2EXLA

Grp94 n-terminal domain bound to geldanamycin
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
229
structure length
206
Chain Sequence
KSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIASTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Different poses for ligand and chaperone in inhibitor-bound Hsp90 and GRP94: implications for paralog-specific drug design.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
molecule keywords Endoplasmin
total genus 63
structure length 206
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2exlA00
4I5SA 4JQLA 2WI1A 3OMUA 1B62A 3GIFA 2YE4A 2XCMA 3Q5JA 4LWFA 3EKOA 1ZW9A 2QG2A 4U93A 4WUBA 4PRXA 3TTZA 2YI5A 2FYPA 2YEGA 4B6CA 5J71A 1B63A 2IWXA 1UYMA 3EHFA 1UYFA 3ZKDA 1BKNA 3B25A 2BYIA 3GIGA 3DGEA 3FT8A 2YK2A 3H4LA 1NHHA 4WUDA 2Q8HA 4X9LA 2ZDYA 1AH6A 4BIUA 3OWDA 1S14A 3A0YA 3IEDA 2WI6A 3B28A 2QFOA 2CCSA 2BREA 5J6AA 1Y8PA 5CPHA 3U67A 3HEKA 3QTFA 4YKQA 4GEEA 4GGLA 1Z5BA 4U7NA 1YC4A 3CGYA 4E00A 1QYEA 1TIDA 2YKEA 4CE1A 1Z5AA 2YI0A 4GCZA 1U0ZA 4O0BA 4L93A 2Q8FA 3K99A 3INXA 4R3MA 2FWZA 5D7RA 5BODA 4AWOA 4HY1A 3T0ZA 2CCTA 1PVGA 4URLA 2XX2A 2ZKJA 1US7A 3HYZA 1L0OA 3CWVA 3EHHA 3PEHA 3WQ9A 4HXZA 1AH8A 5M4EA 4HZ5A 4ASAA 2YK9A 1R62A 3LPSA 5D7CA 1I5CA 4MPEA 4L91A 4AWPA 3HZ5A 3HZ1A 3HHUA 3VHDA 2YE5A 4EM7A 4XCLA 1ZXMA 4YKRA 1UY8A 2CGFA 4O05A 1TILA 2YKJA 4BAEA 5CF0A 2FXSA 4H85A 1GKXA 1UY7A 3ZM7A 1UYEA 3WHAA 3C0EA 3Q5KA 3H80A 3OW6A 4MP7A 2BU8A 4XITA 3R92A 2YEBA 1UYDA 2JJCA 4BIZA 1BXDA 1I59A 5IDJA 5CTWA 4MPNA 1GKZA 2CCUA 4ZKIA 4P8OA 2ZBKB 5M4NA 2WI5A 2YJWA 1UY9A 5IDMA 4HYPA 1UY6A 1MU5A 2IWSA 2XJGA 3SL2A 2XK2A 2YEFA 3TUHA 1ID0A 1I5AA 1QY8A 5CTYA 2XDLA 4O07A 2HG1A 3EKRA 1B3QA 3BM9A 3C11A 3K60A 2WI3A 2YGEA 3O0IA 2VWCA 1YC1A 2YEAA 1BGQA 2VCIA 4MBCA 2WI7A 2YEEA 1YT1A 3O2FA 1UYKA 4XIPA 1EA6A 5FNCA 4UROA 1AMWA 4NH7A 4GT8A 2VW5A 4WUCA 2XJJA 3TZ2A 5D6QA 2BT0A 4KP4A 2YJXA 2O1VA 3JZ3A 4MPCA 4FPPA 2XHXA 2WERA 4MB9A 4AS9A 4ASBA 2WEPA 4B7PA 1Y8OA 2GFDA 4LWIA 2BRCA 2O1UA 4AWQA 1THNA 1A4HA 2YE9A 4PL9A 2K5BA 4Q20A 3T0HA 4HY6A 2AKPA 3EHGA 2IOQA 4MP2A 3NMQA 3A0XA 5C93A 4MOTA 2VCJA 4CE3A 5M4PA 4DUHA 2YE7A 2YECA 3HYYA 1I5BA 2BYHA 4W7TA 4ASGA 2XHRA 3GIEA 3R4MA 4L90A 2CH4A 4FCQA 4YKTA 2H8MA 2WI2A 3R4NA 2H55A 2EXLA 3EHJA 3TZ4A 4CWNA 1YT2A 4CWSA 4BQJA 3BMYA 3A0RA 2XDUA 2BU2A 1TC6A 4FCPA 4XKKA 3RLQA 4NH9A 2HKJA 3TZ5A 4URMA 1JM6A 4QPJA 3K98A 4KFGA 4KQVA 1NHIA 2WEQA 2PNRA 2XD6A 4O09A 4YKZA 5M4KA 2XABA 1UYHA 3OPDA 4CWQA 3A0WA 4XIRA 4XDMA 3R4OA 1U2OA 4L8ZA 2YEIA 4LPBA 2YGAA 2XX4A 4CWPA 4NH8A 1Z5CA 3T10A 3G7BA 4CE2A 4XD8A 2YE3A 2CG9A 4PU9A 4LWHA 2XDXA 2YEDA 4E02A 3MNRP 3PEJA 1H7UA 3O6OA 2QG0A 2JKIA 2IOPA 4EGHA 4L94A 4R3AA 4EFTA 2C2AA 1Y4UA 1S16A 1YSZA 3VHCA 3CRKA 4FCRA 3OWBA 4YKUA 4YKWA 2FWYA 5IN9A 5D6PA 1YERA 4EEHA 2ZDXA 4CWRA 4V25A 4H7QA 1I5DA 4URNA 1I58A 1GJVA 2HCHA 3QDDA 3D0BA 4XKOA 1YSRA 3A0TA 1H7SA 4K4OA 1YT0A 4GQTA 3LNUA 5L3JA 2BTZA 3U2KA 4ASFA 3VADA 2BU7A 2BSMA 3R4PA 1UYIA 2ESAA 2GQPA 2YGFA 3INWA 4HZ0A 3RKZA 5CTXA 4HYMA 5FNFA 1TH8A 4KSHA 4YKXA 5D7DA 4XCJA 3FV5A 4KSGA 4CWFA 3B24A 3RLRA 4O04A 2BU6A 5CTUA 1KZNA 2YEJA 2YE6A 4JASA 3RLPA 5BOCA 5M4HA 2BU5A 2YI6A 3KE6A 5F3KA 2YI7A 2UWDA 3B27A 2YKIA 1YC3A 4R1FA 4I3HA 4EFUA 4XIQA 3ZKBA 2YEHA 1AM1A 3T1KA 2WI4A 3FT5A 3GIGB 4YKYA 5M4MA 4EGIA 1UYCA 1TBWA 4EMVA 3VHAA 4V26A 2E0AA 1EI1A 4LWGA 2XDSA 4BQGA 4BXIA 1Y8NA 4CWOA 2Q2EB 2IWUA 1ZXNA 3B26A 4XTJA 3U2DA 1KIJA 4EGKA 1QZRA 3D2RA 1Y4SA 2BZ5A 4DZYA 1UYLA 4H81A 5FWKA 2YE2A 2O1WA 4ZVIA 2Q8GA 3D36A 1YESA 4XKAA 4JAVA 1MX0A 4HXWA 1ZWHA 3A0ZA 4P7AA 1UYGA 1YETA 3G7EA 3CGZA 4XC0A 5F5RA 4LP0A 4JAUA 3T2SA 5FNDA 2Q8IA 2XX5A 4KTNA 2IORA 4PRVA 4LWEA 3Q5LA 1TC0A 3TZ0A 3R91A 2YE8A 2XJXA 1OSFA 4E01A 1Z59A 2YKCA 3ZXQA 2QF6A 2XHTA 3K97A 2XDKA 4CWTA 4FMTA 3CRLA 1NHJA 1YS3A 2YKBA 4XE2A 3ZXOA 3G75A 4U7OA 4GFNA 1AJ6A 5GGZA 4QPKA 1BYQA
chains in the Genus database with same CATH superfamily
4I5SA 4JQLA 2WI1A 3OMUA 1B62A 3GIFA 2YE4A 2XCMA 3Q5JA 4LWFA 3EKOA 1ZW9A 2QG2A 4U93A 4WUBA 4PRXA 3TTZA 2YI5A 2FYPA 2YEGA 4B6CA 5J71A 1B63A 2IWXA 1UYMA 3EHFA 1UYFA 3ZKDA 1BKNA 3B25A 2BYIA 3GIGA 3DGEA 3FT8A 2YK2A 3H4LA 1NHHA 4WUDA 2Q8HA 4X9LA 2ZDYA 1AH6A 4BIUA 3OWDA 1S14A 3A0YA 3IEDA 2WI6A 3B28A 2QFOA 2CCSA 2BREA 4E72A 2HHIA 5J6AA 1Y8PA 5CPHA 3U67A 3HEKA 3QTFA 4YKQA 4GEEA 3S5TA 4GGLA 1Z5BA 4U7NA 1YC4A 3CGYA 4E00A 1QYEA 1TIDA 2YKEA 4CE1A 1Z5AA 2YI0A 4GCZA 1U0ZA 4O0BA 4L93A 2Q8FA 3K99A 3INXA 4R3MA 2FWZA 5D7RA 5BODA 4AWOA 4HY1A 3T0ZA 2CCTA 1PVGA 4URLA 2XX2A 2ZKJA 1US7A 3HYZA 1L0OA 3CWVA 2C1IA 3EHHA 3PEHA 4HXZA 3WQ9A 1AH8A 5M4EA 4HZ5A 4ASAA 2YK9A 1R62A 3LPSA 5D7CA 1I5CA 4MPEA 4L91A 4AWPA 3HZ5A 3HZ1A 3HHUA 3VHDA 2YE5A 4EM7A 4XCLA 1ZXMA 4YKRA 1UY8A 2CGFA 4O05A 1TILA 2YKJA 4BAEA 5CF0A 2FXSA 4H85A 1GKXA 1UY7A 3ZM7A 1UYEA 3WHAA 3C0EA 3Q5KA 3H80A 3OW6A 4MP7A 2BU8A 4XITA 3R92A 2YEBA 1UYDA 2JJCA 4BIZA 1BXDA 1I59A 5IDJA 5CTWA 4MPNA 1GKZA 2CCUA 4ZKIA 4P8OA 2ZBKB 5M4NA 2WI5A 2YJWA 1UY9A 5IDMA 4HYPA 1UY6A 1MU5A 2IWSA 2XJGA 3SL2A 2XK2A 2YEFA 3TUHA 1ID0A 1I5AA 1QY8A 5CTYA 2XDLA 4O07A 2HG1A 3EKRA 1B3QA 3BM9A 3C11A 3K60A 2WI3A 2YGEA 3O0IA 2VWCA 1YC1A 2YEAA 1BGQA 2VCIA 4MBCA 2WI7A 2YEEA 1YT1A 3O2FA 1UYKA 4XIPA 1EA6A 5FNCA 4UROA 1AMWA 4NH7A 4GT8A 2VW5A 4WUCA 2XJJA 3TZ2A 5D6QA 2BT0A 4KP4A 2YJXA 2O1VA 3JZ3A 4MPCA 4FPPA 2XHXA 2WERA 4MB9A 4AS9A 4ASBA 2WEPA 4B7PA 1Y8OA 2GFDA 4LWIA 2BRCA 2O1UA 4AWQA 1THNA 1A4HA 2YE9A 4PL9A 2K5BA 4Q20A 3T0HA 4HY6A 2AKPA 3EHGA 2IOQA 4MP2A 3NMQA 3A0XA 5C93A 4MOTA 2C1GA 2VCJA 4CE3A 5M4PA 4DUHA 2YE7A 2YECA 3HYYA 1I5BA 2BYHA 4W7TA 4ASGA 2XHRA 3GIEA 3R4MA 4L90A 2CH4A 4FCQA 4YKTA 2H8MA 2WI2A 3R4NA 5JENA 2H55A 2EXLA 3EHJA 3TZ4A 4CWNA 1YT2A 4CWSA 4BQJA 3BMYA 3A0RA 2XDUA 2BU2A 1TC6A 4FCPA 4XKKA 3RLQA 4NH9A 2HKJA 3TZ5A 4URMA 1JM6A 4QPJA 3K98A 4KFGA 4KQVA 1NHIA 2WEQA 2PNRA 2XD6A 4O09A 4YKZA 5M4KA 2XABA 1UYHA 3OPDA 4CWQA 3A0WA 4XIRA 1F51A 4XDMA 3R4OA 1U2OA 4L8ZA 2YEIA 4LPBA 2YGAA 2XX4A 4CWPA 4NH8A 1Z5CA 3T10A 3G7BA 4CE2A 4XD8A 2YE3A 2CG9A 4PU9A 2FTKA 4LWHA 2XDXA 2YEDA 4E02A 3MNRP 3PEJA 1H7UA 3O6OA 2QG0A 2JKIA 2IOPA 4EGHA 4L94A 4R3AA 4EFTA 2C2AA 1Y4UA 1S16A 1YSZA 3VHCA 3CRKA 4FCRA 3OWBA 4YKUA 4YKWA 2FWYA 5IN9A 5D6PA 1YERA 4EEHA 2ZDXA 4CWRA 4V25A 4H7QA 1I5DA 4URNA 1I58A 1GJVA 3CYGA 2HCHA 3QDDA 3D0BA 4XKOA 1YSRA 3A0TA 1H7SA 4K4OA 1YT0A 4GQTA 3LNUA 5L3JA 2BTZA 3U2KA 4ASFA 3VADA 2BU7A 2BSMA 3R4PA 1UYIA 4HZ0A 2ESAA 1IXMA 2GQPA 2YGFA 3INWA 3RKZA 5CTXA 4HYMA 5FNFA 1TH8A 4KSHA 4YKXA 5D7DA 4XCJA 3FV5A 4KSGA 4CWFA 3B24A 3RLRA 4O04A 2BU6A 5CTUA 1KZNA 2YEJA 2YE6A 4JASA 3RLPA 5BOCA 5M4HA 2BU5A 2YI6A 3KE6A 5F3KA 2YI7A 2UWDA 3B27A 2YKIA 1YC3A 4R1FA 4I3HA 4EFUA 4XIQA 3ZKBA 2YEHA 1AM1A 3T1KA 2WI4A 3FT5A 3GIGB 4YKYA 5M4MA 4EGIA 1UYCA 1TBWA 4EMVA 3VHAA 4V26A 2E0AA 1EI1A 4LWGA 2XDSA 4BQGA 4BXIA 1Y8NA 4CWOA 2Q2EB 2IWUA 1ZXNA 3B26A 4XTJA 3U2DA 1KIJA 4EGKA 1QZRA 3D2RA 1Y4SA 2BZ5A 4DZYA 1UYLA 4H81A 5FWKA 2YE2A 2O1WA 4ZVIA 2Q8GA 3D36A 1YESA 4XKAA 4JAVA 1MX0A 4HXWA 1ZWHA 3A0ZA 4P7AA 1UYGA 1YETA 3G7EA 3CGZA 4XC0A 5F5RA 3LMMA 4LP0A 4JAUA 3T2SA 5FNDA 2Q8IA 2XX5A 4KTNA 2IORA 4PRVA 4LWEA 3Q5LA 1TC0A 3TZ0A 3R91A 2YE8A 2XJXA 1OSFA 4E01A 1Z59A 2YKCA 3ZXQA 2QF6A 2XHTA 3K97A 2XDKA 4CWTA 4FMTA 3CRLA 1NHJA 1YS3A 2YKBA 4XE2A 3ZXOA 3G75A 4U7OA 4GFNA 1AJ6A 5GGZA 4QPKA 1BYQA
chains in the Genus database with same CATH topology
4I5SA 4JQLA 2WI1A 3OMUA 1B62A 3GIFA 2YE4A 2XCMA 3Q5JA 4LWFA 3EKOA 1ZW9A 2QG2A 4U93A 4WUBA 4PRXA 3TTZA 2YI5A 2FYPA 2YEGA 4B6CA 5J71A 1B63A 2IWXA 1UYMA 3EHFA 1UYFA 3ZKDA 1BKNA 3B25A 2BYIA 3GIGA 3DGEA 3FT8A 2YK2A 3H4LA 1NHHA 4WUDA 2Q8HA 4X9LA 2ZDYA 1AH6A 4BIUA 3OWDA 1S14A 3A0YA 3IEDA 2WI6A 3B28A 2QFOA 2CCSA 2BREA 5J6AA 1Y8PA 5CPHA 3U67A 3HEKA 3QTFA 4YKQA 4GEEA 4GGLA 1Z5BA 4U7NA 1YC4A 3CGYA 4E00A 1QYEA 1TIDA 2YKEA 4CE1A 1Z5AA 2YI0A 4GCZA 1U0ZA 4O0BA 4L93A 2Q8FA 3K99A 3INXA 4R3MA 2FWZA 5D7RA 5BODA 4AWOA 4HY1A 3T0ZA 2CCTA 1PVGA 4URLA 2XX2A 2ZKJA 1US7A 3HYZA 1L0OA 3CWVA 3EHHA 3PEHA 3WQ9A 4HXZA 1AH8A 5M4EA 4HZ5A 4ASAA 2YK9A 1R62A 3LPSA 5D7CA 1I5CA 4MPEA 4L91A 4AWPA 3HZ5A 3HZ1A 3HHUA 3VHDA 2YE5A 4EM7A 4XCLA 1ZXMA 4YKRA 1UY8A 2CGFA 4O05A 1TILA 2YKJA 4BAEA 5CF0A 2FXSA 4H85A 1GKXA 1UY7A 3ZM7A 1UYEA 3WHAA 3C0EA 3Q5KA 3H80A 3OW6A 4MP7A 2BU8A 4XITA 3R92A 2YEBA 1UYDA 2JJCA 4BIZA 1BXDA 1I59A 5IDJA 5CTWA 4MPNA 1GKZA 2CCUA 4ZKIA 4P8OA 2ZBKB 5M4NA 2WI5A 2YJWA 1UY9A 5IDMA 4HYPA 1UY6A 1MU5A 2IWSA 2XJGA 3SL2A 2XK2A 2YEFA 3TUHA 1ID0A 1I5AA 1QY8A 5CTYA 2XDLA 4O07A 2HG1A 3EKRA 1B3QA 3BM9A 3C11A 3K60A 2WI3A 2YGEA 3O0IA 2VWCA 1YC1A 2YEAA 1BGQA 2VCIA 4MBCA 2WI7A 2YEEA 1YT1A 3O2FA 1UYKA 4XIPA 1EA6A 5FNCA 4UROA 1AMWA 4NH7A 4GT8A 2VW5A 4WUCA 2XJJA 3TZ2A 5D6QA 2BT0A 4KP4A 2YJXA 2O1VA 3JZ3A 4MPCA 4FPPA 2XHXA 2WERA 4MB9A 4AS9A 4ASBA 2WEPA 4B7PA 1Y8OA 2GFDA 4LWIA 2BRCA 2O1UA 4AWQA 1THNA 1A4HA 2YE9A 4PL9A 2K5BA 4Q20A 3T0HA 4HY6A 2AKPA 3EHGA 2IOQA 4MP2A 3NMQA 3A0XA 5C93A 4MOTA 2VCJA 4CE3A 5M4PA 4DUHA 2YE7A 2YECA 3HYYA 1I5BA 2BYHA 4W7TA 4ASGA 2XHRA 3GIEA 3R4MA 4L90A 2CH4A 4FCQA 4YKTA 2H8MA 2WI2A 3R4NA 2H55A 2EXLA 3EHJA 3TZ4A 4CWNA 1YT2A 4CWSA 4BQJA 3BMYA 3A0RA 2XDUA 2BU2A 1TC6A 4FCPA 4XKKA 3RLQA 4NH9A 2HKJA 3TZ5A 4URMA 1JM6A 4QPJA 3K98A 4KFGA 4KQVA 1NHIA 2WEQA 2PNRA 2XD6A 4O09A 4YKZA 5M4KA 2XABA 1UYHA 3OPDA 4CWQA 3A0WA 4XIRA 4XDMA 3R4OA 1U2OA 4L8ZA 2YEIA 4LPBA 2YGAA 2XX4A 4CWPA 4NH8A 1Z5CA 3T10A 3G7BA 4CE2A 4XD8A 2YE3A 2CG9A 4PU9A 4LWHA 2XDXA 2YEDA 4E02A 3MNRP 3PEJA 1H7UA 3O6OA 2QG0A 2JKIA 2IOPA 4EGHA 4L94A 4R3AA 4EFTA 2C2AA 1Y4UA 1S16A 1YSZA 3VHCA 3CRKA 4FCRA 3OWBA 4YKUA 4YKWA 2FWYA 5IN9A 5D6PA 1YERA 4EEHA 2ZDXA 4CWRA 4V25A 4H7QA 1I5DA 4URNA 1I58A 1GJVA 2HCHA 3QDDA 3D0BA 4XKOA 1YSRA 3A0TA 1H7SA 4K4OA 1YT0A 4GQTA 3LNUA 5L3JA 2BTZA 3U2KA 4ASFA 3VADA 2BU7A 2BSMA 3R4PA 1UYIA 2ESAA 2GQPA 2YGFA 3INWA 4HZ0A 3RKZA 5CTXA 4HYMA 5FNFA 1TH8A 4KSHA 4YKXA 5D7DA 4XCJA 3FV5A 4KSGA 4CWFA 3B24A 3RLRA 4O04A 2BU6A 5CTUA 1KZNA 2YEJA 2YE6A 4JASA 3RLPA 5BOCA 5M4HA 2BU5A 2YI6A 3KE6A 5F3KA 2YI7A 2UWDA 3B27A 2YKIA 1YC3A 4R1FA 4I3HA 4EFUA 4XIQA 3ZKBA 2YEHA 1AM1A 3T1KA 2WI4A 3FT5A 3GIGB 4YKYA 5M4MA 4EGIA 1UYCA 1TBWA 4EMVA 3VHAA 4V26A 2E0AA 1EI1A 4LWGA 2XDSA 4BQGA 4BXIA 1Y8NA 4CWOA 2Q2EB 2IWUA 1ZXNA 3B26A 4XTJA 3U2DA 1KIJA 4EGKA 1QZRA 3D2RA 1Y4SA 2BZ5A 4DZYA 1UYLA 4H81A 5FWKA 2YE2A 2O1WA 4ZVIA 2Q8GA 3D36A 1YESA 4XKAA 4JAVA 1MX0A 4HXWA 1ZWHA 3A0ZA 4P7AA 1UYGA 1YETA 3G7EA 3CGZA 4XC0A 5F5RA 4LP0A 4JAUA 3T2SA 5FNDA 2Q8IA 2XX5A 4KTNA 2IORA 4PRVA 4LWEA 3Q5LA 1TC0A 3TZ0A 3R91A 2YE8A 2XJXA 1OSFA 4E01A 1Z59A 2YKCA 3ZXQA 2QF6A 2XHTA 3K97A 2XDKA 4CWTA 4FMTA 3CRLA 1NHJA 1YS3A 2YKBA 4XE2A 3ZXOA 3G75A 4U7OA 4GFNA 1AJ6A 5GGZA 4QPKA 1BYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5S A;  4JQL A;  2WI1 A;  3OMU A;  1B62 A;  3GIF A;  2YE4 A;  2XCM A;  3Q5J A;  4LWF A;  3EKO A;  1ZW9 A;  2QG2 A;  4U93 A;  4WUB A;  4PRX A;  3TTZ A;  2YI5 A;  2FYP A;  2YEG A;  4B6C A;  5J71 A;  1B63 A;  2IWX A;  1UYM A;  3EHF A;  1UYF A;  3ZKD A;  1BKN A;  3B25 A;  2BYI A;  3GIG A;  3DGE A;  3FT8 A;  2YK2 A;  3H4L A;  1NHH A;  4WUD A;  2Q8H A;  4X9L A;  2ZDY A;  1AH6 A;  4BIU A;  3OWD A;  1S14 A;  3A0Y A;  3IED A;  2WI6 A;  3B28 A;  2QFO A;  2CCS A;  2BRE A;  5J6A A;  1Y8P A;  5CPH A;  3U67 A;  3HEK A;  3QTF A;  4YKQ A;  4GEE A;  4GGL A;  1Z5B A;  4U7N A;  1YC4 A;  3CGY A;  4E00 A;  1QYE A;  1TID A;  2YKE A;  4CE1 A;  1Z5A A;  2YI0 A;  4GCZ A;  1U0Z A;  4O0B A;  4L93 A;  2Q8F A;  3K99 A;  3INX A;  4R3M A;  2FWZ A;  5D7R A;  5BOD A;  4AWO A;  4HY1 A;  3T0Z A;  2CCT A;  1PVG A;  4URL A;  2XX2 A;  2ZKJ A;  1US7 A;  3HYZ A;  1L0O A;  3CWV A;  3EHH A;  3PEH A;  3WQ9 A;  4HXZ A;  1AH8 A;  5M4E A;  4HZ5 A;  4ASA A;  2YK9 A;  1R62 A;  3LPS A;  5D7C A;  1I5C A;  4MPE A;  4L91 A;  4AWP A;  3HZ5 A;  3HZ1 A;  3HHU A;  3VHD A;  2YE5 A;  4EM7 A;  4XCL A;  1ZXM A;  4YKR A;  1UY8 A;  2CGF A;  4O05 A;  1TIL A;  2YKJ A;  4BAE A;  5CF0 A;  2FXS A;  4H85 A;  1GKX A;  1UY7 A;  3ZM7 A;  1UYE A;  3WHA A;  3C0E A;  3Q5K A;  3H80 A;  3OW6 A;  4MP7 A;  2BU8 A;  4XIT A;  3R92 A;  2YEB A;  1UYD A;  2JJC A;  4BIZ A;  1BXD A;  1I59 A;  5IDJ A;  5CTW A;  4MPN A;  1GKZ A;  2CCU A;  4ZKI A;  4P8O A;  2ZBK B;  5M4N A;  2WI5 A;  2YJW A;  1UY9 A;  5IDM A;  4HYP A;  1UY6 A;  1MU5 A;  2IWS A;  2XJG A;  3SL2 A;  2XK2 A;  2YEF A;  3TUH A;  1ID0 A;  1I5A A;  1QY8 A;  5CTY A;  2XDL A;  4O07 A;  2HG1 A;  3EKR A;  1B3Q A;  3BM9 A;  3C11 A;  3K60 A;  2WI3 A;  2YGE A;  3O0I A;  2VWC A;  1YC1 A;  2YEA A;  1BGQ A;  2VCI A;  4MBC A;  2WI7 A;  2YEE A;  1YT1 A;  3O2F A;  1UYK A;  4XIP A;  1EA6 A;  5FNC A;  4URO A;  1AMW A;  4NH7 A;  4GT8 A;  2VW5 A;  4WUC A;  2XJJ A;  3TZ2 A;  5D6Q A;  2BT0 A;  4KP4 A;  2YJX A;  2O1V A;  3JZ3 A;  4MPC A;  4FPP A;  2XHX A;  2WER A;  4MB9 A;  4AS9 A;  4ASB A;  2WEP A;  4B7P A;  1Y8O A;  2GFD A;  4LWI A;  2BRC A;  2O1U A;  4AWQ A;  1THN A;  1A4H A;  2YE9 A;  4PL9 A;  2K5B A;  4Q20 A;  3T0H A;  4HY6 A;  2AKP A;  3EHG A;  2IOQ A;  4MP2 A;  3NMQ A;  3A0X A;  5C93 A;  4MOT A;  2VCJ A;  4CE3 A;  5M4P A;  4DUH A;  2YE7 A;  2YEC A;  3HYY A;  1I5B A;  2BYH A;  4W7T A;  4ASG A;  2XHR A;  3GIE A;  3R4M A;  4L90 A;  2CH4 A;  4FCQ A;  4YKT A;  2H8M A;  2WI2 A;  3R4N A;  2H55 A;  2EXL A;  3EHJ A;  3TZ4 A;  4CWN A;  1YT2 A;  4CWS A;  4BQJ A;  3BMY A;  3A0R A;  2XDU A;  2BU2 A;  1TC6 A;  4FCP A;  4XKK A;  3RLQ A;  4NH9 A;  2HKJ A;  3TZ5 A;  4URM A;  1JM6 A;  4QPJ A;  3K98 A;  4KFG A;  4KQV A;  1NHI A;  2WEQ A;  2PNR A;  2XD6 A;  4O09 A;  4YKZ A;  5M4K A;  2XAB A;  1UYH A;  3OPD A;  4CWQ A;  3A0W A;  4XIR A;  4XDM A;  3R4O A;  1U2O A;  4L8Z A;  2YEI A;  4LPB A;  2YGA A;  2XX4 A;  4CWP A;  4NH8 A;  1Z5C A;  3T10 A;  3G7B A;  4CE2 A;  4XD8 A;  2YE3 A;  2CG9 A;  4PU9 A;  4LWH A;  2XDX A;  2YED A;  4E02 A;  3MNR P;  3PEJ A;  1H7U A;  3O6O A;  2QG0 A;  2JKI A;  2IOP A;  4EGH A;  4L94 A;  4R3A A;  4EFT A;  2C2A A;  1Y4U A;  1S16 A;  1YSZ A;  3VHC A;  3CRK A;  4FCR A;  3OWB A;  4YKU A;  4YKW A;  2FWY A;  5IN9 A;  5D6P A;  1YER A;  4EEH A;  2ZDX A;  4CWR A;  4V25 A;  4H7Q A;  1I5D A;  4URN A;  1I58 A;  1GJV A;  2HCH A;  3QDD A;  3D0B A;  4XKO A;  1YSR A;  3A0T A;  1H7S A;  4K4O A;  1YT0 A;  4GQT A;  3LNU A;  5L3J A;  2BTZ A;  3U2K A;  4ASF A;  3VAD A;  2BU7 A;  2BSM A;  3R4P A;  1UYI A;  2ESA A;  2GQP A;  2YGF A;  3INW A;  4HZ0 A;  3RKZ A;  5CTX A;  4HYM A;  5FNF A;  1TH8 A;  4KSH A;  4YKX A;  5D7D A;  4XCJ A;  3FV5 A;  4KSG A;  4CWF A;  3B24 A;  3RLR A;  4O04 A;  2BU6 A;  5CTU A;  1KZN A;  2YEJ A;  2YE6 A;  4JAS A;  3RLP A;  5BOC A;  5M4H A;  2BU5 A;  2YI6 A;  3KE6 A;  5F3K A;  2YI7 A;  2UWD A;  3B27 A;  2YKI A;  1YC3 A;  4R1F A;  4I3H A;  4EFU A;  4XIQ A;  3ZKB A;  2YEH A;  1AM1 A;  3T1K A;  2WI4 A;  3FT5 A;  3GIG B;  4YKY A;  5M4M A;  4EGI A;  1UYC A;  1TBW A;  4EMV A;  3VHA A;  4V26 A;  2E0A A;  1EI1 A;  4LWG A;  2XDS A;  4BQG A;  4BXI A;  1Y8N A;  4CWO A;  2Q2E B;  2IWU A;  1ZXN A;  3B26 A;  4XTJ A;  3U2D A;  1KIJ A;  4EGK A;  1QZR A;  3D2R A;  1Y4S A;  2BZ5 A;  4DZY A;  1UYL A;  4H81 A;  5FWK A;  2YE2 A;  2O1W A;  4ZVI A;  2Q8G A;  3D36 A;  1YES A;  4XKA A;  4JAV A;  1MX0 A;  4HXW A;  1ZWH A;  3A0Z A;  4P7A A;  1UYG A;  1YET A;  3G7E A;  3CGZ A;  4XC0 A;  5F5R A;  4LP0 A;  4JAU A;  3T2S A;  5FND A;  2Q8I A;  2XX5 A;  4KTN A;  2IOR A;  4PRV A;  4LWE A;  3Q5L A;  1TC0 A;  3TZ0 A;  3R91 A;  2YE8 A;  2XJX A;  1OSF A;  4E01 A;  1Z59 A;  2YKC A;  3ZXQ A;  2QF6 A;  2XHT A;  3K97 A;  2XDK A;  4CWT A;  4FMT A;  3CRL A;  1NHJ A;  1YS3 A;  2YKB A;  4XE2 A;  3ZXO A;  3G75 A;  4U7O A;  4GFN A;  1AJ6 A;  5GGZ A;  4QPK A;  1BYQ A; 
#chains in the Genus database with same CATH topology
 4I5S A;  4JQL A;  2WI1 A;  3OMU A;  1B62 A;  3GIF A;  2YE4 A;  2XCM A;  3Q5J A;  4LWF A;  3EKO A;  1ZW9 A;  2QG2 A;  4U93 A;  4WUB A;  4PRX A;  3TTZ A;  2YI5 A;  2FYP A;  2YEG A;  4B6C A;  5J71 A;  1B63 A;  2IWX A;  1UYM A;  3EHF A;  1UYF A;  3ZKD A;  1BKN A;  3B25 A;  2BYI A;  3GIG A;  3DGE A;  3FT8 A;  2YK2 A;  3H4L A;  1NHH A;  4WUD A;  2Q8H A;  4X9L A;  2ZDY A;  1AH6 A;  4BIU A;  3OWD A;  1S14 A;  3A0Y A;  3IED A;  2WI6 A;  3B28 A;  2QFO A;  2CCS A;  2BRE A;  4E72 A;  2HHI A;  5J6A A;  1Y8P A;  5CPH A;  3U67 A;  3HEK A;  3QTF A;  4YKQ A;  4GEE A;  3S5T A;  4GGL A;  1Z5B A;  4U7N A;  1YC4 A;  3CGY A;  4E00 A;  1QYE A;  1TID A;  2YKE A;  4CE1 A;  1Z5A A;  2YI0 A;  4GCZ A;  1U0Z A;  4O0B A;  4L93 A;  2Q8F A;  3K99 A;  3INX A;  4R3M A;  2FWZ A;  5D7R A;  5BOD A;  4AWO A;  4HY1 A;  3T0Z A;  2CCT A;  1PVG A;  4URL A;  2XX2 A;  2ZKJ A;  1US7 A;  3HYZ A;  1L0O A;  3CWV A;  2C1I A;  3EHH A;  3PEH A;  4HXZ A;  3WQ9 A;  1AH8 A;  5M4E A;  4HZ5 A;  4ASA A;  2YK9 A;  1R62 A;  3LPS A;  5D7C A;  1I5C A;  4MPE A;  4L91 A;  4AWP A;  3HZ5 A;  3HZ1 A;  3HHU A;  3VHD A;  2YE5 A;  4EM7 A;  4XCL A;  1ZXM A;  4YKR A;  1UY8 A;  2CGF A;  4O05 A;  1TIL A;  2YKJ A;  4BAE A;  5CF0 A;  2FXS A;  4H85 A;  1GKX A;  1UY7 A;  3ZM7 A;  1UYE A;  3WHA A;  3C0E A;  3Q5K A;  3H80 A;  3OW6 A;  4MP7 A;  2BU8 A;  4XIT A;  3R92 A;  2YEB A;  1UYD A;  2JJC A;  4BIZ A;  1BXD A;  1I59 A;  5IDJ A;  5CTW A;  4MPN A;  1GKZ A;  2CCU A;  4ZKI A;  4P8O A;  2ZBK B;  5M4N A;  2WI5 A;  2YJW A;  1UY9 A;  5IDM A;  4HYP A;  1UY6 A;  1MU5 A;  2IWS A;  2XJG A;  3SL2 A;  2XK2 A;  2YEF A;  3TUH A;  1ID0 A;  1I5A A;  1QY8 A;  5CTY A;  2XDL A;  4O07 A;  2HG1 A;  3EKR A;  1B3Q A;  3BM9 A;  3C11 A;  3K60 A;  2WI3 A;  2YGE A;  3O0I A;  2VWC A;  1YC1 A;  2YEA A;  1BGQ A;  2VCI A;  4MBC A;  2WI7 A;  2YEE A;  1YT1 A;  3O2F A;  1UYK A;  4XIP A;  1EA6 A;  5FNC A;  4URO A;  1AMW A;  4NH7 A;  4GT8 A;  2VW5 A;  4WUC A;  2XJJ A;  3TZ2 A;  5D6Q A;  2BT0 A;  4KP4 A;  2YJX A;  2O1V A;  3JZ3 A;  4MPC A;  4FPP A;  2XHX A;  2WER A;  4MB9 A;  4AS9 A;  4ASB A;  2WEP A;  4B7P A;  1Y8O A;  2GFD A;  4LWI A;  2BRC A;  2O1U A;  4AWQ A;  1THN A;  1A4H A;  2YE9 A;  4PL9 A;  2K5B A;  4Q20 A;  3T0H A;  4HY6 A;  2AKP A;  3EHG A;  2IOQ A;  4MP2 A;  3NMQ A;  3A0X A;  5C93 A;  4MOT A;  2C1G A;  2VCJ A;  4CE3 A;  5M4P A;  4DUH A;  2YE7 A;  2YEC A;  3HYY A;  1I5B A;  2BYH A;  4W7T A;  4ASG A;  2XHR A;  3GIE A;  3R4M A;  4L90 A;  2CH4 A;  4FCQ A;  4YKT A;  2H8M A;  2WI2 A;  3R4N A;  5JEN A;  2H55 A;  2EXL A;  3EHJ A;  3TZ4 A;  4CWN A;  1YT2 A;  4CWS A;  4BQJ A;  3BMY A;  3A0R A;  2XDU A;  2BU2 A;  1TC6 A;  4FCP A;  4XKK A;  3RLQ A;  4NH9 A;  2HKJ A;  3TZ5 A;  4URM A;  1JM6 A;  4QPJ A;  3K98 A;  4KFG A;  4KQV A;  1NHI A;  2WEQ A;  2PNR A;  2XD6 A;  4O09 A;  4YKZ A;  5M4K A;  2XAB A;  1UYH A;  3OPD A;  4CWQ A;  3A0W A;  4XIR A;  1F51 A;  4XDM A;  3R4O A;  1U2O A;  4L8Z A;  2YEI A;  4LPB A;  2YGA A;  2XX4 A;  4CWP A;  4NH8 A;  1Z5C A;  3T10 A;  3G7B A;  4CE2 A;  4XD8 A;  2YE3 A;  2CG9 A;  4PU9 A;  2FTK A;  4LWH A;  2XDX A;  2YED A;  4E02 A;  3MNR P;  3PEJ A;  1H7U A;  3O6O A;  2QG0 A;  2JKI A;  2IOP A;  4EGH A;  4L94 A;  4R3A A;  4EFT A;  2C2A A;  1Y4U A;  1S16 A;  1YSZ A;  3VHC A;  3CRK A;  4FCR A;  3OWB A;  4YKU A;  4YKW A;  2FWY A;  5IN9 A;  5D6P A;  1YER A;  4EEH A;  2ZDX A;  4CWR A;  4V25 A;  4H7Q A;  1I5D A;  4URN A;  1I58 A;  1GJV A;  3CYG A;  2HCH A;  3QDD A;  3D0B A;  4XKO A;  1YSR A;  3A0T A;  1H7S A;  4K4O A;  1YT0 A;  4GQT A;  3LNU A;  5L3J A;  2BTZ A;  3U2K A;  4ASF A;  3VAD A;  2BU7 A;  2BSM A;  3R4P A;  1UYI A;  4HZ0 A;  2ESA A;  1IXM A;  2GQP A;  2YGF A;  3INW A;  3RKZ A;  5CTX A;  4HYM A;  5FNF A;  1TH8 A;  4KSH A;  4YKX A;  5D7D A;  4XCJ A;  3FV5 A;  4KSG A;  4CWF A;  3B24 A;  3RLR A;  4O04 A;  2BU6 A;  5CTU A;  1KZN A;  2YEJ A;  2YE6 A;  4JAS A;  3RLP A;  5BOC A;  5M4H A;  2BU5 A;  2YI6 A;  3KE6 A;  5F3K A;  2YI7 A;  2UWD A;  3B27 A;  2YKI A;  1YC3 A;  4R1F A;  4I3H A;  4EFU A;  4XIQ A;  3ZKB A;  2YEH A;  1AM1 A;  3T1K A;  2WI4 A;  3FT5 A;  3GIG B;  4YKY A;  5M4M A;  4EGI A;  1UYC A;  1TBW A;  4EMV A;  3VHA A;  4V26 A;  2E0A A;  1EI1 A;  4LWG A;  2XDS A;  4BQG A;  4BXI A;  1Y8N A;  4CWO A;  2Q2E B;  2IWU A;  1ZXN A;  3B26 A;  4XTJ A;  3U2D A;  1KIJ A;  4EGK A;  1QZR A;  3D2R A;  1Y4S A;  2BZ5 A;  4DZY A;  1UYL A;  4H81 A;  5FWK A;  2YE2 A;  2O1W A;  4ZVI A;  2Q8G A;  3D36 A;  1YES A;  4XKA A;  4JAV A;  1MX0 A;  4HXW A;  1ZWH A;  3A0Z A;  4P7A A;  1UYG A;  1YET A;  3G7E A;  3CGZ A;  4XC0 A;  5F5R A;  3LMM A;  4LP0 A;  4JAU A;  3T2S A;  5FND A;  2Q8I A;  2XX5 A;  4KTN A;  2IOR A;  4PRV A;  4LWE A;  3Q5L A;  1TC0 A;  3TZ0 A;  3R91 A;  2YE8 A;  2XJX A;  1OSF A;  4E01 A;  1Z59 A;  2YKC A;  3ZXQ A;  2QF6 A;  2XHT A;  3K97 A;  2XDK A;  4CWT A;  4FMT A;  3CRL A;  1NHJ A;  1YS3 A;  2YKB A;  4XE2 A;  3ZXO A;  3G75 A;  4U7O A;  4GFN A;  1AJ6 A;  5GGZ A;  4QPK A;  1BYQ A; 
#chains in the Genus database with same CATH homology
 4I5S A;  4JQL A;  2WI1 A;  3OMU A;  1B62 A;  3GIF A;  2YE4 A;  2XCM A;  3Q5J A;  4LWF A;  3EKO A;  1ZW9 A;  2QG2 A;  4U93 A;  4WUB A;  4PRX A;  3TTZ A;  2YI5 A;  2FYP A;  2YEG A;  4B6C A;  5J71 A;  1B63 A;  2IWX A;  1UYM A;  3EHF A;  1UYF A;  3ZKD A;  1BKN A;  3B25 A;  2BYI A;  3GIG A;  3DGE A;  3FT8 A;  2YK2 A;  3H4L A;  1NHH A;  4WUD A;  2Q8H A;  4X9L A;  2ZDY A;  1AH6 A;  4BIU A;  3OWD A;  1S14 A;  3A0Y A;  3IED A;  2WI6 A;  3B28 A;  2QFO A;  2CCS A;  2BRE A;  5J6A A;  1Y8P A;  5CPH A;  3U67 A;  3HEK A;  3QTF A;  4YKQ A;  4GEE A;  4GGL A;  1Z5B A;  4U7N A;  1YC4 A;  3CGY A;  4E00 A;  1QYE A;  1TID A;  2YKE A;  4CE1 A;  1Z5A A;  2YI0 A;  4GCZ A;  1U0Z A;  4O0B A;  4L93 A;  2Q8F A;  3K99 A;  3INX A;  4R3M A;  2FWZ A;  5D7R A;  5BOD A;  4AWO A;  4HY1 A;  3T0Z A;  2CCT A;  1PVG A;  4URL A;  2XX2 A;  2ZKJ A;  1US7 A;  3HYZ A;  1L0O A;  3CWV A;  3EHH A;  3PEH A;  3WQ9 A;  4HXZ A;  1AH8 A;  5M4E A;  4HZ5 A;  4ASA A;  2YK9 A;  1R62 A;  3LPS A;  5D7C A;  1I5C A;  4MPE A;  4L91 A;  4AWP A;  3HZ5 A;  3HZ1 A;  3HHU A;  3VHD A;  2YE5 A;  4EM7 A;  4XCL A;  1ZXM A;  4YKR A;  1UY8 A;  2CGF A;  4O05 A;  1TIL A;  2YKJ A;  4BAE A;  5CF0 A;  2FXS A;  4H85 A;  1GKX A;  1UY7 A;  3ZM7 A;  1UYE A;  3WHA A;  3C0E A;  3Q5K A;  3H80 A;  3OW6 A;  4MP7 A;  2BU8 A;  4XIT A;  3R92 A;  2YEB A;  1UYD A;  2JJC A;  4BIZ A;  1BXD A;  1I59 A;  5IDJ A;  5CTW A;  4MPN A;  1GKZ A;  2CCU A;  4ZKI A;  4P8O A;  2ZBK B;  5M4N A;  2WI5 A;  2YJW A;  1UY9 A;  5IDM A;  4HYP A;  1UY6 A;  1MU5 A;  2IWS A;  2XJG A;  3SL2 A;  2XK2 A;  2YEF A;  3TUH A;  1ID0 A;  1I5A A;  1QY8 A;  5CTY A;  2XDL A;  4O07 A;  2HG1 A;  3EKR A;  1B3Q A;  3BM9 A;  3C11 A;  3K60 A;  2WI3 A;  2YGE A;  3O0I A;  2VWC A;  1YC1 A;  2YEA A;  1BGQ A;  2VCI A;  4MBC A;  2WI7 A;  2YEE A;  1YT1 A;  3O2F A;  1UYK A;  4XIP A;  1EA6 A;  5FNC A;  4URO A;  1AMW A;  4NH7 A;  4GT8 A;  2VW5 A;  4WUC A;  2XJJ A;  3TZ2 A;  5D6Q A;  2BT0 A;  4KP4 A;  2YJX A;  2O1V A;  3JZ3 A;  4MPC A;  4FPP A;  2XHX A;  2WER A;  4MB9 A;  4AS9 A;  4ASB A;  2WEP A;  4B7P A;  1Y8O A;  2GFD A;  4LWI A;  2BRC A;  2O1U A;  4AWQ A;  1THN A;  1A4H A;  2YE9 A;  4PL9 A;  2K5B A;  4Q20 A;  3T0H A;  4HY6 A;  2AKP A;  3EHG A;  2IOQ A;  4MP2 A;  3NMQ A;  3A0X A;  5C93 A;  4MOT A;  2VCJ A;  4CE3 A;  5M4P A;  4DUH A;  2YE7 A;  2YEC A;  3HYY A;  1I5B A;  2BYH A;  4W7T A;  4ASG A;  2XHR A;  3GIE A;  3R4M A;  4L90 A;  2CH4 A;  4FCQ A;  4YKT A;  2H8M A;  2WI2 A;  3R4N A;  2H55 A;  2EXL A;  3EHJ A;  3TZ4 A;  4CWN A;  1YT2 A;  4CWS A;  4BQJ A;  3BMY A;  3A0R A;  2XDU A;  2BU2 A;  1TC6 A;  4FCP A;  4XKK A;  3RLQ A;  4NH9 A;  2HKJ A;  3TZ5 A;  4URM A;  1JM6 A;  4QPJ A;  3K98 A;  4KFG A;  4KQV A;  1NHI A;  2WEQ A;  2PNR A;  2XD6 A;  4O09 A;  4YKZ A;  5M4K A;  2XAB A;  1UYH A;  3OPD A;  4CWQ A;  3A0W A;  4XIR A;  4XDM A;  3R4O A;  1U2O A;  4L8Z A;  2YEI A;  4LPB A;  2YGA A;  2XX4 A;  4CWP A;  4NH8 A;  1Z5C A;  3T10 A;  3G7B A;  4CE2 A;  4XD8 A;  2YE3 A;  2CG9 A;  4PU9 A;  4LWH A;  2XDX A;  2YED A;  4E02 A;  3MNR P;  3PEJ A;  1H7U A;  3O6O A;  2QG0 A;  2JKI A;  2IOP A;  4EGH A;  4L94 A;  4R3A A;  4EFT A;  2C2A A;  1Y4U A;  1S16 A;  1YSZ A;  3VHC A;  3CRK A;  4FCR A;  3OWB A;  4YKU A;  4YKW A;  2FWY A;  5IN9 A;  5D6P A;  1YER A;  4EEH A;  2ZDX A;  4CWR A;  4V25 A;  4H7Q A;  1I5D A;  4URN A;  1I58 A;  1GJV A;  2HCH A;  3QDD A;  3D0B A;  4XKO A;  1YSR A;  3A0T A;  1H7S A;  4K4O A;  1YT0 A;  4GQT A;  3LNU A;  5L3J A;  2BTZ A;  3U2K A;  4ASF A;  3VAD A;  2BU7 A;  2BSM A;  3R4P A;  1UYI A;  2ESA A;  2GQP A;  2YGF A;  3INW A;  4HZ0 A;  3RKZ A;  5CTX A;  4HYM A;  5FNF A;  1TH8 A;  4KSH A;  4YKX A;  5D7D A;  4XCJ A;  3FV5 A;  4KSG A;  4CWF A;  3B24 A;  3RLR A;  4O04 A;  2BU6 A;  5CTU A;  1KZN A;  2YEJ A;  2YE6 A;  4JAS A;  3RLP A;  5BOC A;  5M4H A;  2BU5 A;  2YI6 A;  3KE6 A;  5F3K A;  2YI7 A;  2UWD A;  3B27 A;  2YKI A;  1YC3 A;  4R1F A;  4I3H A;  4EFU A;  4XIQ A;  3ZKB A;  2YEH A;  1AM1 A;  3T1K A;  2WI4 A;  3FT5 A;  3GIG B;  4YKY A;  5M4M A;  4EGI A;  1UYC A;  1TBW A;  4EMV A;  3VHA A;  4V26 A;  2E0A A;  1EI1 A;  4LWG A;  2XDS A;  4BQG A;  4BXI A;  1Y8N A;  4CWO A;  2Q2E B;  2IWU A;  1ZXN A;  3B26 A;  4XTJ A;  3U2D A;  1KIJ A;  4EGK A;  1QZR A;  3D2R A;  1Y4S A;  2BZ5 A;  4DZY A;  1UYL A;  4H81 A;  5FWK A;  2YE2 A;  2O1W A;  4ZVI A;  2Q8G A;  3D36 A;  1YES A;  4XKA A;  4JAV A;  1MX0 A;  4HXW A;  1ZWH A;  3A0Z A;  4P7A A;  1UYG A;  1YET A;  3G7E A;  3CGZ A;  4XC0 A;  5F5R A;  4LP0 A;  4JAU A;  3T2S A;  5FND A;  2Q8I A;  2XX5 A;  4KTN A;  2IOR A;  4PRV A;  4LWE A;  3Q5L A;  1TC0 A;  3TZ0 A;  3R91 A;  2YE8 A;  2XJX A;  1OSF A;  4E01 A;  1Z59 A;  2YKC A;  3ZXQ A;  2QF6 A;  2XHT A;  3K97 A;  2XDK A;  4CWT A;  4FMT A;  3CRL A;  1NHJ A;  1YS3 A;  2YKB A;  4XE2 A;  3ZXO A;  3G75 A;  4U7O A;  4GFN A;  1AJ6 A;  5GGZ A;  4QPK A;  1BYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...