2EX9A

Crystal structure of penicillin binding protein 4 (dacb) from escherichia coli, complexed with penicillin-v
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
450
structure length
442
Chain Sequence
TQLPAGANLALMVQKVGASAPAIDYHSQQMALPASTQKVITALAALIQLGPDFRFTTTLETKGNVENGVLKGDLVARFGADPTLKRQDIRNMVATLKKSGVNQIDGNVLIDTSIFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSVSLYSAPKPGDMAFIRVASYYPVTMFSQVRTLPRGSAEAQYCELDVVPGDLNRFTLTGCLPQRSEPLPLAFAVQDGASYAGAILKYELKQAGITWSGTLLRQTQVNEPGTVVASKQSAPLHDLLKIMLKKSDNMIADTVFRMIGHARFNVPGTWRAGSDAVRQILRQQAGVDIGNTIIADGSGLSRHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGSLQGVYNLAGFITTASGQRMAFVQYLSGYAVEIPLVRFESRLYKDIYQNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of penicillin binding protein 4 (dacB) from Escherichia coli, both in the native form and covalently linked to various antibiotics
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Penicillin-binding protein 4
total genus 140
structure length 442
sequence length 450
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2005-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2ex9A01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 2ex9A02
5EVIC 1CEFA 1FSYA 4X6TA 5F82A 1YMSA 1K55C 2Y4AA 5HAQA 1IYSA 3BFFA 2C5WB 1MKIA 1TDGA 1FCOA 5HAPA 5FAPA 1K57A 2XK1A 1E25A 1FCNA 2WKIA 4KQRA 5DTSA 3Q7VA 3M2KA 5AQBA 5A91A 2G2WA 3G32A 1GHIA 4OVDA 3OCNA 5DF8A 5F1GA 5KSHA 1MPLA 1I2SA 3LY3A 3QHYA 1Q2PA 4OLGA 2X71A 4OQHA 4S2OA 4E3LA 3O87A 4FCFA 2WGVA 1J9MA 3P09A 3NIAA 4EWFA 5M19A 4WYYA 5DF9A 3EQVA 2QZ6A 5CTMA 4R1GA 1KDSA 3HUMA 1KGGA 1JWPA 4S2LA 5CGXA 1PZOA 3WS4A 4E3OA 2HPBA 4IVIA 3ZCZA 5AQ9A 4WZ5A 5GLDA 4IBRA 4R4SA 1DJAA 1L0GA 1ES2A 4UA7A 4B4ZA 4BL2A 1NZOA 3IXGA 4WMCD 4X69A 3C4OA 2Q9MA 4ZBEA 2HP5A 1JTDA 5M18A 5FI2A 5FQIA 4KZ8A 1CK3A 2R9XA 1YM1A 4KZ4A 4N92A 5DVAA 5GL9A 4BENA 1G6AA 1ERMA 2PU4A 3PBTA 3IHBA 4N9LA 2H0TA 2DRWA 4BL3A 2I72A 5CEBA 3AGFA 5IHVA 5TR7A 3WS0A 1PWCA 3ZG0A 2B5RA 1IKIA 3A3FA 2A49A 3DW0A 2XQZA 3HLCA 2RL3A 2EX9A 4JLFA 4C3QA 2EFUA 4OPZA 1M40A 4HBTA 4DRTA 4PMAA 3ZFZA 1K4FA 4LV1A 5HARA 4WMCA 1YLTA 2WKHA 1GA9A 4OONA 3A3JA 4R0QA 4S2MA 5GLCA 1W8YA 2QMIA 2ZM8A 3IF6B 5EUAA 4Y7PA 3S4XA 3AGEA 5KMWA 1E3UA 2BG1A 4R3BA 3UN7A 2P9VB 1CEGA 3VP4A 3VP3A 2GDNA 2WYXA 1GHMA 2ZC7A 3HLEA 1PW1A 3OPLA 4BD1A 3MZEA 1RP5A 2Y2NA 4B4XA 1FR6A 4EBLA 1PWGA 1SHVA 4C6YA 4LV0A 1FQGA 3ZG9B 1W7FA 5DTTA 5M1AA 3IF6A 1FOFA 3PAGA 4KZ3A 1CI9A 1IYPA 3ZVWA 1KE0A 2A3UA 2H5SA 4ZJ3A 1SDEA 2JCHA 5CHMA 3N8SA 2ZC6B 2Y2PA 4BQMA 1IKGA 1YT4A 1VQQA 4WM9A 1KGEA 1RGYA 3QNCA 1XPBA 1PZPA 2JC7A 3G2YA 3IWOA 1OMEA 4KZ9A 3UE0A 1BSGA 4JXWA 4LV3A 1PW8A 1RGZA 3FWLA 5FQKA 3Q81A 3TG9A 3CG5A 1ESUA 3PBNA 3IH8A 4GD8A 4GDBA 2HDRA 1YLWA 2EXBA 3OPHA 2G2UA 4Q8IA 1ALQA 2HDQA 3IF5A 2EX2A 3G35A 2RCXA 4MBFA 3OZHA 3WS5A 2ZJ9A 4B88A 4E3JA 5CHUA 1BTLA 1XA1A 1KE4A 4JBFA 2R9WA 5HAIA 2WKEA 3RJUA 2Q9NA 4OQIA 3BFDA 5E43A 1MBLA 2E8IA 3AGDA 4S2KA 5EVIB 3VP0A 3ZVTA 4EV4A 5EVID 4MNRA 5FSRA 3SOIA 1HTZA 1IELA 3RXWA 4ZDXA 4WZ4A 1WYCA 4YFMA 4BLMA 1XKZA 2DNSA 5EPHA 1PYYA 1K25A 1L0DA 1XGJA 3WWXA 2WADA 3VSLA 2EX6A 3Q82A 5EVIA 2FFFB 4U0XA 1HZOA 3Q7ZA 3IHAA 4C75A 5E2EA 3LEZA 1NXYA 1M6KA 4GZBA 4LCMA 3M6HA 1ONGA 3W4PA 2V1ZA 3ZDJA 4QJGA 3IQAA 3NY4A 4KZAA 1SKFA 4N1HA 1Q2QA 3M2JA 3OCLA 5HFOA 3UY6A 1E4DA 1NYYA 3LCEA 3BLSA 3CMZA 3MKFA 1L0EA 2C6WB 3VOYA 3ZNYA 2JBFA 4GKUA 5DF7A 3FV7A 4EUZA 1S6RA 4KZ7A 2ZC5B 5FQJA 4O7DA 4OPRA 1KE3A 2Y2KA 1ZKJA 3GMWA 2ZC3B 4E6WA 4OPQA 5A93A 1CI8A 2Y59A 3HBRA 3PBSA 4RX3A 4QY6A 1PI4A 2J8YA 1KVMA 4OOLA 3IWQA 3UPNA 1BLCA 1N4OA 1YLJA 2ZC4B 4OQGA 4BJPA 2ZQAA 3BFEA 4D2OA 5JYOA 4KENB 4A5RA 4PM9A 1BT5A 4HESA 4JKTA 3VP2A 1ES5A 3PBOA 5U47A 5F1FA 3VOZA 4X68A 4BD0A 1WE4A 2Y2IA 4JF4A 1XA7A 2XLNA 2ZQDA 3B3XA 4KG6A 5FQ9A 1FCMA 3G34A 3A3EA 1K54C 4RVAA 4S2NC 1MWRA 3ZG7B 4ZAMA 1ZG6A 2EXAA 2WZZA 4NK3A 3V5MA 3VFFA 3WRZA 4HBUA 1ONHA 3C5AA 3IT9A 5GHYA 5JYPA 4H8RA 3G30A 3IF6C 2Y2LA 3S22A 1JWZA 2J9OA 2WUQA 1K6RA 1I2WA 4R23A 2XF3A 3G31A 2X01A 3ISGA 4N1XA 5L2FA 1NZUA 3GRJA 5AQAA 4ZJ2A 4WEJA 1MWSA 1NRFA 1JWVA 3EQUA 3ITBA 3IXHA 4ID4A 5CGSA 1VM1A 3Q1FA 3V3SA 1GHPA 4OP5A 4EBNA 2XDMA 1O7EA 3UE1A 2X02A 4DDYA 3BM6A 3HLDA 3UO9A 3MXRA 2PBYA 4IBXA 1KDWA 2OV5A 2Y2GA 3A3DA 3MKEA 4MBHA 4NETA 4Y0OA 1U60A 1ZC2A 2QPNA 1YLYA 2P74A 1LHYA 2ZQCA 3MXSA 3V39A 1PWDA 3VP1A 2VGJA 1YLPA 3NCKA 3HREA 3PBQA 1C3BA 5TGFA 1KVLA 4JXVA 1E3UD 2OLVA 3O88A 4JF5A 1SDNA 3SH9A 4UHUA 2JE5A 2J7VA 5A92A 3IXBA 4KG2A 1W79A 1W5DA 5GLBA 4QD4A 4KZ5A 2OSUA 5FAOA 5F83A 4CJNA 2HP9A 4LCLA 2ZD8A 4M3KA 3UDIA 5CTNA 1L2SA 4L0LA 2VGKA 3BEBA 3E2LA 1Z6FA 2WGWA 3WRTA 5CHJA 2PU2A 3ZG5A 1EROA 4OQ0A 2XFTA 3C7UA 5FQQA 3UDXA 1NY0A 1HVBA 4WBGA 3NC8A 3SS3A 3IH9A 2WGIA 5FA7A 1WYBA 3BYDA 5FI7A 3GVBA 4X53A 1NJ4A 3HUOA 5EE8A 4F94A 5TFQA 5G18A 4ZTKA 4OLDA 4KZ6A 4KZBA 4K0WA 4GD6A 4JXGA 4E3IA 2Y55A 4UA9A 3S1YA 5CERA 3NBLA 4CPKA 1EI5A 1W8QA 4P87A 5E2FA 3W4QA 3Q07A 4ZJ1A 1YQSA 5D3OA 3RXXA 1XP4A 1QMEA 4DE3A 5EVLA 2V20A 5I94A 4P6BA 1XGIA 2XGNA 4R4RA 5GLAA 2Y2QA 3Q7VB 4WZ5C 1FSWA 4JPMA 5FDHA 3GTCA 3QNBA 3W8KA 4EQIA 3GV9A 4IVKA 4PM8A 4RX2A 4X55A 4PM7A 2WAEA 1MXOA 2FFYA 3IWIA 4E3NA 3UPOA 3MBZA 4DKIA 4QY5A 4R3JA 5GHZA 2J9PA 2XEPA 1BLPA 2ZLYA 3N8RA 4S2NA 4GDNA 3OPPA 5FQMA 2XD5A 2Z2MB 4GB7A 3FZCA 3UPPA 5HX9A 1BULA 4JF6A 3HLBA 2XH9A 4WELA 1BZAA 4QHCA 2Z2LB 3GR2A 2Y91A 4XXRA 3OPRA 4P0MA 5CEDA 3G2ZA 1LL5A 3BECA 3V3RA 3O3VA 3UE3A 2ZMAA 1N9BA 4UA6A 3ITAA 4S2PA 3A3IA 4K91A 3VMAA 3ZG8B 2ZQ7A 1BLSA 3ZNTA 4FH4A 3FKWA 3HL9A 3D4FA 1IYQA 3MZFA 5KZHA 2HDUA 2OLUA 3WS2A 1QMFA 3P98A 2ZM0A 3FYZA 3C7VA 3DWKA 1ESIA 3SH8A 4QB8A 2ZM2A 3DWZA 4PPRA 2WZXA 2IWCA 4E3MA 4PM5A 5FI6A 4S2JA 4Y0UA 1K4EA 2Y2MA 3LY4A 4FH2A 5BOHA 4DE1A 1K38A 4RYEA 3UNWA 1HD8A 4OOMA 2V2FF 1H5XA 3SS5A 1XX2A 4U3TA 3ZGAB 3IXDA 5FATA 2EFXA 3DTMA 4S2IA 3VSKA 3HLFA 2CC1A 5E2GA 4OOYA 5HW3A 4XUZA 1IEMA 3HLGA 3GQZA 5EOOA 3TSGA 5CGWA 3W4OA 1GCEA 1DY6A 5AQ7A 3HLWA 1SCWA 2DCFA 4LENA 1K57C 4MBKA 4OH0A 3N7WA 2ZQ8A 1AXBA 1H8YA 4EBPA 1K54A 3TOIA 1I5QA 1GA0A 5CECA 1O07A 5GHXA 3V50A 4X56A 1LL9A 3FKVA 4OKPA 1K6SA 5KSCA 2UWXA 1L0FA 3SS4A 1DJCA 3WS1A 1MWTA 4PM6A 1LLBA 2BLSA 4N9KA 2WGWB 4DE2A 4IEDA 1YMXA 2HDSA 1LI9A 3HUNA 2IWBA 4DXCA 5E2HA 4KQQA 2H10A 5EOEA 1IYOA 4OP8A 2ZQ9A 1Y54A 4DXBA 1PI5A 4DF6A 2XFSA 3VFHA 4K0XA 3O86A 4U0TA 3BLMA 1G68A 3NI9A 3I7JA 1MWUA 1PIOA 3JYIA 5FAQA 5J8XA 3LO7A 3C4PA 4Z9QA 5EECA 1MY8A 1JTGA 3BFGA 1K56A 2XR0A 4E6XA 5A90A 1FR1A 3N4IA 4WEKA 3BFCA 4YINA 2H0YA 1ZG4A 4HEFA 5FASA 5DTKA 3CJMA 3N6IA 4Y0TA 3UDFA 2WK0A 1TEMA 4GN2A 4OPYA 1K55A 4FSFA 2HP6A 3HVFA 4QU3A 3CZDA 3M6BA 4MEZA 1KGFA 2Y2HA 2WAFA 3PAEA 3NDEA 2EX8A 3G4PA 3SH7A 4DE0A 4XUXA 2IWDA 1RCJA 4KG5A 2XD1A 4LV2A 3PBRA 1LI0A 2Y2OA 2Y2JA 1XXMA 3GSGA 3PTEA 4E3KA 1TDLA 1NYMA 4UAAA 1BUEA 3MFDA 4DDSA 3OC2A 1BLHA 3E2KA 4FD8A 2P9VA 4P85A 4JXSA 3MZDA 1ES4A 1YLZA 4MLLA 4KQOA 1K56D 1EWZA 4RA7A 3N8LA 1S0WA 5CRFA 3BRMA 4GOGA 3ZHHA 1DJBA 4GNUA 1ERQA 5HL1A 1JVJA 3NDGA 1H8ZA 5CXWA 1ES3A 1TVFA
chains in the Genus database with same CATH superfamily
1TF1A 3PD2A 1CEFA 5F82A 5HAQA 2HJEA 1TDGA 5HAPA 1E25A 1FCNA 1DP8A 1WA9A 5A91A 1GHIA 2I9VA 1TS0A 4S2OA 3O87A 4FCFA 4IUKA 2LB5A 3BW6A 3P09A 4EWFA 5M19A 5DF9A 2QZ6A 5CTMA 3HUMA 2GNXA 4YOFA 4E3OA 2HPBA 4IVIA 4BL2A 4X69A 2VK3A 4ZBEA 2PR5A 1CK3A 4EXOA 3S7PA 4BENA 1G6AA 3PBTA 4N9LA 2H0TA 4BL3A 2XA7S 5TR7A 4PKYG 2A49A 2RL3A 3FPVA 2HZ5A 1M40A 1XFQA 4IHQA 3ZFZA 3IX8A 2YKFA 3T50A 5HARA 2PAVP 4S0KA 2K7SA 3IS2B 1YLTA 2WKHA 2QMIA 5EUAA 4Y7PA 3S4XA 3AGEA 1VEUA 1PW1A 4BD1A 3BWLA 3MZEA 1RP5A 2Y2NA 1PWGA 4LV0A 2W1RA 3ZG9B 2CMNA 1CI9A 3KNFA 2H5SA 4ZJ3A 1SDEA 2JCHA 5CHMA 2Y2PA 4BQMA 2O9CA 1XPBA 3IWOA 1OMEA 1BSGA 4LV3A 1PW8A 3FWLA 5FQKA 1OJGA 3TG9A 1ESUA 1OTBA 3IH8A 5DJUA 3KSIA 4Q8IA 4MBFA 3VE3A 3WS5A 3E4PA 3KX0X 5HAIA 3RJUA 4HP9A 5HDDA 1MBLA 4S2KA 4Y3IA 1IELA 4LRXC 4YFMA 2W3FA 3F1PA 4EERA 3WWXA 4X1LA 1YPRA 1HZOA 4GJ4A 3QP2A 1TS7A 5E2EA 2PD8A 2V1ZA 3IQAA 3NY4A 4NBJA 2JKRM 3OCLA 2ZL1B 1E4DA 3F1OB 2IA2A 3LCEA 3MKFA 1L0EA 2VLGA 3FV7A 4OPRA 2HGVA 1Z09A 4OPQA 1H8MA 4ETXA 4QY6A 1PI4A 4OOLA 4OQGA 2VKSA 3S7OA 3EOIA 1NLZA 3PD4A 1X0OA 2KLIA 4PM9A 4JKTA 3LR0A 1EW0A 1XA7A 5FDSA 5FQ9A 1FCMA 1OPXA 4HJ4A 1K54C 1W63M 4Y2FA 4ME4A 1MKMA 2WZZA 4MN7A 5JYPA 3G30A 2QHKA 3S22A 1K6RA 1I2WA 2B18A 1PFLA 4EU0A 4N1XA 3GRJA 5AQAA 4WEJA 1NRFA 1ACFA 1JWVA 2QJ7A 3T1XA 5CGSA 3S7QA 2DMWA 4EBNA 2XDMA 1O7EA 4WL9A 2ZMFA 5FEGA 3BM6A 3UO9A 3MXRA 4IBXA 1KDWA 3CLOA 4MBHA 2DBOA 2ZQCA 3VP1A 4S0JA 3LIFA 2XRNA 3NCKA 2J3TC 3HREA 4PHTA 3T1QB 2GX5A 4JF5A 2GZAA 2JE5A 2ZBBA 3IXBA 5F69A 1VETB 4KG2A 1W79A 4H6JA 1W5DA 4QD4A 3JVVA 5FAOA 4CJNA 5HPIA 4O0PA 1IFQA 1SKOA 5HZHA 5FEFA 4I3JA 2HL1A 2WGWA 3QP1A 5FQQA 1NY0A 4LLOB 4NXBA 3SZTA 5EE8A 5TFQA 2BASA 5LBRA 4KZBA 4K0WA 3S1YA 2V0UA 5TBMA 3W4QA 1W8QA 3RXXA 5GLAA 2Y2QA 3GTCA 1IOUA 4PM8A 4RX2A 3MS6A 1YAXA 4EQ1A 5GHZA 3N8RA 4R38A 2J3WA 4HHDA 5HX9A 1P9RA 4EEPA 4CLCE 4QHCA 3LICA 4AFIA 3G6OA 4P0MA 3G2ZA 4BMWA 1S4SA 3O3VA 4HY8A 2ZMAA 1N9BA 1OT6A 4F3LA 3HL9A 1AWIA 1IYQA 3IX4A 4DJ2A 1XJ2A 3NJAA 4E3MA 4Q0IA 4S2JA 3T4QA 4OOMA 2G7UA 3LGOA 5EVEA 3IXDA 5CX7A 2EFXA 5EOOA 3TSGA 5CGWA 3W4OA 1SCWA 3CI6A 1DRMA 4LENA 4MBKA 1AXBA 1H8YA 4EBPA 1K54A 4H6JB 3TOIA 1I5QA 1GA0A 4Y13A 3T4LA 4X56A 2D01A 1LL9A 3H7WA 4OKPA 2Y8HA 2UWXA 3SS4A 1DJCA 4N9KA 1NWZA 2WGWB 4DE2A 4IEDA 1YMXA 1LI9A 3HUNA 2IWBA 3KNPA 4KQQA 2B95A 1IYOA 3KSFA 2UV0E 1PI5A 3VFHA 4K0XA 4U0TA 1MWUA 3LO7A 2HJ9C 3C4PA 3TRCA 1VETA 3BFGA 2B02A 2XR0A 3N4IA 3UMDA 4YINA 4HEFA 4GLQA 1TC5A 1TEMA 3MQ0A 5L09A 3CZDA 2NUPC 3G4PA 4DE0A 4KG5A 2XD1A 4L9FA 2Y2OA 1DP6A 2Y2JA 4G3KA 4IJGA 2VV7A 4FOFA 4E3KA 1NYMA 2FH5A 4GS9A 1BUEA 1BLHA 3E2KA 2P9VA 3MZDA 4RA7A 3N8LA 1GSXA 5CXWA 1ES3A 4WLAA 5EVIC 4X6TA 1YMSA 1IYSA 5DFXA 2C5WB 5FAPA 2XK1A 2Q0OA 4KQRA 4RRFA 3M2KA 3G32A 3R7WB 2WKQA 5DF8A 4RRJA 3BQAA 1I2SA 3LY3A 4OLGA 4MDZA 4E3LA 1J9MA 4WYYA 5J7EA 4FUWA 4RR9A 4R1GA 3MQOA 4HOIA 4S2LA 5CGXA 5J61A 5F5YA 1Y4OA 4YWZA 5AQ9A 3OLOA 4IBRA 1ES2A 3C4OA 2JN7A 2Q9MA 1JTDA 5M18A 4LRZE 5FQIA 1YM1A 3U4LP 4HJ3A 4KZ4A 4LPZA 2PU4A 3IHBA 2PR6A 2I72A 4HIAA 4LRYC 3A3FA 3A0VA 2Z6CA 1MC0A 4HBTA 1K4FA 3LMVA 4R70A 4S2MA 1W8YA 1E3UA 3VP4A 3VP3A 2GDNA 2WYXA 3BJNA 3OPLA 1NLYA 4EBLA 2ZL1A 5MC7A 1FQGA 3PAGA 1KE0A 2A3UA 3HJKA 3N8SA 5DKLA 2JC7A 3G2YA 4RRHA 3CAXA 3MR0A 4B93A 2VZWA 2V1BA 4P6ZM 2ZOHA 2W3EA 2HDRA 3B47A 1YLWA 3RTYA 3OPHA 2HDQA 3IF5A 2EX2A 2W3DA 5EM1A 4RR7A 3MF0A 1KE4A 3F1PB 2WKRA 3D9YA 3B42A 4OQIA 3BFDA 5E43A 1Y28A 3P01A 2NUTC 2QJ5A 2E8IA 4ARZB 4GHIB 2L4RA 3A0SA 4ZDXA 1WYCA 2DNSA 4EESA 1K25A 1N9NA 4R6LA 2WADA 3VV4A 3VSLA 1HLUP 2E8JA 4LCMA 4KZAA 1F9IA 4N1HA 5TJJA 3M2JA 3BLSA 3VOYA 3ZNYA 1LSWA 5DF7A 4EUZA 4KZ7A 2ZC5B 2EA9A 2Y2KA 1ZKJA 3O5YA 2D02A 5A93A 1CI8A 3A0RA 3PBSA 4Z1WA 3BY8A 3UPNA 2ZC4B 2P7JA 3KYQA 1BT5A 4G3VA 5F1FA 1UWPX 4BD0A 4UQIM 3NHQA 3HCYA 4EEUA 3A3EA 2OOLA 1D7EA 3H82B 3JVUA 3C5AA 5GHYA 2JKRI 4H8RA 3EGXC 2WUQA 1V9ZA 5IS1A 4KUOA 4NXEA 5L2FA 4RRGA 1NZUA 4ZJ2A 3V3SA 1GHPA 4OP5A 4S03A 5HWWA 3LIBA 2PBYA 3IX3A 1G5UA 2Y2GA 3A3DA 4QPRA 4Y0OA 1U60A 1YLYA 1LHYA 1PWDA 1YSPA 3PBQA 1C3BA 5G4YA 1KVLA 4MMNA 3SH9A 5FL3A 1OTEA 4KZ5A 5F83A 4LCLA 1GSVA 3UDIA 3VE4A 2PD7A 1L2SA 4L0LA 1JKEA 3KOBA 3WRTA 3ZG5A 1EROA 3UB9A 4WBGA 3NC8A 3SS3A 5FA7A 4MN5A 1H0MA 4EW7A 3HUOA 4F94A 4ZTKA 1S4RA 3EEAA 4X1MA 2M7VA 4UA9A 2PT7A 4CLCB 3TE8A 4RRQA 2W1TA 5KIZA 4ZJ1A 5D3OA 1XP4A 5HL6A 2P04A 4P6BA 1PNEA 3Q7VB 4EQIA 4IVKA 4X55A 1TD5A 2XSSA 4GHIA 4QY5A 4R3JA 2J9PA 2XEPA 3NOUC 2INWA 3IS2A 3D72A 2Z2MB 3DBAA 2PYPA 4K08A 3LI9A 4WELA 2J3TD 3OPRA 1LL5A 4RRAA 4UA6A 2ZQ7A 4FH4A 4I5SA 2OLUA 3P98A 3MSHA 1ESIA 3T12B 3DWZA 2IWCA 1K4EA 1CF0A 3KOCA 5BOHA 4UQIS 2P08A 1K38A 1H5XA 1XX2A 4U3TA 3ZGAB 2VGLM 5FATA 2V1AA 1NRJA 4S2IA 5K5BA 3H82A 2CC1A 4R3AA 5HW3A 4XUZA 3HLGA 1S67L 3GQZA 4O8GA 1GCEA 3HLWA 3PYPA 2DCFA 5DJTA 5GHXA 3V50A 2ACGA 3FKVA 1K6SA 1L0FA 4PM6A 1J7GA 2HDSA 2H10A 2OAQ1 3OBFA 2KX6A 3KYZA 1T18A 3BQ8A 4OP8A 2W0NA 5AVFA 3NI9A 5J3WA 3I7JA 2XROA 4HI4A 1GSWA 1FR1A 4GW9A 4WEKA 3UB7A 5DTKA 3CJMA 4GN2A 1N9LA 4UEYA 1K55A 2PHYA 2WAFA 3NDEA 3LMTA 4FTXA 4B9OA 1RCJA 4LV2A 1FIKA 3PBRA 1LI0A 1XXMA 2YKHA 1TDLA 3LR5A 4I38A 3GDIA 5CRFA 1JVJA 3NDGA 1H8ZA 3C30A 4MN6A 2JKTI 2Y4AA 1K55C 3BFFA 1MKIA 1FCOA 4NG2A 1K57A 4S0IA 3Q7VA 5AQBA 2G2WA 3OCNA 5KSHA 5F1GA 1ZHHB 2X71A 1UGUA 4HH3A 3LFVA 5DFYA 2WKPA 1KGGA 4P6ZS 1PZOA 3ZCZA 1LT0A 4WZ5A 4RRIA 5GLDA 1XJ3A 1DJAA 4L9GA 4B4ZA 1NZOA 3IXGA 4WMCD 3C2WA 3C8CA 5FI2A 2J80A 4Y17A 1W63Q 2R9XA 5DVAA 3KODA 2DRWA 3U2AA 5CEBA 3KSHA 3WS0A 1PWCA 3ZG0A 4JLFA 1IKIA 4Q0JA 2XQZA 2EX9A 4C3QA 2EFUA 4OPZA 5I5LA 1P97A 4DRTA 4PMAA 4WMCA 2M7UA 1GA9A 4OONA 3A3JA 4R0QA 5GLCA 5TBMB 1CQAA 2ZM8A 3T4JA 5KMWA 2BG1A 4R3BA 1CEGA 1GHMA 3HLEA 1VHMA 4G3WA 2QWSA 4B4XA 1FR6A 3QP8A 4C6YA 1ODVA 1SHVA 3UB5P 3IF6A 4KZ3A 1IYPA 1TS6A 1IKGA 1YT4A 1VQQA 1RGYA 3QNCA 1PZPA 4PKYA 3MXQA 3PBNA 2G2UA 3RFBA 5J4EA 2HL2A 2VJWA 3OZHA 4E3JA 5CHUA 3EGDC 1P9WA 4HNBA 4RRKA 3UE6A 4JBFA 2JHEA 2WKEA 1F2KA 3AGDA 3VP0A 4EV4A 1HTZA 4ZRRA 4BLMA 1XKZA 5EPHA 2A24B 3MJQA 2A2LA 4Q0HA 3CITA 1XGJA 1DP9A 2V8CA 1LSVA 3PD5A 5EVIA 2FFFB 4U0XA 3Q7ZA 5HDCA 4C75A 3LEZA 1NXYA 1P0ZA 3ZDJA 1ONGA 4QJGA 1YKDA 1SKFA 1Q2QA 1NYYA 3CMZA 4GKUA 3KSGA 1S6RA 4RQ9A 1KE3A 3GMWA 2ZC3B 4E6WA 2ZMVA 5HSQA 5IT5A 2Y59A 4RX3A 3W2ZA 1KVMA 2J8YA 4M4XA 1N4OA 4BJPA 3H7WB 4D2OA 3BFEA 4HESA 3VP2A 1ZTUA 5U47A 4X68A 3P7NA 2Y2IA 2ZQDA 3LIDA 1YSQA 3PD3A 4S2NC 2KDKA 3GECA 3KO4A 2QYBA 1ZG6A 2EXAA 4NK3A 1OT9A 4HBUA 1ONHA 3IT9A 4S0LA 3IF6C 2J9OA 2Y79A 2XF3A 2OWJA 2VX8A 3EQUA 3IXHA 5AVEA 5IU1A 2X02A 3HLDA 2OV5A 4NETA 2HL0A 3MXSA 4PAUA 5TGFA 4JXVA 1E3UD 2OLVA 3O88A 4JGQA 3CUEC 2J7VA 4E04A 4RRDA 3QP6A 2W27A 3F1OA 3OOVA 2HP9A 2AVXA 4M3KA 2O9AA 5CTNA 1F98A 3E2LA 5C5KA 1Z6FA 2PU2A 3R7WA 3K2NA 3C7UA 3UDXA 4IUHA 1OTAA 4BBTA 3IH9A 2WGIA 3PHYA 1WYBA 3BYDA 1NJ4A 3NECA 1G28A 1VB6A 5G18A 1TS8A 2A24A 4OLDA 4GD6A 4JXGA 4E3IA 2VV6A 1SZVA 4CPKA 4P87A 5E2FA 1YQSA 3MFXA 3T1SA 5EVLA 4HQAA 2V20A 4L9EA 5I94A 2XGNA 4RR8A 5FDHA 3GV9A 3UPOA 4PM7A 2WAEA 3IWIA 4E3NA 2OAP1 1BLPA 2ZLYA 4S2NA 4XT2B 5FQMA 1BULA 3HLBA 4HJ6A 4LGWA 1BZAA 4XXRA 5G4ZA 5CEDA 3MQQA 4WN5A 3V3RA 3ITAA 3UB6A 3VMAA 3ZG8B 3FKWA 1XJ4A 3D4FA 3WS2A 1QMFA 2BTFP 2ZM0A 3C7VA 3DWKA 1G6OA 3SH8A 2ZM2A 4PPRA 4PM5A 3F1NA 4Y0UA 2Y2MA 4DE1A 4RYEA 2PDRA 3CPTB 3DTMA 3VSKA 3HLFA 5E2GA 4OOYA 3KO3A 2LB9A 3T4SA 5HD3A 3T1RA 4OH0A 3N7WA 3FG8A 5CECA 3TJZC 1O07A 5KSCA 3WS1A 1LLBA 3LR3A 2PRFA 2ZQ9A 1Y54A 3UB8A 4DF6A 3PR6A 3BLMA 1G68A 5J8XA 5EECA 2HV1A 3E0YA 5FASA 3DTEA 4GCZA 2R78A 5EM0A 3N6IA 2KOIA 4OPYA 4QU3A 3HVFA 4ESPA 1KGFA 2Y2HA 1T19A 2EX8A 2IWDA 4CLCD 3NULA 2VGLS 3MFDA 3NOTC 4FD8A 4P85A 1J3WA 2JKFA 4JXSA 1YLZA 4II7A 3CHWP 4KQOA 1EWZA 5F6AA 5HWTA 4XT2A 3ZHHA 1DJBA 1ERQA 1K0KA 4Y15A 3ZVWA 1FSYA 1JNUA 3LIAA 3LYXA 1S1YA 2W3GA 2WKIA 5DTSA 2HKZA 4OVDA 4DN0A 2K31A 1MPLA 3QHYA 1Q2PA 4D60A 4I3AA 4OQHA 5HWVA 2WGVA 3NIAA 3EQVA 1KDSA 3E4OA 1JWPA 3E98A 3WS4A 4JGOA 4R4SA 1L0GA 4UA7A 2M1CA 2HP5A 3K3DA 4KZ8A 4N92A 5GL9A 2JKTM 5EV0A 1ERMA 3KO7A 3L7HA 3TW8A 1KOUA 3AGFA 2ZOIA 5IHVA 2B5RA 1A0KA 3DW0A 3HLCA 2XA7M 4LV1A 1D1JA 3IF6B 4ARZA 3DTKA 3UN7A 2P9VB 3CPTA 1LSXA 2ZC7A 3IBJA 4S02A 5L07A 1W7FA 3LI8A 5DTTA 5M1AA 5HDSA 1FOFA 3T4TA 2O9BA 2ZC6B 3IBRA 4RRMA 4WM9A 3ZYTA 1KGEA 4KZ9A 3EEHA 3UE0A 4JXWA 3PXPA 1RGZA 3Q81A 3ICYA 3CG5A 4GD8A 2OKVA 4GDBA 2EXBA 1T1AA 1ALQA 1V9YA 3G35A 2RCXA 2QKPA 3KYEA 2ZJ9A 4B88A 1BTLA 1XA1A 5HPFA 4NKPA 4I39A 2VV8A 2R9WA 2Q9NA 2VEAA 4JGRA 1XFNA 5EVIB 5L8MA 3ZVTA 5EVID 4MNRA 5FSRA 4RR6A 2H28A 3SOIA 3RXWA 4WZ4A 1OJ5A 1PYYA 4NXFA 1L0DA 3S7NA 3ZQ5A 2EX6A 3Q82A 2VA0A 3IHAA 1M6KA 4GZBA 2MJ6A 3JPUA 3M6HA 3W4PA 5HFOA 3UY6A 2C6WB 2JBFA 5FQJA 4O7DA 3NOPC 3HBRA 3IWQA 3L9KA 1BLCA 1YLJA 4DMZA 2ZQAA 5JYOA 4KENB 4A5RA 2V9AA 1ES5A 3PBOA 3VOZA 1WE4A 4JF4A 4I3IA 2XLNA 3B3XA 4KG6A 3G34A 2JKGA 4RVAA 1MWRA 3ZG7B 4ZAMA 3V5MA 3VFFA 3WRZA 1OTIA 2Y2LA 1JWZA 4R23A 3G31A 1Y2QA 2X01A 3ISGA 3SW1A 3VOLA 1MWSA 3ITBA 4ID4A 1VM1A 3Q1FA 3UMEA 3UE1A 4DDYA 2O99A 1L3LA 3FPWA 1N9OA 3MKEA 1ZC2A 2QPNA 1PRQA 2P74A 4CLCA 1BYWA 3V39A 2VGJA 1YLPA 3C38A 3DTIA 1XJ6A 4O01A 4CQHA 1SDNA 4UHUA 2L0WA 5A92A 5GLBA 2OSUA 2L1MA 2ZD8A 3KO6A 2VGKA 3BEBA 4RRBA 5CHJA 3KO5A 3T4KA 4OQ0A 2XFTA 4YNRA 4X25A 4CLCC 2Z6DA 1HVBA 3BY9A 3T4OA 4LFUA 5FI7A 3GVBA 4X53A 4MCWA 1OTDA 4KZ6A 3F1NB 2Y55A 5CERA 3NBLA 1EI5A 1F5MA 2PBDP 3Q07A 4DE3A 3LEQA 1QMEA 1UWNX 4KUKA 1XGIA 4R4RA 2HF6A 3CUEA 4WZ5C 1FSWA 4JPMA 1LL8A 3QNBA 3W8KA 3K3CA 1MXOA 2FFYA 3KO9A 1S1ZA 3LUQA 3MBZA 4DKIA 3FC7A 4GDNA 3RH8B 3OPPA 1D06A 1S66L 2XD5A 4GB7A 3FZCA 3UPPA 1STZA 4DJ3A 4BBVA 4JF6A 2O0YA 2XH9A 3R4KA 1T1BA 2Z2LB 3GR2A 2Y91A 5L10A 3BECA 4ETZA 2OWHA 3UE3A 5HD5A 4S2PA 3A3IA 3QP5A 4K91A 3ZNTA 1BLSA 5KZHA 3MZFA 2HDUA 4RRRA 5EFWA 1T1CA 2FZ0A 3DAVA 3FYZA 3MMHA 4QB8A 3CWFA 2WZXA 3HJIA 5FI6A 3LY4A 4FH2A 4F3LB 4RRCA 3UNWA 1HD8A 2V2FF 3SS5A 1VEUB 2EWVA 4NEED 4RRLA 1IEMA 2W1TB 1DY6A 5AQ7A 1MZUA 4EETB 4BWIA 1K57C 2V8FA 2ZQ8A 3LMUA 4Y5FA 1MWTA 2BLSA 4WF0A 4DXCA 5E2HA 5EOEA 4NBIA 3LR4A 4HH2A 5AJGA 4DXBA 2XFSA 1SKOB 1CJFA 3O86A 3QP4A 1PIOA 5FAQA 3JYIA 4WUJA 3EWKA 4Z9QA 2W3HA 1MY8A 1JTGA 4EUVA 1K56A 4E6XA 4QWOA 5A90A 5F68A 3H9WA 3BFCA 2H0YA 5DKKA 1ZG4A 2V0WA 3B33A 1FILA 2K2NA 4Y0TA 3UDFA 2WK0A 3ULFA 4FSFA 2HP6A 3M6BA 4MEZA 3PAEA 1H3QA 2GJ3A 3SH7A 4KQDA 4NXGA 4XUXA 4JGPA 5A8BA 3E4QA 3GSGA 2EWWA 3PTEA 4UAAA 4DDSA 3OC2A 3LIEA 1ES4A 4HP4A 2PYRA 4MLLA 1K56D 3D3OA 1S0WA 3BRMA 4BBUA 4GOGA 3V67A 4GNUA 5HL1A 1TVFA 4GS9B
chains in the Genus database with same CATH topology
3PD2A 5EVIC 1CEFA 1FSYA 4X6TA 5F82A 1YMSA 1K55C 2Y4AA 5HAQA 1IYSA 3BFFA 2C5WB 1MKIA 1TDGA 1FCOA 5HAPA 5FAPA 1K57A 2XK1A 1E25A 1FCNA 2WKIA 4KQRA 4S0IA 5DTSA 2HKZA 4RRFA 3Q7VA 3M2KA 5AQBA 5A91A 2G2WA 3G32A 1GHIA 4OVDA 3OCNA 4RRJA 5DF8A 5F1GA 5KSHA 1MPLA 1I2SA 3LY3A 3QHYA 1Q2PA 4OLGA 2X71A 4OQHA 4S2OA 4E3LA 3O87A 4FCFA 2WGVA 1J9MA 3P09A 3NIAA 4EWFA 5M19A 4WYYA 5DF9A 4RR9A 3EQVA 2QZ6A 5CTMA 4R1GA 1KDSA 3HUMA 1KGGA 1JWPA 4S2LA 5CGXA 5J61A 1PZOA 3WS4A 4E3OA 2HPBA 4IVIA 3ZCZA 5AQ9A 4WZ5A 4RRIA 5GLDA 4IBRA 4R4SA 1DJAA 1L0GA 1ES2A 4UA7A 4B4ZA 4BL2A 1NZOA 3IXGA 4WMCD 4X69A 3C4OA 2Q9MA 4ZBEA 2HP5A 1JTDA 5M18A 5FI2A 5FQIA 4KZ8A 1CK3A 2R9XA 1YM1A 4KZ4A 4N92A 5DVAA 5GL9A 4BENA 1G6AA 1ERMA 2PU4A 3KODA 3PBTA 3IHBA 4N9LA 3KO7A 2H0TA 2DRWA 4BL3A 2I72A 5CEBA 3AGFA 5IHVA 5TR7A 3WS0A 1PWCA 3ZG0A 2B5RA 1IKIA 3A3FA 2A49A 3DW0A 2XQZA 3HLCA 2RL3A 2EX9A 4JLFA 4C3QA 2EFUA 4OPZA 1M40A 4HBTA 4DRTA 4PMAA 3ZFZA 1K4FA 3LMVA 4LV1A 5HARA 4WMCA 4S0KA 1YLTA 2WKHA 1GA9A 4OONA 3A3JA 4R0QA 4S2MA 5GLCA 1W8YA 2QMIA 2ZM8A 3IF6B 5EUAA 4Y7PA 3S4XA 3AGEA 5KMWA 1E3UA 2BG1A 4R3BA 3UN7A 2P9VB 1CEGA 3VP4A 3VP3A 2GDNA 2WYXA 1GHMA 2ZC7A 3HLEA 1PW1A 3OPLA 4BD1A 3MZEA 1RP5A 4S02A 2Y2NA 4B4XA 1FR6A 4EBLA 1PWGA 1SHVA 4C6YA 4LV0A 1FQGA 3ZG9B 1W7FA 5DTTA 5M1AA 3IF6A 1FOFA 3PAGA 4KZ3A 1CI9A 3KNFA 1IYPA 3ZVWA 1KE0A 2A3UA 2H5SA 4ZJ3A 1SDEA 2JCHA 5CHMA 3N8SA 2ZC6B 2Y2PA 4BQMA 1IKGA 1YT4A 1VQQA 4RRMA 4WM9A 1KGEA 1RGYA 3QNCA 1XPBA 1PZPA 2JC7A 3G2YA 3IWOA 4RRHA 1OMEA 4KZ9A 3UE0A 1BSGA 4JXWA 4LV3A 1PW8A 1RGZA 3FWLA 5FQKA 3Q81A 3TG9A 3CG5A 1ESUA 3PBNA 3IH8A 4GD8A 2OKVA 4GDBA 2HDRA 1YLWA 2EXBA 3OPHA 2G2UA 4Q8IA 1ALQA 2HDQA 3IF5A 2EX2A 2HL2A 3G35A 2RCXA 4MBFA 3OZHA 3WS5A 2ZJ9A 4B88A 4E3JA 5CHUA 1BTLA 4RRKA 1XA1A 4RR7A 1KE4A 4JBFA 2R9WA 5HAIA 2WKEA 3RJUA 2Q9NA 4OQIA 3BFDA 5E43A 1MBLA 2E8IA 3AGDA 4S2KA 5EVIB 3VP0A 3ZVTA 4EV4A 5EVID 4MNRA 5FSRA 4RR6A 3SOIA 1HTZA 1IELA 3RXWA 4ZDXA 4WZ4A 1WYCA 4YFMA 4BLMA 1XKZA 2DNSA 5EPHA 1PYYA 1K25A 1L0DA 1XGJA 3WWXA 2WADA 3VSLA 2EX6A 3Q82A 3PD5A 5EVIA 2FFFB 4U0XA 1HZOA 3Q7ZA 3IHAA 4C75A 5E2EA 3LEZA 1NXYA 1M6KA 4GZBA 4LCMA 3M6HA 1ONGA 3W4PA 2V1ZA 3ZDJA 4QJGA 3IQAA 3NY4A 4KZAA 4NBJA 1SKFA 4N1HA 1Q2QA 3M2JA 3OCLA 5HFOA 3UY6A 1E4DA 1NYYA 3LCEA 3BLSA 3CMZA 3MKFA 1L0EA 2C6WB 3VOYA 3ZNYA 2JBFA 4GKUA 5DF7A 3FV7A 4EUZA 1S6RA 4KZ7A 2ZC5B 5FQJA 4O7DA 4OPRA 1KE3A 2Y2KA 1ZKJA 3GMWA 2ZC3B 4E6WA 4OPQA 5A93A 1CI8A 2Y59A 3HBRA 3PBSA 4RX3A 4QY6A 1PI4A 2J8YA 1KVMA 4OOLA 3IWQA 3UPNA 1BLCA 1N4OA 1YLJA 2ZC4B 4OQGA 4BJPA 2ZQAA 3BFEA 4D2OA 5JYOA 4KENB 4A5RA 3PD4A 4PM9A 1BT5A 4HESA 4JKTA 3VP2A 1ES5A 3PBOA 5U47A 5F1FA 3VOZA 4X68A 4BD0A 1WE4A 2Y2IA 4JF4A 1XA7A 2XLNA 2ZQDA 3B3XA 4KG6A 5FQ9A 1FCMA 3G34A 3A3EA 1K54C 4RVAA 3PD3A 4S2NC 1MWRA 3KO4A 3ZG7B 4ZAMA 1ZG6A 2EXAA 2WZZA 4NK3A 3V5MA 3VFFA 3WRZA 4HBUA 1ONHA 3C5AA 3IT9A 5GHYA 5JYPA 4H8RA 4S0LA 3G30A 3IF6C 2Y2LA 3S22A 1JWZA 2J9OA 2WUQA 1K6RA 1I2WA 4R23A 2XF3A 3G31A 1Y2QA 2X01A 3ISGA 4N1XA 5L2FA 4RRGA 1NZUA 3GRJA 5AQAA 4ZJ2A 4WEJA 1MWSA 1NRFA 1JWVA 3EQUA 3ITBA 3IXHA 4ID4A 5CGSA 1VM1A 3Q1FA 3V3SA 1GHPA 4OP5A 4EBNA 4S03A 2XDMA 1O7EA 3UE1A 2X02A 4DDYA 3BM6A 3HLDA 3UO9A 3MXRA 2PBYA 4IBXA 1KDWA 2OV5A 2Y2GA 3A3DA 3MKEA 4MBHA 4NETA 4Y0OA 1U60A 2DBOA 1ZC2A 2QPNA 1YLYA 2P74A 1LHYA 2ZQCA 3MXSA 3V39A 1PWDA 3VP1A 2HL0A 4S0JA 2VGJA 1YLPA 3NCKA 3HREA 3PBQA 1C3BA 5TGFA 1KVLA 4JXVA 1E3UD 2OLVA 3O88A 4JF5A 1SDNA 3SH9A 4UHUA 2JE5A 2J7VA 5A92A 3IXBA 4KG2A 1W79A 4RRDA 1W5DA 5GLBA 4QD4A 4KZ5A 2OSUA 5FAOA 5F83A 4CJNA 2HP9A 4LCLA 2ZD8A 4M3KA 3UDIA 5CTNA 1L2SA 4L0LA 2VGKA 1JKEA 3BEBA 2HL1A 3E2LA 3KOBA 1Z6FA 2WGWA 3WRTA 4RRBA 5CHJA 3KO5A 2PU2A 3ZG5A 1EROA 4OQ0A 2XFTA 3C7UA 5FQQA 3UDXA 1NY0A 1HVBA 4WBGA 3NC8A 3SS3A 3IH9A 2WGIA 5FA7A 1WYBA 3BYDA 5FI7A 3GVBA 4X53A 1NJ4A 3HUOA 5EE8A 4F94A 5TFQA 5G18A 4ZTKA 4OLDA 4KZ6A 4KZBA 4K0WA 4GD6A 4JXGA 4E3IA 2Y55A 4UA9A 3S1YA 5CERA 4RRQA 3NBLA 4CPKA 1EI5A 1W8QA 4P87A 5E2FA 3W4QA 3Q07A 4ZJ1A 1YQSA 5D3OA 3RXXA 1XP4A 1QMEA 4DE3A 5EVLA 2V20A 5I94A 4P6BA 1XGIA 2XGNA 4R4RA 5GLAA 2Y2QA 3Q7VB 4WZ5C 4RR8A 1FSWA 4JPMA 5FDHA 3GTCA 3QNBA 3W8KA 4EQIA 3GV9A 4IVKA 4PM8A 4RX2A 4X55A 4PM7A 2WAEA 1MXOA 2FFYA 3IWIA 4E3NA 3UPOA 3KO9A 3MBZA 4DKIA 4QY5A 4R3JA 5GHZA 2J9PA 2XEPA 1BLPA 2ZLYA 3N8RA 4S2NA 4GDNA 3OPPA 5FQMA 2XD5A 2Z2MB 4GB7A 3FZCA 3UPPA 5HX9A 1BULA 4JF6A 3HLBA 2XH9A 4WELA 1BZAA 4QHCA 2Z2LB 3GR2A 2Y91A 4XXRA 3OPRA 4P0MA 5CEDA 3G2ZA 1LL5A 4RRAA 3BECA 3V3RA 3O3VA 3UE3A 2ZMAA 1N9BA 4UA6A 3ITAA 4S2PA 3A3IA 4K91A 3VMAA 3ZG8B 2ZQ7A 1BLSA 3ZNTA 4FH4A 3FKWA 3HL9A 3D4FA 1IYQA 3MZFA 5KZHA 2HDUA 2OLUA 3WS2A 1QMFA 3P98A 4RRRA 2ZM0A 3FYZA 3C7VA 3DWKA 1ESIA 3SH8A 4QB8A 2ZM2A 3DWZA 4PPRA 2WZXA 2IWCA 4E3MA 4PM5A 5FI6A 4S2JA 4Y0UA 1K4EA 2Y2MA 3LY4A 4FH2A 3KOCA 5BOHA 4RRCA 4DE1A 1K38A 4RYEA 3UNWA 1HD8A 4OOMA 2V2FF 1H5XA 3SS5A 1XX2A 4U3TA 3ZGAB 3IXDA 5FATA 2EFXA 3DTMA 4S2IA 3VSKA 3HLFA 2CC1A 5E2GA 4OOYA 5HW3A 4RRLA 4XUZA 1IEMA 3HLGA 3GQZA 3KO3A 5EOOA 3TSGA 5CGWA 3W4OA 1GCEA 1DY6A 5AQ7A 3HLWA 1SCWA 2DCFA 4LENA 1K57C 4MBKA 4OH0A 3N7WA 2ZQ8A 1AXBA 3LMUA 1H8YA 4EBPA 1K54A 3TOIA 1I5QA 1GA0A 5CECA 1O07A 5GHXA 3V50A 4X56A 1LL9A 3FKVA 4OKPA 1K6SA 5KSCA 2UWXA 1L0FA 3SS4A 1DJCA 3WS1A 1MWTA 4PM6A 1LLBA 2BLSA 4N9KA 2WGWB 4DE2A 4IEDA 1YMXA 2HDSA 1J7GA 1LI9A 3HUNA 2IWBA 3KNPA 4DXCA 5E2HA 4KQQA 2H10A 5EOEA 4NBIA 1IYOA 4OP8A 2ZQ9A 1Y54A 4DXBA 1PI5A 4DF6A 2XFSA 3VFHA 4K0XA 3O86A 4U0TA 3BLMA 1G68A 3NI9A 3I7JA 1MWUA 1PIOA 3JYIA 5FAQA 5J8XA 3LO7A 3C4PA 4Z9QA 5EECA 1MY8A 1JTGA 3BFGA 1K56A 2XR0A 4E6XA 5A90A 1FR1A 3N4IA 4WEKA 3BFCA 4YINA 2H0YA 1ZG4A 4HEFA 5FASA 5DTKA 3CJMA 1TC5A 3N6IA 4Y0TA 3UDFA 2WK0A 1TEMA 4GN2A 4OPYA 1K55A 4FSFA 2HP6A 3HVFA 4QU3A 3CZDA 3M6BA 4MEZA 1KGFA 2Y2HA 2WAFA 3PAEA 3NDEA 3LMTA 2EX8A 3G4PA 3SH7A 4DE0A 4XUXA 2IWDA 1RCJA 4KG5A 2XD1A 4LV2A 3PBRA 1LI0A 2Y2OA 2Y2JA 1XXMA 3GSGA 3PTEA 4E3KA 1TDLA 1NYMA 4UAAA 1BUEA 3MFDA 4DDSA 3OC2A 1BLHA 3E2KA 4FD8A 2P9VA 4P85A 4JXSA 3MZDA 1ES4A 1YLZA 4MLLA 4KQOA 1K56D 1EWZA 4RA7A 3N8LA 1S0WA 5CRFA 3BRMA 4GOGA 3ZHHA 1DJBA 4GNUA 1ERQA 5HL1A 1JVJA 3NDGA 1H8ZA 5CXWA 1ES3A 1TVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EVI C;  1CEF A;  1FSY A;  4X6T A;  5F82 A;  1YMS A;  1K55 C;  2Y4A A;  5HAQ A;  1IYS A;  3BFF A;  2C5W B;  1MKI A;  1TDG A;  1FCO A;  5HAP A;  5FAP A;  1K57 A;  2XK1 A;  1E25 A;  1FCN A;  2WKI A;  4KQR A;  5DTS A;  3Q7V A;  3M2K A;  5AQB A;  5A91 A;  2G2W A;  3G32 A;  1GHI A;  4OVD A;  3OCN A;  5DF8 A;  5F1G A;  5KSH A;  1MPL A;  1I2S A;  3LY3 A;  3QHY A;  1Q2P A;  4OLG A;  2X71 A;  4OQH A;  4S2O A;  4E3L A;  3O87 A;  4FCF A;  2WGV A;  1J9M A;  3P09 A;  3NIA A;  4EWF A;  5M19 A;  4WYY A;  5DF9 A;  3EQV A;  2QZ6 A;  5CTM A;  4R1G A;  1KDS A;  3HUM A;  1KGG A;  1JWP A;  4S2L A;  5CGX A;  1PZO A;  3WS4 A;  4E3O A;  2HPB A;  4IVI A;  3ZCZ A;  5AQ9 A;  4WZ5 A;  5GLD A;  4IBR A;  4R4S A;  1DJA A;  1L0G A;  1ES2 A;  4UA7 A;  4B4Z A;  4BL2 A;  1NZO A;  3IXG A;  4WMC D;  4X69 A;  3C4O A;  2Q9M A;  4ZBE A;  2HP5 A;  1JTD A;  5M18 A;  5FI2 A;  5FQI A;  4KZ8 A;  1CK3 A;  2R9X A;  1YM1 A;  4KZ4 A;  4N92 A;  5DVA A;  5GL9 A;  4BEN A;  1G6A A;  1ERM A;  2PU4 A;  3PBT A;  3IHB A;  4N9L A;  2H0T A;  2DRW A;  4BL3 A;  2I72 A;  5CEB A;  3AGF A;  5IHV A;  5TR7 A;  3WS0 A;  1PWC A;  3ZG0 A;  2B5R A;  1IKI A;  3A3F A;  2A49 A;  3DW0 A;  2XQZ A;  3HLC A;  2RL3 A;  2EX9 A;  4JLF A;  4C3Q A;  2EFU A;  4OPZ A;  1M40 A;  4HBT A;  4DRT A;  4PMA A;  3ZFZ A;  1K4F A;  4LV1 A;  5HAR A;  4WMC A;  1YLT A;  2WKH A;  1GA9 A;  4OON A;  3A3J A;  4R0Q A;  4S2M A;  5GLC A;  1W8Y A;  2QMI A;  2ZM8 A;  3IF6 B;  5EUA A;  4Y7P A;  3S4X A;  3AGE A;  5KMW A;  1E3U A;  2BG1 A;  4R3B A;  3UN7 A;  2P9V B;  1CEG A;  3VP4 A;  3VP3 A;  2GDN A;  2WYX A;  1GHM A;  2ZC7 A;  3HLE A;  1PW1 A;  3OPL A;  4BD1 A;  3MZE A;  1RP5 A;  2Y2N A;  4B4X A;  1FR6 A;  4EBL A;  1PWG A;  1SHV A;  4C6Y A;  4LV0 A;  1FQG A;  3ZG9 B;  1W7F A;  5DTT A;  5M1A A;  3IF6 A;  1FOF A;  3PAG A;  4KZ3 A;  1CI9 A;  1IYP A;  3ZVW A;  1KE0 A;  2A3U A;  2H5S A;  4ZJ3 A;  1SDE A;  2JCH A;  5CHM A;  3N8S A;  2ZC6 B;  2Y2P A;  4BQM A;  1IKG A;  1YT4 A;  1VQQ A;  4WM9 A;  1KGE A;  1RGY A;  3QNC A;  1XPB A;  1PZP A;  2JC7 A;  3G2Y A;  3IWO A;  1OME A;  4KZ9 A;  3UE0 A;  1BSG A;  4JXW A;  4LV3 A;  1PW8 A;  1RGZ A;  3FWL A;  5FQK A;  3Q81 A;  3TG9 A;  3CG5 A;  1ESU A;  3PBN A;  3IH8 A;  4GD8 A;  4GDB A;  2HDR A;  1YLW A;  2EXB A;  3OPH A;  2G2U A;  4Q8I A;  1ALQ A;  2HDQ A;  3IF5 A;  2EX2 A;  3G35 A;  2RCX A;  4MBF A;  3OZH A;  3WS5 A;  2ZJ9 A;  4B88 A;  4E3J A;  5CHU A;  1BTL A;  1XA1 A;  1KE4 A;  4JBF A;  2R9W A;  5HAI A;  2WKE A;  3RJU A;  2Q9N A;  4OQI A;  3BFD A;  5E43 A;  1MBL A;  2E8I A;  3AGD A;  4S2K A;  5EVI B;  3VP0 A;  3ZVT A;  4EV4 A;  5EVI D;  4MNR A;  5FSR A;  3SOI A;  1HTZ A;  1IEL A;  3RXW A;  4ZDX A;  4WZ4 A;  1WYC A;  4YFM A;  4BLM A;  1XKZ A;  2DNS A;  5EPH A;  1PYY A;  1K25 A;  1L0D A;  1XGJ A;  3WWX A;  2WAD A;  3VSL A;  2EX6 A;  3Q82 A;  5EVI A;  2FFF B;  4U0X A;  1HZO A;  3Q7Z A;  3IHA A;  4C75 A;  5E2E A;  3LEZ A;  1NXY A;  1M6K A;  4GZB A;  4LCM A;  3M6H A;  1ONG A;  3W4P A;  2V1Z A;  3ZDJ A;  4QJG A;  3IQA A;  3NY4 A;  4KZA A;  1SKF A;  4N1H A;  1Q2Q A;  3M2J A;  3OCL A;  5HFO A;  3UY6 A;  1E4D A;  1NYY A;  3LCE A;  3BLS A;  3CMZ A;  3MKF A;  1L0E A;  2C6W B;  3VOY A;  3ZNY A;  2JBF A;  4GKU A;  5DF7 A;  3FV7 A;  4EUZ A;  1S6R A;  4KZ7 A;  2ZC5 B;  5FQJ A;  4O7D A;  4OPR A;  1KE3 A;  2Y2K A;  1ZKJ A;  3GMW A;  2ZC3 B;  4E6W A;  4OPQ A;  5A93 A;  1CI8 A;  2Y59 A;  3HBR A;  3PBS A;  4RX3 A;  4QY6 A;  1PI4 A;  2J8Y A;  1KVM A;  4OOL A;  3IWQ A;  3UPN A;  1BLC A;  1N4O A;  1YLJ A;  2ZC4 B;  4OQG A;  4BJP A;  2ZQA A;  3BFE A;  4D2O A;  5JYO A;  4KEN B;  4A5R A;  4PM9 A;  1BT5 A;  4HES A;  4JKT A;  3VP2 A;  1ES5 A;  3PBO A;  5U47 A;  5F1F A;  3VOZ A;  4X68 A;  4BD0 A;  1WE4 A;  2Y2I A;  4JF4 A;  1XA7 A;  2XLN A;  2ZQD A;  3B3X A;  4KG6 A;  5FQ9 A;  1FCM A;  3G34 A;  3A3E A;  1K54 C;  4RVA A;  4S2N C;  1MWR A;  3ZG7 B;  4ZAM A;  1ZG6 A;  2EXA A;  2WZZ A;  4NK3 A;  3V5M A;  3VFF A;  3WRZ A;  4HBU A;  1ONH A;  3C5A A;  3IT9 A;  5GHY A;  5JYP A;  4H8R A;  3G30 A;  3IF6 C;  2Y2L A;  3S22 A;  1JWZ A;  2J9O A;  2WUQ A;  1K6R A;  1I2W A;  4R23 A;  2XF3 A;  3G31 A;  2X01 A;  3ISG A;  4N1X A;  5L2F A;  1NZU A;  3GRJ A;  5AQA A;  4ZJ2 A;  4WEJ A;  1MWS A;  1NRF A;  1JWV A;  3EQU A;  3ITB A;  3IXH A;  4ID4 A;  5CGS A;  1VM1 A;  3Q1F A;  3V3S A;  1GHP A;  4OP5 A;  4EBN A;  2XDM A;  1O7E A;  3UE1 A;  2X02 A;  4DDY A;  3BM6 A;  3HLD A;  3UO9 A;  3MXR A;  2PBY A;  4IBX A;  1KDW A;  2OV5 A;  2Y2G A;  3A3D A;  3MKE A;  4MBH A;  4NET A;  4Y0O A;  1U60 A;  1ZC2 A;  2QPN A;  1YLY A;  2P74 A;  1LHY A;  2ZQC A;  3MXS A;  3V39 A;  1PWD A;  3VP1 A;  2VGJ A;  1YLP A;  3NCK A;  3HRE A;  3PBQ A;  1C3B A;  5TGF A;  1KVL A;  4JXV A;  1E3U D;  2OLV A;  3O88 A;  4JF5 A;  1SDN A;  3SH9 A;  4UHU A;  2JE5 A;  2J7V A;  5A92 A;  3IXB A;  4KG2 A;  1W79 A;  1W5D A;  5GLB A;  4QD4 A;  4KZ5 A;  2OSU A;  5FAO A;  5F83 A;  4CJN A;  2HP9 A;  4LCL A;  2ZD8 A;  4M3K A;  3UDI A;  5CTN A;  1L2S A;  4L0L A;  2VGK A;  3BEB A;  3E2L A;  1Z6F A;  2WGW A;  3WRT A;  5CHJ A;  2PU2 A;  3ZG5 A;  1ERO A;  4OQ0 A;  2XFT A;  3C7U A;  5FQQ A;  3UDX A;  1NY0 A;  1HVB A;  4WBG A;  3NC8 A;  3SS3 A;  3IH9 A;  2WGI A;  5FA7 A;  1WYB A;  3BYD A;  5FI7 A;  3GVB A;  4X53 A;  1NJ4 A;  3HUO A;  5EE8 A;  4F94 A;  5TFQ A;  5G18 A;  4ZTK A;  4OLD A;  4KZ6 A;  4KZB A;  4K0W A;  4GD6 A;  4JXG A;  4E3I A;  2Y55 A;  4UA9 A;  3S1Y A;  5CER A;  3NBL A;  4CPK A;  1EI5 A;  1W8Q A;  4P87 A;  5E2F A;  3W4Q A;  3Q07 A;  4ZJ1 A;  1YQS A;  5D3O A;  3RXX A;  1XP4 A;  1QME A;  4DE3 A;  5EVL A;  2V20 A;  5I94 A;  4P6B A;  1XGI A;  2XGN A;  4R4R A;  5GLA A;  2Y2Q A;  3Q7V B;  4WZ5 C;  1FSW A;  4JPM A;  5FDH A;  3GTC A;  3QNB A;  3W8K A;  4EQI A;  3GV9 A;  4IVK A;  4PM8 A;  4RX2 A;  4X55 A;  4PM7 A;  2WAE A;  1MXO A;  2FFY A;  3IWI A;  4E3N A;  3UPO A;  3MBZ A;  4DKI A;  4QY5 A;  4R3J A;  5GHZ A;  2J9P A;  2XEP A;  1BLP A;  2ZLY A;  3N8R A;  4S2N A;  4GDN A;  3OPP A;  5FQM A;  2XD5 A;  2Z2M B;  4GB7 A;  3FZC A;  3UPP A;  5HX9 A;  1BUL A;  4JF6 A;  3HLB A;  2XH9 A;  4WEL A;  1BZA A;  4QHC A;  2Z2L B;  3GR2 A;  2Y91 A;  4XXR A;  3OPR A;  4P0M A;  5CED A;  3G2Z A;  1LL5 A;  3BEC A;  3V3R A;  3O3V A;  3UE3 A;  2ZMA A;  1N9B A;  4UA6 A;  3ITA A;  4S2P A;  3A3I A;  4K91 A;  3VMA A;  3ZG8 B;  2ZQ7 A;  1BLS A;  3ZNT A;  4FH4 A;  3FKW A;  3HL9 A;  3D4F A;  1IYQ A;  3MZF A;  5KZH A;  2HDU A;  2OLU A;  3WS2 A;  1QMF A;  3P98 A;  2ZM0 A;  3FYZ A;  3C7V A;  3DWK A;  1ESI A;  3SH8 A;  4QB8 A;  2ZM2 A;  3DWZ A;  4PPR A;  2WZX A;  2IWC A;  4E3M A;  4PM5 A;  5FI6 A;  4S2J A;  4Y0U A;  1K4E A;  2Y2M A;  3LY4 A;  4FH2 A;  5BOH A;  4DE1 A;  1K38 A;  4RYE A;  3UNW A;  1HD8 A;  4OOM A;  2V2F F;  1H5X A;  3SS5 A;  1XX2 A;  4U3T A;  3ZGA B;  3IXD A;  5FAT A;  2EFX A;  3DTM A;  4S2I A;  3VSK A;  3HLF A;  2CC1 A;  5E2G A;  4OOY A;  5HW3 A;  4XUZ A;  1IEM A;  3HLG A;  3GQZ A;  5EOO A;  3TSG A;  5CGW A;  3W4O A;  1GCE A;  1DY6 A;  5AQ7 A;  3HLW A;  1SCW A;  2DCF A;  4LEN A;  1K57 C;  4MBK A;  4OH0 A;  3N7W A;  2ZQ8 A;  1AXB A;  1H8Y A;  4EBP A;  1K54 A;  3TOI A;  1I5Q A;  1GA0 A;  5CEC A;  1O07 A;  5GHX A;  3V50 A;  4X56 A;  1LL9 A;  3FKV A;  4OKP A;  1K6S A;  5KSC A;  2UWX A;  1L0F A;  3SS4 A;  1DJC A;  3WS1 A;  1MWT A;  4PM6 A;  1LLB A;  2BLS A;  4N9K A;  2WGW B;  4DE2 A;  4IED A;  1YMX A;  2HDS A;  1LI9 A;  3HUN A;  2IWB A;  4DXC A;  5E2H A;  4KQQ A;  2H10 A;  5EOE A;  1IYO A;  4OP8 A;  2ZQ9 A;  1Y54 A;  4DXB A;  1PI5 A;  4DF6 A;  2XFS A;  3VFH A;  4K0X A;  3O86 A;  4U0T A;  3BLM A;  1G68 A;  3NI9 A;  3I7J A;  1MWU A;  1PIO A;  3JYI A;  5FAQ A;  5J8X A;  3LO7 A;  3C4P A;  4Z9Q A;  5EEC A;  1MY8 A;  1JTG A;  3BFG A;  1K56 A;  2XR0 A;  4E6X A;  5A90 A;  1FR1 A;  3N4I A;  4WEK A;  3BFC A;  4YIN A;  2H0Y A;  1ZG4 A;  4HEF A;  5FAS A;  5DTK A;  3CJM A;  3N6I A;  4Y0T A;  3UDF A;  2WK0 A;  1TEM A;  4GN2 A;  4OPY A;  1K55 A;  4FSF A;  2HP6 A;  3HVF A;  4QU3 A;  3CZD A;  3M6B A;  4MEZ A;  1KGF A;  2Y2H A;  2WAF A;  3PAE A;  3NDE A;  2EX8 A;  3G4P A;  3SH7 A;  4DE0 A;  4XUX A;  2IWD A;  1RCJ A;  4KG5 A;  2XD1 A;  4LV2 A;  3PBR A;  1LI0 A;  2Y2O A;  2Y2J A;  1XXM A;  3GSG A;  3PTE A;  4E3K A;  1TDL A;  1NYM A;  4UAA A;  1BUE A;  3MFD A;  4DDS A;  3OC2 A;  1BLH A;  3E2K A;  4FD8 A;  2P9V A;  4P85 A;  4JXS A;  3MZD A;  1ES4 A;  1YLZ A;  4MLL A;  4KQO A;  1K56 D;  1EWZ A;  4RA7 A;  3N8L A;  1S0W A;  5CRF A;  3BRM A;  4GOG A;  3ZHH A;  1DJB A;  4GNU A;  1ERQ A;  5HL1 A;  1JVJ A;  3NDG A;  1H8Z A;  5CXW A;  1ES3 A;  1TVF A; 
#chains in the Genus database with same CATH topology
 1TF1 A;  3PD2 A;  1CEF A;  5F82 A;  5HAQ A;  2HJE A;  1TDG A;  5HAP A;  1E25 A;  1FCN A;  1DP8 A;  1WA9 A;  5A91 A;  1GHI A;  2I9V A;  1TS0 A;  4S2O A;  3O87 A;  4FCF A;  4IUK A;  2LB5 A;  3BW6 A;  3P09 A;  4EWF A;  5M19 A;  5DF9 A;  2QZ6 A;  5CTM A;  3HUM A;  2GNX A;  4YOF A;  4E3O A;  2HPB A;  4IVI A;  4BL2 A;  4X69 A;  2VK3 A;  4ZBE A;  2PR5 A;  1CK3 A;  4EXO A;  3S7P A;  4BEN A;  1G6A A;  3PBT A;  4N9L A;  2H0T A;  4BL3 A;  2XA7 S;  5TR7 A;  4PKY G;  2A49 A;  2RL3 A;  3FPV A;  2HZ5 A;  1M40 A;  1XFQ A;  4IHQ A;  3ZFZ A;  3IX8 A;  2YKF A;  3T50 A;  5HAR A;  2PAV P;  4S0K A;  2K7S A;  3IS2 B;  1YLT A;  2WKH A;  2QMI A;  5EUA A;  4Y7P A;  3S4X A;  3AGE A;  1VEU A;  1PW1 A;  4BD1 A;  3BWL A;  3MZE A;  1RP5 A;  2Y2N A;  1PWG A;  4LV0 A;  2W1R A;  3ZG9 B;  2CMN A;  1CI9 A;  3KNF A;  2H5S A;  4ZJ3 A;  1SDE A;  2JCH A;  5CHM A;  2Y2P A;  4BQM A;  2O9C A;  1XPB A;  3IWO A;  1OME A;  1BSG A;  4LV3 A;  1PW8 A;  3FWL A;  5FQK A;  1OJG A;  3TG9 A;  1ESU A;  1OTB A;  3IH8 A;  5DJU A;  3KSI A;  4Q8I A;  4MBF A;  3VE3 A;  3WS5 A;  3E4P A;  3KX0 X;  5HAI A;  3RJU A;  4HP9 A;  5HDD A;  1MBL A;  4S2K A;  4Y3I A;  1IEL A;  4LRX C;  4YFM A;  2W3F A;  3F1P A;  4EER A;  3WWX A;  4X1L A;  1YPR A;  1HZO A;  4GJ4 A;  3QP2 A;  1TS7 A;  5E2E A;  2PD8 A;  2V1Z A;  3IQA A;  3NY4 A;  4NBJ A;  2JKR M;  3OCL A;  2ZL1 B;  1E4D A;  3F1O B;  2IA2 A;  3LCE A;  3MKF A;  1L0E A;  2VLG A;  3FV7 A;  4OPR A;  2HGV A;  1Z09 A;  4OPQ A;  1H8M A;  4ETX A;  4QY6 A;  1PI4 A;  4OOL A;  4OQG A;  2VKS A;  3S7O A;  3EOI A;  1NLZ A;  3PD4 A;  1X0O A;  2KLI A;  4PM9 A;  4JKT A;  3LR0 A;  1EW0 A;  1XA7 A;  5FDS A;  5FQ9 A;  1FCM A;  1OPX A;  4HJ4 A;  1K54 C;  1W63 M;  4Y2F A;  4ME4 A;  1MKM A;  2WZZ A;  4MN7 A;  5JYP A;  3G30 A;  2QHK A;  3S22 A;  1K6R A;  1I2W A;  2B18 A;  1PFL A;  4EU0 A;  4N1X A;  3GRJ A;  5AQA A;  4WEJ A;  1NRF A;  1ACF A;  1JWV A;  2QJ7 A;  3T1X A;  5CGS A;  3S7Q A;  2DMW A;  4EBN A;  2XDM A;  1O7E A;  4WL9 A;  2ZMF A;  5FEG A;  3BM6 A;  3UO9 A;  3MXR A;  4IBX A;  1KDW A;  3CLO A;  4MBH A;  2DBO A;  2ZQC A;  3VP1 A;  4S0J A;  3LIF A;  2XRN A;  3NCK A;  2J3T C;  3HRE A;  4PHT A;  3T1Q B;  2GX5 A;  4JF5 A;  2GZA A;  2JE5 A;  2ZBB A;  3IXB A;  5F69 A;  1VET B;  4KG2 A;  1W79 A;  4H6J A;  1W5D A;  4QD4 A;  3JVV A;  5FAO A;  4CJN A;  5HPI A;  4O0P A;  1IFQ A;  1SKO A;  5HZH A;  5FEF A;  4I3J A;  2HL1 A;  2WGW A;  3QP1 A;  5FQQ A;  1NY0 A;  4LLO B;  4NXB A;  3SZT A;  5EE8 A;  5TFQ A;  2BAS A;  5LBR A;  4KZB A;  4K0W A;  3S1Y A;  2V0U A;  5TBM A;  3W4Q A;  1W8Q A;  3RXX A;  5GLA A;  2Y2Q A;  3GTC A;  1IOU A;  4PM8 A;  4RX2 A;  3MS6 A;  1YAX A;  4EQ1 A;  5GHZ A;  3N8R A;  4R38 A;  2J3W A;  4HHD A;  5HX9 A;  1P9R A;  4EEP A;  4CLC E;  4QHC A;  3LIC A;  4AFI A;  3G6O A;  4P0M A;  3G2Z A;  4BMW A;  1S4S A;  3O3V A;  4HY8 A;  2ZMA A;  1N9B A;  1OT6 A;  4F3L A;  3HL9 A;  1AWI A;  1IYQ A;  3IX4 A;  4DJ2 A;  1XJ2 A;  3NJA A;  4E3M A;  4Q0I A;  4S2J A;  3T4Q A;  4OOM A;  2G7U A;  3LGO A;  5EVE A;  3IXD A;  5CX7 A;  2EFX A;  5EOO A;  3TSG A;  5CGW A;  3W4O A;  1SCW A;  3CI6 A;  1DRM A;  4LEN A;  4MBK A;  1AXB A;  1H8Y A;  4EBP A;  1K54 A;  4H6J B;  3TOI A;  1I5Q A;  1GA0 A;  4Y13 A;  3T4L A;  4X56 A;  2D01 A;  1LL9 A;  3H7W A;  4OKP A;  2Y8H A;  2UWX A;  3SS4 A;  1DJC A;  4N9K A;  1NWZ A;  2WGW B;  4DE2 A;  4IED A;  1YMX A;  1LI9 A;  3HUN A;  2IWB A;  3KNP A;  4KQQ A;  2B95 A;  1IYO A;  3KSF A;  2UV0 E;  1PI5 A;  3VFH A;  4K0X A;  4U0T A;  1MWU A;  3LO7 A;  2HJ9 C;  3C4P A;  3TRC A;  1VET A;  3BFG A;  2B02 A;  2XR0 A;  3N4I A;  3UMD A;  4YIN A;  4HEF A;  4GLQ A;  1TC5 A;  1TEM A;  3MQ0 A;  5L09 A;  3CZD A;  2NUP C;  3G4P A;  4DE0 A;  4KG5 A;  2XD1 A;  4L9F A;  2Y2O A;  1DP6 A;  2Y2J A;  4G3K A;  4IJG A;  2VV7 A;  4FOF A;  4E3K A;  1NYM A;  2FH5 A;  4GS9 A;  1BUE A;  1BLH A;  3E2K A;  2P9V A;  3MZD A;  4RA7 A;  3N8L A;  1GSX A;  5CXW A;  1ES3 A;  4WLA A;  5EVI C;  4X6T A;  1YMS A;  1IYS A;  5DFX A;  2C5W B;  5FAP A;  2XK1 A;  2Q0O A;  4KQR A;  4RRF A;  3M2K A;  3G32 A;  3R7W B;  2WKQ A;  5DF8 A;  4RRJ A;  3BQA A;  1I2S A;  3LY3 A;  4OLG A;  4MDZ A;  4E3L A;  1J9M A;  4WYY A;  5J7E A;  4FUW A;  4RR9 A;  4R1G A;  3MQO A;  4HOI A;  4S2L A;  5CGX A;  5J61 A;  5F5Y A;  1Y4O A;  4YWZ A;  5AQ9 A;  3OLO A;  4IBR A;  1ES2 A;  3C4O A;  2JN7 A;  2Q9M A;  1JTD A;  5M18 A;  4LRZ E;  5FQI A;  1YM1 A;  3U4L P;  4HJ3 A;  4KZ4 A;  4LPZ A;  2PU4 A;  3IHB A;  2PR6 A;  2I72 A;  4HIA A;  4LRY C;  3A3F A;  3A0V A;  2Z6C A;  1MC0 A;  4HBT A;  1K4F A;  3LMV A;  4R70 A;  4S2M A;  1W8Y A;  1E3U A;  3VP4 A;  3VP3 A;  2GDN A;  2WYX A;  3BJN A;  3OPL A;  1NLY A;  4EBL A;  2ZL1 A;  5MC7 A;  1FQG A;  3PAG A;  1KE0 A;  2A3U A;  3HJK A;  3N8S A;  5DKL A;  2JC7 A;  3G2Y A;  4RRH A;  3CAX A;  3MR0 A;  4B93 A;  2VZW A;  2V1B A;  4P6Z M;  2ZOH A;  2W3E A;  2HDR A;  3B47 A;  1YLW A;  3RTY A;  3OPH A;  2HDQ A;  3IF5 A;  2EX2 A;  2W3D A;  5EM1 A;  4RR7 A;  3MF0 A;  1KE4 A;  3F1P B;  2WKR A;  3D9Y A;  3B42 A;  4OQI A;  3BFD A;  5E43 A;  1Y28 A;  3P01 A;  2NUT C;  2QJ5 A;  2E8I A;  4ARZ B;  4GHI B;  2L4R A;  3A0S A;  4ZDX A;  1WYC A;  2DNS A;  4EES A;  1K25 A;  1N9N A;  4R6L A;  2WAD A;  3VV4 A;  3VSL A;  1HLU P;  2E8J A;  4LCM A;  4KZA A;  1F9I A;  4N1H A;  5TJJ A;  3M2J A;  3BLS A;  3VOY A;  3ZNY A;  1LSW A;  5DF7 A;  4EUZ A;  4KZ7 A;  2ZC5 B;  2EA9 A;  2Y2K A;  1ZKJ A;  3O5Y A;  2D02 A;  5A93 A;  1CI8 A;  3A0R A;  3PBS A;  4Z1W A;  3BY8 A;  3UPN A;  2ZC4 B;  2P7J A;  3KYQ A;  1BT5 A;  4G3V A;  5F1F A;  1UWP X;  4BD0 A;  4UQI M;  3NHQ A;  3HCY A;  4EEU A;  3A3E A;  2OOL A;  1D7E A;  3H82 B;  3JVU A;  3C5A A;  5GHY A;  2JKR I;  4H8R A;  3EGX C;  2WUQ A;  1V9Z A;  5IS1 A;  4KUO A;  4NXE A;  5L2F A;  4RRG A;  1NZU A;  4ZJ2 A;  3V3S A;  1GHP A;  4OP5 A;  4S03 A;  5HWW A;  3LIB A;  2PBY A;  3IX3 A;  1G5U A;  2Y2G A;  3A3D A;  4QPR A;  4Y0O A;  1U60 A;  1YLY A;  1LHY A;  1PWD A;  1YSP A;  3PBQ A;  1C3B A;  5G4Y A;  1KVL A;  4MMN A;  3SH9 A;  5FL3 A;  1OTE A;  4KZ5 A;  5F83 A;  4LCL A;  1GSV A;  3UDI A;  3VE4 A;  2PD7 A;  1L2S A;  4L0L A;  1JKE A;  3KOB A;  3WRT A;  3ZG5 A;  1ERO A;  3UB9 A;  4WBG A;  3NC8 A;  3SS3 A;  5FA7 A;  4MN5 A;  1H0M A;  4EW7 A;  3HUO A;  4F94 A;  4ZTK A;  1S4R A;  3EEA A;  4X1M A;  2M7V A;  4UA9 A;  2PT7 A;  4CLC B;  3TE8 A;  4RRQ A;  2W1T A;  5KIZ A;  4ZJ1 A;  5D3O A;  1XP4 A;  5HL6 A;  2P04 A;  4P6B A;  1PNE A;  3Q7V B;  4EQI A;  4IVK A;  4X55 A;  1TD5 A;  2XSS A;  4GHI A;  4QY5 A;  4R3J A;  2J9P A;  2XEP A;  3NOU C;  2INW A;  3IS2 A;  3D72 A;  2Z2M B;  3DBA A;  2PYP A;  4K08 A;  3LI9 A;  4WEL A;  2J3T D;  3OPR A;  1LL5 A;  4RRA A;  4UA6 A;  2ZQ7 A;  4FH4 A;  4I5S A;  2OLU A;  3P98 A;  3MSH A;  1ESI A;  3T12 B;  3DWZ A;  2IWC A;  1K4E A;  1CF0 A;  3KOC A;  5BOH A;  4UQI S;  2P08 A;  1K38 A;  1H5X A;  1XX2 A;  4U3T A;  3ZGA B;  2VGL M;  5FAT A;  2V1A A;  1NRJ A;  4S2I A;  5K5B A;  3H82 A;  2CC1 A;  4R3A A;  5HW3 A;  4XUZ A;  3HLG A;  1S67 L;  3GQZ A;  4O8G A;  1GCE A;  3HLW A;  3PYP A;  2DCF A;  5DJT A;  5GHX A;  3V50 A;  2ACG A;  3FKV A;  1K6S A;  1L0F A;  4PM6 A;  1J7G A;  2HDS A;  2H10 A;  2OAQ 1;  3OBF A;  2KX6 A;  3KYZ A;  1T18 A;  3BQ8 A;  4OP8 A;  2W0N A;  5AVF A;  3NI9 A;  5J3W A;  3I7J A;  2XRO A;  4HI4 A;  1GSW A;  1FR1 A;  4GW9 A;  4WEK A;  3UB7 A;  5DTK A;  3CJM A;  4GN2 A;  1N9L A;  4UEY A;  1K55 A;  2PHY A;  2WAF A;  3NDE A;  3LMT A;  4FTX A;  4B9O A;  1RCJ A;  4LV2 A;  1FIK A;  3PBR A;  1LI0 A;  1XXM A;  2YKH A;  1TDL A;  3LR5 A;  4I38 A;  3GDI A;  5CRF A;  1JVJ A;  3NDG A;  1H8Z A;  3C30 A;  4MN6 A;  2JKT I;  2Y4A A;  1K55 C;  3BFF A;  1MKI A;  1FCO A;  4NG2 A;  1K57 A;  4S0I A;  3Q7V A;  5AQB A;  2G2W A;  3OCN A;  5KSH A;  5F1G A;  1ZHH B;  2X71 A;  1UGU A;  4HH3 A;  3LFV A;  5DFY A;  2WKP A;  1KGG A;  4P6Z S;  1PZO A;  3ZCZ A;  1LT0 A;  4WZ5 A;  4RRI A;  5GLD A;  1XJ3 A;  1DJA A;  4L9G A;  4B4Z A;  1NZO A;  3IXG A;  4WMC D;  3C2W A;  3C8C A;  5FI2 A;  2J80 A;  4Y17 A;  1W63 Q;  2R9X A;  5DVA A;  3KOD A;  2DRW A;  3U2A A;  5CEB A;  3KSH A;  3WS0 A;  1PWC A;  3ZG0 A;  4JLF A;  1IKI A;  4Q0J A;  2XQZ A;  2EX9 A;  4C3Q A;  2EFU A;  4OPZ A;  5I5L A;  1P97 A;  4DRT A;  4PMA A;  4WMC A;  2M7U A;  1GA9 A;  4OON A;  3A3J A;  4R0Q A;  5GLC A;  5TBM B;  1CQA A;  2ZM8 A;  3T4J A;  5KMW A;  2BG1 A;  4R3B A;  1CEG A;  1GHM A;  3HLE A;  1VHM A;  4G3W A;  2QWS A;  4B4X A;  1FR6 A;  3QP8 A;  4C6Y A;  1ODV A;  1SHV A;  3UB5 P;  3IF6 A;  4KZ3 A;  1IYP A;  1TS6 A;  1IKG A;  1YT4 A;  1VQQ A;  1RGY A;  3QNC A;  1PZP A;  4PKY A;  3MXQ A;  3PBN A;  2G2U A;  3RFB A;  5J4E A;  2HL2 A;  2VJW A;  3OZH A;  4E3J A;  5CHU A;  3EGD C;  1P9W A;  4HNB A;  4RRK A;  3UE6 A;  4JBF A;  2JHE A;  2WKE A;  1F2K A;  3AGD A;  3VP0 A;  4EV4 A;  1HTZ A;  4ZRR A;  4BLM A;  1XKZ A;  5EPH A;  2A24 B;  3MJQ A;  2A2L A;  4Q0H A;  3CIT A;  1XGJ A;  1DP9 A;  2V8C A;  1LSV A;  3PD5 A;  5EVI A;  2FFF B;  4U0X A;  3Q7Z A;  5HDC A;  4C75 A;  3LEZ A;  1NXY A;  1P0Z A;  3ZDJ A;  1ONG A;  4QJG A;  1YKD A;  1SKF A;  1Q2Q A;  1NYY A;  3CMZ A;  4GKU A;  3KSG A;  1S6R A;  4RQ9 A;  1KE3 A;  3GMW A;  2ZC3 B;  4E6W A;  2ZMV A;  5HSQ A;  5IT5 A;  2Y59 A;  4RX3 A;  3W2Z A;  1KVM A;  2J8Y A;  4M4X A;  1N4O A;  4BJP A;  3H7W B;  4D2O A;  3BFE A;  4HES A;  3VP2 A;  1ZTU A;  5U47 A;  4X68 A;  3P7N A;  2Y2I A;  2ZQD A;  3LID A;  1YSQ A;  3PD3 A;  4S2N C;  2KDK A;  3GEC A;  3KO4 A;  2QYB A;  1ZG6 A;  2EXA A;  4NK3 A;  1OT9 A;  4HBU A;  1ONH A;  3IT9 A;  4S0L A;  3IF6 C;  2J9O A;  2Y79 A;  2XF3 A;  2OWJ A;  2VX8 A;  3EQU A;  3IXH A;  5AVE A;  5IU1 A;  2X02 A;  3HLD A;  2OV5 A;  4NET A;  2HL0 A;  3MXS A;  4PAU A;  5TGF A;  4JXV A;  1E3U D;  2OLV A;  3O88 A;  4JGQ A;  3CUE C;  2J7V A;  4E04 A;  4RRD A;  3QP6 A;  2W27 A;  3F1O A;  3OOV A;  2HP9 A;  2AVX A;  4M3K A;  2O9A A;  5CTN A;  1F98 A;  3E2L A;  5C5K A;  1Z6F A;  2PU2 A;  3R7W A;  3K2N A;  3C7U A;  3UDX A;  4IUH A;  1OTA A;  4BBT A;  3IH9 A;  2WGI A;  3PHY A;  1WYB A;  3BYD A;  1NJ4 A;  3NEC A;  1G28 A;  1VB6 A;  5G18 A;  1TS8 A;  2A24 A;  4OLD A;  4GD6 A;  4JXG A;  4E3I A;  2VV6 A;  1SZV A;  4CPK A;  4P87 A;  5E2F A;  1YQS A;  3MFX A;  3T1S A;  5EVL A;  4HQA A;  2V20 A;  4L9E A;  5I94 A;  2XGN A;  4RR8 A;  5FDH A;  3GV9 A;  3UPO A;  4PM7 A;  2WAE A;  3IWI A;  4E3N A;  2OAP 1;  1BLP A;  2ZLY A;  4S2N A;  4XT2 B;  5FQM A;  1BUL A;  3HLB A;  4HJ6 A;  4LGW A;  1BZA A;  4XXR A;  5G4Z A;  5CED A;  3MQQ A;  4WN5 A;  3V3R A;  3ITA A;  3UB6 A;  3VMA A;  3ZG8 B;  3FKW A;  1XJ4 A;  3D4F A;  3WS2 A;  1QMF A;  2BTF P;  2ZM0 A;  3C7V A;  3DWK A;  1G6O A;  3SH8 A;  2ZM2 A;  4PPR A;  4PM5 A;  3F1N A;  4Y0U A;  2Y2M A;  4DE1 A;  4RYE A;  2PDR A;  3CPT B;  3DTM A;  3VSK A;  3HLF A;  5E2G A;  4OOY A;  3KO3 A;  2LB9 A;  3T4S A;  5HD3 A;  3T1R A;  4OH0 A;  3N7W A;  3FG8 A;  5CEC A;  3TJZ C;  1O07 A;  5KSC A;  3WS1 A;  1LLB A;  3LR3 A;  2PRF A;  2ZQ9 A;  1Y54 A;  3UB8 A;  4DF6 A;  3PR6 A;  3BLM A;  1G68 A;  5J8X A;  5EEC A;  2HV1 A;  3E0Y A;  5FAS A;  3DTE A;  4GCZ A;  2R78 A;  5EM0 A;  3N6I A;  2KOI A;  4OPY A;  4QU3 A;  3HVF A;  4ESP A;  1KGF A;  2Y2H A;  1T19 A;  2EX8 A;  2IWD A;  4CLC D;  3NUL A;  2VGL S;  3MFD A;  3NOT C;  4FD8 A;  4P85 A;  1J3W A;  2JKF A;  4JXS A;  1YLZ A;  4II7 A;  3CHW P;  4KQO A;  1EWZ A;  5F6A A;  5HWT A;  4XT2 A;  3ZHH A;  1DJB A;  1ERQ A;  1K0K A;  4Y15 A;  3ZVW A;  1FSY A;  1JNU A;  3LIA A;  3LYX A;  1S1Y A;  2W3G A;  2WKI A;  5DTS A;  2HKZ A;  4OVD A;  4DN0 A;  2K31 A;  1MPL A;  3QHY A;  1Q2P A;  4D60 A;  4I3A A;  4OQH A;  5HWV A;  2WGV A;  3NIA A;  3EQV A;  1KDS A;  3E4O A;  1JWP A;  3E98 A;  3WS4 A;  4JGO A;  4R4S A;  1L0G A;  4UA7 A;  2M1C A;  2HP5 A;  3K3D A;  4KZ8 A;  4N92 A;  5GL9 A;  2JKT M;  5EV0 A;  1ERM A;  3KO7 A;  3L7H A;  3TW8 A;  1KOU A;  3AGF A;  2ZOI A;  5IHV A;  2B5R A;  1A0K A;  3DW0 A;  3HLC A;  2XA7 M;  4LV1 A;  1D1J A;  3IF6 B;  4ARZ A;  3DTK A;  3UN7 A;  2P9V B;  3CPT A;  1LSX A;  2ZC7 A;  3IBJ A;  4S02 A;  5L07 A;  1W7F A;  3LI8 A;  5DTT A;  5M1A A;  5HDS A;  1FOF A;  3T4T A;  2O9B A;  2ZC6 B;  3IBR A;  4RRM A;  4WM9 A;  3ZYT A;  1KGE A;  4KZ9 A;  3EEH A;  3UE0 A;  4JXW A;  3PXP A;  1RGZ A;  3Q81 A;  3ICY A;  3CG5 A;  4GD8 A;  2OKV A;  4GDB A;  2EXB A;  1T1A A;  1ALQ A;  1V9Y A;  3G35 A;  2RCX A;  2QKP A;  3KYE A;  2ZJ9 A;  4B88 A;  1BTL A;  1XA1 A;  5HPF A;  4NKP A;  4I39 A;  2VV8 A;  2R9W A;  2Q9N A;  2VEA A;  4JGR A;  1XFN A;  5EVI B;  5L8M A;  3ZVT A;  5EVI D;  4MNR A;  5FSR A;  4RR6 A;  2H28 A;  3SOI A;  3RXW A;  4WZ4 A;  1OJ5 A;  1PYY A;  4NXF A;  1L0D A;  3S7N A;  3ZQ5 A;  2EX6 A;  3Q82 A;  2VA0 A;  3IHA A;  1M6K A;  4GZB A;  2MJ6 A;  3JPU A;  3M6H A;  3W4P A;  5HFO A;  3UY6 A;  2C6W B;  2JBF A;  5FQJ A;  4O7D A;  3NOP C;  3HBR A;  3IWQ A;  3L9K A;  1BLC A;  1YLJ A;  4DMZ A;  2ZQA A;  5JYO A;  4KEN B;  4A5R A;  2V9A A;  1ES5 A;  3PBO A;  3VOZ A;  1WE4 A;  4JF4 A;  4I3I A;  2XLN A;  3B3X A;  4KG6 A;  3G34 A;  2JKG A;  4RVA A;  1MWR A;  3ZG7 B;  4ZAM A;  3V5M A;  3VFF A;  3WRZ A;  1OTI A;  2Y2L A;  1JWZ A;  4R23 A;  3G31 A;  1Y2Q A;  2X01 A;  3ISG A;  3SW1 A;  3VOL A;  1MWS A;  3ITB A;  4ID4 A;  1VM1 A;  3Q1F A;  3UME A;  3UE1 A;  4DDY A;  2O99 A;  1L3L A;  3FPW A;  1N9O A;  3MKE A;  1ZC2 A;  2QPN A;  1PRQ A;  2P74 A;  4CLC A;  1BYW A;  3V39 A;  2VGJ A;  1YLP A;  3C38 A;  3DTI A;  1XJ6 A;  4O01 A;  4CQH A;  1SDN A;  4UHU A;  2L0W A;  5A92 A;  5GLB A;  2OSU A;  2L1M A;  2ZD8 A;  3KO6 A;  2VGK A;  3BEB A;  4RRB A;  5CHJ A;  3KO5 A;  3T4K A;  4OQ0 A;  2XFT A;  4YNR A;  4X25 A;  4CLC C;  2Z6D A;  1HVB A;  3BY9 A;  3T4O A;  4LFU A;  5FI7 A;  3GVB A;  4X53 A;  4MCW A;  1OTD A;  4KZ6 A;  3F1N B;  2Y55 A;  5CER A;  3NBL A;  1EI5 A;  1F5M A;  2PBD P;  3Q07 A;  4DE3 A;  3LEQ A;  1QME A;  1UWN X;  4KUK A;  1XGI A;  4R4R A;  2HF6 A;  3CUE A;  4WZ5 C;  1FSW A;  4JPM A;  1LL8 A;  3QNB A;  3W8K A;  3K3C A;  1MXO A;  2FFY A;  3KO9 A;  1S1Z A;  3LUQ A;  3MBZ A;  4DKI A;  3FC7 A;  4GDN A;  3RH8 B;  3OPP A;  1D06 A;  1S66 L;  2XD5 A;  4GB7 A;  3FZC A;  3UPP A;  1STZ A;  4DJ3 A;  4BBV A;  4JF6 A;  2O0Y A;  2XH9 A;  3R4K A;  1T1B A;  2Z2L B;  3GR2 A;  2Y91 A;  5L10 A;  3BEC A;  4ETZ A;  2OWH A;  3UE3 A;  5HD5 A;  4S2P A;  3A3I A;  3QP5 A;  4K91 A;  3ZNT A;  1BLS A;  5KZH A;  3MZF A;  2HDU A;  4RRR A;  5EFW A;  1T1C A;  2FZ0 A;  3DAV A;  3FYZ A;  3MMH A;  4QB8 A;  3CWF A;  2WZX A;  3HJI A;  5FI6 A;  3LY4 A;  4FH2 A;  4F3L B;  4RRC A;  3UNW A;  1HD8 A;  2V2F F;  3SS5 A;  1VEU B;  2EWV A;  4NEE D;  4RRL A;  1IEM A;  2W1T B;  1DY6 A;  5AQ7 A;  1MZU A;  4EET B;  4BWI A;  1K57 C;  2V8F A;  2ZQ8 A;  3LMU A;  4Y5F A;  1MWT A;  2BLS A;  4WF0 A;  4DXC A;  5E2H A;  5EOE A;  4NBI A;  3LR4 A;  4HH2 A;  5AJG A;  4DXB A;  2XFS A;  1SKO B;  1CJF A;  3O86 A;  3QP4 A;  1PIO A;  5FAQ A;  3JYI A;  4WUJ A;  3EWK A;  4Z9Q A;  2W3H A;  1MY8 A;  1JTG A;  4EUV A;  1K56 A;  4E6X A;  4QWO A;  5A90 A;  5F68 A;  3H9W A;  3BFC A;  2H0Y A;  5DKK A;  1ZG4 A;  2V0W A;  3B33 A;  1FIL A;  2K2N A;  4Y0T A;  3UDF A;  2WK0 A;  3ULF A;  4FSF A;  2HP6 A;  3M6B A;  4MEZ A;  3PAE A;  1H3Q A;  2GJ3 A;  3SH7 A;  4KQD A;  4NXG A;  4XUX A;  4JGP A;  5A8B A;  3E4Q A;  3GSG A;  2EWW A;  3PTE A;  4UAA A;  4DDS A;  3OC2 A;  3LIE A;  1ES4 A;  4HP4 A;  2PYR A;  4MLL A;  1K56 D;  3D3O A;  1S0W A;  3BRM A;  4BBU A;  4GOG A;  3V67 A;  4GNU A;  5HL1 A;  1TVF A;  4GS9 B; 
#chains in the Genus database with same CATH homology
 3PD2 A;  5EVI C;  1CEF A;  1FSY A;  4X6T A;  5F82 A;  1YMS A;  1K55 C;  2Y4A A;  5HAQ A;  1IYS A;  3BFF A;  2C5W B;  1MKI A;  1TDG A;  1FCO A;  5HAP A;  5FAP A;  1K57 A;  2XK1 A;  1E25 A;  1FCN A;  2WKI A;  4KQR A;  4S0I A;  5DTS A;  2HKZ A;  4RRF A;  3Q7V A;  3M2K A;  5AQB A;  5A91 A;  2G2W A;  3G32 A;  1GHI A;  4OVD A;  3OCN A;  4RRJ A;  5DF8 A;  5F1G A;  5KSH A;  1MPL A;  1I2S A;  3LY3 A;  3QHY A;  1Q2P A;  4OLG A;  2X71 A;  4OQH A;  4S2O A;  4E3L A;  3O87 A;  4FCF A;  2WGV A;  1J9M A;  3P09 A;  3NIA A;  4EWF A;  5M19 A;  4WYY A;  5DF9 A;  4RR9 A;  3EQV A;  2QZ6 A;  5CTM A;  4R1G A;  1KDS A;  3HUM A;  1KGG A;  1JWP A;  4S2L A;  5CGX A;  5J61 A;  1PZO A;  3WS4 A;  4E3O A;  2HPB A;  4IVI A;  3ZCZ A;  5AQ9 A;  4WZ5 A;  4RRI A;  5GLD A;  4IBR A;  4R4S A;  1DJA A;  1L0G A;  1ES2 A;  4UA7 A;  4B4Z A;  4BL2 A;  1NZO A;  3IXG A;  4WMC D;  4X69 A;  3C4O A;  2Q9M A;  4ZBE A;  2HP5 A;  1JTD A;  5M18 A;  5FI2 A;  5FQI A;  4KZ8 A;  1CK3 A;  2R9X A;  1YM1 A;  4KZ4 A;  4N92 A;  5DVA A;  5GL9 A;  4BEN A;  1G6A A;  1ERM A;  2PU4 A;  3KOD A;  3PBT A;  3IHB A;  4N9L A;  3KO7 A;  2H0T A;  2DRW A;  4BL3 A;  2I72 A;  5CEB A;  3AGF A;  5IHV A;  5TR7 A;  3WS0 A;  1PWC A;  3ZG0 A;  2B5R A;  1IKI A;  3A3F A;  2A49 A;  3DW0 A;  2XQZ A;  3HLC A;  2RL3 A;  2EX9 A;  4JLF A;  4C3Q A;  2EFU A;  4OPZ A;  1M40 A;  4HBT A;  4DRT A;  4PMA A;  3ZFZ A;  1K4F A;  3LMV A;  4LV1 A;  5HAR A;  4WMC A;  4S0K A;  1YLT A;  2WKH A;  1GA9 A;  4OON A;  3A3J A;  4R0Q A;  4S2M A;  5GLC A;  1W8Y A;  2QMI A;  2ZM8 A;  3IF6 B;  5EUA A;  4Y7P A;  3S4X A;  3AGE A;  5KMW A;  1E3U A;  2BG1 A;  4R3B A;  3UN7 A;  2P9V B;  1CEG A;  3VP4 A;  3VP3 A;  2GDN A;  2WYX A;  1GHM A;  2ZC7 A;  3HLE A;  1PW1 A;  3OPL A;  4BD1 A;  3MZE A;  1RP5 A;  4S02 A;  2Y2N A;  4B4X A;  1FR6 A;  4EBL A;  1PWG A;  1SHV A;  4C6Y A;  4LV0 A;  1FQG A;  3ZG9 B;  1W7F A;  5DTT A;  5M1A A;  3IF6 A;  1FOF A;  3PAG A;  4KZ3 A;  1CI9 A;  3KNF A;  1IYP A;  3ZVW A;  1KE0 A;  2A3U A;  2H5S A;  4ZJ3 A;  1SDE A;  2JCH A;  5CHM A;  3N8S A;  2ZC6 B;  2Y2P A;  4BQM A;  1IKG A;  1YT4 A;  1VQQ A;  4RRM A;  4WM9 A;  1KGE A;  1RGY A;  3QNC A;  1XPB A;  1PZP A;  2JC7 A;  3G2Y A;  3IWO A;  4RRH A;  1OME A;  4KZ9 A;  3UE0 A;  1BSG A;  4JXW A;  4LV3 A;  1PW8 A;  1RGZ A;  3FWL A;  5FQK A;  3Q81 A;  3TG9 A;  3CG5 A;  1ESU A;  3PBN A;  3IH8 A;  4GD8 A;  2OKV A;  4GDB A;  2HDR A;  1YLW A;  2EXB A;  3OPH A;  2G2U A;  4Q8I A;  1ALQ A;  2HDQ A;  3IF5 A;  2EX2 A;  2HL2 A;  3G35 A;  2RCX A;  4MBF A;  3OZH A;  3WS5 A;  2ZJ9 A;  4B88 A;  4E3J A;  5CHU A;  1BTL A;  4RRK A;  1XA1 A;  4RR7 A;  1KE4 A;  4JBF A;  2R9W A;  5HAI A;  2WKE A;  3RJU A;  2Q9N A;  4OQI A;  3BFD A;  5E43 A;  1MBL A;  2E8I A;  3AGD A;  4S2K A;  5EVI B;  3VP0 A;  3ZVT A;  4EV4 A;  5EVI D;  4MNR A;  5FSR A;  4RR6 A;  3SOI A;  1HTZ A;  1IEL A;  3RXW A;  4ZDX A;  4WZ4 A;  1WYC A;  4YFM A;  4BLM A;  1XKZ A;  2DNS A;  5EPH A;  1PYY A;  1K25 A;  1L0D A;  1XGJ A;  3WWX A;  2WAD A;  3VSL A;  2EX6 A;  3Q82 A;  3PD5 A;  5EVI A;  2FFF B;  4U0X A;  1HZO A;  3Q7Z A;  3IHA A;  4C75 A;  5E2E A;  3LEZ A;  1NXY A;  1M6K A;  4GZB A;  4LCM A;  3M6H A;  1ONG A;  3W4P A;  2V1Z A;  3ZDJ A;  4QJG A;  3IQA A;  3NY4 A;  4KZA A;  4NBJ A;  1SKF A;  4N1H A;  1Q2Q A;  3M2J A;  3OCL A;  5HFO A;  3UY6 A;  1E4D A;  1NYY A;  3LCE A;  3BLS A;  3CMZ A;  3MKF A;  1L0E A;  2C6W B;  3VOY A;  3ZNY A;  2JBF A;  4GKU A;  5DF7 A;  3FV7 A;  4EUZ A;  1S6R A;  4KZ7 A;  2ZC5 B;  5FQJ A;  4O7D A;  4OPR A;  1KE3 A;  2Y2K A;  1ZKJ A;  3GMW A;  2ZC3 B;  4E6W A;  4OPQ A;  5A93 A;  1CI8 A;  2Y59 A;  3HBR A;  3PBS A;  4RX3 A;  4QY6 A;  1PI4 A;  2J8Y A;  1KVM A;  4OOL A;  3IWQ A;  3UPN A;  1BLC A;  1N4O A;  1YLJ A;  2ZC4 B;  4OQG A;  4BJP A;  2ZQA A;  3BFE A;  4D2O A;  5JYO A;  4KEN B;  4A5R A;  3PD4 A;  4PM9 A;  1BT5 A;  4HES A;  4JKT A;  3VP2 A;  1ES5 A;  3PBO A;  5U47 A;  5F1F A;  3VOZ A;  4X68 A;  4BD0 A;  1WE4 A;  2Y2I A;  4JF4 A;  1XA7 A;  2XLN A;  2ZQD A;  3B3X A;  4KG6 A;  5FQ9 A;  1FCM A;  3G34 A;  3A3E A;  1K54 C;  4RVA A;  3PD3 A;  4S2N C;  1MWR A;  3KO4 A;  3ZG7 B;  4ZAM A;  1ZG6 A;  2EXA A;  2WZZ A;  4NK3 A;  3V5M A;  3VFF A;  3WRZ A;  4HBU A;  1ONH A;  3C5A A;  3IT9 A;  5GHY A;  5JYP A;  4H8R A;  4S0L A;  3G30 A;  3IF6 C;  2Y2L A;  3S22 A;  1JWZ A;  2J9O A;  2WUQ A;  1K6R A;  1I2W A;  4R23 A;  2XF3 A;  3G31 A;  1Y2Q A;  2X01 A;  3ISG A;  4N1X A;  5L2F A;  4RRG A;  1NZU A;  3GRJ A;  5AQA A;  4ZJ2 A;  4WEJ A;  1MWS A;  1NRF A;  1JWV A;  3EQU A;  3ITB A;  3IXH A;  4ID4 A;  5CGS A;  1VM1 A;  3Q1F A;  3V3S A;  1GHP A;  4OP5 A;  4EBN A;  4S03 A;  2XDM A;  1O7E A;  3UE1 A;  2X02 A;  4DDY A;  3BM6 A;  3HLD A;  3UO9 A;  3MXR A;  2PBY A;  4IBX A;  1KDW A;  2OV5 A;  2Y2G A;  3A3D A;  3MKE A;  4MBH A;  4NET A;  4Y0O A;  1U60 A;  2DBO A;  1ZC2 A;  2QPN A;  1YLY A;  2P74 A;  1LHY A;  2ZQC A;  3MXS A;  3V39 A;  1PWD A;  3VP1 A;  2HL0 A;  4S0J A;  2VGJ A;  1YLP A;  3NCK A;  3HRE A;  3PBQ A;  1C3B A;  5TGF A;  1KVL A;  4JXV A;  1E3U D;  2OLV A;  3O88 A;  4JF5 A;  1SDN A;  3SH9 A;  4UHU A;  2JE5 A;  2J7V A;  5A92 A;  3IXB A;  4KG2 A;  1W79 A;  4RRD A;  1W5D A;  5GLB A;  4QD4 A;  4KZ5 A;  2OSU A;  5FAO A;  5F83 A;  4CJN A;  2HP9 A;  4LCL A;  2ZD8 A;  4M3K A;  3UDI A;  5CTN A;  1L2S A;  4L0L A;  2VGK A;  1JKE A;  3BEB A;  2HL1 A;  3E2L A;  3KOB A;  1Z6F A;  2WGW A;  3WRT A;  4RRB A;  5CHJ A;  3KO5 A;  2PU2 A;  3ZG5 A;  1ERO A;  4OQ0 A;  2XFT A;  3C7U A;  5FQQ A;  3UDX A;  1NY0 A;  1HVB A;  4WBG A;  3NC8 A;  3SS3 A;  3IH9 A;  2WGI A;  5FA7 A;  1WYB A;  3BYD A;  5FI7 A;  3GVB A;  4X53 A;  1NJ4 A;  3HUO A;  5EE8 A;  4F94 A;  5TFQ A;  5G18 A;  4ZTK A;  4OLD A;  4KZ6 A;  4KZB A;  4K0W A;  4GD6 A;  4JXG A;  4E3I A;  2Y55 A;  4UA9 A;  3S1Y A;  5CER A;  4RRQ A;  3NBL A;  4CPK A;  1EI5 A;  1W8Q A;  4P87 A;  5E2F A;  3W4Q A;  3Q07 A;  4ZJ1 A;  1YQS A;  5D3O A;  3RXX A;  1XP4 A;  1QME A;  4DE3 A;  5EVL A;  2V20 A;  5I94 A;  4P6B A;  1XGI A;  2XGN A;  4R4R A;  5GLA A;  2Y2Q A;  3Q7V B;  4WZ5 C;  4RR8 A;  1FSW A;  4JPM A;  5FDH A;  3GTC A;  3QNB A;  3W8K A;  4EQI A;  3GV9 A;  4IVK A;  4PM8 A;  4RX2 A;  4X55 A;  4PM7 A;  2WAE A;  1MXO A;  2FFY A;  3IWI A;  4E3N A;  3UPO A;  3KO9 A;  3MBZ A;  4DKI A;  4QY5 A;  4R3J A;  5GHZ A;  2J9P A;  2XEP A;  1BLP A;  2ZLY A;  3N8R A;  4S2N A;  4GDN A;  3OPP A;  5FQM A;  2XD5 A;  2Z2M B;  4GB7 A;  3FZC A;  3UPP A;  5HX9 A;  1BUL A;  4JF6 A;  3HLB A;  2XH9 A;  4WEL A;  1BZA A;  4QHC A;  2Z2L B;  3GR2 A;  2Y91 A;  4XXR A;  3OPR A;  4P0M A;  5CED A;  3G2Z A;  1LL5 A;  4RRA A;  3BEC A;  3V3R A;  3O3V A;  3UE3 A;  2ZMA A;  1N9B A;  4UA6 A;  3ITA A;  4S2P A;  3A3I A;  4K91 A;  3VMA A;  3ZG8 B;  2ZQ7 A;  1BLS A;  3ZNT A;  4FH4 A;  3FKW A;  3HL9 A;  3D4F A;  1IYQ A;  3MZF A;  5KZH A;  2HDU A;  2OLU A;  3WS2 A;  1QMF A;  3P98 A;  4RRR A;  2ZM0 A;  3FYZ A;  3C7V A;  3DWK A;  1ESI A;  3SH8 A;  4QB8 A;  2ZM2 A;  3DWZ A;  4PPR A;  2WZX A;  2IWC A;  4E3M A;  4PM5 A;  5FI6 A;  4S2J A;  4Y0U A;  1K4E A;  2Y2M A;  3LY4 A;  4FH2 A;  3KOC A;  5BOH A;  4RRC A;  4DE1 A;  1K38 A;  4RYE A;  3UNW A;  1HD8 A;  4OOM A;  2V2F F;  1H5X A;  3SS5 A;  1XX2 A;  4U3T A;  3ZGA B;  3IXD A;  5FAT A;  2EFX A;  3DTM A;  4S2I A;  3VSK A;  3HLF A;  2CC1 A;  5E2G A;  4OOY A;  5HW3 A;  4RRL A;  4XUZ A;  1IEM A;  3HLG A;  3GQZ A;  3KO3 A;  5EOO A;  3TSG A;  5CGW A;  3W4O A;  1GCE A;  1DY6 A;  5AQ7 A;  3HLW A;  1SCW A;  2DCF A;  4LEN A;  1K57 C;  4MBK A;  4OH0 A;  3N7W A;  2ZQ8 A;  1AXB A;  3LMU A;  1H8Y A;  4EBP A;  1K54 A;  3TOI A;  1I5Q A;  1GA0 A;  5CEC A;  1O07 A;  5GHX A;  3V50 A;  4X56 A;  1LL9 A;  3FKV A;  4OKP A;  1K6S A;  5KSC A;  2UWX A;  1L0F A;  3SS4 A;  1DJC A;  3WS1 A;  1MWT A;  4PM6 A;  1LLB A;  2BLS A;  4N9K A;  2WGW B;  4DE2 A;  4IED A;  1YMX A;  2HDS A;  1J7G A;  1LI9 A;  3HUN A;  2IWB A;  3KNP A;  4DXC A;  5E2H A;  4KQQ A;  2H10 A;  5EOE A;  4NBI A;  1IYO A;  4OP8 A;  2ZQ9 A;  1Y54 A;  4DXB A;  1PI5 A;  4DF6 A;  2XFS A;  3VFH A;  4K0X A;  3O86 A;  4U0T A;  3BLM A;  1G68 A;  3NI9 A;  3I7J A;  1MWU A;  1PIO A;  3JYI A;  5FAQ A;  5J8X A;  3LO7 A;  3C4P A;  4Z9Q A;  5EEC A;  1MY8 A;  1JTG A;  3BFG A;  1K56 A;  2XR0 A;  4E6X A;  5A90 A;  1FR1 A;  3N4I A;  4WEK A;  3BFC A;  4YIN A;  2H0Y A;  1ZG4 A;  4HEF A;  5FAS A;  5DTK A;  3CJM A;  1TC5 A;  3N6I A;  4Y0T A;  3UDF A;  2WK0 A;  1TEM A;  4GN2 A;  4OPY A;  1K55 A;  4FSF A;  2HP6 A;  3HVF A;  4QU3 A;  3CZD A;  3M6B A;  4MEZ A;  1KGF A;  2Y2H A;  2WAF A;  3PAE A;  3NDE A;  3LMT A;  2EX8 A;  3G4P A;  3SH7 A;  4DE0 A;  4XUX A;  2IWD A;  1RCJ A;  4KG5 A;  2XD1 A;  4LV2 A;  3PBR A;  1LI0 A;  2Y2O A;  2Y2J A;  1XXM A;  3GSG A;  3PTE A;  4E3K A;  1TDL A;  1NYM A;  4UAA A;  1BUE A;  3MFD A;  4DDS A;  3OC2 A;  1BLH A;  3E2K A;  4FD8 A;  2P9V A;  4P85 A;  4JXS A;  3MZD A;  1ES4 A;  1YLZ A;  4MLL A;  4KQO A;  1K56 D;  1EWZ A;  4RA7 A;  3N8L A;  1S0W A;  5CRF A;  3BRM A;  4GOG A;  3ZHH A;  1DJB A;  4GNU A;  1ERQ A;  5HL1 A;  1JVJ A;  3NDG A;  1H8Z A;  5CXW A;  1ES3 A;  1TVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...