2EX9A

Crystal structure of penicillin binding protein 4 (dacb) from escherichia coli, complexed with penicillin-v
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
450
structure length
442
Chain Sequence
b'TQLPAGANLALMVQKVGASAPAIDYHSQQMALPASTQKVITALAALIQLGPDFRFTTTLETKGNVENGVLKGDLVARFGADPTLKRQDIRNMVATLKKSGVNQIDGNVLIDTSIFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSVSLYSAPKPGDMAFIRVASYYPVTMFSQVRTLPRGSAEAQYCELDVVPGDLNRFTLTGCLPQRSEPLPLAFAVQDGASYAGAILKYELKQAGITWSGTLLRQTQVNEPGTVVASKQSAPLHDLLKIMLKKSDNMIADTVFRMIGHARFNVPGTWRAGSDAVRQILRQQAGVDIGNTIIADGSGLSRHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGSLQGVYNLAGFITTASGQRMAFVQYLSGYAVEIPLVRFESRLYKDIYQNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein 4
publication title Crystal structure of penicillin binding protein 4 (dacB) from Escherichia coli, both in the native form and covalently linked to various antibiotics
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 140
structure length 442
sequence length 450
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2005-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2ex9A01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 2ex9A02
2Y2KA 1K55A 3Q82A 3ZFZA 1GHIA 2HDRA 3P09A 4R4SA 4P85A 3UN7A 2J9PA 2WAFA 2J7VA 3HLCA 5CHMA 3UDXA 3VP0A 1DY6A 1ES5A 4U0XA 1XX2A 3IH9A 1L0DA 4R4RA 3W8KA 4X69A 3SS3A 4EBPA 5A92A 3AGFA 4KZBA 3Q81A 5HAPA 4WZ5C 3HL9A 3BFCA 1Z6FA 2GDNA 2ZQCA 3QHYA 4ZJ1A 3WS1A 2Y2QA 2A49A 2JC7A 2R9XA 3N7WA 4IBRA 3WRTA 3BRMA 2RCXA 2V2FF 4BJPA 3O3VA 1XP4A 2X71A 3QNCA 3N6IA 4X55A 4PM5A 2QZ6A 1SHVA 4OP8A 1BUEA 3IF6B 5E2EA 3VP4A 1YLJA 1PYYA 1NY0A 3A3DA 4ID4A 2WGVA 3P98A 4ZTKA 3BFFA 1Y54A 4JBFA 5CTMA 4E3KA 4B88A 3UY6A 3NIAA 4PMAA 3CG5A 5AQBA 1GCEA 4DE0A 4EWFA 3A3JA 1MKIA 2HP5A 3PAGA 4KQRA 5DTKA 3BM6A 3DW0A 1K4FA 4A5RA 1YLPA 1RGYA 4OKPA 3OCNA 5L2FA 4HBTA 2HPBA 4GD8A 3V50A 2PU2A 4JPMA 1BSGA 3HLDA 2HP9A 3IQAA 3ZCZA 1NYYA 1JTGA 1WYCA 4UA6A 5CECA 3Q7ZA 1AXBA 2C5WB 3WS5A 4Y0TA 4EV4A 1FSYA 5EOOA 2Y91A 5IHVA 4IVKA 1YLTA 3I7JA 1H8YA 4E3NA 3ISGA 5FQKA 3UE3A 4K0WA 3ZG9B 3EQUA 3IXGA 2Y2OA 4P0MA 3M6BA 4Q8IA 1HZOA 1NXYA 1EROA 2A3UA 3PBOA 3A3IA 1JWVA 1GHMA 1MWUA 4U3TA 3OZHA 1Q2PA 4UA9A 4IEDA 3V3SA 4L0LA 4Y0UA 4UHUA 3RXXA 2JBFA 3OC2A 5AQ7A 3HUMA 3VP3A 1TVFA 2G2WA 3VMAA 3UE0A 3WS0A 5CHJA 1DJAA 3GTCA 4JXSA 3OPHA 4K0XA 4E3JA 1W79A 2J8YA 5U47A 2WZXA 5CGWA 4DF6A 1G6AA 2JE5A 4QHCA 3W4QA 1K55C 5FI2A 5A91A 3IT9A 1I2WA 4WYYA 4GDNA 3FWLA 1MWRA 4LV1A 1RGZA 1KE4A 3SOIA 4KZ3A 4ZBEA 1PW8A 4BQMA 5M18A 4PM8A 3PBQA 4RVAA 3D4FA 3VP1A 4CPKA 4DXCA 3OPLA 1BLSA 3ZDJA 2HDUA 4GDBA 5F1GA 2WKIA 2VGJA 1HD8A 3IXBA 2EX8A 3LY3A 3G32A 1IYQA 1RCJA 2ZC5B 3VFHA 1CEFA 3QNBA 4O7DA 4PM6A 3WRZA 4OLDA 5AQ9A 1XA1A 1EI5A 4KZ6A 5FATA 2ZM0A 3FKWA 1ZG4A 4E3LA 4WBGA 1ZG6A 5HFOA 1MY8A 5EE8A 3HUOA 3SS5A 1ERMA 3G2YA 1K57A 4OLGA 4QB8A 4FH4A 4R23A 2HP6A 3NDEA 3M2KA 2ZM2A 3UE1A 3LY4A 3UO9A 3G35A 4JKTA 3GRJA 4XUZA 1I2SA 3BFDA 3ITAA 4R0QA 4EBNA 3JYIA 2OV5A 2FFFB 1M6KA 5EVIB 1BTLA 1FCOA 3OPRA 4YFMA 2WGWB 3ZHHA 3VSLA 1FCNA 1YMXA 1Q2QA 1YM1A 3N8SA 4S2JA 3FZCA 4R1GA 1IKIA 2WZZA 5HX9A 2H10A 2WUQA 4OOMA 4KQQA 1LL5A 5HL1A 5EECA 4DE1A 2ZQDA 1SDNA 2WKEA 2Y2LA 1LI9A 5FQMA 4Y7PA 3MZDA 1PIOA 2XD1A 4MNRA 5F83A 1JWPA 1L0GA 5J8XA 3M6HA 4C3QA 2C6WB 3ZGAB 4RX3A 2WAEA 2VGKA 3HLFA 1S6RA 3NY4A 3BECA 5E2FA 1U60A 2ZD8A 3A3EA 3AGEA 4ZDXA 1OMEA 2EXAA 2Y2MA 2Y2IA 3C7VA 3ZVTA 1HVBA 1FR6A 4JXGA 3C7UA 1PWCA 1ALQA 3OPPA 1RP5A 3G34A 2B5RA 1LL9A 4JLFA 1NZUA 5EVIA 4QJGA 4OOLA 3VOYA 3WWXA 1K4EA 1EWZA 1NRFA 3N8RA 3PBRA 2ZQ7A 2WK0A 3W4OA 1NZOA 2ZC7A 3VOZA 3HLWA 4N1HA 5FAPA 3GR2A 3IHBA 4BENA 4QD4A 1JWZA 1H5XA 3HBRA 4PPRA 4EBLA 2WKHA 3HLGA 1ESIA 2PU4A 1FSWA 1TDGA 4B4XA 4GN2A 2PBYA 3B3XA 1K38A 3TSGA 4OVDA 1GHPA 2BLSA 1MXOA 1TEMA 1WE4A 2Q9NA 5TFQA 1FCMA 2X02A 2IWCA 4WM9A 2R9WA 1VQQA 5FQQA 3IWIA 1ES3A 4OONA 4DKIA 2Z2LB 3WS2A 3UDIA 3G4PA 3RJUA 4EQIA 2HDQA 4UAAA 2XK1A 1XKZA 1WYBA 4R3BA 4S2OA 3Q7VB 3IF6A 3NCKA 1NJ4A 3O86A 3MZEA 5BOHA 4S2PA 5GLBA 3IH8A 4H8RA 1K57C 1YLZA 4IBXA 5CGXA 3NI9A 4ZAMA 5JYPA 1FOFA 2OLVA 1S0WA 5FAQA 3EQVA 1KVMA 1MWTA 2QMIA 1ES4A 4S2NA 4WMCA 1PZPA 4WZ4A 2IWBA 5CERA 1PZOA 4WELA 2XEPA 1BT5A 2XDMA 1GA9A 4OPYA 1FQGA 3FKVA 3Q07A 5GHXA 3C5AA 4X6TA 4KG5A 4QY6A 3TG9A 3NBLA 3MZFA 1E3UA 3GSGA 3LO7A 4S2MA 2DNSA 1CEGA 1L0EA 3ITBA 5DVAA 4N1XA 4OQGA 1YQSA 1XA7A 2EFUA 4IVIA 1PWDA 2XF3A 1KVLA 1MBLA 4OQ0A 4OOYA 2ZQAA 3Q1FA 3UPPA 4LV0A 2Y2GA 3IF5A 4P6BA 5E43A 2OSUA 1I5QA 3OCLA 1G68A 2Y2PA 5TR7A 2ZMAA 1BLHA 2FFYA 1W8YA 4KZAA 2EX9A 3E2KA 4S2IA 1BZAA 4DE3A 2Q9MA 4K91A 5DF8A 5EVIC 2J9OA 5EVID 4LV3A 4N9LA 3DTMA 5FI7A 5CRFA 5KSHA 3G31A 4JF6A 2Y2JA 3S4XA 1GA0A 5FSRA 3IWOA 5M1AA 5JYOA 4R3JA 1NYMA 2ZC4B 1C3BA 1XPBA 1IKGA 1L0FA 3W4PA 1J9MA 3CJMA 3V39A 2RL3A 2Y55A 3GMWA 2XLNA 1W7FA 5GHYA 2XFSA 3TOIA 3UNWA 3VSKA 2EXBA 3ZVWA 4MBFA 4DE2A 1YMSA 5FA7A 3HUNA 3M2JA 1BLCA 4KZ9A 3HLEA 4RX2A 2JCHA 4D2OA 4EUZA 4GB7A 2ZM8A 4OH0A 4FCFA 2ZQ8A 3HREA 3VFFA 3E2LA 1ZC2A 5DTTA 1N9BA 4BL3A 3CZDA 3SH9A 4PM9A 3V5MA 4E6WA 1K56A 1ONGA 3IF6C 4C6YA 2OLUA 4KG6A 1SCWA 3BFGA 4KZ4A 4LCMA 1YLYA 2Y4AA 1O07A 3S1YA 2X01A 5HAIA 4JXWA 3C4PA 4OPRA 1YT4A 4P87A 4KZ5A 2QPNA 5A93A 3PAEA 3BFEA 2ZC6B 3GQZA 5CHUA 5GLCA 3MFDA 4GNUA 1ES2A 4N92A 3UPNA 4PM7A 2WGWA 3GV9A 1CI8A 4S2NC 2G2UA 3LCEA 2EX2A 4YINA 5EOEA 1KE0A 3WS4A 2P9VB 4FD8A 4WMCD 4C75A 3ZG7B 4CJNA 2WGIA 3BYDA 4MEZA 3BLSA 1KGEA 1VM1A 4OQIA 4QU3A 2H0TA 1K25A 3HVFA 1LHYA 4BLMA 1K54A 5KMWA 1IYOA 3HLBA 3MKFA 1PI5A 1E3UD 2P74A 3O87A 4DRTA 1LI0A 1KDSA 3C4OA 1W8QA 2WADA 5AQAA 4HBUA 1ESUA 4GKUA 4RA7A 1KE3A 4B4ZA 1XGIA 4KZ8A 2XH9A 1N4OA 4NK3A 3ZG5A 1BLPA 1PWGA 1E25A 4KG2A 2ZLYA 2ZC3B 4LENA 4OQHA 2CC1A 3N4IA 5M19A 3PBTA 2ZJ9A 4DDYA 1KGFA 3FV7A 4JXVA 1QMFA 2P9VA 2DRWA 4KENB 3DWZA 1PW1A 2Y2HA 1YLWA 3AGDA 4WEJA 2H0YA 4BD1A 5GHZA 4JF4A 2Y59A 2Z2MB 4HEFA 5DF7A 2XFTA 4GD6A 2HDSA 1TDLA 3IXDA 4E3MA 5F1FA 3MBZA 4WEKA 4LCLA 1M40A 3ZNTA 5FASA 5TGFA 4BD0A 4ZJ2A 3NC8A 3SS4A 1K6RA 3MXSA 1XGJA 4QY5A 4WZ5A 3MXRA 3SH7A 5FQ9A 3NDGA 4KQOA 5FQIA 5G18A 5CXWA 3Q7VA 5CGSA 5E2GA 5GLDA 3IWQA 3BEBA 3PBNA 2Y2NA 3IXHA 5FDHA 2XR0A 4N9KA 5EUAA 4MBHA 1K56D 5HARA 1MPLA 4S2KA 3DWKA 2IWDA 2UWXA 2XD5A 4X68A 1W5DA 3V3RA 4E6XA 4GOGA 1ERQA 4MLLA 4BL2A 1KGGA 1HTZA 3MKEA 3LEZA 1DJCA 5CEBA 1LLBA 5CTNA 1ZKJA 3O88A 3FYZA 4LV2A 4DXBA 5CEDA 1ONHA 1E4DA 4U0TA 1L2SA 2WYXA 1CK3A 1H8ZA 2E8IA 3BLMA 4X53A 5D3OA 1PI4A 3ZG8B 4F94A 1JVJA 5KZHA 4XXRA 3ZG0A 4KZ7A 4OPZA 5E2HA 4X56A 2ZQ9A 3PBSA 3RXWA 3S22A 1K6SA 4RYEA 4Y0OA 5DTSA 3G2ZA 5GL9A 3SH8A 4NETA 4XUXA 2H5SA 1IYSA 2XQZA 2V20A 3UDFA 1KDWA 4FSFA 1K54C 5FQJA 4E3OA 3A3FA 1IELA 2XGNA 1QMEA 2I72A 4HESA 4S2LA 5F82A 5HAQA 1SDEA 5FI6A 1XXMA 2EX6A 4ZJ3A 3ZNYA 5A90A 3N8LA 4Z9QA 3CMZA 5HW3A 5KSCA 3G30A 4MBKA 3UPOA 4E3IA 2V1ZA 4UA7A 5GLAA 1O7EA 1IEMA 4JF5A 2EFXA 1CI9A 3VP2A 4DDSA 5I94A 4OP5A 4FH2A 2DCFA 5EPHA 1IYPA 4GZBA 1JTDA 5DF9A 1SKFA 2BG1A 3GVBA 4M3KA 5EVLA 1MWSA 4OPQA 1BULA 1FR1A 5FAOA 3PTEA 1DJBA 3IHAA
chains in the Genus database with same CATH superfamily
3Q82A 3T4OA 3ZYTA 3KO4A 4HIAA 3VP0A 3F1OB 3IS2B 1ES5A 3NECA 3IH9A 4R4RA 4EBPA 3DBAA 5HAPA 1P9RA 1EW0A 2QJ5A 2XA7M 3BFCA 2W3GA 2Y2QA 2A49A 1UWNX 4IBRA 3LI9A 4HJ4A 4ESPA 4PM5A 1UWPX 3QNCA 3VP4A 4ID4A 1PYYA 3P98A 4JBFA 3TRCA 3NIAA 2LB5A 5AQBA 3A3JA 5K5BA 2PYRA 5L2FA 2O9CA 2HPBA 4GD8A 3V50A 4G3KA 1L3LA 3WS5A 1LSWA 4IVKA 3I7JA 1H8YA 5EVEA 3ISGA 5FQKA 1PRQA 2ZOHA 4P0MA 5DJTA 4QPRA 1JWVA 3UB7A 4U3TA 3PYPA 4UA9A 4IEDA 2JBFA 5AQ7A 1S66L 2G2WA 3FPVA 1PNEA 3UE0A 1F5MA 3VE3A 2J8YA 3C30A 2M7UA 3H82B 2WZXA 4HQAA 4DF6A 3ICYA 2JE5A 3W4QA 1K55C 1BYWA 3IT9A 1I2WA 4WYYA 3FWLA 4GHIB 4KZ3A 4JGQA 4BQMA 5M18A 4PM8A 3D4FA 5EV0A 1BLSA 3BJNA 4YNRA 4GDBA 5F1GA 2W0NA 4O8GA 3PHYA 4RRHA 4WF0A 5AQ9A 1XA1A 2W1TB 3SS5A 1F2KA 4ETZA 4HP4A 3NDEA 2Y79A 2ZM2A 3LY4A 3UO9A 3T4QA 4EBNA 2MJ6A 2OV5A 4RRCA 3HJIA 3OPRA 4YFMA 2WGWB 1FCNA 1YMXA 3LIAA 4S2JA 2W3HA 2WZZA 3PXPA 5HX9A 2VX8A 4Y17A 5EECA 4DE1A 3KYEA 1LI9A 3BQAA 4C3QA 2C6WB 5DFXA 3K3DA 3HLFA 2KLIA 4ZDXA 2ZD8A 4CLCE 1FR6A 3MQQA 4EQ1A 1TS6A 3F1PB 3T1RA 3G34A 3FPWA 3VOYA 4RRIA 3N8RA 1FIKA 2WK0A 3VOZA 3HLWA 4MMNA 3IHBA 4QD4A 1CJFA 4PPRA 1T19A 3A0VA 4EBLA 2B95A 1FSWA 1KOUA 5J7EA 1VB6A 4OVDA 1GHPA 2BLSA 1MXOA 4FTXA 4LRZE 4S0IA 1WE4A 2X02A 3LR3A 4RRMA 4OONA 3UDIA 3RJUA 4EQIA 4RRRA 1XKZA 3Q7VB 1TC5A 4I3JA 1K57C 2V8CA 3LGOA 2OLVA 4IJGA 3F1NB 1KVMA 1MWTA 2QMIA 4S2NA 2A24B 2IWBA 5G4ZA 4KQDA 2GNXA 4BBTA 4KG5A 4R6LA 4B9OA 4DMZA 3S7QA 3GSGA 4DN0A 2D02A 3ITBA 5F6AA 4OQ0A 2XF3A 2ZQAA 4ARZB 4P6BA 4NXBA 1SKOA 2OSUA 4HOIA 2Y2PA 1W8YA 4X25A 1S1YA 5IU1A 4S2IA 1BZAA 2Q9MA 4PHTA 2V1BA 4N9LA 3DTMA 1G5UA 4RQ9A 5CRFA 3IWOA 4F3LA 5J61A 5EFWA 2ZC4B 1XPBA 3W4PA 1J9MA 3V39A 2RL3A 2XLNA 2JKRI 1NWZA 1JNUA 4UEYA 3TOIA 2P04A 1YMSA 4RX2A 2JCHA 2YKFA 4EW7A 4OH0A 1ZC2A 1N9BA 3MXQA 4E6WA 3IF6C 2OLUA 4KG6A 4KZ4A 2Y4AA 3KODA 4EETB 1Y28A 1YT4A 3OBFA 4EU0A 3BFEA 3GQZA 2O0YA 3MFDA 1ES2A 2PDRA 4YINA 3ULFA 4FD8A 3TJZC 3LFVA 2WGIA 3BYDA 3KOCA 4HI4A 2J3WA 1K25A 1LHYA 1F98A 1ZHHB 4HY8A 1IYOA 3MKFA 3LICA 4EUVA 1W8QA 5AQAA 1ESUA 1OTEA 4DJ2A 4YOFA 1XGIA 3KO6A 2EWVA 3UMDA 1BLPA 4KG2A 1YSPA 3MFXA 4LENA 4OQHA 3N4IA 1Y2QA 3UB5P 5I5LA 4DDYA 4Q0JA 4L9FA 3AGDA 4Y13A 2Z2MB 4NG2A 3T50A 4JGOA 4HNBA 2HDSA 1TDLA 3LYXA 3C8CA 5TGFA 3NC8A 1K6RA 3MXSA 5DKLA 1XGJA 5FQ9A 4KQOA 3H7WA 5EM1A 5FQIA 5GLDA 3QP5A 4RRJA 2E8JA 3PR6A 3DWKA 4LRXC 4X68A 1W5DA 1ERQA 1KGGA 1HTZA 1LLBA 4RR6A 4GJ4A 4LV2A 4M4XA 5HWTA 4JGPA 4U0TA 2BASA 4F94A 4Y15A 3ZG0A 4ZRRA 1H8MA 1K6SA 3G2ZA 3RH8B 3LIBA 1IYSA 2GX5A 3UDFA 1KDWA 1GSXA 2XGNA 1XJ3A 2I72A 4S2LA 4ZJ3A 5L09A 3KSIA 4Z9QA 5KSCA 3W2ZA 4KUKA 1O7EA 2Y8HA 1IEMA 2EFXA 4DDSA 4FH2A 1IYPA 3E98A 1FR1A 3MQ0A 5CX7A 1DJBA 3IHAA 1K55A 2ZOIA 2HDRA 4R4SA 2J9PA 2WAFA 4X69A 3SS3A 5A92A 2JKTM 3IBJA 3Q81A 4WZ5C 1VHMA 3EEAA 4ZJ1A 2B18A 2W3DA 1XP4A 2X71A 3BY8A 1SHVA 1NY0A 4LGWA 4E3KA 3UY6A 4PMAA 4DE0A 4EWFA 4KQRA 3PAGA 3BM6A 4L9GA 2ACGA 3OCNA 3F1OA 3IS2A 1S4RA 1BSGA 3HLDA 1WYCA 3Q7ZA 1AXBA 3OLOA 4Y0TA 4R3AA 3LIFA 1STZA 4E3NA 3CI6A 3UE3A 4K0WA 2Y2OA 3M6BA 1NXYA 2A3UA 1GHMA 3MR0A 3VV4A 3V3SA 4I3AA 3HUMA 1H3QA 3QP8A 1DJAA 3BWLA 3GTCA 4QHCA 1OJGA 5FI2A 4GDNA 2ZBBA 4EEPA 4ZBEA 1PW8A 3KYQA 4I3IA 4RR8A 5HZHA 3IXBA 2VGJA 3G32A 1RCJA 5FL3A 1CEFA 1NLYA 3QNBA 4PM6A 5HL6A 4E3LA 3FKWA 3KX0X 2OAQ1 4WBGA 1MY8A 5EE8A 3G2YA 1K57A 3SW1A 3UE1A 3P7NA 3GRJA 4XUZA 1I2SA 4GHIA 3JYIA 1Z09A 1D7EA 3NOUC 2G7UA 3LUQA 2H10A 2OKVA 2W1TA 2Y2LA 2HV1A 1L0GA 1JWPA 5J8XA 4R70A 3ZGAB 4RX3A 2VGKA 3NY4A 3BECA 3AGEA 3CLOA 2PT7A 3ZVTA 3C7UA 5FEGA 1PWCA 5TJJA 2VV8A 4KUOA 4OOLA 3K2NA 3WWXA 1K4EA 2PYPA 1NZOA 5L10A 2VJWA 3E4OA 1OT9A 4XT2A 1H5XA 3HBRA 2W27A 3HLGA 4P6ZS 4B4XA 4LLOB 3KO9A 3B3XA 1K38A 5J4EA 4NBJA 1TEMA 2OOLA 2IWCA 5HWWA 4WM9A 3F1PA 3G4PA 4UAAA 2XK1A 1N9NA 3IF6A 3MZEA 3IH8A 4IBXA 3NI9A 4P6ZM 1FOFA 1ES4A 1VEUB 4WMCA 1PZOA 4WELA 1BT5A 1G28A 3LMTA 3FKVA 3Q07A 4MN7A 3PD3A 4X6TA 4QY6A 2J3TC 3NBLA 4S2MA 4DJ3A 1CEGA 4MCWA 4MN5A 5DVAA 4S0KA 4N1XA 3IX3A 1MBLA 3B47A 3Q1FA 2Y2GA 5E43A 1G68A 3F1NA 2ZMAA 2FFYA 4KZAA 2EX9A 3E4PA 4S02A 4LV3A 3QP4A 5TBMB 3HJKA 3G31A 4JF6A 2Y2JA 5FSRA 4MDZA 4R3JA 1A0KA 4H6JB 3IX4A 2V0UA 3UNWA 2EXBA 3IBRA 3QP2A 3HUNA 1LT0A 3NOTC 4BL3A 3RTYA 3CZDA 1K56A 2O9AA 1TF1A 4JXWA 3C4PA 4OPRA 1T18A 1YPRA 2QPNA 3PAEA 4KZ5A 2ZC6B 5GLCA 5CHUA 3MQOA 3MJQA 2PR6A 4N92A 4L9EA 2KOIA 3GV9A 2G2UA 2UV0E 2EX2A 2OWHA 5EOEA 1KE0A 3WS4A 4WMCD 4C75A 4CJNA 1S4SA 3T1QB 3FC7A 3CUEC 5KMWA 5L07A 2INWA 3HLBA 1PI5A 2P74A 3C4OA 4HBUA 2PHYA 2XH9A 1UGUA 3NJAA 1N4OA 4PKYA 2VA0A 3PD4A 3T1SA 1KGFA 4JXVA 1QMFA 5HSQA 4MN6A 1PW1A 3LR5A 2NUTC 2Y59A 5DF7A 2XFTA 4CLCB 1OTBA 3IXDA 5F1FA 3MBZA 4WEKA 4LCLA 2HL1A 4HH2A 4ZJ2A 4QY5A 4WZ5A 3SH7A 2XRNA 1H0MA 5E2GA 3CAXA 3IWQA 2Y2NA 4S03A 2HL0A 1K56D 5HARA 1MPLA 4S2KA 2IWDA 3S7OA 2XD5A 3T1XA 2ZMFA 4GOGA 4EERA 3LIEA 3BQ8A 3LEZA 4NKPA 5CTNA 3O88A 4LRYC 3FYZA 4DXBA 5CEDA 1E4DA 2P7JA 1D1JA 1H8ZA 2E8IA 4S0LA 1ZTUA 4GCZA 4KZ7A 4X56A 3RXWA 4II7A 1ODVA 4Y0OA 2B02A 2JHEA 2XQZA 2V20A 1IOUA 1QMEA 4HESA 4HJ3A 5F82A 2NUPC 5FI6A 5HD3A 1XXMA 3H9WA 3VOLA 3N8LA 3CMZA 5G4YA 1NLZA 3G30A 3EOIA 5DKKA 4E3IA 5GLAA 1CI9A 3MS6A 4GZBA 5DF9A 1SKFA 3GVBA 4M3KA 5EVLA 1MWSA 1OJ5A 1G6OA 3PTEA 2PRFA 3CITA 2Y2KA 1T1CA 3ZFZA 1GHIA 3KO5A 4P85A 3UN7A 5CHMA 2J7VA 3HLCA 4U0XA 1XX2A 3W8KA 2J80A 3A0SA 3AGFA 3K3CA 3HL9A 1Z6FA 2GDNA 4S0JA 3WS1A 3WRTA 3UB8A 2R9XA 3N7WA 3BRMA 2RCXA 4FOFA 3N6IA 1BUEA 1YLJA 2BTFP 2WGVA 5AVEA 3V67A 1Y54A 5CTMA 1GCEA 2HP5A 4ETXA 3DW0A 1K4FA 5EM0A 4CLCC 1RGYA 1S1ZA 4OKPA 2JN7A 2PU2A 3E4QA 2HP9A 4UA6A 5CECA 1OTAA 2C5WB 1FSYA 5EOOA 2GJ3A 2Y91A 4ME4A 5DJUA 1YLTA 3T4LA 3VE4A 1V9YA 4NXGA 3EQUA 3IXGA 3UB6A 1HZOA 3PBOA 1EROA 1MWUA 2AVXA 4RRQA 3OZHA 3B33A 1Q2PA 3OC2A 3VP3A 4WN5A 3VMAA 4RRDA 3LI8A 3WS0A 1MC0A 5FEFA 3OPHA 5AJGA 4E3JA 1W79A 1OTDA 3DTEA 5A91A 2LB9A 1MWRA 4LV1A 1KE4A 3SOIA 5FDSA 3JVVA 1VETB 3VP1A 4DXCA 4GS9B 2HDUA 4NEED 2WKIA 2EX8A 3LY3A 2I9VA 2ZC5B 3VFHA 4O7DA 4OLDA 1ZG4A 5DFYA 2K31A 3HUOA 1D06A 4OLGA 4QB8A 4FH4A 5IT5A 4RR7A 3M2KA 3LMVA 4JKTA 4R0QA 3BFDA 3ITAA 2FFFB 1M6KA 5EVIB 1FCOA 2HGVA 3ZHHA 3VSLA 1Q2QA 1YM1A 3EWKA 1S67L 4R1GA 1IKIA 1DP9A 1LL5A 3T4KA 5HL1A 2ZQDA 1SDNA 2WKEA 4Y7PA 3MZDA 1PIOA 2GZAA 3M6HA 3KSGA 1S6RA 5E2FA 1TS7A 1J3WA 3T4JA 4RRKA 4JXGA 1TD5A 1ALQA 3OPPA 4Y2FA 2B5RA 1NZUA 2WKPA 3PBRA 3W4OA 2ZC7A 3R4KA 4Q0HA 4N1HA 5FAPA 3GR2A 2O99A 2L0WA 1JWZA 2WKHA 2PU4A 1XJ6A 1TDGA 2PBYA 3TSGA 2Q9NA 5TFQA 2KDKA 2R9WA 3T4TA 3IWIA 1ES3A 2QHKA 2Z2LB 3MF0A 4AFIA 3KOBA 3NCKA 4Z1WA 3S7NA 5BOHA 4S2PA 2YKHA 5GLBA 4D60A 1XFNA 4HHDA 3R7WB 5CGXA 1S0WA 3EQVA 5CERA 2XDMA 1GA9A 4OPYA 5GHXA 3C5AA 3CUEA 3MZFA 4BBVA 2J3TD 1MZUA 2DNSA 1L0EA 1XA7A 1YAXA 4K08A 5MC7A 3KSHA 1IFQA 4LV0A 5HDDA 3IF5A 4O01A 1I5QA 3OCLA 1VEUA 2V8FA 4DE3A 5DF8A 5EVIC 4I5SA 2VZWA 5FI7A 3H82A 1GA0A 5M1AA 5JYOA 1NYMA 2Z6CA 1L0FA 1TS0A 3CJMA 2JKRM 2Y55A 2PBDP 3GMWA 1W7FA 2XFSA 4RRAA 4MBFA 4DE2A 1MKMA 2R78A 4KZ9A 2D01A 2ZM8A 4FCFA 5J3WA 2ZQ8A 2V0WA 3CPTB 5DTTA 2V1AA 3SH9A 2VKSA 4C6YA 5TBMA 3BFGA 1YLYA 3S1YA 2X01A 2M7VA 4P87A 2OWJA 1ACFA 4H6JA 1T1BA 1YSQA 3UPNA 4PM7A 3HCYA 2WGWA 3TW8A 4G3WA 4NBIA 2P9VB 3D9YA 1OTIA 1VM1A 4QU3A 2H0TA 3EEHA 2EA9A 3O87A 5HDSA 1KDSA 5HDCA 3G6OA 4GKUA 4RA7A 4HH3A 3U4LP 4B4ZA 1OPXA 4NK3A 5F69A 1WA9A 4UQIS 3PBTA 2ZJ9A 3FV7A 2DBOA 2ZMVA 5GHZA 4JF4A 2O9BA 4GD6A 4E3MA 4I39A 1P0ZA 2PD7A 4HJ6A 5FASA 3OOVA 1N9LA 3SS4A 3MXRA 2ZL1B 4UQIM 1DP8A 3NDGA 5CXWA 3Q7VA 4G3VA 2HJ9C 3BEBA 4BWIA 2OAP1 5FDHA 3LR4A 2V9AA 2UWXA 3UB9A 4BL2A 1P9WA 1YKDA 3MKEA 5CEBA 4CLCA 1ONHA 2A24A 1L2SA 5D3OA 3BLMA 3ZG8B 1PI4A 4OPZA 5E2HA 2ZQ9A 3S22A 4E04A 5DTSA 1OT6A 4XUXA 2HZ5A 1W63M 4FSFA 1K54C 4E3OA 3A3FA 1IELA 4NXFA 4LFUA 4ARZA 2EX6A 3ZNYA 5A90A 5HW3A 5HWVA 4MBKA 3LEQA 3UPOA 1V9ZA 4JF5A 4X1MA 3VP2A 5EPHA 3KYZA 3KNPA 2BG1A 3FG8A 4HP9A 4OPQA 4XT2B 2L4RA 3P09A 1XJ4A 2VK3A 3UDXA 1DY6A 2QYBA 1L0DA 2VV6A 5A8BA 2JKTI 4KZBA 4EEUA 2ZQCA 3B42A 3QHYA 2JC7A 2V2FF 4BJPA 4GW9A 3O3VA 4X55A 2QZ6A 4OP8A 5E2EA 3IF6B 3A3DA 4ZTKA 3BFFA 4B88A 3CG5A 3PD2A 1MKIA 5DTKA 4A5RA 1YLPA 2HJEA 4CLCD 3TE8A 4HBTA 2VLGA 4JPMA 3IQAA 3ZCZA 1NYYA 1JTGA 1TS8A 4EV4A 2VEAA 3P01A 4IUHA 4PKYG 5IHVA 2XROA 5KIZA 1CQAA 3ZG9B 4X1LA 4Q8IA 3A3IA 3T4SA 4EESA 4L0LA 1N9OA 4Y0UA 4UHUA 3RXXA 1TVFA 4WLAA 5CHJA 3EGXC 5IS1A 4JXSA 4CQHA 2JKFA 4K0XA 5U47A 5CGWA 4RRGA 1G6AA 3SZTA 2HF6A 4FUWA 1RGZA 3PBQA 4RVAA 4CPKA 3OPLA 3ZDJA 3U2AA 1HD8A 4BMWA 1IYQA 3KO7A 5L8MA 2FZ0A 3WRZA 2M1CA 1EI5A 4KZ6A 5FATA 2ZM0A 4EXOA 5HFOA 1ZG6A 5LBRA 1ERMA 4R23A 5HPIA 2HP6A 4LPZA 1DP6A 3G35A 3BY9A 1XJ2A 1BTLA 3NOPC 1VETA 5HPFA 4GS9A 3N8SA 1X0OA 3FZCA 2WUQA 4OOMA 4KQQA 2QKPA 2Z6DA 2P08A 3E0YA 5FQMA 2XD1A 4MNRA 5F83A 2WAEA 3L7HA 1U60A 3A3EA 3PD5A 1OMEA 2EXAA 2Y2MA 2Y2IA 3C7VA 3IX8A 1HVBA 4PAUA 3D3OA 1RP5A 1LL9A 4JLFA 4QJGA 5EVIA 5AVFA 1NRFA 1EWZA 2ZQ7A 3O5YA 4BENA 3DTIA 2EWWA 1ESIA 4GN2A 3S7PA 3NHQA 5F5YA 1K0KA 1FCMA 1VQQA 4IHQA 5FQQA 1Y4OA 4DKIA 3WS2A 3ZQ5A 2HDQA 3GDIA 1WYBA 4R3BA 4S2OA 3A0RA 3O86A 1NJ4A 3LR0A 4H8RA 1YLZA 3MMHA 2K7SA 3DTKA 4ZAMA 1SKOB 1SZVA 3JPUA 2QWSA 5JYPA 5FAQA 3RFBA 1PZPA 4WZ4A 2XEPA 5C5KA 1FQGA 1LSXA 1GSWA 2PAVP 2W1RA 3TG9A 4GLQA 4F3LB 1E3UA 1FILA 3LO7A 4R38A 4OQGA 1YQSA 2EFUA 4IVIA 1PWDA 1KVLA 4OOYA 3UPPA 3R7WA 3NULA 1LL8A 3QP6A 1LSVA 5TR7A 1BLHA 4WL9A 1HLUP 1NRJA 3DAVA 3E2KA 2KX6A 4K91A 4QWOA 1P97A 4NXEA 2J9OA 5EVID 5KSHA 4O0PA 3C2WA 3S4XA 1GSVA 3UE6A 1C3BA 4B93A 1IKGA 5GHYA 3VSKA 3ZVWA 3MSHA 5FA7A 4Q0IA 3M2JA 1BLCA 2W3EA 3HLEA 4D2OA 4EUZA 4GB7A 3EGDC 3HREA 4Y5FA 3E2LA 3VFFA 2H28A 4PM9A 3V5MA 1ONGA 1SCWA 4LCMA 1O07A 5HAIA 1T1AA 2IA2A 5A93A 1W63Q 4GNUA 1CI8A 4S2NC 3LCEA 3L9KA 5F68A 3ZG7B 4MEZA 3BLSA 1KGEA 4OQIA 4WUJA 3CPTA 3HVFA 2FH5A 4BLMA 1K54A 2WKQA 1E3UD 4DRTA 1LI0A 1JKEA 2WADA 3BW6A 2HKZA 3D72A 1KE3A 4KZ8A 3LIDA 3ZG5A 1PWGA 1E25A 3H7WB 2ZLYA 2ZC3B 2XSSA 2CC1A 5M19A 2Q0OA 3QP1A 2P9VA 2DRWA 3KSFA 4KENB 3UMEA 2DMWA 2VV7A 3DWZA 4BBUA 2Y2HA 1YLWA 3C38A 4WEJA 5HD5A 2H0YA 2VGLS 4BD1A 4HEFA 4IUKA 2PD8A 3KO3A 4JGRA 1M40A 1PFLA 3CWFA 3ZNTA 4BD0A 4Y3IA 1AWIA 5G18A 5CGSA 4I38A 3PBNA 1DRMA 3IXHA 1XFQA 2XR0A 4N9KA 5EUAA 4MBHA 2K2NA 2VGLM 2WKRA 4E6XA 3V3RA 1J7GA 4MLLA 1DJCA 1ZKJA 3LMUA 4YWZA 1CF0A 2WYXA 1CK3A 2A2LA 4X53A 5KZHA 1JVJA 4XXRA 3PBSA 4RYEA 2ZL1A 5GL9A 1F9IA 2PR5A 4NETA 3SH8A 2CMNA 2H5SA 2QJ7A 4RRLA 5FQJA 2L1MA 5HAQA 1SDEA 3T12B 2V1ZA 4UA7A 3CHWP 4RRBA 2W3FA 5I94A 4OP5A 4RR9A 2DCFA 3KNFA 2XA7S 3JVUA 1JTDA 1BULA 3GECA 5FAOA 4RRFA 2JKGA 2HL2A
chains in the Genus database with same CATH topology
2Y2KA 1K55A 3Q82A 3ZFZA 1GHIA 2HDRA 3P09A 4R4SA 3KO5A 4P85A 3UN7A 2J9PA 2WAFA 2J7VA 3HLCA 5CHMA 3UDXA 3KO4A 3VP0A 1DY6A 1ES5A 4U0XA 1XX2A 3IH9A 1L0DA 4R4RA 3W8KA 4X69A 3SS3A 4EBPA 5A92A 3AGFA 4KZBA 3Q81A 5HAPA 4WZ5C 3HL9A 3BFCA 1Z6FA 2GDNA 2ZQCA 3QHYA 4ZJ1A 4S0JA 3WS1A 2Y2QA 2A49A 2JC7A 2R9XA 3N7WA 4IBRA 3WRTA 3BRMA 2RCXA 2V2FF 4BJPA 3O3VA 1XP4A 2X71A 3QNCA 3N6IA 4X55A 4PM5A 2QZ6A 1SHVA 4OP8A 1BUEA 3IF6B 5E2EA 3VP4A 1YLJA 1PYYA 1NY0A 3A3DA 4ID4A 2WGVA 3P98A 4ZTKA 3BFFA 1Y54A 4JBFA 5CTMA 4E3KA 4B88A 3UY6A 3NIAA 4PMAA 3CG5A 5AQBA 3PD2A 1GCEA 4DE0A 4EWFA 3A3JA 1MKIA 2HP5A 3PAGA 4KQRA 5DTKA 3BM6A 3DW0A 1K4FA 4A5RA 1YLPA 1RGYA 4OKPA 3OCNA 5L2FA 4HBTA 2HPBA 4GD8A 3V50A 2PU2A 4JPMA 1BSGA 3HLDA 2HP9A 3IQAA 3ZCZA 1NYYA 1JTGA 1WYCA 4UA6A 5CECA 3Q7ZA 1AXBA 2C5WB 3WS5A 4Y0TA 4EV4A 1FSYA 5EOOA 2Y91A 5IHVA 4IVKA 1YLTA 3I7JA 1H8YA 4E3NA 3ISGA 5FQKA 3UE3A 4K0WA 3ZG9B 3EQUA 3IXGA 2Y2OA 4P0MA 3M6BA 4Q8IA 1HZOA 1NXYA 1EROA 2A3UA 3PBOA 3A3IA 1JWVA 1GHMA 1MWUA 4U3TA 4RRQA 3OZHA 1Q2PA 4UA9A 4IEDA 3V3SA 4L0LA 4Y0UA 4UHUA 3RXXA 2JBFA 3OC2A 5AQ7A 3HUMA 3VP3A 1TVFA 2G2WA 3VMAA 4RRDA 3UE0A 3WS0A 5CHJA 1DJAA 3GTCA 4JXSA 3OPHA 4K0XA 4E3JA 1W79A 2J8YA 5U47A 2WZXA 5CGWA 4DF6A 4RRGA 1G6AA 2JE5A 4QHCA 3W4QA 1K55C 5FI2A 5A91A 3IT9A 1I2WA 4WYYA 4GDNA 3FWLA 1MWRA 4LV1A 1RGZA 1KE4A 3SOIA 4KZ3A 4ZBEA 1PW8A 4BQMA 5M18A 4PM8A 3PBQA 4RVAA 3D4FA 4RR8A 3VP1A 4CPKA 4DXCA 3OPLA 1BLSA 3ZDJA 2HDUA 4GDBA 5F1GA 2WKIA 2VGJA 1HD8A 3IXBA 2EX8A 3LY3A 3G32A 1IYQA 1RCJA 2ZC5B 3KO7A 3VFHA 1CEFA 3QNBA 4O7DA 4PM6A 3WRZA 4RRHA 4OLDA 5AQ9A 1XA1A 1EI5A 4KZ6A 5FATA 2ZM0A 3FKWA 1ZG4A 4E3LA 4WBGA 1ZG6A 5HFOA 1MY8A 5EE8A 3HUOA 3SS5A 1ERMA 3G2YA 1K57A 4OLGA 4QB8A 4FH4A 4R23A 2HP6A 3NDEA 4RR7A 3M2KA 2ZM2A 3UE1A 3LY4A 3UO9A 3G35A 3LMVA 4JKTA 3GRJA 4XUZA 1I2SA 3BFDA 3ITAA 4R0QA 4EBNA 3JYIA 2OV5A 2FFFB 1M6KA 5EVIB 4RRCA 1BTLA 1FCOA 3OPRA 4YFMA 2WGWB 3ZHHA 3VSLA 1FCNA 1YMXA 1Q2QA 1YM1A 3N8SA 4S2JA 3FZCA 4R1GA 1IKIA 2WZZA 5HX9A 2H10A 2WUQA 4OOMA 2OKVA 4KQQA 1LL5A 5HL1A 4S0LA 5EECA 4DE1A 2ZQDA 1SDNA 2WKEA 2Y2LA 1LI9A 5FQMA 4Y7PA 3MZDA 1PIOA 2XD1A 4MNRA 5F83A 1JWPA 1L0GA 5J8XA 3M6HA 4C3QA 2C6WB 3ZGAB 4RX3A 2WAEA 2VGKA 3HLFA 1S6RA 3NY4A 3BECA 5E2FA 1U60A 2ZD8A 3A3EA 3AGEA 4ZDXA 3PD5A 1OMEA 2EXAA 2Y2MA 2Y2IA 3C7VA 3ZVTA 4RRKA 1HVBA 1FR6A 4JXGA 3C7UA 1PWCA 1ALQA 3OPPA 1RP5A 3G34A 2B5RA 1LL9A 4JLFA 1NZUA 5EVIA 4QJGA 4OOLA 3VOYA 4RRIA 3WWXA 1K4EA 1EWZA 1NRFA 3N8RA 3PBRA 2ZQ7A 2WK0A 3W4OA 1NZOA 2ZC7A 3VOZA 3HLWA 4N1HA 5FAPA 3GR2A 3IHBA 4BENA 4QD4A 1JWZA 1H5XA 3HBRA 4PPRA 4EBLA 2WKHA 3HLGA 1ESIA 2PU4A 1FSWA 1TDGA 4B4XA 3KO9A 4GN2A 2PBYA 3B3XA 1K38A 3TSGA 4OVDA 1GHPA 4NBJA 2BLSA 1MXOA 1TEMA 4S0IA 1WE4A 2Q9NA 5TFQA 1FCMA 2X02A 2IWCA 4WM9A 2R9WA 1VQQA 5FQQA 3IWIA 4RRMA 1ES3A 4OONA 4DKIA 2Z2LB 3WS2A 3UDIA 3G4PA 3RJUA 4EQIA 2HDQA 4UAAA 4RRRA 2XK1A 1XKZA 1WYBA 4R3BA 4S2OA 3Q7VB 1TC5A 3IF6A 3NCKA 1NJ4A 3O86A 3KOBA 3MZEA 5BOHA 4S2PA 5GLBA 3IH8A 4H8RA 1K57C 1YLZA 4IBXA 5CGXA 3NI9A 4ZAMA 5JYPA 1FOFA 2OLVA 1S0WA 5FAQA 3EQVA 1KVMA 1MWTA 2QMIA 1ES4A 4S2NA 4WMCA 1PZPA 4WZ4A 2IWBA 5CERA 1PZOA 4WELA 2XEPA 1BT5A 2XDMA 1GA9A 4OPYA 3LMTA 1FQGA 3FKVA 3Q07A 5GHXA 3C5AA 3PD3A 4X6TA 4KG5A 4QY6A 3TG9A 3NBLA 3MZFA 1E3UA 3GSGA 3LO7A 4S2MA 2DNSA 1CEGA 1L0EA 3ITBA 5DVAA 4S0KA 4N1XA 4OQGA 1YQSA 1XA7A 2EFUA 4IVIA 1PWDA 2XF3A 1KVLA 1MBLA 4OQ0A 4OOYA 2ZQAA 3Q1FA 3UPPA 4LV0A 2Y2GA 3IF5A 4P6BA 5E43A 2OSUA 1I5QA 3OCLA 1G68A 2Y2PA 5TR7A 2ZMAA 1BLHA 2FFYA 1W8YA 4KZAA 2EX9A 3E2KA 4S2IA 1BZAA 4DE3A 2Q9MA 4K91A 5DF8A 5EVIC 4S02A 2J9OA 5EVID 4LV3A 4N9LA 3DTMA 5FI7A 5CRFA 5KSHA 3G31A 4JF6A 2Y2JA 3S4XA 1GA0A 5FSRA 3IWOA 5M1AA 5JYOA 5J61A 4R3JA 1NYMA 2ZC4B 1C3BA 1XPBA 1IKGA 1L0FA 3W4PA 1J9MA 3CJMA 3V39A 2RL3A 2Y55A 3GMWA 2XLNA 1W7FA 5GHYA 2XFSA 3TOIA 3UNWA 3VSKA 2EXBA 3ZVWA 4RRAA 4MBFA 4DE2A 1YMSA 5FA7A 3HUNA 3M2JA 1BLCA 4KZ9A 3HLEA 4RX2A 2JCHA 4D2OA 4EUZA 4GB7A 2ZM8A 4OH0A 4FCFA 2ZQ8A 3HREA 3VFFA 3E2LA 1ZC2A 5DTTA 1N9BA 4BL3A 3CZDA 3SH9A 4PM9A 3V5MA 4E6WA 1K56A 1ONGA 3IF6C 4C6YA 2OLUA 4KG6A 1SCWA 3BFGA 4KZ4A 4LCMA 1YLYA 2Y4AA 1O07A 3KODA 3S1YA 2X01A 5HAIA 4JXWA 3C4PA 4OPRA 1YT4A 4P87A 4KZ5A 2QPNA 5A93A 3PAEA 3BFEA 2ZC6B 3GQZA 5CHUA 5GLCA 3MFDA 4GNUA 1ES2A 4N92A 3UPNA 4PM7A 2WGWA 3GV9A 1CI8A 4S2NC 2G2UA 3LCEA 2EX2A 4YINA 5EOEA 1KE0A 3WS4A 4NBIA 2P9VB 4FD8A 4WMCD 4C75A 3ZG7B 4CJNA 2WGIA 3BYDA 4MEZA 3KOCA 3BLSA 1KGEA 1VM1A 4OQIA 4QU3A 2H0TA 1K25A 3HVFA 1LHYA 4BLMA 1K54A 5KMWA 1IYOA 3HLBA 3MKFA 1PI5A 1E3UD 2P74A 3O87A 4DRTA 1LI0A 1KDSA 3C4OA 1W8QA 2WADA 1JKEA 5AQAA 4HBUA 2HKZA 1ESUA 4GKUA 4RA7A 1KE3A 4B4ZA 1XGIA 4KZ8A 2XH9A 1N4OA 4NK3A 3ZG5A 1BLPA 1PWGA 1E25A 4KG2A 2ZLYA 2ZC3B 4LENA 4OQHA 2CC1A 3N4IA 1Y2QA 5M19A 3PBTA 2ZJ9A 4DDYA 3PD4A 1KGFA 3FV7A 4JXVA 1QMFA 2P9VA 2DRWA 4KENB 3DWZA 1PW1A 2Y2HA 2DBOA 1YLWA 3AGDA 4WEJA 2H0YA 4BD1A 5GHZA 4JF4A 2Y59A 2Z2MB 4HEFA 5DF7A 2XFTA 4GD6A 2HDSA 1TDLA 3IXDA 4E3MA 3KO3A 5F1FA 3MBZA 4WEKA 4LCLA 2HL1A 1M40A 3ZNTA 5FASA 5TGFA 4BD0A 4ZJ2A 3NC8A 3SS4A 1K6RA 3MXSA 1XGJA 4QY5A 4WZ5A 3MXRA 3SH7A 5FQ9A 3NDGA 4KQOA 5FQIA 5G18A 5CXWA 3Q7VA 5CGSA 5E2GA 5GLDA 3IWQA 3BEBA 3PBNA 4RRJA 2Y2NA 3IXHA 5FDHA 4S03A 2HL0A 2XR0A 4N9KA 5EUAA 4MBHA 1K56D 5HARA 1MPLA 4S2KA 3DWKA 2IWDA 2UWXA 2XD5A 4X68A 1W5DA 3V3RA 4E6XA 1J7GA 4GOGA 1ERQA 4MLLA 4BL2A 1KGGA 1HTZA 3MKEA 3LEZA 1DJCA 5CEBA 1LLBA 5CTNA 1ZKJA 3O88A 4RR6A 3FYZA 4LV2A 4DXBA 5CEDA 1ONHA 3LMUA 1E4DA 4U0TA 1L2SA 2WYXA 1CK3A 1H8ZA 2E8IA 3BLMA 4X53A 5D3OA 1PI4A 3ZG8B 4F94A 1JVJA 5KZHA 4XXRA 3ZG0A 4KZ7A 4OPZA 5E2HA 4X56A 2ZQ9A 3PBSA 3RXWA 3S22A 1K6SA 4RYEA 4Y0OA 5DTSA 3G2ZA 5GL9A 3SH8A 4NETA 4XUXA 2H5SA 1IYSA 2XQZA 2V20A 3UDFA 4RRLA 1KDWA 4FSFA 1K54C 5FQJA 4E3OA 3A3FA 1IELA 2XGNA 1QMEA 2I72A 4HESA 4S2LA 5F82A 5HAQA 1SDEA 5FI6A 1XXMA 2EX6A 4ZJ3A 3ZNYA 5A90A 3N8LA 4Z9QA 3CMZA 5HW3A 5KSCA 3G30A 4MBKA 3UPOA 4E3IA 2V1ZA 4UA7A 5GLAA 1O7EA 1IEMA 4JF5A 2EFXA 4RRBA 1CI9A 3VP2A 4DDSA 5I94A 4OP5A 4RR9A 4FH2A 2DCFA 3KNFA 5EPHA 1IYPA 4GZBA 3KNPA 1JTDA 5DF9A 1SKFA 2BG1A 3GVBA 4M3KA 5EVLA 1MWSA 4OPQA 1BULA 1FR1A 5FAOA 4RRFA 3PTEA 1DJBA 2HL2A 3IHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y2K A;  1K55 A;  3Q82 A;  3ZFZ A;  1GHI A;  2HDR A;  3P09 A;  4R4S A;  4P85 A;  3UN7 A;  2J9P A;  2WAF A;  2J7V A;  3HLC A;  5CHM A;  3UDX A;  3VP0 A;  1DY6 A;  1ES5 A;  4U0X A;  1XX2 A;  3IH9 A;  1L0D A;  4R4R A;  3W8K A;  4X69 A;  3SS3 A;  4EBP A;  5A92 A;  3AGF A;  4KZB A;  3Q81 A;  5HAP A;  4WZ5 C;  3HL9 A;  3BFC A;  1Z6F A;  2GDN A;  2ZQC A;  3QHY A;  4ZJ1 A;  3WS1 A;  2Y2Q A;  2A49 A;  2JC7 A;  2R9X A;  3N7W A;  4IBR A;  3WRT A;  3BRM A;  2RCX A;  2V2F F;  4BJP A;  3O3V A;  1XP4 A;  2X71 A;  3QNC A;  3N6I A;  4X55 A;  4PM5 A;  2QZ6 A;  1SHV A;  4OP8 A;  1BUE A;  3IF6 B;  5E2E A;  3VP4 A;  1YLJ A;  1PYY A;  1NY0 A;  3A3D A;  4ID4 A;  2WGV A;  3P98 A;  4ZTK A;  3BFF A;  1Y54 A;  4JBF A;  5CTM A;  4E3K A;  4B88 A;  3UY6 A;  3NIA A;  4PMA A;  3CG5 A;  5AQB A;  1GCE A;  4DE0 A;  4EWF A;  3A3J A;  1MKI A;  2HP5 A;  3PAG A;  4KQR A;  5DTK A;  3BM6 A;  3DW0 A;  1K4F A;  4A5R A;  1YLP A;  1RGY A;  4OKP A;  3OCN A;  5L2F A;  4HBT A;  2HPB A;  4GD8 A;  3V50 A;  2PU2 A;  4JPM A;  1BSG A;  3HLD A;  2HP9 A;  3IQA A;  3ZCZ A;  1NYY A;  1JTG A;  1WYC A;  4UA6 A;  5CEC A;  3Q7Z A;  1AXB A;  2C5W B;  3WS5 A;  4Y0T A;  4EV4 A;  1FSY A;  5EOO A;  2Y91 A;  5IHV A;  4IVK A;  1YLT A;  3I7J A;  1H8Y A;  4E3N A;  3ISG A;  5FQK A;  3UE3 A;  4K0W A;  3ZG9 B;  3EQU A;  3IXG A;  2Y2O A;  4P0M A;  3M6B A;  4Q8I A;  1HZO A;  1NXY A;  1ERO A;  2A3U A;  3PBO A;  3A3I A;  1JWV A;  1GHM A;  1MWU A;  4U3T A;  3OZH A;  1Q2P A;  4UA9 A;  4IED A;  3V3S A;  4L0L A;  4Y0U A;  4UHU A;  3RXX A;  2JBF A;  3OC2 A;  5AQ7 A;  3HUM A;  3VP3 A;  1TVF A;  2G2W A;  3VMA A;  3UE0 A;  3WS0 A;  5CHJ A;  1DJA A;  3GTC A;  4JXS A;  3OPH A;  4K0X A;  4E3J A;  1W79 A;  2J8Y A;  5U47 A;  2WZX A;  5CGW A;  4DF6 A;  1G6A A;  2JE5 A;  4QHC A;  3W4Q A;  1K55 C;  5FI2 A;  5A91 A;  3IT9 A;  1I2W A;  4WYY A;  4GDN A;  3FWL A;  1MWR A;  4LV1 A;  1RGZ A;  1KE4 A;  3SOI A;  4KZ3 A;  4ZBE A;  1PW8 A;  4BQM A;  5M18 A;  4PM8 A;  3PBQ A;  4RVA A;  3D4F A;  3VP1 A;  4CPK A;  4DXC A;  3OPL A;  1BLS A;  3ZDJ A;  2HDU A;  4GDB A;  5F1G A;  2WKI A;  2VGJ A;  1HD8 A;  3IXB A;  2EX8 A;  3LY3 A;  3G32 A;  1IYQ A;  1RCJ A;  2ZC5 B;  3VFH A;  1CEF A;  3QNB A;  4O7D A;  4PM6 A;  3WRZ A;  4OLD A;  5AQ9 A;  1XA1 A;  1EI5 A;  4KZ6 A;  5FAT A;  2ZM0 A;  3FKW A;  1ZG4 A;  4E3L A;  4WBG A;  1ZG6 A;  5HFO A;  1MY8 A;  5EE8 A;  3HUO A;  3SS5 A;  1ERM A;  3G2Y A;  1K57 A;  4OLG A;  4QB8 A;  4FH4 A;  4R23 A;  2HP6 A;  3NDE A;  3M2K A;  2ZM2 A;  3UE1 A;  3LY4 A;  3UO9 A;  3G35 A;  4JKT A;  3GRJ A;  4XUZ A;  1I2S A;  3BFD A;  3ITA A;  4R0Q A;  4EBN A;  3JYI A;  2OV5 A;  2FFF B;  1M6K A;  5EVI B;  1BTL A;  1FCO A;  3OPR A;  4YFM A;  2WGW B;  3ZHH A;  3VSL A;  1FCN A;  1YMX A;  1Q2Q A;  1YM1 A;  3N8S A;  4S2J A;  3FZC A;  4R1G A;  1IKI A;  2WZZ A;  5HX9 A;  2H10 A;  2WUQ A;  4OOM A;  4KQQ A;  1LL5 A;  5HL1 A;  5EEC A;  4DE1 A;  2ZQD A;  1SDN A;  2WKE A;  2Y2L A;  1LI9 A;  5FQM A;  4Y7P A;  3MZD A;  1PIO A;  2XD1 A;  4MNR A;  5F83 A;  1JWP A;  1L0G A;  5J8X A;  3M6H A;  4C3Q A;  2C6W B;  3ZGA B;  4RX3 A;  2WAE A;  2VGK A;  3HLF A;  1S6R A;  3NY4 A;  3BEC A;  5E2F A;  1U60 A;  2ZD8 A;  3A3E A;  3AGE A;  4ZDX A;  1OME A;  2EXA A;  2Y2M A;  2Y2I A;  3C7V A;  3ZVT A;  1HVB A;  1FR6 A;  4JXG A;  3C7U A;  1PWC A;  1ALQ A;  3OPP A;  1RP5 A;  3G34 A;  2B5R A;  1LL9 A;  4JLF A;  1NZU A;  5EVI A;  4QJG A;  4OOL A;  3VOY A;  3WWX A;  1K4E A;  1EWZ A;  1NRF A;  3N8R A;  3PBR A;  2ZQ7 A;  2WK0 A;  3W4O A;  1NZO A;  2ZC7 A;  3VOZ A;  3HLW A;  4N1H A;  5FAP A;  3GR2 A;  3IHB A;  4BEN A;  4QD4 A;  1JWZ A;  1H5X A;  3HBR A;  4PPR A;  4EBL A;  2WKH A;  3HLG A;  1ESI A;  2PU4 A;  1FSW A;  1TDG A;  4B4X A;  4GN2 A;  2PBY A;  3B3X A;  1K38 A;  3TSG A;  4OVD A;  1GHP A;  2BLS A;  1MXO A;  1TEM A;  1WE4 A;  2Q9N A;  5TFQ A;  1FCM A;  2X02 A;  2IWC A;  4WM9 A;  2R9W A;  1VQQ A;  5FQQ A;  3IWI A;  1ES3 A;  4OON A;  4DKI A;  2Z2L B;  3WS2 A;  3UDI A;  3G4P A;  3RJU A;  4EQI A;  2HDQ A;  4UAA A;  2XK1 A;  1XKZ A;  1WYB A;  4R3B A;  4S2O A;  3Q7V B;  3IF6 A;  3NCK A;  1NJ4 A;  3O86 A;  3MZE A;  5BOH A;  4S2P A;  5GLB A;  3IH8 A;  4H8R A;  1K57 C;  1YLZ A;  4IBX A;  5CGX A;  3NI9 A;  4ZAM A;  5JYP A;  1FOF A;  2OLV A;  1S0W A;  5FAQ A;  3EQV A;  1KVM A;  1MWT A;  2QMI A;  1ES4 A;  4S2N A;  4WMC A;  1PZP A;  4WZ4 A;  2IWB A;  5CER A;  1PZO A;  4WEL A;  2XEP A;  1BT5 A;  2XDM A;  1GA9 A;  4OPY A;  1FQG A;  3FKV A;  3Q07 A;  5GHX A;  3C5A A;  4X6T A;  4KG5 A;  4QY6 A;  3TG9 A;  3NBL A;  3MZF A;  1E3U A;  3GSG A;  3LO7 A;  4S2M A;  2DNS A;  1CEG A;  1L0E A;  3ITB A;  5DVA A;  4N1X A;  4OQG A;  1YQS A;  1XA7 A;  2EFU A;  4IVI A;  1PWD A;  2XF3 A;  1KVL A;  1MBL A;  4OQ0 A;  4OOY A;  2ZQA A;  3Q1F A;  3UPP A;  4LV0 A;  2Y2G A;  3IF5 A;  4P6B A;  5E43 A;  2OSU A;  1I5Q A;  3OCL A;  1G68 A;  2Y2P A;  5TR7 A;  2ZMA A;  1BLH A;  2FFY A;  1W8Y A;  4KZA A;  2EX9 A;  3E2K A;  4S2I A;  1BZA A;  4DE3 A;  2Q9M A;  4K91 A;  5DF8 A;  5EVI C;  2J9O A;  5EVI D;  4LV3 A;  4N9L A;  3DTM A;  5FI7 A;  5CRF A;  5KSH A;  3G31 A;  4JF6 A;  2Y2J A;  3S4X A;  1GA0 A;  5FSR A;  3IWO A;  5M1A A;  5JYO A;  4R3J A;  1NYM A;  2ZC4 B;  1C3B A;  1XPB A;  1IKG A;  1L0F A;  3W4P A;  1J9M A;  3CJM A;  3V39 A;  2RL3 A;  2Y55 A;  3GMW A;  2XLN A;  1W7F A;  5GHY A;  2XFS A;  3TOI A;  3UNW A;  3VSK A;  2EXB A;  3ZVW A;  4MBF A;  4DE2 A;  1YMS A;  5FA7 A;  3HUN A;  3M2J A;  1BLC A;  4KZ9 A;  3HLE A;  4RX2 A;  2JCH A;  4D2O A;  4EUZ A;  4GB7 A;  2ZM8 A;  4OH0 A;  4FCF A;  2ZQ8 A;  3HRE A;  3VFF A;  3E2L A;  1ZC2 A;  5DTT A;  1N9B A;  4BL3 A;  3CZD A;  3SH9 A;  4PM9 A;  3V5M A;  4E6W A;  1K56 A;  1ONG A;  3IF6 C;  4C6Y A;  2OLU A;  4KG6 A;  1SCW A;  3BFG A;  4KZ4 A;  4LCM A;  1YLY A;  2Y4A A;  1O07 A;  3S1Y A;  2X01 A;  5HAI A;  4JXW A;  3C4P A;  4OPR A;  1YT4 A;  4P87 A;  4KZ5 A;  2QPN A;  5A93 A;  3PAE A;  3BFE A;  2ZC6 B;  3GQZ A;  5CHU A;  5GLC A;  3MFD A;  4GNU A;  1ES2 A;  4N92 A;  3UPN A;  4PM7 A;  2WGW A;  3GV9 A;  1CI8 A;  4S2N C;  2G2U A;  3LCE A;  2EX2 A;  4YIN A;  5EOE A;  1KE0 A;  3WS4 A;  2P9V B;  4FD8 A;  4WMC D;  4C75 A;  3ZG7 B;  4CJN A;  2WGI A;  3BYD A;  4MEZ A;  3BLS A;  1KGE A;  1VM1 A;  4OQI A;  4QU3 A;  2H0T A;  1K25 A;  3HVF A;  1LHY A;  4BLM A;  1K54 A;  5KMW A;  1IYO A;  3HLB A;  3MKF A;  1PI5 A;  1E3U D;  2P74 A;  3O87 A;  4DRT A;  1LI0 A;  1KDS A;  3C4O A;  1W8Q A;  2WAD A;  5AQA A;  4HBU A;  1ESU A;  4GKU A;  4RA7 A;  1KE3 A;  4B4Z A;  1XGI A;  4KZ8 A;  2XH9 A;  1N4O A;  4NK3 A;  3ZG5 A;  1BLP A;  1PWG A;  1E25 A;  4KG2 A;  2ZLY A;  2ZC3 B;  4LEN A;  4OQH A;  2CC1 A;  3N4I A;  5M19 A;  3PBT A;  2ZJ9 A;  4DDY A;  1KGF A;  3FV7 A;  4JXV A;  1QMF A;  2P9V A;  2DRW A;  4KEN B;  3DWZ A;  1PW1 A;  2Y2H A;  1YLW A;  3AGD A;  4WEJ A;  2H0Y A;  4BD1 A;  5GHZ A;  4JF4 A;  2Y59 A;  2Z2M B;  4HEF A;  5DF7 A;  2XFT A;  4GD6 A;  2HDS A;  1TDL A;  3IXD A;  4E3M A;  5F1F A;  3MBZ A;  4WEK A;  4LCL A;  1M40 A;  3ZNT A;  5FAS A;  5TGF A;  4BD0 A;  4ZJ2 A;  3NC8 A;  3SS4 A;  1K6R A;  3MXS A;  1XGJ A;  4QY5 A;  4WZ5 A;  3MXR A;  3SH7 A;  5FQ9 A;  3NDG A;  4KQO A;  5FQI A;  5G18 A;  5CXW A;  3Q7V A;  5CGS A;  5E2G A;  5GLD A;  3IWQ A;  3BEB A;  3PBN A;  2Y2N A;  3IXH A;  5FDH A;  2XR0 A;  4N9K A;  5EUA A;  4MBH A;  1K56 D;  5HAR A;  1MPL A;  4S2K A;  3DWK A;  2IWD A;  2UWX A;  2XD5 A;  4X68 A;  1W5D A;  3V3R A;  4E6X A;  4GOG A;  1ERQ A;  4MLL A;  4BL2 A;  1KGG A;  1HTZ A;  3MKE A;  3LEZ A;  1DJC A;  5CEB A;  1LLB A;  5CTN A;  1ZKJ A;  3O88 A;  3FYZ A;  4LV2 A;  4DXB A;  5CED A;  1ONH A;  1E4D A;  4U0T A;  1L2S A;  2WYX A;  1CK3 A;  1H8Z A;  2E8I A;  3BLM A;  4X53 A;  5D3O A;  1PI4 A;  3ZG8 B;  4F94 A;  1JVJ A;  5KZH A;  4XXR A;  3ZG0 A;  4KZ7 A;  4OPZ A;  5E2H A;  4X56 A;  2ZQ9 A;  3PBS A;  3RXW A;  3S22 A;  1K6S A;  4RYE A;  4Y0O A;  5DTS A;  3G2Z A;  5GL9 A;  3SH8 A;  4NET A;  4XUX A;  2H5S A;  1IYS A;  2XQZ A;  2V20 A;  3UDF A;  1KDW A;  4FSF A;  1K54 C;  5FQJ A;  4E3O A;  3A3F A;  1IEL A;  2XGN A;  1QME A;  2I72 A;  4HES A;  4S2L A;  5F82 A;  5HAQ A;  1SDE A;  5FI6 A;  1XXM A;  2EX6 A;  4ZJ3 A;  3ZNY A;  5A90 A;  3N8L A;  4Z9Q A;  3CMZ A;  5HW3 A;  5KSC A;  3G30 A;  4MBK A;  3UPO A;  4E3I A;  2V1Z A;  4UA7 A;  5GLA A;  1O7E A;  1IEM A;  4JF5 A;  2EFX A;  1CI9 A;  3VP2 A;  4DDS A;  5I94 A;  4OP5 A;  4FH2 A;  2DCF A;  5EPH A;  1IYP A;  4GZB A;  1JTD A;  5DF9 A;  1SKF A;  2BG1 A;  3GVB A;  4M3K A;  5EVL A;  1MWS A;  4OPQ A;  1BUL A;  1FR1 A;  5FAO A;  3PTE A;  1DJB A;  3IHA A; 
#chains in the Genus database with same CATH topology
 3Q82 A;  3T4O A;  3ZYT A;  3KO4 A;  4HIA A;  3VP0 A;  3F1O B;  3IS2 B;  1ES5 A;  3NEC A;  3IH9 A;  4R4R A;  4EBP A;  3DBA A;  5HAP A;  1P9R A;  1EW0 A;  2QJ5 A;  2XA7 M;  3BFC A;  2W3G A;  2Y2Q A;  2A49 A;  1UWN X;  4IBR A;  3LI9 A;  4HJ4 A;  4ESP A;  4PM5 A;  1UWP X;  3QNC A;  3VP4 A;  4ID4 A;  1PYY A;  3P98 A;  4JBF A;  3TRC A;  3NIA A;  2LB5 A;  5AQB A;  3A3J A;  5K5B A;  2PYR A;  5L2F A;  2O9C A;  2HPB A;  4GD8 A;  3V50 A;  4G3K A;  1L3L A;  3WS5 A;  1LSW A;  4IVK A;  3I7J A;  1H8Y A;  5EVE A;  3ISG A;  5FQK A;  1PRQ A;  2ZOH A;  4P0M A;  5DJT A;  4QPR A;  1JWV A;  3UB7 A;  4U3T A;  3PYP A;  4UA9 A;  4IED A;  2JBF A;  5AQ7 A;  1S66 L;  2G2W A;  3FPV A;  1PNE A;  3UE0 A;  1F5M A;  3VE3 A;  2J8Y A;  3C30 A;  2M7U A;  3H82 B;  2WZX A;  4HQA A;  4DF6 A;  3ICY A;  2JE5 A;  3W4Q A;  1K55 C;  1BYW A;  3IT9 A;  1I2W A;  4WYY A;  3FWL A;  4GHI B;  4KZ3 A;  4JGQ A;  4BQM A;  5M18 A;  4PM8 A;  3D4F A;  5EV0 A;  1BLS A;  3BJN A;  4YNR A;  4GDB A;  5F1G A;  2W0N A;  4O8G A;  3PHY A;  4RRH A;  4WF0 A;  5AQ9 A;  1XA1 A;  2W1T B;  3SS5 A;  1F2K A;  4ETZ A;  4HP4 A;  3NDE A;  2Y79 A;  2ZM2 A;  3LY4 A;  3UO9 A;  3T4Q A;  4EBN A;  2MJ6 A;  2OV5 A;  4RRC A;  3HJI A;  3OPR A;  4YFM A;  2WGW B;  1FCN A;  1YMX A;  3LIA A;  4S2J A;  2W3H A;  2WZZ A;  3PXP A;  5HX9 A;  2VX8 A;  4Y17 A;  5EEC A;  4DE1 A;  3KYE A;  1LI9 A;  3BQA A;  4C3Q A;  2C6W B;  5DFX A;  3K3D A;  3HLF A;  2KLI A;  4ZDX A;  2ZD8 A;  4CLC E;  1FR6 A;  3MQQ A;  4EQ1 A;  1TS6 A;  3F1P B;  3T1R A;  3G34 A;  3FPW A;  3VOY A;  4RRI A;  3N8R A;  1FIK A;  2WK0 A;  3VOZ A;  3HLW A;  4MMN A;  3IHB A;  4QD4 A;  1CJF A;  4PPR A;  1T19 A;  3A0V A;  4EBL A;  2B95 A;  1FSW A;  1KOU A;  5J7E A;  1VB6 A;  4OVD A;  1GHP A;  2BLS A;  1MXO A;  4FTX A;  4LRZ E;  4S0I A;  1WE4 A;  2X02 A;  3LR3 A;  4RRM A;  4OON A;  3UDI A;  3RJU A;  4EQI A;  4RRR A;  1XKZ A;  3Q7V B;  1TC5 A;  4I3J A;  1K57 C;  2V8C A;  3LGO A;  2OLV A;  4IJG A;  3F1N B;  1KVM A;  1MWT A;  2QMI A;  4S2N A;  2A24 B;  2IWB A;  5G4Z A;  4KQD A;  2GNX A;  4BBT A;  4KG5 A;  4R6L A;  4B9O A;  4DMZ A;  3S7Q A;  3GSG A;  4DN0 A;  2D02 A;  3ITB A;  5F6A A;  4OQ0 A;  2XF3 A;  2ZQA A;  4ARZ B;  4P6B A;  4NXB A;  1SKO A;  2OSU A;  4HOI A;  2Y2P A;  1W8Y A;  4X25 A;  1S1Y A;  5IU1 A;  4S2I A;  1BZA A;  2Q9M A;  4PHT A;  2V1B A;  4N9L A;  3DTM A;  1G5U A;  4RQ9 A;  5CRF A;  3IWO A;  4F3L A;  5J61 A;  5EFW A;  2ZC4 B;  1XPB A;  3W4P A;  1J9M A;  3V39 A;  2RL3 A;  2XLN A;  2JKR I;  1NWZ A;  1JNU A;  4UEY A;  3TOI A;  2P04 A;  1YMS A;  4RX2 A;  2JCH A;  2YKF A;  4EW7 A;  4OH0 A;  1ZC2 A;  1N9B A;  3MXQ A;  4E6W A;  3IF6 C;  2OLU A;  4KG6 A;  4KZ4 A;  2Y4A A;  3KOD A;  4EET B;  1Y28 A;  1YT4 A;  3OBF A;  4EU0 A;  3BFE A;  3GQZ A;  2O0Y A;  3MFD A;  1ES2 A;  2PDR A;  4YIN A;  3ULF A;  4FD8 A;  3TJZ C;  3LFV A;  2WGI A;  3BYD A;  3KOC A;  4HI4 A;  2J3W A;  1K25 A;  1LHY A;  1F98 A;  1ZHH B;  4HY8 A;  1IYO A;  3MKF A;  3LIC A;  4EUV A;  1W8Q A;  5AQA A;  1ESU A;  1OTE A;  4DJ2 A;  4YOF A;  1XGI A;  3KO6 A;  2EWV A;  3UMD A;  1BLP A;  4KG2 A;  1YSP A;  3MFX A;  4LEN A;  4OQH A;  3N4I A;  1Y2Q A;  3UB5 P;  5I5L A;  4DDY A;  4Q0J A;  4L9F A;  3AGD A;  4Y13 A;  2Z2M B;  4NG2 A;  3T50 A;  4JGO A;  4HNB A;  2HDS A;  1TDL A;  3LYX A;  3C8C A;  5TGF A;  3NC8 A;  1K6R A;  3MXS A;  5DKL A;  1XGJ A;  5FQ9 A;  4KQO A;  3H7W A;  5EM1 A;  5FQI A;  5GLD A;  3QP5 A;  4RRJ A;  2E8J A;  3PR6 A;  3DWK A;  4LRX C;  4X68 A;  1W5D A;  1ERQ A;  1KGG A;  1HTZ A;  1LLB A;  4RR6 A;  4GJ4 A;  4LV2 A;  4M4X A;  5HWT A;  4JGP A;  4U0T A;  2BAS A;  4F94 A;  4Y15 A;  3ZG0 A;  4ZRR A;  1H8M A;  1K6S A;  3G2Z A;  3RH8 B;  3LIB A;  1IYS A;  2GX5 A;  3UDF A;  1KDW A;  1GSX A;  2XGN A;  1XJ3 A;  2I72 A;  4S2L A;  4ZJ3 A;  5L09 A;  3KSI A;  4Z9Q A;  5KSC A;  3W2Z A;  4KUK A;  1O7E A;  2Y8H A;  1IEM A;  2EFX A;  4DDS A;  4FH2 A;  1IYP A;  3E98 A;  1FR1 A;  3MQ0 A;  5CX7 A;  1DJB A;  3IHA A;  1K55 A;  2ZOI A;  2HDR A;  4R4S A;  2J9P A;  2WAF A;  4X69 A;  3SS3 A;  5A92 A;  2JKT M;  3IBJ A;  3Q81 A;  4WZ5 C;  1VHM A;  3EEA A;  4ZJ1 A;  2B18 A;  2W3D A;  1XP4 A;  2X71 A;  3BY8 A;  1SHV A;  1NY0 A;  4LGW A;  4E3K A;  3UY6 A;  4PMA A;  4DE0 A;  4EWF A;  4KQR A;  3PAG A;  3BM6 A;  4L9G A;  2ACG A;  3OCN A;  3F1O A;  3IS2 A;  1S4R A;  1BSG A;  3HLD A;  1WYC A;  3Q7Z A;  1AXB A;  3OLO A;  4Y0T A;  4R3A A;  3LIF A;  1STZ A;  4E3N A;  3CI6 A;  3UE3 A;  4K0W A;  2Y2O A;  3M6B A;  1NXY A;  2A3U A;  1GHM A;  3MR0 A;  3VV4 A;  3V3S A;  4I3A A;  3HUM A;  1H3Q A;  3QP8 A;  1DJA A;  3BWL A;  3GTC A;  4QHC A;  1OJG A;  5FI2 A;  4GDN A;  2ZBB A;  4EEP A;  4ZBE A;  1PW8 A;  3KYQ A;  4I3I A;  4RR8 A;  5HZH A;  3IXB A;  2VGJ A;  3G32 A;  1RCJ A;  5FL3 A;  1CEF A;  1NLY A;  3QNB A;  4PM6 A;  5HL6 A;  4E3L A;  3FKW A;  3KX0 X;  2OAQ 1;  4WBG A;  1MY8 A;  5EE8 A;  3G2Y A;  1K57 A;  3SW1 A;  3UE1 A;  3P7N A;  3GRJ A;  4XUZ A;  1I2S A;  4GHI A;  3JYI A;  1Z09 A;  1D7E A;  3NOU C;  2G7U A;  3LUQ A;  2H10 A;  2OKV A;  2W1T A;  2Y2L A;  2HV1 A;  1L0G A;  1JWP A;  5J8X A;  4R70 A;  3ZGA B;  4RX3 A;  2VGK A;  3NY4 A;  3BEC A;  3AGE A;  3CLO A;  2PT7 A;  3ZVT A;  3C7U A;  5FEG A;  1PWC A;  5TJJ A;  2VV8 A;  4KUO A;  4OOL A;  3K2N A;  3WWX A;  1K4E A;  2PYP A;  1NZO A;  5L10 A;  2VJW A;  3E4O A;  1OT9 A;  4XT2 A;  1H5X A;  3HBR A;  2W27 A;  3HLG A;  4P6Z S;  4B4X A;  4LLO B;  3KO9 A;  3B3X A;  1K38 A;  5J4E A;  4NBJ A;  1TEM A;  2OOL A;  2IWC A;  5HWW A;  4WM9 A;  3F1P A;  3G4P A;  4UAA A;  2XK1 A;  1N9N A;  3IF6 A;  3MZE A;  3IH8 A;  4IBX A;  3NI9 A;  4P6Z M;  1FOF A;  1ES4 A;  1VEU B;  4WMC A;  1PZO A;  4WEL A;  1BT5 A;  1G28 A;  3LMT A;  3FKV A;  3Q07 A;  4MN7 A;  3PD3 A;  4X6T A;  4QY6 A;  2J3T C;  3NBL A;  4S2M A;  4DJ3 A;  1CEG A;  4MCW A;  4MN5 A;  5DVA A;  4S0K A;  4N1X A;  3IX3 A;  1MBL A;  3B47 A;  3Q1F A;  2Y2G A;  5E43 A;  1G68 A;  3F1N A;  2ZMA A;  2FFY A;  4KZA A;  2EX9 A;  3E4P A;  4S02 A;  4LV3 A;  3QP4 A;  5TBM B;  3HJK A;  3G31 A;  4JF6 A;  2Y2J A;  5FSR A;  4MDZ A;  4R3J A;  1A0K A;  4H6J B;  3IX4 A;  2V0U A;  3UNW A;  2EXB A;  3IBR A;  3QP2 A;  3HUN A;  1LT0 A;  3NOT C;  4BL3 A;  3RTY A;  3CZD A;  1K56 A;  2O9A A;  1TF1 A;  4JXW A;  3C4P A;  4OPR A;  1T18 A;  1YPR A;  2QPN A;  3PAE A;  4KZ5 A;  2ZC6 B;  5GLC A;  5CHU A;  3MQO A;  3MJQ A;  2PR6 A;  4N92 A;  4L9E A;  2KOI A;  3GV9 A;  2G2U A;  2UV0 E;  2EX2 A;  2OWH A;  5EOE A;  1KE0 A;  3WS4 A;  4WMC D;  4C75 A;  4CJN A;  1S4S A;  3T1Q B;  3FC7 A;  3CUE C;  5KMW A;  5L07 A;  2INW A;  3HLB A;  1PI5 A;  2P74 A;  3C4O A;  4HBU A;  2PHY A;  2XH9 A;  1UGU A;  3NJA A;  1N4O A;  4PKY A;  2VA0 A;  3PD4 A;  3T1S A;  1KGF A;  4JXV A;  1QMF A;  5HSQ A;  4MN6 A;  1PW1 A;  3LR5 A;  2NUT C;  2Y59 A;  5DF7 A;  2XFT A;  4CLC B;  1OTB A;  3IXD A;  5F1F A;  3MBZ A;  4WEK A;  4LCL A;  2HL1 A;  4HH2 A;  4ZJ2 A;  4QY5 A;  4WZ5 A;  3SH7 A;  2XRN A;  1H0M A;  5E2G A;  3CAX A;  3IWQ A;  2Y2N A;  4S03 A;  2HL0 A;  1K56 D;  5HAR A;  1MPL A;  4S2K A;  2IWD A;  3S7O A;  2XD5 A;  3T1X A;  2ZMF A;  4GOG A;  4EER A;  3LIE A;  3BQ8 A;  3LEZ A;  4NKP A;  5CTN A;  3O88 A;  4LRY C;  3FYZ A;  4DXB A;  5CED A;  1E4D A;  2P7J A;  1D1J A;  1H8Z A;  2E8I A;  4S0L A;  1ZTU A;  4GCZ A;  4KZ7 A;  4X56 A;  3RXW A;  4II7 A;  1ODV A;  4Y0O A;  2B02 A;  2JHE A;  2XQZ A;  2V20 A;  1IOU A;  1QME A;  4HES A;  4HJ3 A;  5F82 A;  2NUP C;  5FI6 A;  5HD3 A;  1XXM A;  3H9W A;  3VOL A;  3N8L A;  3CMZ A;  5G4Y A;  1NLZ A;  3G30 A;  3EOI A;  5DKK A;  4E3I A;  5GLA A;  1CI9 A;  3MS6 A;  4GZB A;  5DF9 A;  1SKF A;  3GVB A;  4M3K A;  5EVL A;  1MWS A;  1OJ5 A;  1G6O A;  3PTE A;  2PRF A;  3CIT A;  2Y2K A;  1T1C A;  3ZFZ A;  1GHI A;  3KO5 A;  4P85 A;  3UN7 A;  5CHM A;  2J7V A;  3HLC A;  4U0X A;  1XX2 A;  3W8K A;  2J80 A;  3A0S A;  3AGF A;  3K3C A;  3HL9 A;  1Z6F A;  2GDN A;  4S0J A;  3WS1 A;  3WRT A;  3UB8 A;  2R9X A;  3N7W A;  3BRM A;  2RCX A;  4FOF A;  3N6I A;  1BUE A;  1YLJ A;  2BTF P;  2WGV A;  5AVE A;  3V67 A;  1Y54 A;  5CTM A;  1GCE A;  2HP5 A;  4ETX A;  3DW0 A;  1K4F A;  5EM0 A;  4CLC C;  1RGY A;  1S1Z A;  4OKP A;  2JN7 A;  2PU2 A;  3E4Q A;  2HP9 A;  4UA6 A;  5CEC A;  1OTA A;  2C5W B;  1FSY A;  5EOO A;  2GJ3 A;  2Y91 A;  4ME4 A;  5DJU A;  1YLT A;  3T4L A;  3VE4 A;  1V9Y A;  4NXG A;  3EQU A;  3IXG A;  3UB6 A;  1HZO A;  3PBO A;  1ERO A;  1MWU A;  2AVX A;  4RRQ A;  3OZH A;  3B33 A;  1Q2P A;  3OC2 A;  3VP3 A;  4WN5 A;  3VMA A;  4RRD A;  3LI8 A;  3WS0 A;  1MC0 A;  5FEF A;  3OPH A;  5AJG A;  4E3J A;  1W79 A;  1OTD A;  3DTE A;  5A91 A;  2LB9 A;  1MWR A;  4LV1 A;  1KE4 A;  3SOI A;  5FDS A;  3JVV A;  1VET B;  3VP1 A;  4DXC A;  4GS9 B;  2HDU A;  4NEE D;  2WKI A;  2EX8 A;  3LY3 A;  2I9V A;  2ZC5 B;  3VFH A;  4O7D A;  4OLD A;  1ZG4 A;  5DFY A;  2K31 A;  3HUO A;  1D06 A;  4OLG A;  4QB8 A;  4FH4 A;  5IT5 A;  4RR7 A;  3M2K A;  3LMV A;  4JKT A;  4R0Q A;  3BFD A;  3ITA A;  2FFF B;  1M6K A;  5EVI B;  1FCO A;  2HGV A;  3ZHH A;  3VSL A;  1Q2Q A;  1YM1 A;  3EWK A;  1S67 L;  4R1G A;  1IKI A;  1DP9 A;  1LL5 A;  3T4K A;  5HL1 A;  2ZQD A;  1SDN A;  2WKE A;  4Y7P A;  3MZD A;  1PIO A;  2GZA A;  3M6H A;  3KSG A;  1S6R A;  5E2F A;  1TS7 A;  1J3W A;  3T4J A;  4RRK A;  4JXG A;  1TD5 A;  1ALQ A;  3OPP A;  4Y2F A;  2B5R A;  1NZU A;  2WKP A;  3PBR A;  3W4O A;  2ZC7 A;  3R4K A;  4Q0H A;  4N1H A;  5FAP A;  3GR2 A;  2O99 A;  2L0W A;  1JWZ A;  2WKH A;  2PU4 A;  1XJ6 A;  1TDG A;  2PBY A;  3TSG A;  2Q9N A;  5TFQ A;  2KDK A;  2R9W A;  3T4T A;  3IWI A;  1ES3 A;  2QHK A;  2Z2L B;  3MF0 A;  4AFI A;  3KOB A;  3NCK A;  4Z1W A;  3S7N A;  5BOH A;  4S2P A;  2YKH A;  5GLB A;  4D60 A;  1XFN A;  4HHD A;  3R7W B;  5CGX A;  1S0W A;  3EQV A;  5CER A;  2XDM A;  1GA9 A;  4OPY A;  5GHX A;  3C5A A;  3CUE A;  3MZF A;  4BBV A;  2J3T D;  1MZU A;  2DNS A;  1L0E A;  1XA7 A;  1YAX A;  4K08 A;  5MC7 A;  3KSH A;  1IFQ A;  4LV0 A;  5HDD A;  3IF5 A;  4O01 A;  1I5Q A;  3OCL A;  1VEU A;  2V8F A;  4DE3 A;  5DF8 A;  5EVI C;  4I5S A;  2VZW A;  5FI7 A;  3H82 A;  1GA0 A;  5M1A A;  5JYO A;  1NYM A;  2Z6C A;  1L0F A;  1TS0 A;  3CJM A;  2JKR M;  2Y55 A;  2PBD P;  3GMW A;  1W7F A;  2XFS A;  4RRA A;  4MBF A;  4DE2 A;  1MKM A;  2R78 A;  4KZ9 A;  2D01 A;  2ZM8 A;  4FCF A;  5J3W A;  2ZQ8 A;  2V0W A;  3CPT B;  5DTT A;  2V1A A;  3SH9 A;  2VKS A;  4C6Y A;  5TBM A;  3BFG A;  1YLY A;  3S1Y A;  2X01 A;  2M7V A;  4P87 A;  2OWJ A;  1ACF A;  4H6J A;  1T1B A;  1YSQ A;  3UPN A;  4PM7 A;  3HCY A;  2WGW A;  3TW8 A;  4G3W A;  4NBI A;  2P9V B;  3D9Y A;  1OTI A;  1VM1 A;  4QU3 A;  2H0T A;  3EEH A;  2EA9 A;  3O87 A;  5HDS A;  1KDS A;  5HDC A;  3G6O A;  4GKU A;  4RA7 A;  4HH3 A;  3U4L P;  4B4Z A;  1OPX A;  4NK3 A;  5F69 A;  1WA9 A;  4UQI S;  3PBT A;  2ZJ9 A;  3FV7 A;  2DBO A;  2ZMV A;  5GHZ A;  4JF4 A;  2O9B A;  4GD6 A;  4E3M A;  4I39 A;  1P0Z A;  2PD7 A;  4HJ6 A;  5FAS A;  3OOV A;  1N9L A;  3SS4 A;  3MXR A;  2ZL1 B;  4UQI M;  1DP8 A;  3NDG A;  5CXW A;  3Q7V A;  4G3V A;  2HJ9 C;  3BEB A;  4BWI A;  2OAP 1;  5FDH A;  3LR4 A;  2V9A A;  2UWX A;  3UB9 A;  4BL2 A;  1P9W A;  1YKD A;  3MKE A;  5CEB A;  4CLC A;  1ONH A;  2A24 A;  1L2S A;  5D3O A;  3BLM A;  3ZG8 B;  1PI4 A;  4OPZ A;  5E2H A;  2ZQ9 A;  3S22 A;  4E04 A;  5DTS A;  1OT6 A;  4XUX A;  2HZ5 A;  1W63 M;  4FSF A;  1K54 C;  4E3O A;  3A3F A;  1IEL A;  4NXF A;  4LFU A;  4ARZ A;  2EX6 A;  3ZNY A;  5A90 A;  5HW3 A;  5HWV A;  4MBK A;  3LEQ A;  3UPO A;  1V9Z A;  4JF5 A;  4X1M A;  3VP2 A;  5EPH A;  3KYZ A;  3KNP A;  2BG1 A;  3FG8 A;  4HP9 A;  4OPQ A;  4XT2 B;  2L4R A;  3P09 A;  1XJ4 A;  2VK3 A;  3UDX A;  1DY6 A;  2QYB A;  1L0D A;  2VV6 A;  5A8B A;  2JKT I;  4KZB A;  4EEU A;  2ZQC A;  3B42 A;  3QHY A;  2JC7 A;  2V2F F;  4BJP A;  4GW9 A;  3O3V A;  4X55 A;  2QZ6 A;  4OP8 A;  5E2E A;  3IF6 B;  3A3D A;  4ZTK A;  3BFF A;  4B88 A;  3CG5 A;  3PD2 A;  1MKI A;  5DTK A;  4A5R A;  1YLP A;  2HJE A;  4CLC D;  3TE8 A;  4HBT A;  2VLG A;  4JPM A;  3IQA A;  3ZCZ A;  1NYY A;  1JTG A;  1TS8 A;  4EV4 A;  2VEA A;  3P01 A;  4IUH A;  4PKY G;  5IHV A;  2XRO A;  5KIZ A;  1CQA A;  3ZG9 B;  4X1L A;  4Q8I A;  3A3I A;  3T4S A;  4EES A;  4L0L A;  1N9O A;  4Y0U A;  4UHU A;  3RXX A;  1TVF A;  4WLA A;  5CHJ A;  3EGX C;  5IS1 A;  4JXS A;  4CQH A;  2JKF A;  4K0X A;  5U47 A;  5CGW A;  4RRG A;  1G6A A;  3SZT A;  2HF6 A;  4FUW A;  1RGZ A;  3PBQ A;  4RVA A;  4CPK A;  3OPL A;  3ZDJ A;  3U2A A;  1HD8 A;  4BMW A;  1IYQ A;  3KO7 A;  5L8M A;  2FZ0 A;  3WRZ A;  2M1C A;  1EI5 A;  4KZ6 A;  5FAT A;  2ZM0 A;  4EXO A;  5HFO A;  1ZG6 A;  5LBR A;  1ERM A;  4R23 A;  5HPI A;  2HP6 A;  4LPZ A;  1DP6 A;  3G35 A;  3BY9 A;  1XJ2 A;  1BTL A;  3NOP C;  1VET A;  5HPF A;  4GS9 A;  3N8S A;  1X0O A;  3FZC A;  2WUQ A;  4OOM A;  4KQQ A;  2QKP A;  2Z6D A;  2P08 A;  3E0Y A;  5FQM A;  2XD1 A;  4MNR A;  5F83 A;  2WAE A;  3L7H A;  1U60 A;  3A3E A;  3PD5 A;  1OME A;  2EXA A;  2Y2M A;  2Y2I A;  3C7V A;  3IX8 A;  1HVB A;  4PAU A;  3D3O A;  1RP5 A;  1LL9 A;  4JLF A;  4QJG A;  5EVI A;  5AVF A;  1NRF A;  1EWZ A;  2ZQ7 A;  3O5Y A;  4BEN A;  3DTI A;  2EWW A;  1ESI A;  4GN2 A;  3S7P A;  3NHQ A;  5F5Y A;  1K0K A;  1FCM A;  1VQQ A;  4IHQ A;  5FQQ A;  1Y4O A;  4DKI A;  3WS2 A;  3ZQ5 A;  2HDQ A;  3GDI A;  1WYB A;  4R3B A;  4S2O A;  3A0R A;  3O86 A;  1NJ4 A;  3LR0 A;  4H8R A;  1YLZ A;  3MMH A;  2K7S A;  3DTK A;  4ZAM A;  1SKO B;  1SZV A;  3JPU A;  2QWS A;  5JYP A;  5FAQ A;  3RFB A;  1PZP A;  4WZ4 A;  2XEP A;  5C5K A;  1FQG A;  1LSX A;  1GSW A;  2PAV P;  2W1R A;  3TG9 A;  4GLQ A;  4F3L B;  1E3U A;  1FIL A;  3LO7 A;  4R38 A;  4OQG A;  1YQS A;  2EFU A;  4IVI A;  1PWD A;  1KVL A;  4OOY A;  3UPP A;  3R7W A;  3NUL A;  1LL8 A;  3QP6 A;  1LSV A;  5TR7 A;  1BLH A;  4WL9 A;  1HLU P;  1NRJ A;  3DAV A;  3E2K A;  2KX6 A;  4K91 A;  4QWO A;  1P97 A;  4NXE A;  2J9O A;  5EVI D;  5KSH A;  4O0P A;  3C2W A;  3S4X A;  1GSV A;  3UE6 A;  1C3B A;  4B93 A;  1IKG A;  5GHY A;  3VSK A;  3ZVW A;  3MSH A;  5FA7 A;  4Q0I A;  3M2J A;  1BLC A;  2W3E A;  3HLE A;  4D2O A;  4EUZ A;  4GB7 A;  3EGD C;  3HRE A;  4Y5F A;  3E2L A;  3VFF A;  2H28 A;  4PM9 A;  3V5M A;  1ONG A;  1SCW A;  4LCM A;  1O07 A;  5HAI A;  1T1A A;  2IA2 A;  5A93 A;  1W63 Q;  4GNU A;  1CI8 A;  4S2N C;  3LCE A;  3L9K A;  5F68 A;  3ZG7 B;  4MEZ A;  3BLS A;  1KGE A;  4OQI A;  4WUJ A;  3CPT A;  3HVF A;  2FH5 A;  4BLM A;  1K54 A;  2WKQ A;  1E3U D;  4DRT A;  1LI0 A;  1JKE A;  2WAD A;  3BW6 A;  2HKZ A;  3D72 A;  1KE3 A;  4KZ8 A;  3LID A;  3ZG5 A;  1PWG A;  1E25 A;  3H7W B;  2ZLY A;  2ZC3 B;  2XSS A;  2CC1 A;  5M19 A;  2Q0O A;  3QP1 A;  2P9V A;  2DRW A;  3KSF A;  4KEN B;  3UME A;  2DMW A;  2VV7 A;  3DWZ A;  4BBU A;  2Y2H A;  1YLW A;  3C38 A;  4WEJ A;  5HD5 A;  2H0Y A;  2VGL S;  4BD1 A;  4HEF A;  4IUK A;  2PD8 A;  3KO3 A;  4JGR A;  1M40 A;  1PFL A;  3CWF A;  3ZNT A;  4BD0 A;  4Y3I A;  1AWI A;  5G18 A;  5CGS A;  4I38 A;  3PBN A;  1DRM A;  3IXH A;  1XFQ A;  2XR0 A;  4N9K A;  5EUA A;  4MBH A;  2K2N A;  2VGL M;  2WKR A;  4E6X A;  3V3R A;  1J7G A;  4MLL A;  1DJC A;  1ZKJ A;  3LMU A;  4YWZ A;  1CF0 A;  2WYX A;  1CK3 A;  2A2L A;  4X53 A;  5KZH A;  1JVJ A;  4XXR A;  3PBS A;  4RYE A;  2ZL1 A;  5GL9 A;  1F9I A;  2PR5 A;  4NET A;  3SH8 A;  2CMN A;  2H5S A;  2QJ7 A;  4RRL A;  5FQJ A;  2L1M A;  5HAQ A;  1SDE A;  3T12 B;  2V1Z A;  4UA7 A;  3CHW P;  4RRB A;  2W3F A;  5I94 A;  4OP5 A;  4RR9 A;  2DCF A;  3KNF A;  2XA7 S;  3JVU A;  1JTD A;  1BUL A;  3GEC A;  5FAO A;  4RRF A;  2JKG A;  2HL2 A; 
#chains in the Genus database with same CATH homology
 2Y2K A;  1K55 A;  3Q82 A;  3ZFZ A;  1GHI A;  2HDR A;  3P09 A;  4R4S A;  3KO5 A;  4P85 A;  3UN7 A;  2J9P A;  2WAF A;  2J7V A;  3HLC A;  5CHM A;  3UDX A;  3KO4 A;  3VP0 A;  1DY6 A;  1ES5 A;  4U0X A;  1XX2 A;  3IH9 A;  1L0D A;  4R4R A;  3W8K A;  4X69 A;  3SS3 A;  4EBP A;  5A92 A;  3AGF A;  4KZB A;  3Q81 A;  5HAP A;  4WZ5 C;  3HL9 A;  3BFC A;  1Z6F A;  2GDN A;  2ZQC A;  3QHY A;  4ZJ1 A;  4S0J A;  3WS1 A;  2Y2Q A;  2A49 A;  2JC7 A;  2R9X A;  3N7W A;  4IBR A;  3WRT A;  3BRM A;  2RCX A;  2V2F F;  4BJP A;  3O3V A;  1XP4 A;  2X71 A;  3QNC A;  3N6I A;  4X55 A;  4PM5 A;  2QZ6 A;  1SHV A;  4OP8 A;  1BUE A;  3IF6 B;  5E2E A;  3VP4 A;  1YLJ A;  1PYY A;  1NY0 A;  3A3D A;  4ID4 A;  2WGV A;  3P98 A;  4ZTK A;  3BFF A;  1Y54 A;  4JBF A;  5CTM A;  4E3K A;  4B88 A;  3UY6 A;  3NIA A;  4PMA A;  3CG5 A;  5AQB A;  3PD2 A;  1GCE A;  4DE0 A;  4EWF A;  3A3J A;  1MKI A;  2HP5 A;  3PAG A;  4KQR A;  5DTK A;  3BM6 A;  3DW0 A;  1K4F A;  4A5R A;  1YLP A;  1RGY A;  4OKP A;  3OCN A;  5L2F A;  4HBT A;  2HPB A;  4GD8 A;  3V50 A;  2PU2 A;  4JPM A;  1BSG A;  3HLD A;  2HP9 A;  3IQA A;  3ZCZ A;  1NYY A;  1JTG A;  1WYC A;  4UA6 A;  5CEC A;  3Q7Z A;  1AXB A;  2C5W B;  3WS5 A;  4Y0T A;  4EV4 A;  1FSY A;  5EOO A;  2Y91 A;  5IHV A;  4IVK A;  1YLT A;  3I7J A;  1H8Y A;  4E3N A;  3ISG A;  5FQK A;  3UE3 A;  4K0W A;  3ZG9 B;  3EQU A;  3IXG A;  2Y2O A;  4P0M A;  3M6B A;  4Q8I A;  1HZO A;  1NXY A;  1ERO A;  2A3U A;  3PBO A;  3A3I A;  1JWV A;  1GHM A;  1MWU A;  4U3T A;  4RRQ A;  3OZH A;  1Q2P A;  4UA9 A;  4IED A;  3V3S A;  4L0L A;  4Y0U A;  4UHU A;  3RXX A;  2JBF A;  3OC2 A;  5AQ7 A;  3HUM A;  3VP3 A;  1TVF A;  2G2W A;  3VMA A;  4RRD A;  3UE0 A;  3WS0 A;  5CHJ A;  1DJA A;  3GTC A;  4JXS A;  3OPH A;  4K0X A;  4E3J A;  1W79 A;  2J8Y A;  5U47 A;  2WZX A;  5CGW A;  4DF6 A;  4RRG A;  1G6A A;  2JE5 A;  4QHC A;  3W4Q A;  1K55 C;  5FI2 A;  5A91 A;  3IT9 A;  1I2W A;  4WYY A;  4GDN A;  3FWL A;  1MWR A;  4LV1 A;  1RGZ A;  1KE4 A;  3SOI A;  4KZ3 A;  4ZBE A;  1PW8 A;  4BQM A;  5M18 A;  4PM8 A;  3PBQ A;  4RVA A;  3D4F A;  4RR8 A;  3VP1 A;  4CPK A;  4DXC A;  3OPL A;  1BLS A;  3ZDJ A;  2HDU A;  4GDB A;  5F1G A;  2WKI A;  2VGJ A;  1HD8 A;  3IXB A;  2EX8 A;  3LY3 A;  3G32 A;  1IYQ A;  1RCJ A;  2ZC5 B;  3KO7 A;  3VFH A;  1CEF A;  3QNB A;  4O7D A;  4PM6 A;  3WRZ A;  4RRH A;  4OLD A;  5AQ9 A;  1XA1 A;  1EI5 A;  4KZ6 A;  5FAT A;  2ZM0 A;  3FKW A;  1ZG4 A;  4E3L A;  4WBG A;  1ZG6 A;  5HFO A;  1MY8 A;  5EE8 A;  3HUO A;  3SS5 A;  1ERM A;  3G2Y A;  1K57 A;  4OLG A;  4QB8 A;  4FH4 A;  4R23 A;  2HP6 A;  3NDE A;  4RR7 A;  3M2K A;  2ZM2 A;  3UE1 A;  3LY4 A;  3UO9 A;  3G35 A;  3LMV A;  4JKT A;  3GRJ A;  4XUZ A;  1I2S A;  3BFD A;  3ITA A;  4R0Q A;  4EBN A;  3JYI A;  2OV5 A;  2FFF B;  1M6K A;  5EVI B;  4RRC A;  1BTL A;  1FCO A;  3OPR A;  4YFM A;  2WGW B;  3ZHH A;  3VSL A;  1FCN A;  1YMX A;  1Q2Q A;  1YM1 A;  3N8S A;  4S2J A;  3FZC A;  4R1G A;  1IKI A;  2WZZ A;  5HX9 A;  2H10 A;  2WUQ A;  4OOM A;  2OKV A;  4KQQ A;  1LL5 A;  5HL1 A;  4S0L A;  5EEC A;  4DE1 A;  2ZQD A;  1SDN A;  2WKE A;  2Y2L A;  1LI9 A;  5FQM A;  4Y7P A;  3MZD A;  1PIO A;  2XD1 A;  4MNR A;  5F83 A;  1JWP A;  1L0G A;  5J8X A;  3M6H A;  4C3Q A;  2C6W B;  3ZGA B;  4RX3 A;  2WAE A;  2VGK A;  3HLF A;  1S6R A;  3NY4 A;  3BEC A;  5E2F A;  1U60 A;  2ZD8 A;  3A3E A;  3AGE A;  4ZDX A;  3PD5 A;  1OME A;  2EXA A;  2Y2M A;  2Y2I A;  3C7V A;  3ZVT A;  4RRK A;  1HVB A;  1FR6 A;  4JXG A;  3C7U A;  1PWC A;  1ALQ A;  3OPP A;  1RP5 A;  3G34 A;  2B5R A;  1LL9 A;  4JLF A;  1NZU A;  5EVI A;  4QJG A;  4OOL A;  3VOY A;  4RRI A;  3WWX A;  1K4E A;  1EWZ A;  1NRF A;  3N8R A;  3PBR A;  2ZQ7 A;  2WK0 A;  3W4O A;  1NZO A;  2ZC7 A;  3VOZ A;  3HLW A;  4N1H A;  5FAP A;  3GR2 A;  3IHB A;  4BEN A;  4QD4 A;  1JWZ A;  1H5X A;  3HBR A;  4PPR A;  4EBL A;  2WKH A;  3HLG A;  1ESI A;  2PU4 A;  1FSW A;  1TDG A;  4B4X A;  3KO9 A;  4GN2 A;  2PBY A;  3B3X A;  1K38 A;  3TSG A;  4OVD A;  1GHP A;  4NBJ A;  2BLS A;  1MXO A;  1TEM A;  4S0I A;  1WE4 A;  2Q9N A;  5TFQ A;  1FCM A;  2X02 A;  2IWC A;  4WM9 A;  2R9W A;  1VQQ A;  5FQQ A;  3IWI A;  4RRM A;  1ES3 A;  4OON A;  4DKI A;  2Z2L B;  3WS2 A;  3UDI A;  3G4P A;  3RJU A;  4EQI A;  2HDQ A;  4UAA A;  4RRR A;  2XK1 A;  1XKZ A;  1WYB A;  4R3B A;  4S2O A;  3Q7V B;  1TC5 A;  3IF6 A;  3NCK A;  1NJ4 A;  3O86 A;  3KOB A;  3MZE A;  5BOH A;  4S2P A;  5GLB A;  3IH8 A;  4H8R A;  1K57 C;  1YLZ A;  4IBX A;  5CGX A;  3NI9 A;  4ZAM A;  5JYP A;  1FOF A;  2OLV A;  1S0W A;  5FAQ A;  3EQV A;  1KVM A;  1MWT A;  2QMI A;  1ES4 A;  4S2N A;  4WMC A;  1PZP A;  4WZ4 A;  2IWB A;  5CER A;  1PZO A;  4WEL A;  2XEP A;  1BT5 A;  2XDM A;  1GA9 A;  4OPY A;  3LMT A;  1FQG A;  3FKV A;  3Q07 A;  5GHX A;  3C5A A;  3PD3 A;  4X6T A;  4KG5 A;  4QY6 A;  3TG9 A;  3NBL A;  3MZF A;  1E3U A;  3GSG A;  3LO7 A;  4S2M A;  2DNS A;  1CEG A;  1L0E A;  3ITB A;  5DVA A;  4S0K A;  4N1X A;  4OQG A;  1YQS A;  1XA7 A;  2EFU A;  4IVI A;  1PWD A;  2XF3 A;  1KVL A;  1MBL A;  4OQ0 A;  4OOY A;  2ZQA A;  3Q1F A;  3UPP A;  4LV0 A;  2Y2G A;  3IF5 A;  4P6B A;  5E43 A;  2OSU A;  1I5Q A;  3OCL A;  1G68 A;  2Y2P A;  5TR7 A;  2ZMA A;  1BLH A;  2FFY A;  1W8Y A;  4KZA A;  2EX9 A;  3E2K A;  4S2I A;  1BZA A;  4DE3 A;  2Q9M A;  4K91 A;  5DF8 A;  5EVI C;  4S02 A;  2J9O A;  5EVI D;  4LV3 A;  4N9L A;  3DTM A;  5FI7 A;  5CRF A;  5KSH A;  3G31 A;  4JF6 A;  2Y2J A;  3S4X A;  1GA0 A;  5FSR A;  3IWO A;  5M1A A;  5JYO A;  5J61 A;  4R3J A;  1NYM A;  2ZC4 B;  1C3B A;  1XPB A;  1IKG A;  1L0F A;  3W4P A;  1J9M A;  3CJM A;  3V39 A;  2RL3 A;  2Y55 A;  3GMW A;  2XLN A;  1W7F A;  5GHY A;  2XFS A;  3TOI A;  3UNW A;  3VSK A;  2EXB A;  3ZVW A;  4RRA A;  4MBF A;  4DE2 A;  1YMS A;  5FA7 A;  3HUN A;  3M2J A;  1BLC A;  4KZ9 A;  3HLE A;  4RX2 A;  2JCH A;  4D2O A;  4EUZ A;  4GB7 A;  2ZM8 A;  4OH0 A;  4FCF A;  2ZQ8 A;  3HRE A;  3VFF A;  3E2L A;  1ZC2 A;  5DTT A;  1N9B A;  4BL3 A;  3CZD A;  3SH9 A;  4PM9 A;  3V5M A;  4E6W A;  1K56 A;  1ONG A;  3IF6 C;  4C6Y A;  2OLU A;  4KG6 A;  1SCW A;  3BFG A;  4KZ4 A;  4LCM A;  1YLY A;  2Y4A A;  1O07 A;  3KOD A;  3S1Y A;  2X01 A;  5HAI A;  4JXW A;  3C4P A;  4OPR A;  1YT4 A;  4P87 A;  4KZ5 A;  2QPN A;  5A93 A;  3PAE A;  3BFE A;  2ZC6 B;  3GQZ A;  5CHU A;  5GLC A;  3MFD A;  4GNU A;  1ES2 A;  4N92 A;  3UPN A;  4PM7 A;  2WGW A;  3GV9 A;  1CI8 A;  4S2N C;  2G2U A;  3LCE A;  2EX2 A;  4YIN A;  5EOE A;  1KE0 A;  3WS4 A;  4NBI A;  2P9V B;  4FD8 A;  4WMC D;  4C75 A;  3ZG7 B;  4CJN A;  2WGI A;  3BYD A;  4MEZ A;  3KOC A;  3BLS A;  1KGE A;  1VM1 A;  4OQI A;  4QU3 A;  2H0T A;  1K25 A;  3HVF A;  1LHY A;  4BLM A;  1K54 A;  5KMW A;  1IYO A;  3HLB A;  3MKF A;  1PI5 A;  1E3U D;  2P74 A;  3O87 A;  4DRT A;  1LI0 A;  1KDS A;  3C4O A;  1W8Q A;  2WAD A;  1JKE A;  5AQA A;  4HBU A;  2HKZ A;  1ESU A;  4GKU A;  4RA7 A;  1KE3 A;  4B4Z A;  1XGI A;  4KZ8 A;  2XH9 A;  1N4O A;  4NK3 A;  3ZG5 A;  1BLP A;  1PWG A;  1E25 A;  4KG2 A;  2ZLY A;  2ZC3 B;  4LEN A;  4OQH A;  2CC1 A;  3N4I A;  1Y2Q A;  5M19 A;  3PBT A;  2ZJ9 A;  4DDY A;  3PD4 A;  1KGF A;  3FV7 A;  4JXV A;  1QMF A;  2P9V A;  2DRW A;  4KEN B;  3DWZ A;  1PW1 A;  2Y2H A;  2DBO A;  1YLW A;  3AGD A;  4WEJ A;  2H0Y A;  4BD1 A;  5GHZ A;  4JF4 A;  2Y59 A;  2Z2M B;  4HEF A;  5DF7 A;  2XFT A;  4GD6 A;  2HDS A;  1TDL A;  3IXD A;  4E3M A;  3KO3 A;  5F1F A;  3MBZ A;  4WEK A;  4LCL A;  2HL1 A;  1M40 A;  3ZNT A;  5FAS A;  5TGF A;  4BD0 A;  4ZJ2 A;  3NC8 A;  3SS4 A;  1K6R A;  3MXS A;  1XGJ A;  4QY5 A;  4WZ5 A;  3MXR A;  3SH7 A;  5FQ9 A;  3NDG A;  4KQO A;  5FQI A;  5G18 A;  5CXW A;  3Q7V A;  5CGS A;  5E2G A;  5GLD A;  3IWQ A;  3BEB A;  3PBN A;  4RRJ A;  2Y2N A;  3IXH A;  5FDH A;  4S03 A;  2HL0 A;  2XR0 A;  4N9K A;  5EUA A;  4MBH A;  1K56 D;  5HAR A;  1MPL A;  4S2K A;  3DWK A;  2IWD A;  2UWX A;  2XD5 A;  4X68 A;  1W5D A;  3V3R A;  4E6X A;  1J7G A;  4GOG A;  1ERQ A;  4MLL A;  4BL2 A;  1KGG A;  1HTZ A;  3MKE A;  3LEZ A;  1DJC A;  5CEB A;  1LLB A;  5CTN A;  1ZKJ A;  3O88 A;  4RR6 A;  3FYZ A;  4LV2 A;  4DXB A;  5CED A;  1ONH A;  3LMU A;  1E4D A;  4U0T A;  1L2S A;  2WYX A;  1CK3 A;  1H8Z A;  2E8I A;  3BLM A;  4X53 A;  5D3O A;  1PI4 A;  3ZG8 B;  4F94 A;  1JVJ A;  5KZH A;  4XXR A;  3ZG0 A;  4KZ7 A;  4OPZ A;  5E2H A;  4X56 A;  2ZQ9 A;  3PBS A;  3RXW A;  3S22 A;  1K6S A;  4RYE A;  4Y0O A;  5DTS A;  3G2Z A;  5GL9 A;  3SH8 A;  4NET A;  4XUX A;  2H5S A;  1IYS A;  2XQZ A;  2V20 A;  3UDF A;  4RRL A;  1KDW A;  4FSF A;  1K54 C;  5FQJ A;  4E3O A;  3A3F A;  1IEL A;  2XGN A;  1QME A;  2I72 A;  4HES A;  4S2L A;  5F82 A;  5HAQ A;  1SDE A;  5FI6 A;  1XXM A;  2EX6 A;  4ZJ3 A;  3ZNY A;  5A90 A;  3N8L A;  4Z9Q A;  3CMZ A;  5HW3 A;  5KSC A;  3G30 A;  4MBK A;  3UPO A;  4E3I A;  2V1Z A;  4UA7 A;  5GLA A;  1O7E A;  1IEM A;  4JF5 A;  2EFX A;  4RRB A;  1CI9 A;  3VP2 A;  4DDS A;  5I94 A;  4OP5 A;  4RR9 A;  4FH2 A;  2DCF A;  3KNF A;  5EPH A;  1IYP A;  4GZB A;  3KNP A;  1JTD A;  5DF9 A;  1SKF A;  2BG1 A;  3GVB A;  4M3K A;  5EVL A;  1MWS A;  4OPQ A;  1BUL A;  1FR1 A;  5FAO A;  4RRF A;  3PTE A;  1DJB A;  2HL2 A;  3IHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...