2EX3A

Bacteriophage phi29 dna polymerase bound to terminal protein
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
570
structure length
570
Chain Sequence
RKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The phi29 DNA polymerase:protein-primer structure suggests a model for the initiation to elongation transition
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transferase/replication
molecule keywords DNA polymerase
total genus 150
structure length 570
sequence length 570
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2ex3A04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ex3A01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2ex3A03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2ex3A02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2ex3A05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2ex3A06
3KD5E 2HHSA 1JLGA 2P51A 3AO1A 3AVGA 4M41A 3OYJA 1WSFA 3LALA 2VG6A 4GVMA 3TI0A 2BE2A 1S1XA 1JLQA 3KLGA 1Y97A 3SV4A 3ZT0A 3ULDA 2PW9A 3C6TA 4CJ4A 1XHZA 2ZQBA 4E7HA 3AA5X 4LSNA 3ZSZA 3RMBA 4JS5A 1HRHA 1BGXT 1CXUA 2B4JA 3HL8A 1SL2A 2XHBA 4M3RA 4CFAA 3THVA 1TGOA 4C8NA 4AHTA 4O0JA 2OZSA 4YNQA 2F8TA 5JS2A 4FJ5A 3CM5A 1WSIA 3L3UA 2HB5A 3V9ZA 5KGWA 3U6FA 4E19A 1NOYA 4FW2A 4CE9A 4QOZB 1X1PA 3QEPA 1S5JA 3LWLA 3OS0A 1U45A 1NKCA 1HYZA 4FJ9A 4NCAA 3SCXA 4M42A 4CF9A 5KGXA 4CGHA 2Z1GA 3OYAA 3SZ2A 4KV8A 4FJKA 5JS1A 1JXEA 1A5WA 1WSEA 4CEBA 4I2PA 2WOMA 4CHPA 4DU4A 2Y1JA 4C8LA 4DSLA 4F4KA 1U04A 4FJ7A 3AVKA 1GOBA 1TK8A 2KFNA 4DSEA 2DTUA 1ZBIA 4ZHRA 1VRUA 4BE1A 3DLKA 4OGEA 4CEAA 4HUEA 1IKXA 4KHNA 4FJ8A 2I5JA 3LP3A 5E41A 3HVRA 4I2QA 3VQ9A 3SYZA 4DF8A 5I3UA 1RT6A 3IS9A 1G15A 4NCGA 3QNOA 3S3OA 1VSLA 3BGRA 1RBTA 1U49A 5CZ1A 2OPQA 4DSIA 1NKEA 1J53A 3C94A 4DU3A 1UA1A 4M3TA 3RTVA 4B08A 2KZMA 4RG8A 1TAQA 4DQQA 4Z4IA 4FZXC 2IAJA 1I3AA 2QXFA 4KTWA 1EETA 2X6SA 4HCCA 1UWBA 3HP6A 3AA3A 3SQ4A 1RDAA 3VQ7A 4CGIA 2HHWA 5CZ2A 1KLNA 2Q3SA 3AVCA 4CF1A 3AO3A 2VWKA 4J2DA 1VSEA 1EP4A 1YT3A 1DTQA 2IC3A 3PUFA 1RT7A 2YHBA 3AVFA 2RN2A 2DY4A 1XHXA 5I42A 1NJYA 2IGIA 4FLZA 3CFPA 4FJIA 3SUOA 4M3WA 2E4LA 4CGGA 1UA0A 2D0BA 3TAEA 3MEGA 3K2PA 3PX4A 2HHXA 4CHQA 4DSFA 3DLHA 4HCBA 4FCYA 1XWLA 1HPZA 3QETA 4CJEA 1XC9A 2O4IA 2HHVA 4W5QA 3C6UA 4M3ZA 2WONA 3VQ4A 4AHVA 4IFYA 1TKZA 1T03A 4Q0BA 2AJQA 5T7BA 1VSKA 3D0PA 1L3SA 2NUBA 3G0ZA 3OS2A 1QSLA 2HW3A 1RBSA 1CZ9A 3KIOA 4H8KA 3WNFA 4I7FA 1WAJA 3NFAA 4CJTA 3KKSA 3QIPA 3LWMA 3SPYA 3PO4A 3OYHA 4N47A 3DRRA 3O3GA 3EY1A 1YTUA 3V1QA 5C24A 2G8IA 4DQSA 4L8RB 2YNHA 1SL0A 4QAGA 1Z26A 4KHWA 1KCFA 2ATQA 1RDBA 4KAZA 1B9FA 2R7YA 4OLBA 4QCLA 4KHSA 4DTRA 1ZBFA 3CFOA 4CJ3A 4FZYA 4KHUA 3MAQA 3OYMA 3K5MA 5J2NA 3AV9A 5J2QA 1RT2A 1F21A 1FK9A 1VSDA 3UIQA 4KRFA 3VQ8A 3OYCA 4CGFA 3KD1E 4CJWA 4RW6A 5FRMA 1N5YA 4O0IA 4E89A 3K59A 3AO5A 3AVLA 3T3FA 1JXBA 1NKBA 1WLJA 1D9FA 4FJHA 4DU1A 1BCOA 3V1OA 4CF8A 4OLAA 3DOLA 3FFIA 1HNVA 1BQMA 5EU7A 1Q9XA 3VQAA 3HO1A 1REVA 2FBYA 3TWHA 3QEVA 1KVAA 1TKTA 4ID5A 4E7LA 3TAFA 2R7FA 4M45A 4CERA 4E0DA 4NCBA 2Z1IA 3DLRA 3NH0A 5HRPA 1ZBLA 4J2BA 3F73A 4FLYA 4BWJA 4FM1A 1GOCA 3KK2A 4FXDA 3RR8A 4IG3A 1VSJA 4PQUA 4O44A 4FJNA 2D5RA 2YKNA 2HHTA 3IG1A 3NGYA 4AILC 1MU2A 3PX6A 1S1UA 2B5JA 1S9EA 3OYLA 4BDYA 2RF2A 5KRSA 1TKDA 3U3YA 2XY8A 3S3NA 4C8OA 3VN5A 3ISNC 3NF8A 4OKJA 4Z0UA 3OVNA 4ZTFA 3SPZA 2ETJA 1SKWA 4C8KA 1BL3A 4FLVA 3SUNA 2PY5A 4JS4A 1WNSA 4LH4A 3KJVA 3OY9A 1TK0A 3EZ5A 1NK0A 2D0AA 3LDSA 4RW8A 3WNHA 4DTMA 2VG5A 4HUFA 1JL1A 2A1RA 1WSHA 3ZSWA 1QSYA 2X78A 2HHUA 3AVBA 4OKKA 4KI6A 3CQ8A 4IBNA 1WSGA 3S9HA 1A5VA 3KLIA 4FJGA 4MQ3A 3K5LA 3KK3A 2G8KA 5KTQA 1JLAA 3L3VA 1X9MA 1W9HA 1QTMA 2G8UA 2X6NA 1VRTA 3U3GA 3M8RA 3S3MA 4E7JA 1UOCA 4E7KA 4FLUA 3P83D 4CIEA 4FVMA 1KRPA 3HK2A 4KB0A 1TL3A 1N6QA 1U48A 1TAUA 1KVBA 4PA1A 1YTAA 1NJZA 4NYFA 4E1NA 4CJPA 1SKRA 1HMVA 3PY8A 4B9SA 4KB1A 3OYEA 1DTTA 4C8MA 4W5NA 4BACA 1D9DA 4DTXA 4FW1A 3T19A 1ASUA 3AVMA 3TANA 3OYGA 4DFPA 1B92A 2P1JA 4TSXA 4DFMA 4PUOA 2G8HA 3LP2A 4KHYA 4KREA 4DF4A 5FROA 3LPTA 1HNIA 4HTUA 4FLWA 2YKMA 4KTQA 4N41A 3AVIA 5D3GA 1C0MA 4YFUA 4CJSA 3SNNA 1J5OA 3LZJA 4AHUA 2QK9A 1ZBHA 4FK0A 2XY5A 4IFVA 2IOCA 4EP4A 3KKRA 3AA2A 4IG0A 4B9LA 2BDPA 5KRTA 3O3FA 2Z1HA 4Z4HA 4B9UA 1RBVA 1S6QA 1S9GA 3HP9A 3NAEA 5DK5A 3ZT2A 1LV5A 2QKKA 2VWJA 1RTJA 4CJUA 2KW4A 2HVIA 1QQCA 1SL1A 4Z4EA 1VSIA 4FK2A 1VSFA 2GUIA 3O4NA 4LH5A 5FDLA 4B8CA 4DQRA 1QE1A 1S1TA 1JLCA 3WNEA 3HJFA 1U4BA 1NJXA 3CFRA 2RPIA 3CG7A 1JL2A 3LP0A 1ITGA 1RT5A 4LSLA 4AHCA 4AHSA 2G8FA 1HYSA 4RW9A 3V1RA 3VQBA 5HROA 3LP1A 3V9UA 3OYDA 4CHYA 3O3HA 5HBMA 4F2SA 2JLEA 3DRSA 3RMDA 4KHQA 3FI7A 1NK7A 3QLHA 3K58A 1IKYA 4RW4A 3HXMA 4CF2A 1GOAA 3IAYA 1K6YA 1KTQA 3RMAA 4CFBA 1HJRA 1CZBA 5J1EA 3SQ0A 3LAMA 2P5GA 1BI4A 4ELUA 1TV6A 4RW7A 3T1AA 3DM2A 4IKFA 1BQNA 3ZT3A 3AVHA 1X9WA 2OA8A 3NDKA 2OPSA 3MEEA 3OYNA 1RBRA 2FBTA 3RRHA 1NK4A 2PZSA 3B6OA 3DI6A 3M8PA 2OPPA 3E01A 2Z1JA 2HNZA 3AO4A 3NGIA 3L2UA 1RDDA 1LWFA 4B9TA 1DLOA 3HVTA 3RR7A 5HRNA 4DLEA 4FJLA 3DLEA 4HVJA 4FM0A 1L3VA 4W5RA 3TR8A 2QKBA 3OYBA 4B9MA 4OKEA 1KFDA 3ZSQA 4CIGA 3OYIA 3KLFA 1WAFA 2KQ2A 4CGDA 3VQEA 4FYDA 1ASVA 4CECA 3JYTA 1S6PA 3VQDA 1D5AA 2ZD1A 3I8DA 2LSNA 2YV0X 1VSHA 3OYKA 1W0HA 1S1WA 4LY7A 3L2QA 3SQ2A 3MEDA 2P5OA 1JLFA 3AO2A 4O55A 4W5TA 2F96A 4DQPA 3C95A 1XI1A 1LW2A 4JRPA 2BANA 4E7IA 3V4IA 1RTHA 4KTZA 5CYQA 4CHOA 4CGJA 2O4GA 1C0TA 3LZIA 1KSPA 4NYNA 1RNHA 1TK5A 2FC0A 4CEFA 3TARA 3V81A 1IH7A 1NK5A 1IO2A 4M3XA 4CCHA 1ZBUA 1WSJA 2E6LA 1RTDA 3B6PA 4F3OA 1QHTA 1RTIA 4N56A 3L2VA 3D45A 4FZZA 2G8WA 1HQUA 2D0CA 1C1AA 2W42A 3V9SA 3SUQA 4FK4A 5C25A 4FM2A 3DYAA 4CK2A 2GV9A 1C1BA 2GBZA 4ID1A 4Q5VA 1NK6A 1QSSA 2HVHA 4ELVA 2BGGA 4FJMA 1Q9YA 3AVJA 1BIZA 1SUQA 3VA3A 1IG9A 4J2EA 3HPOA 3V9WA 2Y1IA 1IKVA 3ZCMA 4I9QA 4OVLA 4KKOA 3SI6A 3TAPA 4CEZA 1D8YA 1I39A 5HLFA 4DLGA 4AHRA 5HRRA 4AH9A 3OS1A 4PWDA 4HHTA 3K57A 4DTNA 3K5NA 2YNIA 4LD0A 3A2FA 2DFEA 4Y1DA 3TAMA 3SUPA 1NOZA 2A1SA 3NBPA 4K8XA 4HUGA 4DTPA 4PY5A 3ZT1A 1SKSA 3NF9A 3ZSXA 3QINA 4Y1CA 3VA0A 3KTQA 4DFJA 1C1CA 4CIFA 4H4MA 1ASWA 2EHGA 4Z4GA 3HPHA 2KZZA 1HQEA 1T8EA 4BDPA 1L3TA 2F8SA 1WN7A 3DRPA 4O5BA 4DWIA 3SQ1A 4CESA 1NK9A 1A5XA 3RWUA 3SV3A 4MFBA 1QS4A 3OJSA 5K14A 3ZSVA 4CJFA 4R5PA 2OYQA 1RCHA 4CK3A 3TAQA 3CM6A 4GW6A 3P1GA 4K8ZA 2YNFA 1EXQA 4ICLA 4O4GA 4F3TA 3I0RA 1UAXA 2VG7A 5HRSA 5SWMA 5CY4A 4XIUA 2HMIA 4EP5A 1L3UA 3NF6A 1B9DA 3DOKA 3DLBA 3I0SA 4IDKA 4CJ5A 3MXJA 5FRNA 1J9AA 2YHAA 2HHQA 1Z25A 4B9VA 4CJRA 5J2MA 2IS3A 3NH2A 3DMJA 3AVNA 3G10A 4G1QA 4UQGA 3QNNA 1FKPA 3RRGA 2FBXA 3IRXA 5KI6A 4F8RA 1CLQA 3LAKA 4DFKA 2X74A 3QIOA 3KK1A 3MXIA 1T7PA 2XRIA 4KPYA 1NK8A 3VQQA 1U47A 3DLGA 4M3UA 4N76A 1JLEA 1RILA 3M8SA 4CFCA 3OYFA 1EX4A 4F2RA 3QEIA 4CFDA 4DS5A 4DMNA 2DFFA 5DMRA 4Z4CA 4E3SA 3QESA 3RMCA 5HP1A 3H08A 4CJKA 1BCMA 3NH1A 1L5UA 3WNGA 3JSMA 4B9NA 2PYJA 4GMJB 4B3OA 3V6DA 3L8BA 2RKIA 4JLHA 3HYFA 4CJLA 1BIUA 4DSJA 2ZE2A 5J2PA 2HNDA 3ALYA 2E6MA 1LAVA 3AA4A 3HT3A 1YVUA 3LANA 2OPRA 3V9XA 3ITHA 4EZ6A 2HNYA 1TL1A 3HPGA 2JGUA 3HSTB 1C0UA 3BDPA 1IKWA 4BE2A 4CEEA 2IDOA 3LPUA 1LAWA 4B8AB 3NF7A 2XY7A 3M8QA 1FXXA 1VSMA 4N5SA 4ELTA 1RT4A 4CK1A 2OZMA 3AVAA 4OPJA 3CYMA 1S1VA 1T05A 1KFSA 2G8VA 1LWEA 4CEOA 1JKHA 3ZT4A 3KLEA 4CJVA 4CEQA 4DS4A 2XY6A 4ZTJA 1BHLA 1TVRA 4FJXA 3EYZA 4DSKA 2DFHA 1J54A 4EZ9A 4I9LA 4J2AA 1C6VA 3QEWA 3NGZA 3F9KA 3HM9A 3SJJA 2XO7A 1X9SA 4BWMA 3QERA 2FBVA 3NE6A 3KLHA 1EKEA 4BDZA 2KFZA 4KO0A 3O4QA 4W5OA 4H4OA 3L2WA 2ITGA 3MECA 1LW0A 1SV5A 3VQ5A 2B6AA 3VQPA 1RBUA 5CYMA 1Q8IA 3ZSRA 3OJUA 4DTJA 1KVCA 4BE0A 4OPKA 3MXMA 1R0AA 4Z4FA 3NHGA 3ASMA 4KFBA 3L2RA 4DTSA 1RT3A 1TKXA 3ZSOA 4DTOA 3PV8A 1RDCA 4CEDA 4FJJA 4DG1A 3TABA 3PO5A 1NJWA 4FLTA 3QO9A 3P5JA 4WE1A 3QEXA 5C42A 4M3YA 2KTQA 4JRQA 3NCIA 4OGCA 4CJQA 1VK0A 1RT1A 3VQ6A 3K5OA 4CF0A 4CHNA 4KI4A 3TAGA 1BI4B 1CXQA 1O1WA 1FKOA 4OJRA 1BISA 4FLXA 1HYVA 2YNGA 1ZYQA 2PYLA 4DTUA 3ZSYA 3PX0A 1KLMA 2EX3A 4CHZA 5SZTA 1LWCA 4DQIA 4E1MA 3VQCA 1JLBA
chains in the Genus database with same CATH superfamily
4X1IB 1KKDA 4KH6A 3OUSA 4ICGA 1JLGA 2YHXA 3AO1A 3ZMSA 3AVGA 3N2GA 1WSFA 4DK1A 3VTIA 3OYJA 4YJ3B 1VQLN 1S1XA 3ABLC 1Y97A 1KP2A 4YSZA 3R6MA 4PA9A 3C6TA 1VQ7V 1FD9A 2XAJA 1HRHA 2YIBD 2XHBA 1NQTA 4M3RA 4CFAA 3BEXA 2ZJPL 3BEHA 4O0JA 4AI8A 4LF6K 1NJIO 1HNZB 1WSIA 4BRNA 4LH6A 4JD2B 5KA5A 1K3EA 2HB5A 4ZOLB 4I0XB 5KGWA 1CPYA 1KD1W 1HNXB 3QEPA 1NTKH 1WB8A 2R72A 2F4VK 1HYZA 3WT0A 3VPZA 2A3ZA 2CTRA 2G38A 4CGHA 3GG4A 5BR8K 1DGKN 3SZ2A 4FFBA 3A8YA 3A8TA 3DSQA 1N33O 1JXEA 4IO8A 4KV8A 4A59A 4YOWA 1T6DA 3THWA 2Y1JA 1KFYA 2Y48A 2LQTA 5B1OA 1U04A 3H1JH 5M1OA 3VENA 4X1KB 4DSEA 2DTUA 5IE9A 5LMNB 3OT7A 3APQA 2L35A 1S0VA 4LFCB 3ZN1A 4LF6O 4MDBA 3VETA 4GKKO 4CEAA 4DF8A 1RT6A 3ZHUA 3H45C 1YVNA 2Q68A 5GONB 3CMAV 1I0HA 2ZQMA 1RBTA 2E20A 2OPQA 4DSIA 5BREA 5C8YB 3C94A 4DU3A 1LNQA 2KZMA 4JI3B 4B08A 4IT5A 2WQYA 5FPEA 1OH6A 1JJ2U 1UWBA 3H1HH 1W2BM 1N0NA 1M57C 1XMQK 4CGIA 3LDCA 2BSKA 4DO2A 3EHBB 2HHHB 4DR6O 3AVCA 3VF6A 1EP4A 1YT3A 3PUFA 2M7WA 3AVFA 4C1NI 5A2QO 4LBEC 4EKWA 2CAZC 1NJYA 2YC0A 2A0LA 3I5DA 3CRMA 4LNUB 1VF5B 3ABMC 5CB4A 4F6RA 4QE7A 4A5AA 4BQZA 1UA0A 4DV7O 1FPOA 4CH4A 4PA6A 2D0BA 2HBKA 3GL1A 3K2PA 5AQMA 1QR9A 2Q73A 2ZCEA 2ZR3A 3QO5A 2O57A 3ID8A 3O8MA 1AJNA 1NVPD 4FCYA 1I94K 4L3QA 4LF5B 4O2AA 1TYQB 2P9LB 1NGEA 1HP8A 4B3MO 4AHVA 1TKZA 4Q0BA 3BF3A 1Y76A 5F1XA 3J8F4 2R9AA 2HW3A 4IEEA 2EIJC 2KKWA 2E5LB 4H8KA 1H8HG 2WLLB 3WNFA 3ETQA 3SPYA 1YTUA 3CCMV 2RS14 4GZRB 1T6CA 4MLHA 1LR1A 5LP6A 1HNWK 2G8IA 4K42A 1ZL8B 1YJNN 1Z26A 2UU9K 1IXBA 3NVMA 3BPZA 5CBHA 1BA0A 1NS1A 1AR94 4A57A 4AQYK 4WFBL 3OR6C 4DTRA 4FZYA 1VBE4 3L6QA 2H88A 5FPRA 3ZMTA 5J2QA 1JR9A 1RT2A 1F21A 1XMOB 4DR6K 1MWKA 4JI7K 1Q90D 3M5RA 3W7TA 4JYYA 3A5LC 4CJWA 3AG3C 2WDRA 4O0IA 2E75B 3O80A 3JCZA 5JH7A 2IVPA 1XNRK 1WLJA 1I5XA 1YUWA 1JFFB 4DU1A 3LDNA 3V1OA 4MLEA 4WCEV 4CF8A 1WB7A 3FFIA 2ZE5A 2VGNA 1Q9XA 1S5LZ 2A41A 3QFUA 2UXXA 4BWAA 3SLCA 1L0VA 2RQ6A 1E79G 4GKJB 1GN3A 4ID5A 4E7LA 1JQ0A 1EN6A 3TCUA 4MTFA 1HW7A 1VQKV 2LFSA 3DLRA 3NH0A 4J2BA 2UUCK 3OHRA 3W7WA 3HKEA 2HWC4 3VQYA 1GOCA 4DR1K 4PDWD 1U2VA 1S22A 2OWOA 1VSJA 5LP6B 4D6TH 3U11A 2HHTA 1XNRO 3IG1A 5H6QA 1BO5O 2HF3A 3PX6A 5E79Z 5EC2C 1S9EA 3EL2A 4BDYA 3AE3A 2RF2A 3JARB 1K7DA 1Y76B 3W0LA 2KSDA 4O2AB 3H6EA 4IWVA 3QB0A 3OVNA 4Z1MG 3SPZA 1N32B 4ZTFA 1SKWA 4NXNK 2ACZA 3SUNA 2PY5A 1WNSA 2F4VB 3LDPA 4LH4A 3OY9A 3CCRV 5CB4B 1HNXO 4I55B 3MDQA 3JYCA 2D0AA 2A1RA 2VG5A 3ZSWA 5AQLA 4OKKA 3SPCA 2W0XA 1WSGA 2DOSA 5IY5B 1A5VA 3O9SA 1YIJV 3JCUZ 4JAUA 3K5LA 1FFXA 5BXZA 4FJGA 1PO24 2WDVA 1SKVA 3OGCC 4DXWA 4UB6Z 2QKAA 4RTFD 1GRJA 2G8UA 3GVMA 2KG7A 1SQVH 4JZGA 2NRZA 5LP6C 4YY3B 3BZKA 4FLUA 1MSWD 1GLLO 5J2UB 4GKKB 5JVHL 5GONA 5E26A 1MOFA 4PA7A 4JYAO 3M1FA 5J2UA 4BREA 3WXKA 1KVBA 4HAMA 3C0BA 1TAUA 1VQMV 5BR9A 1SQBH 4JKGA 4E1NA 3ZS8C 5AQUA 3E89A 5IYBO 4EIAA 4B9SA 5LYJA 4X1KA 3OYEA 1FFXB 3OEHG 3S3WA 2CH7B 4C8MA 4DTXA 1SC5B 2WLKA 1ASUA 4JI5K 1B92A 4PUOA 3AGKA 5B1BC 3BY6A 4KTQA 2UUAK 5D3GA 2ARHA 2DN9A 2ZF5O 4Q4W4 1IXMA 3HZ6A 1FYJA 2QK9A 1NJIW 2XY5A 2GSMB 3IFXA 4H0TB 4IFVA 2JRIA 3AA2A 4B9LA 2BOBC 4MO5A 1AI4A 1GN4A 5J9PC 3THYA 4LF5O 2Z1HA 3R8EA 4B9UA 1RBVA 3PIPL 2M6YA 3SJHA 3J81O 2QKKA 1SZXA 1V54B 2LP7A 4BR9A 4CJUA 5C10A 3CWBH 1QQOA 1OCRC 4FK2A 3O4NA 4DQRA 4B8CA 3C7NB 1BMFG 3B4SA 1YSCA 2FTKA 3RN4A 3SPHA 2W40A 2D2CB 1JL2A 4LSLA 2DE0X 3N4PA 1HYSA 2D0OA 2OTJN 1YJNV 3O3HA 2O8EA 5LJVA 3FYIB 2ZD9A 4X62K 1NK7A 2NRHA 2V7QG 3DJCA 1UJWB 3QLHA 4IZ9A 4JI4K 4RW4A 1GN6A 2RM24 1KTQA 3O4WA 3SQ0A 4MS2A 3HKBA 3AEBA 1AI6A 4X20B 3JASB 3AK1A 5AQSA 3T1AA 2YI8A 3RWRD 3WG7B 1AI5A 5AZJB 2OPSA 3MEEA 4J8FA 1RBRA 2FBTA 4LFCK 3B6OA 2UXNA 3DI6A 4TUYB 1NGCA 3E01A 1BE3H 3UO2A 1KP3A 4X64B 1EV14 3HVTA 4FJLA 5CR4A 2GEMA 1P90A 3TR8A 1W97L 3RYHB 5LXTB 2QEXN 2JWLA 5LMNK 4OKEA 4B9MA 4YTPA 4CGDA 1P8ZA 2CGKA 4LWSA 2LJ2A 5LHHA 2ZD1A 2E2NA 1OZ0A 3VEYA 1IBKO 2YV0X 4C23A 1HJOA 2AA4A 3OYKA 3RYFB 2GELA 1VARA 1JVMA 3AO2A 2XUMA 4O55A 5AQZA 4U3FH 1S72V 5TKWA 3VMFB 3E86A 3UB5A 4HZ3A 4E7IA 2EIKB 3KCYA 3AK3A 2PI5A 3IC9A 1QVGM 1C0TA 2JEUA 4DV3O 3HM8A 4DR2K 1KSPA 1VQ6V 4JHDA 3WG7C 4DR7B 3E9PA 4M3XA 3AG4B 4CCHA 1MZEA 1ZBUA 4HNAA 3RYCA 1WSJA 2E6LA 1RTDA 2JK5C 1J6ZA 3L2VA 3CMAN 3D2EA 2GHYA 1GLBG 1HQUA 2D0CA 4GUNA 1C1AA 3V9SA 4FK4A 4X65B 4B1WB 2B9ZA 3CMEN 5CA3A 5LL6Y 4ELVA 4B7KA 1R3LC 1Q9YA 2PGGA 3CCRN 3K9KA 4LWSB 4J2EA 1SQKA 2P9NB 3HPOA 2BSKB 1IKVA 1I5YA 4NTXA 4I9QA 4DB3A 4I9WA 3BCCH 2WLHA 4DLGA 5HRRA 4BRMA 4HHTA 4DTNA 1RDUA 4LD0A 1YIJN 2B5UA 1HDJA 4F4LA 4K8XA 4DUYO 4DTPA 3ZT1A 4ZI7B 1PKXA 3KTQA 4LF8K 1NWKA 3DLLL 2OTLN 4CIFA 4CJ7A 4FO0A 3CCUV 3HPHA 4H03B 5AZJA 4P9OA 3SAHA 3A5MC 4CZLA 2IU0A 4DUZB 2F8SA 3Q7CA 2QWNB 3SQ1A 1OCZC 4WFAV 3CPEA 1GLJO 1NK9A 1A5XA 3SV3A 4MFBA 3VEVA 1SZ2A 4FFBB 4CS3A 4CJFA 2RHKA 4R5PA 4A2BA 1OCCB 4FWOA 5FPDA 3UKMA 3UKUB 3CM6A 3QO8A 3GWKC 3P1GA 4GW6A 5IT9O 3ATVA 4PKGA 3ZJZA 5LBQA 4F3TA 3CPWM 3I0RA 3OBYA 3HKDB 4I0XA 3ICXA 3HRGA 1RUE4 3S3XA 4J11A 1SA0A 3CETA 3AGRA 1WAZA 4EP5A 2HKOA 1UFIA 5KX5A 4R6ZA 3L71H 5AQRA 5FRNA 1K34A 4O4IA 2E8AA 2QWMA 5J2MA 3SAFA 3DMJA 5BMVA 3IMXA 2QA4N 1VP7A 4F8RA 3QO7A 2X74A 1Q86O 2QKCA 2OANA 3I56N 1JPXA 4KPYA 4JI1B 3R3LA 1U47A 1JLEA 3N2GB 1SQPH 2WLNA 4FIPC 1RILA 1Q7YW 4DV6B 4TV8B 1VQON 5IWAK 1ZUQA 3WXIA 1I94O 3ZN0A 1S76D 3QESA 1YJWN 3K0GA 5ADXA 1K4DC 1OV9A 3K04A 3NH1A 3CCVN 3B8AX 4TQFA 3L8BA 4BGBA 4DSJA 3CC7N 5J2PA 4JI6B 3TSQA 1VQNN 3FZMA 1DF5A 3B2EE 2OCCC 2IJHA 1BL8A 1LAVA 2E6MA 1YVUA 3LUTB 2X7RB 4DR5K 1A32A 5H5NA 4MT8A 1L1FA 4BC4A 1K73W 1KD1O 2JGUA 1YCIA 1IKWA 3EKSA 2Q0OC 2IDOA 1TUBA 3LPUA 4X64O 3AE2A 4J9YB 3M8QA 3JATB 1IVSA 2QWQB 5L3FA 4OPJA 1HR0B 4FPBA 4JYBA 1T05A 2VWBA 1IBMK 1D2DA 3ZHRA 3P4RA 2ZINA 4JK7A 2XY6A 2OCHA 3U10A 3ZCCA 3I8BA 4FJXA 3STZC 4DSKA 1AR64 1WP7A 4EZ9A 5KMGA 3AG1B 3NGZA 5M1KA 3SJJA 2XO7A 1ROPA 1EQYA 1S72N 2EZOA 5HFMA 1K8KA 2KFZA 1GN2A 4KO0A 4YIOA 1YJ9N 1R73A 3D36A 4WFBV 4CS2A 4IOXA 1IX9A 2UXBO 2AXTZ 1R0AA 2QXLA 1KVCA 3G4SN 4BE0A 3DXKA 1JCFA 4DTSA 3PV8A 1XNQO 1RT3A 1TKXA 1RDCA 2Q7EA 3T1YB 4CEDA 4FJJA 4DG1A 3AG7A 1NJWA 5FNVB 4JI1O 3STLC 2GUZB 1ZBSA 4M3YA 2IW5A 4JRQA 2Z5UA 1NA1D 2EBOA 4D7SA 4CJQA 1RT1A 3K5OA 5LGTA 4CF0A 4CHNA 3TAGA 5CA0B 1BI4B 1O1WA 1FKOA 4JKBA 4FLXA 2YNGA 1RPRA 5C15A 1O9GA 1FXVA 1IDSA 1Z2GA 3B40A 2YHWA 3SMSA 4JGSA 1BWFO 2NRXA 5GTHZ 3ZSYA 1HR0K 1NEKA 1N34O 2ZM6O 5SZTA 2FL4A 4B1ZA 1FKAO 3K03A 2HJFC 4NXMO 3VQWA 4IO9L 2P51A 4FJKA 4DUYB 1FJGK 1FXHA 2DYSC 3LALA 5BY1A 3TI0A 1XNQK 2BE2A 1JLQA 4PKIA 4RWTA 3KLGA 1YITV 4IHJA 3LSQA 3ULDA 2IM9A 4JI0O 2Q0UA 1WA8B 1XHZA 2ZQBA 3E8HA 3FD9A 4NB4A 3ZSZA 4BRKA 4K0KK 4JS5A 1V9PA 4JI2B 1NENA 4OO1J 4B3MB 1CXUA 1SL2A 1NR1A 3KWIA 4C8NA 2I7PA 2O8BB 4PA3A 1Q6UA 3L3UA 3J7AU 1P4RA 2QEXV 4W4KA 2HVJC 4QIWF 4IHJB 4YY3K 2YHYA 3OTOO 4BRDA 2DW4A 4KHUA 4QOZB 1ZL8A 4M42A 3O9UA 3SCXA 2NLXA 3AECA 3MN6A 1EM1A 1R6TA 5KGXA 4GY2B 2Z1GA 2CH5A 4EHUA 1K9MW 4Q6GA 1VF7A 1PO14 1VQ4V 3NVKA 2WOMA 5AG2A 3JXUA 3P39A 5GIOA 3CXHF 5GAGP 4U7BA 5H6RA 3AVKA 2JS5A 3EN9A 2DYSB 5LL6Z 2KFNA 5JJNB 1TA8A 1L8DA 3J7ZO 1OKJA 4OGEA 5AFUH 2HHQA 2I5JA 1H2GA 2ITCC 3HVRA 2CDYA 4OPAA 1V55B 5CE3A 2O8DA 3ENOA 2HBJA 1S3XA 4LNUA 4FWMA 3S3OA 4XDKA 2NN4A 3LDLA 1U49A 1H38A 1H2NA 3H46O 1RUG4 3EEQA 2A3QA 1PL0A 3LDEA 4M3TA 4DR4O 4KHPK 1TAQA 4UCUA 4O4HA 2QXFA 1H8EG 1EETA 2X6SA 4KTWA 4HCCA 2CUGA 5JS1A 4YTMA 3SQ4A 2AW9A 1NMNA 3AA3A 1E1QG 4MO4A 5DEDA 1OH5A 2Q3SA 4CF1A 2DQ0A 1N34B 3AO3A 1JA8A 1XL6A 1YAGA 3VEWA 3CRRA 5I42A 4J7ZA 3ZRVA 3LNMB 4CD3A 1B6QA 4ZHQA 2W6IG 3E8BA 1W7AA 1YXBA 3QETA 4CJEA 4P9PA 3N27A 4U3JA 1CZAN 5KHIA 2QWQA 3VQ4A 4IFYA 1AR4A 1RFYA 1IBLB 2HJDA 1ESVA 2Q6AA 2NUBA 3OS2A 3FFQA 2QWPB 1CZ9A 4CC6A 4MVUA 1N5YA 1WAJA 3NFAA 3QIPA 3T69A 4WQ4C 3M7MX 3OYHA 3L72H 1YDXA 4I4TA 5C24A 4LP8A 1NTMH 4O4JA 4MVSA 2BTQB 5LHIA 4DQSA 1SL0A 1HNXK 4QAGA 5AQYA 2WP9A 4PDLA 3CC4N 1WPBA 1RDBA 1B9FA 4B3SK 3ASNB 2W41A 4QCLA 4DHYA 4KHSA 4AF1A 1ZBFA 2F1MA 3CFOA 2YJFA 2CE4A 1DT9A 3MAQA 4AQYB 4CJ3A 1NT2B 4CZEA 3CJ7A 1DKGD 4FWNA 3OYMA 5J2NA 5EOYA 3JD1A 2HFEC 1FK9A 4F6EA 4KRFA 3VQ8A 2GBOA 1KF6A 3F9MA 4CGFA 3UKRA 4PA4A 3OBWA 3VEZA 1NMDA 4LF6B 2HWB4 1XNQB 1G99A 2QM4A 2XAQA 3CF5L 2E1YA 3T3FA 3UT5B 1GK9A 4UCOA 4WYBA 3VGKA 1D9FA 4JI1K 1LUWA 1BCOA 3ID6A 1ZOYA 4M7YA 4OLAA 3P32A 4UV9A 3DOLA 1Y4MA 2ETNA 1BQMA 3VQAA 4B1YB 5KQDA 1NGGA 3ULEA 2XNDG 4O4IB 2GWJA 1KVAA 5KPRA 3CCJV 4B1XB 4WFGA 1HX1A 4O2BA 1X3NA 4IOAL 1ZBLA 5HRPA 4HBNA 3G71V 2ZM6B 5IJ9A 3F73A 3OW2M 4BWJA 2HG5C 3HKDA 1K5MD 2OIGA 2A06H 2CGNA 3KK2A 3O65A 2R044 3CIPA 4UCTA 5EZYA 4O44A 4FJNA 2D5RA 3UKUA 4B3SO 3NGYA 2Y4TA 1MU2A 1OVYA 2B5JA 4BR0A 1Y6XA 3OYLA 4LF5K 1K92A 4UY8O 4IJAA 2HVKC 2XY8A 1Q86W 5DM7L 5GAEP 2F23A 3VBBA 4LF4O 1OCOC 4E4EA 4EB6B 3C6AA 1M1KW 3IUCA 4IEIA 2ETJA 2ITMA 4DV0K 3CMEV 1BL3A 2A6AA 2HHXA 3T1YK 1R6NA 2LGWA 1GLEG 1VAZA 3WXMB 5TKYA 1TK0A 2O8FA 4DR5O 3EZ5A 1NK0A 3OTOK 3LDSA 4GX1A 2VGMA 4RW8A 4HUFA 1JL1A 2Q8VA 5A9GA 4JKEA 3O1WA 2EILC 4MW3A 3S9HA 4AQYO 3KLIA 3JD0A 4MQ3A 2G8KA 3KK3A 4DV5K 5EIBC 3L3VA 1CP9A 1W9HA 2YSUB 4DR3K 1QTMA 2UUCB 5LMNO 2X6NA 3U3GA 3M8RA 3S3MA 3P83D 4CIEA 2ZDIC 4FVMA 3HI0A 3P4SA 5LA6A 2FYUH 5LA6B 1L0NH 1BHBA 1G6UA 3CQYA 5LMUO 2J4RA 2B76A 1NJZA 1FXKA 1W59A 1Y74A 4BAYA 4NYFA 4CJPA 5C2DA 3ZHSA 2YIDA 1HMVA 1OCOB 4I5SA 4OX9O 2DYRC 4J10A 1EBOA 5CA1B 5L3GA 5M1NA 3AVMA 5B3SC 3OYGA 2BTFA 5AQOA 2WLIB 5LOVB 4KHYA 4OPHA 5AQXA 4KXRA 3AE7A 3ABLB 4FLWA 3AE5A 3AVIA 4N21A 2JJ2G 1NGHA 4G27B 4LFAO 2WBNA 1MNGA 1VQLV 3JAKA 2Q97A 2ZJQL 5KRTA 2X5ID 2CTPA 4BRGA 3F5TA 2RDCA 1IBLO 3HP9A 3ZEUB 2NLJC 3ZT2A 4BR6A 3NAEA 4OX9K 1LV5A 1E3MA 2VWJA 1VBB4 1Z6RA 4BR4A 3J7YP 4JASA 2VQEO 1VQPN 3ZX3A 2HBMA 2FF6A 1BHAA 1JLCA 3WNEA 3OMIB 3HJFA 4DV4B 1U4BA 1NJXA 4JYAK 3AEFA 2RPIA 3CG7A 4Q4X4 4KB1A 4LFBK 5CBGA 4AHCA 4QNHB 2G8FA 1YJWV 1BEV4 1EZVH 4BRQA 1POV0 4F2SA 4X66O 3HKBB 4WBNA 2JLEA 1N8RO 1VF6A 3NMUA 5AZIB 1IKYA 1YZBA 4KHPB 4WQ5C 4CF2A 4FSVA 1Q81O 2H89A 2JS3A 1RPOA 4FL9A 3APOA 2WA3A 1HJRA 4PELA 5J1EA 3LAMA 2P5GA 1BI4A 1BGYH 4RW7A 4FOEA 4BGAA 2LW1A 3DM2A 2O8EB 4IKFA 1AL24 1GH6A 4CZMA 4WFNL 2EULA 2DWEC 5L3DA 3CCUN 3ZBHA 1P84F 3W7UA 2OPPA 3K08A 2ZWHA 3SUCA 2KLAA 3AO4A 4PI0A 3ABKB 1K5SA 1RDDA 1FS0G 3R66A 2RS34 1W0JG 3RT3C 1I7FA 2Y0IA 4BVPA 5ITZB 3PLAA 1PIV4 4W5RA 2FXUA 3OYIA 3CJHB 3FGUA 1AB3A 2NZTA 2DYRB 3CSXA 5CN0A 4YJ2B 3VQEA 1T44A 4NXMK 4CECA 3JYTA 1MG1A 1NG9A 2D1KA 3KZIZ 4RUEA 4JV5B 1OVQA 5TISZ 5JVGL 2P5OA 4GLXA 1JLFA 4LFAB 5FPMA 3OM3B 2F96A 3C95A 4JRPA 5KA6A 4X66K 2B1IA 1VQ9V 4B3SB 1RTHA 4KTZA 5D5PA 2GUPA 4CGJA 2O4GA 2X0LA 4NYNA 2IH3C 4ZKIA 1BS3A 1TK5A 2CH7A 3T4DA 4E2LA 5JQGA 3CJ9A 5JQGB 4CEFA 4U3JB 3SR2C 1E1RG 2NRRA 4DR3O 4A61A 1Z5WA 3SJCC 3H1QA 4F3OA 3AG4C 3IC7A 3TXQA 1KB9F 1N32O 4FWRA 2WU5A 4DV4O 3CCSV 1AI7A 1K5QA 5E84A 2W42A 3SUQA 4FVUA 4CK2A 3EVKA 1C1BA 1M9NA 1QQNA 5JCOC 2P9SA 5EBWC 2HVHA 2BGGA 2EILB 2QWLA 2ZE8A 2DJVA 4ABMA 3WB1A 4J80A 4HTLA 3TTDA 1QR8A 4OVLA 1OCCC 3SI6A 4YOXA 3CJHA 4EAHD 1NM1A 1BU6O 5HLFA 1M93A 1R3JC 2ILMA 1MSDA 4C1NK 3OS1A 1Q43A 4PWDA 3K5NA 1KAZA 2YNIA 2DFEA 4NXMB 3X2QC 2A1SA 1FAFA 4BG9A 3AG3B 1C1CA 4H4MA 2UU9O 2P7TC 2QWRA 3ETGA 2EHGA 4Z4GA 1IZ3A 1QVGU 1KQSU 4B3TB 2UXCB 2VYPA 2E1ZA 1F23A 3D6RA 4CD1A 1T8EA 4BDPA 5IWAO 2PLV4 1L3TA 5M1QA 1WN7A 5BMVB 3N4QA 5IYZB 4JI4B 1N33K 5C93A 4OX9B 1NLVA 3RWUA 2BCCH 3OJSA 4QPJA 4I7ZB 5B1AB 3G6BA 4K8ZA 2YNFA 1IG8A 3A5OC 1U2VB 3ASNC 1J5EB 4FFKA 3UM7A 3O1BA 2PBDA 4GX2A 4JEPA 1VQ9N 1B9DA 4CJ5A 3T2MA 1J9AA 4B3RO 1YF5L 3GWOA 3CHWA 1ILYA 4CBCA 3TGUH 3AVNA 4G1QA 3ZX2A 4MDAA 3ZLJA 2FBXA 1JOYA 5KI6A 3MXIA 5AQGA 3QIOA 2Q36A 2HLDG 2XRIA 3CP1A 5CHIA 3U8XA 1NK8A 3U4LA 4PI2A 5GAHP 4X8AA 3DLGA 4TV9A 4M3UA 4UV8A 1Q3EA 2V4DA 3TJTA 3QEIA 4DV7K 1YI2N 5AFUA 2BUPA 4Z4CA 4E3SA 3L0QA 1NGJA 3OW2U 2W6LA 1BCMA 5GIPA 3CRCA 1L5UA 1WJZA 3JSMA 4JTDB 3CEIA 3G80A 2PYJA 4GMJB 2XOKG 1QVFM 1QCEA 2RKIA 4CJLA 1BIUA 2P67A 2Q0RA 4H0YB 4NXNO 2HNDA 2P9NA 4YOTA 3BRCA 4CH6A 3HT3A 4GKKK 1NGIA 3V9XA 3WFVA 3ABKC 1R6KA 4TT3G 3GOIA 4ZBMA 1TL1A 2QW9A 5IDJA 4BE2A 1F4MA 3O9RA 3SJAC 5ELZA 1LAWA 3P30A 1IURA 3RYCB 4HNAB 3T1HB 4JI2O 2XY7A 2AZ2A 5M1FA 4DV5B 1M1KO 1RM1C 1B04A 1FXXA 1NGFA 4UVBA 3W7SA 1SERA 4N5SA 4ELTA 3VEOA 3CCMN 3CYMA 2IBZH 3RFRA 1KFSA 4RHV4 3KLEA 3ZT4A 5KMGB 3RVCA 4CEQA 1XL4A 1Z05A 4DS4A 3OTOB 4JKCA 2FSJA 4ZTJA 1AP5A 2E2OA 4LF7B 1BHLA 4ILHA 2EIMB 4DV6K 2DFHA 1J54A 3C6HA 2WUSA 2F7TA 3QEWA 2LGQA 3VGMA 2FBVA 1MWMA 3NE6A 3KLHA 1EKEA 2ATKC 4DUZK 2Z0AA 5IYDO 3JD2A 4H4OA 4W5OA 1XMOO 2JDIG 2B6AA 1TUEB 1Y67A 1RBUA 4FWSA 3ZSRA 3OUFA 4B1UB 2LO1A 3MXMA 4ZIBA 2ZJRL 1CLQA 1H2LA 4OGQB 3VOUA 4JI5B 2D0PA 5EZYB 3I56V 3QEXA 5C42A 2KTQA 3CJAA 3NCIA 1H1VA 3BAAA 1VK0A 3SBGA 4RWUA 5BPNA 5H2FZ 2ADQB 1QHAA 1WBDA 3JASA 1DGSA 4X20A 4B3TK 3OTFA 2VQFK 5B8HA 5DECA 4OJRA 5DM6L 3BY5A 4BROA 2RN9A 3CJCA 3U9DA 2RMU4 3JAWA 2PYLA 1JCEA 1JCGA 4DTUA 3J7AP 3PX0A 1KLMA 3G67A 4JI6O 2HP8A 2R70A 2DWDC 1THZA 2IIRA 2RE2A 4FOIA 1MMMA 4JI6K 3VQCA 3KD5E 4JI8K 2HHSA 4M41A 2IJJA 4GVMA 2Q7GA 4P30A 3VR9A 5GW7A 4BR5A 3SV4A 4TSFG 1CXZB 2UU9B 4XEIA 4I6MA 2PW9A 3C7NA 1N0JA 1XBLA 4CS4A 4Q20A 4CJ4A 2HEPA 3ETDA 3CB2A 3RMBA 1M90O 5IWAB 4H13B 4DR2B 3O08A 1QNMA 1NNEA 1VQMN 2P90A 2B4JA 2CTWA 3R65A 3T4ZA 2GTDA 3MX5A 4I50B 4CI6A 4AHTA 2E5LK 2OZSA 4BIOA 4YNQA 3MDSA 5BPMA 4FJ5A 3CM5A 3JSNA 1G8MA 4E1JA 2OIEA 4H5TA 3U6FA 2DMXA 4DR5B 4FW2A 4MTGA 4CE9A 1X1PA 1GO3F 3BVOA 1NOYA 1S5JA 4EFBA 3LWLA 1U45A 4O4JB 4FJ9A 3SFDA 4NCAA 3QTCA 4X1IA 1J5EO 1LCUA 1TVKA 2NRVA 4Z94A 2YDEA 2XAFA 1WSEA 2QWPA 4CHPA 3JAWB 4F4KA 3Q4HB 4DRXA 1M56C 5JJEB 3CCLN 3R9PA 2WLMA 3A0IX 4ISEA 2HHHK 1YJ9V 1ZBIA 5LYJB 4ZHRA 2FKXA 3FB6C 4LR3A 4D7TA 1VRUA 2FF3B 1HXS4 1XUQA 1SS6A 5BN9A 4BRHA 4FJ8A 3LP3A 1KAYA 2K1EA 1FJGB 4I2QA 3SYZA 2W6KA 4FK5C 1PNLA 3TK1A 1NH2D 4DR1B 3OEEG 3IS9A 2UUAO 2P22C 1VBC4 4U7OA 1VSLA 4FWPA 1ENVA 3CCSN 5IT9N 4YOVA 1KQSM 1J53A 4J9ZB 1QZ5A 3RTVA 4TOIA 4X1YB 4DQQA 4Z4IA 2JJ1G 1NGAA 4YTNA 5AQNA 1BCCH 1XQ8A 2X6CA 2Y4UA 2V1DA 1IBMB 3VQ7A 3SFEA 1BQZA 5CZ2A 1OH7A 1KLNA 2VWKA 4J7KA 4J2DA 2IC3A 1TUYA 1RT7A 2YHBA 4KH5A 1N34K 2DY4A 2QKSA 2CTQA 4NR1A 4LF7K 2IGIA 4M3WA 4FJIA 1KC8W 3SUOA 1N36O 3AEGA 1EN5A 3D2EB 1W2BU 3MEGA 3SAGA 5LHGA 1YITN 4MW8A 3BA8A 3ZHVA 2CGOA 4CHQA 4DSFA 3DLHA 4HCBA 1OCZB 1SF9A 3QG5A 2YCHA 1XC9A 1K97A 4JI3K 3C6UA 1EZJA 3IKMA 1T03A 1VSKA 3JARA 4YIPA 3OA9A 1RBSA 3KIOA 3D3QA 4IFEA 5BRHA 2JIZG 4I7FA 4CJTA 1NR7A 1Q5OA 3VESA 3EY1A 3DRRA 4IL6Z 3TAEA 3PO4A 4JI7B 4FWLA 3V1QA 3L70H 4L8RB 4JAAA 2Q7HA 5B1NA 2YNHA 1PV0A 3ZETB 4KHWA 1RUF4 4KX6A 4LF7O 1KCFA 5CMUA 2ATQA 1Y64A 4X62O 4KAZA 5JJJB 4YHHK 4GVEA 3AE8A 3HKEB 4OLBA 2EWSA 5KHKA 4KP4A 2QTSA 2V51B 3FZKA 5KAFZ 5KUMA 2JWKA 1K9MO 4BG8A 4WFHA 3HBTA 3JD3A 3RYHA 3K5MA 3AV9A 1AILA 3HOTA 4UCRA 1VSDA 4B3MK 3UIQA 3ENHA 3OYCA 2VQEK 2D4WA 4B9QA 1WA8A 4LFCO 3L4IA 3MX2A 1YTFB 3DXMB 2WPDG 3K59A 3AO5A 4JI8B 4TV9B 3CRQA 4E89A 3MCAB 3H1IH 1B06A 3E9LA 3ZMUA 4NLCA 1REVA 3TWHA 2P6JA 5AQVA 5L3BA 3QEVA 2ZE6A 3AAPA 3TAFA 4FPAA 4CERA 2CK3G 2IVNA 4NCBA 3JD74 3IDHA 2E3CA 3BP8A 4CVNE 3RW0A 4DV2B 3VQVA 4FM1A 4JAXA 4G9ZA 1VQ5V 1YQ4A 4FXDA 1SQGA 4IG3A 3PJSK 2GUZA 4DKWA 3O9OA 4CBWA 4PQUA 3EZWA 1ZTEA 3AE6A 3DC5A 4WFEA 4X88A 1BDGA 2E2PA 4YSYA 3HTVA 2WLLA 2GWKA 1Q18A 1R3IC 1V4TA 3S3NA 4QS7A 3VN5A 4CZIA 3ZMZA 5IYZA 2W0FC 4G28B 1HUXA 4OKJA 4JZ2A 4WFFA 1IJJA 4Z0UA 3CX5F 5FPNA 1RUC4 2EZPA 5EIBD 4C8KA 4FLVA 3JS6A 2QWRB 4RO2A 2Y0PA 2FBWA 2O8CA 3SJQC 3GQKA 3LSUA 4DTMA 3WNHA 1YF2A 4UVAA 5D5QA 5F2RA 1WSHA 3G6EN 2WA4A 5L3CA 3AVBA 5C12A 2H8PC 5GADP 2V7YA 3T1HK 5JVDA 3A0HZ 1F4NA 2QM8A 3CERA 3LM9A 3P4IA 1JLAA 4YDUA 2UUBK 3C65A 4X1YA 3QBXA 1TUBB 1XDCA 5C8YA 3E22B 1RGIA 4E7KA 1AJQA 1HNWB 5FLXO 4OXSA 3HK2A 1FJGO 1AVMA 1O9HA 4JI8O 1ATRA 2PTMA 1VEWA 1TL3A 2IH1C 3ZEDA 1N6QA 3LSSA 3AEAA 4LC9B 5GINA 2AHZA 1SKRA 3PY8A 3SDLA 4UXNA 1GLDG 1ASJ4 1DTTA 3TSPA 4W5NA 3WQUA 2IU3A 3QVNA 2YICA 4PV1B 2PFUA 4BACA 1D9DA 3AE1A 3GDQA 1NU0A 1OJHA 2G8HA 3LP2A 3F7VC 4KREA 3ATUA 2OT5A 1HNIA 2P9KB 3LPTA 4DUYK 4GT1A 3VF2A 2YKMA 1ZSPA 3WUHA 4HTUA 4N41A 1NZ6A 2EINB 4YFUA 1NTZH 1MZFA 3H01A 5KPTA 2BH1A 4FPPA 2EJ7A 4ZOLA 1XNRB 4GYCB 4FWKA 4EP4A 3KKRA 5JLHA 3BF1A 2WTUA 3EE8A 4O5FA 4JI2K 4DV3B 1QVFU 1M5IA 4Z4HA 4I50A 3PN1A 3I33A 2GX9A 1S6QA 2P9IB 1S9GA 1M90W 3BA9A 1V55C 4DR3B 1RTJA 3HKCB 3TPQA 2HVIA 1QQCA 1SL1A 4Z4EA 4LH5A 2GUIA 3H1KH 1QE1A 1S1TA 2A42A 1C0GA 3QNEA 2F4VO 4LC1A 4FMTA 4CH5A 1ITGA 3LP0A 4AHSA 1RDWX 2LW7A 1L0LH 3V1RA 3VQBA 5HROA 3EXAA 3LP1A 3OYDA 4CHYA 1GLAG 5HBMA 3CCVV 4KHQA 2A5XA 3K58A 3G6EV 2RCVA 3E83A 3FLCO 1YVWA 4X64K 3HXMA 1GOAA 4XDLA 1K6YA 1ZX3A 2ASMA 2V7ZA 2AP1A 1OH8A 1VQ4N 2QWNA 1TV6A 2ZXWB 1QU7A 1JFFA 1BQNA 2NRTA 4IOCL 1IBKK 3ZT3A 3DC6A 3AVHA 1ATNA 3NDKA 3IGAC 4UFZA 3OYNA 3RRHA 1WUAA 5KPZA 3ASOB 3THXA 1NK4A 1KECA 1P49A 1NU1H 3O9QA 1RUD4 2Z1JA 2UXCO 3NGIA 3L2UA 1Q81W 2BOCC 1LWFA 1JX9A 3SPIA 1DLOA 3L74H 3RR7A 4U7NA 4DV5O 1YEWA 4TQDA 4FM0A 2QKBA 5EYPA 4DQ8A 1KFDA 1KU9A 2KQ2A 4B3RK 3OMAB 4FYDA 1ASVA 3ZHTA 3ZIAG 3K79A 5JWPA 1S6PA 1D5AA 1TUUA 2HBLA 2YEVB 3I8DA 5K1PA 3ZETA 4FWQA 2ZIMA 1XOUA 4O4LA 3KKYA 4LY7A 4K41A 3L2QA 4DW0A 4W5TA 1G1XB 2Q5ZA 1QLEB 4K35A 3FB7C 1XI1A 3V4IA 2WLIA 4H0XB 4YOYA 5CYQA 2RJZA 4CHOA 1X3MA 1F7YA 4WF9L 4UVCA 3LZIA 5CA1A 1RNHA 2R9RB 3TARA 1DEJA 3AG2C 4IGGA 3V81A 1IO2A 1TYQA 2XAHA 4XDJA 2P9LA 2VCPA 1YQ3A 4EFHA 4BC3A 1QHTA 2VQEB 1RTIA 4N56A 4NKGB 2VS0A 4L87A 4UUJC 5AQFA 5L3EA 2G8WA 3OFNG 5C25A 3DYAA 1TAEA 4W4LA 1NK6A 2B1GA 3MN5A 4ID1A 4DK0A 4GCZA 1KC8O 4LF9O 1QQMA 3AVJA 1BIZA 3RGBA 4BR7A 1WLEA 5FPOA 1HWYA 3CC7V 1GLFO 2Y1IA 1IG9A 1VF6C 3CRAA 3MN9A 1YHQN 4KKOA 1D8YA 4CEZA 1EO1A 1I39A 4MVZA 4A5UB 5EYPB 3D2FA 2OCCB 3ETEA 3TU5A 2JEXA 3A2FA 3SUPA 1DF4A 3Q7BA 1Z5VA 4HUGA 2AGAA 1SKSA 2O8FB 1P7BA 3VRAA 2E76B 4Y1CA 4PDVA 4JI0K 4LF8O 1VQ7N 3M99B 5B5EZ 3AE9A 3ABMB 4K0KO 5LMUB 2P4VA 2KZZA 1HQEA 4MTXA 4RUFA 3OGIB 1QZ6A 2WWWA 3HPLC 4G2KA 3KVGA 3DGEA 4DR2O 3K3WA 3DRPA 5M1PA 2WDQA 5BRDA 3SBTA 4DRXB 4PKHA 5LGNA 3JALA 1HNZO 5K14A 3ZSVA 5JMVA 3AEEA 2QWOB 2OYQA 4RQFA 2ZM6K 1SS3A 2YI9A 3FB8C 2BTOA 2FMLA 4O4GA 3T1CA 3H9VA 1K8AW 1UAXA 2VG7A 5KUKA 5SWMA 2KB1A 2Q69A 4JD2A 2QR4A 4Q4Y4 4XIUA 4RCHA 3ZYYX 2HMIA 1L3UA 5EBMC 3NF6A 3S41A 3DLBA 3I0SA 2EIKC 2MK3A 2ZNIA 4DR7O 2P9IA 4BRAA 4EHTA 1Z25A 4B9VA 1RHI4 1MA9B 3NH2A 2UXBB 2N74A 5HFLA 3G10A 5JICA 4UQGA 3FAVB 1FKPA 2X6AA 3D3IA 3KK1A 1HNZK 3ZHQA 4YJ3A 1VQPV 2WSSG 3A0RA 4N76A 4AM7A 5IYCO 3OYFA 4H5NA 3E2EA 1LUVA 5BR8B 4LF9B 2A40A 2P9KA 3E9OA 5AQHA 4BIUA 3UKRB 4CFDA 4RAIA 5DMRA 4DMNA 4DS5A 3RMCA 2ZDIA 3ZRWA 4DV1O 5HP1A 3CC4V 1X9JA 1BT8A 3WNGA 4ISFA 2WLJA 1IBMO 4B9NA 1S5HC 2HHHO 4DR6B 2KHOA 4JLHA 3V6DA 3HYFA 5J2TB 1GLCG 4B3OA 1HRI4 2ZE2A 3K0SA 2QTDA 3B8MA 2KKZA 3ALYA 4JKGB 1X4TA 3AA4A 4PHZA 3LANA 4CBXA 1U97A 2UXDB 4LFBO 4DV7B 3ITHA 4EZ6A 2PF4E 3JBG4 3P4QA 3BDPA 4YT0A 3MWTA 4CZGA 4IYIA 2KG7B 3JAMN 2P06A 1DTOA 1WOQA 2OZMA 2E5LO 3AVAA 3R1XA 4XH5A 3D36C 1S1VA 4H5WA 1KKCA 4CEOA 2G8VA 1JKHA 1US6A 1H2KA 4ZHQB 3FZLA 4QS8A 4GV3A 3M8AA 4HWIA 2A9HA 5B3SB 1GMGA 5KAIZ 2DQ3A 4JKDA 4CBUA 4I55A 2HR3A 2ZKOA 1TVRA 2E2QA 4BW5A 4ILGB 4B7EA 2HOEA 3DXRB 4R7CA 1J5EK 2WS3A 5IY5C 4I9LA 4J2AA 4NLBA 3HM9A 1X9SA 3UCSC 4YJ2A 3SMPA 3AG2B 4N23A 4CZHA 2XTAA 3O4QA 4CZFA 3WU2Z 2Q4PA 2ITGA 4YORA 3VQPA 5CYMA 1Q8IA 3UQ8A 4QGPA 4OPKA 3CE2A 3CC2V 3ASMA 4KFBA 3L2RA 1EAH4 3ZSOA 4DTOA 4WCEL 5BN8A 3TABA 3PO5A 4FLTA 3QO9A 2KQXA 3NXSA 4CH3A 3P5JA 4WE1A 1XQSC 4X89A 1Y66A 4YDUC 3VQ6A 3A5NC 2CGJA 1S3JA 2JGDA 3PSFA 4BRFA 1JCHA 1BUPA 2FLOA 1COWG 1CXQA 1H2MA 2QDOA 4DR4B 3LM2A 1AR5A 1GM8A 1RUJ4 5KLVH 1HYVA 3GE1A 4GKJK 1D5NA 2FSKA 4KBOA 1I08A 2A7WA 2EX3A 4KL1A 3A0BZ 4CHZA 4XBFA 3RYIA 4WBNB 1LWCA 4DQIA 1NGDA 1JLBA 1T3VA 4DV0O 3RVYA 3AG1C 2VG6A 5B1BB 4UCSA 3SYQA 4Y0WA 2UXCK 5JH7B 1HPMA 3JD4A 1M56B 3ZT0A 3DXMA 5AQTA 3OMNB 3E8GA 4K0KB 4E7HA 3AA5X 4LSNA 2O8BA 1BGXT 1V54C 2P9PB 1XMOK 5EK0A 3ZEUA 1JJOA 3HL8A 4CZZA 3RSEA 4A2AA 3H1VX 1TGOA 3EE9A 3THVA 1XEQA 1BG3A 2F8TA 5JS2A 1NH2B 3V9ZA 3FX7A 4E19A 2GTSA 1NKCA 3OS0A 1SESA 3SYAA 5IJ0A 3T7ZA 4PL7A 4CF9A 3KK7A 3RYIB 3OYAA 2ASOA 4WQ5A 1A5WA 4CEBA 4I2PA 4Z1VA 4DU4A 2XT9A 1YTFD 4C8LA 4DSLA 2NNWA 1DLBA 4FZ0A 3AAQA 5LJWA 2XAGA 3IFRA 4FJ7A 3B09A 4IIJA 1GOBA 1TK8A 2QI2A 3JAMO 1UPGA 2JGDB 4BE1A 2UYTA 3DLKA 3G4SV 1IKXA 4HUEA 4KHNA 5E41A 3WEEB 1FXKB 1Y74B 1URFA 3VQ9A 5I3UA 3KWGA 2W6JG 4F6RB 4UB8Z 5MLCQ 1G15A 3QDKA 4NCGA 3QNOA 3ASOC 3BGRA 4JKFA 5CZ1A 3E1YA 4V19S 4H5VA 2EIJB 1NKEA 4YHHO 1R3KC 3CI5A 1UA1A 4RG8A 2VQFB 1YI2V 1RFQA 3KG2A 4FZXC 2IAJA 1I3AA 1XMQB 4BVOA 4KH4A 1MDUB 3HP6A 4ILJA 5AR0A 1RDAA 3G71N 2HHWA 3EKUA 3G25A 1VSEA 2RR14 1DTQA 4JKHA 1VQ5N 5EC1C 2Y69C 2RN2A 4IYHA 1NBWA 1XHXA 4YSXA 1BQ0A 4H0LB 3SYOA 2IJKA 1GTOA 4RQEA 4FLZA 3CFPA 1X59A 5C3JA 2UXDO 2E4LA 4UCVA 4CGGA 3PX4A 3K06A 3H3OB 3QICA 5LMUK 1Q7YO 3P3NA 4JI0B 3CQXA 1XWLA 1HPZA 2OTLV 5LY3A 3W3DA 2O4IA 2HHVA 4W5QA 1IV0A 4M3ZA 2WONA 1XUPO 3OR7C 2CH6A 4BQLA 4R50A 2AJQA 5T7BA 1L3SA 3HB3B 5BPLA 3D0PA 1FXKC 3CD6V 3Q4HA 2IVOA 3G0ZA 1QSLA 4LF4B 1PPJH 4CW7B 2D3OW 3KKSA 4K43A 3LWMA 4H44B 1TVKB 3F7YC 4JN4A 4N47A 5ADXH 5KQ8A 3O3GA 5E1AC 4MTOA 1VIBA 3UE5A 2HSTA 4YXDA 1WB9A 2O8CB 1PNKA 1RSOA 1KUQA 2Q1NA 1Q6HA 2R7YA 2YXLA 1EWRA 3H1LH 5AJ3K 2XASA 1WPXA 4KHPO 3C3TA 1QLEC 2ZR2A 1M4UA 3SYPA 3LDOA 4M63C 5ITZA 1ORQC 5F0XA 4IDHA 2LFRA 3CPWU 3CCLV 3D7EO 3O9TA 2N04A 1N4CA 1VQ8V 3KD1E 1AROP 4PDMA 4RW6A 4KUMA 5AQPA 1B3QA 4TV8A 5FRMA 3D8CA 4I6MB 3U0ZA 3T1YO 1MA1A 2QJ1A 3AVLA 4A5BA 4JI5O 2Q67A 1JXBA 2UXDK 2ZNJA 2RS54 3CS5A 3HR0A 5HL7L 3I55N 1D4XA 4PHTX 1NKBA 1ATSA 4FJHA 3TTFA 1SRYA 2MW2B 1HNVA 5EU7A 1EN4A 3HO1A 2FBYA 5AQKA 1TKTA 3TTCA 4IXCA 1XREA 2R7FA 4M45A 4E0DA 3MCPA 2Z1IA 1SA0B 4TWKA 2EIMC 3MN7A 4FLYA 4LH7A 1MABG 3NR7A 4JV5O 2QE7G 1KBHA 5C2FA 4J7JA 4DV0B 5AQIA 5EVZA 1GM7A 5F2VO 3RR8A 2Y69B 4J42A 1RVF4 2BTQA 5JCOA 2P4KA 4I4TB 3FKSG 2YKNA 2EJRA 2YXYA 4AILC 2QWOA 3FFKB 1S1UA 1HKCA 1EWQA 3JALB 1U6ZA 5GTIZ 3CC2N 1COV4 1RP3B 5KRSA 1E4FT 1TKDA 3U3YA 4C8OA 3H3NO 4DYLA 3ISNC 3NF8A 3CCEV 2N05A 2YI1A 1N32K 4GX0A 3O6WA 3GB7C 5FL7G 5EY4A 1VQOV 4JS4A 4A62A 2F66C 1FFTB 1AR1B 4X65O 3KJVA 3CCQN 1QBZA 2ZGYA 3HOSA 3E8FA 1RUH4 1YHQV 4JK8A 5LOVA 4H37A 3BUZB 1QSYA 2X78A 2HHUA 3F5WC 3KZBA 5AQWA 1Q82O 5HOOA 3CQ8A 4IBNA 4KI6A 4K3AA 3VQXA 1GAXA 4BRLA 4H0VB 4QS9A 3FYEB 1AR74 1VQNV 2RNBA 1Q6IA 4MVOA 5KTQA 1X9MA 1R094 3OE7G 2PI4A 3U9ZA 3B8NA 3AE4A 2HMPA 1VRTA 2HF4A 1ZAUA 4E7JA 1UOCA 4GB34 2RMKB 1KRPA 4KB0A 1VBD4 3ABVA 3C3SA 4H33A 4LF8B 2YS8A 3RVZA 1U48A 4X65K 2O8DB 2H3GX 1YTAA 4PA1A 5BRFA 3DTUB 4BIZA 4GNIA 4R79A 5LGUA 4YHHB 4F9OA 5K1XA 4MSWC 4JI3O 4JF3A 2F9TA 3L9DA 4GKJO 3E35A 1U96A 3CHXA 5B66Z 3HSCA 3CYOA 1C0FA 4JHDB 1VRH4 1XC3A 3L75H 3OD4A 3WB2A 4FW1A 4DR7K 3J80N 3T19A 3TANA 4WF9V 4DFPA 2UXBK 2P1JA 4TSXA 4DFMA 4NB5A 1K8AO 2R064 4DF4A 5FROA 3EFFK 3VTHA 4BRCA 5IJ0B 3RYFA 5DN6G 1BOTO 4C7UA 5B1AC 1C0MA 1J5OA 4CJSA 3SNNA 3BZCA 1NBMG 2YEVA 1N36B 3LZJA 4AHUA 4LFAK 1ZBHA 3AY9A 4FK0A 5FLXN 2IOCA 2EINC 3VOVA 4IG0A 2BDPA 2QTOA 3CJBA 2ZXWC 1R1BA 3O3FA 3ZRSA 3O5BA 4PL8A 3RSEB 3WQTA 2V52B 1OCRB 2Q2RA 2ITDC 2UUBB 2F43G 2P9PA 3P38A 5DK5A 3PIOL 4P2ZA 4ISGA 1OOPD 3K9AA 1ZXOA 2KW4A 3MHSC 3B77A 3GBTA 2QM7A 1VSIA 1VSFA 5FDLA 3CD6N 3MMVA 4TUYA 1NI8A 1SZTA 1WP8A 3CFRA 4JK9A 1H8TD 3MHHC 1RT5A 1SQQH 3CCQV 3ML0A 4RW9A 5KHHA 4BR2A 1K73O 3V9UA 4J41A 4X62B 1I94B 2WAMA 1M57B 4DV1B 3MD0A 3DRSA 4O2BB 3N2KB 3RMDA 4BRPA 3J80O 4KFMA 2WU2A 5CBFA 2ASPA 3FI7A 2L6LA 4DCHA 1PNMA 2VRZA 3IAYA 2GTAA 4Z2WA 3ULEB 3RMAA 4CFBA 1CZBA 4ELUA 1P7GA 1NGBA 5H9CA 4AM6A 4XH4A 4CZJA 2AHYA 1GM9A 3GQHA 1HNWO 1X9WA 2OA8A 1QLNA 3UT5A 1LOTB 3QBWA 2PZSA 3M8PA 5FNVA 5EXWA 4JPRA 4MVRA 3K0DA 4B3TO 2HNZA 3VF4A 4NO7A 3HKCA 3T1HO 4B9TA 1W0KG 5HRNA 4DLEA 3DLEA 4HVJA 4DW1A 1L3VA 3ZX6A 2R9IA 2PAVA 3OYBA 3QF7A 4CIGA 3ZSQA 1HR0O 1HKBA 3THYB 3C90A 1BZKA 2NNUA 1K8KB 3FB5C 2YUAA 1H2SB 1WAFA 3KLFA 1DK1A 3VQDA 4CZKA 4GV9A 2YJEA 2P9SB 1RSOB 3K9SA 4JTCB 4JTAB 2LSNA 3VERA 1VSHA 4JKAA 1KAXA 1S1WA 1W0HA 4R8CA 3MEDA 3SQ2A 4JV5K 1PVC4 3QMLA 3P4PA 2YX6A 4JYCA 1PD3A 4DQPA 3SPJA 1LW2A 4PJ0Z 1JMKC 2Q9LA 1V4SA 2BANA 2P9UB 5KHGA 4DR4K 4HYOA 4EEQA 2FC0A 1HLUA 4NTYA 4EFEA 4B3RB 4PDRA 1IH7A 5EBLC 1NK5A 2QA4V 3DAWA 3B6PA 3ZMVA 2P9UA 5AQJA 4MVMA 2Q0AA 3TETA 3FZHA 3LDQA 3ZRXA 3D45A 4LF4K 4FZZA 5BZBA 3FR0A 2BE3A 4JAVA 4YXWG 4FM2A 2GV9A 1GKFA 2GBZA 4Q5VA 1QSSA 3CJ1A 4DV6O 5KHJA 5BR8O 5H1SQ 4FJMA 3E22A 4LCUC 1SUQA 3VA3A 3VR8A 4X66B 3V9WA 1RUI4 3M6GA 3ZCMA 3TSUA 5C0YA 2AZ0A 3TAPA 2WFBA 3LDDA 5JVDB 1CEZA 4O4HB 1EFRG 3K9JA 4AHRA 1S77D 3ZX0A 4AH9A 3K57A 3MWPA 1R084 3ZRWB 1ZLZA 3TAMA 4Y1DA 4NXNB 4O8UA 3QFPA 2UUCO 1NOZA 3NBPA 5JLFA 4PY5A 3L73H 1KXPA 2E88A 3P31A 4YY3O 1ZWIC 3ABUA 3E66A 3NF9A 3QINA 3ZSXA 4LFBB 3VA0A 3P3PA 4DFJA 4JYAB 1ASWA 3WEEA 3CXCM 2PUSA 4DV4K 2H3OA 1FW6A 3FAVA 4DWIA 4O5BA 4IIJB 2QM1A 1JJ2M 1AR84 3AEDA 3THOA 4CESA 1IBLK 4H0OA 3WXLA 5KX5B 1QS4A 5DM6V 1RMU4 5AZIA 4GX5A 3CXCU 4Q4V4 3AEIA 3N2KA 4DV2K 1RCHA 4CK3A 1T5EA 4BC2A 3TAQA 2C2AA 3BABA 3WB0A 1EXQA 1IBKB 4ICLA 1N36K 3MK6A 2ZT9B 2GDSA 1SETA 1ZC6A 5HRSA 4GV6A 3AARA 3JSLA 4IJNA 5CY4A 1XILA 1PP9H 1N33B 4QPKA 1ZP0A 4JNEA 3AK2A 1NCQD 3DOKA 4DV3K 4BRIA 4WQ4A 4IDKA 4XH1A 3PSIA 3TXSA 1VQ8N 4FJCC 1F51A 3MXJA 2YHAA 5EX5A 4MVQA 1AJPA 4CJRA 1J95A 1VHXA 2IS3A 2UUBO 3QNNA 1VBA4 3RRGA 3IRXA 3JAKB 1KYOF 1PM9A 1RM1B 3LAKA 1AP6A 4DFKA 1T7PA 2QSAA 3VQQA 1R59O 4DR1O 4BC5A 2ADPA 1D4M4 4O8KA 1SQXH 3M8SA 5C2TA 1K4CC 2F9WA 5A2QN 4ZI7A 3VGLA 1EX4A 1E4GT 4CFCA 4F2RA 2WC9A 2A79B 2DFFA 4YOUA 4CC5A 3UO3A 3H08A 4CJKA 1XMQO 1VQKN 2CGLA 1O13A 2I7NA 1HRV4 3D2FB 1N8RW 2NRWA 2FSNA 3WXJA 2F95B 4WFAL 5AQQA 5CA0A 2Q31A 1BSMA 2YIBA 3RBZA 1Z7S4 3LL3A 3LNNA 4NYKA 2OPRA 4LF9K 1PL4A 4H0PA 3BFRA 3EO3A 3SJBC 4FZ1A 2IJIA 3M3ZA 2HNYA 3HPGA 2K9PA 3HSTB 4QE9A 1C0UA 3VEXA 3F2KA 1MQTD 2ZE7A 3DXKB 1HKGA 2H94A 3SK3A 4CEEA 4DUZO 1OHHG 2ZIOA 3DWLA 3NF7A 4B8AB 3FE1A 3CCEN 4JI4O 2DPNA 2JVDA 3J81N 1VSMA 1RT4A 3ABTA 4CK1A 1WBBA 1YXQA 4U67L 4NTWA 3SGIA 2X6BA 3SPGA 1LWEA 3VRBA 4PD4F 4ASUG 3IJ4A 4JI7O 3KHYA 3L4QA 4CJVA 3DXRA 3CCJN 1NKDA 4NVPA 2YIAA 4O4LB 3EYZA 1Q82W 3J8AA 2Z3YA 1C6VA 5I9EB 4QJFB 3F9KA 2FB5A 4BWMA 3QERA 4EB6A 4K25A 4M7XA 4BDZA 3BHPA 3JATA 4H5RA 2ZGZA 2R074 5LXTA 3L2WA 4BY9C 2F93B 1LW0A 1SV5A 3MECA 1SQFA 3VQ5A 4DTJA 4Z4FA 3W7XA 3OJUA 1VQ6N 3FZFA 1KMIZ 3NHGA 2QGNA 4X9QA 3I55V 2OCEA 1BA1A 3THXB 2UUAB 1K33A 2YXHA 4OGCA 3SYCA 2ODMA 5IJ9B 2NR5A 4KI4A 3OAAG 5J2TA 2VQFO 3KCXA 4B1VA 2OTJV 4DV1K 1NVPB 1BISA 3X2QB 2E74B 3THWB 1SAZA 1ZYQA 1VMGA 3ENBA 3CIRA 4BW9A 1G4YB 4DV2O 4E1MA 4L8JA
chains in the Genus database with same CATH topology
4X1IB 1JLGA 3AO1A 3AVGA 3OYJA 3N2GA 1WSFA 4DK1A 4YJ3B 1S1XA 1Y97A 3C6TA 1HRHA 2YIBD 2XHBA 4M3RA 4CFAA 4O0JA 1HNZB 1WSIA 4LH6A 2HB5A 4ZOLB 5KGWA 1HNXB 3QEPA 2R72A 1HYZA 4CGHA 3SZ2A 4FFBA 4KV8A 3DSQA 1JXEA 4FJKA 5JS1A 2Y1JA 1U04A 4X1KB 4DSEA 2DTUA 5LMNB 4CEAA 4LFCB 4DF8A 1RT6A 5GONB 1RBTA 2OPQA 4DSIA 5C8YB 3C94A 4DU3A 2KZMA 4JI3B 4B08A 1UWBA 4CGIA 2HHHB 3AVCA 1EP4A 1YT3A 3PUFA 3AVFA 2CAZC 1NJYA 4LNUB 5CB4A 4F6RA 1UA0A 2D0BA 4CH4A 3TAEA 3K2PA 2ZCEA 2HHXA 4FCYA 4LF5B 4O2AA 4AHVA 1TKZA 4Q0BA 2R9AA 2HW3A 2E5LB 2KKWA 4H8KA 3WNFA 3ETQA 3SPYA 1YTUA 5LP6A 2G8IA 1Z26A 3BPZA 4DTRA 4FZYA 5FPRA 5J2QA 1RT2A 1F21A 1XMOB 4CJWA 4O0IA 5JH7A 1WLJA 1JFFB 4DU1A 3V1OA 4CF8A 3FFIA 1Q9XA 4BWAA 2RQ6A 4GKJB 4ID5A 4E7LA 1HW7A 3DLRA 3NH0A 4J2BA 3HKEA 3VQYA 1GOCA 2OWOA 1VSJA 5LP6B 3U11A 2HHTA 3IG1A 3PX6A 1S9EA 4BDYA 2RF2A 3JARB 4O2AB 3OVNA 4ZTFA 3SPZA 1N32B 1SKWA 3SUNA 2PY5A 1WNSA 2F4VB 4LH4A 3OY9A 5CB4B 4I55B 2D0AA 2A1RA 2VG5A 3ZSWA 4OKKA 1WSGA 1A5VA 4FJGA 3K5LA 1FFXA 1SKVA 2G8UA 5LP6C 4YY3B 4FLUA 5J2UB 4GKKB 5GONA 5J2UA 1TAUA 1KVBA 4E1NA 3ZS8C 4B9SA 5LYJA 4X1KA 3OYEA 1FFXB 4C8MA 4DTXA 1ASUA 1B92A 4PUOA 4KTQA 5D3GA 2QK9A 2XY5A 4IFVA 3AA2A 4B9LA 2Z1HA 4B9UA 1RBVA 2QKKA 4CJUA 4FK2A 3O4NA 4DQRA 4B8CA 1JL2A 4LSLA 1HYSA 3O3HA 1NK7A 3QLHA 4RW4A 1KTQA 3SQ0A 3HKBA 3T1AA 4X20B 3JASB 2YI8A 3RWRD 2OPSA 3MEEA 1RBRA 2FBTA 3B6OA 3DI6A 4TUYB 3E01A 4X64B 3HVTA 4FJLA 3TR8A 3RYHB 5LXTB 4B9MA 4OKEA 4CGDA 2ZD1A 2YV0X 3OYKA 3RYFB 3AO2A 4O55A 4E7IA 1C0TA 1KSPA 4DR7B 4M3XA 4CCHA 1ZBUA 4HNAA 3RYCA 1WSJA 2E6LA 1RTDA 3L2VA 1HQUA 2D0CA 1C1AA 3V9SA 4FK4A 4X65B 4ELVA 1Q9YA 2PGGA 4J2EA 3HPOA 1IKVA 4I9QA 4DLGA 5HRRA 4HHTA 4DTNA 4LD0A 4K8XA 4DTPA 3ZT1A 4ZI7B 3KTQA 4CIFA 3HPHA 4DUZB 2F8SA 3SQ1A 1NK9A 1A5XA 3SV3A 4MFBA 4FFBB 4CS3A 4CJFA 4R5PA 3CM6A 4GW6A 3P1GA 4F3TA 3I0RA 3HKDB 3ICXA 1SA0A 4EP5A 5KX5A 5FRNA 4O4IA 5J2MA 3DMJA 5BMVA 4F8RA 2X74A 4KPYA 4JI1B 1U47A 1JLEA 3N2GB 1RILA 4DV6B 4TV8B 3QESA 3NH1A 4TQFA 3L8BA 4DSJA 5J2PA 4JI6B 3B2EE 2E6MA 1LAVA 1YVUA 2JGUA 1IKWA 2IDOA 1TUBA 3LPUA 3M8QA 3JATB 4OPJA 1HR0B 1T05A 2ZINA 2XY6A 3U10A 4FJXA 4DSKA 4EZ9A 5KMGA 3NGZA 3SJJA 2XO7A 2KFZA 4KO0A 4CS2A 1R0AA 1KVCA 4BE0A 4DTSA 3PV8A 1RT3A 1TKXA 1RDCA 2Q7EA 3T1YB 4CEDA 4FJJA 4DG1A 1NJWA 5FNVB 4M3YA 4JRQA 4D7SA 4CJQA 1RT1A 3K5OA 4CF0A 4CHNA 3TAGA 5CA0B 1BI4B 1O1WA 1FKOA 4FLXA 2YNGA 1O9GA 3ZSYA 5SZTA 3VQWA 2P51A 4DUYB 3LALA 3TI0A 2BE2A 1JLQA 3KLGA 4IHJA 3ULDA 2IM9A 1XHZA 2ZQBA 3ZSZA 4JS5A 1V9PA 4JI2B 4B3MB 1CXUA 1SL2A 4C8NA 3L3UA 4IHJB 4QOZB 4M42A 3SCXA 5KGXA 2Z1GA 4Q6GA 1VF7A 2WOMA 3AVKA 2JS5A 2KFNA 5JJNB 1TA8A 1L8DA 4OGEA 2HHQA 2I5JA 3HVRA 4LNUA 3S3OA 1U49A 4M3TA 1TAQA 4UCUA 4O4HA 2QXFA 4KTWA 1EETA 2X6SA 4HCCA 3SQ4A 3AA3A 2Q3SA 4CF1A 3AO3A 1N34B 5I42A 4ZHQA 3QETA 4CJEA 4U3JA 5KHIA 3VQ4A 4IFYA 1IBLB 2NUBA 3OS2A 3FFQA 1CZ9A 4CC6A 1N5YA 1WAJA 3NFAA 3QIPA 3M7MX 3OYHA 4I4TA 5C24A 4DQSA 4O4JA 2BTQB 1SL0A 4QAGA 1WPBA 1RDBA 1B9FA 4QCLA 4KHSA 1ZBFA 2F1MA 3CFOA 4CJ3A 4KHUA 3MAQA 4AQYB 3OYMA 1NT2B 5J2NA 1FK9A 4KRFA 4CGFA 4LF6B 1XNQB 2QM4A 3T3FA 3UT5B 4UCOA 1D9FA 1BCOA 4OLAA 3DOLA 1BQMA 3VQAA 4O4IB 1KVAA 4O2BA 1ZBLA 5HRPA 4HBNA 2ZM6B 5IJ9A 3F73A 4BWJA 3HKDA 3KK2A 4UCTA 5EZYA 4O44A 4FJNA 2D5RA 3NGYA 1MU2A 2B5JA 3OYLA 2XY8A 4EB6B 2ETJA 1BL3A 1TK0A 3EZ5A 1NK0A 3LDSA 4RW8A 4HUFA 1JL1A 3S9HA 3KLIA 4MQ3A 2G8KA 3KK3A 5EIBC 3L3VA 1W9HA 1QTMA 2UUCB 2X6NA 3U3GA 3M8RA 3S3MA 3P83D 4CIEA 4FVMA 5LA6A 5LA6B 1G6UA 1NJZA 4NYFA 4CJPA 1HMVA 5CA1B 3AVMA 3OYGA 5LOVB 4KHYA 4FLWA 3AVIA 3JAKA 5KRTA 3HP9A 3NAEA 3ZT2A 1LV5A 2VWJA 1JLCA 3WNEA 3HJFA 4DV4B 1U4BA 1NJXA 2RPIA 3CG7A 4AHCA 2G8FA 4F2SA 2JLEA 3HKBB 4WBNA 1IKYA 4KHPB 4CF2A 1HJRA 5J1EA 2P5GA 3LAMA 1BI4A 4RW7A 3DM2A 4IKFA 2OPPA 3AO4A 4PI0A 1RDDA 1I7FA 5ITZB 4W5RA 3OYIA 3CSXA 4YJ2B 3VQEA 4CECA 3JYTA 4JV5B 2P5OA 4GLXA 1JLFA 4LFAB 2F96A 3C95A 4JRPA 1RTHA 4B3SB 4KTZA 5D5PA 4CGJA 2O4GA 4NYNA 1TK5A 5JQGA 4CEFA 5JQGB 4U3JB 3SR2C 1Z5WA 3SJCC 4F3OA 2W42A 3SUQA 4CK2A 1C1BA 5JCOC 2HVHA 2BGGA 3WB1A 4OVLA 3SI6A 5HLFA 1M93A 4PWDA 3OS1A 1Q43A 3K5NA 2YNIA 2DFEA 4NXMB 2A1SA 1C1CA 4H4MA 2EHGA 4Z4GA 4B3TB 2UXCB 1T8EA 4BDPA 1L3TA 1WN7A 5BMVB 5IYZB 4JI4B 4OX9B 3RWUA 3OJSA 4K8ZA 2YNFA 1J5EB 1B9DA 4CJ5A 1J9AA 4G1QA 3AVNA 2FBXA 5KI6A 3MXIA 3QIOA 2XRIA 1NK8A 4PI2A 3DLGA 4TV9A 4M3UA 1Q3EA 2V4DA 3QEIA 4Z4CA 4E3SA 1BCMA 1L5UA 3JSMA 2PYJA 4GMJB 2RKIA 4CJLA 1BIUA 2HNDA 3BRCA 4CH6A 3HT3A 3V9XA 1TL1A 4BE2A 3SJAC 1LAWA 2XY7A 3RYCB 4HNAB 3T1HB 4DV5B 1B04A 1FXXA 4N5SA 4ELTA 3CYMA 3RFRA 1KFSA 3KLEA 3ZT4A 5KMGB 4CEQA 4DS4A 3OTOB 4ZTJA 4LF7B 1BHLA 2DFHA 1J54A 3QEWA 2FBVA 3NE6A 3KLHA 1EKEA 4W5OA 4H4OA 2B6AA 1RBUA 3ZSRA 3MXMA 4ZIBA 1CLQA 4JI5B 5EZYB 3QEXA 5C42A 2KTQA 3NCIA 3BAAA 1VK0A 3JASA 1DGSA 4X20A 3OTFA 4OJRA 3JAWA 2PYLA 4DTUA 3PX0A 1KLMA 2R70A 3VQCA 3KD5E 2HHSA 4M41A 4GVMA 2Q7GA 3SV4A 2UU9B 2PW9A 4CS4A 4CJ4A 2HEPA 3CB2A 3RMBA 5IWAB 4DR2B 2B4JA 4I50B 4AHTA 2OZSA 4YNQA 4FJ5A 3CM5A 3JSNA 3U6FA 1NOYA 4DR5B 4FW2A 4CE9A 1X1PA 1S5JA 4EFBA 3LWLA 1U45A 4O4JB 4FJ9A 4NCAA 3QTCA 4X1IA 1TVKA 1WSEA 4CHPA 3JAWB 4F4KA 4DRXA 5JJEB 1ZBIA 5LYJB 4ZHRA 4LR3A 4D7TA 1VRUA 4FJ8A 3LP3A 1FJGB 3SYZA 4I2QA 3IS9A 4DR1B 2P22C 1VSLA 1J53A 3RTVA 4TOIA 4X1YB 4DQQA 4Z4IA 1XQ8A 1IBMB 3VQ7A 5CZ2A 1KLNA 2VWKA 4J2DA 2IC3A 1RT7A 2YHBA 2DY4A 2IGIA 4M3WA 4FJIA 3SUOA 3MEGA 4CHQA 3BA8A 4DSFA 3DLHA 4HCBA 3QG5A 1XC9A 3C6UA 1T03A 1VSKA 3JARA 1RBSA 3KIOA 4I7FA 4CJTA 1Q5OA 3EY1A 3PO4A 3DRRA 4JI7B 3V1QA 4L8RB 2YNHA 2Q7HA 4KHWA 1KCFA 2ATQA 4KAZA 5JJJB 3HKEB 4OLBA 5KHKA 3RYHA 3K5MA 3AV9A 4UCRA 1VSDA 3UIQA 3OYCA 4E89A 3K59A 3AO5A 4JI8B 4TV9B 1REVA 3TWHA 3QEVA 3TAFA 4CERA 4NCBA 2E3CA 4DV2B 3VQVA 4FM1A 4FXDA 1SQGA 4IG3A 4PQUA 3S3NA 3VN5A 5IYZA 4OKJA 4Z0UA 5EIBD 4C8KA 4FLVA 4DTMA 3WNHA 5D5QA 1WSHA 3AVBA 5JVDA 1JLAA 4X1YA 1TUBB 5C8YA 3E22B 4E7KA 1HNWB 3HK2A 1O9HA 2PTMA 1TL3A 1N6QA 3ZEDA 1SKRA 3PY8A 1DTTA 4W5NA 4BACA 1D9DA 2G8HA 3LP2A 4KREA 3LPTA 1HNIA 4HTUA 2YKMA 4N41A 4YFUA 4ZOLA 1XNRB 4GYCB 4EP4A 3KKRA 4DV3B 1M5IA 4Z4HA 4I50A 3PN1A 1S6QA 1S9GA 3BA9A 4DR3B 1RTJA 3HKCB 2HVIA 1QQCA 1SL1A 4Z4EA 4LH5A 2GUIA 1QE1A 1S1TA 4CH5A 1ITGA 3LP0A 4AHSA 3V1RA 3VQBA 5HROA 3LP1A 3OYDA 4CHYA 5HBMA 4KHQA 3K58A 3HXMA 1GOAA 1K6YA 1TV6A 1BQNA 1JFFA 3ZT3A 3AVHA 3NDKA 4UFZA 3OYNA 3RRHA 1NK4A 1P49A 2Z1JA 3NGIA 3L2UA 1LWFA 1DLOA 3RR7A 1YEWA 4TQDA 4FM0A 2QKBA 5EYPA 1KFDA 1KU9A 2KQ2A 4FYDA 1ASVA 1S6PA 1D5AA 3I8DA 5K1PA 2ZIMA 4O4LA 4LY7A 3L2QA 4W5TA 1XI1A 3V4IA 5CYQA 2RJZA 4CHOA 3LZIA 5CA1A 1RNHA 3TARA 3V81A 1IO2A 1QHTA 2VQEB 1RTIA 4N56A 2G8WA 5C25A 3DYAA 1TAEA 1NK6A 4ID1A 4DK0A 3AVJA 1BIZA 3RGBA 5FPOA 1IG9A 2Y1IA 4KKOA 1D8YA 4CEZA 1I39A 5EYPB 3A2FA 3SUPA 1Z5VA 4HUGA 1SKSA 4Y1CA 5LMUB 2KZZA 1HQEA 3DRPA 4DRXB 3JALA 5K14A 3ZSVA 2OYQA