2EX3A

Bacteriophage phi29 dna polymerase bound to terminal protein
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
570
structure length
570
Chain Sequence
RKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The phi29 DNA polymerase:protein-primer structure suggests a model for the initiation to elongation transition
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transferase/replication
molecule keywords DNA polymerase
total genus 150
structure length 570
sequence length 570
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2005-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2ex3A04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ex3A01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2ex3A03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2ex3A02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2ex3A05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2ex3A06
3KD1E 3AO3A 2OZSA 1SL0A 1JLEA 3EY1A 4RW8A 3DLBA 1W0HA 3SYZA 4K8ZA 4PWDA 3HK2A 5KGWA 3VQPA 3VQ8A 3HM9A 1C1CA 2VG7A 1U45A 3LPUA 3MEDA 3JYTA 1LV5A 3T3FA 4Z4EA 4NCGA 3PX6A 4DTUA 4DSIA 2W42A 4CJ4A 4BWJA 1SL1A 3AV9A 2IAJA 2HNZA 4CHZA 4CJSA 3THVA 4CHYA 2ETJA 1HMVA 1JL2A 1JXBA 1Q8IA 3QLHA 4DSFA 1SKSA 4J2AA 3RTVA 2IDOA 1XHXA 2HVHA 1HQUA 3HPGA 2ZE2A 4CJVA 3C6TA 3L3UA 1L3SA 4J2BA 2HHSA 3QESA 3M8RA 1SKRA 1WAFA 5C24A 3RR8A 2HHWA 4LD0A 1N5YA 1CXQA 3HP6A 4O4GA 1RTHA 3VN5A 3QNNA 3TWHA 1U4BA 2KZMA 3D0PA 4CEBA 3TABA 1UA1A 3RMAA 2YNFA 4FJXA 1TKTA 4FLZA 1UWBA 4OKEA 3SNNA 1A5XA 4IFYA 4M3XA 2FBYA 4AH9A 4N76A 1XC9A 1RT7A 3LPTA 4HUFA 3OYJA 2RPIA 3AA3A 5KRTA 4K8XA 4CJFA 4DTNA 3QEIA 3SPZA 4C8KA 3K5NA 2D0AA 1XWLA 1UA0A 3TR8A 1U04A 1BI4A 1C0TA 1RBVA 3M8SA 1NJWA 3G10A 4KO0A 2VG6A 3ISNC 1RT6A 5FDLA 3NGIA 3V9UA 1WSHA 2KQ2A 1LW0A 4M3RA 3SI6A 4CF8A 4F3OA 2XY8A 4HUEA 2A1SA 4FJMA 5FRMA 4B3OA 3T19A 4CEFA 1X1PA 3HO1A 4DMNA 4CFBA 4CJ5A 1TGOA 4N5SA 1VSIA 1QS4A 4KTQA 1Z25A 5HRSA 3KLHA 4AILC 3VQ7A 3ZSZA 4YNQA 1RT2A 1TL1A 4DFJA 3B6PA 3ZCMA 1A5VA 2P5OA 5HROA 1X9WA 4FVMA 2VWJA 1RDAA 4E1MA 1YTUA 1ASWA 1SUQA 2HB5A 3ZSVA 1GOBA 3S3NA 3V1OA 3K5MA 4E89A 1ASUA 1EP4A 4M3ZA 4E19A 3O3FA 2AJQA 3L3VA 3P1GA 4OKJA 1HNVA 4KV8A 2O4GA 1TAQA 4Y1DA 4AHCA 3OYBA 3CYMA 4HTUA 3TI0A 1RT1A 3F73A 3HVTA 4E3SA 1RCHA 3DMJA 3ZT4A 5SZTA 3EZ5A 4C8LA 3U3YA 4MFBA 4M42A 4CJLA 1L3VA 2G8KA 3V9SA 2DY4A 3OYLA 4KTWA 3LALA 2Z1GA 1BQNA 1GOAA 3PUFA 1BL3A 5C42A 2G8FA 1ZBIA 3V9ZA 1BIZA 4PQUA 4JS4A 2I5JA 4LH4A 4BE0A 4IG3A 2YNHA 4BE1A 3CG7A 1QHTA 3AVCA 4I9QA 3O4QA 3ZSQA 3KTQA 4OGEA 4DFMA 3ALYA 1JL1A 3IS9A 5CZ2A 3TAFA 2BGGA 4FJLA 3NH2A 2YNGA 4OGCA 1S1UA 2DFHA 2HHTA 3OYGA 1N6QA 4DQSA 4FK2A 4OLAA 4CIFA 1HYSA 1S1WA 3VQQA 3K57A 3BGRA 2IOCA 4DFKA 3OYCA 3QEVA 1C6VA 1NK5A 4L8RB 4FZYA 3C94A 4KHWA 4CEEA 5I3UA 1ZBLA 3TAQA 2HHUA 3QIPA 3QIOA 4CJUA 3OJSA 3AVLA 3OYKA 4HHTA 1RNHA 2FBTA 3AVIA 4NYNA 3SQ2A 1T8EA 1WN7A 4FXDA 1JLQA 3AVKA 3MEGA 1UOCA 4QOZB 3PO5A 1KFSA 4M3WA 3QEWA 3SZ2A 3DLRA 2G8IA 3KLEA 3OYMA 3DRSA 1YT3A 4WE1A 3NHGA 1RBRA 1TKZA 3L2UA 1IKXA 2WONA 3O3GA 3OYEA 4B9MA 1BHLA 1D9DA 1HPZA 4FW1A 3I0SA 1S1TA 4ZTJA 4BDPA 3DRPA 4KRFA 4OPJA 2P51A 5DMRA 3ZT2A 4QCLA 5J2QA 2EX3A 1TAUA 3ULDA 3K5OA 1YTAA 3SPYA 4CESA 1BIUA 3S3OA 4I2PA 1DLOA 3SV3A 3LP3A 2Q3SA 3QO9A 3ASMA 4KI6A 1NK0A 2F8SA 2HVIA 4CGFA 3OYAA 3AVHA 1BISA 2QKBA 3K58A 2GUIA 2GV9A 3AA4A 3LZIA 3OY9A 2QKKA 4B9SA 3RMCA 4Z4IA 4W5NA 2XY5A 3PY8A 4O55A 4BE2A 2JLEA 3AA2A 4CIEA 4JRQA 4KPYA 1J9AA 1RT4A 1DTTA 1WSFA 1VRUA 3LWLA 3VA0A 3BDPA 2OYQA 3WNFA 5J2NA 2G8HA 1ZBHA 1TL3A 4AHRA 3VQBA 2XHBA 2OPPA 3P5JA 3VQDA 3KLGA 4IBNA 3SUPA 4RW4A 4N41A 4KAZA 3SUOA 4KREA 4DG1A 4JS5A 4CGHA 3O3HA 3MXMA 1TV6A 4CFDA 2D0BA 2Z1JA 1NK4A 1C0MA 2HW3A 4IDKA 2Z1HA 1S9GA 4CF9A 1NK6A 3KK2A 2FBXA 4E1NA 4OJRA 2YHAA 4W5TA 4FLYA 2RF2A 5CYQA 4Z4CA 3SUQA 4DF4A 3AO2A 1KTQA 5HRRA 4KHNA 3TAPA 4CJEA 1VSHA 3TAEA 3FI7A 3ITHA 5HLFA 5EU7A 1NJZA 2XO7A 4FLTA 1C1AA 3NF6A 3LP1A 4DFPA 3VA3A 1U47A 4CK2A 4EP4A 4CK3A 3OYFA 4LSNA 5JS1A 1KVBA 3AO4A 3NF9A 4H4MA 3NGZA 1S6PA 4C8MA 4CF0A 2P1JA 4E7HA 1YVUA 4ELVA 3OYIA 1LWFA 1TK8A 1B92A 1VSEA 1WLJA 3U6FA 1RT3A 2OA8A 1RDCA 3S3MA 4N56A 2HHQA 3CFOA 3VQ4A 2ZQBA 3DLEA 1ZYQA 2R7YA 1D9FA 2IC3A 4KFBA 4DTOA 3L2RA 4AHTA 2X78A 1WSGA 4W5QA 4CJWA 4W5OA 1IG9A 4FZXC 4CJ3A 1A5WA 1UAXA 3LAKA 4RW7A 4CEOA 1NK9A 1LW2A 2YNIA 4ID1A 1IO2A 2QXFA 1TKXA 4CECA 1SL2A 4CHOA 4CCHA 1W9HA 1NKBA 2PYLA 1XHZA 4CGDA 5HP1A 2FC0A 4CGJA 3I8DA 1T03A 4B9TA 3M8PA 2NUBA 2HHVA 3HXMA 1S1VA 4B9VA 1BCMA 3NCIA 4DU4A 2HNYA 2F96A 1WSEA 3RMDA 4CJPA 1BQMA 2O4IA 1U49A 1CLQA 4RW6A 4DQQA 3ZT0A 1T05A 3TANA 4ELTA 1HQEA 3HT3A 3CM6A 4G1QA 4Z4FA 3ZT1A 4C8OA 5KTQA 5T7BA 3ZSRA 4EZ9A 3AVJA 1D5AA 3KK1A 2OPQA 4FJ5A 2XY6A 5FROA 2XY7A 4CHQA 1SKWA 1KLNA 1QSLA 4LY7A 3DOLA 3H08A 2PYJA 4DQIA 1O1WA 3AO1A 4R5PA 1GOCA 1LAWA 3AO5A 4FLUA 4HUGA 4J2EA 1HYVA 1J53A 2D0CA 1VSDA 3V1RA 1L3TA 3K2PA 4FM0A 3OJUA 3DLGA 4DTRA 1ASVA 4I7FA 4BDZA 2VG5A 4KHQA 4IFVA 3K5LA 4B8CA 1TVRA 3L2VA 3NE6A 4CFCA 3PX4A 1IKWA 1RBUA 1HYZA 2G8WA 4UQGA 3JSMA 3E01A 3NBPA 4CIGA 1X9SA 4FK0A 2A1RA 4BWMA 1Y97A 5CY4A 3WNEA 5I42A 4DSKA 1VSLA 5K14A 4Q5VA 3NDKA 3RRGA 1EKEA 1L3UA 3CFRA 4HCBA 2Y1JA 3OS0A 4N47A 3SQ4A 3SQ1A 3O4NA 2KTQA 4OPKA 3HP9A 2BANA 4HVJA 4KB0A 1QSSA 4F2RA 1REVA 4F3TA 3HPHA 4CERA 2WOMA 2E6MA 3KD5E 4AHVA 4YFUA 3AA5X 3VQ5A 1VRTA 3SCXA 1VK0A 1MU2A 4OVLA 4Z4GA 1J54A 3LANA 3VQCA 1NOYA 3RMBA 1NKCA 1WNSA 1HJRA 4NYFA 1J5OA 2B4JA 5SWMA 4Z0UA 4CHPA 4CK1A 4CF2A 3D45A 3F9KA 4CFAA 3CFPA 4W5RA 1Z26A 3CQ8A 3OYHA 4DTJA 4ELUA 4GVMA 4OKKA 4RW9A 4FM1A 4CEQA 2YHBA 3RWUA 2OPSA 4FM2A 4CGGA 3L8BA 2RKIA 4KHYA 2R7FA 5JS2A 3WNGA 1T7PA 1K6YA 2Z1IA 1LWCA 2B5JA 3HPOA 2OPRA 5HBMA 4CGIA 5J2PA 3LWMA 1CXUA 1KVAA 3DM2A 2PZSA 2RN2A 2E6LA 3NF7A 1KRPA 2GBZA 3TARA 3WNHA 4J2DA 3B6OA 1RTJA 2PW9A 3RR7A 1CZBA 4FJGA 1NOZA 2Y1IA 2YKMA 1I39A 4FJIA 1B9FA 2B6AA 3KKRA 5FRNA 5CZ1A 3VQ9A 4M3UA 4M3YA 3SV4A 4KB1A 1RBTA 3C6UA 3V4IA 3QEXA 3KK3A 3SUNA 3K59A 3MEEA 4FJ9A 2HHXA 3AVMA 1FK9A 3KLFA 2HMIA 3C95A 4F2SA 4KHUA 1HRHA 3A2FA 1BI4B 3V9WA 1KLMA 3KLIA 4CJQA 3QNOA 3SQ0A 1NJXA 4DQPA 3IAYA 3OVNA 4RG8A 5HRNA 4CF1A 4FJ7A 4B9UA 3AVBA 1EX4A 1VSMA 4GW6A 3LZJA 4JLHA 2G8UA 3NH1A 1QSYA 1B9DA 4DQRA 4GMJB 4M45A 2P5GA 2DFEA 2IS3A 3HL8A 4DLEA 1L5UA 1FKPA 1ZBUA 4O0JA 3AVGA 3VQ6A 4CE9A 3SJJA 1VSKA 5KRSA 3T1AA 3HYFA 5E41A 4E0DA 1IKVA 1KCFA 4B9LA 2F8TA 3NH0A 4DS5A 1WAJA 4F4KA 3VQAA 4OLBA 4NCAA 3V6DA 4JRPA 3ZSWA 3ZSYA 4F8RA 2HNDA 4FK4A 4FLVA 4FLXA 1U48A 3LDSA 4QAGA 4KTZA 4MQ3A 5KI6A 3V9XA 3QEPA 4FLWA 4O44A 4IG0A 2E4LA 2ZD1A 3DI6A 4DU1A 4FZZA 3HSTB 1S5JA 3FFIA 4BDYA 1KSPA 3NF8A 5D3GA 1LWEA 4O0IA 1NK7A 3NFAA 1WSIA 4PA1A 5HRPA 4HCCA 1RDBA 1KFDA 4H4OA 4FYDA 3S9HA 3PX0A 2X6SA 1XI1A 3QETA 3ZSXA 2DTUA 3PV8A 1CZ9A 1BGXT 1EETA 1S6QA 2DFFA 3AVFA 5KGXA 3OYDA 2G8VA 4E7LA 2PY5A 1G15A 4FCYA 4DWIA 2VWKA 4ICLA 3IG1A 3OYNA 1JXEA 4DLGA 4FJNA 1JLFA 4CEDA 1IKYA 3LAMA 1X9MA 1TK0A 1Q9XA 1BCOA 1I3AA 1WSJA 2BE2A 4LSLA 1FXXA 4M3TA 2OZMA 2ATQA 1RDDA 1JLGA 3M8QA 2KFZA 3AVNA 3OS1A 1JLCA 1ITGA 1D8YA 4BACA 3MAQA 1S9EA 1VSFA 2XRIA 5CYMA 3TAGA 3V81A 3ZSOA 3RRHA 3L2QA 2ITGA 3IRXA 3P83D 4PUOA 2JGUA 4H8KA 4AHUA 1F21A 1LAVA 1S1XA 3AVAA 3DYAA 3LP2A 4E7IA 4FJHA 4ZHRA 4I2QA 4CJKA 4I9LA 2EHGA 3QINA 4KI4A 4PY5A 4B8AB 3I0RA 1VSJA 4DSJA 3MXIA 2X6NA 1RT5A 3G0ZA 3MECA 2IGIA 4XIUA 2YV0X 3U3GA 2KZZA 1HNIA 3DLKA 4B08A 4FJKA 1RTIA 4EZ6A 4DF8A 4ZTFA 3KIOA 1NJYA 3VQEA 4CEZA 1QE1A 1JLBA 3HVRA 4Q0BA 1JKHA 5C25A 2D5RA 4FW2A 3KJVA 4E7KA 4M41A 4ID5A 1RTDA 2KFNA 4DTXA 5J2MA 4Y1CA 4O5BA 3UIQA 1RBSA 3PO4A 3QERA 1EXQA 1TKDA 3CM5A 4FJ8A 1DTQA 5J1EA 4DTPA 1QTMA 4DU3A 1QQCA 1Q9YA 4DS4A 1JLAA 3L2WA 1C0UA 3DLHA 3MXJA 4IKFA 4AHSA 4C8NA 3OS2A 2X74A 4NCBA 1RILA 1FKOA 4CHNA 1KVCA 4B9NA 3KKSA 3NGYA 4KKOA 4CEAA 4CJTA 4DSEA 3LP0A 2YKNA 2BDPA 3DOKA 4LH5A 4DTSA 4DTMA 4E7JA 1ZBFA 4TSXA 1IH7A 2KW4A 2LSNA 1R0AA 2QK9A 3V1QA 4DSLA 1NKEA 3TAMA 3EYZA 3DRRA 2FBVA 1NK8A 1SV5A 1TK5A 4FJJA 4KHSA 5DK5A 4Z4HA 3HJFA 1C1BA 4EP5A 4CJRA 3NAEA 3ZT3A
chains in the Genus database with same CATH superfamily
3PIPL 1YQ4A 4LFBK 1NR1A 2CTQA 3EY1A 3DLBA 2WLMA 1FXHA 1NTKH 1IBLK 3ZN1A 4Z1VA 5HOOA 4E4EA 5FPMA 5KGWA 3CRRA 2VG7A 3JD1A 4FOEA 3D2FB 4R6ZA 3CJCA 4CJ4A 4BWJA 2Q67A 4CHZA 4H37A 3Q7BA 3VETA 3EEQA 3ZCCA 3CCRV 5I9EB 1I94B 1BS3A 4DR1B 3QLHA 5A9GA 3RTVA 4JK7A 2QWQB 3C90A 1HQUA 3HPGA 4CJVA 1SKRA 3RVYA 5GIOA 2QEXV 3UKRB 3OEEG 4J9YB 4O4GA 1U4BA 4U7OA 1AR5A 1Z2GA 4ZI7A 3HRGA 4JKGA 3D0PA 4OX9B 4NXNK 4IEIA 1TKTA 1UWBA 3H01A 4LC9B 1N32K 4PA7A 4B3TK 2FBYA 3WEEB 3CCJN 3H3NO 2ASOA 1AI6A 5EC1C 3LPTA 2O8BB 3OYJA 2X6BA 1NVPD 2P6JA 2XNDG 4K8XA 1EWRA 1I5XA 2F43G 3STLC 2D0AA 1QR8A 3C6AA 3CCLV 5JH7A 3FAVA 4W4LA 2OANA 2GTDA 3ZMSA 3E9PA 1ATNA 2F9TA 1NJWA 3G10A 4WQ5C 2EIJC 5LMUB 4DV5O 5FDLA 2WFBA 3OTOO 4YY3O 1VQ8N 3D7EO 2KQ2A 4JN4A 1H38A 2CGOA 1KFYA 4ZKIA 3I8BA 2W40A 3BF1A 1I94K 4MTXA 5HFMA 3X2QC 4DRXB 3HO1A 1HR0B 1OV9A 1JQ0A 1ROPA 1F7YA 1BU6O 4DR3O 1TGOA 5FNVB 4JI5B 4FWQA 1VSIA 1QS4A 3ZX2A 4N5SA 3BAAA 5CBHA 3KLHA 1XNQK 3B2EE 2WSSG 3VQ7A 2UUBK 4G9ZA 4JYAK 3B6PA 1A5VA 5HROA 2PUSA 4E1MA 2HB5A 4DUYK 2CK3G 2WQYA 3V1OA 3K5MA 4E89A 5IJ0B 4X62B 1EP4A 4M7XA 2PBDA 2RMU4 4E19A 4B3TB 1NNEA 4RHV4 2V7ZA 5IT9O 3HKCA 2HF4A 4DR6O 1NJIW 2O4GA 3OYBA 5C2FA 2O8DA 4JEPA 4QPJA 1KAZA 5AQYA 3DMJA 3ZT4A 1R1BA 5IWAO 4MFBA 1PIV4 3JAMN 2GELA 3OMNB 2G8KA 1QVFU 3OYLA 2BUPA 4KTWA 3LALA 2H3GX 3RWRD 2A7WA 4RUFA 3PUFA 5C42A 2G8FA 4RO2A 4BE0A 5GONB 1GLLO 4BE1A 4QS9A 1FAFA 3RYIB 1IXMA 4MS2A 3KTQA 2EINC 3A8YA 3G4SN 3LNNA 3WG7C 1GLAG 4O4IA 2KSDA 1ZAUA 3WQTA 1KXPA 2XAFA 4OGCA 4B3SO 3HKBB 3ICXA 4GKJO 1S1UA 5JLFA 1KKCA 5CBFA 1M90O 1M4UA 4RQEA 4JYBA 3ASNB 4X89A 1N34B 3KZIZ 3G6BA 4KP4A 3OYCA 4JNEA 1K3EA 4IGGA 3W7XA 3C6HA 1EWQA 3HKCB 1OCOB 3STZC 5IY5B 1ZBLA 3TAQA 3JARB 3FE1A 1Q6UA 5B3SC 1XUQA 3AVLA 3U8XA 4I9WA 5LOVA 1G1XB 5IJ9A 4FXDA 2ZXWC 1JLQA 3AVKA 2NLJC 4O4HA 2D0OA 4WYBA 3UCSC 5FNVA 2V51B 2VRZA 4BC4A 4O2BB 4JF3A 4HZ3A 4JI1K 4A2AA 4B1XB 3J81O 4DRXA 2HHHO 3H45C 1VQMN 3CXCU 1Q6IA 1FPOA 4IWVA 2HKOA 4C1NK 2X5ID 4TV9B 1S1TA 3F2KA 4BDPA 1V55C 4OPJA 5DMRA 3VEZA 3ZT2A 5J2QA 2EX3A 4K3AA 1YQ3A 3G25A 2XAHA 4I7ZB 3ULDA 2QE7G 4BY9C 3K5OA 3SPYA 4CESA 1BIUA 5JVDB 3CC7V 1SQVH 3O5BA 4DCHA 2Q3SA 4JTCB 3ASMA 3K06A 2ASMA 5LL6Y 2F8SA 5K1XA 1JJ2U 5KHJA 2O8FB 2WLIB 3RYCB 3FB8C 3K58A 3M3ZA 4Q4W4 5CE3A 2ZM6B 3LZIA 4B9SA 2YEVB 1VEWA 3CWBH 1NGDA 5C10A 2YXLA 1D4XA 1UFIA 3N2KB 5EBMC 4KPYA 3AE1A 1RT4A 1H2LA 1ZL8A 2EIMC 3WNFA 1MABG 4X1KA 3UO3A 1NGJA 3ENBA 1JX9A 1GLBG 2HEPA 1S3JA 3BHPA 2OPPA 3SUPA 4N41A 1R094 2CAZC 4MO5A 4JI8B 4X66B 2NRXA 1K9MO 5LXTB 4LFAO 2WLNA 1JVMA 1TV6A 4BR6A 1NK4A 3O1BA 3IGAC 2W0FC 1C0MA 2Z1HA 1X59A 4H44B 4FFBB 4OJRA 2ZJQL 1NCQD 1K5SA 1L0NH 4LP8A 1MG1A 2F66C 3WT0A 3IJ4A 2LGQA 4F6RB 4PHTX 3THYB 1NA1D 5HLFA 3FI7A 3CCVN 2HJFC 1EM1A 1H2KA 4DR3K 5EC2C 2M6YA 1RUC4 5JLHA 4FLTA 3LP1A 4JI5O 4QS7A 3CF5L 3VA3A 4MLHA 3CRQA 5JJEB 1HR0O 3EN9A 4LSNA 3OYFA 4JI7K 4WFGA 3RYFB 4H4MA 1P8ZA 1QQOA 3WXIA 3MK6A 3K04A 5ADXH 4G27B 3OTOK 4H0LB 2RR14 3VEYA 1PNKA 1WLJA 2OA8A 1BL8A 3WG7B 3S3MA 3OA9A 1W0JG 3DLEA 1J5EO 1B6QA 3R66A 5CR4A 1QHAA 1WSGA 2GUPA 2QTDA 2YHYA 1SZ2A 5F2VO 1YIJV 5KUMA 2R9AA 1UAXA 3DTUB 1LW2A 4ID1A 5JMVA 4CCHA 4YTMA 4CC6A 3LDPA 5EIBC 4O2AB 2YIBA 4B9TA 1VIBA 2DYSB 4UCUA 3DXRA 1KUQA 1P7GA 4QS8A 3HR0A 1BCMA 3TTDA 5BR8B 4JPRA 1EN4A 1Q81W 3VPZA 1AR64 3A5LC 2O4IA 1TA8A 1MMMA 3GVMA 2YHXA 2Q0UA 2YHWA 4U3JA 3KCXA 3ZT0A 3WFVA 4BRPA 1AROP 2P9UA 4G1QA 3HT3A 4Z4FA 3ZT1A 4C8OA 1I94O 4GYCB 2BSKA 3SPGA 5LGNA 3AVJA 4I6MA 3ZX3A 3N2GA 2OPQA 2Q68A 3KK1A 2XY6A 1N33K 4DW0A 1SKWA 2P9NB 4YY3K 2L35A 2LJ2A 4E2LA 1V55B 4LF7K 1RMU4 5B1AC 3K79A 4J2EA 2JRIA 4EIAA 1J53A 1DT9A 4U7BA 3K2PA 1BDGA 1XNRK 3DLGA 1M1KO 3AGRA 4P30A 2HVJC 1XMQO 2Y69C 1ASVA 1DGKN 4I7FA 5KPRA 2VG5A 4BDZA 4IFVA 4WFFA 3TSPA 4KHQA 5BRDA 3CS5A 2P9KB 4W4KA 1E1RG 1RBUA 1OH5A 1K8AO 1WPXA 1VQ5V 1OJHA 1U96A 3JSMA 3NBPA 3DXKA 4CIGA 2UU9O 1X9SA 4ABMA 4NXMB 1Y97A 4BWMA 3WNEA 4GCZA 3J7YP 4TV8A 5I42A 2FL4A 3DXMA 2LO1A 3CFRA 1FJGO 1WP7A 4YDUC 4QNHB 1Z6RA 3SQ1A 4LWSA 1OH8A 2IJJA 2GHYA 5BN8A 4TV9A 4BG8A 4L87A 2QWPA 2RE2A 1REVA 3SJHA 3HPHA 4CERA 1YJNV 2E6MA 3KD5E 3ETDA 4YFUA 1X4TA 3ID8A 4Z4GA 1M57B 1MU2A 4GVEA 4OVLA 3LANA 1VF5B 4CH6A 2FF6A 5KX5A 1RUH4 2RQ6A 4UCTA 4DV0O 1SA0A 5E1AC 5GTIZ 4ZBMA 2B4JA 3JALA 4KBOA 4CFAA 1JFFA 4MVOA 3CFPA 4BRIA 1Z26A 4DTJA 2NRRA 4PJ0Z 5ADXA 2OCCB 3OYHA 4DUZK 5FLXO 1NBWA 4DV6K 3J80O 4MSWC 1T7PA 2BTOA 1K6YA 2Z1IA 1LWCA 2ITMA 3HPOA 4KL1A 2UXBB 4NXMK 4GV3A 5AQGA 1IV0A 3NF7A 2E6LA 1K33A 4BREA 1HP8A 3TARA 3WNHA 4J2DA 1JR9A 3NXSA 1AR4A 1CZBA 2ZDIC 1YXQA 2RS54 2YIAA 1R3KC 2YKMA 3FZHA 3JATB 4J11A 5AQUA 4DYLA 4CS4A 5FRNA 3RYIA 3GDQA 2JEUA 4A62A 5LHHA 1VP7A 4KB1A 1RBTA 3ABLB 3GG4A 3SUNA 1AI4A 3IDHA 2IVOA 3MWPA 2MK3A 1RM1C 3C95A 3KLIA 4IOXA 4DV3B 2JJ1G 1B06A 5IYCO 4X65B 4CF1A 5HRNA 4FJ7A 4GW6A 3AG2B 4MVZA 3GE1A 3K0DA 4JLHA 4MVQA 5GADP 3PSIA 3NH1A 2G8UA 2F7TA 1V54B 2F1MA 4M45A 2IS3A 3HL8A 1L5UA 2DOSA 1N0NA 3JD74 2UXDK 2ZM6O 5KRSA 1R6TA 3AAPA 3Q7CA 1FW6A 3AEIA 1IKVA 2F8TA 4GLXA 3NH0A 1GAXA 4HTLA 5LA6B 2P9SA 2ZJPL 4LF5B 5E84A 1SERA 4YXWG 2JJ2G 2Q4PA 4WFHA 1MA1A 1HX1A 1H2SB 4BQZA 2QKAA 1U48A 2NR5A 1HUXA 2ASPA 3LDSA 1IBLO 5KPTA 1X9JA 2ZQMA 1MOFA 4MQ3A 5KI6A 4GKKO 4BR4A 3ZS8C 4DR2B 3LDEA 4DU1A 3OW2U 5HL7L 1OH6A 1KSPA 2DYSC 5M1PA 4H33A 3FYEB 4LF7O 1NK7A 1MNGA 5CB4A 4B3MK 3QBXA 3O9OA 1A32A 4WQ4A 2P4KA 2NZTA 2A6AA 1ZXOA 2NNUA 3SJQC 2IVPA 3ZSXA 4PL7A 2O8CB 1BGXT 1EETA 2DFFA 1R6NA 5LMNO 3TU5A 3JASB 5AJ3K 2G8VA 2PY5A 2HG5C 4FCYA 2QXLA 5CA3A 3FZFA 2HOEA 3VR8A 3VTIA 4BRKA 1Q9XA 3MN7A 1BCOA 1I3AA 4LSLA 3T2MA 3TTFA 1RSOA 3AVNA 1DLBA 2HHHB 1JLCA 1ITGA 1S5HC 2P9PB 5LMNK 4BACA 1VSFA 3JD4A 5CYMA 3TAGA 4F4LA 1GN3A 3P3PA 1AJQA 3AK2A 4KH6A 1RUF4 1F51A 3AG3C 3H1LH 1S1XA 3HZ6A 4JI6B 2NRWA 4NXMO 4JZ2A 4JI3B 1OCCC 4WQ4C 4H5VA 4ZHRA 1TUUA 2ZJRL 3E8FA 3F7VC 3B8MA 3P32A 3I0RA 4D6TH 4B8AB 3QO8A 3W0LA 2X6NA 4XIUA 3SGIA 2QWNB 1AR1B 5FPNA 3U3GA 2P9SB 2KKWA 4AI8A 2OCHA 4DKWA 3UB5A 4ZTFA 4UCRA 3JCZA 4ASUG 5KA6A 4LFBB 3KIOA 1NJYA 3ZJZA 1NI8A 4O8UA 1SS6A 2Q5ZA 2HBJA 4FW2A 3NVMA 4XBFA 1RTDA 4K0KO 2WS3A 1P49A 5J2MA 4Y1CA 4EAHD 1OOPD 4FJ8A 3HM8A 2E2PA 4DR3B 1LUWA 4I55B 3F9MA 3HSCA 3ZYYX 4DTPA 1Q9YA 5D5PA 3L2WA 1C0UA 1N0JA 2EJ7A 3VRBA 2FBWA 2Q36A 1Q6HA 2YIBD 4BW9A 1KVCA 3KKSA 5FL7G 1G4YB 1NZ6A 4PA4A 5DEDA 2QTOA 4I0XB 1Q86O 2BDPA 3I33A 4DTMA 1VF7A 4MDBA 1RUI4 4DR6B 1Y4MA 4X1IA 1SAZA 1R0AA 3E89A 3HB3B 2FBVA 3DRRA 4QIWF 5DK5A 1YJ9N 4KUMA 4X62O 4ELTA 3ZT3A 3P30A 3IKMA 4PWDA 4BRNA 2Q2RA 2OZSA 4UCOA 1JLEA 2GDSA 2QWNA 2ZIOA 1Z7S4 4PV1B 3ZIAG 4K8ZA 1J5EB 4RUEA 5CA0A 4CZJA 1IZ3A 1VMGA 1XL4A 2JK5C 3E2EA 2AGAA 2GTSA 1JFFB 4Q6GA 1C1CA 4KHPB 5LMUK 1QCEA 2FMLA 5J2UA 1KKDA 4DTUA 4Z1MG 3NVKA 4CJ7A 4CJSA 2IAJA 2HNZA 1ORQC 3CRCA 4JI2O 5H1SQ 1IJJA 1CPYA 4CZLA 3DXRB 1JL2A 4IIJA 3ABLC 3MHSC 1U2VA 1BA0A 1FXVA 1XHXA 4J7ZA 4DV5B 1FKAO 2F4VB 1CZAN 2IDOA 3C6TA 5C93A 2EJRA 3L3UA 1L3SA 2HWC4 3CHXA 3A5MC 4L8JA 1HLUA 3BY5A 3TWHA 1N36B 1F23A 4CEBA 2WA4A 3TABA 1GN4A 1UA1A 1HNZB 3SNNA 1Z05A 4IFYA 2F93B 4TT3G 2AXTZ 1TYQA 3AA3A 5KRTA 5EBWC 4GNIA 3C3TA 2KLAA 4JASA 3SPZA 4BC3A 3M1FA 4IOAL 4YTPA 4C23A 1AJNA 3T1HK 4CZZA 1XWLA 5AQWA 1IBLB 3TR8A 1UA0A 1XOUA 2Q0OC 1B3QA 4NTXA 3BPZA 3KG2A 2IJIA 4NKGB 5H2FZ 1C0TA 4YIPA 3KWIA 3CC4N 3ZLJA 1YJWV 4J41A 1RT6A 4I55A 3V9UA 1WSHA 3PSFA 3VGKA 2PLV4 2HWB4 3THWB 4WFEA 2PF4E 1WJZA 4PA9A 4R50A 2XY8A 4DHYA 4HUEA 2QWOB 5FRMA 4B3OA 3O1WA 3KZBA 1X1PA 3A0BZ 4FPBA 4DMNA 2F4VK 3O9QA 3JAKB 3L4QA 1OCZC 1YF2A 2BSKB 2Q0AA 1Z25A 4DV7O 3AARA 2QKSA 1ATRA 2P5OA 4UVBA 1K5QA 2H88A 1RDAA 1YTUA 3AE9A 4X1KB 3ZSVA 1SQPH 4DV3O 1HNZK 1ASUA 1E1QG 2A3QA 5B1NA 1N32B 2ZF5O 3FB5C 3EO3A 4RQFA 2JEXA 2N04A 4OKJA 1HNVA 3H6EA 1FXKB 2RM24 3W3DA 2UYTA 2EULA 1TAQA 2GUZA 3P31A 2JWLA 1WUAA 4AHCA 4CS2A 4DUYO 4Y1DA 1VQON 2A0LA 3CYMA 4HTUA 3TI0A 3O65A 4AQYB 1NBMG 1RT1A 3HVTA 3F73A 1HNWK 2Q7GA 5SZTA 4C8LA 3ABKC 4DV6B 4M42A 1VQKN 1VF6A 3V9SA 5LP6B 2DY4A 3ZETA 5LHGA 4YTNA 5AZJB 3FX7A 2C2AA 3AGKA 1RSOB 1I08A 1BIZA 4JI0B 4JS4A 2I5JA 4PQUA 1EFRG 3U9ZA 3CG7A 3AVCA 2LP7A 2CH7A 3LUTB 3TXQA 3VEWA 5EY4A 4OGEA 1OVQA 2IIRA 1VQNN 3SPJA 3IS9A 5CZ2A 3TAFA 1PNMA 3NH2A 2YNGA 3RVZA 2UUBB 2DFHA 4FIPC 3LDOA 4OLAA 2ARHA 3EKUA 3K57A 1G8MA 4UVCA 4X62K 3QEVA 1NK5A 3SYQA 5IJ9B 4UB8Z 4X9QA 4FZYA 2D0PA 3R8EA 1R3JC 3AE3A 4CEEA 1UPGA 2HHUA 4LF4O 1YZBA 3QIOA 3OJSA 4FFBA 4HHTA 3L6QA 4CZMA 2JDIG 5IWAB 1E4GT 3AVIA 3ZHQA 3SQ2A 1SQXH 4DV4B 1NEKA 1UOCA 2JGDB 4JYCA 3PO5A 4QOZB 1KFSA 1Y76A 1YJNN 4E1JA 4M3WA 1QNMA 1FJGB 3SZ2A 5KMGA 3OYMA 1JCFA 4YHHB 3DRSA 1IXBA 4JI0K 3UKUB 4DR4B 4J8FA 3I56N 1BQ0A 1VBB4 2WONA 3N2KA 4FK5C 1HPZA 3O80A 4FW1A 4CBUA 2QEXN 3DRPA 4BROA 4QCLA 4TQFA 3ABVA 1QLEB 3P39A 1YTAA 4IXCA 4QJFB 1Y6XA 1OCRC 1PD3A 1NGCA 4I2PA 5AQQA 4OO1J 3AK1A 1GRJA 5H5NA 3AY9A 4KI6A 4TV8B 3ASNC 5B3SB 2DW4A 3GB7C 4RWUA 4H0OA 3OYAA 3AVHA 1BISA 2VWBA 2ITCC 1RP3B 3C65A 2GV9A 3AA4A 4JI6K 1DKGD 2GUZB 3RMCA 3DJCA 4GX0A 1WA8B 4BWAA 4O55A 3QG5A 4CIEA 3ABMB 4JRQA 1DTTA 1VRUA 1VQKV 3GL1A 3LWLA 5J2NA 3BDPA 4P9PA 4AHRA 1R6KA 2XHBA 3KLGA 2YICA 4IBNA 4BR0A 2BH1A 3JATA 2QW9A 1IBKK 4JI1B 4DXWA 1LOTB 3C0BA 3O3HA 4CFDA 1AI5A 2D0BA 5E26A 5JCOC 1S9GA 3BZKA 3G71V 4CF9A 1WB9A 4C7UA 3IC7A 3SDLA 1Y76B 4PKIA 4E1NA 1YTFD 5EOYA 4W5TA 3L4IA 5CYQA 1MQTD 3SUQA 5L3BA 1MDUB 1NTZH 2HVKC 1XNQO 2VGMA 1H8TD 4B3RK 5EU7A 2LW7A 1C1AA 3DC6A 4CZGA 4CK2A 3VF6A 4J42A 1JMKC 3I56V 2LFRA 4HWIA 4IDHA 4JKBA 1KVBA 4K25A 1O9HA 2B5UA 5JH7B 3NGZA 2WDVA 5JWPA 4E7HA 1YVUA 4ELVA 4B3MO 3E8GA 4O4IB 1VAZA 1LWFA 1G6UA 3H1IH 1VSEA 3CCMN 1RT3A 3EXAA 3MCPA 4N56A 3LNMB 3VQ4A 1ZYQA 4IT5A 1D9FA 3VR9A 4MW3A 5CBGA 4X64K 4JI4K 4CJWA 4W5OA 4DV0K 2Q9LA 3CCVV 1A5WA 3JSNA 3ZMUA 4B1ZA 2F23A 1IO2A 3GOIA 1W9HA 3I55V 3H1HH 2PYLA 3ZETB 1T03A 2QA4N 3CCQN 1OH7A 3KKYA 4PDVA 1YUWA 2HHVA 5LJWA 4FPAA 3NCIA 4DU4A 3ZMTA 1BG3A 1BQMA 4UVAA 3HI0A 5AFUA 1CLQA 1IURA 2W6JG 2Y4TA 3RT3C 4FSVA 3O9UA 3AG1B 3O8MA 4YIOA 4EZ9A 3JAKA 1KU9A 2ZDIA 4JI2B 4FJ5A 5KMGB 1KLNA 4NB4A 4DQIA 3E35A 3P4IA 4X65O 2PYJA 1POV0 2ZIMA 3GBTA 5CA1A 1GOCA 4KXRA 3AO5A 4NO7A 4HUGA 2E5LO 1B04A 3THWA 3HKDB 4X64O 1R3LC 3HPLC 3V1RA 3OJUA 4DV0B 2Q0RA 2PI5A 3T1HB 3D8CA 3L2VA 1OKJA 1KC8W 1Q82O 3NE6A 4CFCA 2XOKG 1IKWA 1FS0G 1HYZA 4JYYA 2G8WA 3CCJV 1IBMO 1NM1A 4MTFA 3SUCA 3PIOL 1VSLA 3NDKA 4DR1K 2R70A 4DSKA 3SJCC 4DV5K 1EKEA 5JVDA 4HCBA 1L0LH 4DV6O 3SQ4A 4CZEA 4DR5B 2ZD9A 3BEHA 2PGGA 4AQYO 1T3VA 2BANA 2AHYA 1MSWD 1TUEB 1WOQA 1QSSA 2RS34 4F3TA 4DR7K 1GH6A 1ZBSA 2WOMA 5F2RA 1U2VB 2VQEO 2BOBC 5M1QA 2ZE8A 3AA5X 2HF3A 1NU1H 4O2BA 5AQFA 2GX9A 1J54A 4IEEA 1TAEA 1WBDA 1IBKO 3AG3B 1N4CA 2ETNA 2L6LA 1WNSA 3ETQA 5C8YB 5ITZB 1XMQB 1NMDA 4NYFA 4BAYA 1BEV4 3G6EV 3H1QA 3D6RA 5SWMA 2FTKA 5J2UB 4JI4O 3APOA 4DV2B 4Z0UA 2ZE7A 4CK1A 4YJ3B 4CF2A 3ZBHA 1R59O 4B7EA 5LHIA 4K41A 1X3MA 4JKEA 5C8YA 5ITZA 4ELUA 4R79A 3JARA 4FM1A 5KX5B 3I55N 5FPOA 1J5EK 3ZEUA 4FM2A 4CGGA 3L8BA 2QKCA 3BY6A 3CCEV 3THYA 2Q8VA 2WAMA 2LFSA 1MWMA 3OUFA 2OPRA 3FGUA 1KMIZ 3LWMA 1CXUA 2VYPA 4JI3O 4EFBA 1IBMK 1PVC4 2Q69A 4X1IB 2UU9B 3B6OA 4JI5K 1FYJA 2PW9A 5JQGB 1XNQB 4GZRB 1NOZA 3HOSA 1MZEA 3D3IA 4H0TB 2B6AA 3KKRA 2CTPA 5L3FA 3X2QB 4EFHA 3V4IA 2D3OW 5JCOA 4LBEC 4BG9A 4A5BA 3K59A 2HHXA 3NMUA 5GAGP 4X8AA 1FK9A 3EE8A 2HMIA 4KHUA 3A2FA 3W7WA 1KLMA 1PL0A 3CERA 2WP9A 1ZWIC 3I5DA 1XDCA 3IAYA 1NLVA 4B3MB 1QQMA 3K3WA 3FZLA 3RSEB 3OW2M 2WLIA 3A0RA 3RYCA 3UQ8A 1QSYA 3NAEA 3JD3A 3SBGA 3PN1A 4DQRA 1W59A 1ASJ4 4GMJB 4DLEA 4JK8A 4DV4K 4NVPA 4AF1A 3ZHVA 3CJ9A 3SJJA 1VSKA 3MD0A 4E0DA 1FJGK 4B9LA 1Q5OA 4BIZA 3WB1A 3ZMVA 5KQDA 4F4KA 3AAQA 2EIKC 4JAVA 4X20A 2OIGA 1NMNA 2P9LB 2P9UB 2UU9K 4JAAA 2Q97A 4LR3A 2Q1NA 4FLVA 3CQYA 3M6GA 1FFTB 4NLBA 3CETA 3VGLA 3VQWA 1DGSA 5IYBO 2Q7HA 2P67A 4WF9L 2UUAK 4YJ3A 3VRAA 4DV1K 3ABMC 1RUG4 4FZZA 1S5JA 2P9PA 3CIRA 4O8KA 4Q4V4 4LFAB 3THOA 2DN9A 4CFBA 2OIEA 1O9GA 3NFAA 4CH3A 2VQEK 1WSIA 4RAIA 4K42A 3H46O 3ZX0A 3MWTA 2O57A 4YOXA 1H2MA 1QZ6A 3PV8A 5EBLC 1S6QA 3JCUZ 1GLFO 4FWRA 4E7LA 2DQ0A 3D36C 4DWIA 1BCCH 3IG1A 2Q7EA 4WF9V 5AQOA 2JVDA 1JLFA 4LNUB 3P4PA 5M1OA 1VBA4 2ZXWB 3LAMA 1TK0A 4N23A 3P4SA 1QLNA 1WSJA 2BE2A 4GX1A 2IU3A 2ATQA 1RDDA 3M8QA 2FYUH 2P06A 4PDLA 1Z5VA 4DR4O 4FWLA 5AZJA 1S9EA 2XRIA 2I7PA 3ZSOA 1SQGA 3CE2A 4X66O 3TSQA 3BRCA 1HKBA 3IRXA 2Y4UA 4PUOA 2JGUA 3VEVA 4H8KA 2N74A 3P38A 4E7IA 3T4ZA 1HNXO 3DYAA 1VQ6V 4I2QA 3R6MA 4I9LA 3ZHSA 2DWDC 1RM1B 2EHGA 4JTDB 1QZ5A 4JAXA 3GQKA 1VSJA 4DSJA 4JI6O 5C3JA 1YITN 1HNIA 3T1HO 5LA6A 4TSFG 1IDSA 4JAUA 4DF8A 4IL6Z 1Q86W 2CH6A 3VQEA 4CEZA 1D5NA 3L70H 4PKHA 3WB0A 2Q73A 3E9LA 1VQ4V 3QF7A 1KP3A 2EZPA 2KG7A 1NGEA 4A5AA 4O5BA 3UIQA 1L8DA 1Q82W 1EXQA 3OFNG 1TKDA 3F5WC 3CM5A 4JI0O 3TPQA 4PDWD 3M7MX 4CBWA 2UXCK 3U11A 5L3CA 4DU3A 1QQCA 1U6ZA 3VOVA 3WU2Z 2W0XA 4H03B 1YHQV 1NH2D 1BMFG 4IKFA 1YF5L 3OS2A 3SYAA 2X74A 2E88A 1SQFA 1S5LZ 4CHNA 5FPEA 3NGYA 4KKOA 3CPEA 4CEAA 4DSEA 3QFUA 2YKNA 1AP6A 4LH5A 4DTSA 4E7JA 4LF4K 2R9RB 1ZBFA 2P9IB 1IH7A 4TSXA 3J8F4 2XASA 3CQXA 2XTAA 4V19S 3V1QA 1NKEA 3JYCA 4YT0A 1VQ9N 1ZP0A 1ZUQA 2DYRC 4GX2A 4MTOA 1C1BA 4MVUA 2W6KA 4ILGB 4CJRA 1AP5A 3KD1E 3RN4A 2IU0A 2E8AA 3AO3A 4B1VA 1SL0A 2CGJA 4RW8A 5IT9N 1W0HA 3SYZA 1WB8A 5B66Z 4GV6A 1VF6C 2WPDG 2UUAB 4H0VB 1K97A 2UXNA 4B3TO 2QWQA 4CZFA 4B3SB 4GKJB 2A06H 4IIJB 5AQTA 3VQ8A 3MEDA 5IDJA 3JYTA 3HM9A 1U45A 1LV5A 4Z4EA 3K08A 3WXLA 1SA0B 1SL1A 1MSDA 4DSIA 2BCCH 3AV9A 4RCHA 1ZBIA 3AK3A 5B8HA 4I4TB 3THVA 4CHYA 4LCUC 2WBNA 2WWWA 2Z0AA 2ETJA 3A5OC 4JHDA 2ZKOA 1SKSA 4FFKA 5B1BB 4J2AA 4GT1A 2P7TC 2B76A 2HVHA 5LGTA 2K9PA 2ZE2A 3B40A 2P9LA 1COV4 2HHSA 4X20B 3M8RA 3QESA 3NR7A 3RR8A 4LF9O 2WU2A 1SQBH 1HNWO 2IH1C 4LD0A 5HFLA 1CXQA 3FZMA 4JI2K 1RTHA 3VN5A 3HP6A 3TK1A 5AQLA 4R8CA 3QNNA 2KZMA 2IVNA 4P2ZA 1SS3A 2YNFA 4DR6K 2R72A 4K0KK 5BREA 5KQ8A 5L3DA 4FJXA 1OCZB 5LMUO 4FLZA 4OKEA 2OTJN 2XAQA 3ASOC 5LP6A 4AH9A 4J80A 1HNZO 2VGNA 4H5WA 5M1KA 2CH5A 4CI6A 4CJFA 4DTNA 2QWLA 3T7ZA 3H3OB 4UCSA 3SYPA 3K5NA 4PA6A 3DWLA 3HTVA 4WQ5A 1EN6A 1U04A 1VQ4N 3JS6A 4LH7A 2ILMA 5BMVA 3F5TA 3FFQA 5AQPA 4B3SK 3J8AA 2F4VO 4KO0A 5MLCQ 4GKJK 3ISNC 4EB6A 2YI9A 3CCMV 4JK9A 5H6QA 1YTFB 3GQHA 1M57C 1J6ZA 2BTFA 1LW0A 4M3RA 3SI6A 5H6RA 1N8RO 4F3OA 2A1SA 1Y74A 3MDQA 4YXDA 2NLXA 1RUE4 5A2QN 3ABUA 3VQYA 4MT8A 1XQSC 3VTHA 4I6MB 2F9WA 4AILC 1P84F 3R3LA 3ZSZA 4YNQA 1TL1A 4DK1A 1SESA 4DFJA 4JV5K 3ZCMA 1K8AW 5L3GA 1X9WA 3D3QA 3E8BA 4OX9K 4K0KB 1SUQA 2A41A 3S3NA 1VQMV 5AR0A 1YDXA 3E83A 3P1GA 1ZC6A 4KV8A 4NXNO 1C0FA 3T1CA 4J7KA 5LGUA 5A2QO 3EKSA 3H1KH 3OM3B 4BW5A 3K03A 1WB7A 1RCHA 3N4QA 4BRMA 2O8FA 1VQOV 2DPNA 2ZWHA 1W2BM 2E75B 3B8NA 1RDWX 4OPAA 4CJLA 1L3VA 3GWKC 5GINA 2V7QG 2ZINA 2AA4A 4PHZA 1EAH4 3VBBA 1ATSA 1BL3A 4DR1O 4OGQB 4LH4A 1LCUA 4IG3A 4WCEL 3RGBA 1QU7A 3UKRA 2QWRA 5IE9A 1R73A 3O4QA 3LL3A 3DSQA 4UV9A 3ALYA 1KQSU 1JL1A 1S76D 4FJLA 2ADPA 2WU5A 3DXMB 5H9CA 1N6QA 2OCCC 4DQSA 4DV2O 2E76B 1DEJA 3CJ1A 4UFZA 3LM9A 4FK2A 3SPCA 1AR74 1S1WA 3VQQA 3BGRA 2IOCA 4DFKA 2FLOA 4DR2K 4GUNA 4L8RB 3C94A 4F6RA 1EN5A 1PO14 4N21A 4IOCL 3OYKA 1US6A 1RNHA 3FKSG 4D7TA 2FBTA 2QSAA 1T8EA 1WN7A 3TETA 2QR4A 5CA1B 4BVOA 2UUCK 3DLRA 2G8IA 3KLEA 2D1KA 1MWKA 1TKZA 3L2UA 3G67A 1NKDA 3LSUA 3CHWA 3D36A 3EL2A 1IKXA 4B1YB 1HW7A 3O3GA 4KFMA 4MTGA 1BHLA 5F0XA 5B1OA 3I0SA 3ID6A 4ZTJA 4KRFA 3K9KA 3CYOA 2P51A 1YVWA 3SJAC 1TAUA 3S3OA 1JCGA 3RVCA 4OXSA 4JKHA 2YI8A 2MW2B 5CN0A 4ZOLA 5LMNB 3QO9A 5KLVH 1NK0A 2YEVA 1N34K 2FSKA 5FPRA 4ZIBA 1GM9A 4PELA 1JPXA 2B9ZA 1EV14 3SAGA 1HRV4 4W5NA 2QKKA 1TYQB 4Z4IA 3ATVA 3T1YK 3O9RA 1DF4A 3PY8A 1ESVA 4BE2A 3AA2A 5AQJA 1XMOO 3QMLA 5M1NA 1PM9A 1WSFA 2CTWA 2ZT9B 3VA0A 2G8HA 4K43A 1F4NA 1ZBHA 3AE2A 4OPHA 3EZWA 3VQDA 5DM6L 4RW4A 4KAZA 4YHHK 4DG1A 4JS5A 4B3RO 2X6AA 3MXMA 4J9ZB 4WFNL 3RYFA 5B5EZ 4JHDB 1NK6A 3LM2A 4EEQA 3KK2A 3VMFB 2YHAA 4FLYA 2RF2A 3E8HA 4F6EA 4I5SA 2Z5UA 4DF4A 4JV5O 3AO2A 1HKGA 3BABA 4KHNA 3TAPA 4CJEA 4JI8O 3TAEA 5BR8K 2ACZA 1NGGA 4TQDA 2XO7A 3OUSA 4MVSA 2ZR3A 3NF6A 4DFPA 1U47A 3ASOB 4CBCA 2R074 2UXBO 2X7RB 1VQNV 1S6PA 2XAGA 4DW1A 1RFYA 1TVKA 5DM6V 2P1JA 1RPOA 4A59A 3T1YB 1VQPN 3FB7C 3U0ZA 2FSNA 1WLEA 2NRTA 5AQZA 1NQTA 3ENOA 3OYIA 1TK8A 4FOIA 4YY3B 1VQ8V 3O4WA 2O8CA 1K5MD 1THZA 3OGIB 3CFOA 1ZL8B 4LF6K 2R7YA 5B1BC 5TISZ 4FWPA 1HKCA 4DTOA 4JKGB 4AHTA 1VBE4 4NTYA 4Q20A 4XDLA 4YJ2B 4KH5A 4W5QA 1WA8A 2P4VA 4LF8B 1IG9A 3CCLN 4BVPA 4FZXC 5J2TA 4RW7A 3WUHA 1NK9A 4CECA 2ZNIA 2QXFA 1YIJN 2XAJA 1SL2A 1SQQH 1OCOC 1XHZA 4CGDA 2P90A 1N33O 5AFUH 3M8PA 2NUBA 3MDSA 1S1VA 3HXMA 4B9VA 4OX9O 4QPKA 3AECA 2H94A 2YXHA 3U4LA 4IHJB 4BRFA 3JSLA 1WSEA 4LF9B 4UUJC 4LFCO 2DYRB 1FFXA 1VQ7V 2V52B 4DQQA 1T05A 3TANA 1HQEA 4Z2WA 2QWMA 5KTQA 3Q4HA 5AQNA 3E22A 2AZ0A 1D5AA 3SYCA 3ETGA 3JAWB 5FROA 4CHQA 1P4RA 2JGDA 3AO1A 1SC5B 2UUAO 1XMQK 4LH6A 3VESA 1BOTO 1L3TA 4FM0A 4LF8K 3HKEB 3KWGA 4DV2K 1GK9A 5EK0A 1HPMA 1VQ5N 3OMAB 5EYPB 1NH2B 2GBOA 4MLEA 4B8CA 4KHPK 3UO2A 1COWG 4YORA 5K1PA 1H2NA 3FD9A 3A5NC 3E01A 3WQUA 4CZIA 4UQGA 4YOYA 4FK0A 2A1RA 3KHYA 5K14A 3IUCA 5KHGA 4Q5VA 4O2AA 3J7AU 2PFUA 4JZGA 3RRGA 4LF9K 1L3UA 2EBOA 1AL24 3MN5A 3WXMB 1NENA 2E74B 5JVHL 2ODMA 1PKXA 2CH7B 3JASA 3K0GA 3O4NA 4U67L 3SR2C 1CP9A 3HP9A 3S3WA 1K92A 1N33B 4KB0A 2IW5A 1M56C 3UE5A 4U7NA 1V4TA 4UB6Z 3MX2A 4A57A 1NGBA 4UXNA 4AHVA 2A9HA 3VQ5A 2YDEA 3VQCA 1NOYA 1GM8A 3BA8A 2RDCA 1NKCA 4NYKA 2A79B 2G38A 1BQZA 1HJRA 1Y64A 2WC9A 4DV3K 3K0SA 5ELZA 2I7NA 2WLLA 3D45A 3F9KA 4JKDA 3G71N 4KH4A 2HLDG 2E1YA 3CQ8A 4GVMA 1WP8A 4OKKA 4CC5A 5KHKA 4RW9A 1LNQA 2YHBA 3RWUA 4YOVA 4KHYA 2R7FA 4DR5O 2UXBK 5JS2A 3WNGA 5LL6Z 5CHIA 2QM4A 1UJWB 5CA0B 3VGMA 2QTSA 4BIUA 1Q7YW 5HBMA 3EVKA 4PA3A 3CIPA 4IFEA 4IO8A 1KVAA 3DM2A 4FZ1A 4CGIA 4JI7O 1JCEA 1HR0K 2GBZA 4FWKA 1BSMA 4GKKB 1M93A 4FJGA 2DQ3A 1H8EG 4JYAB 1RPRA 1SZXA 4R7CA 1I39A 2UXCO 2OTLN 3DC5A 3CJHB 1CEZA 3VQ9A 3L75H 4FWMA 1HXS4 3SV4A 3C6UA 1GN2A 4FJ9A 3ZHRA 3FZKA 3MEEA 5EX5A 2ZGYA 2RJZA 3AVMA 2FKXA 3KLFA 2YX6A 4MDAA 4CJQA 3QNOA 1NJXA 3SQ0A 4LFAK 1BHAA 1OZ0A 3OVNA 4RG8A 3SPIA 1S72N 4Y0WA 2LGWA 3AVBA 4B9UA 1EX4A 5IYZA 1VSMA 4CW7B 2HBKA 3H1JH 1HJOA 1P90A 2WUSA 4DUZB 3CCQV 1B9DA 2QA4V 4I50B 3VF4A 2P5GA 1WAZA 2NRHA 1FKPA 3CC4V 1ZBUA 3VQ6A 4CE9A 4FVUA 4H13B 4EKWA 3HYFA 5E41A 3OGCC 3H9VA 2OTLV 1TUBA 2CDYA 1NGAA 1WAJA 1E3MA 3VQAA 3C7NA 3ETEA 3JXUA 5GIPA 5DN6G 4JRPA 3LDLA 1VQ6N 1V54C 3ZSYA 1YEWA 2EIKB 3WXJA 4F8RA 5GW7A 4FK4A 3N27A 4FLXA 2VCPA 3J7AP 4LC1A 1JCHA 1TUBB 4UY8O 3ZEUB 4QAGA 1U97A 2PTMA 4KTZA 1YI2V 2AHZA 1JA8A 1Y74B 3RYHA 1SKVA 4IG0A 5AQMA 1V9PA 3HSTB 5LOVB 1D2DA 3FFIA 3VEXA 3VEOA 4BQLA 4CVNE 1XMOB 4EB6B 1E4FT 2DJVA 4CD1A 1VQ7N 5D3GA 4JI1O 3SJBC 1M90W 1LWEA 4O0IA 3THXB 3FYIB 4O4JB 5IYDO 2Y48A 1N36O 3JBG4 3O9TA 4PA1A 3B77A 5IWAK 2E2QA 1RDBA 1OCRB 4PDMA 1NT2B 1BHBA 2W6LA 1HDJA 2IJHA 4BC2A 3W7TA 3PX0A 3S9HA 1K7DA 3B09A 1XI1A 1YXBA 2HP8A 2X6SA 3LSQA 3U10A 3QETA 2DTUA 3AEGA 3A0IX 2RS14 2A42A 3OYDA 4Q4Y4 3AVFA 2WDQA 3ZRSA 3OBWA 1HRI4 3LDDA 1G15A 3VERA 2VWKA 4LFCK 4ICLA 4DR4K 3OYNA 1JXEA 5F1XA 5JJJB 2IJKA 2VQFK 1NGIA 3UKMA 2YJFA 3EE9A 4FO0A 4FMTA 2YI1A 4CEDA 4JTAB 3ULEB 1FXXA 3QVNA 3SMSA 4CH5A 2OZMA 1JLGA 1D8YA 5KAFZ 5BPLA 2P9KA 3OTFA 4U3FH 1XNRO 3V81A 3VF2A 2ITGA 2QGNA 3E9OA 1Q7YO 4HNAB 4DV1B 3K9JA 4MVMA 1DK1A 3UT5B 1F21A 1LAVA 3LP2A 1XC3A 4F9OA 2BTQA 1QLEC 3HKDA 2H3OA 3BFRA 3DGEA 1EO1A 4B1WB 5BRHA 4CJKA 5JVGL 4WFAL 3APQA 1TUYA 3MXIA 3MECA 2IGIA 3E86A 4AM6A 5IJ0A 4DV4O 3N2GB 2YV0X 2KZZA 1XILA 4ISFA 1HNXK 1R3IC 3DLKA 5KAIZ 4UCVA 1VRH4 3L74H 4JI4B 3L73H 3GWOA 1JLBA 3OR6C 4BRGA 5C25A 3ZRXA 2E2OA 4E7KA 3BCCH 1IX9A 2EILB 5AZIA 1RBSA 3PO4A 1I0HA 4XEIA 1RUD4 3WB2A 5BY1A 2HHHK 3ABKB 1ZLZA 4PKGA 1FXKC 3OD4A 1K34A 1QTMA 1HYSA 1XQ8A 4DS4A 4Z94A 3DLHA 2PAVA 3MN9A 5LJVA 3DAWA 1FKOA 5AZIB 3TTCA 1L1FA 1BZKA 4JI3K 1ZSPA 3LP0A 1L0VA 4BC5A 5KUKA 5AQXA 3ABTA 2P22C 3CMEN 4NXNB 2KW4A 3ZRWB 2QK9A 2J4RA 4PL8A 3TAMA 1NK8A 4TUYA 1SV5A 4KHSA 3J81N 3WXKA 1NVPB 3HJFA 1T44A 5C15A 1PO24 4HAMA 1J95A 4DV1O 4G28B 3PLAA 5AQVA 3Q4HB 3ZHTA 2X0LA 1VHXA 1AVMA 3ZMZA 1O13A 4BR9A 4MO4A 3HK2A 3VQPA 2LW1A 3LPUA 3T3FA 4NCGA 3PX6A 1BO5O 2W42A 3UT5A 3OR7C 2QDOA 5KHHA 3ZRVA 1GN6A 4XDJA 1NTMH 1HMVA 2EIJB 3P4RA 1JXBA 1Q8IA 1S77D 3HKBA 4DSFA 2R9IA 3SAHA 5JJNB 3CPWU 2WTUA 4J2BA 3QDKA 2HHWA 1WAFA 5C24A 3PJSK 1K73W 3JD0A 4G2KA 1N5YA 4GB34 1WBBA 2CTRA 4YJ2A 4JV5B 1BA1A 3BUZB 3TJTA 1JJOA 3RMAA 1VBD4 4DUYB 4TUYB 4M3XA 1VARA 1A5XA 4B7KA 4N76A 4LWSB 1XC9A 2QM1A 1RT7A 3SMPA 4HUFA 5E79Z 2RPIA 4DR2O 3QEIA 4NR1A 4C8KA 5EXWA 4JD2B 2YSUB 3CCSV 1HNWB 2IH3C 4LF6O 3D2EA 4AQYK 3P3NA 1BI4A 4ISEA 1RBVA 3M8SA 3RW0A 4DV7B 2VG6A 3NGIA 1SZTA 5KPZA 4LF5O 1VQPV 4CZKA 3M99B 2NRVA 3BEXA 2Y0IA 5BZBA 4CF8A 2E20A 3MMVA 4FJMA 1I7FA 3JD2A 3T19A 3UKUA 5GTHZ 4CEFA 2D2CB 4CJ5A 1KECA 1M56B 4KTQA 5HRSA 4DUZO 3CI5A 1RT2A 1NGFA 4FWSA 2P9NA 4DR7B 4FVMA 2LQTA 5EZYA 2VWJA 2E5LK 1ASWA 1GOBA 4CD3A 3SYOA 4M3ZA 4X88A 3G80A 1ZTEA 3O3FA 2AJQA 3L3VA 1T6DA 4M63C 1QQNA 1E79G 2PI4A 2ADQB 1Q43A 1SF9A 3R9PA 3JALB 1W7AA 1Y66A 5AQHA 2BTQB 1BT8A 2E2NA 3TCUA 2O8EA 4E3SA 4YOTA 3RSEA 1K8KA 3AEDA 3EZ5A 3U3YA 5AQKA 2JWKA 2RCVA 2CGLA 4WFAV 4BRCA 2UXDB 2Z1GA 2W6IG 1BQNA 1GOAA 1Y67A 3CMAV 3V9ZA 5C2DA 4NTWA 2QWPB 5GAEP 4B1UB 1PV0A 1IBMB 1NU0A 2YNHA 4IYIA 1HWYA 3KK7A 3VENA 3ATUA 2KQXA 3CJHA 1QHTA 1N34O 4LF5K 4I9QA 3E1YA 3F7YC 3ZSQA 4GKKK 4DFMA 2BGGA 1D4M4 2FF3B 5TKWA 2HHTA 3OYGA 4PD4F 1GKFA 4RTFD 5EVZA 3M8AA 4CIFA 3DXKB 1JJ2M 4J7JA 3A0HZ 2VS0A 2O8DB 1C6VA 4D7SA 2VQFO 1ILYA 1FXKA 4KHWA 3CJAA 5I3UA 2JS5A 3ML0A 1EZJA 2UUCO 2Q31A 3QIPA 5IY5C 4CJUA 3K9AA 1KBHA 2V4DA 3HOTA 4HYOA 2KKZA 4NYNA 3MEGA 3CCEN 4EFEA 1QR9A 4DTRA 3RBZA 3QEWA 3CC2N 2EINB 1VQLN 3ZRWA 4JI8K 4WE1A 1YT3A 3NHGA 3EFFK 2KB1A 1RBRA 1YJWN 1KQSM 3AG4B 2WDRA 1K4DC 3OYEA 1Q81O 4B9MA 2VQFB 3G6EN 4NLCA 2V7YA 4U3JB 2ITDC 1SETA 2M7WA 4XH5A 1D9DA 1FD9A 3C7NB 2CGNA 3MCAB 5AQSA 4JKAA 3AEFA 3B8AX 3TSUA 3QFPA 1K9MW 4BGAA 1BUPA 1F4MA 1WPBA 3KVGA 1DLOA 3SV3A 3LP3A 5LBQA 1BWFO 1W0KG 3TXSA 5L3EA 2BOCC 2HVIA 4ZOLB 3E66A 4CGFA 1PL4A 3AG7A 2O8EB 2QKBA 4BR2A 2NNWA 3MHHC 2GUIA 3OY9A 1BGYH 2UXXA 2XY5A 1SRYA 5EYPA 3OTOB 4ICGA 2JLEA 3QTCA 3LDCA 3UM7A 3HKEA 1J9AA 1YVNA 1H2GA 3CXHF 4ZI7B 3BZCA 4BR5A 2OYQA 3OT7A 1MZFA 3CSXA 1TL3A 2EIMB 5EZYB 1GTOA 3P5JA 3VQBA 1ZOYA 4QGPA 4KREA 4LFCB 1W97L 3SUOA 4FJCC 4CGHA 2B1GA 4IJNA 2Z1JA 4JKFA 2HW3A 4IDKA 4WBNB 5KA5A 1KAYA 3C3SA 2FBXA 2W41A 3TGUH 4XDKA 4Z4CA 1Q90D 3ZX6A 4DK0A 3J80N 2AZ2A 1KTQA 5HRRA 4QE9A 4CZHA 1VSHA 3G4SV 3VOUA 2A5XA 2AW9A 2E3CA 3ITHA 2KHOA 3CMAN 2BE3A 4JGSA 1NJZA 1RGIA 3LSSA 4IHJA 1W2BU 4EP4A 1DTOA 4CK3A 5JS1A 4PDRA 1DF5A 3NF9A 3AO4A 2WLLB 5BPMA 4C8MA 4CF0A 3IC9A 5C2TA 3RMBA 5LXTA 3O9SA 2JIZG 1B92A 3U6FA 1URFA 4LF7B 1RDCA 5AQRA 2HHQA 3BF3A 3W7SA 5FLXN 2ZQBA 4X1YA 4I0XA 2IC3A 4ISGA 4KFBA 2CGKA 3L2RA 3CC2V 2X78A 3CC7N 4YOUA 2GSMB 4X66K 1XNRB 3H1VX 1GMGA 3A8TA 3LAKA 4CJ3A 2NRZA 1KF6A 4CEOA 2YNIA 3SLCA 1S3XA 1TKXA 4CHOA 3ZHUA 1NKBA 1NS1A 5HP1A 3SFEA 2FC0A 4CGJA 3S41A 3I8DA 4QE7A 1RFQA 3W7UA 4H0YB 5DECA 4O5FA 3AEEA 3RYHB 3SAFA 1K8KB 3ENHA 1GLDG 1VQLV 3CX5F 2N05A 4JYAO 1AR94 3QO7A 4P9OA 2HNYA 2F96A 1LUVA 3O08A 3FB6C 4CJPA 3RMDA 4YDUA 4BGBA 1U49A 4IZ9A 3CRAA 4RW6A 1R084 3CM6A 4YSZA 5T7BA 1GM7A 3ZSRA 5JICA 4LF4B 1RVF4 4FPPA 3MN6A 4RWTA 3OE7G 1YAGA 1Q3EA 1IG8A 2XY7A 1NJIO 1N36K 2DE0X 1QSLA 1GO3F 3CCUV 3DOLA 3H08A 4LY7A 1O1WA 1OHHG 2B1IA 4O4HB 4R5PA 4KHPO 3BA9A 3ZN0A 3AE6A 1LAWA 4FLUA 1QVGM 1GLEG 1HYVA 2VQEB 3AEBA 2GEMA 4BRAA 2QM8A 3E22B 4CS3A 1VSDA 2D0CA 2WLHA 4WCEV 1M9NA 2GTAA 3T69A 4C1NI 3CD6V 3JAMO 1KD1O 1H1VA 4BRHA 4H5NA 5M1FA 3K5LA 1YCIA 1TVRA 5EIBD 3RFRA 1Q18A 1X3NA 1XREA 2Y0PA 2HBMA 3FLCO 2X6CA 3PX4A 1XBLA 1SQKA 4ILJA 5CMUA 4JD2A 3AE7A 4BRLA 2Z3YA 2RHKA 3AE4A 5CY4A 3S3XA 3AEAA 1EBOA 3OHRA 2YUAA 4UV8A 3ZEDA 2Y1JA 3OS0A 4N47A 2HSTA 3U9DA 2O8BA 2GWJA 1YHQN 4A61A 2KTQA 4FZ0A 4MVRA 4OPKA 1RUJ4 5GONA 5B1AB 3T4DA 2WLJA 2NN4A 3HBTA 4FWNA 4HVJA 2ZNJA 4F2RA 3VQXA 2IBZH 1JOYA 2E5LB 1S0VA 1VRTA 5CB4B 3SCXA 1VK0A 4YOWA 3N4PA 4H0XB 5DM7L 1J5OA 1TVKB 2YJEA 4CHPA 1PPJH 4L3QA 4LFBO 5GAHP 4W5RA 1T5EA 4DV7K 2Y69B 3J7ZO 2V1DA 4CEQA 1CXZB 2ZCEA 5BXZA 2OPSA 1AJPA 2RKIA 2ZE5A 1BE3H 4WFBL 2B5JA 2WLKA 3AE8A 1VQ9V 3LDNA 2ATKC 1K73O 3IFRA 3IFXA 5J2PA 3OEHG 4A5UB 1P7BA 5LYJA 2PZSA 2RN2A 4WBNA 4PI2A 3AG1C 1KRPA 3K9SA 2P9IA 5C0YA 1RTJA 3RR7A 2WA3A 4IYHA 2QI2A 4DR5K 2Y1IA 3CP1A 2YC0A 4FJIA 1B9FA 5BR8O 1N8RW 2QWRB 5CZ1A 5TKYA 1YJ9V 1Z5WA 1QVGU 4M3UA 4M3YA 2FSJA 1XMOK 3QEXA 3CRMA 3KK3A 5BR9A 4F2SA 1HRHA 2F95B 4MW8A 1BI4B 1C0GA 1V4SA 3V9WA 3D2EB 3FAVB 4H5RA 1QVFM 3M5RA 4DQPA 1YITV 5BPNA 1OVYA 3FR0A 1XUPO 3LZJA 2KG7B 2IM9A 2YXYA 1PNLA 4GX5A 1NR7A 4CBXA 3QICA 3WEEA 4YSXA 2DFEA 2XUMA 2DWEC 3AVGA 4O0JA 2E1ZA 4TOIA 3T1AA 5LY3A 3CCRN 4IJAA 3CJBA 3T1YO 1S22A 1KCFA 1RHI4 4DS5A 4OLBA 4DB3A 5LYJB 2RMKB 3SK3A 4NCAA 3V6DA 3CD6N 3P4QA 4FWOA 1M1KW 2QM7A 2QJ1A 4H5TA 5AQIA 3ZSWA 2HNDA 2HBLA 1IVSA 1FFXB 2YCHA 1AI7A 2FB5A 1GLJO 3CCUN 3V9XA 1H8HG 3CCSN 3QEPA 1XL6A 4FLWA 1K4CC 1AB3A 2QWOA 4LF8O 4O44A 1LR1A 4B9QA 3D2FA 4I50A 2E4LA 2ZD1A 3DI6A 4NB5A 4PI0A 1I5YA 3AG2C 4BDYA 2RN9A 1GLCG 3CMEV 2EZOA 3NF8A 4TWKA 4K35A 1EZVH 4O4LB 1NWKA 2H89A 2ZM6K 4X65K 5BMVB 3L9DA 5J2TB 4GY2B 5BN9A 2ZR2A 5HRPA 2K1EA 4HCCA 2R064 1KFDA 4H4OA 4FYDA 4LNUA 3L0QA 2OTJV 3AG4C 3QNEA 2UUCB 4ZHQA 3B4SA 1CZ9A 3ULEA 4BRDA 4DQ8A 5KGXA 1VBC4 5AG2A 3CB2A 2EWSA 4FL9A 4XH4A 3CJ7A 1AR84 4CH4A 3L72H 4YSYA 1IBKB 1YI2N 4FJNA 4DLGA 1QBZA 3CXCM 3LDQA 1IKYA 4XH1A 3QO5A 1X9MA 5C12A 4ZHQB 4M3TA 3IMXA 4GV9A 2KFZA 2UUBO 1KAXA 4AM7A 2A40A 3OS1A 4Q4X4 4BIOA 4WFBV 4YHHO 3MAQA 2UXCB 2GWKA 1RDUA 4B3RB 2Q6AA 4O4JA 3RRHA 1T6CA 3L2QA 3THXA 4O4LA 2ZGZA 3P83D 4I4TA 3OMIB 3QB0A 2HMPA 4AHUA 2HR3A 3AVAA 5D5QA 4FJHA 4JI7B 4BRQA 4EHTA 2YIDA 3DLLL 4KX6A 4PY5A 3QINA 2XT9A 4ILHA 4KI4A 3L71H 2CE4A 2AP1A 1NG9A 3AE5A 3OAAG 1RT5A 3G0ZA 4J10A 4M7YA 1AILA 1EQYA 4A2BA 3SBTA 2A3ZA 4B08A 4FJKA 3MX5A 1KYOF 1RTIA 4EZ6A 5KHIA 2R044 2D4WA 4X64B 1KP2A 3R65A 2OT5A 1QE1A 3R1XA 3HVRA 1N32O 4Q0BA 1JKHA 4JKCA 2OCEA 2D5RA 1PP9H 3KJVA 2CUGA 4ID5A 4M41A 3QBWA 2KFNA 3EHBB 4DTXA 4HBNA 5IYZB 2ZE6A 2OWOA 4DR7O 4HNAA 1XEQA 5LP6C 1ENVA 4EHUA 3QERA 2EILC 5BRFA 3BP8A 1DTQA 4H0PA 2H8PC 5J1EA 3VQVA 4IO9L 1G99A 3KCYA 1OCCB 2UXDO 2HFEC 1JLAA 2JS3A 3BVOA 3MXJA 5FPDA 1MA9B 4AHSA 3CPWM 4C8NA 3SPHA 4NCBA 3SFDA 1RILA 4B9NA 1S72V 3FFKB 1KD1W 1ZX3A 4CJTA 3O6WA 3DOKA 4X1YB 3CEIA 1KC8O 5JQGA 1YSCA 1M5IA 3OBYA 2FXUA 1KB9F 2HJDA 4DO2A 5J9PC 2LSNA 2RNBA 4DSLA 1NGHA 3EYZA 4LF6B 4FJJA 1TK5A 1HNXB 4Z4HA 4EP5A 2DMXA 2YS8A 4BR7A 3JAWA
chains in the Genus database with same CATH topology
3EY1A 3DLBA 5KGWA 2VG7A 4CJ4A 4BWJA 4CHZA 1I94B 4DR1B 3QLHA 3RTVA 1HQUA 3HPGA 4CJVA 1SKRA 4O4GA 1U4BA 4ZI7A 3D0PA 4OX9B 1TKTA 1UWBA 2FBYA 3LPTA 3OYJA 4K8XA 2D0AA 5JH7A 1NJWA 3G10A 5LMUB 5FDLA 2KQ2A 4DRXB 3HO1A 1HR0B 4CFBA 1TGOA 5FNVB 4JI5B 4N5SA 1VSIA 1QS4A 3BAAA 3KLHA 3B2EE 3VQ7A 3B6PA 1A5VA 5HROA 2PUSA 4E1MA 2HB5A 3V1OA 3K5MA 4E89A 5IJ0B 4X62B 1EP4A 4E19A 4B3TB 3HKCA 2O4GA 3OYBA 3DMJA 3ZT4A 4MFBA 2G8KA 3OYLA 4KTWA 3LALA 3RWRD 5C42A 3PUFA 2G8FA 4BE0A 5GONB 4BE1A 3RYIB 3KTQA 3LNNA 4O4IA 1ZAUA 4OGCA 3HKBB 3ICXA 1S1UA 1M4UA 1N34B 3OYCA 3HKCB 1ZBLA 3TAQA 3JARB 3AVLA 5LOVA 5IJ9A 4FXDA 1JLQA 3AVKA 4O4HA 5FNVA 4O2BB 4DRXA 4TV9B 1S1TA 4BDPA 4OPJA 5DMRA 3ZT2A 5J2QA 2EX3A 3ULDA 3K5OA 3SPYA 4CESA 1BIUA 5JVDB 2Q3SA 3ASMA 2F8SA 5K1XA 5KHJA 3RYCB 3K58A 3LZIA 2ZM6B 4B9SA 2YXLA 3N2KB 4KPYA 1RT4A 3WNFA 4X1KA 2HEPA 2OPPA 3BHPA 3SUPA 4N41A 2CAZC 4JI8B 4X66B 5LXTB 1TV6A 1NK4A 1C0MA 2Z1HA 4FFBB 4OJRA 2F66C 4F6RB 3FI7A 5HLFA 4FLTA 3LP1A 3VA3A 5JJEB 3OYFA 4LSNA 3RYFB 4H4MA 1WLJA 2OA8A 3S3MA 3DLEA 1WSGA 2R9AA 1UAXA 1LW2A 4ID1A 4CCHA 4CC6A 5EIBC 4O2AB 2YIBA 4B9TA 4UCUA 1BCMA 5BR8B 2O4IA 1TA8A 4U3JA 3ZT0A 3HT3A 4G1QA 4Z4FA 3ZT1A 4C8OA 4GYCB 3AVJA 3KK1A 3N2GA 2OPQA 2XY6A 1SKWA 4J2EA 1J53A 3K2PA 3DLGA 4DTRA 1ASVA 4I7FA 4BDZA 2VG5A 4KHQA 4IFVA 1RBUA 3JSMA 3NBPA 4CIGA 1X9SA 4NXMB 4BWMA 1Y97A 3WNEA 5I42A 4TV8A 3CFRA 3SQ1A 4TV9A 1REVA 3HPHA 4CERA 2E6MA 3KD5E 4YFUA 1X4TA 4Z4GA 1MU2A 4OVLA 3LANA 4CH6A 5KX5A 2RQ6A 4UCTA 1SA0A 2B4JA 3JALA 4CFAA 3CFPA 1JFFA 1Z26A 4DTJA 3OYHA 1T7PA 2BTOA 1K6YA 2Z1IA 1LWCA 3HPOA 4KL1A 2UXBB 3NF7A 2E6LA 3TARA 3WNHA 4J2DA 1CZBA 2YIAA 2YKMA 3JATB 4CS4A 5FRNA 3RYIA 4KB1A 1RBTA 3SUNA 3C95A 3KLIA 4DV3B 4X65B 5HRNA 4CF1A 4FJ7A 4GW6A 4JLHA 2G8UA 3NH1A 2F1MA 4M45A 2IS3A 3HL8A 1L5UA 5KRSA 1IKVA 2F8TA 4GLXA 3NH0A 5LA6B 4LF5B 1H2SB 1U48A 3LDSA 4MQ3A 5KI6A 3ZS8C 4DR2B 4DU1A 1KSPA 1NK7A 5CB4A 3ZSXA 1BGXT 1EETA 2DFFA 2G8VA 3JASB 2PY5A 4FCYA 1Q9XA 1BCOA 1I3AA 4LSLA 1RSOA 3AVNA 2HHHB 1JLCA 1ITGA 4BACA 1VSFA 5CYMA 3TAGA 1S1XA 4JI6B 4ZHRA 4JI3B 4B8AB 3I0RA 2X6NA 4XIUA 3SGIA 3U3GA 2KKWA 4ZTFA 4UCRA 3KIOA 4LFBB 1NJYA 4FW2A 1RTDA 1P49A 5J2MA 4Y1CA 4FJ8A 4DR3B 4I55B 4DTPA 1Q9YA 5D5PA 3L2WA 1C0UA 2YIBD 4BW9A 1KVCA 3KKSA 2BDPA 4DTMA 1VF7A 4DR6B 1R0AA 4X1IA 3DRRA 2FBVA 5DK5A 4ELTA 4PWDA 3ZT3A 2OZSA 4UCOA 1JLEA 2ZIOA 4K8ZA 1J5EB 5CA0A 4Q6GA 1JFFB 1C1CA 4KHPB 5J2UA 4DTUA 4CJSA 2IAJA 2HNZA 1JL2A 4IIJA 2IDOA 1XHXA 4DV5B 2F4VB 3C6TA 3L3UA 1L3SA 3CHXA 4L8JA 3TWHA 1N36B 4CEBA 3TABA 1UA1A 1HNZB 3SNNA 4IFYA 2F93B 3AA3A 5KRTA 3SPZA 1XWLA 1UA0A 3TR8A 1IBLB 3BPZA 1C0TA 1RT6A 4I55A 3V9UA 1WSHA 2XY8A 4HUEA 5FRMA 4B3OA 1X1PA 4DMNA 3JAKB 2Q0AA 1Z25A 2P5OA 1RDAA 1YTUA 4X1KB 3ZSVA 1ASUA 1N32B 4OKJA 1HNVA 1TAQA 4Y1DA 4AHCA 4CS2A 3CYMA 4HTUA 3TI0A 1RT1A 4AQYB 3F73A 3HVTA 2Q7GA 5SZTA 4C8LA 4DV6B 4M42A 3V9SA 5LP6B 2DY4A 1BIZA 4PQUA 4JS4A 4JI0B 2I5JA 3CG7A 3AVCA 4OGEA 5CZ2A 3IS9A 3TAFA 3NH2A 2YNGA 2UUBB 2DFHA 4OLAA 3K57A 3QEVA 1NK5A 5IJ9B 4FZYA 4CEEA 2HHUA 3QIOA 3OJSA 4FFBA 4HHTA 5IWAB 3AVIA 3SQ2A 4DV4B 1UOCA 4QOZB 3PO5A 1KFSA 4M3WA 1FJGB 3SZ2A 5KMGA 3OYMA 4YHHB 3DRSA 4DR4B 2WONA 3N2KA 1HPZA 4FW1A 3DRPA 4QCLA 4TQFA 1YTAA 4I2PA 4KI6A 4TV8B 3OYAA 3AVHA 1BISA 2GV9A 3AA4A 3RMCA 4BWAA 4O55A 3QG5A 4CIEA 4JRQA 1DTTA 1VRUA 3LWLA 3BDPA 5J2NA 4AHRA 2XHBA 3KLGA 4IBNA 3JATA 4JI1B 3O3HA 4CFDA 2D0BA 5JCOC 1S9GA 4CF9A 4E1NA 4W5TA 5CYQA 3SUQA 5EU7A 1C1AA 4CK2A 1JMKC 1KVBA 1O9HA 5JH7B 3NGZA 4E7HA 1YVUA 4ELVA 4O4IB 1LWFA 1G6UA 1VSEA 1RT3A 4N56A 3VQ4A 1ZYQA 1D9FA 4CJWA 4W5OA 1A5WA 3JSNA 1IO2A 1W9HA 2PYLA 1T03A 2HHVA 3NCIA 4DU4A 1BQMA 1CLQA 4EZ9A 3JAKA 1KU9A 4JI2B 4FJ5A 5KMGB 1KLNA 4DQIA 2PYJA 2ZIMA 5CA1A 1GOCA 3AO5A 4HUGA 1B04A 3HKDB 3V1RA 3OJUA 4DV0B 3T1HB 3L2VA 3NE6A 4CFCA 1IKWA 1HYZA 2G8WA 4DSKA 1VSLA 3NDKA 2R70A 3SJCC 1EKEA 5JVDA 4HCBA 3SQ4A 4DR5B 2PGGA 2BANA 1QSSA 4F3TA 2WOMA 3AA5X 4O2BA 1J54A 1TAEA 3RMBA 3ETQA 1WNSA 5ITZB 5C8YB 1XMQB 4NYFA 5SWMA 4CF2A 5J2UB 4Z0UA 4DV2B 4CK1A 4YJ3B 4ELUA 5C8YA 5ITZA 3JARA 4FM1A 5KX5B 5FPOA 4FM2A 4CGGA 3L8BA 2OPRA 1KMIZ 3LWMA 1CXUA 4EFBA 4X1IB 2UU9B 3B6OA 2PW9A 5JQGB 1XNQB 1NOZA 2B6AA 3KKRA 3V4IA 5JCOA 3K59A 2HHXA 1FK9A 2HMIA 4KHUA 3A2FA 1KLMA 3IAYA 4B3MB 3RYCA 3UQ8A 1QSYA 3PN1A 4DQRA 4GMJB 4DLEA 4NVPA 3SJJA 1VSKA 4E0DA 4B9LA 1Q5OA 3WB1A 4F4KA 4X20A 4LR3A 4FLVA 3VQWA 1DGSA 2Q7HA 4YJ3A 4FZZA 1S5JA 4LFAB 3THOA 1O9GA 3NFAA 4CH3A 1WSIA 3PV8A 1S6QA 4E7LA 4DWIA 3IG1A 2Q7EA 2JVDA 1JLFA 4LNUB 3LAMA 1TK0A 2BE2A 1WSJA 2ATQA 1RDDA 3M8QA 1Z5VA 1S9EA 2XRIA 3ZSOA 1SQGA 3BRCA 3IRXA 4PUOA 2JGUA 4H8KA 4E7IA 3DYAA 4I2QA 4I9LA 2EHGA 1VSJA 4DSJA 1HNIA 5LA6A 4DF8A 3VQEA 4CEZA 3WB0A 3QF7A 4O5BA 3UIQA 1L8DA 1EXQA 1TKDA 3CM5A 3M7MX 3U11A 4DU3A 1QQCA 4IKFA 3OS2A 2X74A 1SQFA 4CHNA 3NGYA 4KKOA 4CEAA 4DSEA 2YKNA 4LH5A 4DTSA 4E7JA 1ZBFA 4TSXA 1IH7A 3V1QA 1NKEA 1C1BA 4CJRA 3KD1E 3AO3A 1SL0A 4RW8A 1W0HA 3SYZA 2UUAB 4B3SB 4GKJB 3HM9A 4IIJB 3VQ8A 1U45A 3MEDA 3JYTA 1LV5A 4Z4EA 4DSIA 1SA0B 1SL1A 1ZBIA 3AV9A 4I4TB 3THVA 4CHYA 2ETJA 1SKSA 4J2AA 2HVHA 2ZE2A 2HHSA 4X20B 3M8RA 3QESA 3RR8A 4LD0A 1CXQA 3HP6A 3VN5A 1RTHA 3QNNA 2KZMA 2YNFA 2R72A 4FJXA 4FLZA 4OKEA 5LP6A 4AH9A 4CJFA 4DTNA 4UCSA 3K5NA 1U04A 4LH7A 5BMVA 3FFQA 4KO0A 3ISNC 4EB6A 2YI9A 1LW0A 4M3RA 3SI6A 4F3OA 2A1SA 3VQYA 4AILC 3ZSZA 4YNQA 1TL1A 4DK1A 4DFJA 3ZCMA 1X9WA 4K0KB 1SUQA 3S3NA 3P1GA 4KV8A 1RCHA 4CJLA 1L3VA 2ZINA 4PHZA 1BL3A 4LH4A 4IG3A 3RGBA 3O4QA 3DSQA 3ALYA 1JL1A 4FJLA 1N6QA 4DQSA 4FK2A 4UFZA 1S1WA 3VQQA 3BGRA 2IOCA 4DFKA 4L8RB 3C94A 4F6RA 3OYKA 1RNHA 4D7TA 2FBTA 1T8EA 1WN7A 5CA1B 3DLRA 2G8IA 3KLEA 1TKZA 3L2UA 1IKXA 1HW7A 3O3GA 1BHLA 3I0SA 4ZTJA 4KRFA 2P51A 3SJAC 1TAUA 3S3OA 2YI8A 4ZOLA 5LMNB 3QO9A 1NK0A 5FPRA 4ZIBA 4W5NA 2QKKA 4Z4IA 3PY8A 4BE2A 3AA2A 1WSFA 3VA0A 2G8HA 1ZBHA 3VQDA 4RW4A 4KAZA 4DG1A 4JS5A 3MXMA 3RYFA 1NK6A 3KK2A 4EEQA 2YHAA 4FLYA 2RF2A 4DF4A 3AO2A 3BABA 4KHNA 3TAPA 4CJEA 3TAEA 4TQDA 2XO7A 3NF6A 4DFPA 1U47A 1S6PA 2P1JA 1TVKA 3T1YB 3U0ZA 3OYIA 1TK8A 4YY3B 3CFOA 2R7YA 4DTOA 4AHTA 4YJ2B 4W5QA 1IG9A 4LF8B 4FZXC 5J2TA 4RW7A 1NK9A 4CECA 2ZNIA 2QXFA 1SL2A 1XHZA 4CGDA 3M8PA 2NUBA 3HXMA 1S1VA 4B9VA 4IHJB 3JSLA 1WSEA 4LF9B 1FFXA 4DQQA 1T05A 3TANA 1HQEA 5KTQA 3E22A 1D5AA 3JAWB 5FROA 4CHQA 3AO1A 4LH6A 1L3TA 4FM0A 3HKEB 5EYPB 4B8CA 5K1PA 4UQGA 3E01A 4FK0A 2A1RA 5K14A 4Q5VA 5KHGA 4O2AA 3RRGA 1L3UA 3O4NA 3JASA 3SR2C 3HP9A 1N33B 4KB0A 4AHVA 3VQ5A 3VQCA 1NOYA 3BA8A 1NKCA 1HJRA 3D45A 3F9KA 3CQ8A 4GVMA 4OKKA 4RW9A 4CC5A 5KHKA 2YHBA 3RWUA 4KHYA 2R7FA 5JS2A 3WNGA 2QM4A 5CA0B 5HBMA 4CGIA 1KVAA 3DM2A 2GBZA 4GKKB 1M93A 4FJGA 4JYAB 1I39A 3VQ9A 3SV4A 3C6UA 4FJ9A 3MEEA 3AVMA 2RJZA 3KLFA 4CJQA 3QNOA 1NJXA 3SQ0A 3OVNA 4RG8A 4B9UA 3AVBA 1EX4A 5IYZA 1VSMA 4DUZB 1B9DA 4I50B 2P5GA