2EX9A

Crystal structure of penicillin binding protein 4 (dacb) from escherichia coli, complexed with penicillin-v
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
450
structure length
442
Chain Sequence
TQLPAGANLALMVQKVGASAPAIDYHSQQMALPASTQKVITALAALIQLGPDFRFTTTLETKGNVENGVLKGDLVARFGADPTLKRQDIRNMVATLKKSGVNQIDGNVLIDTSIFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSVSLYSAPKPGDMAFIRVASYYPVTMFSQVRTLPRGSAEAQYCELDVVPGDLNRFTLTGCLPQRSEPLPLAFAVQDGASYAGAILKYELKQAGITWSGTLLRQTQVNEPGTVVASKQSAPLHDLLKIMLKKSDNMIADTVFRMIGHARFNVPGTWRAGSDAVRQILRQQAGVDIGNTIIADGSGLSRHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGSLQGVYNLAGFITTASGQRMAFVQYLSGYAVEIPLVRFESRLYKDIYQNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein 4
publication title Crystal structure of penicillin binding protein 4 (dacB) from Escherichia coli, both in the native form and covalently linked to various antibiotics
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 140
structure length 442
sequence length 450
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2005-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2ex9A01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 2ex9A02
2B5RA 1H8ZA 2RCXA 3NIAA 3A3JA 4U0XA 1DJCA 3HLEA 2UWXA 3O3VA 1IYSA 5CGXA 4FD8A 2ZC3B 4QJGA 3UPOA 4U0TA 3FWLA 5FATA 1CEFA 3HREA 1O07A 1SDNA 3GRJA 1IYQA 1BLCA 3PBNA 3ZVTA 4BQMA 1W7FA 4JLFA 4KQQA 5CHUA 4C6YA 1YLJA 1MPLA 2G2WA 4OLGA 3VP3A 1N9BA 4MBKA 5FI6A 3W4OA 1MY8A 1K4FA 4E6XA 5CECA 3S1YA 1KE3A 5EE8A 4S2NA 3ZG8B 3UE0A 1FCOA 3HLFA 3HUMA 3LCEA 5CXWA 1ZKJA 1PI4A 1W5DA 3VOYA 4KG2A 3NY4A 1ZG6A 3GV9A 3RJUA 4WZ4A 3W8KA 1K56A 1PZOA 1GHMA 1LI9A 4N9KA 3HL9A 2XD1A 5FQKA 1XXMA 2CC1A 4ID4A 4KZ6A 1ES3A 2EX8A 3Q82A 3WS2A 2XGNA 3S4XA 4DKIA 3BRMA 3UPNA 3DTMA 3VP4A 5EVID 1GCEA 3VP1A 3HLBA 2WKIA 3Q7VB 3BFGA 1NZUA 2XFSA 4CJNA 1FSYA 1FR1A 4P85A 4R3JA 4EBPA 2ZJ9A 3CZDA 4P0MA 2DCFA 1VQQA 3Q81A 2H5SA 3N8RA 3ZGAB 1L2SA 5TGFA 5J8XA 3GMWA 1ESIA 5CGWA 1K55A 1TDGA 3ISGA 4DE1A 1E3UA 2QPNA 5E43A 5KSHA 4OP8A 1YM1A 4IBRA 4GZBA 1IKIA 3VFHA 4R23A 2IWBA 1YLYA 2OV5A 4N92A 4FCFA 2A3UA 4BLMA 3FV7A 2WADA 3ZVWA 5FDHA 4DE2A 3GVBA 2XLNA 4X69A 5EPHA 3NCKA 4GKUA 3PBQA 4XXRA 2ZMAA 2XF3A 3BM6A 1IELA 2ZD8A 3A3FA 1LLBA 2QZ6A 1J9MA 3HLCA 4C75A 4DXBA 5M18A 2Y91A 1SKFA 4DE3A 2WGIA 3O86A 2XK1A 2WUQA 2V1ZA 4KZ3A 3UNWA 2JC7A 3M6HA 2I72A 1Q2PA 3S22A 2Z2MB 5CRFA 5F1GA 4GD6A 4QHCA 5F82A 4WZ5C 5FQQA 4HBTA 2HP9A 3DWZA 4WMCD 4OLDA 1MWRA 3ZNTA 2HP5A 4KZAA 3M6BA 4R4RA 2VGKA 1DJAA 1NXYA 3WWXA 3GQZA 3FZCA 3VSKA 4JF4A 1H5XA 2H0YA 3N4IA 3N6IA 4R1GA 4WM9A 4DRTA 5GHZA 2X71A 4Y0OA 5EVIB 1JWZA 1EROA 5KSCA 3E2LA 3OCNA 4BJPA 2BLSA 5CTMA 2WZZA 5FQMA 5HW3A 4DDYA 4WYYA 1KGGA 5F1FA 2Y55A 3E2KA 1KDSA 5L2FA 3V5MA 1SDEA 4R0QA 2ZQ8A 2WGVA 5FAOA 4PM8A 3SH7A 3Q7ZA 3JYIA 2PU4A 4PM7A 4JXVA 4QY5A 5GLBA 5CGSA 3NDGA 5AQAA 1NYYA 2X01A 3O87A 3TOIA 1KE0A 4IBXA 3WS4A 4R4SA 1KDWA 3ZNYA 1XA1A 3V50A 1K57C 4OVDA 1K55C 1CK3A 1BULA 4OOMA 4YFMA 3HLGA 1PZPA 3AGFA 1MXOA 1EI5A 3G30A 4E3MA 1K38A 2ZM2A 1CI8A 3AGEA 4E3LA 5FAQA 3HLWA 3MZEA 3A3DA 2WKHA 1BUEA 2P74A 5HAIA 1TEMA 3UY6A 4FSFA 4FH2A 2Y2PA 1K54A 1NRFA 1W79A 3GTCA 3IWQA 1XX2A 4D2OA 4EV4A 3HLDA 3VSLA 1MWSA 2HDRA 3VFFA 2EXBA 3HUOA 2DRWA 3IHBA 2EFUA 4JPMA 4M3KA 4GB7A 4MLLA 5DTKA 2XDMA 3VP2A 5HARA 2V20A 3PAGA 4UA9A 1H8YA 2EXAA 3SH9A 2RL3A 3PBSA 1HVBA 1JTDA 1XPBA 1C3BA 2Y2HA 5CERA 1O7EA 2XR0A 2C5WB 3HUNA 3UE1A 4UA6A 5CEBA 1PWDA 5CHJA 4P87A 2VGJA 1IYOA 2G2UA 5IHVA 2Y2LA 3A3IA 4EBNA 4Y7PA 4ZDXA 3ITBA 3N7WA 1MWUA 4BL2A 3MZFA 3BEBA 2WKEA 5AQ9A 5E2FA 1K25A 1HTZA 3NI9A 5DTSA 3LY3A 1BLPA 4DDSA 3NC8A 4KZ8A 2EX6A 4S2PA 1L0GA 5JYOA 4EUZA 2Z2LB 3C7UA 4NK3A 4Q8IA 1JTGA 1FSWA 3UN7A 5EOOA 1PW8A 1MKIA 2HDSA 1TDLA 2IWCA 4GNUA 5EVIA 4KZ7A 4OP5A 4P6BA 3UE3A 4OKPA 4E6WA 3MKFA 5BOHA 4OQ0A 1S0WA 4S2JA 4ZJ2A 3HBRA 2XEPA 1BLSA 1M40A 5GLCA 4OPQA 4JXSA 5EVLA 4X68A 4JF5A 3IF5A 1HZOA 4KQRA 4CPKA 1L0FA 4GD8A 1JWVA 3BLMA 3D4FA 2FFFB 1S6RA 4DE0A 4X6TA 3WS0A 1WE4A 4OQHA 5KMWA 3I7JA 1ALQA 2ZC7A 3VMAA 3HVFA 5TFQA 3IXHA 3GR2A 4KQOA 4OQIA 4MNRA 1WYCA 1W8YA 3NDEA 3CG5A 5GLDA 1LI0A 3EQUA 1FR6A 3PBTA 1ONGA 5G18A 2Y59A 2ZM8A 1Q2QA 3OPLA 4S2NC 3W4PA 3IF6A 5DF7A 2V2FF 1YQSA 1N4OA 3MXSA 4ZAMA 4RVAA 4LENA 1E4DA 3CMZA 4XUZA 4WEJA 4BD1A 1L0DA 5DTTA 4Y0TA 3BYDA 4JKTA 5A90A 4N1XA 1YLZA 2XH9A 5FQIA 1XGJA 2OLVA 3PBRA 1FOFA 1I2WA 3WRZA 4A5RA 1WYBA 4B4XA 5FAPA 3PTEA 1SHVA 4B88A 3ZG0A 3IXBA 3LO7A 5GL9A 4WMCA 1Y54A 3LEZA 2Q9NA 1XGIA 2Y2JA 2XQZA 3IQAA 5KZHA 3BLSA 4N9LA 1U60A 1YLTA 1KVLA 2QMIA 3C4OA 4MBHA 4RX3A 3ZFZA 3EQVA 3IWIA 5DF8A 4DXCA 5HX9A 4BL3A 3SS4A 4OPYA 4PM6A 1NY0A 4HEFA 2ZC4B 1PWGA 4KENB 3SS5A 3OC2A 1MWTA 1TVFA 2Y2NA 3BFFA 1XKZA 2Y2KA 5EOEA 1GA9A 2WZXA 3G35A 3O88A 5EVIC 3G31A 5AQBA 3CJMA 1ESUA 3BFEA 1NZOA 3RXWA 5FQ9A 2WK0A 1ERMA 3SH8A 2DNSA 4UA7A 1XP4A 1PIOA 3N8SA 1ES5A 3ZDJA 3IF6B 4KG5A 2ZC6B 4ZJ1A 5HFOA 1K4EA 1NJ4A 3VOZA 2JCHA 5EECA 1PI5A 4OPZA 1JVJA 4E3NA 5EUAA 4X53A 2HDUA 2WAFA 3PAEA 5GLAA 2PBYA 4E3KA 3UO9A 5FI7A 4E3OA 4MEZA 4PMAA 3DWKA 1BTLA 2Y2GA 2P9VA 4R3BA 5JYPA 3C7VA 1VM1A 4HBUA 4OOLA 1LL9A 1KVMA 3IXGA 3MXRA 3OCLA 1PYYA 2XD5A 2E8IA 5CTNA 4HESA 4NETA 3ZHHA 1BLHA 2R9WA 5AQ7A 4S2LA 1RGZA 4LV2A 4B4ZA 1KGEA 4KZ9A 3MKEA 5E2GA 5A93A 5CHMA 1ONHA 4IVIA 4LV0A 2WYXA 2J9OA 2ZM0A 1CEGA 1KE4A 2H0TA 2OLUA 3G34A 2EX9A 4OOYA 5E2EA 5HAQA 4GDBA 3MBZA 2JE5A 1GHIA 3IH9A 4S2KA 3AGDA 5FQJA 1MBLA 4S2IA 4XUXA 4EQIA 2BG1A 4DF6A 2ZQAA 1K56D 3ZCZA 5HAPA 3Q1FA 3MFDA 5FASA 3PBOA 2C6WB 4WZ5A 1LHYA 1Z6FA 4GDNA 4BD0A 4Y0UA 4E3IA 3GSGA 1YT4A 1K6RA 4IVKA 1FCNA 3V3RA 3MZDA 2J7VA 1ERQA 2HPBA 1IYPA 2P9VB 3G2YA 4S2OA 5DF9A 3RXXA 4PPRA 1OMEA 3OPRA 1M6KA 2ZQCA 3G2ZA 3P09A 2X02A 4Z9QA 4ZTKA 3IHAA 4S2MA 3WRTA 4O7DA 1CI9A 4F94A 1ES4A 3Q07A 4LV1A 3N8LA 1I5QA 5GHYA 3QHYA 1K54C 4JXWA 4N1HA 2H10A 1E3UD 3OPPA 4YINA 5FSRA 3QNBA 4KG6A 5U47A 5A92A 2HDQA 4LCMA 3G4PA 3ITAA 1IKGA 3P98A 5M19A 1YMSA 2WGWA 2J8YA 1JWPA 1K57A 2Y2IA 3B3XA 1KGFA 4LV3A 3FKVA 4WELA 3OZHA 4PM5A 1QMFA 4GN2A 1IEMA 2EX2A 4QB8A 3A3EA 3SOIA 1YLWA 1AXBA 3DW0A 3NBLA 5M1AA 4X55A 1ES2A 1FQGA 3BECA 4LCLA 2Y2OA 1QMEA 3IT9A 4H8RA 1G68A 2Y2MA 5TR7A 4MBFA 3BFDA 4EWFA 1SCWA 2JBFA 4K0XA 1GHPA 4IEDA 4UAAA 5E2HA 4C3QA 3G32A 4RYEA 2FFYA 2WAEA 4QD4A 4KZ5A 3WS5A 3UPPA 3C4PA 4KZ4A 1RGYA 3WS1A 5I94A 4ZBEA 2J9PA 3UDFA 4EBLA 2EFXA 1DJBA 1HD8A 3W4QA 3IWOA 4JBFA 3LY4A 5CEDA 4OPRA 1I2SA 2ZQDA 3TG9A 5GHXA 1PW1A 1E25A 2ZLYA 2A49A 3C5AA 1NYMA 3UDXA 4E3JA 4WBGA 5FI2A 3IH8A 4K0WA 4L0LA 2HP6A 1BZAA 4ZJ3A 3VP0A 2WGWB 4OQGA 4OONA 3ZG9B 1G6AA 3TSGA 2PU2A 1LL5A 2ZQ9A 4QU3A 4RX2A 4UHUA 2OSUA 4PM9A 5D3OA 5DVAA 2Y4AA 4BENA 4QY6A 3UDIA 1XA7A 5A91A 2XFTA 2ZQ7A 5HL1A 3IXDA 4WEKA 3ZG5A 1FCMA 3BFCA 5FA7A 1DY6A 3V39A 2ZC5B 2GDNA 2R9XA 4JF6A 4RA7A 1RCJA 2Q9MA 1K6SA 1L0EA 2Y2QA 3FYZA 4X56A 3FKWA 1RP5A 3M2KA 3SS3A 4JXGA 1GA0A 3V3SA 4K91A 1EWZA 1YMXA 2IWDA 1ZC2A 1PWCA 4FH4A 3M2JA 1BSGA 4GOGA 3ZG7B 3OPHA 3IF6C 4U3TA 4KZBA 1BT5A 3Q7VA 4OH0A 1ZG4A 5F83A 3QNCA 1YLPA 1W8QA
chains in the Genus database with same CATH superfamily
2B5RA 3A3JA 4WL9A 3HLEA 5CGXA 1IYSA 4U0TA 4QWOA 3IX3A 1G28A 4S0JA 3HREA 1IYQA 1PFLA 4JLFA 4C6YA 1YLJA 3VP3A 1N9BA 4E6XA 2QKPA 3S1YA 1TS8A 3HUMA 4Y17A 3B33A 3LI9A 2VEAA 1NWZA 1PZOA 3GDIA 2CC1A 2QJ7A 1JKEA 2EX8A 2XGNA 4DKIA 1TD5A 3UPNA 3Q7VB 1FR1A 4EBPA 3GECA 3CZDA 1TF1A 3Q81A 3DAVA 5TGFA 3ISGA 3FG8A 1E3UA 4UEYA 3DTIA 5E43A 4N92A 3ZQ5A 4BLMA 3FV7A 4GKUA 4XXRA 3HLCA 2ZD8A 1LLBA 3OLOA 1OTAA 4KZ3A 3VE4A 3S7QA 3MR0A 1Q2PA 4HI4A 2JN7A 2HV1A 4GD6A 2PDRA 5F82A 1YAXA 4HBTA 2HP5A 2VGKA 3GQZA 4RQ9A 3F1OA 4R1GA 5EVIB 1JWZA 5KSCA 3E2LA 5HD3A 2CMNA 5CTMA 1ZHHB 1KGGA 5F1FA 5L2FA 4R0QA 3SH7A 4MDZA 2J80A 4IBXA 3ZNYA 4GS9A 1K57C 1CK3A 2PAVP 3T1SA 3HLGA 1PZPA 1MXOA 1EI5A 1K38A 5HWTA 2ZM2A 5FAQA 3HLWA 2J3TD 1XJ2A 4HJ3A 2ZOHA 4R70A 3VSLA 2HDRA 3VFFA 3IHBA 4B9OA 4JPMA 4RR9A 4JGQA 3T4KA 3VP2A 4IHQA 5HARA 4RRKA 3D72A 5CERA 3L9KA 3HUNA 1UWPX 3UE1A 4UA6A 5AVFA 4NBJA 4CQHA 2Y2LA 3A3IA 5F69A 2JKTM 3MZFA 3BEBA 2KX6A 1KOUA 5AQ9A 1VEUB 1K25A 3LY3A 3NULA 3BWLA 3T4TA 2W3DA 3E4PA 4GNUA 3F1NB 3UB5P 2VJWA 3MKFA 5BOHA 4FUWA 2W1RA 5HL6A 2HJ9C 2O0YA 1F98A 4KQRA 3D4FA 3LIFA 4X6TA 5KMWA 3KODA 2ZC7A 4NEED 3BY9A 3CG5A 3KNFA 5G18A 1Q2QA 3PD5A 3OPLA 4RRMA 1E4DA 4XUZA 4WEJA 3LR0A 3NECA 1L0DA 1YSPA 4JKTA 3IBJA 4EXOA 1YLZA 2XH9A 1XGJA 3PBRA 2W3FA 1FOFA 1WYBA 3UB6A 1SHVA 2B18A 3BLSA 3C4OA 4RX3A 5DF8A 1PNEA 3UMDA 4DN0A 2HL1A 1XKZA 2Y2KA 5EOEA 1DP8A 3T50A 4JGPA 1ZTUA 1S67L 5AQBA 3BFEA 3RXWA 5FQ9A 3N8SA 3H82A 3R7WB 5HFOA 1NJ4A 2JCHA 5EECA 1JVJA 3KO5A 5EUAA 4X53A 1G5UA 4E3KA 2V0WA 1BTLA 3T4SA 2P9VA 1LL9A 2E8IA 4DJ3A 4EU0A 3C8CA 1VHMA 4RRGA 5AQ7A 5HWWA 4B4ZA 1KGEA 2VV7A 4KZ9A 4JGOA 3IS2B 5CHMA 3IX8A 4GDBA 5IT5A 3PR6A 2O9CA 1MBLA 4S2IA 2ZQAA 3ZCZA 3MFDA 5FASA 3HJKA 4L9FA 3MJQA 1LHYA 2ZMFA 4E3IA 3GSGA 1YT4A 3PXPA 1FCNA 2GNXA 2J7VA 1ERQA 2HPBA 2BTFP 5DF9A 5F6AA 4Y5FA 1OMEA 3OPRA 4Z9QA 2W3GA 3JVUA 1XFNA 3P09A 2O9AA 3KNPA 3IHAA 1CI9A 4F94A 3Q07A 1I5QA 3H7WB 4H6JB 1K54C 4N1HA 3EGDC 1EW0A 5FSRA 5K5BA 3NOPC 4IJGA 4L9EA 3ITAA 4O8GA 3OZHA 2PHYA 4PM5A 2PYRA 1IEMA 4Y13A 2V0UA 3NBLA 3BECA 4LCLA 3IT9A 2W1TB 3KSFA 4H8RA 4R6LA 1YSQA 4GHIB 5E2HA 2FFYA 2WAEA 4NKPA 4RRFA 5EV0A 3LIBA 3UDFA 4LPZA 1DJBA 3W4QA 4JBFA 3LY4A 2L0WA 1E25A 4L0LA 5I5LA 2V8FA 3P01A 3VP0A 2WGWB 4OQGA 4RRBA 4OONA 4M4XA 3ZG9B 1LL5A 5DVAA 4BENA 2JKRI 4QY6A 3BFCA 2ZC5B 3RH8B 4Y2FA 3A0SA 4NXFA 3FYZA 3M2KA 4IUKA 1EWZA 5AJGA 1ZC2A 1BSGA 3F1PA 3ZG7B 4B93A 3IF6C 2VV8A 3Q7VA 4OH0A 3QNCA 1W63Q 1W8QA 2RCXA 2L1MA 1CQAA 2UWXA 4QJGA 4FD8A 3UPOA 1FIKA 5FATA 1CEFA 4UQIM 1O07A 1SDNA 3PBNA 4F3LB 3O5YA 4RR7A 2ACGA 3ZVTA 4KQQA 3E4OA 5MC7A 3RTYA 4LFUA 3W4OA 5CECA 4MBKA 1MY8A 1K4FA 4BMWA 5EE8A 4S2NA 1Z09A 3HLFA 5CXWA 4X1MA 4WLAA 3E4QA 3NY4A 1ZG6A 2JHEA 4NXEA 1A0KA 1P9WA 3T4LA 4EESA 1HLUP 1GHMA 1LI9A 2W27A 2HGVA 2V9AA 4N9KA 5FQKA 1XXMA 3MMHA 4ID4A 4KZ6A 3Q82A 3WS2A 3VOLA 3D3OA 3VP4A 1GCEA 3HLBA 2WKIA 2XRNA 3LR3A 2AVXA 3LMVA 2ZJ9A 1VQQA 3ZGAB 3C2WA 1ESIA 2Y79A 1LL8A 3TW8A 3QP4A 2QPNA 3KYZA 1YM1A 4HQAA 3EOIA 2IWBA 2OV5A 1YLYA 2A3UA 3GVBA 4MN6A 4X69A 3NCKA 3NHQA 3PBQA 2XF3A 4C75A 1J9MA 5M18A 1SKFA 3EGXC 2V1ZA 2JC7A 4UQIS 2W3HA 2Z2MB 5F5YA 2GZAA 3W2ZA 4QHCA 1MZUA 3DWZA 3MS6A 4KZAA 1LSWA 3KO6A 3R4KA 1NXYA 4WUJA 2H0YA 3N4IA 4DRTA 2X71A 4Y0OA 3S7NA 3OCNA 4BJPA 2BLSA 5HPFA 3CLOA 5FQMA 4CLCB 2ZL1A 4DDYA 5DJTA 3FPWA 4Z1WA 4Q0JA 2WGVA 5FAOA 4RRHA 3JYIA 4PM7A 5CGSA 5AQAA 3P7NA 3TOIA 1Y28A 3WS4A 4R4SA 1OTBA 1KDWA 1D7EA 3DBAA 1XA1A 3T4JA 1OPXA 4OOMA 4GCZA 3G30A 2VZWA 1CI8A 3AGEA 4E3LA 1VEUA 1TEMA 4S0KA 4FH2A 1NRFA 1W79A 3LIEA 4G3KA 3IWQA 1XX2A 1VETB 1CF0A 4EV4A 4PKYG 4RRIA 4HP4A 3H9WA 4LRXC 2EFUA 4M3KA 4GB7A 4MLLA 5DTKA 3F1NA 5F68A 2DBOA 2OWJA 4L9GA 4UA9A 2GJ3A 2RL3A 1LSVA 1JTDA 1SKOB 1C3BA 3PYPA 4EQ1A 4P87A 1IYOA 2G2UA 4AFIA 5IHVA 4ZDXA 5HDSA 3ITBA 3N7WA 4BL2A 2WKEA 5E2FA 1HTZA 5DTSA 1BLPA 3KSHA 4DDSA 3NC8A 4KZ8A 2EX6A 4S2PA 4BBVA 1L0GA 1OJ5A 2Z2LB 3CUEC 4ZRRA 4NK3A 4Q8IA 1JTGA 1FSWA 2FZ0A 2HDSA 2IWCA 2Z6CA 2Y8HA 4OKPA 2W0NA 4ZJ2A 1DP9A 5HSQA 4X68A 4JF5A 3IF5A 4RRRA 1L0FA 3BLMA 5AVEA 4DE0A 3IBRA 3WS0A 1WE4A 4OQHA 3I7JA 1ODVA 5LBRA 5TFQA 3MF0A 1WYCA 4Y3IA 1W8YA 2WKRA 1LI0A 1FR6A 3PBTA 2ZM8A 3KSIA 3W4PA 3R7WA 4ZAMA 5EM0A 4LENA 1P0ZA 4Y0TA 3BYDA 5A90A 2M1CA 1XJ3A 4A5RA 4B4XA 3NJAA 1JNUA 2Q9NA 1XGIA 5CX7A 5KZHA 4N9LA 4KQDA 1U60A 1NLYA 2PBDP 1KVLA 3IWIA 5HX9A 3SS4A 3IS2A 1NY0A 2ZC4B 3OC2A 1NRJA 1MWTA 3BFFA 1GA9A 2WZXA 3O88A 3MSHA 2HL2A 3CJMA 1ERMA 3CWFA 2A24B 1P97A 3QP8A 1ES5A 3ZDJA 2ZC6B 3LFVA 4YNRA 1K4EA 2QWSA 3T1XA 2P08A 4PHTA 4E3NA 2HDUA 5GLAA 4I38A 3UO9A 4MEZA 4PMAA 3DWKA 2Y2GA 2O99A 4OOLA 1VM1A 4HBUA 3OCLA 2XD5A 5A8BA 4P6ZM 1RGZA 4LV2A 3H7WA 1NLZA 1IFQA 2J9OA 2ZM0A 1CEGA 2H0TA 2OLUA 2PT7A 2K2NA 3A0RA 4R3AA 3IH9A 4S2KA 3AGDA 4EQIA 3NOUC 4DF6A 1TS6A 3Q1FA 4WZ5A 4NG2A 4BD0A 2W1TA 2P04A 3V3RA 3MZDA 4S2OA 4GHIA 2W3EA 3RXXA 4PPRA 4BWIA 4ZTKA 1T18A 2HKZA 2KDKA 3N8LA 5GHYA 3HCYA 4JXWA 3BQAA 3UE6A 3OPPA 4YINA 4CLCD 4KG6A 4RR6A 5A92A 2WGWA 1S66L 2J8YA 1JWPA 4LGWA 1KGFA 4GN2A 3RFBA 2EX2A 4QB8A 4HNBA 1VB6A 3SOIA 1AXBA 3DW0A 3G6OA 3LEQA 1G68A 5TR7A 3BFDA 4EWFA 1N9NA 1GHPA 4C3QA 3G32A 3S7OA 4KZ5A 4EW7A 4KZ4A 1XJ6A 1RGYA 3WS1A 4ZBEA 1OT6A 2KOIA 3IWOA 1I2SA 2ZQDA 1PW1A 3C5AA 2A49A 1BZAA 4ZJ3A 4GLQA 3TSGA 4QU3A 3LI8A 4UHUA 4F3LA 3FC7A 4PM9A 5D3OA 2Y4AA 3OBFA 4S0IA 2XFTA 2ZQ7A 5L8MA 2A2LA 3ZG5A 3E0YA 3V39A 4GJ4A 4LRZE 4JF6A 4RA7A 1RCJA 1K6SA 4X56A 5EFWA 3SS3A 4ESPA 1YMXA 2L4RA 3M2JA 3OPHA 4U3TA 1BT5A 1ZG4A 5M19A 5IU1A 1H8ZA 1DJCA 3F1OB 2K31A 3PHYA 3GRJA 3T1QB 1BLCA 2G2WA 4OLGA 2VGLM 5TJJA 3ZG8B 1FCOA 1ZKJA 1PI4A 1W5DA 3VOYA 2V1BA 1XFQA 4EUVA 3HJIA 4BBUA 2XSSA 3CPTB 2XD1A 5HWVA 3BRMA 5TBMA 3DTMA 5EVID 3EEHA 3VP1A 4CJNA 3BFGA 1NZUA 2XFSA 1N9OA 4P85A 4R3JA 1Y2QA 3DTEA 4P0MA 2DCFA 2NUPC 4XT2A 1L2SA 2J3TC 5J8XA 3GMWA 5J3WA 3TJZC 4G3VA 1OJGA 5HD5A 4CLCA 1X0OA 2PYPA 4IBRA 3VFHA 2JKTI 1ACFA 4FCFA 3ZVWA 3QP6A 5FDHA 4DE2A 2XLNA 1UGUA 5EPHA 3SZTA 3MXQA 3A3FA 4HY8A 2Y91A 4DE3A 2WGIA 2QJ5A 2WUQA 3UNWA 2I72A 3C38A 4ARZA 5F1GA 2VGLS 5FQQA 2OAQ1 2HP9A 4WF0A 4OLDA 1MWRA 3LUQA 3M6BA 3WWXA 3KO4A 1VETA 2Q0OA 1H5XA 4WM9A 5GHZA 3T1RA 1EROA 4WYYA 2JKFA 2Y55A 3E2KA 1KDSA 3V5MA 3JVVA 1SDEA 1SKOA 2ZQ8A 3Q7ZA 4QY5A 4JXVA 3NDGA 4RR8A 2OWHA 3O87A 3V50A 4YFMA 1T1BA 4E3MA 2WKHA 3UY6A 1OTEA 2Y2PA 2OKVA 4D2OA 3HUOA 2DRWA 3VV4A 5IS1A 3L7HA 4RRLA 1DRMA 3QP5A 3LIAA 3SH9A 1HVBA 1XPBA 2Y2HA 2C5WB 3B47A 4EBNA 4I3JA 1MWUA 2YKHA 3LMUA 4KUOA 3H82B 2PD7A 2WKQA 5G4YA 1V9YA 4EUZA 3C7UA 5EOOA 1PW8A 1MKIA 1TDLA 5EVIA 3SW1A 4KZ7A 4OP5A 3UE3A 4E6WA 4OQ0A 1S0WA 5DJUA 1BLSA 2E8JA 4OPQA 4JXSA 3BY8A 1HZOA 1S6RA 2HJEA 4HIAA 1ALQA 2HL0A 3VMAA 2IA2A 3HVFA 3GR2A 4KQOA 3A0VA 5EVEA 3NDEA 5GLDA 2Y59A 1MC0A 4S2NC 1GSWA 1YQSA 4E04A 4RVAA 4PKYA 3CMZA 4YOFA 4PAUA 3CHWP 5FQIA 2EWVA 2EWWA 1I2WA 5FAPA 3PTEA 4B88A 3B42A 1Y54A 3LEZA 4FOFA 4R38A 2XQZA 4Q0IA 1YLTA 2QMIA 4DXCA 2PR6A 4BL3A 4HEFA 1PWGA 4ETZA 3G35A 5EVIC 1N9LA 3MQOA 1ESUA 4DMZA 1NZOA 2R78A 2WK0A 2DNSA 4UA7A 1PRQA 3IF6B 2QHKA 4ZJ1A 4EERA 2B95A 1PI5A 3LIDA 2OOLA 2WAFA 3PAEA 4QPRA 2PBYA 4E3OA 1S4RA 4X1LA 3VE3A 1BYWA 3C7VA 4HJ4A 1KVMA 3IXGA 3MXRA 1PYYA 2VLGA 4HESA 1LSXA 3ZHHA 1D1JA 1BLHA 2R9WA 4MCWA 3MKEA 5E2GA 5A93A 2WYXA 1IOUA 3LR4A 1KE4A 2EX9A 4OOYA 5E2EA 4I39A 5FQJA 4XUXA 2BG1A 1K56D 5KIZA 4GDNA 2ZMVA 3K2NA 1S1YA 3G2YA 3T4QA 1M6KA 3G2ZA 2X02A 1TS0A 4MMNA 3F1PB 2GX5A 1ES4A 3QHYA 2H10A 1XJ4A 5U47A 3G4PA 3P98A 1STZA 1K57A 2Y2IA 4HH2A 1FILA 3FKVA 1QMFA 3ZYTA 3A3EA 1YLWA 1ES2A 2Y2OA 1QMEA 2K7SA 3NOTC 2Y2MA 4MBFA 1L3LA 4K0XA 4UAAA 3UB7A 3DTKA 4RRDA 1TC5A 5FDSA 2J9PA 4EBLA 5J7EA 2FH5A 4OPRA 3TG9A 2ZLYA 3C30A 4EETB 4K0WA 4NXBA 1G6AA 4CLCE 2PU2A 4RX2A 2OSUA 1T1AA 3UDIA 1XA7A 5HL1A 3U2AA 3IXDA 4WEKA 1FCMA 2ZOIA 4HP9A 2M7UA 2Q9MA 2KLIA 3D9YA 4K08A 3K3DA 3FKWA 1RP5A 3CPTA 1GA0A 3V3SA 1H8MA 2IWDA 3BW6A 1PWCA 4FH4A 4FTXA 1S1ZA 4HJ6A 4KZBA 4H6JA 4HH3A 4S2JA 2INWA 5F83A 5FEFA 3NIAA 2V1AA 4U0XA 3O3VA 2ZC3B 3FWLA 4MN5A 3MFXA 4HHDA 4ETXA 2ZL1B 4BQMA 3UMEA 4EEUA 1W7FA 5CHUA 1MPLA 2H28A 4I5SA 5FI6A 1KE3A 3UE0A 2PD8A 3LCEA 4KG2A 3GV9A 3RJUA 4NBIA 4WZ4A 3W8KA 1K56A 1GSVA 3HL9A 4RRQA 1YPRA 1ES3A 3KYEA 1SZVA 3S4XA 1P9RA 3ICYA 3MQ0A 5L07A 1FSYA 2ZBBA 2H5SA 3N8RA 2MJ6A 3KYQA 5CGWA 2OAP1 3KOCA 4X25A 1K55A 1TDGA 4DE1A 3KO7A 4OP8A 4IUHA 4GZBA 1IKIA 4R23A 3KX0X 2WADA 4Q0HA 3T12B 4P6ZS 2ZMAA 3BM6A 1V9ZA 1IELA 2QZ6A 4DXBA 2I9VA 4KUKA 3O86A 2XK1A 2P7JA 2JKRM 5FL3A 3M6HA 3S22A 5CRFA 4YWZA 1DP6A 1K0KA 4WZ5C 4WMCD 3ZNTA 1J7GA 3MQQA 2HF6A 4R4RA 1DJAA 3FZCA 3VSKA 4JF4A 3N6IA 4G3WA 2PRFA 4S02A 2WZZA 5HW3A 1Y4OA 2VA0A 4O0PA 3LR5A 1LT0A 4PM8A 2PU4A 5GLBA 1NYYA 2X01A 1KE0A 3ULFA 4OVDA 1K55C 1BULA 3AGFA 1H3QA 5C5KA 1MKMA 3MZEA 3A3DA 5DKKA 1BUEA 2P74A 5HAIA 3TRCA 4D60A 4FSFA 1K54A 3GTCA 2VX8A 1F5MA 3HLDA 5EM1A 1MWSA 3CI6A 2EXBA 4RRJA 1OTIA 3LICA 1J3WA 2XDMA 3BJNA 2LB5A 2V20A 3PAGA 1H8YA 2EXAA 3PBSA 5DFXA 1O7EA 2XR0A 5L10A 1OTDA 3UB9A 5CEBA 1OT9A 1PWDA 3QP1A 5CHJA 4GS9B 2VGJA 4Y7PA 1H0MA 1YKDA 5HZHA 5DFYA 3NI9A 4MN7A 4WN5A 5JYOA 3UN7A 4EEPA 3TE8A 2JKGA 2D02A 2PR5A 4P6BA 1F2KA 4I3IA 3UB8A 3HBRA 2XEPA 3K3CA 2QYBA 1M40A 3T4OA 2DMWA 2VKSA 5GLCA 1WA9A 5EVLA 4S0LA 3CAXA 2O9BA 5FEGA 2VK3A 2D01A 4CPKA 4GD8A 1JWVA 5KSHA 2FFFB 3PD4A 2BASA 2NUTC 3IXHA 4NXGA 4OQIA 3E98A 4MNRA 4RRCA 3EQUA 1ONGA 2XA7M 3QP2A 3IF6A 5DF7A 2V2FF 1N4OA 3MXSA 1CJFA 5DKLA 4BD1A 5DTTA 5HDDA 4N1XA 2VV6A 2OLVA 3WRZA 2LB9A 3IXBA 3LO7A 4I3AA 4WMCA 5GL9A 3ZG0A 2Y2JA 3LGOA 3IQAA 1UWNX 4MBHA 3ZFZA 3EQVA 3KO9A 4OPYA 4PM6A 4KENB 3SS5A 2WKPA 3S7PA 1TVFA 2Y2NA 4HOIA 3G31A 2Z6DA 2M7VA 1S4SA 4CLCC 3SH8A 1XP4A 1AWIA 1PIOA 4KG5A 3VOZA 2J3WA 4OPZA 5FI7A 4R3BA 5L09A 5JYPA 1G6OA 5HPIA 3PD3A 5CTNA 4NETA 5J61A 2YKFA 4S2LA 3OOVA 2XA7S 1W63M 1ONHA 4IVIA 4LV0A 1F9IA 3LYXA 3G34A 5HAQA 3MBZA 2JE5A 1GHIA 5G4ZA 5HAPA 2EA9A 3PBOA 2C6WB 1Z6FA 4Y0UA 3LMTA 3V67A 1K6RA 4IVKA 1TS7A 4O01A 1IYPA 2P9VB 2XROA 4GW9A 2ZQCA 2V8CA 4LLOB 3IX4A 4ME4A 4S2MA 3WRTA 4O7DA 4LV1A 1E3UD 3QNBA 1T1CA 2UV0E 2HDQA 4LCMA 1IKGA 1YMSA 3PD2A 3B3XA 4LV3A 4WELA 3FPVA 5M1AA 2A24A 4X55A 1FQGA 3EEAA 1SCWA 2JBFA 4IEDA 4Y15A 4DJ2A 5J4EA 4RYEA 4QD4A 5HDCA 3UPPA 3C4PA 3U4LP 3KOBA 1T19A 5I94A 5TBMB 2EFXA 1HD8A 5CEDA 5GHXA 3UDXA 4E3JA 1NYMA 4BBTA 3BQ8A 4WBGA 5FI2A 3IH8A 2HP6A 4XT2B 3KSGA 2ZQ9A 4II7A 1D06A 5A91A 2HZ5A 5FA7A 1DY6A 2GDNA 2R9XA 4LRYC 1GSXA 3CUEA 1L0EA 2Y2QA 3JPUA 3CITA 4RRAA 4JXGA 4K91A 4ARZB 4S03A 4JGRA 4GOGA 3KO3A 2G7UA 3EWKA 2B02A 3WS5A 1YLPA
chains in the Genus database with same CATH topology
2B5RA 1H8ZA 2RCXA 3NIAA 3A3JA 4U0XA 1DJCA 3HLEA 2UWXA 3O3VA 1IYSA 5CGXA 4FD8A 2ZC3B 4QJGA 3UPOA 4U0TA 3FWLA 5FATA 4S0JA 1CEFA 3HREA 1O07A 1SDNA 3GRJA 1IYQA 1BLCA 3PBNA 4RR7A 3ZVTA 4BQMA 1W7FA 4JLFA 4KQQA 5CHUA 4C6YA 1YLJA 1MPLA 2G2WA 4OLGA 3VP3A 1N9BA 4MBKA 5FI6A 3W4OA 1MY8A 1K4FA 4E6XA 5CECA 3S1YA 1KE3A 5EE8A 4S2NA 3ZG8B 3UE0A 1FCOA 3HLFA 3HUMA 3LCEA 5CXWA 1ZKJA 1PI4A 1W5DA 3VOYA 4KG2A 3NY4A 1ZG6A 3GV9A 3RJUA 4NBIA 4WZ4A 3W8KA 1K56A 1PZOA 1GHMA 1LI9A 4N9KA 3HL9A 2XD1A 5FQKA 1XXMA 2CC1A 4ID4A 4RRQA 4KZ6A 1JKEA 1ES3A 2EX8A 3Q82A 3WS2A 2XGNA 3S4XA 4DKIA 3BRMA 3UPNA 3DTMA 3VP4A 5EVID 1GCEA 3VP1A 3HLBA 2WKIA 3Q7VB 3BFGA 1NZUA 2XFSA 4CJNA 1FSYA 1FR1A 4P85A 4R3JA 4EBPA 1Y2QA 2ZJ9A 3LMVA 3CZDA 4P0MA 2DCFA 1VQQA 3Q81A 2H5SA 3N8RA 3ZGAB 1L2SA 5TGFA 5J8XA 3GMWA 1ESIA 5CGWA 3KOCA 1K55A 1TDGA 3ISGA 4DE1A 3KO7A 1E3UA 2QPNA 5E43A 5KSHA 4OP8A 1YM1A 4IBRA 4GZBA 1IKIA 3VFHA 4R23A 2IWBA 1YLYA 2OV5A 4N92A 4FCFA 2A3UA 4BLMA 3FV7A 2WADA 3ZVWA 5FDHA 4DE2A 3GVBA 2XLNA 4X69A 5EPHA 3NCKA 4GKUA 3PBQA 4XXRA 2ZMAA 2XF3A 3BM6A 1IELA 2ZD8A 3A3FA 1LLBA 2QZ6A 1J9MA 3HLCA 4C75A 4DXBA 5M18A 2Y91A 1SKFA 4DE3A 2WGIA 3O86A 2XK1A 2WUQA 2V1ZA 4KZ3A 3UNWA 2JC7A 3M6HA 2I72A 1Q2PA 3S22A 2Z2MB 5CRFA 5F1GA 4GD6A 4QHCA 5F82A 4WZ5C 5FQQA 4HBTA 2HP9A 3DWZA 4WMCD 4OLDA 1MWRA 3ZNTA 2HP5A 1J7GA 4KZAA 3M6BA 4R4RA 2VGKA 1DJAA 1NXYA 3WWXA 3GQZA 3FZCA 3KO4A 3VSKA 4JF4A 1H5XA 2H0YA 3N4IA 3N6IA 4R1GA 4WM9A 4DRTA 5GHZA 2X71A 4Y0OA 5EVIB 1JWZA 1EROA 5KSCA 3E2LA 3OCNA 4BJPA 2BLSA 5CTMA 4S02A 2WZZA 5FQMA 5HW3A 4DDYA 4WYYA 1KGGA 5F1FA 2Y55A 3E2KA 1KDSA 5L2FA 3V5MA 1SDEA 4R0QA 2ZQ8A 2WGVA 5FAOA 4PM8A 3SH7A 4RRHA 3Q7ZA 3JYIA 2PU4A 4PM7A 4JXVA 4QY5A 5GLBA 5CGSA 3NDGA 5AQAA 1NYYA 4RR8A 2X01A 3O87A 3TOIA 1KE0A 4IBXA 3WS4A 4R4SA 1KDWA 3ZNYA 1XA1A 3V50A 1K57C 4OVDA 1K55C 1CK3A 1BULA 4OOMA 4YFMA 3HLGA 1PZPA 3AGFA 1MXOA 1EI5A 3G30A 4E3MA 1K38A 2ZM2A 1CI8A 3AGEA 4E3LA 5FAQA 3HLWA 3MZEA 3A3DA 2WKHA 1BUEA 2P74A 5HAIA 1TEMA 3UY6A 4S0KA 4FSFA 4FH2A 2Y2PA 1K54A 1NRFA 1W79A 3GTCA 2OKVA 3IWQA 1XX2A 4D2OA 4EV4A 3HLDA 3VSLA 1MWSA 2HDRA 4RRIA 3VFFA 2EXBA 3HUOA 2DRWA 4RRJA 3IHBA 2EFUA 4JPMA 4RR9A 4M3KA 4GB7A 4MLLA 5DTKA 2DBOA 2XDMA 3VP2A 4RRLA 5HARA 2V20A 4RRKA 3PAGA 4UA9A 1H8YA 2EXAA 3SH9A 2RL3A 3PBSA 1HVBA 1JTDA 1XPBA 1C3BA 2Y2HA 5CERA 1O7EA 2XR0A 2C5WB 3HUNA 3UE1A 4UA6A 5CEBA 1PWDA 4NBJA 5CHJA 4P87A 2VGJA 1IYOA 2G2UA 5IHVA 2Y2LA 3A3IA 4EBNA 4Y7PA 4ZDXA 3ITBA 3N7WA 1MWUA 4BL2A 3MZFA 3BEBA 3LMUA 2WKEA 5AQ9A 5E2FA 1K25A 1HTZA 3NI9A 5DTSA 3LY3A 1BLPA 4DDSA 3NC8A 4KZ8A 2EX6A 4S2PA 1L0GA 5JYOA 4EUZA 2Z2LB 3C7UA 4NK3A 4Q8IA 1JTGA 1FSWA 3UN7A 5EOOA 1PW8A 1MKIA 2HDSA 1TDLA 2IWCA 4GNUA 4RRRA 5EVIA 4KZ7A 4OP5A 4P6BA 3UE3A 4OKPA 4E6WA 3MKFA 5BOHA 4OQ0A 1S0WA 4S2JA 4ZJ2A 3HBRA 2XEPA 1BLSA 1M40A 5GLCA 4OPQA 4JXSA 5EVLA 4S0LA 4X68A 4JF5A 3IF5A 1HZOA 4KQRA 4CPKA 1L0FA 4GD8A 1JWVA 3BLMA 3D4FA 2FFFB 1S6RA 4DE0A 4X6TA 3WS0A 1WE4A 4OQHA 5KMWA 3KODA 3PD4A 3I7JA 1ALQA 2ZC7A 2HL0A 3VMAA 3HVFA 5TFQA 3IXHA 3GR2A 4KQOA 4OQIA 4MNRA 1WYCA 1W8YA 3NDEA 3CG5A 5GLDA 1LI0A 3EQUA 4RRCA 1FR6A 3PBTA 1ONGA 5G18A 2Y59A 2ZM8A 3KNFA 1Q2QA 3PD5A 3OPLA 4S2NC 3W4PA 3IF6A 5DF7A 2V2FF 1YQSA 1N4OA 3MXSA 4ZAMA 4RVAA 4RRMA 4LENA 1E4DA 3CMZA 4XUZA 4WEJA 4BD1A 1L0DA 5DTTA 4Y0TA 3BYDA 4JKTA 5A90A 4N1XA 1YLZA 2XH9A 5FQIA 1XGJA 2OLVA 3PBRA 1FOFA 1I2WA 3WRZA 4A5RA 1WYBA 4B4XA 5FAPA 3PTEA 1SHVA 4B88A 3ZG0A 3IXBA 3LO7A 5GL9A 4WMCA 1Y54A 3LEZA 2Q9NA 1XGIA 2Y2JA 2XQZA 3IQAA 5KZHA 3BLSA 4N9LA 1U60A 1YLTA 1KVLA 2QMIA 3C4OA 4MBHA 4RX3A 3ZFZA 3EQVA 3IWIA 5DF8A 4DXCA 3KO9A 5HX9A 4BL3A 3SS4A 4OPYA 4PM6A 1NY0A 4HEFA 2ZC4B 1PWGA 4KENB 3SS5A 3OC2A 2HL1A 1MWTA 1TVFA 2Y2NA 3BFFA 1XKZA 2Y2KA 5EOEA 1GA9A 2WZXA 3G35A 3O88A 5EVIC 2HL2A 3G31A 5AQBA 3CJMA 1ESUA 3BFEA 1NZOA 3RXWA 5FQ9A 2WK0A 1ERMA 3SH8A 2DNSA 4UA7A 1XP4A 1PIOA 3N8SA 1ES5A 3ZDJA 3IF6B 4KG5A 2ZC6B 4ZJ1A 5HFOA 1K4EA 1NJ4A 3VOZA 2JCHA 5EECA 1PI5A 4OPZA 1JVJA 4E3NA 3KO5A 5EUAA 4X53A 2HDUA 2WAFA 3PAEA 5GLAA 2PBYA 4E3KA 3UO9A 5FI7A 4E3OA 4MEZA 4PMAA 3DWKA 1BTLA 2Y2GA 2P9VA 4R3BA 5JYPA 3C7VA 1VM1A 4HBUA 4OOLA 1LL9A 1KVMA 3IXGA 3MXRA 3OCLA 1PYYA 2XD5A 2E8IA 5CTNA 3PD3A 4HESA 4NETA 5J61A 3ZHHA 1BLHA 4RRGA 2R9WA 5AQ7A 4S2LA 1RGZA 4LV2A 4B4ZA 1KGEA 4KZ9A 3MKEA 5E2GA 5A93A 5CHMA 1ONHA 4IVIA 4LV0A 2WYXA 2J9OA 2ZM0A 1CEGA 1KE4A 2H0TA 2OLUA 3G34A 2EX9A 4OOYA 5E2EA 5HAQA 4GDBA 3MBZA 2JE5A 1GHIA 3IH9A 4S2KA 3AGDA 5FQJA 1MBLA 4S2IA 4XUXA 4EQIA 2BG1A 4DF6A 2ZQAA 1K56D 3ZCZA 5HAPA 3Q1FA 3MFDA 5FASA 3PBOA 2C6WB 4WZ5A 1LHYA 1Z6FA 4GDNA 4BD0A 4Y0UA 4E3IA 3GSGA 1YT4A 3LMTA 1K6RA 4IVKA 1FCNA 3V3RA 3MZDA 2J7VA 1ERQA 2HPBA 1IYPA 2P9VB 3G2YA 4S2OA 5DF9A 3RXXA 4PPRA 1OMEA 3OPRA 1M6KA 2ZQCA 3G2ZA 3P09A 2X02A 4Z9QA 4ZTKA 3KNPA 3IHAA 4S2MA 3WRTA 4O7DA 1CI9A 4F94A 1ES4A 3Q07A 2HKZA 4LV1A 3N8LA 1I5QA 5GHYA 3QHYA 1K54C 4JXWA 4N1HA 2H10A 1E3UD 3OPPA 4YINA 5FSRA 3QNBA 4KG6A 4RR6A 5U47A 5A92A 2HDQA 4LCMA 3G4PA 3ITAA 1IKGA 3P98A 5M19A 1YMSA 2WGWA 3PD2A 2J8YA 1JWPA 1K57A 2Y2IA 3B3XA 1KGFA 4LV3A 3FKVA 4WELA 3OZHA 4PM5A 1QMFA 4GN2A 1IEMA 2EX2A 4QB8A 3A3EA 3SOIA 1YLWA 1AXBA 3DW0A 3NBLA 5M1AA 4X55A 1ES2A 1FQGA 3BECA 4LCLA 2Y2OA 1QMEA 3IT9A 4H8RA 1G68A 2Y2MA 5TR7A 4MBFA 3BFDA 4EWFA 1SCWA 2JBFA 4K0XA 1GHPA 4IEDA 4UAAA 5E2HA 4C3QA 3G32A 4RYEA 2FFYA 2WAEA 4QD4A 4KZ5A 4RRDA 3WS5A 3UPPA 3C4PA 4KZ4A 3KOBA 1RGYA 3WS1A 1TC5A 5I94A 4ZBEA 4RRFA 2J9PA 3UDFA 4EBLA 2EFXA 1DJBA 1HD8A 3W4QA 3IWOA 4JBFA 3LY4A 5CEDA 4OPRA 1I2SA 2ZQDA 3TG9A 5GHXA 1PW1A 1E25A 2ZLYA 2A49A 3C5AA 1NYMA 3UDXA 4E3JA 4WBGA 5FI2A 3IH8A 4K0WA 4L0LA 2HP6A 1BZAA 4ZJ3A 3VP0A 2WGWB 4OQGA 4RRBA 4OONA 3ZG9B 1G6AA 3TSGA 2PU2A 1LL5A 2ZQ9A 4QU3A 4RX2A 4UHUA 2OSUA 4PM9A 5D3OA 5DVAA 2Y4AA 4BENA 4QY6A 4S0IA 3UDIA 1XA7A 5A91A 2XFTA 2ZQ7A 5HL1A 3IXDA 4WEKA 3ZG5A 1FCMA 3BFCA 5FA7A 1DY6A 3V39A 2ZC5B 2GDNA 2R9XA 4JF6A 4RA7A 1RCJA 2Q9MA 1K6SA 1L0EA 2Y2QA 3FYZA 4X56A 3FKWA 1RP5A 3M2KA 3SS3A 4JXGA 1GA0A 3V3SA 4RRAA 4K91A 1EWZA 1YMXA 2IWDA 1ZC2A 1PWCA 4FH4A 4S03A 3M2JA 1BSGA 4GOGA 3ZG7B 3OPHA 3KO3A 3IF6C 4U3TA 4KZBA 1BT5A 3Q7VA 4OH0A 1ZG4A 5F83A 3QNCA 1YLPA 1W8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5R A;  1H8Z A;  2RCX A;  3NIA A;  3A3J A;  4U0X A;  1DJC A;  3HLE A;  2UWX A;  3O3V A;  1IYS A;  5CGX A;  4FD8 A;  2ZC3 B;  4QJG A;  3UPO A;  4U0T A;  3FWL A;  5FAT A;  1CEF A;  3HRE A;  1O07 A;  1SDN A;  3GRJ A;  1IYQ A;  1BLC A;  3PBN A;  3ZVT A;  4BQM A;  1W7F A;  4JLF A;  4KQQ A;  5CHU A;  4C6Y A;  1YLJ A;  1MPL A;  2G2W A;  4OLG A;  3VP3 A;  1N9B A;  4MBK A;  5FI6 A;  3W4O A;  1MY8 A;  1K4F A;  4E6X A;  5CEC A;  3S1Y A;  1KE3 A;  5EE8 A;  4S2N A;  3ZG8 B;  3UE0 A;  1FCO A;  3HLF A;  3HUM A;  3LCE A;  5CXW A;  1ZKJ A;  1PI4 A;  1W5D A;  3VOY A;  4KG2 A;  3NY4 A;  1ZG6 A;  3GV9 A;  3RJU A;  4WZ4 A;  3W8K A;  1K56 A;  1PZO A;  1GHM A;  1LI9 A;  4N9K A;  3HL9 A;  2XD1 A;  5FQK A;  1XXM A;  2CC1 A;  4ID4 A;  4KZ6 A;  1ES3 A;  2EX8 A;  3Q82 A;  3WS2 A;  2XGN A;  3S4X A;  4DKI A;  3BRM A;  3UPN A;  3DTM A;  3VP4 A;  5EVI D;  1GCE A;  3VP1 A;  3HLB A;  2WKI A;  3Q7V B;  3BFG A;  1NZU A;  2XFS A;  4CJN A;  1FSY A;  1FR1 A;  4P85 A;  4R3J A;  4EBP A;  2ZJ9 A;  3CZD A;  4P0M A;  2DCF A;  1VQQ A;  3Q81 A;  2H5S A;  3N8R A;  3ZGA B;  1L2S A;  5TGF A;  5J8X A;  3GMW A;  1ESI A;  5CGW A;  1K55 A;  1TDG A;  3ISG A;  4DE1 A;  1E3U A;  2QPN A;  5E43 A;  5KSH A;  4OP8 A;  1YM1 A;  4IBR A;  4GZB A;  1IKI A;  3VFH A;  4R23 A;  2IWB A;  1YLY A;  2OV5 A;  4N92 A;  4FCF A;  2A3U A;  4BLM A;  3FV7 A;  2WAD A;  3ZVW A;  5FDH A;  4DE2 A;  3GVB A;  2XLN A;  4X69 A;  5EPH A;  3NCK A;  4GKU A;  3PBQ A;  4XXR A;  2ZMA A;  2XF3 A;  3BM6 A;  1IEL A;  2ZD8 A;  3A3F A;  1LLB A;  2QZ6 A;  1J9M A;  3HLC A;  4C75 A;  4DXB A;  5M18 A;  2Y91 A;  1SKF A;  4DE3 A;  2WGI A;  3O86 A;  2XK1 A;  2WUQ A;  2V1Z A;  4KZ3 A;  3UNW A;  2JC7 A;  3M6H A;  2I72 A;  1Q2P A;  3S22 A;  2Z2M B;  5CRF A;  5F1G A;  4GD6 A;  4QHC A;  5F82 A;  4WZ5 C;  5FQQ A;  4HBT A;  2HP9 A;  3DWZ A;  4WMC D;  4OLD A;  1MWR A;  3ZNT A;  2HP5 A;  4KZA A;  3M6B A;  4R4R A;  2VGK A;  1DJA A;  1NXY A;  3WWX A;  3GQZ A;  3FZC A;  3VSK A;  4JF4 A;  1H5X A;  2H0Y A;  3N4I A;  3N6I A;  4R1G A;  4WM9 A;  4DRT A;  5GHZ A;  2X71 A;  4Y0O A;  5EVI B;  1JWZ A;  1ERO A;  5KSC A;  3E2L A;  3OCN A;  4BJP A;  2BLS A;  5CTM A;  2WZZ A;  5FQM A;  5HW3 A;  4DDY A;  4WYY A;  1KGG A;  5F1F A;  2Y55 A;  3E2K A;  1KDS A;  5L2F A;  3V5M A;  1SDE A;  4R0Q A;  2ZQ8 A;  2WGV A;  5FAO A;  4PM8 A;  3SH7 A;  3Q7Z A;  3JYI A;  2PU4 A;  4PM7 A;  4JXV A;  4QY5 A;  5GLB A;  5CGS A;  3NDG A;  5AQA A;  1NYY A;  2X01 A;  3O87 A;  3TOI A;  1KE0 A;  4IBX A;  3WS4 A;  4R4S A;  1KDW A;  3ZNY A;  1XA1 A;  3V50 A;  1K57 C;  4OVD A;  1K55 C;  1CK3 A;  1BUL A;  4OOM A;  4YFM A;  3HLG A;  1PZP A;  3AGF A;  1MXO A;  1EI5 A;  3G30 A;  4E3M A;  1K38 A;  2ZM2 A;  1CI8 A;  3AGE A;  4E3L A;  5FAQ A;  3HLW A;  3MZE A;  3A3D A;  2WKH A;  1BUE A;  2P74 A;  5HAI A;  1TEM A;  3UY6 A;  4FSF A;  4FH2 A;  2Y2P A;  1K54 A;  1NRF A;  1W79 A;  3GTC A;  3IWQ A;  1XX2 A;  4D2O A;  4EV4 A;  3HLD A;  3VSL A;  1MWS A;  2HDR A;  3VFF A;  2EXB A;  3HUO A;  2DRW A;  3IHB A;  2EFU A;  4JPM A;  4M3K A;  4GB7 A;  4MLL A;  5DTK A;  2XDM A;  3VP2 A;  5HAR A;  2V20 A;  3PAG A;  4UA9 A;  1H8Y A;  2EXA A;  3SH9 A;  2RL3 A;  3PBS A;  1HVB A;  1JTD A;  1XPB A;  1C3B A;  2Y2H A;  5CER A;  1O7E A;  2XR0 A;  2C5W B;  3HUN A;  3UE1 A;  4UA6 A;  5CEB A;  1PWD A;  5CHJ A;  4P87 A;  2VGJ A;  1IYO A;  2G2U A;  5IHV A;  2Y2L A;  3A3I A;  4EBN A;  4Y7P A;  4ZDX A;  3ITB A;  3N7W A;  1MWU A;  4BL2 A;  3MZF A;  3BEB A;  2WKE A;  5AQ9 A;  5E2F A;  1K25 A;  1HTZ A;  3NI9 A;  5DTS A;  3LY3 A;  1BLP A;  4DDS A;  3NC8 A;  4KZ8 A;  2EX6 A;  4S2P A;  1L0G A;  5JYO A;  4EUZ A;  2Z2L B;  3C7U A;  4NK3 A;  4Q8I A;  1JTG A;  1FSW A;  3UN7 A;  5EOO A;  1PW8 A;  1MKI A;  2HDS A;  1TDL A;  2IWC A;  4GNU A;  5EVI A;  4KZ7 A;  4OP5 A;  4P6B A;  3UE3 A;  4OKP A;  4E6W A;  3MKF A;  5BOH A;  4OQ0 A;  1S0W A;  4S2J A;  4ZJ2 A;  3HBR A;  2XEP A;  1BLS A;  1M40 A;  5GLC A;  4OPQ A;  4JXS A;  5EVL A;  4X68 A;  4JF5 A;  3IF5 A;  1HZO A;  4KQR A;  4CPK A;  1L0F A;  4GD8 A;  1JWV A;  3BLM A;  3D4F A;  2FFF B;  1S6R A;  4DE0 A;  4X6T A;  3WS0 A;  1WE4 A;  4OQH A;  5KMW A;  3I7J A;  1ALQ A;  2ZC7 A;  3VMA A;  3HVF A;  5TFQ A;  3IXH A;  3GR2 A;  4KQO A;  4OQI A;  4MNR A;  1WYC A;  1W8Y A;  3NDE A;  3CG5 A;  5GLD A;  1LI0 A;  3EQU A;  1FR6 A;  3PBT A;  1ONG A;  5G18 A;  2Y59 A;  2ZM8 A;  1Q2Q A;  3OPL A;  4S2N C;  3W4P A;  3IF6 A;  5DF7 A;  2V2F F;  1YQS A;  1N4O A;  3MXS A;  4ZAM A;  4RVA A;  4LEN A;  1E4D A;  3CMZ A;  4XUZ A;  4WEJ A;  4BD1 A;  1L0D A;  5DTT A;  4Y0T A;  3BYD A;  4JKT A;  5A90 A;  4N1X A;  1YLZ A;  2XH9 A;  5FQI A;  1XGJ A;  2OLV A;  3PBR A;  1FOF A;  1I2W A;  3WRZ A;  4A5R A;  1WYB A;  4B4X A;  5FAP A;  3PTE A;  1SHV A;  4B88 A;  3ZG0 A;  3IXB A;  3LO7 A;  5GL9 A;  4WMC A;  1Y54 A;  3LEZ A;  2Q9N A;  1XGI A;  2Y2J A;  2XQZ A;  3IQA A;  5KZH A;  3BLS A;  4N9L A;  1U60 A;  1YLT A;  1KVL A;  2QMI A;  3C4O A;  4MBH A;  4RX3 A;  3ZFZ A;  3EQV A;  3IWI A;  5DF8 A;  4DXC A;  5HX9 A;  4BL3 A;  3SS4 A;  4OPY A;  4PM6 A;  1NY0 A;  4HEF A;  2ZC4 B;  1PWG A;  4KEN B;  3SS5 A;  3OC2 A;  1MWT A;  1TVF A;  2Y2N A;  3BFF A;  1XKZ A;  2Y2K A;  5EOE A;  1GA9 A;  2WZX A;  3G35 A;  3O88 A;  5EVI C;  3G31 A;  5AQB A;  3CJM A;  1ESU A;  3BFE A;  1NZO A;  3RXW A;  5FQ9 A;  2WK0 A;  1ERM A;  3SH8 A;  2DNS A;  4UA7 A;  1XP4 A;  1PIO A;  3N8S A;  1ES5 A;  3ZDJ A;  3IF6 B;  4KG5 A;  2ZC6 B;  4ZJ1 A;  5HFO A;  1K4E A;  1NJ4 A;  3VOZ A;  2JCH A;  5EEC A;  1PI5 A;  4OPZ A;  1JVJ A;  4E3N A;  5EUA A;  4X53 A;  2HDU A;  2WAF A;  3PAE A;  5GLA A;  2PBY A;  4E3K A;  3UO9 A;  5FI7 A;  4E3O A;  4MEZ A;  4PMA A;  3DWK A;  1BTL A;  2Y2G A;  2P9V A;  4R3B A;  5JYP A;  3C7V A;  1VM1 A;  4HBU A;  4OOL A;  1LL9 A;  1KVM A;  3IXG A;  3MXR A;  3OCL A;  1PYY A;  2XD5 A;  2E8I A;  5CTN A;  4HES A;  4NET A;  3ZHH A;  1BLH A;  2R9W A;  5AQ7 A;  4S2L A;  1RGZ A;  4LV2 A;  4B4Z A;  1KGE A;  4KZ9 A;  3MKE A;  5E2G A;  5A93 A;  5CHM A;  1ONH A;  4IVI A;  4LV0 A;  2WYX A;  2J9O A;  2ZM0 A;  1CEG A;  1KE4 A;  2H0T A;  2OLU A;  3G34 A;  2EX9 A;  4OOY A;  5E2E A;  5HAQ A;  4GDB A;  3MBZ A;  2JE5 A;  1GHI A;  3IH9 A;  4S2K A;  3AGD A;  5FQJ A;  1MBL A;  4S2I A;  4XUX A;  4EQI A;  2BG1 A;  4DF6 A;  2ZQA A;  1K56 D;  3ZCZ A;  5HAP A;  3Q1F A;  3MFD A;  5FAS A;  3PBO A;  2C6W B;  4WZ5 A;  1LHY A;  1Z6F A;  4GDN A;  4BD0 A;  4Y0U A;  4E3I A;  3GSG A;  1YT4 A;  1K6R A;  4IVK A;  1FCN A;  3V3R A;  3MZD A;  2J7V A;  1ERQ A;  2HPB A;  1IYP A;  2P9V B;  3G2Y A;  4S2O A;  5DF9 A;  3RXX A;  4PPR A;  1OME A;  3OPR A;  1M6K A;  2ZQC A;  3G2Z A;  3P09 A;  2X02 A;  4Z9Q A;  4ZTK A;  3IHA A;  4S2M A;  3WRT A;  4O7D A;  1CI9 A;  4F94 A;  1ES4 A;  3Q07 A;  4LV1 A;  3N8L A;  1I5Q A;  5GHY A;  3QHY A;  1K54 C;  4JXW A;  4N1H A;  2H10 A;  1E3U D;  3OPP A;  4YIN A;  5FSR A;  3QNB A;  4KG6 A;  5U47 A;  5A92 A;  2HDQ A;  4LCM A;  3G4P A;  3ITA A;  1IKG A;  3P98 A;  5M19 A;  1YMS A;  2WGW A;  2J8Y A;  1JWP A;  1K57 A;  2Y2I A;  3B3X A;  1KGF A;  4LV3 A;  3FKV A;  4WEL A;  3OZH A;  4PM5 A;  1QMF A;  4GN2 A;  1IEM A;  2EX2 A;  4QB8 A;  3A3E A;  3SOI A;  1YLW A;  1AXB A;  3DW0 A;  3NBL A;  5M1A A;  4X55 A;  1ES2 A;  1FQG A;  3BEC A;  4LCL A;  2Y2O A;  1QME A;  3IT9 A;  4H8R A;  1G68 A;  2Y2M A;  5TR7 A;  4MBF A;  3BFD A;  4EWF A;  1SCW A;  2JBF A;  4K0X A;  1GHP A;  4IED A;  4UAA A;  5E2H A;  4C3Q A;  3G32 A;  4RYE A;  2FFY A;  2WAE A;  4QD4 A;  4KZ5 A;  3WS5 A;  3UPP A;  3C4P A;  4KZ4 A;  1RGY A;  3WS1 A;  5I94 A;  4ZBE A;  2J9P A;  3UDF A;  4EBL A;  2EFX A;  1DJB A;  1HD8 A;  3W4Q A;  3IWO A;  4JBF A;  3LY4 A;  5CED A;  4OPR A;  1I2S A;  2ZQD A;  3TG9 A;  5GHX A;  1PW1 A;  1E25 A;  2ZLY A;  2A49 A;  3C5A A;  1NYM A;  3UDX A;  4E3J A;  4WBG A;  5FI2 A;  3IH8 A;  4K0W A;  4L0L A;  2HP6 A;  1BZA A;  4ZJ3 A;  3VP0 A;  2WGW B;  4OQG A;  4OON A;  3ZG9 B;  1G6A A;  3TSG A;  2PU2 A;  1LL5 A;  2ZQ9 A;  4QU3 A;  4RX2 A;  4UHU A;  2OSU A;  4PM9 A;  5D3O A;  5DVA A;  2Y4A A;  4BEN A;  4QY6 A;  3UDI A;  1XA7 A;  5A91 A;  2XFT A;  2ZQ7 A;  5HL1 A;  3IXD A;  4WEK A;  3ZG5 A;  1FCM A;  3BFC A;  5FA7 A;  1DY6 A;  3V39 A;  2ZC5 B;  2GDN A;  2R9X A;  4JF6 A;  4RA7 A;  1RCJ A;  2Q9M A;  1K6S A;  1L0E A;  2Y2Q A;  3FYZ A;  4X56 A;  3FKW A;  1RP5 A;  3M2K A;  3SS3 A;  4JXG A;  1GA0 A;  3V3S A;  4K91 A;  1EWZ A;  1YMX A;  2IWD A;  1ZC2 A;  1PWC A;  4FH4 A;  3M2J A;  1BSG A;  4GOG A;  3ZG7 B;  3OPH A;  3IF6 C;  4U3T A;  4KZB A;  1BT5 A;  3Q7V A;  4OH0 A;  1ZG4 A;  5F83 A;  3QNC A;  1YLP A;  1W8Q A; 
#chains in the Genus database with same CATH topology
 2B5R A;  3A3J A;  4WL9 A;  3HLE A;  5CGX A;  1IYS A;  4U0T A;  4QWO A;  3IX3 A;  1G28 A;  4S0J A;  3HRE A;  1IYQ A;  1PFL A;  4JLF A;  4C6Y A;  1YLJ A;  3VP3 A;  1N9B A;  4E6X A;  2QKP A;  3S1Y A;  1TS8 A;  3HUM A;  4Y17 A;  3B33 A;  3LI9 A;  2VEA A;  1NWZ A;  1PZO A;  3GDI A;  2CC1 A;  2QJ7 A;  1JKE A;  2EX8 A;  2XGN A;  4DKI A;  1TD5 A;  3UPN A;  3Q7V B;  1FR1 A;  4EBP A;  3GEC A;  3CZD A;  1TF1 A;  3Q81 A;  3DAV A;  5TGF A;  3ISG A;  3FG8 A;  1E3U A;  4UEY A;  3DTI A;  5E43 A;  4N92 A;  3ZQ5 A;  4BLM A;  3FV7 A;  4GKU A;  4XXR A;  3HLC A;  2ZD8 A;  1LLB A;  3OLO A;  1OTA A;  4KZ3 A;  3VE4 A;  3S7Q A;  3MR0 A;  1Q2P A;  4HI4 A;  2JN7 A;  2HV1 A;  4GD6 A;  2PDR A;  5F82 A;  1YAX A;  4HBT A;  2HP5 A;  2VGK A;  3GQZ A;  4RQ9 A;  3F1O A;  4R1G A;  5EVI B;  1JWZ A;  5KSC A;  3E2L A;  5HD3 A;  2CMN A;  5CTM A;  1ZHH B;  1KGG A;  5F1F A;  5L2F A;  4R0Q A;  3SH7 A;  4MDZ A;  2J80 A;  4IBX A;  3ZNY A;  4GS9 A;  1K57 C;  1CK3 A;  2PAV P;  3T1S A;  3HLG A;  1PZP A;  1MXO A;  1EI5 A;  1K38 A;  5HWT A;  2ZM2 A;  5FAQ A;  3HLW A;  2J3T D;  1XJ2 A;  4HJ3 A;  2ZOH A;  4R70 A;  3VSL A;  2HDR A;  3VFF A;  3IHB A;  4B9O A;  4JPM A;  4RR9 A;  4JGQ A;  3T4K A;  3VP2 A;  4IHQ A;  5HAR A;  4RRK A;  3D72 A;  5CER A;  3L9K A;  3HUN A;  1UWP X;  3UE1 A;  4UA6 A;  5AVF A;  4NBJ A;  4CQH A;  2Y2L A;  3A3I A;  5F69 A;  2JKT M;  3MZF A;  3BEB A;  2KX6 A;  1KOU A;  5AQ9 A;  1VEU B;  1K25 A;  3LY3 A;  3NUL A;  3BWL A;  3T4T A;  2W3D A;  3E4P A;  4GNU A;  3F1N B;  3UB5 P;  2VJW A;  3MKF A;  5BOH A;  4FUW A;  2W1R A;  5HL6 A;  2HJ9 C;  2O0Y A;  1F98 A;  4KQR A;  3D4F A;  3LIF A;  4X6T A;  5KMW A;  3KOD A;  2ZC7 A;  4NEE D;  3BY9 A;  3CG5 A;  3KNF A;  5G18 A;  1Q2Q A;  3PD5 A;  3OPL A;  4RRM A;  1E4D A;  4XUZ A;  4WEJ A;  3LR0 A;  3NEC A;  1L0D A;  1YSP A;  4JKT A;  3IBJ A;  4EXO A;  1YLZ A;  2XH9 A;  1XGJ A;  3PBR A;  2W3F A;  1FOF A;  1WYB A;  3UB6 A;  1SHV A;  2B18 A;  3BLS A;  3C4O A;  4RX3 A;  5DF8 A;  1PNE A;  3UMD A;  4DN0 A;  2HL1 A;  1XKZ A;  2Y2K A;  5EOE A;  1DP8 A;  3T50 A;  4JGP A;  1ZTU A;  1S67 L;  5AQB A;  3BFE A;  3RXW A;  5FQ9 A;  3N8S A;  3H82 A;  3R7W B;  5HFO A;  1NJ4 A;  2JCH A;  5EEC A;  1JVJ A;  3KO5 A;  5EUA A;  4X53 A;  1G5U A;  4E3K A;  2V0W A;  1BTL A;  3T4S A;  2P9V A;  1LL9 A;  2E8I A;  4DJ3 A;  4EU0 A;  3C8C A;  1VHM A;  4RRG A;  5AQ7 A;  5HWW A;  4B4Z A;  1KGE A;  2VV7 A;  4KZ9 A;  4JGO A;  3IS2 B;  5CHM A;  3IX8 A;  4GDB A;  5IT5 A;  3PR6 A;  2O9C A;  1MBL A;  4S2I A;  2ZQA A;  3ZCZ A;  3MFD A;  5FAS A;  3HJK A;  4L9F A;  3MJQ A;  1LHY A;  2ZMF A;  4E3I A;  3GSG A;  1YT4 A;  3PXP A;  1FCN A;  2GNX A;  2J7V A;  1ERQ A;  2HPB A;  2BTF P;  5DF9 A;  5F6A A;  4Y5F A;  1OME A;  3OPR A;  4Z9Q A;  2W3G A;  3JVU A;  1XFN A;  3P09 A;  2O9A A;  3KNP A;  3IHA A;  1CI9 A;  4F94 A;  3Q07 A;  1I5Q A;  3H7W B;  4H6J B;  1K54 C;  4N1H A;  3EGD C;  1EW0 A;  5FSR A;  5K5B A;  3NOP C;  4IJG A;  4L9E A;  3ITA A;  4O8G A;  3OZH A;  2PHY A;  4PM5 A;  2PYR A;  1IEM A;  4Y13 A;  2V0U A;  3NBL A;  3BEC A;  4LCL A;  3IT9 A;  2W1T B;  3KSF A;  4H8R A;  4R6L A;  1YSQ A;  4GHI B;  5E2H A;  2FFY A;  2WAE A;  4NKP A;  4RRF A;  5EV0 A;  3LIB A;  3UDF A;  4LPZ A;  1DJB A;  3W4Q A;  4JBF A;  3LY4 A;  2L0W A;  1E25 A;  4L0L A;  5I5L A;  2V8F A;  3P01 A;  3VP0 A;  2WGW B;  4OQG A;  4RRB A;  4OON A;  4M4X A;  3ZG9 B;  1LL5 A;  5DVA A;  4BEN A;  2JKR I;  4QY6 A;  3BFC A;  2ZC5 B;  3RH8 B;  4Y2F A;  3A0S A;  4NXF A;  3FYZ A;  3M2K A;  4IUK A;  1EWZ A;  5AJG A;  1ZC2 A;  1BSG A;  3F1P A;  3ZG7 B;  4B93 A;  3IF6 C;  2VV8 A;  3Q7V A;  4OH0 A;  3QNC A;  1W63 Q;  1W8Q A;  2RCX A;  2L1M A;  1CQA A;  2UWX A;  4QJG A;  4FD8 A;  3UPO A;  1FIK A;  5FAT A;  1CEF A;  4UQI M;  1O07 A;  1SDN A;  3PBN A;  4F3L B;  3O5Y A;  4RR7 A;  2ACG A;  3ZVT A;  4KQQ A;  3E4O A;  5MC7 A;  3RTY A;  4LFU A;  3W4O A;  5CEC A;  4MBK A;  1MY8 A;  1K4F A;  4BMW A;  5EE8 A;  4S2N A;  1Z09 A;  3HLF A;  5CXW A;  4X1M A;  4WLA A;  3E4Q A;  3NY4 A;  1ZG6 A;  2JHE A;  4NXE A;  1A0K A;  1P9W A;  3T4L A;  4EES A;  1HLU P;  1GHM A;  1LI9 A;  2W27 A;  2HGV A;  2V9A A;  4N9K A;  5FQK A;  1XXM A;  3MMH A;  4ID4 A;  4KZ6 A;  3Q82 A;  3WS2 A;  3VOL A;  3D3O A;  3VP4 A;  1GCE A;  3HLB A;  2WKI A;  2XRN A;  3LR3 A;  2AVX A;  3LMV A;  2ZJ9 A;  1VQQ A;  3ZGA B;  3C2W A;  1ESI A;  2Y79 A;  1LL8 A;  3TW8 A;  3QP4 A;  2QPN A;  3KYZ A;  1YM1 A;  4HQA A;  3EOI A;  2IWB A;  2OV5 A;  1YLY A;  2A3U A;  3GVB A;  4MN6 A;  4X69 A;  3NCK A;  3NHQ A;  3PBQ A;  2XF3 A;  4C75 A;  1J9M A;  5M18 A;  1SKF A;  3EGX C;  2V1Z A;  2JC7 A;  4UQI S;  2W3H A;  2Z2M B;  5F5Y A;  2GZA A;  3W2Z A;  4QHC A;  1MZU A;  3DWZ A;  3MS6 A;  4KZA A;  1LSW A;  3KO6 A;  3R4K A;  1NXY A;  4WUJ A;  2H0Y A;  3N4I A;  4DRT A;  2X71 A;  4Y0O A;  3S7N A;  3OCN A;  4BJP A;  2BLS A;  5HPF A;  3CLO A;  5FQM A;  4CLC B;  2ZL1 A;  4DDY A;  5DJT A;  3FPW A;  4Z1W A;  4Q0J A;  2WGV A;  5FAO A;  4RRH A;  3JYI A;  4PM7 A;  5CGS A;  5AQA A;  3P7N A;  3TOI A;  1Y28 A;  3WS4 A;  4R4S A;  1OTB A;  1KDW A;  1D7E A;  3DBA A;  1XA1 A;  3T4J A;  1OPX A;  4OOM A;  4GCZ A;  3G30 A;  2VZW A;  1CI8 A;  3AGE A;  4E3L A;  1VEU A;  1TEM A;  4S0K A;  4FH2 A;  1NRF A;  1W79 A;  3LIE A;  4G3K A;  3IWQ A;  1XX2 A;  1VET B;  1CF0 A;  4EV4 A;  4PKY G;  4RRI A;  4HP4 A;  3H9W A;  4LRX C;  2EFU A;  4M3K A;  4GB7 A;  4MLL A;  5DTK A;  3F1N A;  5F68 A;  2DBO A;  2OWJ A;  4L9G A;  4UA9 A;  2GJ3 A;  2RL3 A;  1LSV A;  1JTD A;  1SKO B;  1C3B A;  3PYP A;  4EQ1 A;  4P87 A;  1IYO A;  2G2U A;  4AFI A;  5IHV A;  4ZDX A;  5HDS A;  3ITB A;  3N7W A;  4BL2 A;  2WKE A;  5E2F A;  1HTZ A;  5DTS A;  1BLP A;  3KSH A;  4DDS A;  3NC8 A;  4KZ8 A;  2EX6 A;  4S2P A;  4BBV A;  1L0G A;  1OJ5 A;  2Z2L B;  3CUE C;  4ZRR A;  4NK3 A;  4Q8I A;  1JTG A;  1FSW A;  2FZ0 A;  2HDS A;  2IWC A;  2Z6C A;  2Y8H A;  4OKP A;  2W0N A;  4ZJ2 A;  1DP9 A;  5HSQ A;  4X68 A;  4JF5 A;  3IF5 A;  4RRR A;  1L0F A;  3BLM A;  5AVE A;  4DE0 A;  3IBR A;  3WS0 A;  1WE4 A;  4OQH A;  3I7J A;  1ODV A;  5LBR A;  5TFQ A;  3MF0 A;  1WYC A;  4Y3I A;  1W8Y A;  2WKR A;  1LI0 A;  1FR6 A;  3PBT A;  2ZM8 A;  3KSI A;  3W4P A;  3R7W A;  4ZAM A;  5EM0 A;  4LEN A;  1P0Z A;  4Y0T A;  3BYD A;  5A90 A;  2M1C A;  1XJ3 A;  4A5R A;  4B4X A;  3NJA A;  1JNU A;  2Q9N A;  1XGI A;  5CX7 A;  5KZH A;  4N9L A;  4KQD A;  1U60 A;  1NLY A;  2PBD P;  1KVL A;  3IWI A;  5HX9 A;  3SS4 A;  3IS2 A;  1NY0 A;  2ZC4 B;  3OC2 A;  1NRJ A;  1MWT A;  3BFF A;  1GA9 A;  2WZX A;  3O88 A;  3MSH A;  2HL2 A;  3CJM A;  1ERM A;  3CWF A;  2A24 B;  1P97 A;  3QP8 A;  1ES5 A;  3ZDJ A;  2ZC6 B;  3LFV A;  4YNR A;  1K4E A;  2QWS A;  3T1X A;  2P08 A;  4PHT A;  4E3N A;  2HDU A;  5GLA A;  4I38 A;  3UO9 A;  4MEZ A;  4PMA A;  3DWK A;  2Y2G A;  2O99 A;  4OOL A;  1VM1 A;  4HBU A;  3OCL A;  2XD5 A;  5A8B A;  4P6Z M;  1RGZ A;  4LV2 A;  3H7W A;  1NLZ A;  1IFQ A;  2J9O A;  2ZM0 A;  1CEG A;  2H0T A;  2OLU A;  2PT7 A;  2K2N A;  3A0R A;  4R3A A;  3IH9 A;  4S2K A;  3AGD A;  4EQI A;  3NOU C;  4DF6 A;  1TS6 A;  3Q1F A;  4WZ5 A;  4NG2 A;  4BD0 A;  2W1T A;  2P04 A;  3V3R A;  3MZD A;  4S2O A;  4GHI A;  2W3E A;  3RXX A;  4PPR A;  4BWI A;  4ZTK A;  1T18 A;  2HKZ A;  2KDK A;  3N8L A;  5GHY A;  3HCY A;  4JXW A;  3BQA A;  3UE6 A;  3OPP A;  4YIN A;  4CLC D;  4KG6 A;  4RR6 A;  5A92 A;  2WGW A;  1S66 L;  2J8Y A;  1JWP A;  4LGW A;  1KGF A;  4GN2 A;  3RFB A;  2EX2 A;  4QB8 A;  4HNB A;  1VB6 A;  3SOI A;  1AXB A;  3DW0 A;  3G6O A;  3LEQ A;  1G68 A;  5TR7 A;  3BFD A;  4EWF A;  1N9N A;  1GHP A;  4C3Q A;  3G32 A;  3S7O A;  4KZ5 A;  4EW7 A;  4KZ4 A;  1XJ6 A;  1RGY A;  3WS1 A;  4ZBE A;  1OT6 A;  2KOI A;  3IWO A;  1I2S A;  2ZQD A;  1PW1 A;  3C5A A;  2A49 A;  1BZA A;  4ZJ3 A;  4GLQ A;  3TSG A;  4QU3 A;  3LI8 A;  4UHU A;  4F3L A;  3FC7 A;  4PM9 A;  5D3O A;  2Y4A A;  3OBF A;  4S0I A;  2XFT A;  2ZQ7 A;  5L8M A;  2A2L A;  3ZG5 A;  3E0Y A;  3V39 A;  4GJ4 A;  4LRZ E;  4JF6 A;  4RA7 A;  1RCJ A;  1K6S A;  4X56 A;  5EFW A;  3SS3 A;  4ESP A;  1YMX A;  2L4R A;  3M2J A;  3OPH A;  4U3T A;  1BT5 A;  1ZG4 A;  5M19 A;  5IU1 A;  1H8Z A;  1DJC A;  3F1O B;  2K31 A;  3PHY A;  3GRJ A;  3T1Q B;  1BLC A;  2G2W A;  4OLG A;  2VGL M;  5TJJ A;  3ZG8 B;  1FCO A;  1ZKJ A;  1PI4 A;  1W5D A;  3VOY A;  2V1B A;  1XFQ A;  4EUV A;  3HJI A;  4BBU A;  2XSS A;  3CPT B;  2XD1 A;  5HWV A;  3BRM A;  5TBM A;  3DTM A;  5EVI D;  3EEH A;  3VP1 A;  4CJN A;  3BFG A;  1NZU A;  2XFS A;  1N9O A;  4P85 A;  4R3J A;  1Y2Q A;  3DTE A;  4P0M A;  2DCF A;  2NUP C;  4XT2 A;  1L2S A;  2J3T C;  5J8X A;  3GMW A;  5J3W A;  3TJZ C;  4G3V A;  1OJG A;  5HD5 A;  4CLC A;  1X0O A;  2PYP A;  4IBR A;  3VFH A;  2JKT I;  1ACF A;  4FCF A;  3ZVW A;  3QP6 A;  5FDH A;  4DE2 A;  2XLN A;  1UGU A;  5EPH A;  3SZT A;  3MXQ A;  3A3F A;  4HY8 A;  2Y91 A;  4DE3 A;  2WGI A;  2QJ5 A;  2WUQ A;  3UNW A;  2I72 A;  3C38 A;  4ARZ A;  5F1G A;  2VGL S;  5FQQ A;  2OAQ 1;  2HP9 A;  4WF0 A;  4OLD A;  1MWR A;  3LUQ A;  3M6B A;  3WWX A;  3KO4 A;  1VET A;  2Q0O A;  1H5X A;  4WM9 A;  5GHZ A;  3T1R A;  1ERO A;  4WYY A;  2JKF A;  2Y55 A;  3E2K A;  1KDS A;  3V5M A;  3JVV A;  1SDE A;  1SKO A;  2ZQ8 A;  3Q7Z A;  4QY5 A;  4JXV A;  3NDG A;  4RR8 A;  2OWH A;  3O87 A;  3V50 A;  4YFM A;  1T1B A;  4E3M A;  2WKH A;  3UY6 A;  1OTE A;  2Y2P A;  2OKV A;  4D2O A;  3HUO A;  2DRW A;  3VV4 A;  5IS1 A;  3L7H A;  4RRL A;  1DRM A;  3QP5 A;  3LIA A;  3SH9 A;  1HVB A;  1XPB A;  2Y2H A;  2C5W B;  3B47 A;  4EBN A;  4I3J A;  1MWU A;  2YKH A;  3LMU A;  4KUO A;  3H82 B;  2PD7 A;  2WKQ A;  5G4Y A;  1V9Y A;  4EUZ A;  3C7U A;  5EOO A;  1PW8 A;  1MKI A;  1TDL A;  5EVI A;  3SW1 A;  4KZ7 A;  4OP5 A;  3UE3 A;  4E6W A;  4OQ0 A;  1S0W A;  5DJU A;  1BLS A;  2E8J A;  4OPQ A;  4JXS A;  3BY8 A;  1HZO A;  1S6R A;  2HJE A;  4HIA A;  1ALQ A;  2HL0 A;  3VMA A;  2IA2 A;  3HVF A;  3GR2 A;  4KQO A;  3A0V A;  5EVE A;  3NDE A;  5GLD A;  2Y59 A;  1MC0 A;  4S2N C;  1GSW A;  1YQS A;  4E04 A;  4RVA A;  4PKY A;  3CMZ A;  4YOF A;  4PAU A;  3CHW P;  5FQI A;  2EWV A;  2EWW A;  1I2W A;  5FAP A;  3PTE A;  4B88 A;  3B42 A;  1Y54 A;  3LEZ A;  4FOF A;  4R38 A;  2XQZ A;  4Q0I A;  1YLT A;  2QMI A;  4DXC A;  2PR6 A;  4BL3 A;  4HEF A;  1PWG A;  4ETZ A;  3G35 A;  5EVI C;  1N9L A;  3MQO A;  1ESU A;  4DMZ A;  1NZO A;  2R78 A;  2WK0 A;  2DNS A;  4UA7 A;  1PRQ A;  3IF6 B;  2QHK A;  4ZJ1 A;  4EER A;  2B95 A;  1PI5 A;  3LID A;  2OOL A;  2WAF A;  3PAE A;  4QPR A;  2PBY A;  4E3O A;  1S4R A;  4X1L A;  3VE3 A;  1BYW A;  3C7V A;  4HJ4 A;  1KVM A;  3IXG A;  3MXR A;  1PYY A;  2VLG A;  4HES A;  1LSX A;  3ZHH A;  1D1J A;  1BLH A;  2R9W A;  4MCW A;  3MKE A;  5E2G A;  5A93 A;  2WYX A;  1IOU A;  3LR4 A;  1KE4 A;  2EX9 A;  4OOY A;  5E2E A;  4I39 A;  5FQJ A;  4XUX A;  2BG1 A;  1K56 D;  5KIZ A;  4GDN A;  2ZMV A;  3K2N A;  1S1Y A;  3G2Y A;  3T4Q A;  1M6K A;  3G2Z A;  2X02 A;  1TS0 A;  4MMN A;  3F1P B;  2GX5 A;  1ES4 A;  3QHY A;  2H10 A;  1XJ4 A;  5U47 A;  3G4P A;  3P98 A;  1STZ A;  1K57 A;  2Y2I A;  4HH2 A;  1FIL A;  3FKV A;  1QMF A;  3ZYT A;  3A3E A;  1YLW A;  1ES2 A;  2Y2O A;  1QME A;  2K7S A;  3NOT C;  2Y2M A;  4MBF A;  1L3L A;  4K0X A;  4UAA A;  3UB7 A;  3DTK A;  4RRD A;  1TC5 A;  5FDS A;  2J9P A;  4EBL A;  5J7E A;  2FH5 A;  4OPR A;  3TG9 A;  2ZLY A;  3C30 A;  4EET B;  4K0W A;  4NXB A;  1G6A A;  4CLC E;  2PU2 A;  4RX2 A;  2OSU A;  1T1A A;  3UDI A;  1XA7 A;  5HL1 A;  3U2A A;  3IXD A;  4WEK A;  1FCM A;  2ZOI A;  4HP9 A;  2M7U A;  2Q9M A;  2KLI A;  3D9Y A;  4K08 A;  3K3D A;  3FKW A;  1RP5 A;  3CPT A;  1GA0 A;  3V3S A;  1H8M A;  2IWD A;  3BW6 A;  1PWC A;  4FH4 A;  4FTX A;  1S1Z A;  4HJ6 A;  4KZB A;  4H6J A;  4HH3 A;  4S2J A;  2INW A;  5F83 A;  5FEF A;  3NIA A;  2V1A A;  4U0X A;  3O3V A;  2ZC3 B;  3FWL A;  4MN5 A;  3MFX A;  4HHD A;  4ETX A;  2ZL1 B;  4BQM A;  3UME A;  4EEU A;  1W7F A;  5CHU A;  1MPL A;  2H28 A;  4I5S A;  5FI6 A;  1KE3 A;  3UE0 A;  2PD8 A;  3LCE A;  4KG2 A;  3GV9 A;  3RJU A;  4NBI A;  4WZ4 A;  3W8K A;  1K56 A;  1GSV A;  3HL9 A;  4RRQ A;  1YPR A;  1ES3 A;  3KYE A;  1SZV A;  3S4X A;  1P9R A;  3ICY A;  3MQ0 A;  5L07 A;  1FSY A;  2ZBB A;  2H5S A;  3N8R A;  2MJ6 A;  3KYQ A;  5CGW A;  2OAP 1;  3KOC A;  4X25 A;  1K55 A;  1TDG A;  4DE1 A;  3KO7 A;  4OP8 A;  4IUH A;  4GZB A;  1IKI A;  4R23 A;  3KX0 X;  2WAD A;  4Q0H A;  3T12 B;  4P6Z S;  2ZMA A;  3BM6 A;  1V9Z A;  1IEL A;  2QZ6 A;  4DXB A;  2I9V A;  4KUK A;  3O86 A;  2XK1 A;  2P7J A;  2JKR M;  5FL3 A;  3M6H A;  3S22 A;  5CRF A;  4YWZ A;  1DP6 A;  1K0K A;  4WZ5 C;  4WMC D;  3ZNT A;  1J7G A;  3MQQ A;  2HF6 A;  4R4R A;  1DJA A;  3FZC A;  3VSK A;  4JF4 A;  3N6I A;  4G3W A;  2PRF A;  4S02 A;  2WZZ A;  5HW3 A;  1Y4O A;  2VA0 A;  4O0P A;  3LR5 A;  1LT0 A;  4PM8 A;  2PU4 A;  5GLB A;  1NYY A;  2X01 A;  1KE0 A;  3ULF A;  4OVD A;  1K55 C;  1BUL A;  3AGF A;  1H3Q A;  5C5K A;  1MKM A;  3MZE A;  3A3D A;  5DKK A;  1BUE A;  2P74 A;  5HAI A;  3TRC A;  4D60 A;  4FSF A;  1K54 A;  3GTC A;  2VX8 A;  1F5M A;  3HLD A;  5EM1 A;  1MWS A;  3CI6 A;  2EXB A;  4RRJ A;  1OTI A;  3LIC A;  1J3W A;  2XDM A;  3BJN A;  2LB5 A;  2V20 A;  3PAG A;  1H8Y A;  2EXA A;  3PBS A;  5DFX A;  1O7E A;  2XR0 A;  5L10 A;  1OTD A;  3UB9 A;  5CEB A;  1OT9 A;  1PWD A;  3QP1 A;  5CHJ A;  4GS9 B;  2VGJ A;  4Y7P A;  1H0M A;  1YKD A;  5HZH A;  5DFY A;  3NI9 A;  4MN7 A;  4WN5 A;  5JYO A;  3UN7 A;  4EEP A;  3TE8 A;  2JKG A;  2D02 A;  2PR5 A;  4P6B A;  1F2K A;  4I3I A;  3UB8 A;  3HBR A;  2XEP A;  3K3C A;  2QYB A;  1M40 A;  3T4O A;  2DMW A;  2VKS A;  5GLC A;  1WA9 A;  5EVL A;  4S0L A;  3CAX A;  2O9B A;  5FEG A;  2VK3 A;  2D01 A;  4CPK A;  4GD8 A;  1JWV A;  5KSH A;  2FFF B;  3PD4 A;  2BAS A;  2NUT C;  3IXH A;  4NXG A;  4OQI A;  3E98 A;  4MNR A;  4RRC A;  3EQU A;  1ONG A;  2XA7 M;  3QP2 A;  3IF6 A;  5DF7 A;  2V2F F;  1N4O A;  3MXS A;  1CJF A;  5DKL A;  4BD1 A;  5DTT A;  5HDD A;  4N1X A;  2VV6 A;  2OLV A;  3WRZ A;  2LB9 A;  3IXB A;  3LO7 A;  4I3A A;  4WMC A;  5GL9 A;  3ZG0 A;  2Y2J A;  3LGO A;  3IQA A;  1UWN X;  4MBH A;  3ZFZ A;  3EQV A;  3KO9 A;  4OPY A;  4PM6 A;  4KEN B;  3SS5 A;  2WKP A;  3S7P A;  1TVF A;  2Y2N A;  4HOI A;  3G31 A;  2Z6D A;  2M7V A;  1S4S A;  4CLC C;  3SH8 A;  1XP4 A;  1AWI A;  1PIO A;  4KG5 A;  3VOZ A;  2J3W A;  4OPZ A;  5FI7 A;  4R3B A;  5L09 A;  5JYP A;  1G6O A;  5HPI A;  3PD3 A;  5CTN A;  4NET A;  5J61 A;  2YKF A;  4S2L A;  3OOV A;  2XA7 S;  1W63 M;  1ONH A;  4IVI A;  4LV0 A;  1F9I A;  3LYX A;  3G34 A;  5HAQ A;  3MBZ A;  2JE5 A;  1GHI A;  5G4Z A;  5HAP A;  2EA9 A;  3PBO A;  2C6W B;  1Z6F A;  4Y0U A;  3LMT A;  3V67 A;  1K6R A;  4IVK A;  1TS7 A;  4O01 A;  1IYP A;  2P9V B;  2XRO A;  4GW9 A;  2ZQC A;  2V8C A;  4LLO B;  3IX4 A;  4ME4 A;  4S2M A;  3WRT A;  4O7D A;  4LV1 A;  1E3U D;  3QNB A;  1T1C A;  2UV0 E;  2HDQ A;  4LCM A;  1IKG A;  1YMS A;  3PD2 A;  3B3X A;  4LV3 A;  4WEL A;  3FPV A;  5M1A A;  2A24 A;  4X55 A;  1FQG A;  3EEA A;  1SCW A;  2JBF A;  4IED A;  4Y15 A;  4DJ2 A;  5J4E A;  4RYE A;  4QD4 A;  5HDC A;  3UPP A;  3C4P A;  3U4L P;  3KOB A;  1T19 A;  5I94 A;  5TBM B;  2EFX A;  1HD8 A;  5CED A;  5GHX A;  3UDX A;  4E3J A;  1NYM A;  4BBT A;  3BQ8 A;  4WBG A;  5FI2 A;  3IH8 A;  2HP6 A;  4XT2 B;  3KSG A;  2ZQ9 A;  4II7 A;  1D06 A;  5A91 A;  2HZ5 A;  5FA7 A;  1DY6 A;  2GDN A;  2R9X A;  4LRY C;  1GSX A;  3CUE A;  1L0E A;  2Y2Q A;  3JPU A;  3CIT A;  4RRA A;  4JXG A;  4K91 A;  4ARZ B;  4S03 A;  4JGR A;  4GOG A;  3KO3 A;  2G7U A;  3EWK A;  2B02 A;  3WS5 A;  1YLP A; 
#chains in the Genus database with same CATH homology
 2B5R A;  1H8Z A;  2RCX A;  3NIA A;  3A3J A;  4U0X A;  1DJC A;  3HLE A;  2UWX A;  3O3V A;  1IYS A;  5CGX A;  4FD8 A;  2ZC3 B;  4QJG A;  3UPO A;  4U0T A;  3FWL A;  5FAT A;  4S0J A;  1CEF A;  3HRE A;  1O07 A;  1SDN A;  3GRJ A;  1IYQ A;  1BLC A;  3PBN A;  4RR7 A;  3ZVT A;  4BQM A;  1W7F A;  4JLF A;  4KQQ A;  5CHU A;  4C6Y A;  1YLJ A;  1MPL A;  2G2W A;  4OLG A;  3VP3 A;  1N9B A;  4MBK A;  5FI6 A;  3W4O A;  1MY8 A;  1K4F A;  4E6X A;  5CEC A;  3S1Y A;  1KE3 A;  5EE8 A;  4S2N A;  3ZG8 B;  3UE0 A;  1FCO A;  3HLF A;  3HUM A;  3LCE A;  5CXW A;  1ZKJ A;  1PI4 A;  1W5D A;  3VOY A;  4KG2 A;  3NY4 A;  1ZG6 A;  3GV9 A;  3RJU A;  4NBI A;  4WZ4 A;  3W8K A;  1K56 A;  1PZO A;  1GHM A;  1LI9 A;  4N9K A;  3HL9 A;  2XD1 A;  5FQK A;  1XXM A;  2CC1 A;  4ID4 A;  4RRQ A;  4KZ6 A;  1JKE A;  1ES3 A;  2EX8 A;  3Q82 A;  3WS2 A;  2XGN A;  3S4X A;  4DKI A;  3BRM A;  3UPN A;  3DTM A;  3VP4 A;  5EVI D;  1GCE A;  3VP1 A;  3HLB A;  2WKI A;  3Q7V B;  3BFG A;  1NZU A;  2XFS A;  4CJN A;  1FSY A;  1FR1 A;  4P85 A;  4R3J A;  4EBP A;  1Y2Q A;  2ZJ9 A;  3LMV A;  3CZD A;  4P0M A;  2DCF A;  1VQQ A;  3Q81 A;  2H5S A;  3N8R A;  3ZGA B;  1L2S A;  5TGF A;  5J8X A;  3GMW A;  1ESI A;  5CGW A;  3KOC A;  1K55 A;  1TDG A;  3ISG A;  4DE1 A;  3KO7 A;  1E3U A;  2QPN A;  5E43 A;  5KSH A;  4OP8 A;  1YM1 A;  4IBR A;  4GZB A;  1IKI A;  3VFH A;  4R23 A;  2IWB A;  1YLY A;  2OV5 A;  4N92 A;  4FCF A;  2A3U A;  4BLM A;  3FV7 A;  2WAD A;  3ZVW A;  5FDH A;  4DE2 A;  3GVB A;  2XLN A;  4X69 A;  5EPH A;  3NCK A;  4GKU A;  3PBQ A;  4XXR A;  2ZMA A;  2XF3 A;  3BM6 A;  1IEL A;  2ZD8 A;  3A3F A;  1LLB A;  2QZ6 A;  1J9M A;  3HLC A;  4C75 A;  4DXB A;  5M18 A;  2Y91 A;  1SKF A;  4DE3 A;  2WGI A;  3O86 A;  2XK1 A;  2WUQ A;  2V1Z A;  4KZ3 A;  3UNW A;  2JC7 A;  3M6H A;  2I72 A;  1Q2P A;  3S22 A;  2Z2M B;  5CRF A;  5F1G A;  4GD6 A;  4QHC A;  5F82 A;  4WZ5 C;  5FQQ A;  4HBT A;  2HP9 A;  3DWZ A;  4WMC D;  4OLD A;  1MWR A;  3ZNT A;  2HP5 A;  1J7G A;  4KZA A;  3M6B A;  4R4R A;  2VGK A;  1DJA A;  1NXY A;  3WWX A;  3GQZ A;  3FZC A;  3KO4 A;  3VSK A;  4JF4 A;  1H5X A;  2H0Y A;  3N4I A;  3N6I A;  4R1G A;  4WM9 A;  4DRT A;  5GHZ A;  2X71 A;  4Y0O A;  5EVI B;  1JWZ A;  1ERO A;  5KSC A;  3E2L A;  3OCN A;  4BJP A;  2BLS A;  5CTM A;  4S02 A;  2WZZ A;  5FQM A;  5HW3 A;  4DDY A;  4WYY A;  1KGG A;  5F1F A;  2Y55 A;  3E2K A;  1KDS A;  5L2F A;  3V5M A;  1SDE A;  4R0Q A;  2ZQ8 A;  2WGV A;  5FAO A;  4PM8 A;  3SH7 A;  4RRH A;  3Q7Z A;  3JYI A;  2PU4 A;  4PM7 A;  4JXV A;  4QY5 A;  5GLB A;  5CGS A;  3NDG A;  5AQA A;  1NYY A;  4RR8 A;  2X01 A;  3O87 A;  3TOI A;  1KE0 A;  4IBX A;  3WS4 A;  4R4S A;  1KDW A;  3ZNY A;  1XA1 A;  3V50 A;  1K57 C;  4OVD A;  1K55 C;  1CK3 A;  1BUL A;  4OOM A;  4YFM A;  3HLG A;  1PZP A;  3AGF A;  1MXO A;  1EI5 A;  3G30 A;  4E3M A;  1K38 A;  2ZM2 A;  1CI8 A;  3AGE A;  4E3L A;  5FAQ A;  3HLW A;  3MZE A;  3A3D A;  2WKH A;  1BUE A;  2P74 A;  5HAI A;  1TEM A;  3UY6 A;  4S0K A;  4FSF A;  4FH2 A;  2Y2P A;  1K54 A;  1NRF A;  1W79 A;  3GTC A;  2OKV A;  3IWQ A;  1XX2 A;  4D2O A;  4EV4 A;  3HLD A;  3VSL A;  1MWS A;  2HDR A;  4RRI A;  3VFF A;  2EXB A;  3HUO A;  2DRW A;  4RRJ A;  3IHB A;  2EFU A;  4JPM A;  4RR9 A;  4M3K A;  4GB7 A;  4MLL A;  5DTK A;  2DBO A;  2XDM A;  3VP2 A;  4RRL A;  5HAR A;  2V20 A;  4RRK A;  3PAG A;  4UA9 A;  1H8Y A;  2EXA A;  3SH9 A;  2RL3 A;  3PBS A;  1HVB A;  1JTD A;  1XPB A;  1C3B A;  2Y2H A;  5CER A;  1O7E A;  2XR0 A;  2C5W B;  3HUN A;  3UE1 A;  4UA6 A;  5CEB A;  1PWD A;  4NBJ A;  5CHJ A;  4P87 A;  2VGJ A;  1IYO A;  2G2U A;  5IHV A;  2Y2L A;  3A3I A;  4EBN A;  4Y7P A;  4ZDX A;  3ITB A;  3N7W A;  1MWU A;  4BL2 A;  3MZF A;  3BEB A;  3LMU A;  2WKE A;  5AQ9 A;  5E2F A;  1K25 A;  1HTZ A;  3NI9 A;  5DTS A;  3LY3 A;  1BLP A;  4DDS A;  3NC8 A;  4KZ8 A;  2EX6 A;  4S2P A;  1L0G A;  5JYO A;  4EUZ A;  2Z2L B;  3C7U A;  4NK3 A;  4Q8I A;  1JTG A;  1FSW A;  3UN7 A;  5EOO A;  1PW8 A;  1MKI A;  2HDS A;  1TDL A;  2IWC A;  4GNU A;  4RRR A;  5EVI A;  4KZ7 A;  4OP5 A;  4P6B A;  3UE3 A;  4OKP A;  4E6W A;  3MKF A;  5BOH A;  4OQ0 A;  1S0W A;  4S2J A;  4ZJ2 A;  3HBR A;  2XEP A;  1BLS A;  1M40 A;  5GLC A;  4OPQ A;  4JXS A;  5EVL A;  4S0L A;  4X68 A;  4JF5 A;  3IF5 A;  1HZO A;  4KQR A;  4CPK A;  1L0F A;  4GD8 A;  1JWV A;  3BLM A;  3D4F A;  2FFF B;  1S6R A;  4DE0 A;  4X6T A;  3WS0 A;  1WE4 A;  4OQH A;  5KMW A;  3KOD A;  3PD4 A;  3I7J A;  1ALQ A;  2ZC7 A;  2HL0 A;  3VMA A;  3HVF A;  5TFQ A;  3IXH A;  3GR2 A;  4KQO A;  4OQI A;  4MNR A;  1WYC A;  1W8Y A;  3NDE A;  3CG5 A;  5GLD A;  1LI0 A;  3EQU A;  4RRC A;  1FR6 A;  3PBT A;  1ONG A;  5G18 A;  2Y59 A;  2ZM8 A;  3KNF A;  1Q2Q A;  3PD5 A;  3OPL A;  4S2N C;  3W4P A;  3IF6 A;  5DF7 A;  2V2F F;  1YQS A;  1N4O A;  3MXS A;  4ZAM A;  4RVA A;  4RRM A;  4LEN A;  1E4D A;  3CMZ A;  4XUZ A;  4WEJ A;  4BD1 A;  1L0D A;  5DTT A;  4Y0T A;  3BYD A;  4JKT A;  5A90 A;  4N1X A;  1YLZ A;  2XH9 A;  5FQI A;  1XGJ A;  2OLV A;  3PBR A;  1FOF A;  1I2W A;  3WRZ A;  4A5R A;  1WYB A;  4B4X A;  5FAP A;  3PTE A;  1SHV A;  4B88 A;  3ZG0 A;  3IXB A;  3LO7 A;  5GL9 A;  4WMC A;  1Y54 A;  3LEZ A;  2Q9N A;  1XGI A;  2Y2J A;  2XQZ A;  3IQA A;  5KZH A;  3BLS A;  4N9L A;  1U60 A;  1YLT A;  1KVL A;  2QMI A;  3C4O A;  4MBH A;  4RX3 A;  3ZFZ A;  3EQV A;  3IWI A;  5DF8 A;  4DXC A;  3KO9 A;  5HX9 A;  4BL3 A;  3SS4 A;  4OPY A;  4PM6 A;  1NY0 A;  4HEF A;  2ZC4 B;  1PWG A;  4KEN B;  3SS5 A;  3OC2 A;  2HL1 A;  1MWT A;  1TVF A;  2Y2N A;  3BFF A;  1XKZ A;  2Y2K A;  5EOE A;  1GA9 A;  2WZX A;  3G35 A;  3O88 A;  5EVI C;  2HL2 A;  3G31 A;  5AQB A;  3CJM A;  1ESU A;  3BFE A;  1NZO A;  3RXW A;  5FQ9 A;  2WK0 A;  1ERM A;  3SH8 A;  2DNS A;  4UA7 A;  1XP4 A;  1PIO A;  3N8S A;  1ES5 A;  3ZDJ A;  3IF6 B;  4KG5 A;  2ZC6 B;  4ZJ1 A;  5HFO A;  1K4E A;  1NJ4 A;  3VOZ A;  2JCH A;  5EEC A;  1PI5 A;  4OPZ A;  1JVJ A;  4E3N A;  3KO5 A;  5EUA A;  4X53 A;  2HDU A;  2WAF A;  3PAE A;  5GLA A;  2PBY A;  4E3K A;  3UO9 A;  5FI7 A;  4E3O A;  4MEZ A;  4PMA A;  3DWK A;  1BTL A;  2Y2G A;  2P9V A;  4R3B A;  5JYP A;  3C7V A;  1VM1 A;  4HBU A;  4OOL A;  1LL9 A;  1KVM A;  3IXG A;  3MXR A;  3OCL A;  1PYY A;  2XD5 A;  2E8I A;  5CTN A;  3PD3 A;  4HES A;  4NET A;  5J61 A;  3ZHH A;  1BLH A;  4RRG A;  2R9W A;  5AQ7 A;  4S2L A;  1RGZ A;  4LV2 A;  4B4Z A;  1KGE A;  4KZ9 A;  3MKE A;  5E2G A;  5A93 A;  5CHM A;  1ONH A;  4IVI A;  4LV0 A;  2WYX A;  2J9O A;  2ZM0 A;  1CEG A;  1KE4 A;  2H0T A;  2OLU A;  3G34 A;  2EX9 A;  4OOY A;  5E2E A;  5HAQ A;  4GDB A;  3MBZ A;  2JE5 A;  1GHI A;  3IH9 A;  4S2K A;  3AGD A;  5FQJ A;  1MBL A;  4S2I A;  4XUX A;  4EQI A;  2BG1 A;  4DF6 A;  2ZQA A;  1K56 D;  3ZCZ A;  5HAP A;  3Q1F A;  3MFD A;  5FAS A;  3PBO A;  2C6W B;  4WZ5 A;  1LHY A;  1Z6F A;  4GDN A;  4BD0 A;  4Y0U A;  4E3I A;  3GSG A;  1YT4 A;  3LMT A;  1K6R A;  4IVK A;  1FCN A;  3V3R A;  3MZD A;  2J7V A;  1ERQ A;  2HPB A;  1IYP A;  2P9V B;  3G2Y A;  4S2O A;  5DF9 A;  3RXX A;  4PPR A;  1OME A;  3OPR A;  1M6K A;  2ZQC A;  3G2Z A;  3P09 A;  2X02 A;  4Z9Q A;  4ZTK A;  3KNP A;  3IHA A;  4S2M A;  3WRT A;  4O7D A;  1CI9 A;  4F94 A;  1ES4 A;  3Q07 A;  2HKZ A;  4LV1 A;  3N8L A;  1I5Q A;  5GHY A;  3QHY A;  1K54 C;  4JXW A;  4N1H A;  2H10 A;  1E3U D;  3OPP A;  4YIN A;  5FSR A;  3QNB A;  4KG6 A;  4RR6 A;  5U47 A;  5A92 A;  2HDQ A;  4LCM A;  3G4P A;  3ITA A;  1IKG A;  3P98 A;  5M19 A;  1YMS A;  2WGW A;  3PD2 A;  2J8Y A;  1JWP A;  1K57 A;  2Y2I A;  3B3X A;  1KGF A;  4LV3 A;  3FKV A;  4WEL A;  3OZH A;  4PM5 A;  1QMF A;  4GN2 A;  1IEM A;  2EX2 A;  4QB8 A;  3A3E A;  3SOI A;  1YLW A;  1AXB A;  3DW0 A;  3NBL A;  5M1A A;  4X55 A;  1ES2 A;  1FQG A;  3BEC A;  4LCL A;  2Y2O A;  1QME A;  3IT9 A;  4H8R A;  1G68 A;  2Y2M A;  5TR7 A;  4MBF A;  3BFD A;  4EWF A;  1SCW A;  2JBF A;  4K0X A;  1GHP A;  4IED A;  4UAA A;  5E2H A;  4C3Q A;  3G32 A;  4RYE A;  2FFY A;  2WAE A;  4QD4 A;  4KZ5 A;  4RRD A;  3WS5 A;  3UPP A;  3C4P A;  4KZ4 A;  3KOB A;  1RGY A;  3WS1 A;  1TC5 A;  5I94 A;  4ZBE A;  4RRF A;  2J9P A;  3UDF A;  4EBL A;  2EFX A;  1DJB A;  1HD8 A;  3W4Q A;  3IWO A;  4JBF A;  3LY4 A;  5CED A;  4OPR A;  1I2S A;  2ZQD A;  3TG9 A;  5GHX A;  1PW1 A;  1E25 A;  2ZLY A;  2A49 A;  3C5A A;  1NYM A;  3UDX A;  4E3J A;  4WBG A;  5FI2 A;  3IH8 A;  4K0W A;  4L0L A;  2HP6 A;  1BZA A;  4ZJ3 A;  3VP0 A;  2WGW B;  4OQG A;  4RRB A;  4OON A;  3ZG9 B;  1G6A A;  3TSG A;  2PU2 A;  1LL5 A;  2ZQ9 A;  4QU3 A;  4RX2 A;  4UHU A;  2OSU A;  4PM9 A;  5D3O A;  5DVA A;  2Y4A A;  4BEN A;  4QY6 A;  4S0I A;  3UDI A;  1XA7 A;  5A91 A;  2XFT A;  2ZQ7 A;  5HL1 A;  3IXD A;  4WEK A;  3ZG5 A;  1FCM A;  3BFC A;  5FA7 A;  1DY6 A;  3V39 A;  2ZC5 B;  2GDN A;  2R9X A;  4JF6 A;  4RA7 A;  1RCJ A;  2Q9M A;  1K6S A;  1L0E A;  2Y2Q A;  3FYZ A;  4X56 A;  3FKW A;  1RP5 A;  3M2K A;  3SS3 A;  4JXG A;  1GA0 A;  3V3S A;  4RRA A;  4K91 A;  1EWZ A;  1YMX A;  2IWD A;  1ZC2 A;  1PWC A;  4FH4 A;  4S03 A;  3M2J A;  1BSG A;  4GOG A;  3ZG7 B;  3OPH A;  3KO3 A;  3IF6 C;  4U3T A;  4KZB A;  1BT5 A;  3Q7V A;  4OH0 A;  1ZG4 A;  5F83 A;  3QNC A;  1YLP A;  1W8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...