJA 5LYJB 1VSDA 2G8IA 1YTAA 4M3ZA 5KGXA 1EP4A 1GOAA 4ZOLA 1ZBLA 3KJVA 4J2BA 2Q7EA 3SUPA 5KMGB 1SQGA 4OPJA 3UIQA 1RTJA 5CZ2A 3RWUA 4EB6B 4YJ3A 1YT3A 4NYFA 5HLFA 1O9GA 5HBMA 1L8DA 2ATQA 1IBMB 4PY5A 4DV7B 2EHGA 4B9SA 1A5VA 3VA3A 3OYLA 1ASVA 4FCYA 3NBPA 2E3CA 3SJJA 3RYCB 3IS9A 3N2KA 2UUAB 3M8PA 3OYEA 3FI7A 4E7JA 3HKEA 5J2PA 4FZYA 1RSOA 3OYBA 1JL2A 4PHZA 2YV0X 3VQYA 1IKYA 4ZTJA 5GONB 4DG1A 1QSYA 3NH1A 1LAWA 4CE9A 4IKFA 1RDCA 2Q3SA 5DK5A 4CS3A 1XHXA 4HCBA 3WB0A 1NOZA 4KHPB 3QG5A 1N34B 4M3YA 3KK3A 1IBKB 1RT5A 3L2WA 1HNVA 4O5BA 4IHJB 1JLFA 4DFJA 4X20B 3T1YB 2B5JA 3SUQA 4DU1A 3ICXA 3M8QA 4TQFA 1NJXA 4Z4CA 1TVKA 4B3RB 1NK9A 2RKIA 2P22C 4GMJB 1FXXA 1T03A 1RT6A 4ZI7B 3HVTA 5JS1A 3ZS8C 1V9PA 2QJ1A 4CJSA 3QEWA 2HHHB 4FLVA 1WSIA 1HYSA 4Y1CA 2IM9A 1U45A 1VSEA 1HMVA 2G8FA 1CXQA 4C8NA 4DSLA 1TKDA 4CEFA 5JJJB 4EEQA 3OYDA 4CESA 3O3FA 1W9HA 4IBNA 4ZHRA 4B3OA 4KV8A 1KMIZ 3ULDA 1B9FA 4CIGA 3SQ2A 1JLEA 4FZXC 3ZCMA 1WLJA 5IYZB 2RN2A 3HKDB 1X9WA 3V9SA 2NUBA 3VN5A 1BCOA 1I7FA 1VSMA 5FNVB 4IFVA 2ZIOA 2E5LB 4BE2A 4JI0B 2UUCB 4E89A 3THOA 1JLCA 4I4TA 4FVMA 4I9QA 4HVJA 1TA8A 3AO3A 1KFDA 4DV5B 3I8DA 3WB2A 4JI1B 4LR3A 2KW4A 3KLHA 4BE0A 5T7BA 1JLGA 1S1VA 4DFMA 4W5OA 4O4LA 4HCCA 1QE1A 3RTVA 3OS1A 4PUOA 4YJ2B 1EXQA 4EP5A 3S3OA 1VRUA 4K8ZA 3VQDA 3ZSQA 4W5TA 4FYDA 1VSIA 2HHXA 3QF7A 3UT5A 1B92A 3RYFB 4F6RA 3QEVA 1G6UA 2Q0AA 3VQ8A 2ZM6B 1VRTA 1SKWA 1J54A 1XNRB 3K5NA 3OYNA 4O44A 1BI4B 5EZYB 3F9KA 3NDKA 5ITZA 4YY3B 1B9DA 3MEEA 3BABA 5J2UA 3F73A 4CH4A 1X1PA 3ZT2A 4FJ7A 4CHPA 1U4BA 1WSEA 1XC9A 5JH7A 1FJGB 3P83D 3U3YA 2R7YA 5CYQA 4M3UA 4AHVA 3TI0A 4TQDA 1TAEA 2XY7A 2Z1IA 4DLGA 2UUBB 4GYCB 5KMGA 3V81A 1S9GA 4FJLA 4JRPA 4CGFA 4KO0A 4Q5VA 3OYAA 3LP2A 4CJFA 3VQBA 3ZT4A 1Z5VA 4GW6A 1TK8A 1TUBB 3LP0A 4N47A 4DV4B 4B8AB 2O4IA 3RYCA 4KKOA 2HEPA 3QINA 1S1TA 3U3GA 3C6TA 4DK1A 4C8OA 1Q43A 4IDKA 3ZEDA 4JS5A 4JI8B 4RW7A 2R72A 2DFEA 4CGJA 4UCRA 5GONA 2I5JA 4PWDA 4DK0A 3CSXA 3A2FA 3K5MA 4FLTA 3SR2C 2PTMA 3U0ZA 4CHYA 2FC0A 1O1WA 3T1AA 2HHQA 4BDPA 4DWIA 3LDSA 2YNFA 1HR0B 4LF9B 4IHJA 4TSXA 3U10A 3V1QA 2PY5A 2PGGA 3TABA 1ASUA 1U49A 1IKVA 1NJWA 3DYAA 4CH6A 4OPKA 3SV3A 4KRFA 3TAGA 2G8HA 4I50B 3B6OA 2OA8A 4DF4A 1XHZA 3TAFA 3AVHA 1UA1A 4JI5B 4FJGA 1KTQA 2OYQA 1DLOA 2Z1HA 4KHWA 2FBVA 3NH0A 3C95A 2ETJA 1LW0A 4OJRA 4O4HB 3AVJA 1UA0A 3B2EE 4FK2A 4CH3A 4DU4A 1NKBA 2F8SA 4E1MA 1KVBA 3MEDA 3DRSA 2JVDA 4UCVA 5C8YA 1JFFA 4M3WA 4CF0A 5JCOC 3C6UA 1BGXT 3BA9A 3HK2A 5BMVB 1WSHA 4GKKB 2G8KA 3AVFA 4KFBA 4LD0A 4M3XA 4CFCA 3LPUA 3LZIA 3V9UA 3TAMA 4FJ5A 1O9HA 1NJZA 3T19A 3JARB 2P5GA 4B9MA 1Q5OA 4DR2B 4DQIA 4W5NA 1CZBA 3NF9A 4W5QA 4B9VA 1I3AA 4MFBA 4LF7B 1J5OA 1FKPA 5K14A 3SZ2A 4FJJA 3SJBC 4IFYA 5CZ1A 4KHNA 1BCMA 2DFHA 3PY8A 3O4QA 3K58A 4WBNB 3DRRA 3ETQA 4YJ2A 4JRQA 1C1BA 4O4IB 3QETA 3P1GA 4J2AA 5J2TB 3VQQA 5JJNB 4CF1A 4JV5B 4DU3A 2X6NA 4OLBA 4B9LA 5LP6C 1JL1A 4M3RA 3RYFA 4N76A 3JALA 4Z4FA 2F93B 4OX9B 4KB1A 3L2RA 1RT7A 4FK4A 3LWMA 1X9SA 4X65B 3AO2A 3DM2A 4DTRA 5K1PA 3RWRD 2P5OA 2WOMA 1IG9A 2Z1GA 4YNQA 2HHSA 3ZT3A 3IRXA 3CG7A 4M45A 4LF8B 4CJPA 3ASMA 4TUYB 5KHHA 4CJ4A 5SZTA 3JYTA 5JS2A 4DTNA 4IIJA 4CK1A 3K59A 4CIEA 3HSTB 4CF8A 4ICLA 4CJTA 5LA6B 1TVRA 3T1HB 1NK5A 4CEDA 1NK7A 3BDPA 1JKHA 4CC6A 5IWAB 2P51A 1TUBA 2YIBD 4Z4HA 4DUYB 1RBTA 3OYMA 4E7IA 4FFBB 4FJHA 3VQPA 1RTHA 3THVA 4QAGA 3KKSA 1L5UA 4FLXA 2VG6A 4EZ6A 3QEIA 1S9EA 2F66C 4FJNA 1TAUA 3H08A 1D9DA 3E22A 4DTOA 4OKJA 2Q7GA 4X1KB 3ZSVA 4ID1A 4BDYA 3WNHA 3LANA 4PQUA 3VQ9A 1MU2A 4DSEA 4FJMA 4UCTA 1HJRA 3MXJA 4B8CA 5KX5B 4CK2A 5CA1B 3VQ5A 1R0AA 3OVNA 3SJAC 3KTQA 4CJWA 2HMIA 4LF6B 4FW1A 2D0CA 4PI2A 3RYIB 4MQ3A 1REVA 1Z25A 4I50A 4I7FA 4DQRA 3LAKA 3AA5X 1A5WA 1C0TA 1D8YA 5HRPA 3ZT0A 1RT4A 3JAKA 4I2PA 4AHSA 4EP4A 4CK3A 2X74A 4B9UA 3HP9A 3FFQA 4CS2A 3HPOA 2CAZC 4M3TA 1HQUA 1SUQA 3BRCA 4I9LA 4O4HA 4KHYA 4C8LA 2BTQB 4CJRA 3HL8A 3AVBA 2YIBA 3VQCA 1RNHA 3K5OA 3OYHA 4O2BB 4CGDA 4BE1A 2VWKA 2ZNJA 1TL1A 1C6VA 1TK5A 2B4JA 5D5QA 1NKEA 4B9TA 4CEZA 5BMVA 4TOIA 2ZD1A 3CM6A 4FJIA 2HVIA 4XIUA 1RTIA 4O0JA 1XMOB 1U04A 4CFAA 2VQFB 4AH9A 2F4VB 2D0AA 1SKRA 4UCOA 1ZBUA 5HP1A 1L3UA 3JARA 3QEPA 4B3TB 2IGIA 3ZSOA 2QM4A 4DS4A 2OPRA 1ITGA 1ZYQA 3QNNA 4AHRA 3JAWB 5KHGA 1S1XA 4RW8A 3S9HA 3PO4A 4RW9A 4DR4B 1DTTA 3SUNA 2W42A 2HHUA 4CC5A 1SV5A 2E6LA 3AVLA 3TWHA 3HKBB 3I0SA 4O4IA 2YNHA 3DSQA 3LP1A 4UQGA 4ZHQA 3QO9A 1SL1A 2HVHA 3MXIA 4FLWA 1QQCA 2PZSA 3JSMA 4CFBA 1D9FA 2Z1JA 2VQEB 3TAEA 1KVAA 2GV9A 5JQGB 3QNOA 3NAEA 4Y1DA 3K5LA 1J9AA 3LALA 4CF2A 2ZQBA 1RBUA 1NOYA 3QERA 1KRPA 3NGYA 4JI2B 1TKTA 1D5AA 3PX0A 2PYJA 4LH4A 1N33B 3ZSYA 3I0RA 2ZCEA 2YNGA 1TL3A 4NCBA 1N36B 3OTFA 3LPTA 3IAYA 1N5YA 2G8UA 1SA0B 1BIZA 1LWCA 1CLQA 3QIPA 3JASB 3HJFA 3BAAA 4JYAB 3QEXA 1KCFA 4NXMB 1JLBA 4N41A 4X1YB 4CEAA 1WN7A 5IJ9A 1ZAUA 1N6QA 4LF4B 3S3NA 1J5EB 4FFBA 3MEGA 4DQSA 1RDBA 1HW7A 3L2VA 1SQFA 5EYPB 2YIAA 2FBTA 3N2GA 3DLRA 3K57A 4X1KA 2PUSA 3D0PA 1HQEA 5LYJA 2UU9B 4Z4EA 2DY4A 4J2DA 4LNUB 4B3SB 3VQ6A 3KKRA 3PV8A 5LMUB 1YVUA 1XQ8A 4L8RB 3VQEA 3UQ8A 2YXLA 5KX5A 2YKNA 3AO1A 4EB6A 4X62B 2O4GA 3EY1A 3JSLA 5LMNB 5CA1A 5J2QA 4E7KA 4M41A 3DRPA 1TGOA 5LP6B 3K2PA 1T05A 4Z4IA 3RYIA 5LOVB 5EIBD 4KHSA 1VSLA 4NVPA 4FM0A 5HRRA 1C1AA 4KHUA 3L8BA 1QSLA 2GBZA 1WAJA 3RYHB 4FJXA 3OS0A 3BPZA 4HHTA 4JI3B 1L3VA 2BGGA 4DV3B 1SKSA 1M93A 3DLEA 4D7SA 4C8MA 5KHIA 2YNIA 3G0ZA 4OKKA 1DTQA 4CHOA 2XRIA 5FRNA 4CIFA 3SUOA 2OPPA 2BTQA 1UAXA 4DQQA 1XWLA 1L3SA 4X20A 2PYLA 3RMDA 4O2BA 1X9MA 3OS2A 3KLGA 4YJ3B 1T7PA 2ITGA 3TANA 1RT1A 4O4GA 4CGHA 3AVAA 1ZBIA 4CS4A 5EIBC 1KLNA 4CEOA 4OGEA 4W5RA 1EX4A 4E1NA 4CJUA 4DTMA 4ZI7A 3QIOA 3AVNA 3LWLA 2LSNA 4YFUA 1UOCA 4FJKA 1HNWB 4QOZB 3CM5A 4CEBA 5KI6A 3JAWA 3L2QA 1TK0A 4N5SA 1JMKC 2OZSA 4BACA 3KLEA 4KHQA 4B9NA 4B3MB 3IG1A 2E4LA 3HKBA 4ELTA 3U11A 4DSIA 3TR8A 2X6SA 3RMCA 3V6DA 5IYZA 1SKVA 4CEEA 3HKDA 1VK0A 1FKOA 3WNFA 4AHUA 3SI6A 3C94A 5FNVA 4F3OA 1J53A 4DR3B 2KFNA 4DV6B 4NXNB 4OKEA 2JLEA 1HYVA 3RMBA 4DRXB 2BTOA 4DV2B 4CHZA 4BDZA 2F8TA 3HVRA 3NGIA 4CHNA 5HRNA 5KHJA 4ZIBA 2QKBA 1BL3A 3O3GA 1NJYA 1Z26A 2Y1JA 3FFIA 1XMQB 1BHLA 3P5JA 1SA0A 4TV8B 3QESA 5JJEB 3PUFA 1KVCA 3JASA 1GOBA 4M42A 5JCOA 4EZ9A 4DTJA 4X1YA 1S5JA 5KTQA 4H4MA 2PW9A 2YI8A 3PX6A 3KLFA 4X64B 4ID5A 3PN1A 2IAJA 2P1JA 2YHBA 4O0IA 1IBLB 4O4JB 1BI4A 5KHKA 5EZYA 3HXMA 4JLHA 3VQWA 5EYPA 4DR5B 2EX3A 5IJ0B 5C42A 3O4NA 4F8RA 1WSFA 1H2SB 1EKEA 4DFPA 1RTDA 1QSSA 4LNUA 4AILC 4I4TB 4DTPA 1LW2A 1VSKA 3KD1E 5CYMA 2HW3A 1NT2B 1LAVA 1S6PA 1ZBFA 3WNEA 3DLHA 4H8KA 5KRTA 3AA2A 1Z5WA 3V9XA 4I55B 4FW2A 2XO7A 1IO2A 3TAPA 1K6YA 1U47A 4CJ3A 3MXMA 1U48A 5LOVA 4LF5B 3NFAA 4UFZA