2EXLA

Grp94 n-terminal domain bound to geldanamycin
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
229
structure length
206
Chain Sequence
KSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIASTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Different poses for ligand and chaperone in inhibitor-bound Hsp90 and GRP94: implications for paralog-specific drug design.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
molecule keywords Endoplasmin
total genus 63
structure length 206
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2exlA00
4P8OA 3U2DA 4KSGA 4LWIA 3MNRP 3B25A 4PU9A 3Q5JA 4FCRA 4ZKIA 2WI2A 1AMWA 4XIRA 1U0ZA 5M4NA 4XD8A 1UY9A 4L91A 4XITA 1S14A 4ASAA 4XTJA 1KZNA 3FT5A 2CCUA 1UYFA 4HYPA 4XC0A 3HZ5A 3HZ1A 3CWVA 4GFNA 3ZM7A 4MPEA 2YK2A 3Q5KA 4YKZA 1TH8A 4BIZA 4R3AA 2XX4A 1TC0A 2FWYA 4CWSA 5CPHA 1AH6A 4YKQA 2Q8IA 3QTFA 4LP0A 4CWRA 5FNDA 3TTZA 4NH9A 4I5SA 4LWEA 3K98A 2ZKJA 2BZ5A 4ASFA 2WI1A 1L0OA 1Y8PA 3O0IA 3O6OA 4MPNA 4U7NA 4CWQA 2YI6A 3B24A 3RLRA 2XHXA 1Y4SA 2YEAA 5L3JA 2GQPA 2JKIA 2XABA 2CCSA 2FXSA 1I5BA 4CWNA 3CGZA 1AH8A 4YKXA 1Y4UA 1A4HA 5BOCA 4K4OA 2XDKA 4EFUA 3EKOA 3ZKBA 2H8MA 4KP4A 5IDMA 3HYZA 3Q5LA 3A0XA 2Q8GA 2BU2A 2O1UA 5D7RA 3VHAA 1UYHA 1B63A 1MX0A 1Z5CA 2JJCA 2CG9A 2HKJA 2YE4A 4E02A 2IWXA 2XX5A 3LPSA 4L94A 2CGFA 4YKYA 4P7AA 2VCIA 1Z5BA 2IORA 1S16A 5CTXA 2QFOA 4UROA 3TZ0A 4CE3A 4EMVA 4GEEA 2CCTA 4PRVA 1YETA 5CF0A 5GGZA 3TZ5A 4XCJA 2E0AA 2YGFA 3R92A 3OPDA 4I3HA 3RLQA 2VCJA 4HYMA 4QPKA 1YC1A 4XDMA 5F3KA 2YE6A 4V25A 1QZRA 4FCQA 2PNRA 1BYQA 2BTZA 5D7DA 1UYIA 2XDLA 1AJ6A 1YT1A 4AS9A 2BT0A 3VHDA 1UY7A 2YKEA 2XHTA 1QY8A 1ID0A 4EGIA 4LWHA 1NHJA 1UYDA 4MB9A 5D6QA 3T10A 3U2KA 4KTNA 2IWUA 3H4LA 5D6PA 3T0ZA 2YI7A 3ZXQA 3ZKDA 1NHIA 4BIUA 4WUCA 2O1VA 5F5RA 3EHJA 3B27A 2XJJA 4WUDA 1GKXA 1I5CA 3H80A 3JZ3A 2BYHA 2XD6A 2BREA 2XHRA 2YE7A 4YKTA 1THNA 3QDDA 4BQGA 3OWDA 3ZXOA 3TZ2A 1UY8A 2YE5A 4H85A 2BSMA 2XX2A 3SL2A 3G75A 4BQJA 2YEEA 3R4OA 4FPPA 1EI1A 4Q20A 3GIGA 2O1WA 2VWCA 1UYMA 4XCLA 4XKAA 2YEJA 5M4PA 1TILA 1H7SA 2YEBA 5CTWA 4B6CA 2YEDA 4CWTA 3RKZA 1YSZA 1ZW9A 4AWOA 1EA6A 4BXIA 4O0BA 1ZXMA 2ZDYA 1Y8OA 3RLPA 4JAVA 1BXDA 1UYLA 3DGEA 1B62A 2YJWA 2YKCA 4AWQA 3VHCA 2AKPA 2YGAA 5C93A 2WEPA 2EXLA 2YKIA 3FT8A 1BKNA 2YEHA 4XIQA 3R91A 2YGEA 3HHUA 1R62A 1TIDA 4U7OA 5M4EA 2BU5A 4JQLA 3GIEA 4LWFA 2Q2EB 4YKUA 3TZ4A 3B28A 3EHGA 4QPJA 4LWGA 4XE2A 3B26A 3T0HA 1OSFA 5CTYA 1GKZA 2Q8HA 5FNFA 2VW5A 4NH8A 4CE1A 4DZYA 4HXWA 2WI4A 2WEQA 5M4KA 2QF6A 1UYEA 4O09A 3INXA 2IWSA 1I5AA 4LPBA 2GFDA 2HG1A 2YI5A 3HEKA 1YC3A 3CRLA 1TC6A 2XJXA 3CRKA 4NH7A 3KE6A 4X9LA 2FWZA 1Z5AA 4W7TA 1YC4A 2YE2A 2WI7A 3R4MA 3A0WA 4EGHA 1UYCA 4URLA 4GGLA 2WI6A 1I5DA 4CE2A 1Y8NA 2HCHA 4E00A 2C2AA 2YEGA 3R4PA 1JM6A 2UWDA 3K97A 5BODA 4MBCA 1BGQA 3HYYA 4KQVA 4H7QA 1ZWHA 2CH4A 3PEJA 4HY6A 4DUHA 2WI3A 4FCPA 2QG0A 4O07A 1MU5A 4MP2A 2BYIA 4CWOA 1Z59A 5M4MA 4E01A 1UY6A 3TUHA 4R3MA 2XDUA 4XKKA 2IOQA 5D7CA 4O05A 4XKOA 2YEFA 4EM7A 5M4HA 3BM9A 5FNCA 1AM1A 3C0EA 4L8ZA 3K60A 3T2SA 2QG2A 3O2FA 2XCMA 4GCZA 4H81A 1B3QA 2YECA 2Q8FA 1YERA 5FWKA 3OW6A 3EHFA 4CWPA 3G7EA 2H55A 2ZBKB 3LNUA 5IN9A 4AWPA 2BU6A 4EFTA 1I58A 4HXZA 4KFGA 4EGKA 1UYKA 3EKRA 4R1FA 1QYEA 1YT2A 2YE8A 3OWBA 2XK2A 2ZDXA 4U93A 5CTUA 4L93A 4JAUA 4L90A 4ASGA 3WQ9A 5J6AA 2ESAA 4B7PA 1YT0A 3R4NA 1NHHA 2BU7A 5J71A 2WERA 2YEIA 4WUBA 2FYPA 4ZVIA 4YKRA 3D2RA 3INWA 3PEHA 1YSRA 1KIJA 1H7UA 2XDXA 1GJVA 4GT8A 3EHHA 4JASA 3CGYA 4CWFA 4PL9A 2IOPA 3T1KA 2BU8A 3A0RA 3D36A 2YE3A 2BRCA 3FV5A 2YKBA 3C11A 3U67A 4V26A 4O04A 1YS3A 2XDSA 1TBWA 3A0TA 4GQTA 2YKJA 3NMQA 4EEHA 1U2OA 4KSHA 1PVGA 3K99A 3A0YA 3GIFA 4HZ5A 3G7BA 2XJGA 1US7A 4PRXA 3WHAA 1UYGA 4URMA 2YE9A 4HZ0A 4ASBA 2K5BA 2YI0A 4BAEA 2YK9A 1I59A 4MOTA 3OMUA 4HY1A 3GIGB 3VADA 3A0ZA 4URNA 1YESA 2WI5A 5IDJA 4MP7A 4YKWA 3IEDA 4MPCA 3BMYA 1ZXNA 4FMTA 4XIPA 3D0BA 2YJXA
chains in the Genus database with same CATH superfamily
4P8OA 3U2DA 4KSGA 4LWIA 3MNRP 3B25A 4PU9A 3Q5JA 3CYGA 4FCRA 4ZKIA 2WI2A 1AMWA 4XIRA 1U0ZA 5M4NA 4XD8A 1UY9A 4L91A 1F51A 4XITA 1S14A 4ASAA 4XTJA 1KZNA 3FT5A 2CCUA 1UYFA 4HYPA 4XC0A 3HZ5A 3HZ1A 3CWVA 4GFNA 3ZM7A 4MPEA 2YK2A 3Q5KA 4YKZA 1TH8A 4BIZA 4R3AA 2XX4A 1TC0A 2FWYA 4CWSA 5CPHA 1AH6A 4YKQA 2Q8IA 3QTFA 4LP0A 4CWRA 5FNDA 3TTZA 4NH9A 4I5SA 4LWEA 3K98A 2ZKJA 2BZ5A 4ASFA 2WI1A 1L0OA 1Y8PA 3O0IA 3O6OA 4MPNA 4U7NA 4CWQA 2YI6A 2FTKA 3B24A 3RLRA 2XHXA 1Y4SA 2YEAA 5L3JA 2GQPA 2JKIA 2XABA 2CCSA 2FXSA 1I5BA 4CWNA 3CGZA 1AH8A 4YKXA 1Y4UA 1A4HA 5BOCA 4K4OA 2XDKA 4EFUA 3EKOA 3ZKBA 2H8MA 4KP4A 5IDMA 3HYZA 1IXMA 3Q5LA 3A0XA 2Q8GA 2BU2A 2O1UA 5D7RA 3VHAA 1UYHA 1B63A 1MX0A 1Z5CA 2JJCA 2CG9A 2HKJA 2YE4A 4E02A 2IWXA 2XX5A 3LPSA 4L94A 2CGFA 4YKYA 4P7AA 2VCIA 1Z5BA 2IORA 1S16A 5CTXA 2QFOA 4UROA 3TZ0A 4CE3A 4EMVA 4GEEA 2CCTA 4PRVA 1YETA 5CF0A 5GGZA 3TZ5A 4XCJA 2E0AA 2YGFA 3R92A 3OPDA 4I3HA 3RLQA 2VCJA 4HYMA 4QPKA 1YC1A 4XDMA 5F3KA 2YE6A 4V25A 1QZRA 4FCQA 2PNRA 1BYQA 2BTZA 5D7DA 1UYIA 2XDLA 1AJ6A 1YT1A 4AS9A 2BT0A 3VHDA 1UY7A 2YKEA 2XHTA 1QY8A 1ID0A 4EGIA 4LWHA 1NHJA 1UYDA 4MB9A 5D6QA 2C1GA 3T10A 3U2KA 4KTNA 2IWUA 3H4LA 5D6PA 3T0ZA 2YI7A 3ZXQA 3ZKDA 1NHIA 4BIUA 4WUCA 2O1VA 5F5RA 3EHJA 3B27A 2XJJA 4WUDA 1GKXA 1I5CA 3H80A 3JZ3A 2BYHA 2XD6A 2BREA 2XHRA 2YE7A 4YKTA 1THNA 3QDDA 4BQGA 3OWDA 3ZXOA 3TZ2A 1UY8A 2YE5A 4H85A 2BSMA 2XX2A 3SL2A 3G75A 4BQJA 2YEEA 2C1IA 3R4OA 4FPPA 1EI1A 4Q20A 3GIGA 2O1WA 2VWCA 1UYMA 4XCLA 4E72A 4XKAA 2YEJA 5M4PA 1TILA 1H7SA 2YEBA 5CTWA 4B6CA 3LMMA 2YEDA 4CWTA 3RKZA 1YSZA 1ZW9A 4AWOA 1EA6A 4BXIA 4O0BA 1ZXMA 2ZDYA 1Y8OA 3RLPA 4JAVA 1BXDA 1UYLA 3DGEA 1B62A 2YJWA 2YKCA 4AWQA 3VHCA 2AKPA 2YGAA 5C93A 2WEPA 2EXLA 2YKIA 3FT8A 1BKNA 2YEHA 4XIQA 3R91A 2YGEA 3HHUA 1R62A 1TIDA 4U7OA 5M4EA 2BU5A 4JQLA 3GIEA 4LWFA 2Q2EB 4YKUA 3TZ4A 3B28A 3EHGA 4QPJA 4LWGA 4XE2A 3B26A 3T0HA 1OSFA 5CTYA 1GKZA 2Q8HA 5FNFA 2VW5A 4NH8A 4CE1A 4DZYA 4HXWA 2WI4A 2WEQA 5M4KA 2QF6A 1UYEA 4O09A 3INXA 2IWSA 1I5AA 4LPBA 2GFDA 2HG1A 2YI5A 5JENA 3HEKA 1YC3A 3CRLA 1TC6A 2XJXA 3CRKA 4NH7A 3KE6A 4X9LA 2FWZA 1Z5AA 4W7TA 1YC4A 2YE2A 2WI7A 3R4MA 3A0WA 4EGHA 1UYCA 4URLA 4GGLA 2WI6A 1I5DA 4CE2A 1Y8NA 2HCHA 4E00A 2C2AA 2YEGA 3R4PA 1JM6A 2UWDA 3K97A 5BODA 4MBCA 1BGQA 3HYYA 4KQVA 4H7QA 1ZWHA 2CH4A 3PEJA 4HY6A 4DUHA 2WI3A 4FCPA 2QG0A 4O07A 1MU5A 4MP2A 2BYIA 4CWOA 1Z59A 5M4MA 4E01A 1UY6A 3TUHA 4R3MA 2XDUA 4XKKA 2IOQA 5D7CA 4O05A 4XKOA 2YEFA 4EM7A 5M4HA 3BM9A 5FNCA 1AM1A 3C0EA 3K60A 4L8ZA 3T2SA 2QG2A 3O2FA 2XCMA 4GCZA 4H81A 1B3QA 2YECA 2Q8FA 1YERA 5FWKA 3OW6A 3EHFA 4CWPA 3G7EA 2H55A 2ZBKB 3LNUA 5IN9A 4AWPA 2BU6A 4EFTA 1I58A 4HXZA 4KFGA 4EGKA 1UYKA 3EKRA 4R1FA 1QYEA 1YT2A 2YE8A 3OWBA 2XK2A 2ZDXA 4U93A 5CTUA 4L93A 4JAUA 4L90A 4ASGA 2HHIA 3WQ9A 5J6AA 2ESAA 4B7PA 1YT0A 3R4NA 1NHHA 2BU7A 5J71A 2WERA 2YEIA 4WUBA 2FYPA 4ZVIA 4YKRA 3D2RA 3INWA 3PEHA 1YSRA 1KIJA 1H7UA 2XDXA 3S5TA 1GJVA 4GT8A 3EHHA 4JASA 3CGYA 4CWFA 4PL9A 2IOPA 3T1KA 2BU8A 3A0RA 3D36A 2YE3A 2BRCA 3FV5A 2YKBA 3C11A 3U67A 4V26A 4O04A 1YS3A 2XDSA 1TBWA 3A0TA 4GQTA 2YKJA 3NMQA 4EEHA 1U2OA 4KSHA 1PVGA 3K99A 3A0YA 3GIFA 4HZ5A 3G7BA 2XJGA 1US7A 4PRXA 3WHAA 1UYGA 4URMA 2YE9A 4HZ0A 4ASBA 2K5BA 2YI0A 4BAEA 2YK9A 1I59A 4MOTA 3OMUA 4HY1A 3GIGB 3VADA 3A0ZA 4URNA 1YESA 2WI5A 5IDJA 4MP7A 4YKWA 3IEDA 4MPCA 3BMYA 1ZXNA 4FMTA 4XIPA 3D0BA 2YJXA
chains in the Genus database with same CATH topology
4P8OA 3U2DA 4KSGA 4LWIA 3MNRP 3B25A 4PU9A 3Q5JA 4FCRA 4ZKIA 2WI2A 1AMWA 4XIRA 1U0ZA 5M4NA 4XD8A 1UY9A 4L91A 4XITA 1S14A 4ASAA 4XTJA 1KZNA 3FT5A 2CCUA 1UYFA 4HYPA 4XC0A 3HZ5A 3HZ1A 3CWVA 4GFNA 3ZM7A 4MPEA 2YK2A 3Q5KA 4YKZA 1TH8A 4BIZA 4R3AA 2XX4A 1TC0A 2FWYA 4CWSA 5CPHA 1AH6A 4YKQA 2Q8IA 3QTFA 4LP0A 4CWRA 5FNDA 3TTZA 4NH9A 4I5SA 4LWEA 3K98A 2ZKJA 2BZ5A 4ASFA 2WI1A 1L0OA 1Y8PA 3O0IA 3O6OA 4MPNA 4U7NA 4CWQA 2YI6A 3B24A 3RLRA 2XHXA 1Y4SA 2YEAA 5L3JA 2GQPA 2JKIA 2XABA 2CCSA 2FXSA 1I5BA 4CWNA 3CGZA 1AH8A 4YKXA 1Y4UA 1A4HA 5BOCA 4K4OA 2XDKA 4EFUA 3EKOA 3ZKBA 2H8MA 4KP4A 5IDMA 3HYZA 3Q5LA 3A0XA 2Q8GA 2BU2A 2O1UA 5D7RA 3VHAA 1UYHA 1B63A 1MX0A 1Z5CA 2JJCA 2CG9A 2HKJA 2YE4A 4E02A 2IWXA 2XX5A 3LPSA 4L94A 2CGFA 4YKYA 4P7AA 2VCIA 1Z5BA 2IORA 1S16A 5CTXA 2QFOA 4UROA 3TZ0A 4CE3A 4EMVA 4GEEA 2CCTA 4PRVA 1YETA 5CF0A 5GGZA 3TZ5A 4XCJA 2E0AA 2YGFA 3R92A 3OPDA 4I3HA 3RLQA 2VCJA 4HYMA 4QPKA 1YC1A 4XDMA 5F3KA 2YE6A 4V25A 1QZRA 4FCQA 2PNRA 1BYQA 2BTZA 5D7DA 1UYIA 2XDLA 1AJ6A 1YT1A 4AS9A 2BT0A 3VHDA 1UY7A 2YKEA 2XHTA 1QY8A 1ID0A 4EGIA 4LWHA 1NHJA 1UYDA 4MB9A 5D6QA 3T10A 3U2KA 4KTNA 2IWUA 3H4LA 5D6PA 3T0ZA 2YI7A 3ZXQA 3ZKDA 1NHIA 4BIUA 4WUCA 2O1VA 5F5RA 3EHJA 3B27A 2XJJA 4WUDA 1GKXA 1I5CA 3H80A 3JZ3A 2BYHA 2XD6A 2BREA 2XHRA 2YE7A 4YKTA 1THNA 3QDDA 4BQGA 3OWDA 3ZXOA 3TZ2A 1UY8A 2YE5A 4H85A 2BSMA 2XX2A 3SL2A 3G75A 4BQJA 2YEEA 3R4OA 4FPPA 1EI1A 4Q20A 3GIGA 2O1WA 2VWCA 1UYMA 4XCLA 4XKAA 2YEJA 5M4PA 1TILA 1H7SA 2YEBA 5CTWA 4B6CA 2YEDA 4CWTA 3RKZA 1YSZA 1ZW9A 4AWOA 1EA6A 4BXIA 4O0BA 1ZXMA 2ZDYA 1Y8OA 3RLPA 4JAVA 1BXDA 1UYLA 3DGEA 1B62A 2YJWA 2YKCA 4AWQA 3VHCA 2AKPA 2YGAA 5C93A 2WEPA 2EXLA 2YKIA 3FT8A 1BKNA 2YEHA 4XIQA 3R91A 2YGEA 3HHUA 1R62A 1TIDA 4U7OA 5M4EA 2BU5A 4JQLA 3GIEA 4LWFA 2Q2EB 4YKUA 3TZ4A 3B28A 3EHGA 4QPJA 4LWGA 4XE2A 3B26A 3T0HA 1OSFA 5CTYA 1GKZA 2Q8HA 5FNFA 2VW5A 4NH8A 4CE1A 4DZYA 4HXWA 2WI4A 2WEQA 5M4KA 2QF6A 1UYEA 4O09A 3INXA 2IWSA 1I5AA 4LPBA 2GFDA 2HG1A 2YI5A 3HEKA 1YC3A 3CRLA 1TC6A 2XJXA 3CRKA 4NH7A 3KE6A 4X9LA 2FWZA 1Z5AA 4W7TA 1YC4A 2YE2A 2WI7A 3R4MA 3A0WA 4EGHA 1UYCA 4URLA 4GGLA 2WI6A 1I5DA 4CE2A 1Y8NA 2HCHA 4E00A 2C2AA 2YEGA 3R4PA 1JM6A 2UWDA 3K97A 5BODA 4MBCA 1BGQA 3HYYA 4KQVA 4H7QA 1ZWHA 2CH4A 3PEJA 4HY6A 4DUHA 2WI3A 4FCPA 2QG0A 4O07A 1MU5A 4MP2A 2BYIA 4CWOA 1Z59A 5M4MA 4E01A 1UY6A 3TUHA 4R3MA 2XDUA 4XKKA 2IOQA 5D7CA 4O05A 4XKOA 2YEFA 4EM7A 5M4HA 3BM9A 5FNCA 1AM1A 3C0EA 4L8ZA 3K60A 3T2SA 2QG2A 3O2FA 2XCMA 4GCZA 4H81A 1B3QA 2YECA 2Q8FA 1YERA 5FWKA 3OW6A 3EHFA 4CWPA 3G7EA 2H55A 2ZBKB 3LNUA 5IN9A 4AWPA 2BU6A 4EFTA 1I58A 4HXZA 4KFGA 4EGKA 1UYKA 3EKRA 4R1FA 1QYEA 1YT2A 2YE8A 3OWBA 2XK2A 2ZDXA 4U93A 5CTUA 4L93A 4JAUA 4L90A 4ASGA 3WQ9A 5J6AA 2ESAA 4B7PA 1YT0A 3R4NA 1NHHA 2BU7A 5J71A 2WERA 2YEIA 4WUBA 2FYPA 4ZVIA 4YKRA 3D2RA 3INWA 3PEHA 1YSRA 1KIJA 1H7UA 2XDXA 1GJVA 4GT8A 3EHHA 4JASA 3CGYA 4CWFA 4PL9A 2IOPA 3T1KA 2BU8A 3A0RA 3D36A 2YE3A 2BRCA 3FV5A 2YKBA 3C11A 3U67A 4V26A 4O04A 1YS3A 2XDSA 1TBWA 3A0TA 4GQTA 2YKJA 3NMQA 4EEHA 1U2OA 4KSHA 1PVGA 3K99A 3A0YA 3GIFA 4HZ5A 3G7BA 2XJGA 1US7A 4PRXA 3WHAA 1UYGA 4URMA 2YE9A 4HZ0A 4ASBA 2K5BA 2YI0A 4BAEA 2YK9A 1I59A 4MOTA 3OMUA 4HY1A 3GIGB 3VADA 3A0ZA 4URNA 1YESA 2WI5A 5IDJA 4MP7A 4YKWA 3IEDA 4MPCA 3BMYA 1ZXNA 4FMTA 4XIPA 3D0BA 2YJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P8O A;  3U2D A;  4KSG A;  4LWI A;  3MNR P;  3B25 A;  4PU9 A;  3Q5J A;  4FCR A;  4ZKI A;  2WI2 A;  1AMW A;  4XIR A;  1U0Z A;  5M4N A;  4XD8 A;  1UY9 A;  4L91 A;  4XIT A;  1S14 A;  4ASA A;  4XTJ A;  1KZN A;  3FT5 A;  2CCU A;  1UYF A;  4HYP A;  4XC0 A;  3HZ5 A;  3HZ1 A;  3CWV A;  4GFN A;  3ZM7 A;  4MPE A;  2YK2 A;  3Q5K A;  4YKZ A;  1TH8 A;  4BIZ A;  4R3A A;  2XX4 A;  1TC0 A;  2FWY A;  4CWS A;  5CPH A;  1AH6 A;  4YKQ A;  2Q8I A;  3QTF A;  4LP0 A;  4CWR A;  5FND A;  3TTZ A;  4NH9 A;  4I5S A;  4LWE A;  3K98 A;  2ZKJ A;  2BZ5 A;  4ASF A;  2WI1 A;  1L0O A;  1Y8P A;  3O0I A;  3O6O A;  4MPN A;  4U7N A;  4CWQ A;  2YI6 A;  3B24 A;  3RLR A;  2XHX A;  1Y4S A;  2YEA A;  5L3J A;  2GQP A;  2JKI A;  2XAB A;  2CCS A;  2FXS A;  1I5B A;  4CWN A;  3CGZ A;  1AH8 A;  4YKX A;  1Y4U A;  1A4H A;  5BOC A;  4K4O A;  2XDK A;  4EFU A;  3EKO A;  3ZKB A;  2H8M A;  4KP4 A;  5IDM A;  3HYZ A;  3Q5L A;  3A0X A;  2Q8G A;  2BU2 A;  2O1U A;  5D7R A;  3VHA A;  1UYH A;  1B63 A;  1MX0 A;  1Z5C A;  2JJC A;  2CG9 A;  2HKJ A;  2YE4 A;  4E02 A;  2IWX A;  2XX5 A;  3LPS A;  4L94 A;  2CGF A;  4YKY A;  4P7A A;  2VCI A;  1Z5B A;  2IOR A;  1S16 A;  5CTX A;  2QFO A;  4URO A;  3TZ0 A;  4CE3 A;  4EMV A;  4GEE A;  2CCT A;  4PRV A;  1YET A;  5CF0 A;  5GGZ A;  3TZ5 A;  4XCJ A;  2E0A A;  2YGF A;  3R92 A;  3OPD A;  4I3H A;  3RLQ A;  2VCJ A;  4HYM A;  4QPK A;  1YC1 A;  4XDM A;  5F3K A;  2YE6 A;  4V25 A;  1QZR A;  4FCQ A;  2PNR A;  1BYQ A;  2BTZ A;  5D7D A;  1UYI A;  2XDL A;  1AJ6 A;  1YT1 A;  4AS9 A;  2BT0 A;  3VHD A;  1UY7 A;  2YKE A;  2XHT A;  1QY8 A;  1ID0 A;  4EGI A;  4LWH A;  1NHJ A;  1UYD A;  4MB9 A;  5D6Q A;  3T10 A;  3U2K A;  4KTN A;  2IWU A;  3H4L A;  5D6P A;  3T0Z A;  2YI7 A;  3ZXQ A;  3ZKD A;  1NHI A;  4BIU A;  4WUC A;  2O1V A;  5F5R A;  3EHJ A;  3B27 A;  2XJJ A;  4WUD A;  1GKX A;  1I5C A;  3H80 A;  3JZ3 A;  2BYH A;  2XD6 A;  2BRE A;  2XHR A;  2YE7 A;  4YKT A;  1THN A;  3QDD A;  4BQG A;  3OWD A;  3ZXO A;  3TZ2 A;  1UY8 A;  2YE5 A;  4H85 A;  2BSM A;  2XX2 A;  3SL2 A;  3G75 A;  4BQJ A;  2YEE A;  3R4O A;  4FPP A;  1EI1 A;  4Q20 A;  3GIG A;  2O1W A;  2VWC A;  1UYM A;  4XCL A;  4XKA A;  2YEJ A;  5M4P A;  1TIL A;  1H7S A;  2YEB A;  5CTW A;  4B6C A;  2YED A;  4CWT A;  3RKZ A;  1YSZ A;  1ZW9 A;  4AWO A;  1EA6 A;  4BXI A;  4O0B A;  1ZXM A;  2ZDY A;  1Y8O A;  3RLP A;  4JAV A;  1BXD A;  1UYL A;  3DGE A;  1B62 A;  2YJW A;  2YKC A;  4AWQ A;  3VHC A;  2AKP A;  2YGA A;  5C93 A;  2WEP A;  2EXL A;  2YKI A;  3FT8 A;  1BKN A;  2YEH A;  4XIQ A;  3R91 A;  2YGE A;  3HHU A;  1R62 A;  1TID A;  4U7O A;  5M4E A;  2BU5 A;  4JQL A;  3GIE A;  4LWF A;  2Q2E B;  4YKU A;  3TZ4 A;  3B28 A;  3EHG A;  4QPJ A;  4LWG A;  4XE2 A;  3B26 A;  3T0H A;  1OSF A;  5CTY A;  1GKZ A;  2Q8H A;  5FNF A;  2VW5 A;  4NH8 A;  4CE1 A;  4DZY A;  4HXW A;  2WI4 A;  2WEQ A;  5M4K A;  2QF6 A;  1UYE A;  4O09 A;  3INX A;  2IWS A;  1I5A A;  4LPB A;  2GFD A;  2HG1 A;  2YI5 A;  3HEK A;  1YC3 A;  3CRL A;  1TC6 A;  2XJX A;  3CRK A;  4NH7 A;  3KE6 A;  4X9L A;  2FWZ A;  1Z5A A;  4W7T A;  1YC4 A;  2YE2 A;  2WI7 A;  3R4M A;  3A0W A;  4EGH A;  1UYC A;  4URL A;  4GGL A;  2WI6 A;  1I5D A;  4CE2 A;  1Y8N A;  2HCH A;  4E00 A;  2C2A A;  2YEG A;  3R4P A;  1JM6 A;  2UWD A;  3K97 A;  5BOD A;  4MBC A;  1BGQ A;  3HYY A;  4KQV A;  4H7Q A;  1ZWH A;  2CH4 A;  3PEJ A;  4HY6 A;  4DUH A;  2WI3 A;  4FCP A;  2QG0 A;  4O07 A;  1MU5 A;  4MP2 A;  2BYI A;  4CWO A;  1Z59 A;  5M4M A;  4E01 A;  1UY6 A;  3TUH A;  4R3M A;  2XDU A;  4XKK A;  2IOQ A;  5D7C A;  4O05 A;  4XKO A;  2YEF A;  4EM7 A;  5M4H A;  3BM9 A;  5FNC A;  1AM1 A;  3C0E A;  4L8Z A;  3K60 A;  3T2S A;  2QG2 A;  3O2F A;  2XCM A;  4GCZ A;  4H81 A;  1B3Q A;  2YEC A;  2Q8F A;  1YER A;  5FWK A;  3OW6 A;  3EHF A;  4CWP A;  3G7E A;  2H55 A;  2ZBK B;  3LNU A;  5IN9 A;  4AWP A;  2BU6 A;  4EFT A;  1I58 A;  4HXZ A;  4KFG A;  4EGK A;  1UYK A;  3EKR A;  4R1F A;  1QYE A;  1YT2 A;  2YE8 A;  3OWB A;  2XK2 A;  2ZDX A;  4U93 A;  5CTU A;  4L93 A;  4JAU A;  4L90 A;  4ASG A;  3WQ9 A;  5J6A A;  2ESA A;  4B7P A;  1YT0 A;  3R4N A;  1NHH A;  2BU7 A;  5J71 A;  2WER A;  2YEI A;  4WUB A;  2FYP A;  4ZVI A;  4YKR A;  3D2R A;  3INW A;  3PEH A;  1YSR A;  1KIJ A;  1H7U A;  2XDX A;  1GJV A;  4GT8 A;  3EHH A;  4JAS A;  3CGY A;  4CWF A;  4PL9 A;  2IOP A;  3T1K A;  2BU8 A;  3A0R A;  3D36 A;  2YE3 A;  2BRC A;  3FV5 A;  2YKB A;  3C11 A;  3U67 A;  4V26 A;  4O04 A;  1YS3 A;  2XDS A;  1TBW A;  3A0T A;  4GQT A;  2YKJ A;  3NMQ A;  4EEH A;  1U2O A;  4KSH A;  1PVG A;  3K99 A;  3A0Y A;  3GIF A;  4HZ5 A;  3G7B A;  2XJG A;  1US7 A;  4PRX A;  3WHA A;  1UYG A;  4URM A;  2YE9 A;  4HZ0 A;  4ASB A;  2K5B A;  2YI0 A;  4BAE A;  2YK9 A;  1I59 A;  4MOT A;  3OMU A;  4HY1 A;  3GIG B;  3VAD A;  3A0Z A;  4URN A;  1YES A;  2WI5 A;  5IDJ A;  4MP7 A;  4YKW A;  3IED A;  4MPC A;  3BMY A;  1ZXN A;  4FMT A;  4XIP A;  3D0B A;  2YJX A; 
#chains in the Genus database with same CATH topology
 4P8O A;  3U2D A;  4KSG A;  4LWI A;  3MNR P;  3B25 A;  4PU9 A;  3Q5J A;  3CYG A;  4FCR A;  4ZKI A;  2WI2 A;  1AMW A;  4XIR A;  1U0Z A;  5M4N A;  4XD8 A;  1UY9 A;  4L91 A;  1F51 A;  4XIT A;  1S14 A;  4ASA A;  4XTJ A;  1KZN A;  3FT5 A;  2CCU A;  1UYF A;  4HYP A;  4XC0 A;  3HZ5 A;  3HZ1 A;  3CWV A;  4GFN A;  3ZM7 A;  4MPE A;  2YK2 A;  3Q5K A;  4YKZ A;  1TH8 A;  4BIZ A;  4R3A A;  2XX4 A;  1TC0 A;  2FWY A;  4CWS A;  5CPH A;  1AH6 A;  4YKQ A;  2Q8I A;  3QTF A;  4LP0 A;  4CWR A;  5FND A;  3TTZ A;  4NH9 A;  4I5S A;  4LWE A;  3K98 A;  2ZKJ A;  2BZ5 A;  4ASF A;  2WI1 A;  1L0O A;  1Y8P A;  3O0I A;  3O6O A;  4MPN A;  4U7N A;  4CWQ A;  2YI6 A;  2FTK A;  3B24 A;  3RLR A;  2XHX A;  1Y4S A;  2YEA A;  5L3J A;  2GQP A;  2JKI A;  2XAB A;  2CCS A;  2FXS A;  1I5B A;  4CWN A;  3CGZ A;  1AH8 A;  4YKX A;  1Y4U A;  1A4H A;  5BOC A;  4K4O A;  2XDK A;  4EFU A;  3EKO A;  3ZKB A;  2H8M A;  4KP4 A;  5IDM A;  3HYZ A;  1IXM A;  3Q5L A;  3A0X A;  2Q8G A;  2BU2 A;  2O1U A;  5D7R A;  3VHA A;  1UYH A;  1B63 A;  1MX0 A;  1Z5C A;  2JJC A;  2CG9 A;  2HKJ A;  2YE4 A;  4E02 A;  2IWX A;  2XX5 A;  3LPS A;  4L94 A;  2CGF A;  4YKY A;  4P7A A;  2VCI A;  1Z5B A;  2IOR A;  1S16 A;  5CTX A;  2QFO A;  4URO A;  3TZ0 A;  4CE3 A;  4EMV A;  4GEE A;  2CCT A;  4PRV A;  1YET A;  5CF0 A;  5GGZ A;  3TZ5 A;  4XCJ A;  2E0A A;  2YGF A;  3R92 A;  3OPD A;  4I3H A;  3RLQ A;  2VCJ A;  4HYM A;  4QPK A;  1YC1 A;  4XDM A;  5F3K A;  2YE6 A;  4V25 A;  1QZR A;  4FCQ A;  2PNR A;  1BYQ A;  2BTZ A;  5D7D A;  1UYI A;  2XDL A;  1AJ6 A;  1YT1 A;  4AS9 A;  2BT0 A;  3VHD A;  1UY7 A;  2YKE A;  2XHT A;  1QY8 A;  1ID0 A;  4EGI A;  4LWH A;  1NHJ A;  1UYD A;  4MB9 A;  5D6Q A;  2C1G A;  3T10 A;  3U2K A;  4KTN A;  2IWU A;  3H4L A;  5D6P A;  3T0Z A;  2YI7 A;  3ZXQ A;  3ZKD A;  1NHI A;  4BIU A;  4WUC A;  2O1V A;  5F5R A;  3EHJ A;  3B27 A;  2XJJ A;  4WUD A;  1GKX A;  1I5C A;  3H80 A;  3JZ3 A;  2BYH A;  2XD6 A;  2BRE A;  2XHR A;  2YE7 A;  4YKT A;  1THN A;  3QDD A;  4BQG A;  3OWD A;  3ZXO A;  3TZ2 A;  1UY8 A;  2YE5 A;  4H85 A;  2BSM A;  2XX2 A;  3SL2 A;  3G75 A;  4BQJ A;  2YEE A;  2C1I A;  3R4O A;  4FPP A;  1EI1 A;  4Q20 A;  3GIG A;  2O1W A;  2VWC A;  1UYM A;  4XCL A;  4E72 A;  4XKA A;  2YEJ A;  5M4P A;  1TIL A;  1H7S A;  2YEB A;  5CTW A;  4B6C A;  3LMM A;  2YED A;  4CWT A;  3RKZ A;  1YSZ A;  1ZW9 A;  4AWO A;  1EA6 A;  4BXI A;  4O0B A;  1ZXM A;  2ZDY A;  1Y8O A;  3RLP A;  4JAV A;  1BXD A;  1UYL A;  3DGE A;  1B62 A;  2YJW A;  2YKC A;  4AWQ A;  3VHC A;  2AKP A;  2YGA A;  5C93 A;  2WEP A;  2EXL A;  2YKI A;  3FT8 A;  1BKN A;  2YEH A;  4XIQ A;  3R91 A;  2YGE A;  3HHU A;  1R62 A;  1TID A;  4U7O A;  5M4E A;  2BU5 A;  4JQL A;  3GIE A;  4LWF A;  2Q2E B;  4YKU A;  3TZ4 A;  3B28 A;  3EHG A;  4QPJ A;  4LWG A;  4XE2 A;  3B26 A;  3T0H A;  1OSF A;  5CTY A;  1GKZ A;  2Q8H A;  5FNF A;  2VW5 A;  4NH8 A;  4CE1 A;  4DZY A;  4HXW A;  2WI4 A;  2WEQ A;  5M4K A;  2QF6 A;  1UYE A;  4O09 A;  3INX A;  2IWS A;  1I5A A;  4LPB A;  2GFD A;  2HG1 A;  2YI5 A;  5JEN A;  3HEK A;  1YC3 A;  3CRL A;  1TC6 A;  2XJX A;  3CRK A;  4NH7 A;  3KE6 A;  4X9L A;  2FWZ A;  1Z5A A;  4W7T A;  1YC4 A;  2YE2 A;  2WI7 A;  3R4M A;  3A0W A;  4EGH A;  1UYC A;  4URL A;  4GGL A;  2WI6 A;  1I5D A;  4CE2 A;  1Y8N A;  2HCH A;  4E00 A;  2C2A A;  2YEG A;  3R4P A;  1JM6 A;  2UWD A;  3K97 A;  5BOD A;  4MBC A;  1BGQ A;  3HYY A;  4KQV A;  4H7Q A;  1ZWH A;  2CH4 A;  3PEJ A;  4HY6 A;  4DUH A;  2WI3 A;  4FCP A;  2QG0 A;  4O07 A;  1MU5 A;  4MP2 A;  2BYI A;  4CWO A;  1Z59 A;  5M4M A;  4E01 A;  1UY6 A;  3TUH A;  4R3M A;  2XDU A;  4XKK A;  2IOQ A;  5D7C A;  4O05 A;  4XKO A;  2YEF A;  4EM7 A;  5M4H A;  3BM9 A;  5FNC A;  1AM1 A;  3C0E A;  3K60 A;  4L8Z A;  3T2S A;  2QG2 A;  3O2F A;  2XCM A;  4GCZ A;  4H81 A;  1B3Q A;  2YEC A;  2Q8F A;  1YER A;  5FWK A;  3OW6 A;  3EHF A;  4CWP A;  3G7E A;  2H55 A;  2ZBK B;  3LNU A;  5IN9 A;  4AWP A;  2BU6 A;  4EFT A;  1I58 A;  4HXZ A;  4KFG A;  4EGK A;  1UYK A;  3EKR A;  4R1F A;  1QYE A;  1YT2 A;  2YE8 A;  3OWB A;  2XK2 A;  2ZDX A;  4U93 A;  5CTU A;  4L93 A;  4JAU A;  4L90 A;  4ASG A;  2HHI A;  3WQ9 A;  5J6A A;  2ESA A;  4B7P A;  1YT0 A;  3R4N A;  1NHH A;  2BU7 A;  5J71 A;  2WER A;  2YEI A;  4WUB A;  2FYP A;  4ZVI A;  4YKR A;  3D2R A;  3INW A;  3PEH A;  1YSR A;  1KIJ A;  1H7U A;  2XDX A;  3S5T A;  1GJV A;  4GT8 A;  3EHH A;  4JAS A;  3CGY A;  4CWF A;  4PL9 A;  2IOP A;  3T1K A;  2BU8 A;  3A0R A;  3D36 A;  2YE3 A;  2BRC A;  3FV5 A;  2YKB A;  3C11 A;  3U67 A;  4V26 A;  4O04 A;  1YS3 A;  2XDS A;  1TBW A;  3A0T A;  4GQT A;  2YKJ A;  3NMQ A;  4EEH A;  1U2O A;  4KSH A;  1PVG A;  3K99 A;  3A0Y A;  3GIF A;  4HZ5 A;  3G7B A;  2XJG A;  1US7 A;  4PRX A;  3WHA A;  1UYG A;  4URM A;  2YE9 A;  4HZ0 A;  4ASB A;  2K5B A;  2YI0 A;  4BAE A;  2YK9 A;  1I59 A;  4MOT A;  3OMU A;  4HY1 A;  3GIG B;  3VAD A;  3A0Z A;  4URN A;  1YES A;  2WI5 A;  5IDJ A;  4MP7 A;  4YKW A;  3IED A;  4MPC A;  3BMY A;  1ZXN A;  4FMT A;  4XIP A;  3D0B A;  2YJX A; 
#chains in the Genus database with same CATH homology
 4P8O A;  3U2D A;  4KSG A;  4LWI A;  3MNR P;  3B25 A;  4PU9 A;  3Q5J A;  4FCR A;  4ZKI A;  2WI2 A;  1AMW A;  4XIR A;  1U0Z A;  5M4N A;  4XD8 A;  1UY9 A;  4L91 A;  4XIT A;  1S14 A;  4ASA A;  4XTJ A;  1KZN A;  3FT5 A;  2CCU A;  1UYF A;  4HYP A;  4XC0 A;  3HZ5 A;  3HZ1 A;  3CWV A;  4GFN A;  3ZM7 A;  4MPE A;  2YK2 A;  3Q5K A;  4YKZ A;  1TH8 A;  4BIZ A;  4R3A A;  2XX4 A;  1TC0 A;  2FWY A;  4CWS A;  5CPH A;  1AH6 A;  4YKQ A;  2Q8I A;  3QTF A;  4LP0 A;  4CWR A;  5FND A;  3TTZ A;  4NH9 A;  4I5S A;  4LWE A;  3K98 A;  2ZKJ A;  2BZ5 A;  4ASF A;  2WI1 A;  1L0O A;  1Y8P A;  3O0I A;  3O6O A;  4MPN A;  4U7N A;  4CWQ A;  2YI6 A;  3B24 A;  3RLR A;  2XHX A;  1Y4S A;  2YEA A;  5L3J A;  2GQP A;  2JKI A;  2XAB A;  2CCS A;  2FXS A;  1I5B A;  4CWN A;  3CGZ A;  1AH8 A;  4YKX A;  1Y4U A;  1A4H A;  5BOC A;  4K4O A;  2XDK A;  4EFU A;  3EKO A;  3ZKB A;  2H8M A;  4KP4 A;  5IDM A;  3HYZ A;  3Q5L A;  3A0X A;  2Q8G A;  2BU2 A;  2O1U A;  5D7R A;  3VHA A;  1UYH A;  1B63 A;  1MX0 A;  1Z5C A;  2JJC A;  2CG9 A;  2HKJ A;  2YE4 A;  4E02 A;  2IWX A;  2XX5 A;  3LPS A;  4L94 A;  2CGF A;  4YKY A;  4P7A A;  2VCI A;  1Z5B A;  2IOR A;  1S16 A;  5CTX A;  2QFO A;  4URO A;  3TZ0 A;  4CE3 A;  4EMV A;  4GEE A;  2CCT A;  4PRV A;  1YET A;  5CF0 A;  5GGZ A;  3TZ5 A;  4XCJ A;  2E0A A;  2YGF A;  3R92 A;  3OPD A;  4I3H A;  3RLQ A;  2VCJ A;  4HYM A;  4QPK A;  1YC1 A;  4XDM A;  5F3K A;  2YE6 A;  4V25 A;  1QZR A;  4FCQ A;  2PNR A;  1BYQ A;  2BTZ A;  5D7D A;  1UYI A;  2XDL A;  1AJ6 A;  1YT1 A;  4AS9 A;  2BT0 A;  3VHD A;  1UY7 A;  2YKE A;  2XHT A;  1QY8 A;  1ID0 A;  4EGI A;  4LWH A;  1NHJ A;  1UYD A;  4MB9 A;  5D6Q A;  3T10 A;  3U2K A;  4KTN A;  2IWU A;  3H4L A;  5D6P A;  3T0Z A;  2YI7 A;  3ZXQ A;  3ZKD A;  1NHI A;  4BIU A;  4WUC A;  2O1V A;  5F5R A;  3EHJ A;  3B27 A;  2XJJ A;  4WUD A;  1GKX A;  1I5C A;  3H80 A;  3JZ3 A;  2BYH A;  2XD6 A;  2BRE A;  2XHR A;  2YE7 A;  4YKT A;  1THN A;  3QDD A;  4BQG A;  3OWD A;  3ZXO A;  3TZ2 A;  1UY8 A;  2YE5 A;  4H85 A;  2BSM A;  2XX2 A;  3SL2 A;  3G75 A;  4BQJ A;  2YEE A;  3R4O A;  4FPP A;  1EI1 A;  4Q20 A;  3GIG A;  2O1W A;  2VWC A;  1UYM A;  4XCL A;  4XKA A;  2YEJ A;  5M4P A;  1TIL A;  1H7S A;  2YEB A;  5CTW A;  4B6C A;  2YED A;  4CWT A;  3RKZ A;  1YSZ A;  1ZW9 A;  4AWO A;  1EA6 A;  4BXI A;  4O0B A;  1ZXM A;  2ZDY A;  1Y8O A;  3RLP A;  4JAV A;  1BXD A;  1UYL A;  3DGE A;  1B62 A;  2YJW A;  2YKC A;  4AWQ A;  3VHC A;  2AKP A;  2YGA A;  5C93 A;  2WEP A;  2EXL A;  2YKI A;  3FT8 A;  1BKN A;  2YEH A;  4XIQ A;  3R91 A;  2YGE A;  3HHU A;  1R62 A;  1TID A;  4U7O A;  5M4E A;  2BU5 A;  4JQL A;  3GIE A;  4LWF A;  2Q2E B;  4YKU A;  3TZ4 A;  3B28 A;  3EHG A;  4QPJ A;  4LWG A;  4XE2 A;  3B26 A;  3T0H A;  1OSF A;  5CTY A;  1GKZ A;  2Q8H A;  5FNF A;  2VW5 A;  4NH8 A;  4CE1 A;  4DZY A;  4HXW A;  2WI4 A;  2WEQ A;  5M4K A;  2QF6 A;  1UYE A;  4O09 A;  3INX A;  2IWS A;  1I5A A;  4LPB A;  2GFD A;  2HG1 A;  2YI5 A;  3HEK A;  1YC3 A;  3CRL A;  1TC6 A;  2XJX A;  3CRK A;  4NH7 A;  3KE6 A;  4X9L A;  2FWZ A;  1Z5A A;  4W7T A;  1YC4 A;  2YE2 A;  2WI7 A;  3R4M A;  3A0W A;  4EGH A;  1UYC A;  4URL A;  4GGL A;  2WI6 A;  1I5D A;  4CE2 A;  1Y8N A;  2HCH A;  4E00 A;  2C2A A;  2YEG A;  3R4P A;  1JM6 A;  2UWD A;  3K97 A;  5BOD A;  4MBC A;  1BGQ A;  3HYY A;  4KQV A;  4H7Q A;  1ZWH A;  2CH4 A;  3PEJ A;  4HY6 A;  4DUH A;  2WI3 A;  4FCP A;  2QG0 A;  4O07 A;  1MU5 A;  4MP2 A;  2BYI A;  4CWO A;  1Z59 A;  5M4M A;  4E01 A;  1UY6 A;  3TUH A;  4R3M A;  2XDU A;  4XKK A;  2IOQ A;  5D7C A;  4O05 A;  4XKO A;  2YEF A;  4EM7 A;  5M4H A;  3BM9 A;  5FNC A;  1AM1 A;  3C0E A;  4L8Z A;  3K60 A;  3T2S A;  2QG2 A;  3O2F A;  2XCM A;  4GCZ A;  4H81 A;  1B3Q A;  2YEC A;  2Q8F A;  1YER A;  5FWK A;  3OW6 A;  3EHF A;  4CWP A;  3G7E A;  2H55 A;  2ZBK B;  3LNU A;  5IN9 A;  4AWP A;  2BU6 A;  4EFT A;  1I58 A;  4HXZ A;  4KFG A;  4EGK A;  1UYK A;  3EKR A;  4R1F A;  1QYE A;  1YT2 A;  2YE8 A;  3OWB A;  2XK2 A;  2ZDX A;  4U93 A;  5CTU A;  4L93 A;  4JAU A;  4L90 A;  4ASG A;  3WQ9 A;  5J6A A;  2ESA A;  4B7P A;  1YT0 A;  3R4N A;  1NHH A;  2BU7 A;  5J71 A;  2WER A;  2YEI A;  4WUB A;  2FYP A;  4ZVI A;  4YKR A;  3D2R A;  3INW A;  3PEH A;  1YSR A;  1KIJ A;  1H7U A;  2XDX A;  1GJV A;  4GT8 A;  3EHH A;  4JAS A;  3CGY A;  4CWF A;  4PL9 A;  2IOP A;  3T1K A;  2BU8 A;  3A0R A;  3D36 A;  2YE3 A;  2BRC A;  3FV5 A;  2YKB A;  3C11 A;  3U67 A;  4V26 A;  4O04 A;  1YS3 A;  2XDS A;  1TBW A;  3A0T A;  4GQT A;  2YKJ A;  3NMQ A;  4EEH A;  1U2O A;  4KSH A;  1PVG A;  3K99 A;  3A0Y A;  3GIF A;  4HZ5 A;  3G7B A;  2XJG A;  1US7 A;  4PRX A;  3WHA A;  1UYG A;  4URM A;  2YE9 A;  4HZ0 A;  4ASB A;  2K5B A;  2YI0 A;  4BAE A;  2YK9 A;  1I59 A;  4MOT A;  3OMU A;  4HY1 A;  3GIG B;  3VAD A;  3A0Z A;  4URN A;  1YES A;  2WI5 A;  5IDJ A;  4MP7 A;  4YKW A;  3IED A;  4MPC A;  3BMY A;  1ZXN A;  4FMT A;  4XIP A;  3D0B A;  2YJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...