2EXLA

Grp94 n-terminal domain bound to geldanamycin
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
229
structure length
206
Chain Sequence
b'KSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIASTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin
publication title Different poses for ligand and chaperone in inhibitor-bound Hsp90 and GRP94: implications for paralog-specific drug design.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
total genus 63
structure length 206
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2exlA00
3ZXOA 4JQLA 2XABA 2YGFA 3T10A 2WEPA 2CGFA 1I5BA 3D0BA 3WHAA 2YE7A 1BYQA 2YE4A 3EKRA 1US7A 1NHJA 4R3MA 2IWXA 1YC3A 4WUDA 4HYPA 1I5CA 4FCQA 4ASGA 2WI2A 5IN9A 1Z5AA 4EGIA 2XJXA 2K5BA 1TH8A 2BU6A 5GGZA 4XD8A 4XC0A 1BKNA 5D6PA 5CF0A 4XTJA 4MOTA 2H55A 3HZ5A 3O2FA 2Q8FA 4KSHA 3PEHA 4WUBA 3EHGA 3FT8A 2BREA 2HG1A 3B28A 4O05A 3GIFA 1YSZA 4R3AA 3G7EA 2XD6A 3DGEA 4V26A 4YKTA 1YERA 1GJVA 2QG0A 3R4OA 2YE2A 1ZW9A 4B7PA 3H80A 4YKZA 3T2SA 1AMWA 1I58A 2C2AA 4NH8A 3CGZA 4H7QA 1Y8OA 4YKQA 2YI0A 1THNA 4KP4A 2JKIA 2YE8A 2YK9A 2XHRA 3R4MA 3TUHA 3B26A 4DZYA 3BM9A 4LWGA 3A0YA 3BMYA 1GKXA 3RLQA 3TZ0A 4U7NA 4ASAA 3CWVA 4LWIA 3CGYA 2YKEA 1H7SA 2ZDXA 2XDUA 4MBCA 1H7UA 4AWQA 2XHTA 4XIRA 4PU9A 4W7TA 2YE5A 1KIJA 2PNRA 4CE2A 4L90A 3A0TA 4HZ0A 1BXDA 4KQVA 4UROA 2WI3A 4FCRA 2H8MA 4U7OA 4NH9A 1UYFA 1QZRA 4EGKA 1TIDA 3HYZA 2YE3A 3EHJA 4GT8A 2YI5A 4XKAA 4XKKA 1EI1A 2VW5A 1UY7A 3JZ3A 4PRXA 4JAUA 2QF6A 4XIPA 2YEFA 3O6OA 2IWSA 2O1UA 3WQ9A 4BAEA 2IOPA 1YC1A 4XIQA 2YKJA 2CCSA 3ZKBA 4BXIA 5M4MA 1UYMA 4E01A 4DUHA 2FXSA 4LP0A 3VHAA 4LWHA 1YETA 1UYIA 4CWNA 5FWKA 3VHCA 5BODA 1UYGA 1MX0A 1AH6A 4EFUA 3HEKA 1B63A 3ZKDA 2GFDA 4BQJA 4XKOA 3OW6A 4QPJA 5F5RA 5M4HA 2XJGA 4CWTA 2E0AA 3QTFA 4JAVA 4MB9A 1TC6A 2VWCA 3MNRP 3OMUA 5D6QA 3HZ1A 1I5DA 4YKWA 4HXZA 2VCJA 2XDXA 2BU5A 4MPEA 4PRVA 1B3QA 2BTZA 3CRLA 1Y8PA 2XX5A 4ASFA 5L3JA 3VADA 3Q5LA 4AS9A 3IEDA 2Q8GA 5M4NA 4YKXA 2QFOA 4GEEA 4X9LA 5F3KA 1U0ZA 3D2RA 3K97A 2YEHA 4H85A 3ZXQA 3VHDA 2WI6A 4HY6A 3U2DA 3B25A 1UYHA 2GQPA 5D7RA 2ZBKB 4I5SA 4V25A 2YEDA 2CCUA 4L91A 3INWA 1UY9A 5CTWA 3C0EA 4WUCA 4O09A 4MPNA 2WERA 2WI4A 1UYCA 3GIEA 2YEAA 2BYIA 2WEQA 2YKBA 3FV5A 5J6AA 4AWOA 3TZ4A 5CTUA 1YC4A 4P7AA 1TILA 5M4KA 4BQGA 4L94A 2FWYA 3R91A 3G7BA 3GIGB 3O0IA 3A0ZA 5FNDA 5IDMA 4HZ5A 3HYYA 2WI5A 4FPPA 4HY1A 4CWRA 4XE2A 4URMA 3C11A 1NHIA 1ID0A 2YEGA 2CG9A 1KZNA 4CWQA 4HYMA 3T0HA 2BSMA 2XCMA 3GIGA 3OPDA 2AKPA 4YKYA 5CPHA 4GGLA 1AM1A 4ZKIA 2YE9A 1Y4UA 2UWDA 3T1KA 1OSFA 3RLPA 4Q20A 2BU8A 3K99A 1UYKA 3H4LA 3CRKA 2YJXA 4R1FA 3TZ5A 4O0BA 4KSGA 1YT1A 5J71A 1UYLA 4XCLA 4CWSA 4EM7A 4LWEA 5CTXA 4MPCA 1Z59A 3A0XA 4LWFA 4K4OA 4CWOA 2VCIA 4L8ZA 3OWDA 4KTNA 2CH4A 4L93A 2ZKJA 2BU7A 2IOQA 4B6CA 1A4HA 2YKCA 5CTYA 3QDDA 2WI1A 1Z5BA 1AJ6A 3HHUA 3EKOA 2YEEA 3RKZA 1YESA 2HKJA 3EHFA 2BZ5A 2YI7A 4PL9A 2YGAA 3K60A 3A0WA 4EGHA 1R62A 1L0OA 3ZM7A 4BIZA 1AH8A 1JM6A 2YE6A 3TZ2A 5FNFA 4CWPA 1YT0A 2BRCA 5D7CA 2XX2A 3FT5A 1UYDA 1EA6A 2BT0A 5M4PA 3LPSA 1UY8A 2XDSA 4LPBA 4FCPA 3R92A 3TTZA 2BYHA 3R4NA 3OWBA 4KFGA 2FYPA 2IORA 2XJJA 3KE6A 2Q8IA 1Y4SA 2EXLA 3EHHA 3Q5JA 1I5AA 2XHXA 5M4EA 4GCZA 1YSRA 4E00A 2XDKA 5IDJA 3INXA 1Z5CA 1NHHA 4GQTA 4CE1A 2YECA 3LNUA 1ZXNA 3Q5KA 4JASA 2QG2A 4XITA 2YKIA 2YEIA 4AWPA 1QY8A 4URNA 1MU5A 3SL2A 4BIUA 4YKRA 1ZWHA 2YI6A 1BGQA 4EFTA 1GKZA 4XDMA 2WI7A 3G75A 2JJCA 3U2KA 1UYEA 2Q8HA 1YT2A 4E02A 4P8OA 3RLRA 2YJWA 3B24A 3A0RA 1TC0A 4O04A 2YGEA 4QPKA 1ZXMA 4MP2A 2YEBA 4FMTA 3NMQA 1TBWA 1I59A 2XK2A 4ZVIA 3PEJA 1UY6A 4GFNA 1B62A 4ASBA 4EEHA 4H81A 4YKUA 5D7DA 2IWUA 4HXWA 1Y8NA 4O07A 2O1VA 1S14A 4I3HA 1YS3A 4U93A 2XDLA 3D36A 2O1WA 2ESAA 3U67A 2CCTA 1PVGA 2ZDYA 4CWFA 5C93A 3K98A 3R4PA 4NH7A 2XX4A 5FNCA 2FWZA 5BOCA 3T0ZA 4EMVA 4MP7A 2YEJA 4CE3A 1QYEA 3B27A 2BU2A 4URLA 1S16A 4XCJA 2YK2A 2Q2EB 1U2OA 2HCHA
chains in the Genus database with same CATH superfamily
3ZXOA 4JQLA 2XABA 2YGFA 3T10A 2WEPA 2CGFA 1I5BA 3D0BA 3WHAA 2YE7A 1BYQA 2YE4A 3EKRA 1US7A 1NHJA 4R3MA 2IWXA 1YC3A 4WUDA 4HYPA 1I5CA 4FCQA 4ASGA 2WI2A 5IN9A 1Z5AA 4EGIA 2XJXA 2K5BA 1TH8A 2BU6A 5GGZA 4XD8A 4XC0A 1BKNA 5D6PA 5CF0A 4XTJA 4MOTA 2H55A 3HZ5A 3O2FA 2Q8FA 3CYGA 4KSHA 3PEHA 4WUBA 3EHGA 3FT8A 2BREA 2HG1A 3B28A 4O05A 3GIFA 1YSZA 2HHIA 4R3AA 3G7EA 2XD6A 3DGEA 4V26A 4YKTA 1YERA 1GJVA 2QG0A 3R4OA 2YE2A 1ZW9A 4B7PA 3H80A 4YKZA 3T2SA 1AMWA 1I58A 2C2AA 4NH8A 3CGZA 4H7QA 1Y8OA 4YKQA 2YI0A 1THNA 4KP4A 2JKIA 2YE8A 2YK9A 2XHRA 3R4MA 3TUHA 3B26A 4DZYA 3BM9A 4LWGA 3A0YA 3BMYA 1GKXA 3RLQA 3TZ0A 4U7NA 4ASAA 3CWVA 4LWIA 3CGYA 2YKEA 1H7SA 2ZDXA 2XDUA 4MBCA 1H7UA 4AWQA 2XHTA 4XIRA 4PU9A 4W7TA 2YE5A 1KIJA 2PNRA 4CE2A 4L90A 3A0TA 4HZ0A 1BXDA 4KQVA 4UROA 2WI3A 4FCRA 2H8MA 4U7OA 4NH9A 1UYFA 1QZRA 4EGKA 1TIDA 3HYZA 2YE3A 3EHJA 4GT8A 2YI5A 4XKAA 4XKKA 1EI1A 2VW5A 1UY7A 3JZ3A 4PRXA 4JAUA 2QF6A 4XIPA 2YEFA 3O6OA 2IWSA 2O1UA 3WQ9A 4BAEA 2IOPA 1YC1A 4XIQA 2YKJA 2CCSA 3ZKBA 4BXIA 5M4MA 1UYMA 4E01A 4DUHA 2FXSA 4LP0A 3VHAA 4LWHA 1YETA 1UYIA 4CWNA 5FWKA 3VHCA 5BODA 1UYGA 1MX0A 3S5TA 1AH6A 4EFUA 3HEKA 1B63A 3ZKDA 2GFDA 4BQJA 4XKOA 3OW6A 4QPJA 5F5RA 5M4HA 2XJGA 4CWTA 2E0AA 3QTFA 4JAVA 4MB9A 1TC6A 2VWCA 3MNRP 3OMUA 5D6QA 3HZ1A 1I5DA 4YKWA 4HXZA 2VCJA 2XDXA 2BU5A 4MPEA 4PRVA 1B3QA 2BTZA 3CRLA 1Y8PA 2XX5A 4ASFA 5L3JA 3VADA 3Q5LA 4AS9A 3IEDA 2Q8GA 5M4NA 4YKXA 2QFOA 4GEEA 4X9LA 5F3KA 1U0ZA 3D2RA 3K97A 2YEHA 4H85A 3ZXQA 3VHDA 2WI6A 4HY6A 3U2DA 3B25A 1UYHA 2GQPA 5D7RA 2ZBKB 4I5SA 4V25A 2YEDA 2CCUA 4L91A 3INWA 1UY9A 5CTWA 3C0EA 4WUCA 4O09A 4MPNA 2WERA 2WI4A 1UYCA 3GIEA 2YEAA 2BYIA 2WEQA 2YKBA 3FV5A 5J6AA 4AWOA 3TZ4A 5CTUA 1YC4A 4P7AA 1TILA 5M4KA 4BQGA 4L94A 2FWYA 3R91A 3G7BA 3GIGB 3O0IA 3A0ZA 5FNDA 5IDMA 4HZ5A 3HYYA 2WI5A 4FPPA 4HY1A 4CWRA 4XE2A 4URMA 3C11A 1NHIA 1ID0A 2YEGA 2CG9A 1KZNA 4CWQA 4HYMA 3T0HA 2BSMA 2XCMA 3GIGA 3OPDA 2AKPA 4YKYA 5CPHA 4GGLA 1AM1A 4ZKIA 2YE9A 1Y4UA 2UWDA 3T1KA 1OSFA 3RLPA 4Q20A 2BU8A 3K99A 1UYKA 3H4LA 3CRKA 2YJXA 4R1FA 3TZ5A 4O0BA 4KSGA 1YT1A 5J71A 1UYLA 1F51A 4XCLA 4CWSA 4EM7A 4LWEA 5CTXA 4MPCA 1Z59A 3A0XA 4LWFA 4K4OA 4CWOA 2VCIA 4L8ZA 3OWDA 4KTNA 5JENA 2CH4A 4L93A 2ZKJA 2BU7A 2IOQA 4B6CA 1A4HA 1IXMA 2YKCA 5CTYA 3QDDA 2WI1A 1Z5BA 1AJ6A 3HHUA 3EKOA 2YEEA 3RKZA 1YESA 2HKJA 3EHFA 2BZ5A 2YI7A 4PL9A 2YGAA 3K60A 3A0WA 4EGHA 1R62A 1L0OA 3ZM7A 4BIZA 1AH8A 1JM6A 2YE6A 3TZ2A 5FNFA 4CWPA 1YT0A 2BRCA 5D7CA 2XX2A 3FT5A 1UYDA 1EA6A 2BT0A 5M4PA 3LPSA 1UY8A 2XDSA 4LPBA 4FCPA 3R92A 3TTZA 2BYHA 3R4NA 3OWBA 4KFGA 2FYPA 2IORA 2XJJA 2C1GA 3KE6A 2Q8IA 1Y4SA 2EXLA 3EHHA 3Q5JA 1I5AA 2XHXA 5M4EA 4GCZA 1YSRA 4E00A 2XDKA 5IDJA 4E72A 3INXA 1Z5CA 1NHHA 4GQTA 4CE1A 2YECA 3LNUA 1ZXNA 3Q5KA 4JASA 2QG2A 4XITA 2YKIA 2YEIA 4AWPA 1QY8A 4URNA 1MU5A 3SL2A 4BIUA 4YKRA 1ZWHA 2YI6A 1BGQA 2FTKA 4EFTA 1GKZA 4XDMA 2WI7A 3G75A 2JJCA 3U2KA 1UYEA 2Q8HA 1YT2A 4E02A 4P8OA 3RLRA 2YJWA 3B24A 3A0RA 1TC0A 4O04A 2YGEA 4QPKA 1ZXMA 4MP2A 2YEBA 3NMQA 4FMTA 1TBWA 1I59A 2XK2A 4ZVIA 3PEJA 1UY6A 4GFNA 1B62A 4ASBA 4EEHA 4H81A 4YKUA 5D7DA 2IWUA 4HXWA 1Y8NA 4O07A 2O1VA 1S14A 4I3HA 1YS3A 4U93A 3LMMA 2XDLA 3D36A 2O1WA 2ESAA 3U67A 2CCTA 1PVGA 2ZDYA 4CWFA 5C93A 2C1IA 3K98A 3R4PA 4NH7A 2XX4A 5FNCA 2FWZA 5BOCA 3T0ZA 4EMVA 4MP7A 2YEJA 4CE3A 1QYEA 3B27A 2BU2A 4URLA 1S16A 4XCJA 2YK2A 2Q2EB 1U2OA 2HCHA
chains in the Genus database with same CATH topology
3ZXOA 4JQLA 2XABA 2YGFA 3T10A 2WEPA 2CGFA 1I5BA 3D0BA 3WHAA 2YE7A 1BYQA 2YE4A 3EKRA 1US7A 1NHJA 4R3MA 2IWXA 1YC3A 4WUDA 4HYPA 1I5CA 4FCQA 4ASGA 2WI2A 5IN9A 1Z5AA 4EGIA 2XJXA 2K5BA 1TH8A 2BU6A 5GGZA 4XD8A 4XC0A 1BKNA 5D6PA 5CF0A 4XTJA 4MOTA 2H55A 3HZ5A 3O2FA 2Q8FA 4KSHA 3PEHA 4WUBA 3EHGA 3FT8A 2BREA 2HG1A 3B28A 4O05A 3GIFA 1YSZA 4R3AA 3G7EA 2XD6A 3DGEA 4V26A 4YKTA 1YERA 1GJVA 2QG0A 3R4OA 2YE2A 1ZW9A 4B7PA 3H80A 4YKZA 3T2SA 1AMWA 1I58A 2C2AA 4NH8A 3CGZA 4H7QA 1Y8OA 4YKQA 2YI0A 1THNA 4KP4A 2JKIA 2YE8A 2YK9A 2XHRA 3R4MA 3TUHA 3B26A 4DZYA 3BM9A 4LWGA 3A0YA 3BMYA 1GKXA 3RLQA 3TZ0A 4U7NA 4ASAA 3CWVA 4LWIA 3CGYA 2YKEA 1H7SA 2ZDXA 2XDUA 4MBCA 1H7UA 4AWQA 2XHTA 4XIRA 4PU9A 4W7TA 2YE5A 1KIJA 2PNRA 4CE2A 4L90A 3A0TA 4HZ0A 1BXDA 4KQVA 4UROA 2WI3A 4FCRA 2H8MA 4U7OA 4NH9A 1UYFA 1QZRA 4EGKA 1TIDA 3HYZA 2YE3A 3EHJA 4GT8A 2YI5A 4XKAA 4XKKA 1EI1A 2VW5A 1UY7A 3JZ3A 4PRXA 4JAUA 2QF6A 4XIPA 2YEFA 3O6OA 2IWSA 2O1UA 3WQ9A 4BAEA 2IOPA 1YC1A 4XIQA 2YKJA 2CCSA 3ZKBA 4BXIA 5M4MA 1UYMA 4E01A 4DUHA 2FXSA 4LP0A 3VHAA 4LWHA 1YETA 1UYIA 4CWNA 5FWKA 3VHCA 5BODA 1UYGA 1MX0A 1AH6A 4EFUA 3HEKA 1B63A 3ZKDA 2GFDA 4BQJA 4XKOA 3OW6A 4QPJA 5F5RA 5M4HA 2XJGA 4CWTA 2E0AA 3QTFA 4JAVA 4MB9A 1TC6A 2VWCA 3MNRP 3OMUA 5D6QA 3HZ1A 1I5DA 4YKWA 4HXZA 2VCJA 2XDXA 2BU5A 4MPEA 4PRVA 1B3QA 2BTZA 3CRLA 1Y8PA 2XX5A 4ASFA 5L3JA 3VADA 3Q5LA 4AS9A 3IEDA 2Q8GA 5M4NA 4YKXA 2QFOA 4GEEA 4X9LA 5F3KA 1U0ZA 3D2RA 3K97A 2YEHA 4H85A 3ZXQA 3VHDA 2WI6A 4HY6A 3U2DA 3B25A 1UYHA 2GQPA 5D7RA 2ZBKB 4I5SA 4V25A 2YEDA 2CCUA 4L91A 3INWA 1UY9A 5CTWA 3C0EA 4WUCA 4O09A 4MPNA 2WERA 2WI4A 1UYCA 3GIEA 2YEAA 2BYIA 2WEQA 2YKBA 3FV5A 5J6AA 4AWOA 3TZ4A 5CTUA 1YC4A 4P7AA 1TILA 5M4KA 4BQGA 4L94A 2FWYA 3R91A 3G7BA 3GIGB 3O0IA 3A0ZA 5FNDA 5IDMA 4HZ5A 3HYYA 2WI5A 4FPPA 4HY1A 4CWRA 4XE2A 4URMA 3C11A 1NHIA 1ID0A 2YEGA 2CG9A 1KZNA 4CWQA 4HYMA 3T0HA 2BSMA 2XCMA 3GIGA 3OPDA 2AKPA 4YKYA 5CPHA 4GGLA 1AM1A 4ZKIA 2YE9A 1Y4UA 2UWDA 3T1KA 1OSFA 3RLPA 4Q20A 2BU8A 3K99A 1UYKA 3H4LA 3CRKA 2YJXA 4R1FA 3TZ5A 4O0BA 4KSGA 1YT1A 5J71A 1UYLA 4XCLA 4CWSA 4EM7A 4LWEA 5CTXA 4MPCA 1Z59A 3A0XA 4LWFA 4K4OA 4CWOA 2VCIA 4L8ZA 3OWDA 4KTNA 2CH4A 4L93A 2ZKJA 2BU7A 2IOQA 4B6CA 1A4HA 2YKCA 5CTYA 3QDDA 2WI1A 1Z5BA 1AJ6A 3HHUA 3EKOA 2YEEA 3RKZA 1YESA 2HKJA 3EHFA 2BZ5A 2YI7A 4PL9A 2YGAA 3K60A 3A0WA 4EGHA 1R62A 1L0OA 3ZM7A 4BIZA 1AH8A 1JM6A 2YE6A 3TZ2A 5FNFA 4CWPA 1YT0A 2BRCA 5D7CA 2XX2A 3FT5A 1UYDA 1EA6A 2BT0A 5M4PA 3LPSA 1UY8A 2XDSA 4LPBA 4FCPA 3R92A 3TTZA 2BYHA 3R4NA 3OWBA 4KFGA 2FYPA 2IORA 2XJJA 3KE6A 2Q8IA 1Y4SA 2EXLA 3EHHA 3Q5JA 1I5AA 2XHXA 5M4EA 4GCZA 1YSRA 4E00A 2XDKA 5IDJA 3INXA 1Z5CA 1NHHA 4GQTA 4CE1A 2YECA 3LNUA 1ZXNA 3Q5KA 4JASA 2QG2A 4XITA 2YKIA 2YEIA 4AWPA 1QY8A 4URNA 1MU5A 3SL2A 4BIUA 4YKRA 1ZWHA 2YI6A 1BGQA 4EFTA 1GKZA 4XDMA 2WI7A 3G75A 2JJCA 3U2KA 1UYEA 2Q8HA 1YT2A 4E02A 4P8OA 3RLRA 2YJWA 3B24A 3A0RA 1TC0A 4O04A 2YGEA 4QPKA 1ZXMA 4MP2A 2YEBA 4FMTA 3NMQA 1TBWA 1I59A 2XK2A 4ZVIA 3PEJA 1UY6A 4GFNA 1B62A 4ASBA 4EEHA 4H81A 4YKUA 5D7DA 2IWUA 4HXWA 1Y8NA 4O07A 2O1VA 1S14A 4I3HA 1YS3A 4U93A 2XDLA 3D36A 2O1WA 2ESAA 3U67A 2CCTA 1PVGA 2ZDYA 4CWFA 5C93A 3K98A 3R4PA 4NH7A 2XX4A 5FNCA 2FWZA 5BOCA 3T0ZA 4EMVA 4MP7A 2YEJA 4CE3A 1QYEA 3B27A 2BU2A 4URLA 1S16A 4XCJA 2YK2A 2Q2EB 1U2OA 2HCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZXO A;  4JQL A;  2XAB A;  2YGF A;  3T10 A;  2WEP A;  2CGF A;  1I5B A;  3D0B A;  3WHA A;  2YE7 A;  1BYQ A;  2YE4 A;  3EKR A;  1US7 A;  1NHJ A;  4R3M A;  2IWX A;  1YC3 A;  4WUD A;  4HYP A;  1I5C A;  4FCQ A;  4ASG A;  2WI2 A;  5IN9 A;  1Z5A A;  4EGI A;  2XJX A;  2K5B A;  1TH8 A;  2BU6 A;  5GGZ A;  4XD8 A;  4XC0 A;  1BKN A;  5D6P A;  5CF0 A;  4XTJ A;  4MOT A;  2H55 A;  3HZ5 A;  3O2F A;  2Q8F A;  4KSH A;  3PEH A;  4WUB A;  3EHG A;  3FT8 A;  2BRE A;  2HG1 A;  3B28 A;  4O05 A;  3GIF A;  1YSZ A;  4R3A A;  3G7E A;  2XD6 A;  3DGE A;  4V26 A;  4YKT A;  1YER A;  1GJV A;  2QG0 A;  3R4O A;  2YE2 A;  1ZW9 A;  4B7P A;  3H80 A;  4YKZ A;  3T2S A;  1AMW A;  1I58 A;  2C2A A;  4NH8 A;  3CGZ A;  4H7Q A;  1Y8O A;  4YKQ A;  2YI0 A;  1THN A;  4KP4 A;  2JKI A;  2YE8 A;  2YK9 A;  2XHR A;  3R4M A;  3TUH A;  3B26 A;  4DZY A;  3BM9 A;  4LWG A;  3A0Y A;  3BMY A;  1GKX A;  3RLQ A;  3TZ0 A;  4U7N A;  4ASA A;  3CWV A;  4LWI A;  3CGY A;  2YKE A;  1H7S A;  2ZDX A;  2XDU A;  4MBC A;  1H7U A;  4AWQ A;  2XHT A;  4XIR A;  4PU9 A;  4W7T A;  2YE5 A;  1KIJ A;  2PNR A;  4CE2 A;  4L90 A;  3A0T A;  4HZ0 A;  1BXD A;  4KQV A;  4URO A;  2WI3 A;  4FCR A;  2H8M A;  4U7O A;  4NH9 A;  1UYF A;  1QZR A;  4EGK A;  1TID A;  3HYZ A;  2YE3 A;  3EHJ A;  4GT8 A;  2YI5 A;  4XKA A;  4XKK A;  1EI1 A;  2VW5 A;  1UY7 A;  3JZ3 A;  4PRX A;  4JAU A;  2QF6 A;  4XIP A;  2YEF A;  3O6O A;  2IWS A;  2O1U A;  3WQ9 A;  4BAE A;  2IOP A;  1YC1 A;  4XIQ A;  2YKJ A;  2CCS A;  3ZKB A;  4BXI A;  5M4M A;  1UYM A;  4E01 A;  4DUH A;  2FXS A;  4LP0 A;  3VHA A;  4LWH A;  1YET A;  1UYI A;  4CWN A;  5FWK A;  3VHC A;  5BOD A;  1UYG A;  1MX0 A;  1AH6 A;  4EFU A;  3HEK A;  1B63 A;  3ZKD A;  2GFD A;  4BQJ A;  4XKO A;  3OW6 A;  4QPJ A;  5F5R A;  5M4H A;  2XJG A;  4CWT A;  2E0A A;  3QTF A;  4JAV A;  4MB9 A;  1TC6 A;  2VWC A;  3MNR P;  3OMU A;  5D6Q A;  3HZ1 A;  1I5D A;  4YKW A;  4HXZ A;  2VCJ A;  2XDX A;  2BU5 A;  4MPE A;  4PRV A;  1B3Q A;  2BTZ A;  3CRL A;  1Y8P A;  2XX5 A;  4ASF A;  5L3J A;  3VAD A;  3Q5L A;  4AS9 A;  3IED A;  2Q8G A;  5M4N A;  4YKX A;  2QFO A;  4GEE A;  4X9L A;  5F3K A;  1U0Z A;  3D2R A;  3K97 A;  2YEH A;  4H85 A;  3ZXQ A;  3VHD A;  2WI6 A;  4HY6 A;  3U2D A;  3B25 A;  1UYH A;  2GQP A;  5D7R A;  2ZBK B;  4I5S A;  4V25 A;  2YED A;  2CCU A;  4L91 A;  3INW A;  1UY9 A;  5CTW A;  3C0E A;  4WUC A;  4O09 A;  4MPN A;  2WER A;  2WI4 A;  1UYC A;  3GIE A;  2YEA A;  2BYI A;  2WEQ A;  2YKB A;  3FV5 A;  5J6A A;  4AWO A;  3TZ4 A;  5CTU A;  1YC4 A;  4P7A A;  1TIL A;  5M4K A;  4BQG A;  4L94 A;  2FWY A;  3R91 A;  3G7B A;  3GIG B;  3O0I A;  3A0Z A;  5FND A;  5IDM A;  4HZ5 A;  3HYY A;  2WI5 A;  4FPP A;  4HY1 A;  4CWR A;  4XE2 A;  4URM A;  3C11 A;  1NHI A;  1ID0 A;  2YEG A;  2CG9 A;  1KZN A;  4CWQ A;  4HYM A;  3T0H A;  2BSM A;  2XCM A;  3GIG A;  3OPD A;  2AKP A;  4YKY A;  5CPH A;  4GGL A;  1AM1 A;  4ZKI A;  2YE9 A;  1Y4U A;  2UWD A;  3T1K A;  1OSF A;  3RLP A;  4Q20 A;  2BU8 A;  3K99 A;  1UYK A;  3H4L A;  3CRK A;  2YJX A;  4R1F A;  3TZ5 A;  4O0B A;  4KSG A;  1YT1 A;  5J71 A;  1UYL A;  4XCL A;  4CWS A;  4EM7 A;  4LWE A;  5CTX A;  4MPC A;  1Z59 A;  3A0X A;  4LWF A;  4K4O A;  4CWO A;  2VCI A;  4L8Z A;  3OWD A;  4KTN A;  2CH4 A;  4L93 A;  2ZKJ A;  2BU7 A;  2IOQ A;  4B6C A;  1A4H A;  2YKC A;  5CTY A;  3QDD A;  2WI1 A;  1Z5B A;  1AJ6 A;  3HHU A;  3EKO A;  2YEE A;  3RKZ A;  1YES A;  2HKJ A;  3EHF A;  2BZ5 A;  2YI7 A;  4PL9 A;  2YGA A;  3K60 A;  3A0W A;  4EGH A;  1R62 A;  1L0O A;  3ZM7 A;  4BIZ A;  1AH8 A;  1JM6 A;  2YE6 A;  3TZ2 A;  5FNF A;  4CWP A;  1YT0 A;  2BRC A;  5D7C A;  2XX2 A;  3FT5 A;  1UYD A;  1EA6 A;  2BT0 A;  5M4P A;  3LPS A;  1UY8 A;  2XDS A;  4LPB A;  4FCP A;  3R92 A;  3TTZ A;  2BYH A;  3R4N A;  3OWB A;  4KFG A;  2FYP A;  2IOR A;  2XJJ A;  3KE6 A;  2Q8I A;  1Y4S A;  2EXL A;  3EHH A;  3Q5J A;  1I5A A;  2XHX A;  5M4E A;  4GCZ A;  1YSR A;  4E00 A;  2XDK A;  5IDJ A;  3INX A;  1Z5C A;  1NHH A;  4GQT A;  4CE1 A;  2YEC A;  3LNU A;  1ZXN A;  3Q5K A;  4JAS A;  2QG2 A;  4XIT A;  2YKI A;  2YEI A;  4AWP A;  1QY8 A;  4URN A;  1MU5 A;  3SL2 A;  4BIU A;  4YKR A;  1ZWH A;  2YI6 A;  1BGQ A;  4EFT A;  1GKZ A;  4XDM A;  2WI7 A;  3G75 A;  2JJC A;  3U2K A;  1UYE A;  2Q8H A;  1YT2 A;  4E02 A;  4P8O A;  3RLR A;  2YJW A;  3B24 A;  3A0R A;  1TC0 A;  4O04 A;  2YGE A;  4QPK A;  1ZXM A;  4MP2 A;  2YEB A;  4FMT A;  3NMQ A;  1TBW A;  1I59 A;  2XK2 A;  4ZVI A;  3PEJ A;  1UY6 A;  4GFN A;  1B62 A;  4ASB A;  4EEH A;  4H81 A;  4YKU A;  5D7D A;  2IWU A;  4HXW A;  1Y8N A;  4O07 A;  2O1V A;  1S14 A;  4I3H A;  1YS3 A;  4U93 A;  2XDL A;  3D36 A;  2O1W A;  2ESA A;  3U67 A;  2CCT A;  1PVG A;  2ZDY A;  4CWF A;  5C93 A;  3K98 A;  3R4P A;  4NH7 A;  2XX4 A;  5FNC A;  2FWZ A;  5BOC A;  3T0Z A;  4EMV A;  4MP7 A;  2YEJ A;  4CE3 A;  1QYE A;  3B27 A;  2BU2 A;  4URL A;  1S16 A;  4XCJ A;  2YK2 A;  2Q2E B;  1U2O A;  2HCH A; 
#chains in the Genus database with same CATH topology
 3ZXO A;  4JQL A;  2XAB A;  2YGF A;  3T10 A;  2WEP A;  2CGF A;  1I5B A;  3D0B A;  3WHA A;  2YE7 A;  1BYQ A;  2YE4 A;  3EKR A;  1US7 A;  1NHJ A;  4R3M A;  2IWX A;  1YC3 A;  4WUD A;  4HYP A;  1I5C A;  4FCQ A;  4ASG A;  2WI2 A;  5IN9 A;  1Z5A A;  4EGI A;  2XJX A;  2K5B A;  1TH8 A;  2BU6 A;  5GGZ A;  4XD8 A;  4XC0 A;  1BKN A;  5D6P A;  5CF0 A;  4XTJ A;  4MOT A;  2H55 A;  3HZ5 A;  3O2F A;  2Q8F A;  3CYG A;  4KSH A;  3PEH A;  4WUB A;  3EHG A;  3FT8 A;  2BRE A;  2HG1 A;  3B28 A;  4O05 A;  3GIF A;  1YSZ A;  2HHI A;  4R3A A;  3G7E A;  2XD6 A;  3DGE A;  4V26 A;  4YKT A;  1YER A;  1GJV A;  2QG0 A;  3R4O A;  2YE2 A;  1ZW9 A;  4B7P A;  3H80 A;  4YKZ A;  3T2S A;  1AMW A;  1I58 A;  2C2A A;  4NH8 A;  3CGZ A;  4H7Q A;  1Y8O A;  4YKQ A;  2YI0 A;  1THN A;  4KP4 A;  2JKI A;  2YE8 A;  2YK9 A;  2XHR A;  3R4M A;  3TUH A;  3B26 A;  4DZY A;  3BM9 A;  4LWG A;  3A0Y A;  3BMY A;  1GKX A;  3RLQ A;  3TZ0 A;  4U7N A;  4ASA A;  3CWV A;  4LWI A;  3CGY A;  2YKE A;  1H7S A;  2ZDX A;  2XDU A;  4MBC A;  1H7U A;  4AWQ A;  2XHT A;  4XIR A;  4PU9 A;  4W7T A;  2YE5 A;  1KIJ A;  2PNR A;  4CE2 A;  4L90 A;  3A0T A;  4HZ0 A;  1BXD A;  4KQV A;  4URO A;  2WI3 A;  4FCR A;  2H8M A;  4U7O A;  4NH9 A;  1UYF A;  1QZR A;  4EGK A;  1TID A;  3HYZ A;  2YE3 A;  3EHJ A;  4GT8 A;  2YI5 A;  4XKA A;  4XKK A;  1EI1 A;  2VW5 A;  1UY7 A;  3JZ3 A;  4PRX A;  4JAU A;  2QF6 A;  4XIP A;  2YEF A;  3O6O A;  2IWS A;  2O1U A;  3WQ9 A;  4BAE A;  2IOP A;  1YC1 A;  4XIQ A;  2YKJ A;  2CCS A;  3ZKB A;  4BXI A;  5M4M A;  1UYM A;  4E01 A;  4DUH A;  2FXS A;  4LP0 A;  3VHA A;  4LWH A;  1YET A;  1UYI A;  4CWN A;  5FWK A;  3VHC A;  5BOD A;  1UYG A;  1MX0 A;  3S5T A;  1AH6 A;  4EFU A;  3HEK A;  1B63 A;  3ZKD A;  2GFD A;  4BQJ A;  4XKO A;  3OW6 A;  4QPJ A;  5F5R A;  5M4H A;  2XJG A;  4CWT A;  2E0A A;  3QTF A;  4JAV A;  4MB9 A;  1TC6 A;  2VWC A;  3MNR P;  3OMU A;  5D6Q A;  3HZ1 A;  1I5D A;  4YKW A;  4HXZ A;  2VCJ A;  2XDX A;  2BU5 A;  4MPE A;  4PRV A;  1B3Q A;  2BTZ A;  3CRL A;  1Y8P A;  2XX5 A;  4ASF A;  5L3J A;  3VAD A;  3Q5L A;  4AS9 A;  3IED A;  2Q8G A;  5M4N A;  4YKX A;  2QFO A;  4GEE A;  4X9L A;  5F3K A;  1U0Z A;  3D2R A;  3K97 A;  2YEH A;  4H85 A;  3ZXQ A;  3VHD A;  2WI6 A;  4HY6 A;  3U2D A;  3B25 A;  1UYH A;  2GQP A;  5D7R A;  2ZBK B;  4I5S A;  4V25 A;  2YED A;  2CCU A;  4L91 A;  3INW A;  1UY9 A;  5CTW A;  3C0E A;  4WUC A;  4O09 A;  4MPN A;  2WER A;  2WI4 A;  1UYC A;  3GIE A;  2YEA A;  2BYI A;  2WEQ A;  2YKB A;  3FV5 A;  5J6A A;  4AWO A;  3TZ4 A;  5CTU A;  1YC4 A;  4P7A A;  1TIL A;  5M4K A;  4BQG A;  4L94 A;  2FWY A;  3R91 A;  3G7B A;  3GIG B;  3O0I A;  3A0Z A;  5FND A;  5IDM A;  4HZ5 A;  3HYY A;  2WI5 A;  4FPP A;  4HY1 A;  4CWR A;  4XE2 A;  4URM A;  3C11 A;  1NHI A;  1ID0 A;  2YEG A;  2CG9 A;  1KZN A;  4CWQ A;  4HYM A;  3T0H A;  2BSM A;  2XCM A;  3GIG A;  3OPD A;  2AKP A;  4YKY A;  5CPH A;  4GGL A;  1AM1 A;  4ZKI A;  2YE9 A;  1Y4U A;  2UWD A;  3T1K A;  1OSF A;  3RLP A;  4Q20 A;  2BU8 A;  3K99 A;  1UYK A;  3H4L A;  3CRK A;  2YJX A;  4R1F A;  3TZ5 A;  4O0B A;  4KSG A;  1YT1 A;  5J71 A;  1UYL A;  1F51 A;  4XCL A;  4CWS A;  4EM7 A;  4LWE A;  5CTX A;  4MPC A;  1Z59 A;  3A0X A;  4LWF A;  4K4O A;  4CWO A;  2VCI A;  4L8Z A;  3OWD A;  4KTN A;  5JEN A;  2CH4 A;  4L93 A;  2ZKJ A;  2BU7 A;  2IOQ A;  4B6C A;  1A4H A;  1IXM A;  2YKC A;  5CTY A;  3QDD A;  2WI1 A;  1Z5B A;  1AJ6 A;  3HHU A;  3EKO A;  2YEE A;  3RKZ A;  1YES A;  2HKJ A;  3EHF A;  2BZ5 A;  2YI7 A;  4PL9 A;  2YGA A;  3K60 A;  3A0W A;  4EGH A;  1R62 A;  1L0O A;  3ZM7 A;  4BIZ A;  1AH8 A;  1JM6 A;  2YE6 A;  3TZ2 A;  5FNF A;  4CWP A;  1YT0 A;  2BRC A;  5D7C A;  2XX2 A;  3FT5 A;  1UYD A;  1EA6 A;  2BT0 A;  5M4P A;  3LPS A;  1UY8 A;  2XDS A;  4LPB A;  4FCP A;  3R92 A;  3TTZ A;  2BYH A;  3R4N A;  3OWB A;  4KFG A;  2FYP A;  2IOR A;  2XJJ A;  2C1G A;  3KE6 A;  2Q8I A;  1Y4S A;  2EXL A;  3EHH A;  3Q5J A;  1I5A A;  2XHX A;  5M4E A;  4GCZ A;  1YSR A;  4E00 A;  2XDK A;  5IDJ A;  4E72 A;  3INX A;  1Z5C A;  1NHH A;  4GQT A;  4CE1 A;  2YEC A;  3LNU A;  1ZXN A;  3Q5K A;  4JAS A;  2QG2 A;  4XIT A;  2YKI A;  2YEI A;  4AWP A;  1QY8 A;  4URN A;  1MU5 A;  3SL2 A;  4BIU A;  4YKR A;  1ZWH A;  2YI6 A;  1BGQ A;  2FTK A;  4EFT A;  1GKZ A;  4XDM A;  2WI7 A;  3G75 A;  2JJC A;  3U2K A;  1UYE A;  2Q8H A;  1YT2 A;  4E02 A;  4P8O A;  3RLR A;  2YJW A;  3B24 A;  3A0R A;  1TC0 A;  4O04 A;  2YGE A;  4QPK A;  1ZXM A;  4MP2 A;  2YEB A;  3NMQ A;  4FMT A;  1TBW A;  1I59 A;  2XK2 A;  4ZVI A;  3PEJ A;  1UY6 A;  4GFN A;  1B62 A;  4ASB A;  4EEH A;  4H81 A;  4YKU A;  5D7D A;  2IWU A;  4HXW A;  1Y8N A;  4O07 A;  2O1V A;  1S14 A;  4I3H A;  1YS3 A;  4U93 A;  3LMM A;  2XDL A;  3D36 A;  2O1W A;  2ESA A;  3U67 A;  2CCT A;  1PVG A;  2ZDY A;  4CWF A;  5C93 A;  2C1I A;  3K98 A;  3R4P A;  4NH7 A;  2XX4 A;  5FNC A;  2FWZ A;  5BOC A;  3T0Z A;  4EMV A;  4MP7 A;  2YEJ A;  4CE3 A;  1QYE A;  3B27 A;  2BU2 A;  4URL A;  1S16 A;  4XCJ A;  2YK2 A;  2Q2E B;  1U2O A;  2HCH A; 
#chains in the Genus database with same CATH homology
 3ZXO A;  4JQL A;  2XAB A;  2YGF A;  3T10 A;  2WEP A;  2CGF A;  1I5B A;  3D0B A;  3WHA A;  2YE7 A;  1BYQ A;  2YE4 A;  3EKR A;  1US7 A;  1NHJ A;  4R3M A;  2IWX A;  1YC3 A;  4WUD A;  4HYP A;  1I5C A;  4FCQ A;  4ASG A;  2WI2 A;  5IN9 A;  1Z5A A;  4EGI A;  2XJX A;  2K5B A;  1TH8 A;  2BU6 A;  5GGZ A;  4XD8 A;  4XC0 A;  1BKN A;  5D6P A;  5CF0 A;  4XTJ A;  4MOT A;  2H55 A;  3HZ5 A;  3O2F A;  2Q8F A;  4KSH A;  3PEH A;  4WUB A;  3EHG A;  3FT8 A;  2BRE A;  2HG1 A;  3B28 A;  4O05 A;  3GIF A;  1YSZ A;  4R3A A;  3G7E A;  2XD6 A;  3DGE A;  4V26 A;  4YKT A;  1YER A;  1GJV A;  2QG0 A;  3R4O A;  2YE2 A;  1ZW9 A;  4B7P A;  3H80 A;  4YKZ A;  3T2S A;  1AMW A;  1I58 A;  2C2A A;  4NH8 A;  3CGZ A;  4H7Q A;  1Y8O A;  4YKQ A;  2YI0 A;  1THN A;  4KP4 A;  2JKI A;  2YE8 A;  2YK9 A;  2XHR A;  3R4M A;  3TUH A;  3B26 A;  4DZY A;  3BM9 A;  4LWG A;  3A0Y A;  3BMY A;  1GKX A;  3RLQ A;  3TZ0 A;  4U7N A;  4ASA A;  3CWV A;  4LWI A;  3CGY A;  2YKE A;  1H7S A;  2ZDX A;  2XDU A;  4MBC A;  1H7U A;  4AWQ A;  2XHT A;  4XIR A;  4PU9 A;  4W7T A;  2YE5 A;  1KIJ A;  2PNR A;  4CE2 A;  4L90 A;  3A0T A;  4HZ0 A;  1BXD A;  4KQV A;  4URO A;  2WI3 A;  4FCR A;  2H8M A;  4U7O A;  4NH9 A;  1UYF A;  1QZR A;  4EGK A;  1TID A;  3HYZ A;  2YE3 A;  3EHJ A;  4GT8 A;  2YI5 A;  4XKA A;  4XKK A;  1EI1 A;  2VW5 A;  1UY7 A;  3JZ3 A;  4PRX A;  4JAU A;  2QF6 A;  4XIP A;  2YEF A;  3O6O A;  2IWS A;  2O1U A;  3WQ9 A;  4BAE A;  2IOP A;  1YC1 A;  4XIQ A;  2YKJ A;  2CCS A;  3ZKB A;  4BXI A;  5M4M A;  1UYM A;  4E01 A;  4DUH A;  2FXS A;  4LP0 A;  3VHA A;  4LWH A;  1YET A;  1UYI A;  4CWN A;  5FWK A;  3VHC A;  5BOD A;  1UYG A;  1MX0 A;  1AH6 A;  4EFU A;  3HEK A;  1B63 A;  3ZKD A;  2GFD A;  4BQJ A;  4XKO A;  3OW6 A;  4QPJ A;  5F5R A;  5M4H A;  2XJG A;  4CWT A;  2E0A A;  3QTF A;  4JAV A;  4MB9 A;  1TC6 A;  2VWC A;  3MNR P;  3OMU A;  5D6Q A;  3HZ1 A;  1I5D A;  4YKW A;  4HXZ A;  2VCJ A;  2XDX A;  2BU5 A;  4MPE A;  4PRV A;  1B3Q A;  2BTZ A;  3CRL A;  1Y8P A;  2XX5 A;  4ASF A;  5L3J A;  3VAD A;  3Q5L A;  4AS9 A;  3IED A;  2Q8G A;  5M4N A;  4YKX A;  2QFO A;  4GEE A;  4X9L A;  5F3K A;  1U0Z A;  3D2R A;  3K97 A;  2YEH A;  4H85 A;  3ZXQ A;  3VHD A;  2WI6 A;  4HY6 A;  3U2D A;  3B25 A;  1UYH A;  2GQP A;  5D7R A;  2ZBK B;  4I5S A;  4V25 A;  2YED A;  2CCU A;  4L91 A;  3INW A;  1UY9 A;  5CTW A;  3C0E A;  4WUC A;  4O09 A;  4MPN A;  2WER A;  2WI4 A;  1UYC A;  3GIE A;  2YEA A;  2BYI A;  2WEQ A;  2YKB A;  3FV5 A;  5J6A A;  4AWO A;  3TZ4 A;  5CTU A;  1YC4 A;  4P7A A;  1TIL A;  5M4K A;  4BQG A;  4L94 A;  2FWY A;  3R91 A;  3G7B A;  3GIG B;  3O0I A;  3A0Z A;  5FND A;  5IDM A;  4HZ5 A;  3HYY A;  2WI5 A;  4FPP A;  4HY1 A;  4CWR A;  4XE2 A;  4URM A;  3C11 A;  1NHI A;  1ID0 A;  2YEG A;  2CG9 A;  1KZN A;  4CWQ A;  4HYM A;  3T0H A;  2BSM A;  2XCM A;  3GIG A;  3OPD A;  2AKP A;  4YKY A;  5CPH A;  4GGL A;  1AM1 A;  4ZKI A;  2YE9 A;  1Y4U A;  2UWD A;  3T1K A;  1OSF A;  3RLP A;  4Q20 A;  2BU8 A;  3K99 A;  1UYK A;  3H4L A;  3CRK A;  2YJX A;  4R1F A;  3TZ5 A;  4O0B A;  4KSG A;  1YT1 A;  5J71 A;  1UYL A;  4XCL A;  4CWS A;  4EM7 A;  4LWE A;  5CTX A;  4MPC A;  1Z59 A;  3A0X A;  4LWF A;  4K4O A;  4CWO A;  2VCI A;  4L8Z A;  3OWD A;  4KTN A;  2CH4 A;  4L93 A;  2ZKJ A;  2BU7 A;  2IOQ A;  4B6C A;  1A4H A;  2YKC A;  5CTY A;  3QDD A;  2WI1 A;  1Z5B A;  1AJ6 A;  3HHU A;  3EKO A;  2YEE A;  3RKZ A;  1YES A;  2HKJ A;  3EHF A;  2BZ5 A;  2YI7 A;  4PL9 A;  2YGA A;  3K60 A;  3A0W A;  4EGH A;  1R62 A;  1L0O A;  3ZM7 A;  4BIZ A;  1AH8 A;  1JM6 A;  2YE6 A;  3TZ2 A;  5FNF A;  4CWP A;  1YT0 A;  2BRC A;  5D7C A;  2XX2 A;  3FT5 A;  1UYD A;  1EA6 A;  2BT0 A;  5M4P A;  3LPS A;  1UY8 A;  2XDS A;  4LPB A;  4FCP A;  3R92 A;  3TTZ A;  2BYH A;  3R4N A;  3OWB A;  4KFG A;  2FYP A;  2IOR A;  2XJJ A;  3KE6 A;  2Q8I A;  1Y4S A;  2EXL A;  3EHH A;  3Q5J A;  1I5A A;  2XHX A;  5M4E A;  4GCZ A;  1YSR A;  4E00 A;  2XDK A;  5IDJ A;  3INX A;  1Z5C A;  1NHH A;  4GQT A;  4CE1 A;  2YEC A;  3LNU A;  1ZXN A;  3Q5K A;  4JAS A;  2QG2 A;  4XIT A;  2YKI A;  2YEI A;  4AWP A;  1QY8 A;  4URN A;  1MU5 A;  3SL2 A;  4BIU A;  4YKR A;  1ZWH A;  2YI6 A;  1BGQ A;  4EFT A;  1GKZ A;  4XDM A;  2WI7 A;  3G75 A;  2JJC A;  3U2K A;  1UYE A;  2Q8H A;  1YT2 A;  4E02 A;  4P8O A;  3RLR A;  2YJW A;  3B24 A;  3A0R A;  1TC0 A;  4O04 A;  2YGE A;  4QPK A;  1ZXM A;  4MP2 A;  2YEB A;  4FMT A;  3NMQ A;  1TBW A;  1I59 A;  2XK2 A;  4ZVI A;  3PEJ A;  1UY6 A;  4GFN A;  1B62 A;  4ASB A;  4EEH A;  4H81 A;  4YKU A;  5D7D A;  2IWU A;  4HXW A;  1Y8N A;  4O07 A;  2O1V A;  1S14 A;  4I3H A;  1YS3 A;  4U93 A;  2XDL A;  3D36 A;  2O1W A;  2ESA A;  3U67 A;  2CCT A;  1PVG A;  2ZDY A;  4CWF A;  5C93 A;  3K98 A;  3R4P A;  4NH7 A;  2XX4 A;  5FNC A;  2FWZ A;  5BOC A;  3T0Z A;  4EMV A;  4MP7 A;  2YEJ A;  4CE3 A;  1QYE A;  3B27 A;  2BU2 A;  4URL A;  1S16 A;  4XCJ A;  2YK2 A;  2Q2E B;  1U2O A;  2HCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...