2EXUA

Crystal structure of saccharomyces cerevisiae transcription elongation factors spt4-spt5ngn domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
192
structure length
192
Chain Sequence
SERACMLCGIVQTTNEFNRDGCPNCQGIFEEAGVSTMECTSPSFEGLVGMCKPTKSWVAKWLSVDHSIAGMYAIKVDGRLPAEVVELLPHYKPRDGSGSATIWGVRCRPGKEKELIRKLLKKKFNLDRAMGKKKLKILSIFQRDNYTGRIYIEAPKQSVIEKFCNGVPDIYISQKLLIPVQELPLLLKPNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Saccharomyces cerevisiae transcription elongation factors Spt4-Spt5NGN domain
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Transcription initiation protein SPT4/SPT5
total genus 51
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2005-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06093 Spt4 Spt4/RpoE2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.210 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2exuA01
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 2exuA02
3EWGA 3QQCD 1NPRA 4ZN1A 3H7HB 4ZN3A 1M1HA 2OUGA 3H7HA 1NPPA 1M1GA 3LPEA 3P8BB 2LQ8A 2EXUA 2XHCA 1NZ8A 2K06A
chains in the Genus database with same CATH superfamily
2KXFA 4H4OA 1ZZFA 2KZZA 5F8HA 1M5VC 2VJFA 5TDWA 1MU2B 2HRYA 3M8YA 5HBMB 4ED0A 4C8OA 1U2RA 2CPEA 3SCJE 4Z7YA 1BY9A 4C3KA 1UJ4A 4OLOA 3OL9A 2HQ3A 4ED8A 3ZPV1 4RZRA 1U48A 3IM9A 4LBIA 5H1VA 2J7UA 3FAOA 2L9NA 4JUZA 2AF6A 4FVCA 2EG1A 2FFWA 3C16B 2W9AA 1UVLA 1RP5A 2PD1A 3QQCD 1YGYA 2EK6A 3MXHP 2DGTA 1URNA 3O7AA 1VYAA 4ZVRB 3Q83A 4XPCA 3W64A 2XCPA 2YNHB 2N3LA 4IOAQ 2J7KA 2RI7A 1QUPA 5SVIA 3KYLA 3RR8A 2BJEA 5F3TA 2AYEA 2DH7A 2XHCA 2EC2A 4X4NA 3A4TA 2FB0A 1UWAA 3CCJS 2WRMA 3MMAB 1V5VA 2ACYA 3KHRA 5E3QA 1RT3B 3D6FB 4WBFA 4C8NA 3PJ9A 2R8KA 2VOPA 2LLZA 2GHWA 3DMJB 3Q8UA 2W9CB 3VGTA 3KK3B 2YH1A 4CRJA 1FRKA 2DR6A 3RG6A 3A3OB 5CAAA 3ENAA 2RIJA 2N7YA 3W5XA 1HQEA 3IAS9 1URRA 4N77A 2CDRB 3UNGC 3M8QB 4LF2A 1FFSB 1T9WA 4LF8J 1YK9A 4FF3A 2QICA 1ZM4A 1TUVA 2K16A 4IC2A 2ATCB 3Q0AA 4KFBB 3ET6A 1Q95G 1QAXA 5ETNA 2ZM6F 3RZAA 5KFIA 2QIZA 2MPUA 4A8OA 4UT4A 5LSLA 2DXDA 5LOQA 4KKOB 3PR4A 3MEDB 3GR1A 1JLFB 2B6AB 1NM2A 2MKSA 3D1OA 1RXOB 2KYXA 1FK9A 3KFWX 4FPRA 4RBVA 1NSQA 2I50A 1Q8KA 2AJ1A 2OEKA 1O0PA 2GMHA 3U5NA 1HIYA 2JJ4D 3DM2A 5EDWA 5I3LA 2M8DB 3JAMU 3ENWA 2J0XA 3AOAA 4K5SA 3L3CA 1JM7B 2W4CA 5G4DA 7AT1B 4RUAA 4ZUXU 1FE4A 1HD1A 2XYGB 1YBUA 2UP1A 4JI1J 1HBNA 3DDIA 4FXDA 2FVSA 2ZH5A 2JVOA 4KJIA 1PBAA 3SUBA 4I2PB 2BOPA 3K8VA 4QIEA 1KQKA 2KM8C 2IDEA 4IG0B 3K89A 1X4UA 4YBSA 1C1CB 2CSVA 3MGJA 4FYVB 4ZPBA 2DX8A 2VUGA 1JX4A 1PAUB 3OT9A 5GADI 1JLCB 4DL5A 3PRBA 2MSTA 2EVZA 3TX8A 2AGOA 1FP0A 2YKOA 1UEVA 4H4KC 4OJHA 2OMLA 3QGHA 4O0IA 4CI0B 2PI5A 4Q8FA 2KVQE 3D0IE 1EZZB 4O3OA 3SEOA 4DPOA 2DY9A 4KB7A 1D9FA 2Y1MA 1NK4A 1HBMB 1QAIA 2C3YA 2LQBA 3C6UA 3NS5A 1JXLA 4Z2XA 2CJKA 1QE1A 5CABA 1N6QB 3U5MA 4YBMA 3DLHA 3DMJA 2IM0A 4WXOA 2UU9J 1RMDA 3HCTA 2PUYA 5D1KB 2W9BB 1D3WA 3UDEA 3TZYA 1RU2A 3MCMA 3U7JA 2CPJA 2M7SA 1X9WA 4ANDA 4UOFA 3F73A 5DDQC 2VG6A 2MZJA 4DV6F 2CNLB 2BBEA 1U1QA 4NCAA 2QSFA 4URQU 3MURP 1QM9A 2RUSA 5EX3A 4NL5A 1YHQS 2RF2B 4X64F 2IM2A 4DFPA 2GQ2A 2WVDA 2VBWA 4HDHA 3CPWR 5CQGA 3DQVR 1P27B 1T9VA 2FY1A 2MMYA 3I0RA 3E2DA 3BM7A 3S6EA 5B0BA 1KQFB 4UOCA 4TLRA 2KN4A 3NCRA 2LDIA 1FJCA 4AQYJ 3JTNA 3O36A 1WOSA 2OI2A 1HA1A 4P7VA 4RUBA 4NLYA 2F42A 2KFYA 3L7UA 1DBDA 2U2FA 2K3KA 3N6NA 3O5TB 3VAMA 1TKZB 1YRUA 2OD6A 4K0KJ 5LMNJ 4GVBB 5JVHQ 1X4AA 1L3SA 1MSWD 4DUYF 5E0OA 4V1Ak 3AOCA 3MEGA 1MN9A 5T41A 3W65A 2CWXA 3G96A 4K4TA 1CG2A 4J9RA 4OI2A 2WOMA 4RBUA 4P7TA 3R7SB 1IUJA 4HI1A 5HMXA 1RT1A 3SIPB 3G8SA 3IHPA 2HVDA 1TZ0A 2UUCJ 3ITHA 4X4TA 2HK2A 4EBDA 4O23A 2HS3A 3OD2A 1F0XA 1CSJA 4WFYA 3QO9B 2DHGA 2H9ZA 2N3OA 3CXCR 1N5YA 5LJ5Y 4ED5A 4B3OA 3H90A 2ZWPA 3ZVYA 2XEXA 1FVSA 1MW7A 1FWPA 2CRRA 1JXEA 1S1WB 3DRYA 2LGGA 4OYXA 5A0YB 2XCAA 4DV4J 4DR6J 2MSSA 4YDDB 2KKHA 4QPTA 4I7FB 4FJCA 3VALA 4MVTA 2ILZA 2MKHA 3PYDA 2KR4A 3EGNA 4F26A 3IC1A 2MUMA 1ZM3A 1VYXA 1E6VA 2MD7B 3OXGA 1RT4A 4ECRA 3GCXP 3J7YI 1GT8A 2UU9F 1IR2A 2CADA 4PRFA 2HLTA 1MWYA 1Z6UA 8RUCA 4EBCA 2HIYA 2MZ1A 1QSLA 4KFBA 1AT1B 2CPXA 1RT7A 1SJQA 2DGOA 2Q1LA 2E6RA 2IC3A 3HVTA 4DV3F 5I3UA 3LQHA 1FX4A 2WB4A 4RWXA 4FS1A 3QIPB 2RDDA 2ZVIA 2LXHC 1CS4A 1RB0A 2W2NP 3G87A 2VICA 5L1LA 4ZN3A 4ZPWR 2PMWA 4J9KA 5ETRA 5HL7Q 3HM9A 1LV5A 3CD7A 4OHYA 2YNGB 2ZUGA 3MAAB 4ZLJA 3K0JA 1VBYA 1CJKA 3M32A 3SBMA 5GAEI 3CF5Q 2Y1JA 2LEPA 4P2MA 2BJ9A 2CJ9A 5ETMA 5LKZA 3P45B 5GAGU 1KQGB 1TK0A 2VZ9A 2OKQA 1H74A 1K1SA 3NRBA 4Y2IA 4CTAB 1XR6A 1RA7A 2DNHA 2E29A 3ZZZA 4RW9B 1YJVA 4GVBA 4HDGA 4RX6A 3GIJA 2UXBJ 4NRTA 3PACA 3ILIA 5DGBA 2AYMA 4KO0B 2COLA 4A8YA 3O34A 5CYQA 5KAKA 3MM9B 1F6TA 1Y5NB 2I9SA 3VF0B 2G43A 4DX5A 3THVA 1MMLA 3RR7A 4DZ6A 2QSWA 2UV8G 2GS8A 4FNIA 5B76A 1N52B 1S9GA 1NZAA 4CM2A 5F41A 3UI3A 2NREA 4V19X 2CVIA 1APSA 3PG9A 2D8SA 3FL2A 4R8PK 2J9DE 2DGSA 3J80U 1WDTA 3RAQA 1GMWA 5HJXA 3BF4A 1RTJA 3DXSX 5KT2A 1XBWA 3V5RA 3TW0A 1EHWA 2HQFA 1JLBB 2HFVA 2LCWA 3IBWA 3MD1A 4KPYA 1FJ7A 2PFFB 4FXWA 4WWSA 2UXBF 4MMOA 5B75A 1RWKB 2AQ4A 5J2MA 1RKIA 4DI6A 4E98A 2LXPC 3O3LA 2JMDA 3NXZA 2R7XA 3O44A 3P96A 2GQCA 3JSMA 5C25B 3EICA 4KT0C 1WKJA 2HFOA 3MCNA 3GG1A 5E41A 2RDJA 1XNRF 2HHWA 1X9MA 1AYEA 1X4EA 2NAAA 2FY8A 1CPZA 2FUUA 5M2PA 1Z60A 2BANB 4MKBA 1YBAA 5KFEA 3T5HA 1XC9A 3MUVP 4P74A 2AYGA 3HHNB 2DJWA 3A3PB 1I5OB 5FB1A 1VIXA 1S9EB 2R7OA 1SKUB 5I42B 5H9FK 2AKWB 2ECIA 1NXIA 1G1XA 2G9OA 4QWCA 3W2WA 2G0IA 4C11A 3HHLD 3AJ1A 4IC3A 1R89A 2ROPA 3L7PA 3H5YA 1VJWA 1Z2ZA 4ID5B 1JK9B 2VJEB 4KTQA 3KG1A 1QJHA 4R8UA 3I55S 1Y3JA 4LFAF 4H4KA 4MT1A 1X4BA 1EB0A 4I7DA 1FDBA 2DHSA 2OPRB 2V6AA 4Q43A 5J2PA 1KHWA 3RBDA 2XNQA 2OP5A 3LP2B 4OX6A 4EI2A 3TZZA 2QEXS 1LWCA 3BQ1A 1CJTA 1N36J 3K58A 3AQPA 3G6YA 2YNHA 2IBKA 2F63A 2DXEA 2W8LA 1WF2A 3BH7B 2B6AA 2M3HA 1HBUA 2GC8A 5LT5A 5E3CA 3PFEA 3TZXA 4CLUA 3WC2A 3FK4A 3AD8C 3FMWA 3G9CA 1LWXA 1U1NA 1ZAWA 1RAEB 2EW9A 1FJGF 5KG2A 5G05B 2J6UA 1R8AA 2KKYA 2ZHAA 2L41A 3WBZA 2KI2A 3EPGA 1NNDA 5KFOA 1HQEB 2HVHA 2UZAA 1SL2A 4ZPTR 4LR7A 4XO0A 2CPHA 4N3WA 2AP6A 4XIUA 3PX6A 4N4FA 5KFAA 3H25A 4USTA 4DR1J 2CKLA 2GJIA 2YTCA 4NEZA 3M6UA 3QIPA 3CC2S 1JQGA 3HVAA 4DQRA 2RS2A 2DKOB 2HFSA 2KRBA 2XZTB 3BV8A 3LO3A 3O6QA 2MNZA 4NI2B 4RUCA 4I6AA 3GIKA 2YNGA 3ZZUA 3ILJA 2AD9A 3DRSA 2B7CB 1CJKB 4IFYB 4ZPCA 5LKUA 1NAQA 4B3TF 2VOOA 5DQIA 2VP7A 3R5CA 3HMJG 2WSCC 3AHPA 1PCAA 3DM2B 4DQSA 1HYJA 4PWDB 2KL8A 5F0UA 2CNNB 2DD8S 5E33A 3OJUA 3H20A 4V3KC 2RT3A 1UFWA 3DOLB 3Q86A 3NAIA 2BRKA 2VNFA 1JLGB 1U2CA 2GGPB 3KXDA 2VPEA 3MR7A 4KIAA 1PJ6A 2IHR1 5LSRA 3K59A 1Q82T 2WZ1A 3M9MB 2LQ5A 3O37A 4IFVA 2RQCA 1TL3A 5J2PB 1UPPA 4KYZA 4CH0S 2R8IA 3ZZ0A 4GC6A 3PIPQ 5KH9A 1RT6B 1S5ZA 2XB2D 4YB5A 5LJ3Y 1U47A 2V5HG 2G2YA 2Q43A 1GEHA 1Q5YA 2VC0A 1IQZA 2V68A 2V50A 4LBPA 1JLQB 1VQLS 5J3XA 4F0MA 4K4UA 4J9PA 2UZGA 4K5RA 4JI8J 2FC8A 3QAEA 1MMDA 1QVFR 4U7CA 2ASLA 1ULRA 3M05A 5IFMA 3OLBA 3PKYA 3W5YA 4A8MP 1RWWB 4KGMA 4MK9A 4OHWA 4ER8A 1SH3A 4ILLA 3TUJC 1W2IA 1BC6A 2B5JA 2N4CA 4PKDB 3U1MA 4PZVA 3MFHA 2KVIA 4I4BA 4MIWA 5L9XA 3KJVA 3NKYA 5IT0A 2E1AA 2NUUG 3QSYB 4X64J 3Q23A 3GV5B 1FRMA 4LRFA 3HT0A 1PGZA 4EO6A 1NDLA 2W2OP 4ILMA 1SH2A 5B79A 1CULA 3VWSA 4A48A 2YNFB 3OUYB 4OGCA 1YI2S 3I0SA 2H65B 2JSXA 2M52A 2XLJA 3QBCA 1NDKA 1IBLF 1NPPA 1BWVA 1WEMA 1S0NA 2DH8A 3GSIA 4K50A 1I6JA 5B7WA 4HR2A 2DK2A 1MWZA 5CD4A 2OPSA 1PBUA 4NI2A 1PSDA 1SXLA 2E61A 2ZC4A 3W7BA 4F3OA 4LF6F 2V2KA 2R3VA 3FZ2A 4N41A 4ECYA 5D1LB 4QJVA 2CQPA 4MSXA 1MBMA 2F9JA 3JTOA 4KPCA 5KFXA 5KG7A 1FERA 4DR2J 4PUOA 1V3ZA 1HNVA 2HQGA 2Z4PA 5KFLA 4B3RJ 3MEEA 5HATA 4Z7CA 4QIFA 1KEKA 3M7VA 3IS9B 3M8ZA 3U02A 1U1PA 3BDPA 4ENOA 1C0UA 3U5OA 2E5GA 3MMBA 3TAPA 3CCZA 2KWOA 2UUTA 3UFCX 4CLZA 4F0HA 2VU5A 2V67A 4F4AA 1FKPA 1ZOTA 2FUG9 2GIFA 1R0AA 4B3MJ 4JI2J 4DR7J 4OL8A 1XN9A 1ITPA 3C66A 1XTZA 3M8WA 5HQLA 3H59A 2K1RA 1MNEA 2CJXB 4CLTA 1HHQA 4QIWD 2OTLS 3PKMA 1F9EB 2LXFA 1UZHA 2KRRA 3GZ7A 4C97A 4LF9J 2C3UA 5H9EK 3DLJA 5IT4A 4LF7F 1WENA 2Y43A 1G4CA 4M5KA 2H4YB 1RI7A 1SUQA 2XZDB 3PCOB 4FKXA 4C3MA 3NMRA 2HZVA 3GFHA 3V81B 3D6TB 5HROB 3V4IB 4C98A 3LRQA 3C14B 4RW8B 4DL4A 1PC4A 5AT1B 3WDOA 2I0XA 4N56A 2IJFA 1ZBDB 2XSJA 1X31C 2K8GA 3FBFA 1R0CB 1S6OA 4Q7AA 2VJUA 3DKDA 1REGX 3E2EA 1T05A 1NDCA 2JMIA 2F6JA 2I8EA 1VJQA 4EYHB 4M5MA 3RPGC 2D3O1 3AAWB 1JOCA 5DG7A 5TDRA 2CQ3A 4ERDA 3EGVA 2JUNA 4LSLB 2MJUA 1SBRA 2ZWOA 2IRUA 3M2RA 4OYIA 4R0EA 3C46A 1RLDA 4PCQA 2L08A 3SSQA 3UQSA 5AE1A 4ELTA 2M70A 1GH8A 3K8WA 1X4IA 3D0GE 1T11A 1VQYA 2YW8A 4CQ1A 3FCVA 4IR1A 2ZE2A 2MD8C 1UVNA 1FRHA 3E01A 1NJIT 4PR6A 4O0NA 4RW4B 3CCWA 4ZPDA 5IOLA 2XB1A 4ZJLA 3BSOA 2H48B 1MU2A 3HKWA 5HBMA 1N32F 4LF5J 1UVJA 3M8PB 3CWJA 5ETOA 4LVNP 2JX2A 6FD1A 5K20B 2W9CA 3G6VA 3UCZP 3LTOA 1Q53A 2AX1A 3OFEA 3HHLA 4BWJA 2AX0A 2CJYB 4DV7F 3V6KA 1WEEA 1SL1A 9ATCB 2D3UA 1G7CB 3BN7A 1VR6A 2LU1A 1VC5A 1N34J 1IBKJ 4LSNB 1VLOA 1YJRA 3ISND 3TAMA 4N8OA 1YRXA 3O1LA 5IXUA 1LDKC 2H3EB 3LP1B 3DYAA 3DHXA 5JMNA 1N5SA 2DISA 1H0HB 2Z58B 2YPZA 2HRUA 2M0GB 3DCAA 3M30A 4K2XA 2W01A 4DN0A 1P6TA 1S6QA 4CLSA 2BE2B 2H5IB 3NG8A 4OX7A 4P2FA 5IV3A 3U5PA 1HMVB 2LXIA 2AJQA 4KH1B 2FHJD 2HRTA 4C8KA 3AA8A 2D3OR 1T9TA 1U7LA 5L1KA 3LAKA 2GO9A 3CUNA 3TUZC 1O6XA 1YJ7A 4PXEA 4CO1A 2FVRA 4ED6A 2IA6A 4DR4J 5A8RB 2DGWA 1REVB 4B3RF 1U6GB 1RWMB 1TL1A 4W92B 1S76D 1Q16B 1JKHB 4DR2F 2KYUA 2Z2MA 1UKUA 2BYCA 4MKVA 4R0JA 4A49A 1TU0B 4L58A 1UZDA 2F8HA 5CZXA 3KK1A 4FXVA 4ILRA 3VAFA 2GCFA 3N4WA 2OLWA 5IV4A 2VBZA 3BKFA 2QN6B 4IDKA 3KMSA 2H5JB 1N33F 3OTBA 5ETLA 2AEMA 1CS4B 2HPUA 1X8DA 1UWBA 2VONA 4K4WA 3D1HA 5GAGI 3RB4A 3DOMB 2I38A 3KKFA 3HDSA 3G6XA 4IOCQ 2DHHA 2CKWA 2HQIA 3K57A 3KNVA 1FJEB 2XC9A 1PIEA 2PA3A 3C2PA 2V69A 6AT1B 2P2CB 4NLOA 3QGIA 5F8IA 1V3RA 3MHHA 4DBQA 2R2TA 2VFVA 1YJNS 2FHMA 1E6YB 3HHKA 4J37A 1LK7A 1TFYA 4FBUA 1H72C 1LW2B 1R6VA 1S1TA 4M5HA 4F67A 4AYCA 3EUNA 2C2MB 3TUIC 4DQIA 3IG1A 4KR0B 4P9SA 1UJ5A 1XNQF 5CYQB 1RAIB 3PO4A 3TA2A 2E9ZA 3KWMA 2HS4A 3TEGA 2C22A 1GXTA 2IJRA 2RQMA 5HAOA 5FLXY 2ZKUA 1CJTB 4ZVSB 4LFCF 1H7XA 1RTIB 3W61A 1HMVA 3DWDA 1XMOF 2N4DA 1Y10A 1X4HA 3FQKA 2CVEA 5JVGQ 2YKPA 1JB0C 5FERA 3QFWA 4ZK7M 3HX9A 2ZNYA 2KG0A 4NXNJ 4LK9A 3MD3A 2VF3A 3ZNUA 4ETXA 4ECSA 2E1CA 5E7OB 1P8GA 3V4IA 4WXWA 1Q8LA 3W9HA 1UA1A 1WSVA 3NBPA 4QYRA 5HK4A 5BYSA 2V34A 4OI4A 5G0FA 4I6YA 4OJGA 2KJVA 2J8SA 2OWAA 1TP7A 2FJAB 2FDNA 2QLWA 2V9KA 2WVCA 3DOLA 3JSYA 3KG4A 2NZ4A 2XULA 4KV8A 1TUWA 4OI3A 5A8RA 1HQ2A 3KLGA 1PC5A 5HQ8A 4CH7A 1WG1A 5CCLA 3M2UB 3QZ7A 5GAHI 4RL1A 1TL3B 2BV3A 2DJAA 1JLCA 1UCNA 1LW0B 2Z2ZA 4YUDA 5ETTA 2D9OA 3AXMA 4IH7A 2FD2A 4AFFA 4XI1A 1ZAXA 4QYZK 3FRZA 2VPWB 2V4JA 4DX8H 2KWJA 2WBMA 3E8OA 4JV2A 3AB4B 3CC7S 4WIQA 1FDAA 3EZ5A 4JI4J 1OIAA 1S1WA 1U6BA 1SJ1A 5KFQA 2LDRA 4AUQB 5D4OA 4GNEA 3UR0A 2OO4A 3R97A 3AD9C 4YY3J 3I32A 1U6FA 2VA3A 5D3GA 5DETA 2ZH3A 4O4GA 1NHVA 3A3NB 1WEYA 2VJEA 5D0HA 2PI4A 2W24A 1RBLA 1ZTTA 4R8UB 4MIBA 2SXLA 4H4MB 5F8MA 3LPYA 4USWA 1QAJA 3K5MA 3LWLA 5KFNA 2ZJPQ 1RADB 3CCLS 4MK8A 4M5LA 3M63A 5EHHA 4DV1F 1RUSA 2APOA 4P75A 2L75A 1ICEB 1KHVA 2FJEB 3C8YA 3OTDA 5GVQA 1JJHA 1TKDA 3PM9A 3AFGA 3FFIA 2J8AA 4F4ZA 2XP0A 3FVYA 3PYGA 5CYJA 2AYBA 2P57A 4DFKA 2ZVSA 3FM8C 3KLVA 2DGXA 2XMTA 3W1YC 4DV6J 1WD6A 2PNXA 1U1MA 3QWPA 1R8HA 1X7VA 3GSDA 3SYZA 1UFKA 3BKTA 1FNXH 2ECWA 4WKYA 4GNDA 3QT6A 2EI5A 3R5GA 5ETQA 3CD6S 4NLUA 5F3ZA 2O5DA 3JSBA 3SDEB 2A6OA 5BR8J 2LVWA 4BC9A 1VBXA 1EKSA 1T03A 1LDJB 1VRUB 2BKPA 4OJ1A 3IWLA 1MWQA 3T6JA 3KK2A 2NQPA 4F04B 5GMEA 2GAGC 3GFYA 5K14A 3JUEA 4B9NA 2M13A 1LOUA 2B51A 1YJ9S 1FX2A 1M1HA 1UJ6A 3H2UB 1RWXB 4TY8A 4DG1A 1U49A 1AUSL 3HJVA 2Y1LB 1UWBB 3K5PA 3CJ8A 2DR5A 3ZNJ1 2F40A 4WFNQ 1WIMA 1HQUA 4KHMA 4JV5J 3SOWA 2FJXA 5CD4H 3VZIA 2GX8A 2B0OE 2ZH8A 3A13A 4OX9J 1R3NA 4TXSA 1OPZA 3VQSA 4ICLB 5KT5A 3MM7B 1QY7A 3ZZOA 1RLCL 2HEKA 3MM6A 3NCPA 4U8VA 3RUBL 4YHHJ 5HLFA 1KRPA 3M6WA 4DL2A 2HLUA 5J2QA 3PZPA 1ZZNA 4UUXA 2L48A 2KG1A 4EBEA 1WKLA 1S1TB 3MOJB 3KK3A 3GV8B 2ROEA 2NSBA 1RT5A 4TYBA 4YQWA 3IRWP 2HWHA 3H40A 3M6XA 5J2MB 2NYIA 1EAYC 2CQ1A 4DL7A 4QW9A 4F2RA 4DU8A 1DQ9A 5EN1A 2HNDA 2DNQA 2DIUA 1IQTA 3EM1A 1NHUA 2C28A 1N32J 3JQKA 1U02A 2KFTA 1RBOB 2QT7A 2P5VA 1J5OB 4C8ZA 2FJDB 1GMWD 3UDCA 3HPOA 4DSLA 1S9GB 1Y9OA 4OZ3A 4YR3A 2DSMA 3KNAA 4M5IA 4FYWB 4G6VB 4LR8A 4IQMA 1NJWA 2HHHJ 2MY7A 3KJFB 3BZQA 4FIPA 1L5UA 2BE7D 2VB6A 2CG4A 3MPUB 1FE0A 1UETA 2PN6A 2VG7B 4DL3A 1NJYA 3KTQA 2O01C 1FD8A 5A6PA 3HJFA 1JMTA 4IO9Q 1RT4B 2D7SA 3CDWA 3DOKA 4K59A 1WHYA 3RBXA 5KG0A 1DRZA 4I7CA 4UY8T 4NE9C 2BW2A 5BXIA 3TVZA 4DV5J 2ZBPA 4C48A 1SC3B 2E7WA 4M95A 4QIGA 4RNNA 4YY3F 1Y11A 2DYAA 1WWHA 2IM3A 4HH0A 2JFKA 3PYEA 4DG1B 5C13A 1M0SA 3LP2A 5IWAF 1IBKF 3R5BA 4CNYA 1I51B 3CCES 4Q0BA 2QYCA 3N01A 4CCHA 4C3LA 3N9LA 1FEHA 3CDAA 4PWWA 4U96A 4ZCLA 4LREA 3ZTOA 1FI4A 1HQUB 2IVYA 4HHJA 4WE1B 4UP0A 4CH1A 3HVRA 3N9NA 3CMAS 1IKYA 4PUOB 2QLFB 4BWMA 1EP4A 2ACMA 4NLPA 4MKYA 4N8NA 3PHTA 4WFAQ 3AJ2A 3SQGA 1X4FA 2MHNA 2DB1A 4GVLA 1R8CA 1GX5A 3OBIA 3V6DA 3H4DA 1KKHA 1UVMA 4I0WA 4O64A 2X1FA 5CH7B 2E5HA 4AYBD 1LXNA 5GAHU 1OYEA 1HYSB 3DRRB 2NXCA 3OVSA 1FDDA 2AJ4A 3GMGA 2W2QP 2KWKA 4KHPJ 3EZUA 4NCBA 4J9VA 2UUCF 1HL6A 3O2IA 4PG7A 2K1RB 2WCXA 2FLNA 3LGNA 3D0HE 4DV0J 3FRYA 4M8LA 1TKXA 2UUWA 1IR1A 1O8BA 1LNQA 1NK5A 1S6QB 1BLUA 1WTBA 3M62A 3VGUA 3MHSA 2YQ3A 5KFSA 1HBUB 1NK6A 1SJ4P 3G86A 3HD2A 2DPIA 4R2YA 3MMAA 1WESA 1VMBA 4C0HA 5A8KB 4ZVTB 1UTAA 5J2NA 4BS2A 4Y34A 5J1PA 2A1BA 2Y1RI 1RDRA 1VRQC 4GO7X 2W4PA 2KM8B 1IBLJ 2Q6CA 2PIIA 4DV2F 3QJJA 4Y2MA 2UVUA 1IM6A 4K4ZA 1HBNB 2E44A 3B8HA 1Q7LB 2JC0A 1TL5A 1I94J 1I94F 1FEEA 3QYYA 2XM3A 2C2NA 5F9LA 2HWIA 3B78A 1VQNS 3KG0A 1ZPVA 4X3GA 2J9EA 3RB6A 2F9DA 1J2VA 2JFDA 4J91A 3HVWA 1ZPWX 3L1ZB 5C11A 5L39A 1RT6A 2W4DA 3QT7A 2ZJRQ 4OX8A 5KFYA 2FTRA 3ZZYA 5EX0A 2WVEA 3W5ZA 2CFXA 1R6YA 4A4JA 3HSGA 1VFJA 1PG5B 3D1QA 5D1MB 4KHRA 1WG4A 2JLGA 4E0DA 4UY85 2R7SA 2V94A 1DZ5A 1RCXB 4GNFA 1TVRB 2EGMA 5HLFB 1S59A 2CQGA 5C2GA 1K0TA 4ZVHA 1FD2A 2IMOA 4U7UD 1JLAB 1RAAB 3SQGB 3C6TB 5LMUJ 4I7FA 5F8GA 2E9RX 4BHWA 2PEBA 5IQQA 1S6UA 3EWGA 2BEFA 1VQ7S 2ZOFA 1DHMA 3DLEB 2KH9A 1YTYA 1TR0A 1WGMA 2KE1A 1CBKA 1M1GA 1HHSA 1P9QC 2EFQA 2VFUA 1AB8A 5KFFA 3VAGA 3GIIA 2WAQD 3HLUA 4A4CA 3ICLA 3TAMB 1SVDA 2HNYA 2RU3A 1S77D 2RD5C 3HVTB 1H73A 3MR2A 2RKIB 4E2FB 4YN3B 5B0FA 2ILYA 3EYZA 4IR9A 2PGCA 4FYXB 2PE8A 3CCTA 4B86C 1D8ZA 3DLKA 3KDOA 2ZH6A 2E1RA 2AZ3A 2GQQA 2C2ZB 2FGOA 4ED1A 2BA9A 2FHJA 3L95X 4ECWA 3D28A 1SPBP 1XIQA 5JXSA 4OZJA 1DY3A 2DNGA 1QTMA 3J7ZT 3C6UB 4K2JA 2F8MA 3FJUB 1CLFA 4JYAF 2B9WA 1NRKA 2M88A 4OQJA 4PTBA 4HI2A 4L74A 1VQOS 3WIVA 1FTCA 3KJVB 3IMQJ 2IMWP 2OSQA 3IS9A 4F4XA 2BACA 3IAM9 1GTHA 1V9OA 2A10A 2H51B 3BSAA 3DFEA 1P1LA 2CUYA 2GFFA 2WHOA 3LQJA 1CC8A 4FP9A 4WPAA 2MQOA 4B9MA 2XLKA 3OHAA 1RCOB 1SB6A 2FHKA 2NLWA 4NLDA 4QR1A 4GKJF 1B0VA 5J1EB 1TL7B 4O44A 4TVAB 4LUBA 4LRAA 4M5DB 1WI6A 4EMDA 1Q86T 1VQ9S 1ZH5A 4Q0BB 1G2EA 3TAQA 1JLQA 1W7WA 5AJ3F 3K5LA 4IUFA 2BX6A 2A2DA 1ZM9A 2OPSB 2QLXA 3RRHA 2XMKA 4WF9Q 4L3KA 6FDRA 4FBTA 4NRUA 3MAAA 1Y3KA 2MKKA 3CSKA 2EFGA 4RBTA 3CJKB 4HACB 1A0OB 3TJ8A 2V8GA 1HWLA 4A46A 4DN9A 4GKKF 5L9NA 4WIIA 3FUYA 1JLAA 3TNVA 3HTKC 3M8RA 1YKWA 2CAJA 4RWWA 1Q8BA 1BGXT 2YBVA 3ZNIA 2B0GA 4G65A 1BMQB 5A6WA 1GMVA 5AE2A 2C2EA 1U25A 1Q81T 4NXNF 2R7UA 3T19A 3OUYA 3BR8A 5LKXA 1NHKL 1VRTB 2XSFA 1MM3A 2PSZA 4JBCA 4KGVB 1WF1A 5C24B 3VGSA 1FKPB 4NX9A 4ZCMA 4DUYJ 1YITS 1N0UA 5THWA 3UDLA 3J81j 1WE9A 2XGPA 3PX4A 2G1DA 2P9GA 5KFDA 4GNGA 2ZHBA 2VA2A 1DARA 3MZIA 3VVUA 2OUGA 5CXTA 4F4KA 1BD6A 3BN4A 2UUAF 3K5NA 4ZKAA 3QRRA 2X3DA 1C1BA 3NAHA 3QZVA 1SUQB 4DX6A 4CLFA 3T1YF 2XHWA 2VG5A 4OYPA 1K44A 1PJ7A 2P8IA 3I5BA 5J1NA 1P9YA 2H5EA 2OPQB 4C11B 3GPAA 1RWOB 3BGUA 3L09A 1IJFB 3BYRA 5D4NA 3GV7B 4PG6A 2ZD1B 4IH6A 5KG3A 1LWEB 1RT5B 3D3BJ 2MJNA 4WFZA 4ZDNA 3PXGa 2B9EA 4KO0A 1RYRA 3AD7C 3GB0A 2OSRA 1R27B 5CYMA 1R31A 1FNMA 2E5LJ 4IG0A 2ZBRA 2YQLA 1NEEA 2XYPB 2VPDA 4UP5A 5MAOA 1ZTWA 2JL9A 1T3OA 4Y3CA 2F65A 3BGLA 4TLQA 3TOQA 2HNZB 1VLYA 5FEYA 2R8HA 3LVQE 3MMCA 3ADAC 3BR9A 3Q8PB 3M32B 2CWKA 3TARA 1EQ0A 2VFSA 2LAUA 4HH1A 2C2KB 3A8IA 1F62A 2LXUA 4G1IA 4DCJB 2WTFA 1BQNA 1HBOA 1RT3A 3BO2A 1MMNA 4J9SA 3V81A 1N5QA 2MZTA 4Q8EA 1HNWJ 1HPZB 3MECB 2CQCA 2CZVC 5U47A 3DLEA 4CLYA 5DLGA 4LF8F 1V87A 2FPHX 3ZYQA 3A8EA 4DLGA 2L80A 1GK8A 3AOBA 4WZQA 4LLBA 4JI5J 3LALA 2FLLA 2VQEJ 2PC6A 4OI0A 5HVHA 1NUEA 1S4EA 3Q8YA 3LP0A 2ZOMA 3R8YA 4TU7A 2E66A 3CMQA 4F3QA 1HNZF 2MXYA 2AGPA 5HMZA 4O3NA 5CCMA 5DINA 5DDPC 1NMEB 4EWTA 2HBYB 4QW8A 3PW2A 3OTEA 2AIRB 4BBQA 1RHUB 2OPPA 3D6MB 1RZMA 3R6LB 1N48A 4YS2A 2MZSA 1C4CA 2RSDA 1XR7A 1KVKA 1EP4B 4YB6A 3MM5A 4MJKA 5SZTA 3KLEB 2LQ9A 1IKXA 1HWJA 2GMJA 5FIIA 4X4OA 2RB7A 4DV5F 2C2RA 2GJ2A 2RUGA 4DV3J 4OFZA 5KFGA 3QSIA 1RHJB 4KSEB 4RUHA 4DUZJ 2LU2A 1P1TA 2W7AA 1ACMB 4FF2A 2WONB 3HHLB 5HO4A 1F5BA 4MAKA 2QTWA 2VFTA 4B9LA 3NL0A 2O1PA 4TY9A 2HKEA 2XY7A 3M2VA 4UTGA 3NNAA 3LDYA 3HSJA 3I4HX 5J1EA 4DR5J 4DQQA 2IDAA 1RA6A 2CPFA 2NXJA 4LFCJ 2LQ6A 3T6RA 3M7KA 2PEHA 2PMHA 3NGKA 1U1LA 3H5XA 4X4UA 1OSDA 4JI4F 3V6JA 3M8SA 1TKXB 3QAUA 2JEIA 3V43A 2DNRA 3R1LA 3L1XA 1XEZA 2VPXB 5AJ3J 3D54A 3R3TA 4KGXB 4YATA 1S9EA 3B6BA 2K3IA 2CPDA 5LL6d 5GADU 4PXCA 2Y0BB 3THTA 3UN3A 5KFUA 1WELA 2YUCA 1QLNA 2YU4A 4DUZF 4DZDA 5J2QB 4Y2CA 5DRKA 2JHEA 3R27A 3WX4A 5BR8F 2AHOB 1ZBTA 1D1UA 3BDEA 3CIMA 1AZSB 2AEJA 5LMNF 3GV4A 3BSCA 3W2VA 4D3HA 2CA9A 1XK8A 2KB2A 3PFOA 3RAMA 3VQTA 5IS2A 4W90B 2YWKA 3KHLA 3I5AA 4NZ6A 3OSPA 5SVYA 3IGVA 4C0BA 1R8PA 4DL0C 2LECA 4C2MA 3LW5C 4J9MA 1NB2A 2EG2A 1T3NA 1VISA 1NSKL 5K9FA 1FJGJ 1S0VA 4CO2A 1Z1ZA 1WILA 2NXNA 3X1LB 2DR7A 4C8YA 2HHQA 1VD4A 2EKYA 2YNIA 4OGEA 2A6MA 3ISZA 3FSIA 4Q2LA 2W7PA 5KFKA 1WUUA 2BJ3A 2GHVC 3J81Y 3UCUP 2FIUA 3I6PA 2BKOA 4Y0FA 3WIUA 1RTIA 4M94A 1TMMA 1R0BG 4JV5F 2HHTA 1FNOA 2HGLA 2V4JB 4HLBA 4A8XA 5KFHA 4DL6A 4NLQA 4A8QA 2ZZNA 3KLEA 4KRWA 3BBFA 3DRXA 1ZA2B 4JV0A 5IM0A 4K4YA 1FXLA 5KG5A 1HNWF 3W3SA 2QJ3A 3LQIA 2XZWA 2NPFA 1S72S 5K8MA 4I56A 1NH8A 3OW2R 2BM0A 1LWEA 4OLPA 2G2ZA 2MNYA 5MLCV 1PKUA 2YWHA 3IG1B 3QGGA 1C0UB 3MMBB 4JI6F 3ZZPA 4BHQA 2JOQA 3I9ZA 3R7BB 4KV8B 1QAYA 3U1NA 4WCEQ 5AXLA 4LF6J 2MEWA 4KC5A 2R7TA 2I1RA 2GAHC 2IVMA 4UUWA 2HNYB 4KE5A 3W9JA 3IFEA 4DF4A 3B54A 1HLWA 3CO0P 3ITHB 4Q2MA 4YR0A 1VQ4S 5KFCA 2R2RA 4ED7A 2NR0A 1J5EJ 4W4UA 2CQBA 3EDRB 3BGRB 3MMCB 5F0WA 4R5PB 1VC6A 4NLGA 5IT9U 1F60B 2HFZA 1IKWA 1S99A 5SVIB 3C5KA 1KDNA 3CJ0A 3G2XA 4XTTA 3UCGA 1KLNA 3UVJB 3SOXA 3T9NA 1TVRA 3MTKA 2JEGA 2G0JA 2JNJA 3M1VB 3PVXA 1FRXA 5B09A 1EKRA 4OHXA 3HI9A 4G1PA 3CNQP 4UF4A 1CHCA 4X66J 2KREA 4JI1F 3R2CJ 2GJFA 4ZHRA 3BBBA 4V19J 4K4XA 3DRPA 2E7VA 2OFHX 1ZS6A 2ZDPA 4WTOB 1FKAF 2JEJA 1CULB 2B7BB 2DIVA 3KQIA 2X7IA 2IAJB 3MEKA 4LIRA 3OR1B 4DPXA 2YT5A 2C2VS 4EFAC 2MGZA 3LOUA 1W26A 2ZH2A 4ZJOA 1D0EA 1HNZJ 4NXMF 1CQMA 1UP1A 4BC7A 3JSMB 2DITA 5KFWA 4LSLA 3FANA 2EPIA 4LIWA 1BXNA 2G6QA 4DWIA 3JTPA 2Z0GA 2XS7A 3CCVS 4ECTA 3UO0A 1NDPA 3JAMY 4DS5A 3D68A 3BSNA 3IP0A 3J80Y 4I67A 4WTYA 4CIOA 2DGUA 4URGA 2L0BA 2OXQC 1OQ3A 1T9YA 4NA2A 4ZOSA 4ZVUB 5AXNA 1JM7A 1LFWA 1EARA 1KP6A 5HROA 2YQ0A 2RRAA 1WHVA 2WSEC 2IY5B 4S0MA 2ZDOA 1F5CA 4ZLLA 2ERRA 1KBRA 3OPKA 3C16A 2KTQA 4M63A 4TN2A 3R5JB 1U24A 2E5IA 2KGGA 4J90A 4AL6A 5C24A 1NBEB 2EBGA 1DTQB 2O3DA 4NLXA 2R2UA 1SKSA 2ASJA 3BEGB 3M2RB 2Y8YA 2P9CA 1H2TZ 3ZTGA 1B0TA 2CQIA 2JC1A 4QF3A 4LJMA 4ZIVA 3VAIA 3DXBA 4CM0A 2E9TA 4QWEA 3J81U 2UXCF 5DZ7A 1IKWB 1NSPA 4M5JA 3THPA 2HVEA 2IYGA 4Q45A 4AP4A 2DR9A 4USUA 1WOPA 2JM3A 3A8JA 2E5LF 3CJKA 1VQKS 3MEEB 1C1BB 2C3MA 4YB1P 2DNKA 3OFHA 3SDEA 1KONA 5DQGA 5LM7E 4FF4A 4WA6A 1YZ6A 4J9UE 4OZNA 4CT8A 1RAJA 1VBKA 4WZ2A 1Z2LA 2IFXA 4NMLA 1FTRA 4ANCA 1HR0J 3N28A 3OR2A 1FRIA 1HW8A 3PLWA 1IKVA 4KH0B 2LGLA 2Q79A 2LEBA 2HNDB 3CT9A 4PYDA 1I3OB 2QL7B 4RR5A 2MLZA 2W1BA 3DGPB 2FYXA 4B02A 2XMAA 4B9UA 3UW1A 4QQBA 1LFPA 5KT7A 3HZEA 2QL5B 1F9FA 3ZTQA 4JI8F 2MLXA 2BANA 2ZKTA 3BJYA 4DV2J 4L75A 4DQPA 1NCLA 3QT5A 3EX7B 2HZCA 2GHPA 1S1XB 2VPBA 5LCWB 3BB5A 3E01B 1X0PA 2F7VA 3JQMA 4OYMA 3T7LA 1KN6A 3AH6A 3TQEA 5KFMA 3KV5A 2AJ0A 1WFKA 2YPYA 4DSIA 1OMSA 2VG5B 2MQMA 4RJVA 2ASDA 4OZ1A 4B3SJ 1EX8A 5K8OA 3C6WA 4YC9A 4N5SA 4UZBA 1M5OC 1X4GA 1S1VB 3AB2B 4NOHA 2I5JA 2FLOA 5AIUA 4I2PA 4Y28C 2I2YA 2KDOA 1NU4A 3RGIA 3VR1A 4GKKJ 4ED3A 1RHKB 3GLJA 1I1GA 2RRBA 4AXIA 1XR5A 2D8UA 2ZC3A 4H54A 3ZTPA 4DFJA 4FO9A 1WEZA 3MI7X 3TR5A 4AQYF 3P5BP 2YWWA 1HFEL 2XY6A 2NCKL 2A2CA 1B64A 1ZM2A 3AY0A 2BUNA 4WKRA 4J9OA 3PV8A 3FZBA 4J7CA 2M85A 2LQJA 3AODA 1SQGA 2LN0A 3TX0A 2ZE2B 2OPPB 3V2UC 2UUAJ 1UW9A 2DNOA 2JLEA 4NYZA 5KT6A 4C9ZA 4L6V3 2QA2A 1H2UX 1SCJB 1WEPA 1KTQA 2MZRA 2YURA 2XMUA 3MM6B 3MOZA 1FKOA 3CO9A 2LDYA 3PNIA 3WX8A 4EGLA 2XQCA 3HSDA 1DTTB 4C6AA 5F8LA 2B3TB 1N54B 4EYIB 3QMQA 4OYAA 4F25A 4ZP7A 2RR4A 1SH0A 2HHPA 3D7SB 3EXYA 4UQTA 3UN5A 4ZIWA 1E6VB 3KMQA 1RHMB 4OV6A 3PW4A 2KZMA 4NN2A 4P6QA 4YADA 3ZVZB 3KLGB 1NKCA 3HK2A 2J0SD 3O35A 3FJ2A 3KLIA 4C4WA 3T1AA 3G71S 1QDUB 1KR4A 5F9NA 2RQKA 3KJNB 5KT4A 1T8EA 3PY8A 2HYED 3RRGA 4NASA 2GVZB 4WE1A 2CJBA 2EFPA 1XMQF 4QWBA 4NWBA 2HDPA 2UV8A 4MIAA 2HFUA 3B4DA 2CRLA 3K2YA 3POTA 3AA9A 4Y65A 4DOZA 2YQ1A 5HSPA 3H98A 3PHDA 4F4WA 5A8KA 1TV6A 2B43A 4F36A 1FXDA 3CE8A 1LW2A 4DSEA 4AD6A 1NPRA 2GMLA 3FNNA 1AROP 2LA4A 4USHA 3KLFA 3W8GA 4A8WA 2DPJA 2VV5A 4B9TA 2MKJA 3GYXB 3QRPA 4I68A 4RW9A 2I6WA 1B7FA 1SIZA 3PJXA 3OJSA 2HHVA 2G13A 4P73A 1WEVA 2NXUA 2OELA 2UVVA 5LXRA 1HNXF 1SJFA 3IRXB 1X4DA 2Y1NA 1G6BA 4ITSA 3SXLA 2G2OA 4ZVQB 1RQ0A 2NPIA 2DNNA 2YNIB 4LF9F 3KUHA 4QBUA 3N9QA 4WZ0A 2C3PA 2JDJA 3TWZA 3RBEA 2CDQA 5FB0A 1ELOA 1Y0HA 2DNLA 2JZ5A 3R7NB 1GXLA 1S4FA 2IM1A 4RU9A 4X84A 3NS7B 4Q44A 1XNQJ 3P6YC 1KTVA 2AV5A 2R42A 3GILA 5C42B 3EPIA 4G1QA 1WHWA 1BHNA 2HK3A 2V8DA 1RTJB 2CNOB 4MFBA 1U0SA 3GQCA 3C6TA 5KFBA 2KO1A 3IXQA 3SCIE 3DU6A 3C14A 3RJMB 1S6PA 1IBMF 1AZSA 1B70B 4L76A 1PAEX 3DC2A 1WEUA 2JH3A 3GG0A 1WC3A 1RISA 2Q6BA 3KUEA 2DNZA 1NJZA 2CG8A 3QJPA 1XMQJ 3KLHA 3GIMA 3LP0B 2CQDA 3M2UA 3R5DA 1FRJA 2HAFA 3CB4A 4WJBA 3L7OA 5DM6Q 3VZHA 2M6MA 2DT9A 4RO0A 3WZ0A 2IPOB 4ECZA 1L3UA 2DCLA 5C25A 4FNHA 1LWFA 4U7UK 2CXEA 1CJUB 3W62A 3JYTA 4IQXA 3K17A 4FF1A 4URSA 2OMOA 4X62J 1HI0P 3FFIB 4ECXA 5G04B 2EKNA 3RB3A 2OJ3A 2G0CA 1S1UA 2Z57B 1PYTA 5B0GA 1Q0NA 3DDNA 4H4OB 5L1JA 5AXKA 4DSFA 2C2OB 3W9IA 5DKAA 1TELA 2BMBA 2QG9B 4Z0RA 3KHGA 5KG6A 3A8KA 3HSZA 3IR7B 4CLLA 5K8PA 4ZPAA 5D6GA 1GNKA 2GV1A 3GJRB 1TUGB 2NS1B 1UPMB 5D0EA 2X1AA 2HFNA 1OY9A 4JI0F 1EIYB 2ECTA 1C4AA 2AMCB 1S1VA 2DXFA 2Z2LA 4WK1A 1SQFA 2ABYA 2D3ZA 2NUHA 2ZUAA 3DNCA 3GONA 3T6BA 3ZC4A 3ONQA 2L43A 5E3RA 3W60A 4LQ9A 5A8WB 3UD4P 1D09B 2OTJS 2GVDA 2KXHA 1SKRA 3A1YG 3QATA 2MQPA 2QLBB 1KNZA 1FVQA 2P9EA 2LRIC 1RU1A 3ASLA 2B9XA 3I82A 3ISNC 5E2QA 4ANEA 2XOYA 2HHSA 2PA8D 2WK4A 1FFGB 2LP4A 2XMWA 2Y0SD 4ZVOB 1KOHA 3GYGA 3KOAA 4P10A 3ENVA 3LWMA 3VTIA 4F1PA 1JXVA 3H0PA 5H9EJ 2IRYA 2YYRA 1C0TA 1IN0A 1DVPA 1FKOB 2KJWA 2YKQA 2VPYB 4TYAA 4ICLA 2R2SA 2MDAA 2VBXA 2FHOB 4CLWA 2EXUA 4A4BA 2B8PA 2RE1A 4MFBB 3RU0A 3ZXWA 4RNFA 2XGQA 2DNYA 2OPQA 3L9ZA 2D41A 4G3IA 3D67A 1T03B 4ZP8A 2FQQB 2BR0A 2W9BA 2R8GA 1EJ7L 2EFOA 4MKAA 5I3PA 2BJ7A 3EVWA 4KHPF 3C15A 2FVQA 3PURA 4JI7J 2P6TA 2ZZMA 2U1AA 4TY8B 1VRTA 1FCAA 1OPIA 2XMJA 3KLIB 3DN9A 3NGDA 3PW0A 2EEYA 2VJVA 4DR6F 4M5DA 2PFDA 3CCQS 4ZVPB 2XMVA 3FEZA 4ECVA 3MHYA 3R5AA 4X65F 4YBTA 2CPZA 5H1TA 3HHLC 1XMBA 1JLFA 3FDSA 1A6LA 1Y00A 3I9V9 4RPFA 1FK9B 3FCWA 2B4VA 3QNWB 3LUYA 4CLPA 3CJ4A 2KU7A 4DXLA 5I42A 2VODA 1AFJA 4OZLA 1IM4A 5HI7A 2LYVA 1SV5B 3MF5A 3PIOQ 4DLEA 3EMTA 2QYGA 2HSEB 1WOOA 2YWEA 2VH7A 2VASA 2MT5A 3ELHA 3RTRB 2G4BA 4PWDA 3EJMA 3P8BB 2MKEA 3HCXA 3V6DB 3DLGA 1OYDA 2F4VF 2YREA 2OFGX 5KH7A 1WEQA 5A2QY 2LMIA 2XBPA 4K0KF 1FHTA 1RWUA 3Q2TC 3F56A 1L3KA 1XWHA 2B4PA 2KU3A 3FC9A 2OPRA 1HW9A 2Y1IA 4L73A 4LF7J 2GA7A 1NPKA 3BPSP 3OTOF 3R2DJ 3ZTRA 3MWBA 4YP3A 4X2BA 3EZOA 2HHUA 4ZJQA 2QV6A 3N9PA 1X9SA 1T0TV 2L7PA 1F3FA 5AITA 4R5PA 1HHTP 4U8YA 3OVBA 5HP1A 4ZCIA 3Q24A 1OS5A 2IBOA 1H98A 4QWDA 1N0VC 3K7RA 1MROB 3EXCX 5B0EA 4JI5F 4HHHA 1RKJA 2K17A 3AJDA 3OVAA 4YMEA 2H54B 3LF0A 2WBRA 4USVA 3T1HJ 3LGMA 1WEWA 4V3LC 1VK3A 2DHAA 2YX4A 2ATLA 1FESA 7FD1A 3CDUA 1ZETA 2HMIA 1WC6A 3ILLA 2EBEA 3OXLA 2CQ2A 3KLHB 4BCAA 4ED2A 1RTDB 5DGAA 2HYIB 2FD4A 4C9DA 1V3SA 2EA6A 1VCTA 4UOGA 3O33A 2HZAA 3DGPA 2J6SA 1N4LA 4F02A 3JQJA 2CQ0A 4IG3A 4ETZA 2V2QA 2CPYA 3G82A 3FEXB 3NLCA 4GRSA 2MKCA 4I1TA 2KXNB 1T9XA 2DTJA 2R7RA 3SZ2A 5D77A 2L3MA 1XNRJ 3FBCA 2YWGA 2MA5A 3EB6A 2D74B 3LA0A 4A8KA 4PQUA 3UPFA 5D78A 1IXKA 2IA0A 4HYKA 3MM5B 2L9WA 2ZITA 2VFRA 3U27A 5IC4B 2HG4A 4DCPB 3JB9k 2MB0B 2FSAA 4NLRA 1RSCA 3QIDA 2GW8A 4BDPA 1BQMB 4RW7B 5G0RA 3H2LA 3H5UA 3ENQA 4H9DA 3MEGB 2PT0A 1AW0A 4KAIA 5JJBA 3AXKA 2YKMB 4RLEA 1O5JA 2R7VA 2MA6A 1MN7A 1DTQA 1RBAA 3ZZRA 1R0AB 2AW0A 1YRTA 1H3DA 4E8UA 3GL6A 1X60A 4RKUC 4ZA1A 2Y8WA 2AEFA 2RKIA 1V5IB 3D5MA 4IRCA 4RNOA 3A12A 1CJVB 1KVJA 1HNIA 4DFMA 1G3OA 2V8PA 3IA0A 2R7QA 4AVXA 2HVZA 1IKYB 5DDOC 2OH2A 1VQPS 2MTLA 3B4MA 2B56A 1BQNB 1HBOB 3IR6B 3QGPA 2VJFB 1JLEB 3N79A 3Q8SB 4DV0F 2MIQA 4O3SA 2W7OA 3TA0A 3TVYA 4GO5X 5ETSA 3DI6A 2XYHB 4Q5VA 3CVKA 3LQVA 4DSJA 4R25A 3SSRA 4ZP6A 4C8LA 2J9CA 2YKNA 4LJNA 4A47A 1RE1B 3W2VB 4NZ0A 1HD0A 2LV9A 4Y6IA 3SCLE 4I64A 5E3PA 3NGSA 3KK2B 4OI6A 1IYMA 2Z2YB 1WI8A 1S12A 2JRSA 1VHFA 5B0AA 3WHIA 1JNZB 4PXDA 4O3PA 3FGVA 2X51A 1SL0A 1SC4B 4OYBA 3H42A 4DUTA 2R7WA 1RGVA 2HWTA 2QFIA 4OZ5A 3PEHA 4X4PA 1KSPA 2GIQA 1OO0B 1T1HA 3GFXA 4WP3A 3PX0A 4S3OB 3OTOJ 4C8MA 4JI3J 1S10A 2HBQB 4PG5A 2KGIA 1M5SA 2WW4A 2B9YA 2JLFA 2W25A 4HHUA 4FN5A 1RWPB 1WORA 2Z56B 4YABA 4TU9A 4U9RA 3LANA 1HWKA 1LEOA 1TV6B 3FEYB 4O4GB 3GFZA 4OZ0A 3SFGA 1HI1A 2R8JA 4GKJJ 1TAUA 1S57A 1SJRA 4ID5A 2ECJA 2B4OA 2F4FA 1WJ9A 2BE9B 2I5JB 4W98A 1L3TA 4EZ9A 3IWNC 2UXDJ 2IQJA 1FA0A 2A3JA 3RW7A 3IN5A 2XNRA 3CJTA 4GMKA 3MR5A 4DV4F 2V0NA 1FBVA 2HAIA 3R1HA 4L3NA 2UVWA 4AUKA 4LSNA 3N9UC 5H9MA 3BGFA 1A9NB 3N9OA 4HL9A 2K7JA 3IRXA 1RTZA 2BVZA 1CJUA 1VQ5S 3I31A 3HULA 3CTRA 4CYUB 4CCGX 2V4RA 3HCSA 5DQHA 3BQ2A 2BDPA 1NK9A 2VD3A 2IVFB 1U09A 4L72B 3TO8A 4Z37A 5D8HB 3QPIA 5CZVA 1YDLA 3MFIA 5L8RC 3DHWC 4ECUA 3TI0A 1N88A 4GC7A 2HS0A 4HACA 4LADB 1DTTA 3FBBA 3M1VA 4AE5A 1TFWA 1N33J 2ZFHA 3E3XA 2YHNA 1VDHA 1EETA 2X1GA 1YJUA 1WF0A 3QWUA 4IKAA 1F2HA 1VQ8S 1FRLA 3PHEA 3CC4S 4K4SA 2AT1B 5L46A 3SV3A 2FJWA 5TRBA 2CIMA 5K14B 2AGQA 2DGVA 5A8WA 1YBTA 2JRJA 2JWNA 3N5FA 1WC0A 2WVFA 4TKPB 5C7PA 4LQ3A 5D4LA 4QYZJ 4P72A 2JEFA 3KHHA 5F8JA 3G82B 4UW2A 3M9NB 4IO1A 4YR2A 1T7PA 4J5OA 2VBYA 2H0DB 2DO4A 4XK8C 5B0DA 2ZJQQ 3FBEA 2XS2A 4F50A 3V6HA 4TU8A 1K47A 2KT3A 3BH6B 4QR2A 3NOCA 3LAMA 4KBIA 4PXBA 1XQIA 5HN0A 4AT1B 4YFUA 3J7YU 3PRDA 1RTHB 2AJFE 2IRXA 3QLHA 2E1MC 5HVFA 8AT1B 3MM8B 4WYLA 5DDRC 1NK0A 1J5EF 2LKZA 1E6YA 1FWLA 2LEAA 4HTIA 4NZ7A 3Q8RB 3P49B 3O70A 4J9LA 4J9QA 1DCQA 2NZCA 4KGKA 4MTPA 2E7XA 3GJSB 3SV4A 2VKRA 3OR1A 3ILOA 1XERA 5ITHA 2MGZB 4IH5A 1Q1KA 4CWBA 2XTJP 3BO4A 5H9FJ 3I4PA 3OR2B 1Y7PA 3T41A 2E6SA 2OIHA 2ZH7A 2GVDB 2CRWA 1H7WA 1WTFA 1XJWB 3HFZB 4O4RA 3GE9A 2QJ0A 3M30B 5GAEU 2XLIA 2J0QD 1J5OA 4ZVEA 2FJBB 4OV1A 3UD3P 3OFFA 2W8KA 3T1HF 1S7HA 1N5VA 2XO6A 3UWTA 1ZYQA 2HNZA 2VQFF 2BQ3A 1VIOA 1NB7A 5C42A 1IR0A 2ASYA 4EUVA 4YB7A 2WSFC 4I7BA 4I2QB 1YJWS 3FSXA 4WK3A 1YSJA 2YX7A 3NG2A 2XS5A 1SIWB 5J2NB 4PPZA 5M2UA 3QT8A 2C3OA 2FGCA 2QA1A 1M5KC 3KDEC 3Q22A 3H8YA 4HEA9 1YG0A 3DLGB 1W25A 1FDNA 1KLMA 4ZQLA 1T9UA 2VDIA 4EO8A 3TQ1A 2IAJA 5BJRA 3KK1B 2RILA 4LFBJ 4PABA 1UAWA 2DGQA 1RAFB 2DY1A 3CGIA 4U6PA 3T5JA 1DLOB 1DURA 4USKA 5D15A 5DG8A 1IKVB 1SKWA 1KFSA 3I0SB 1WEOA 4U95A 4NLTA 3MMJA 3MCSA 1NO8A 4WFXA 1Q4RA 2MZQA 3AT1B 4PEOA 5LXYA 5T14A 4ZLNA 4A8SA 3I5CA 3T5KA 2ECGA 4ID8A 4Y00A 1TK8A 3SMZA 4A8FA 1CQNA 2ROGA 3DRSB 4IFYA 2W2MP 2OHDA 3W8PA 2UXCJ 2YQMA 5TABA 4F7VA 1TKTB 4JOUA 4XDCA 2RU9A 3G8TA 1TTHB 2YVRA 2QIFA 3H2VE 5KG4A 2Y3YA 1WC4A 4X4SA 4ELUA 3ULHA 1HNVB 4AXJA 2BJDA 2L5UA 1IKXB 4ZVFA 5IT9Y 2BJ8A 2MKIA 5D3GB 3WQPA 4CO5A 2XEUA 5EYAF 1GFWB 5D4PA 4ZN1A 2XWYA 1RYSA 2HVIA 3ZTSA 1JLGA 2GGPA 3CW2C 3SQOP 3QJLA 2HMIB 5D0GA 1QSYA 1IBMJ 4QF2A 3DDKA 2QA4S 4FK5A 1UVKA 4XAKA 1VHIA 5B8DA 3CD5A 4OI1A 2DO0A 4DR5F 5TBNA 2UXDF 4JI7F 5CYMB 1VGYA 4WFBQ 4OYZA 2BM1A 3RBZA 2CSYA 3HT3A 4YEAA 2KHCA 4NYPA 4EZ6A 3HKZD 3X3UA 4LF4F 3DLKB 3EDQB 3OV7A 1YJTA 1U4BA 4O3RA 1V6HA 5KFJA 3H4BA 3RPGB 1BE4A 1FWKA 2H4WB 3VVTA 2VC1A 3BREA 4OMFG 5IC6B 5ADZA 4D3GA 3C3LA 3HCUA 4PWUA 3POTB 4JI3F 2L9DA 1N87A 2CONA 4R7EA 4UI9B 2B5JB 2J76E 2V2VA 1PJ5A 2XWXA 3HFVA 3MECA 2JVRA 2RJZA 3UN2A 3LJUX 4ZDTA 3BGOP 3TA1A 4HKQA 2HURA 4NA1A 5I4MA 1K1QA 3G6ES 3UD5A 1BQXA 3DU5A 3GP9A 3GU0A 2EC0A 1AFIA 4F52B 2XSJB 1KOOA 3M2VB 2ZH9A 2LFVA 4N47A 1OQ6A 3RTVA 2QZ8A 3FQLA 3PW5A 4F2SA 1RT7B 4DCOB 5KG1A 2YX1A 4CDIA 3T1YJ 5SVXA 2IC3B 4MH8A 2AJ2A 2QMWA 2RSQA 3MM9A 5BYRA 4C0OC 2V4QA 2ZH4A 4MYUA 5GMKa 3DPLR 4B7YC 1TQLA 3T9KA 3MCOA 2P6SA 3N6MA 5E5NA 4KKOA 5C2CA 3Q1DA 1WSRA 2N82B 2XO7A 3E51A 4FVMA 2GNKA 3RB0A 3ETMA 1M1KT 4NMXA 3F0NA 3NWRA 3VGVA 3H5SA 3BO3A 1X4CA 4YOEA 2RNEA 2ZOGA 4P2XA 3UVJA 2BW7A 3WC0A 2V2ZA 2Z8QA 4M5NA 4PG4A 2FUIA 5CHCB 2YHOA 5E3AA 3MPYA 3L11A 5IM0B 2XMMA 3MAQA 2Q66A 1R8BA 4CTAA 2ALZA 2BQRA 2YKAA 5DO2A 4DEZA 3PR5B 4JI6J 1VI7A 5D0RA 3Q8VA 1QVGR 2HHXA 2MKYA 2G45A 1OY8A 4CA1A 1UL3A 3Q2SC 1PYSB 2DH9A 3MTJA 4HT7A 3NGTA 1F1BB 1LQ9A 1UEUA 4Z0OA 2KKXA 2M8HA 2VG6B 4OJ3A 4F0KA 3I56S 2QX0A 1B4SA 4M5GA 4ES2A 1AXQA 3IO1A 1UA0A 4DR4F 1DQAA 5AE3A 5KOWA 4DSKA 4B3TJ 4WZ3B 2LA6A 2BKNA 2EGPA 3MPVA 3TRGA 1KD1T 1SI9A 2KT5A 1WKKA 3D66A 2MYFA 1LK5A 1HWIA 2H1YA 2O66A 2K06A 3OFGA 3SOUA 2FZCB 3S7RA 1T94A 1UW4A 4ALZA 3M9OB 1DAXA 2FLPA 4GB0A 4LKAA 5K5MA 3D4JA 5K8NA 3M4XA 1KS2A 2CPIA 5B77A 4TNOA 1REVA 3DGVA 4U67Q 1NSAA 3TZWA 2MQ8A 1TL1B 5HMWA 1RHQB 2F8EX 3UE2A 3JSRA 3KLFB 1W2BR 4W4MA 2QGFB 3DOKB 2CJAA 2CQ4A 2ZD1A 1WHXA 3N0VA 3Q89A 4ZMMA 3CCRS 2JMJA 3SHBA 4JYAJ 4MYTA 3NEKA 4O44B 4EU0A 5RUBA 2WOMB 4DPUA 2CJQA 2CKLB 2PMZD 4X65J 5A76A 1T95A 1K73T 2GVZA 4USIA 1NLKL 1X5SA 3R9LA 1F5AA 4PG8A 5H1SV 1NK8A 2M3DA 5HMYA 2WB1D 2BZ2A 4QQ4A 5KFVA 3NNHA 1PILA 1S1UB 4OHZA 1B99A 1VC0A 4RW4A 1HBMA 2DEJA 1RT2B 2FVCA 2HHHF 2VHGA 4P2SA 3TEHB 1U1KA 5LKTA 1VQMS 1NK7A 1Y5IB 2RRNA 3M8PA 3HFKA 4IYQA 2ZZTA 3NCQA 4NYOA 2XY5A 1K9MT 1U45A 1HR0F 2M9KA 1TKZA 2DEIA 1KVIA 4CP5A 4N76A 1U2FA 5FJ4A 4F8RA 1XMOJ 2KIZA 1WC1A 2C2DA 1WC5A 3EVOA 3H7HB 4Q6FA 2NXEA 2V8HA 3BS9A 4JB8B 1LWCB 5IWAJ 2K2PA 2QC3A 3PTWA 4OYWA 3FMBA 4DMZA 3BGRA 4X4RA 3CEDA 3OL7A 3MAHA 4FS2A 2K7KA 4I6WA 4FYDA 4LF4J 4HVZA 3BPDA 3IBFB 2F5GA 1GTEA 4JI2F 4B3MF 4DR7F 3LVRE 4BBYA 4LFBF 3W2WB 4OX9F 1N6QA 4OIXA 3I2DA 5GMDA 4CZCA 3DI6B 2FC9A 4RW6A 1U8WA 2E5JA 4NCGA 2R9LA 1B3TA 4DPTA 1U26A 1Q8IA 2MQQA 3R6GB 3FSYA 4JI0J 5AXMA 1ROFA 3N9MA 2G1HA 3NWGA 5KFTA 2BRLA 1SC6A 2NSCA 4F4YA 3O8WA 3OLAA 2DCUB 1LWFB 3NGUA 4EK2A 3EB5A 2OEMA 3HZGA 3UNYA 3CCUS 1N5YB 2MHEA 2RDIA 4B3SF 1S48A 4B3OB 1S9FA 5JG6A 1X4JA 4ZPVR 4L7XA 1RAGB 1BUXA 2EFVA 2J7WA 2EK1A 3CDBA 1H6KX 3IBCB 4JP8A 3S1TA 1QTNB 4ED4A 4Y2KA 2V8VA 2YVSA 1FXRA 1RT2A 3OXFA 1FO1A 3D3CJ 3RRKA 3CJ3A 3TJAA 5KOXA 5KT3A 2M1RA 5T7LB 2M4MA 4AL5A 1D8YA 1N8RT 1H38A 2CNKB 3MR6A 4ZITA 1S49A 3BBCA 1FT8A 2X1BA 3CIZA 2X3GA 5A2QU 5FDLB 2A18A 4IFVB 3RYLA 2ZBCA 3IWXA 3U1LA 3J7AN 2VPZB 1RTDA 2ZBIA 1DLOA 1IBCB 2ECNA 1CVJA 1VQ6S 2QFJA 4WU2A 3H7HA 2UVRA 1VOMA 3FEHA 3ET6B 4LT6A 2FVPA 1UVIA 4X4QA 3OTCA 3HP6A 2C2LA 5I3QA 4LRDA 3B82A 3EGZA 3MEDA 2VPGA 2EODA 5DS7A 3D2WA 1YZ7A 1N34F 3ETOA 2OAUA 1OJ4A 2QA4G 9RUBA 2VIHA 1MROA 3K5OA 1TL4A 1X5TA 3CMES 4I2QA 2IIHA 2C42A 2ZEJA 2DRAA 2EFNA 3CD0A 5EUHA 2D1CA 3VAJA 3SCKE 1T02A 2HGNA 1Q7YT 3HHEA 4KY3A 3T5LA 4RW8A 2J0WA 1U0HB 3N6LA 1VS3A 1K2FA 1JNRB 3KUGA 2ZNZA 3GCWP 4NPOA 4IOBA 1X0FA 1JIHA 2VDHA 3C15B 4FZVA 2XOCA 1AA1B 1T05B 3EE3A 2XOZA 5DZ6A 3GJQB 4BLGA 3GJTB 3VAHA 5I3UB 1MM2A 3IM8A 4B9SA 1Y5LB 1U6ZA 1TL7A 4IG3B 1Q78A 2UUBF 2CQHA 2B4UA 3EGWB 2LGKA 4DF8A 2AWZA 3UR3C 2HW3A 1IVZA 2ZBQA 2KT2A 4F3MA 1SV5A 4ZS6A 4QCLA 2V63A 2WVBA 2IJNA 3GR0A 1RTHA 3MPWA 1MG7A 5B78A 2CYYA 2QMXA 2QL9B 2YY3A 3MM7A 1S0OA 3DLLQ 3TYTA 2QRRA 5CA5A 4PPEA 1U8SA 2RHQB 3G4SS 4CNZA 4QWAA 4ZHRB 4H4MA 2YKNB 4J9NA 2RS8A 2MY8A 3DRPB 3FKBA 5KH3A 2M2BA 3M6VA 3M8QA 4NLVA 2F4VJ 2RH3A 4QZVB 4ZLPA 4CLKA 5BYQA 3BYPA 4YAXA 3OSNA 1VBZA 1E4UA 1UEKA 3HF5A 4ES3A 1M90T 5K3QA 2BXJA 3GYNA 1MLAA 4K7QA 4OYOA 4UOHA 5KFRA 1DQ8A 4IDKB 3LGHA 5EWFA 4ELVA 5ETKA 2UUBJ 1HI8A 3NGRA 2D9PA 3MDBC 1N36F 5H1UA 2BJ1A 2C1EB 2WW8A 4WZMA 2J9DA 2J5AA 3LH2S 1KFDA 3OL8A 1YVFA 2W2PP 4LSZB 1PO6A 5FD1A 4IRDA 2R4FA 4O3QA 2OEJA 2Q3PA 2KFZA 1ZAVA 2RQ4A 3CJ2A 4NA3A 3HD1A 3M99A 2LQ8A 1WACA 3OL6A 2K4DA 3VK6A 1YQHA 2YSJA 1CC7A 1XWLA 2GO8A 4WYWA 5EGYA 1KLMB 2D69A 4HT5A 4C7QA 1JKHA 4LFAJ 4DPWA 1UMJA 1HKAA 2MQLA 1M5HA 2YKMA 3FCHA 3OQ2A 4NLWA 1HARA 3P3DA 2ADCA 1C1CA 1GX6A 2IYIA 3DYAB 4PAAA 4WP8A 1TAQA 1Y4ZB 3GIRA 1SQEA 4JV1A 1HYSA 4DPYA 3TANA 4LRBA 1RT1B 2J6TA 2BE2A 4DR3J 2Z30B 4HTJA 2MLYA 3TUPA 3VAKA 1RAOA 1R43A 3AQOA 3CJQA 3QO9A 3T9ZA 5LSOA 3SI8A 4FDFA 1U1OA 2DRBA 4PQUB 4FKYA 5HQMA 2ECVA 1JLEA 3NNCA 1O51A 1OSCA 1L3VA 2RAQA 2FZGB 2HGMA 2OGUA 4X66F 1S97A 1KC8T 4B9VA 3P4UB 3RW6A 1U1RA 3PO5A 2HQCA 2RVJA 2DVIA 1QD1A 4LMZA 5KFPA 3G8QA 1EETB 3L4BC 1G25A 5EWGA 5ETPA 1DFDA 4CO4A 3KNGA 2CT2A 4AYCB 3TJ9A 2F6NA 1N5TA 3DRRA 1D9AA 3KJQB 4RNHA 3IGNA 2DNMA 2YNFA 3D9BA 1HWUA 2RHSB 2YH0A 3NY0A 3VV2B 5B0CA 3JYTB 4FPIA 4TKTA 4DR3F 1EQMA 3ZFVA 4O62A 1RWNB 3W66A 4OHVA 4DHVA 1TMJA 2AU0A 1S0MA 4B17A 2QO3A 2KHDA 2RMLA 1RWVB 1S79A 4CYUA 2DRDA 1F9HA 2POKA 1FF2A 1Q5VA 1Z4UA 2DHXA 2YSMA 2K1JA 2IDLA 3PDNA 4G1QB 3J7Z5 3QRQA 2LGVA 5DJBA 2ZM6J 1RK8A 3F44A 1YWXA 4K8RA 5FLXU 2QMUB 3CJRA 4QU7A 1U0HA 2KWNA 1TK5A 4B08A 1M5PC 5IQ6A 3MDFA 2MQNA 5IZHA 1SJ3P 1A7GE 1GXUA 2WONA 1WNEA 3HO1A 1NKEA 2CZ4A 2XI2A 1IWAA 4MK7A 1VFYA 2HQDA 3TVKA 4DV1J 1NJXA 4IRKA 1F2GA 2ZH1A 5DG9A 4S3OC 4UQGA 3HXMA 3RAXA 2PO4A 2OD4A 4LF1A 4PYAA 4USJC 4ZVGA 4ZCKA 1DJ0A 3DDTA 2XG8A 4QIVA 1YX2A 5F8NA 1RJJA 2EWHA 3JS9A 1LKZA 4DDFA 4TQSA 4DR1F 1OWXA 2DR8A 3DLBA 4YDXA 5KTQA 1IJEB 2GIRA 3I0RB 2VKZG 4DS4A 2H0DA 2PDAA 4KGZB 1C2PA 4DV7J 1X5PA 1JWWA 4KQZA 3CDEA 1LXJA 4M1KA 5HVGA 4XPEA 1GMUA 1HPZA 3KV6A 3UDVA 4EEYA 5SUHA 2HBRB 4NXMJ 3NBPB 2A0FB 1SC1B 2AZ1A 4FYYB 4CO3A 1HNXJ 3S01A 1JLBA 5HJYA 1RACB 4RW6B 1RAHB 5DLFA 1RABB 1WEXA 4QR0A 2B8QA 2ADBA 3CJ5A 1VK8A 1GAOA 1VRUA 2CSZA 1X5OA 1R7IA 5C5JA 3KDNA 4PQAA 4P5OB 5M2RA 5KFZA 3VCDA 4ECQA 3US5A 2CZ9A 4CO0A 1NKBA 1QSSA 3IR5B 3T3FA 1H2VZ 3CJSA 4QOTA 1LW0A 2N7CA 4DX7A 3QZ8A 5L1IA 4A0CD 2BAYA 2QE5A 4AL7A 2VQFJ 2FZKB 2BOAA 2XI3A 4RNMA 5L38A 3NP5A 3MUMP 1HYIA 2DNPA 1S1XA 1K8AT 2KFNA 3J7A1 1F3VA 1C0TB 1B0PA 1YLXA 4X4VA 5A0YA 1WDDA 4DU7A 1AUDA 5DM7Q 1BORA 4K4VA 3QLHB 4LRCA 2ZETC 3MM8A 3NS6A 1JJ4A 2HBZB 3PJWA 3NMAA 2NYHA 1GQEA 2QLJB 4P71A 3I87A 5T7LA 3ZO7A 4NCGB 3MR3A 1K0VA 3GWCA 3HHDA 4PPDA 2HIQA 2O67A 4QPXA 1D9DA 3BKUA 1YIJS 3MUTP 3PW7A 3ZPVE 1B7YB 1Q79A 5FDLA 3SSSA 1PYOB 3MPDA 2V9WA 4QU6A 3O47A 4LF5F 1UFLA 1OY6A 2GZOA 3CCMS 1BWEA 3LP1A 1FFWB 3PYFA 4P52A 4ES1A 4YHHF 5ETVA 3SFUA 1IWGA 3F41A 2DBBA 4DJBA 4ZP9A 3Q8QB 2KYZA 3NOGA 4X62F 4I69A 3V4MA 1HNIB 3D6HB 2VL1A 2F1FA 3ZZTA 2VQEF 4RU2A 5EWEA 4WU3A 3BQ0A 3CULA 3N5BA 4CT9A 4WP9A 3W63A 3TP2A 1Z2QA 4ATNA 2BABA 3JXOA 3PEJA 4XDDA 5B08A 2YWFA 3EVMA 1QE1B 1WG5A 3LPEA 4LR9A 1NZ8A 1VQSA 3S8SA 2VG7A 4Y2AA 4LVOP 1J27A 1KQSR 1RHRB 2M5YA 4UZCA 1S6PB 1BQMA 4RW7A 5G0RB 4NEYA 3VHQA 1CEZA 5JUMA 4N7TA 2BQUA 3GTYX 5HANA 1JJ2R 7FDRA 2YXLA 2FJVA 1NH7A 5LMUF 1ZA1B 2ZHOA 1S7IA 3OHBA 1N56A 1QUVA 3I96A 1KWMA 3P5TL 8ATCB 2RF2A 3PRVA 4OZ2A 2ALYB 3PUQA 4USMA 3CCSS 5HP1B 2Y9HA 3QFHA 1JJCB 2AN6A 4LBHA 1CJVA 1TKTA 4NLSA 3DOMA 4TQRA 2E1PA 3C19A 2F3JA
chains in the Genus database with same CATH topology
2YVRA 2CRRA 3LVRE 2EGMA 2CONA 2JM3A 4Z0RA 3FJUB 3LJUX 2LQ8A 3LPEA 2EXUA 1NZ8A 3P8BB 2MKEA 2KKYA 3EWGA 3KDEC 1NPRA 4ZN1A 2YREA 2RR4A 1DCQA 2OWAA 1M1GA 4H9DA 5SVYA 2IQJA 2FFWA 2XOCA 3SUBA 3PLWA 2XOZA 4OGCA 3JUEA 2FD4A 2M13A 3LDYA 3QQCD 3O47A 5K3QA 4Z0OA 2CRWA 2D8UA 2KKXA 5SVXA 3H7HA 3DDTA 1M1HA 2CSVA 3FEHA 2DJAA 2JUNA 3M7KA 1NPPA 4O62A 2L7PA 4OGEA 3T9KA 2XOYA 3MDBC 3Q1DA 2XP0A 2XHCA 4ZN3A 2E61A 3LVQE 4QQ4A 2P57A 5SVIA 3FM8C 3DWDA 3H7HB 5SVIB 3E2DA 2OUGA 4F1PA 2B0OE 2K06A 2LAUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EWG A;  3QQC D;  1NPR A;  4ZN1 A;  3H7H B;  4ZN3 A;  1M1H A;  2OUG A;  3H7H A;  1NPP A;  1M1G A;  3LPE A;  3P8B B;  2LQ8 A;  2EXU A;  2XHC A;  1NZ8 A;  2K06 A; 
#chains in the Genus database with same CATH topology
 2KXF A;  4H4O A;  1ZZF A;  2KZZ A;  5F8H A;  1M5V C;  2VJF A;  5TDW A;  1MU2 B;  2HRY A;  3M8Y A;  5HBM B;  4ED0 A;  4C8O A;  1U2R A;  2CPE A;  3SCJ E;  4Z7Y A;  1BY9 A;  4C3K A;  1UJ4 A;  4OLO A;  3OL9 A;  2HQ3 A;  4ED8 A;  3ZPV 1;  4RZR A;  1U48 A;  3IM9 A;  4LBI A;  5H1V A;  2J7U A;  3FAO A;  2L9N A;  4JUZ A;  2AF6 A;  4FVC A;  2EG1 A;  2FFW A;  3C16 B;  2W9A A;  1UVL A;  1RP5 A;  2PD1 A;  3QQC D;  1YGY A;  2EK6 A;  3MXH P;  2DGT A;  1URN A;  3O7A A;  1VYA A;  4ZVR B;  3Q83 A;  4XPC A;  3W64 A;  2XCP A;  2YNH B;  2N3L A;  4IOA Q;  2J7K A;  2RI7 A;  1QUP A;  5SVI A;  3KYL A;  3RR8 A;  2BJE A;  5F3T A;  2AYE A;  2DH7 A;  2XHC A;  2EC2 A;  4X4N A;  3A4T A;  2FB0 A;  1UWA A;  3CCJ S;  2WRM A;  3MMA B;  1V5V A;  2ACY A;  3KHR A;  5E3Q A;  1RT3 B;  3D6F B;  4WBF A;  4C8N A;  3PJ9 A;  2R8K A;  2VOP A;  2LLZ A;  2GHW A;  3DMJ B;  3Q8U A;  2W9C B;  3VGT A;  3KK3 B;  2YH1 A;  4CRJ A;  1FRK A;  2DR6 A;  3RG6 A;  3A3O B;  5CAA A;  3ENA A;  2RIJ A;  2N7Y A;  3W5X A;  1HQE A;  3IAS 9;  1URR A;  4N77 A;  2CDR B;  3UNG C;  3M8Q B;  4LF2 A;  1FFS B;  1T9W A;  4LF8 J;  1YK9 A;  4FF3 A;  2QIC A;  1ZM4 A;  1TUV A;  2K16 A;  4IC2 A;  2ATC B;  3Q0A A;  4KFB B;  3ET6 A;  1Q95 G;  1QAX A;  5ETN A;  2ZM6 F;  3RZA A;  5KFI A;  2QIZ A;  2MPU A;  4A8O A;  4UT4 A;  5LSL A;  2DXD A;  5LOQ A;  4KKO B;  3PR4 A;  3MED B;  3GR1 A;  1JLF B;  2B6A B;  1NM2 A;  2MKS A;  3D1O A;  1RXO B;  2KYX A;  1FK9 A;  3KFW X;  4FPR A;  4RBV A;  1NSQ A;  2I50 A;  1Q8K A;  2AJ1 A;  2OEK A;  1O0P A;  2GMH A;  3U5N A;  1HIY A;  2JJ4 D;  3DM2 A;  5EDW A;  5I3L A;  2M8D B;  3JAM U;  3ENW A;  2J0X A;  3AOA A;  4K5S A;  3L3C A;  1JM7 B;  2W4C A;  5G4D A;  7AT1 B;  4RUA A;  4ZUX U;  1FE4 A;  1HD1 A;  2XYG B;  1YBU A;  2UP1 A;  4JI1 J;  1HBN A;  3DDI A;  4FXD A;  2FVS A;  2ZH5 A;  2JVO A;  4KJI A;  1PBA A;  3SUB A;  4I2P B;  2BOP A;  3K8V A;  4QIE A;  1KQK A;  2KM8 C;  2IDE A;  4IG0 B;  3K89 A;  1X4U A;  4YBS A;  1C1C B;  2CSV A;  3MGJ A;  4FYV B;  4ZPB A;  2DX8 A;  2VUG A;  1JX4 A;  1PAU B;  3OT9 A;  5GAD I;  1JLC B;  4DL5 A;  3PRB A;  2MST A;  2EVZ A;  3TX8 A;  2AGO A;  1FP0 A;  2YKO A;  1UEV A;  4H4K C;  4OJH A;  2OML A;  3QGH A;  4O0I A;  4CI0 B;  2PI5 A;  4Q8F A;  2KVQ E;  3D0I E;  1EZZ B;  4O3O A;  3SEO A;  4DPO A;  2DY9 A;  4KB7 A;  1D9F A;  2Y1M A;  1NK4 A;  1HBM B;  1QAI A;  2C3Y A;  2LQB A;  3C6U A;  3NS5 A;  1JXL A;  4Z2X A;  2CJK A;  1QE1 A;  5CAB A;  1N6Q B;  3U5M A;  4YBM A;  3DLH A;  3DMJ A;  2IM0 A;  4WXO A;  2UU9 J;  1RMD A;  3HCT A;  2PUY A;  5D1K B;  2W9B B;  1D3W A;  3UDE A;  3TZY A;  1RU2 A;  3MCM A;  3U7J A;  2CPJ A;  2M7S A;  1X9W A;  4AND A;  4UOF A;  3F73 A;  5DDQ C;  2VG6 A;  2MZJ A;  4DV6 F;  2CNL B;  2BBE A;  1U1Q A;  4NCA A;  2QSF A;  4URQ U;  3MUR P;  1QM9 A;  2RUS A;  5EX3 A;  4NL5 A;  1YHQ S;  2RF2 B;  4X64 F;  2IM2 A;  4DFP A;  2GQ2 A;  2WVD A;  2VBW A;  4HDH A;  3CPW R;  5CQG A;  3DQV R;  1P27 B;  1T9V A;  2FY1 A;  2MMY A;  3I0R A;  3E2D A;  3BM7 A;  3S6E A;  5B0B A;  1KQF B;  4UOC A;  4TLR A;  2KN4 A;  3NCR A;  2LDI A;  1FJC A;  4AQY J;  3JTN A;  3O36 A;  1WOS A;  2OI2 A;  1HA1 A;  4P7V A;  4RUB A;  4NLY A;  2F42 A;  2KFY A;  3L7U A;  1DBD A;  2U2F A;  2K3K A;  3N6N A;  3O5T B;  3VAM A;  1TKZ B;  1YRU A;  2OD6 A;  4K0K J;  5LMN J;  4GVB B;  5JVH Q;  1X4A A;  1L3S A;  1MSW D;  4DUY F;  5E0O A;  4V1A k;  3AOC A;  3MEG A;  1MN9 A;  5T41 A;  3W65 A;  2CWX A;  3G96 A;  4K4T A;  1CG2 A;  4J9R A;  4OI2 A;  2WOM A;  4RBU A;  4P7T A;  3R7S B;  1IUJ A;  4HI1 A;  5HMX A;  1RT1 A;  3SIP B;  3G8S A;  3IHP A;  2HVD A;  1TZ0 A;  2UUC J;  3ITH A;  4X4T A;  2HK2 A;  4EBD A;  4O23 A;  2HS3 A;  3OD2 A;  1F0X A;  1CSJ A;  4WFY A;  3QO9 B;  2DHG A;  2H9Z A;  2N3O A;  3CXC R;  1N5Y A;  5LJ5 Y;  4ED5 A;  4B3O A;  3H90 A;  2ZWP A;  3ZVY A;  2XEX A;  1FVS A;  1MW7 A;  1FWP A;  2CRR A;  1JXE A;  1S1W B;  3DRY A;  2LGG A;  4OYX A;  5A0Y B;  2XCA A;  4DV4 J;  4DR6 J;  2MSS A;  4YDD B;  2KKH A;  4QPT A;  4I7F B;  4FJC A;  3VAL A;  4MVT A;  2ILZ A;  2MKH A;  3PYD A;  2KR4 A;  3EGN A;  4F26 A;  3IC1 A;  2MUM A;  1ZM3 A;  1VYX A;  1E6V A;  2MD7 B;  3OXG A;  1RT4 A;  4ECR A;  3GCX P;  3J7Y I;  1GT8 A;  2UU9 F;  1IR2 A;  2CAD A;  4PRF A;  2HLT A;  1MWY A;  1Z6U A;  8RUC A;  4EBC A;  2HIY A;  2MZ1 A;  1QSL A;  4KFB A;  1AT1 B;  2CPX A;  1RT7 A;  1SJQ A;  2DGO A;  2Q1L A;  2E6R A;  2IC3 A;  3HVT A;  4DV3 F;  5I3U A;  3LQH A;  1FX4 A;  2WB4 A;  4RWX A;  4FS1 A;  3QIP B;  2RDD A;  2ZVI A;  2LXH C;  1CS4 A;  1RB0 A;  2W2N P;  3G87 A;  2VIC A;  5L1L A;  4ZN3 A;  4ZPW R;  2PMW A;  4J9K A;  5ETR A;  5HL7 Q;  3HM9 A;  1LV5 A;  3CD7 A;  4OHY A;  2YNG B;  2ZUG A;  3MAA B;  4ZLJ A;  3K0J A;  1VBY A;  1CJK A;  3M32 A;  3SBM A;  5GAE I;  3CF5 Q;  2Y1J A;  2LEP A;  4P2M A;  2BJ9 A;  2CJ9 A;  5ETM A;  5LKZ A;  3P45 B;  5GAG U;  1KQG B;  1TK0 A;  2VZ9 A;  2OKQ A;  1H74 A;  1K1S A;  3NRB A;  4Y2I A;  4CTA B;  1XR6 A;  1RA7 A;  2DNH A;  2E29 A;  3ZZZ A;  4RW9 B;  1YJV A;  4GVB A;  4HDG A;  4RX6 A;  3GIJ A;  2UXB J;  4NRT A;  3PAC A;  3ILI A;  5DGB A;  2AYM A;  4KO0 B;  2COL A;  4A8Y A;  3O34 A;  5CYQ A;  5KAK A;  3MM9 B;  1F6T A;  1Y5N B;  2I9S A;  3VF0 B;  2G43 A;  4DX5 A;  3THV A;  1MML A;  3RR7 A;  4DZ6 A;  2QSW A;  2UV8 G;  2GS8 A;  4FNI A;  5B76 A;  1N52 B;  1S9G A;  1NZA A;  4CM2 A;  5F41 A;  3UI3 A;  2NRE A;  4V19 X;  2CVI A;  1APS A;  3PG9 A;  2D8S A;  3FL2 A;  4R8P K;  2J9D E;  2DGS A;  3J80 U;  1WDT A;  3RAQ A;  1GMW A;  5HJX A;  3BF4 A;  1RTJ A;  3DXS X;  5KT2 A;  1XBW A;  3V5R A;  3TW0 A;  1EHW A;  2HQF A;  1JLB B;  2HFV A;  2LCW A;  3IBW A;  3MD1 A;  4KPY A;  1FJ7 A;  2PFF B;  4FXW A;  4WWS A;  2UXB F;  4MMO A;  5B75 A;  1RWK B;  2AQ4 A;  5J2M A;  1RKI A;  4DI6 A;  4E98 A;  2LXP C;  3O3L A;  2JMD A;  3NXZ A;  2R7X A;  3O44 A;  3P96 A;  2GQC A;  3JSM A;  5C25 B;  3EIC A;  4KT0 C;  1WKJ A;  2HFO A;  3MCN A;  3GG1 A;  5E41 A;  2RDJ A;  1XNR F;  2HHW A;  1X9M A;  1AYE A;  1X4E A;  2NAA A;  2FY8 A;  1CPZ A;  2FUU A;  5M2P A;  1Z60 A;  2BAN B;  4MKB A;  1YBA A;  5KFE A;  3T5H A;  1XC9 A;  3MUV P;  4P74 A;  2AYG A;  3HHN B;  2DJW A;  3A3P B;  1I5O B;  5FB1 A;  1VIX A;  1S9E B;  2R7O A;  1SKU B;  5I42 B;  5H9F K;  2AKW B;  2ECI A;  1NXI A;  1G1X A;  2G9O A;  4QWC A;  3W2W A;  2G0I A;  4C11 A;  3HHL D;  3AJ1 A;  4IC3 A;  1R89 A;  2ROP A;  3L7P A;  3H5Y A;  1VJW A;  1Z2Z A;  4ID5 B;  1JK9 B;  2VJE B;  4KTQ A;  3KG1 A;  1QJH A;  4R8U A;  3I55 S;  1Y3J A;  4LFA F;  4H4K A;  4MT1 A;  1X4B A;  1EB0 A;  4I7D A;  1FDB A;  2DHS A;  2OPR B;  2V6A A;  4Q43 A;  5J2P A;  1KHW A;  3RBD A;  2XNQ A;  2OP5 A;  3LP2 B;  4OX6 A;  4EI2 A;  3TZZ A;  2QEX S;  1LWC A;  3BQ1 A;  1CJT A;  1N36 J;  3K58 A;  3AQP A;  3G6Y A;  2YNH A;  2IBK A;  2F63 A;  2DXE A;  2W8L A;  1WF2 A;  3BH7 B;  2B6A A;  2M3H A;  1HBU A;  2GC8 A;  5LT5 A;  5E3C A;  3PFE A;  3TZX A;  4CLU A;  3WC2 A;  3FK4 A;  3AD8 C;  3FMW A;  3G9C A;  1LWX A;  1U1N A;  1ZAW A;  1RAE B;  2EW9 A;  1FJG F;  5KG2 A;  5G05 B;  2J6U A;  1R8A A;  2KKY A;  2ZHA A;  2L41 A;  3WBZ A;  2KI2 A;  3EPG A;  1NND A;  5KFO A;  1HQE B;  2HVH A;  2UZA A;  1SL2 A;  4ZPT R;  4LR7 A;  4XO0 A;  2CPH A;  4N3W A;  2AP6 A;  4XIU A;  3PX6 A;  4N4F A;  5KFA A;  3H25 A;  4UST A;  4DR1 J;  2CKL A;  2GJI A;  2YTC A;  4NEZ A;  3M6U A;  3QIP A;  3CC2 S;  1JQG A;  3HVA A;  4DQR A;  2RS2 A;  2DKO B;  2HFS A;  2KRB A;  2XZT B;  3BV8 A;  3LO3 A;  3O6Q A;  2MNZ A;  4NI2 B;  4RUC A;  4I6A A;  3GIK A;  2YNG A;  3ZZU A;  3ILJ A;  2AD9 A;  3DRS A;  2B7C B;  1CJK B;  4IFY B;  4ZPC A;  5LKU A;  1NAQ A;  4B3T F;  2VOO A;  5DQI A;  2VP7 A;  3R5C A;  3HMJ G;  2WSC C;  3AHP A;  1PCA A;  3DM2 B;  4DQS A;  1HYJ A;  4PWD B;  2KL8 A;  5F0U A;  2CNN B;  2DD8 S;  5E33 A;  3OJU A;  3H20 A;  4V3K C;  2RT3 A;  1UFW A;  3DOL B;  3Q86 A;  3NAI A;  2BRK A;  2VNF A;  1JLG B;  1U2C A;  2GGP B;  3KXD A;  2VPE A;  3MR7 A;  4KIA A;  1PJ6 A;  2IHR 1;  5LSR A;  3K59 A;  1Q82 T;  2WZ1 A;  3M9M B;  2LQ5 A;  3O37 A;  4IFV A;  2RQC A;  1TL3 A;  5J2P B;  1UPP A;  4KYZ A;  4CH0 S;  2R8I A;  3ZZ0 A;  4GC6 A;  3PIP Q;  5KH9 A;  1RT6 B;  1S5Z A;  2XB2 D;  4YB5 A;  5LJ3 Y;  1U47 A;  2V5H G;  2G2Y A;  2Q43 A;  1GEH A;  1Q5Y A;  2VC0 A;  1IQZ A;  2V68 A;  2V50 A;  4LBP A;  1JLQ B;  1VQL S;  5J3X A;  4F0M A;  4K4U A;  4J9P A;  2UZG A;  4K5R A;  4JI8 J;  2FC8 A;  3QAE A;  1MMD A;  1QVF R;  4U7C A;  2ASL A;  1ULR A;  3M05 A;  5IFM A;  3OLB A;  3PKY A;  3W5Y A;  4A8M P;  1RWW B;  4KGM A;  4MK9 A;  4OHW A;  4ER8 A;  1SH3 A;  4ILL A;  3TUJ C;  1W2I A;  1BC6 A;  2B5J A;  2N4C A;  4PKD B;  3U1M A;  4PZV A;  3MFH A;  2KVI A;  4I4B A;  4MIW A;  5L9X A;  3KJV A;  3NKY A;  5IT0 A;  2E1A A;  2NUU G;  3QSY B;  4X64 J;  3Q23 A;  3GV5 B;  1FRM A;  4LRF A;  3HT0 A;  1PGZ A;  4EO6 A;  1NDL A;  2W2O P;  4ILM A;  1SH2 A;  5B79 A;  1CUL A;  3VWS A;  4A48 A;  2YNF B;  3OUY B;  4OGC A;  1YI2 S;  3I0S A;  2H65 B;  2JSX A;  2M52 A;  2XLJ A;  3QBC A;  1NDK A;  1IBL F;  1NPP A;  1BWV A;  1WEM A;  1S0N A;  2DH8 A;  3GSI A;  4K50 A;  1I6J A;  5B7W A;  4HR2 A;  2DK2 A;  1MWZ A;  5CD4 A;  2OPS A;  1PBU A;  4NI2 A;  1PSD A;  1SXL A;  2E61 A;  2ZC4 A;  3W7B A;  4F3O A;  4LF6 F;  2V2K A;  2R3V A;  3FZ2 A;  4N41 A;  4ECY A;  5D1L B;  4QJV A;  2CQP A;  4MSX A;  1MBM A;  2F9J A;  3JTO A;  4KPC A;  5KFX A;  5KG7 A;  1FER A;  4DR2 J;  4PUO A;  1V3Z A;  1HNV A;  2HQG A;  2Z4P A;  5KFL A;  4B3R J;  3MEE A;  5HAT A;  4Z7C A;  4QIF A;  1KEK A;  3M7V A;  3IS9 B;  3M8Z A;  3U02 A;  1U1P A;  3BDP A;  4ENO A;  1C0U A;  3U5O A;  2E5G A;  3MMB A;  3TAP A;  3CCZ A;  2KWO A;  2UUT A;  3UFC X;  4CLZ A;  4F0H A;  2VU5 A;  2V67 A;  4F4A A;  1FKP A;  1ZOT A;  2FUG 9;  2GIF A;  1R0A A;  4B3M J;  4JI2 J;  4DR7 J;  4OL8 A;  1XN9 A;  1ITP A;  3C66 A;  1XTZ A;  3M8W A;  5HQL A;  3H59 A;  2K1R A;  1MNE A;  2CJX B;  4CLT A;  1HHQ A;  4QIW D;  2OTL S;  3PKM A;  1F9E B;  2LXF A;  1UZH A;  2KRR A;  3GZ7 A;  4C97 A;  4LF9 J;  2C3U A;  5H9E K;  3DLJ A;  5IT4 A;  4LF7 F;  1WEN A;  2Y43 A;  1G4C A;  4M5K A;  2H4Y B;  1RI7 A;  1SUQ A;  2XZD B;  3PCO B;  4FKX A;  4C3M A;  3NMR A;  2HZV A;  3GFH A;  3V81 B;  3D6T B;  5HRO B;  3V4I B;  4C98 A;  3LRQ A;  3C14 B;  4RW8 B;  4DL4 A;  1PC4 A;  5AT1 B;  3WDO A;  2I0X A;  4N56 A;  2IJF A;  1ZBD B;  2XSJ A;  1X31 C;  2K8G A;  3FBF A;  1R0C B;  1S6O A;  4Q7A A;  2VJU A;  3DKD A;  1REG X;  3E2E A;  1T05 A;  1NDC A;  2JMI A;  2F6J A;  2I8E A;  1VJQ A;  4EYH B;  4M5M A;  3RPG C;  2D3O 1;  3AAW B;  1JOC A;  5DG7 A;  5TDR A;  2CQ3 A;  4ERD A;  3EGV A;  2JUN A;  4LSL B;  2MJU A;  1SBR A;  2ZWO A;  2IRU A;  3M2R A;  4OYI A;  4R0E A;  3C46 A;  1RLD A;  4PCQ A;  2L08 A;  3SSQ A;  3UQS A;  5AE1 A;  4ELT A;  2M70 A;  1GH8 A;  3K8W A;  1X4I A;  3D0G E;  1T11 A;  1VQY A;  2YW8 A;  4CQ1 A;  3FCV A;  4IR1 A;  2ZE2 A;  2MD8 C;  1UVN A;  1FRH A;  3E01 A;  1NJI T;  4PR6 A;  4O0N A;  4RW4 B;  3CCW A;  4ZPD A;  5IOL A;  2XB1 A;  4ZJL A;  3BSO A;  2H48 B;  1MU2 A;  3HKW A;  5HBM A;  1N32 F;  4LF5 J;  1UVJ A;  3M8P B;  3CWJ A;  5ETO A;  4LVN P;  2JX2 A;  6FD1 A;  5K20 B;  2W9C A;  3G6V A;  3UCZ P;  3LTO A;  1Q53 A;  2AX1 A;  3OFE A;  3HHL A;  4BWJ A;  2AX0 A;  2CJY B;  4DV7 F;  3V6K A;  1WEE A;  1SL1 A;  9ATC B;  2D3U A;  1G7C B;  3BN7 A;  1VR6 A;  2LU1 A;  1VC5 A;  1N34 J;  1IBK J;  4LSN B;  1VLO A;  1YJR A;  3ISN D;  3TAM A;  4N8O A;  1YRX A;  3O1L A;  5IXU A;  1LDK C;  2H3E B;  3LP1 B;  3DYA A;  3DHX A;  5JMN A;  1N5S A;  2DIS A;  1H0H B;  2Z58 B;  2YPZ A;  2HRU A;  2M0G B;  3DCA A;  3M30 A;  4K2X A;  2W01 A;  4DN0 A;  1P6T A;  1S6Q A;  4CLS A;  2BE2 B;  2H5I B;  3NG8 A;  4OX7 A;  4P2F A;  5IV3 A;  3U5P A;  1HMV B;  2LXI A;  2AJQ A;  4KH1 B;  2FHJ D;  2HRT A;  4C8K A;  3AA8 A;  2D3O R;  1T9T A;  1U7L A;  5L1K A;  3LAK A;  2GO9 A;  3CUN A;  3TUZ C;  1O6X A;  1YJ7 A;  4PXE A;  4CO1 A;  2FVR A;  4ED6 A;  2IA6 A;  4DR4 J;  5A8R B;  2DGW A;  1REV B;  4B3R F;  1U6G B;  1RWM B;  1TL1 A;  4W92 B;  1S76 D;  1Q16 B;  1JKH B;  4DR2 F;  2KYU A;  2Z2M A;  1UKU A;  2BYC A;  4MKV A;  4R0J A;  4A49 A;  1TU0 B;  4L58 A;  1UZD A;  2F8H A;  5CZX A;  3KK1 A;  4FXV A;  4ILR A;  3VAF A;  2GCF A;  3N4W A;  2OLW A;  5IV4 A;  2VBZ A;  3BKF A;  2QN6 B;  4IDK A;  3KMS A;  2H5J B;  1N33 F;  3OTB A;  5ETL A;  2AEM A;  1CS4 B;  2HPU A;  1X8D A;  1UWB A;  2VON A;  4K4W A;  3D1H A;  5GAG I;  3RB4 A;  3DOM B;  2I38 A;  3KKF A;  3HDS A;  3G6X A;  4IOC Q;  2DHH A;  2CKW A;  2HQI A;  3K57 A;  3KNV A;  1FJE B;  2XC9 A;  1PIE A;  2PA3 A;  3C2P A;  2V69 A;  6AT1 B;  2P2C B;  4NLO A;  3QGI A;  5F8I A;  1V3R A;  3MHH A;  4DBQ A;  2R2T A;  2VFV A;  1YJN S;  2FHM A;  1E6Y B;  3HHK A;  4J37 A;  1LK7 A;  1TFY A;  4FBU A;  1H72 C;  1LW2 B;  1R6V A;  1S1T A;  4M5H A;  4F67 A;  4AYC A;  3EUN A;  2C2M B;  3TUI C;  4DQI A;  3IG1 A;  4KR0 B;  4P9S A;  1UJ5 A;  1XNQ F;  5CYQ B;  1RAI B;  3PO4 A;  3TA2 A;  2E9Z A;  3KWM A;  2HS4 A;  3TEG A;  2C22 A;  1GXT A;  2IJR A;  2RQM A;  5HAO A;  5FLX Y;  2ZKU A;  1CJT B;  4ZVS B;  4LFC F;  1H7X A;  1RTI B;  3W61 A;  1HMV A;  3DWD A;  1XMO F;  2N4D A;  1Y10 A;  1X4H A;  3FQK A;  2CVE A;  5JVG Q;  2YKP A;  1JB0 C;  5FER A;  3QFW A;  4ZK7 M;  3HX9 A;  2ZNY A;  2KG0 A;  4NXN J;  4LK9 A;  3MD3 A;  2VF3 A;  3ZNU A;  4ETX A;  4ECS A;  2E1C A;  5E7O B;  1P8G A;  3V4I A;  4WXW A;  1Q8L A;  3W9H A;  1UA1 A;  1WSV A;  3NBP A;  4QYR A;  5HK4 A;  5BYS A;  2V34 A;  4OI4 A;  5G0F A;  4I6Y A;  4OJG A;  2KJV A;  2J8S A;  2OWA A;  1TP7 A;  2FJA B;  2FDN A;  2QLW A;  2V9K A;  2WVC A;  3DOL A;  3JSY A;  3KG4 A;  2NZ4 A;  2XUL A;  4KV8 A;  1TUW A;  4OI3 A;  5A8R A;  1HQ2 A;  3KLG A;  1PC5 A;  5HQ8 A;  4CH7 A;  1WG1 A;  5CCL A;  3M2U B;  3QZ7 A;  5GAH I;  4RL1 A;  1TL3 B;  2BV3 A;  2DJA A;  1JLC A;  1UCN A;  1LW0 B;  2Z2Z A;  4YUD A;  5ETT A;  2D9O A;  3AXM A;  4IH7 A;  2FD2 A;  4AFF A;  4XI1 A;  1ZAX A;  4QYZ K;  3FRZ A;  2VPW B;  2V4J A;  4DX8 H;  2KWJ A;  2WBM A;  3E8O A;  4JV2 A;  3AB4 B;  3CC7 S;  4WIQ A;  1FDA A;  3EZ5 A;  4JI4 J;  1OIA A;  1S1W A;  1U6B A;  1SJ1 A;  5KFQ A;  2LDR A;  4AUQ B;  5D4O A;  4GNE A;  3UR0 A;  2OO4 A;  3R97 A;  3AD9 C;  4YY3 J;  3I32 A;  1U6F A;  2VA3 A;  5D3G A;  5DET A;  2ZH3 A;  4O4G A;  1NHV A;  3A3N B;  1WEY A;  2VJE A;  5D0H A;  2PI4 A;  2W24 A;  1RBL A;  1ZTT A;  4R8U B;  4MIB A;  2SXL A;  4H4M B;  5F8M A;  3LPY A;  4USW A;  1QAJ A;  3K5M A;  3LWL A;  5KFN A;  2ZJP Q;  1RAD B;  3CCL S;  4MK8 A;  4M5L A;  3M63 A;  5EHH A;  4DV1 F;  1RUS A;  2APO A;  4P75 A;  2L75 A;  1ICE B;  1KHV A;  2FJE B;  3C8Y A;  3OTD A;  5GVQ A;  1JJH A;  1TKD A;  3PM9 A;  3AFG A;  3FFI A;  2J8A A;  4F4Z A;  2XP0 A;  3FVY A;  3PYG A;  5CYJ A;  2AYB A;  2P57 A;  4DFK A;  2ZVS A;  3FM8 C;  3KLV A;  2DGX A;  2XMT A;  3W1Y C;  4DV6 J;  1WD6 A;  2PNX A;  1U1M A;  3QWP A;  1R8H A;  1X7V A;  3GSD A;  3SYZ A;  1UFK A;  3BKT A;  1FNX H;  2ECW A;  4WKY A;  4GND A;  3QT6 A;  2EI5 A;  3R5G A;  5ETQ A;  3CD6 S;  4NLU A;  5F3Z A;  2O5D A;  3JSB A;  3SDE B;  2A6O A;  5BR8 J;  2LVW A;  4BC9 A;  1VBX A;  1EKS A;  1T03 A;  1LDJ B;  1VRU B;  2BKP A;  4OJ1 A;  3IWL A;  1MWQ A;  3T6J A;  3KK2 A;  2NQP A;  4F04 B;  5GME A;  2GAG C;  3GFY A;  5K14 A;  3JUE A;  4B9N A;  2M13 A;  1LOU A;  2B51 A;  1YJ9 S;  1FX2 A;  1M1H A;  1UJ6 A;  3H2U B;  1RWX B;  4TY8 A;  4DG1 A;  1U49 A;  1AUS L;  3HJV A;  2Y1L B;  1UWB B;  3K5P A;  3CJ8 A;  2DR5 A;  3ZNJ 1;  2F40 A;  4WFN Q;  1WIM A;  1HQU A;  4KHM A;  4JV5 J;  3SOW A;  2FJX A;  5CD4 H;  3VZI A;  2GX8 A;  2B0O E;  2ZH8 A;  3A13 A;  4OX9 J;  1R3N A;  4TXS A;  1OPZ A;  3VQS A;  4ICL B;  5KT5 A;  3MM7 B;  1QY7 A;  3ZZO A;  1RLC L;  2HEK A;  3MM6 A;  3NCP A;  4U8V A;  3RUB L;  4YHH J;  5HLF A;  1KRP A;  3M6W A;  4DL2 A;  2HLU A;  5J2Q A;  3PZP A;  1ZZN A;  4UUX A;  2L48 A;  2KG1 A;  4EBE A;  1WKL A;  1S1T B;  3MOJ B;  3KK3 A;  3GV8 B;  2ROE A;  2NSB A;  1RT5 A;  4TYB A;  4YQW A;  3IRW P;  2HWH A;  3H40 A;  3M6X A;  5J2M B;  2NYI A;  1EAY C;  2CQ1 A;  4DL7 A;  4QW9 A;  4F2R A;  4DU8 A;  1DQ9 A;  5EN1 A;  2HND A;  2DNQ A;  2DIU A;  1IQT A;  3EM1 A;  1NHU A;  2C28 A;  1N32 J;  3JQK A;  1U02 A;  2KFT A;  1RBO B;  2QT7 A;  2P5V A;  1J5O B;  4C8Z A;  2FJD B;  1GMW D;  3UDC A;  3HPO A;  4DSL A;  1S9G B;  1Y9O A;  4OZ3 A;  4YR3 A;  2DSM A;  3KNA A;  4M5I A;  4FYW B;  4G6V B;  4LR8 A;  4IQM A;  1NJW A;  2HHH J;  2MY7 A;  3KJF B;  3BZQ A;  4FIP A;  1L5U A;  2BE7 D;  2VB6 A;  2CG4 A;  3MPU B;  1FE0 A;  1UET A;  2PN6 A;  2VG7 B;  4DL3 A;  1NJY A;  3KTQ A;  2O01 C;  1FD8 A;  5A6P A;  3HJF A;  1JMT A;  4IO9 Q;  1RT4 B;  2D7S A;  3CDW A;  3DOK A;  4K59 A;  1WHY A;  3RBX A;  5KG0 A;  1DRZ A;  4I7C A;  4UY8 T;  4NE9 C;  2BW2 A;  5BXI A;  3TVZ A;  4DV5 J;  2ZBP A;  4C48 A;  1SC3 B;  2E7W A;  4M95 A;  4QIG A;  4RNN A;  4YY3 F;  1Y11 A;  2DYA A;  1WWH A;  2IM3 A;  4HH0 A;  2JFK A;  3PYE A;  4DG1 B;  5C13 A;  1M0S A;  3LP2 A;  5IWA F;  1IBK F;  3R5B A;  4CNY A;  1I51 B;  3CCE S;  4Q0B A;  2QYC A;  3N01 A;  4CCH A;  4C3L A;  3N9L A;  1FEH A;  3CDA A;  4PWW A;  4U96 A;  4ZCL A;  4LRE A;  3ZTO A;  1FI4 A;  1HQU B;  2IVY A;  4HHJ A;  4WE1 B;  4UP0 A;  4CH1 A;  3HVR A;  3N9N A;  3CMA S;  1IKY A;  4PUO B;  2QLF B;  4BWM A;  1EP4 A;  2ACM A;  4NLP A;  4MKY A;  4N8N A;  3PHT A;  4WFA Q;  3AJ2 A;  3SQG A;  1X4F A;  2MHN A;  2DB1 A;  4GVL A;  1R8C A;  1GX5 A;  3OBI A;  3V6D A;  3H4D A;  1KKH A;  1UVM A;  4I0W A;  4O64 A;  2X1F A;  5CH7 B;  2E5H A;  4AYB D;  1LXN A;  5GAH U;  1OYE A;  1HYS B;  3DRR B;  2NXC A;  3OVS A;  1FDD A;  2AJ4 A;  3GMG A;  2W2Q P;  2KWK A;  4KHP J;  3EZU A;  4NCB A;  4J9V A;  2UUC F;  1HL6 A;  3O2I A;  4PG7 A;  2K1R B;  2WCX A;  2FLN A;  3LGN A;  3D0H E;  4DV0 J;  3FRY A;  4M8L A;  1TKX A;  2UUW A;  1IR1 A;  1O8B A;  1LNQ A;  1NK5 A;  1S6Q B;  1BLU A;  1WTB A;  3M62 A;  3VGU A;  3MHS A;  2YQ3 A;  5KFS A;  1HBU B;  1NK6 A;  1SJ4 P;  3G86 A;  3HD2 A;  2DPI A;  4R2Y A;  3MMA A;  1WES A;  1VMB A;  4C0H A;  5A8K B;  4ZVT B;  1UTA A;  5J2N A;  4BS2 A;  4Y34 A;  5J1P A;  2A1B A;  2Y1R I;  1RDR A;  1VRQ C;  4GO7 X;  2W4P A;  2KM8 B;  1IBL J;  2Q6C A;  2PII A;  4DV2 F;  3QJJ A;  4Y2M A;  2UVU A;  1IM6 A;  4K4Z A;  1HBN B;  2E44 A;  3B8H A;  1Q7L B;  2JC0 A;  1TL5 A;  1I94 J;  1I94 F;  1FEE A;  3QYY A;  2XM3 A;  2C2N A;  5F9L A;  2HWI A;  3B78 A;  1VQN S;  3KG0 A;  1ZPV A;  4X3G A;  2J9E A;  3RB6 A;  2F9D A;  1J2V A;  2JFD A;  4J91 A;  3HVW A;  1ZPW X;  3L1Z B;  5C11 A;  5L39 A;  1RT6 A;  2W4D A;  3QT7 A;  2ZJR Q;  4OX8 A;  5KFY A;  2FTR A;  3ZZY A;  5EX0 A;  2WVE A;  3W5Z A;  2CFX A;  1R6Y A;  4A4J A;  3HSG A;  1VFJ A;  1PG5 B;  3D1Q A;  5D1M B;  4KHR A;  1WG4 A;  2JLG A;  4E0D A;  4UY8 5;  2R7S A;  2V94 A;  1DZ5 A;  1RCX B;  4GNF A;  1TVR B;  2EGM A;  5HLF B;  1S59 A;  2CQG A;  5C2G A;  1K0T A;  4ZVH A;  1FD2 A;  2IMO A;  4U7U D;  1JLA B;  1RAA B;  3SQG B;  3C6T B;  5LMU J;  4I7F A;  5F8G A;  2E9R X;  4BHW A;  2PEB A;  5IQQ A;  1S6U A;  3EWG A;  2BEF A;  1VQ7 S;  2ZOF A;  1DHM A;  3DLE B;  2KH9 A;  1YTY A;  1TR0 A;  1WGM A;  2KE1 A;  1CBK A;  1M1G A;  1HHS A;  1P9Q C;  2EFQ A;  2VFU A;  1AB8 A;  5KFF A;  3VAG A;  3GII A;  2WAQ D;  3HLU A;  4A4C A;  3ICL A;  3TAM B;  1SVD A;  2HNY A;  2RU3 A;  1S77 D;  2RD5 C;  3HVT B;  1H73 A;  3MR2 A;  2RKI B;  4E2F B;  4YN3 B;  5B0F A;  2ILY A;  3EYZ A;  4IR9 A;  2PGC A;  4FYX B;  2PE8 A;  3CCT A;  4B86 C;  1D8Z A;  3DLK A;  3KDO A;  2ZH6 A;  2E1R A;  2AZ3 A;  2GQQ A;  2C2Z B;  2FGO A;  4ED1 A;  2BA9 A;  2FHJ A;  3L95 X;  4ECW A;  3D28 A;  1SPB P;  1XIQ A;  5JXS A;  4OZJ A;  1DY3 A;  2DNG A;  1QTM A;  3J7Z T;  3C6U B;  4K2J A;  2F8M A;  3FJU B;  1CLF A;  4JYA F;  2B9W A;  1NRK A;  2M88 A;  4OQJ A;  4PTB A;  4HI2 A;  4L74 A;  1VQO S;  3WIV A;  1FTC A;  3KJV B;  3IMQ J;  2IMW P;  2OSQ A;  3IS9 A;  4F4X A;  2BAC A;  3IAM 9;  1GTH A;  1V9O A;  2A10 A;  2H51 B;  3BSA A;  3DFE A;  1P1L A;  2CUY A;  2GFF A;  2WHO A;  3LQJ A;  1CC8 A;  4FP9 A;  4WPA A;  2MQO A;  4B9M A;  2XLK A;  3OHA A;  1RCO B;  1SB6 A;  2FHK A;  2NLW A;  4NLD A;  4QR1 A;  4GKJ F;  1B0V A;  5J1E B;  1TL7 B;  4O44 A;  4TVA B;  4LUB A;  4LRA A;  4M5D B;  1WI6 A;  4EMD A;  1Q86 T;  1VQ9 S;  1ZH5 A;  4Q0B B;  1G2E A;  3TAQ A;  1JLQ A;  1W7W A;  5AJ3 F;  3K5L A;  4IUF A;  2BX6 A;  2A2D A;  1ZM9 A;  2OPS B;  2QLX A;  3RRH A;  2XMK A;  4WF9 Q;  4L3K A;  6FDR A;  4FBT A;  4NRU A;  3MAA A;  1Y3K A;  2MKK A;  3CSK A;  2EFG A;  4RBT A;  3CJK B;  4HAC B;  1A0O B;  3TJ8 A;  2V8G A;  1HWL A;  4A46 A;  4DN9 A;  4GKK F;  5L9N A;  4WII A;  3FUY A;  1JLA A;  3TNV A;  3HTK C;  3M8R A;  1YKW A;  2CAJ A;  4RWW A;  1Q8B A;  1BGX T;  2YBV A;  3ZNI A;  2B0G A;  4G65 A;  1BMQ B;  5A6W A;  1GMV A;  5AE2 A;  2C2E A;  1U25 A;  1Q81 T;  4NXN F;  2R7U A;  3T19 A;  3OUY A;  3BR8 A;  5LKX A;  1NHK L;  1VRT B;  2XSF A;  1MM3 A;  2PSZ A;  4JBC A;  4KGV B;  1WF1 A;  5C24 B;  3VGS A;  1FKP B;  4NX9 A;  4ZCM A;  4DUY J;  1YIT S;  1N0U A;  5THW A;  3UDL A;  3J81 j;  1WE9 A;  2XGP A;  3PX4 A;  2G1D A;  2P9G A;  5KFD A;  4GNG A;  2ZHB A;  2VA2 A;  1DAR A;  3MZI A;  3VVU A;  2OUG A;  5CXT A;  4F4K A;  1BD6 A;  3BN4 A;  2UUA F;  3K5N A;  4ZKA A;  3QRR A;  2X3D A;  1C1B A;  3NAH A;  3QZV A;  1SUQ B;  4DX6 A;  4CLF A;  3T1Y F;  2XHW A;  2VG5 A;  4OYP A;  1K44 A;  1PJ7 A;  2P8I A;  3I5B A;  5J1N A;  1P9Y A;  2H5E A;  2OPQ B;  4C11 B;  3GPA A;  1RWO B;  3BGU A;  3L09 A;  1IJF B;  3BYR A;  5D4N A;  3GV7 B;  4PG6 A;  2ZD1 B;  4IH6 A;  5KG3 A;  1LWE B;  1RT5 B;  3D3B J;  2MJN A;  4WFZ A;  4ZDN A;  3PXG a;  2B9E A;  4KO0 A;  1RYR A;  3AD7 C;  3GB0 A;  2OSR A;  1R27 B;  5CYM A;  1R31 A;  1FNM A;  2E5L J;  4IG0 A;  2ZBR A;  2YQL A;  1NEE A;  2XYP B;  2VPD A;  4UP5 A;  5MAO A;  1ZTW A;  2JL9 A;  1T3O A;  4Y3C A;  2F65 A;  3BGL A;  4TLQ A;  3TOQ A;  2HNZ B;  1VLY A;  5FEY A;  2R8H A;  3LVQ E;  3MMC A;  3ADA C;  3BR9 A;  3Q8P B;  3M32 B;  2CWK A;  3TAR A;  1EQ0 A;  2VFS A;  2LAU A;  4HH1 A;  2C2K B;  3A8I A;  1F62 A;  2LXU A;  4G1I A;  4DCJ B;  2WTF A;  1BQN A;  1HBO A;  1RT3 A;  3BO2 A;  1MMN A;  4J9S A;  3V81 A;  1N5Q A;  2MZT A;  4Q8E A;  1HNW J;  1HPZ B;  3MEC B;  2CQC A;  2CZV C;  5U47 A;  3DLE A;  4CLY A;  5DLG A;  4LF8 F;  1V87 A;  2FPH X;  3ZYQ A;  3A8E A;  4DLG A;  2L80 A;  1GK8 A;  3AOB A;  4WZQ A;  4LLB A;  4JI5 J;  3LAL A;  2FLL A;  2VQE J;  2PC6 A;  4OI0 A;  5HVH A;  1NUE A;  1S4E A;  3Q8Y A;  3LP0 A;  2ZOM A;  3R8Y A;  4TU7 A;  2E66 A;  3CMQ A;  4F3Q A;  1HNZ F;  2MXY A;  2AGP A;  5HMZ A;  4O3N A;  5CCM A;  5DIN A;  5DDP C;  1NME B;  4EWT A;  2HBY B;  4QW8 A;  3PW2 A;  3OTE A;  2AIR B;  4BBQ A;  1RHU B;  2OPP A;  3D6M B;  1RZM A;  3R6L B;  1N48 A;  4YS2 A;  2MZS A;  1C4C A;  2RSD A;  1XR7 A;  1KVK A;  1EP4 B;  4YB6 A;  3MM5 A;  4MJK A;  5SZT A;  3KLE B;  2LQ9 A;  1IKX A;  1HWJ A;  2GMJ A;  5FII A;  4X4O A;  2RB7 A;  4DV5 F;  2C2R A;  2GJ2 A;  2RUG A;  4DV3 J;  4OFZ A;  5KFG A;  3QSI A;  1RHJ B;  4KSE B;  4RUH A;  4DUZ J;  2LU2 A;  1P1T A;  2W7A A;  1ACM B;  4FF2 A;  2WON B;  3HHL B;  5HO4 A;  1F5B A;  4MAK A;  2QTW A;  2VFT A;  4B9L A;  3NL0 A;  2O1P A;  4TY9 A;  2HKE A;  2XY7 A;  3M2V A;  4UTG A;  3NNA A;  3LDY A;  3HSJ A;  3I4H X;  5J1E A;  4DR5 J;  4DQQ A;  2IDA A;  1RA6 A;  2CPF A;  2NXJ A;  4LFC J;  2LQ6 A;  3T6R A;  3M7K A;  2PEH A;  2PMH A;  3NGK A;  1U1L A;  3H5X A;  4X4U A;  1OSD A;  4JI4 F;  3V6J A;  3M8S A;  1TKX B;  3QAU A;  2JEI A;  3V43 A;  2DNR A;  3R1L A;  3L1X A;  1XEZ A;  2VPX B;  5AJ3 J;  3D54 A;  3R3T A;  4KGX B;  4YAT A;  1S9E A;  3B6B A;  2K3I A;  2CPD A;  5LL6 d;  5GAD U;  4PXC A;  2Y0B B;  3THT A;  3UN3 A;  5KFU A;  1WEL A;  2YUC A;  1QLN A;  2YU4 A;  4DUZ F;  4DZD A;  5J2Q B;  4Y2C A;  5DRK A;  2JHE A;  3R27 A;  3WX4 A;  5BR8 F;  2AHO B;  1ZBT A;  1D1U A;  3BDE A;  3CIM A;  1AZS B;  2AEJ A;  5LMN F;  3GV4 A;  3BSC A;  3W2V A;  4D3H A;  2CA9 A;  1XK8 A;  2KB2 A;  3PFO A;  3RAM A;  3VQT A;  5IS2 A;  4W90 B;  2YWK A;  3KHL A;  3I5A A;  4NZ6 A;  3OSP A;  5SVY A;  3IGV A;  4C0B A;  1R8P A;  4DL0 C;  2LEC A;  4C2M A;  3LW5 C;  4J9M A;  1NB2 A;  2EG2 A;  1T3N A;  1VIS A;  1NSK L;  5K9F A;  1FJG J;  1S0V A;  4CO2 A;  1Z1Z A;  1WIL A;  2NXN A;  3X1L B;  2DR7 A;  4C8Y A;  2HHQ A;  1VD4 A;  2EKY A;  2YNI A;  4OGE A;  2A6M A;  3ISZ A;  3FSI A;  4Q2L A;  2W7P A;  5KFK A;  1WUU A;  2BJ3 A;  2GHV C;  3J81 Y;  3UCU P;  2FIU A;  3I6P A;  2BKO A;  4Y0F A;  3WIU A;  1RTI A;  4M94 A;  1TMM A;  1R0B G;  4JV5 F;  2HHT A;  1FNO A;  2HGL A;  2V4J B;  4HLB A;  4A8X A;  5KFH A;  4DL6 A;  4NLQ A;  4A8Q A;  2ZZN A;  3KLE A;  4KRW A;  3BBF A;  3DRX A;  1ZA2 B;  4JV0 A;  5IM0 A;  4K4Y A;  1FXL A;  5KG5 A;  1HNW F;  3W3S A;  2QJ3 A;  3LQI A;  2XZW A;  2NPF A;  1S72 S;  5K8M A;  4I56 A;  1NH8 A;  3OW2 R;  2BM0 A;  1LWE A;  4OLP A;  2G2Z A;  2MNY A;  5MLC V;  1PKU A;  2YWH A;  3IG1 B;  3QGG A;  1C0U B;  3MMB B;  4JI6 F;  3ZZP A;  4BHQ A;  2JOQ A;  3I9Z A;  3R7B B;  4KV8 B;  1QAY A;  3U1N A;  4WCE Q;  5AXL A;  4LF6 J;  2MEW A;  4KC5 A;  2R7T A;  2I1R A;  2GAH C;  2IVM A;  4UUW A;  2HNY B;  4KE5 A;  3W9J A;  3IFE A;  4DF4 A;  3B54 A;  1HLW A;  3CO0 P;  3ITH B;  4Q2M A;  4YR0 A;  1VQ4 S;  5KFC A;  2R2R A;  4ED7 A;  2NR0 A;  1J5E J;  4W4U A;  2CQB A;  3EDR B;  3BGR B;  3MMC B;  5F0W A;  4R5P B;  1VC6 A;  4NLG A;  5IT9 U;  1F60 B;  2HFZ A;  1IKW A;  1S99 A;  5SVI B;  3C5K A;  1KDN A;  3CJ0 A;  3G2X A;  4XTT A;  3UCG A;  1KLN A;  3UVJ B;  3SOX A;  3T9N A;  1TVR A;  3MTK A;  2JEG A;  2G0J A;  2JNJ A;  3M1V B;  3PVX A;  1FRX A;  5B09 A;  1EKR A;  4OHX A;  3HI9 A;  4G1P A;  3CNQ P;  4UF4 A;  1CHC A;  4X66 J;  2KRE A;  4JI1 F;  3R2C J;  2GJF A;  4ZHR A;  3BBB A;  4V19 J;  4K4X A;  3DRP A;  2E7V A;  2OFH X;  1ZS6 A;  2ZDP A;  4WTO B;  1FKA F;  2JEJ A;  1CUL B;  2B7B B;  2DIV A;  3KQI A;  2X7I A;  2IAJ B;  3MEK A;  4LIR A;  3OR1 B;  4DPX A;  2YT5 A;  2C2V S;  4EFA C;  2MGZ A;  3LOU A;  1W26 A;  2ZH2 A;  4ZJO A;  1D0E A;  1HNZ J;  4NXM F;  1CQM A;  1UP1 A;  4BC7 A;  3JSM B;  2DIT A;  5KFW A;  4LSL A;  3FAN A;  2EPI A;  4LIW A;  1BXN A;  2G6Q A;  4DWI A;  3JTP A;  2Z0G A;  2XS7 A;  3CCV S;  4ECT A;  3UO0 A;  1NDP A;  3JAM Y;  4DS5 A;  3D68 A;  3BSN A;  3IP0 A;  3J80 Y;  4I67 A;  4WTY A;  4CIO A;  2DGU A;  4URG A;  2L0B A;  2OXQ C;  1OQ3 A;  1T9Y A;  4NA2 A;  4ZOS A;  4ZVU B;  5AXN A;  1JM7 A;  1LFW A;  1EAR A;  1KP6 A;  5HRO A;  2YQ0 A;  2RRA A;  1WHV A;  2WSE C;  2IY5 B;  4S0M A;  2ZDO A;  1F5C A;  4ZLL A;  2ERR A;  1KBR A;  3OPK A;  3C16 A;  2KTQ A;  4M63 A;  4TN2 A;  3R5J B;  1U24 A;  2E5I A;  2KGG A;  4J90 A;  4AL6 A;  5C24 A;  1NBE B;  2EBG A;  1DTQ B;  2O3D A;  4NLX A;  2R2U A;  1SKS A;  2ASJ A;  3BEG B;  3M2R B;  2Y8Y A;  2P9C A;  1H2T Z;  3ZTG A;  1B0T A;  2CQI A;  2JC1 A;  4QF3 A;  4LJM A;  4ZIV A;  3VAI A;  3DXB A;  4CM0 A;  2E9T A;  4QWE A;  3J81 U;  2UXC F;  5DZ7 A;  1IKW B;  1NSP A;  4M5J A;  3THP A;  2HVE A;  2IYG A;  4Q45 A;  4AP4 A;  2DR9 A;  4USU A;  1WOP A;  2JM3 A;  3A8J A;  2E5L F;  3CJK A;  1VQK S;  3MEE B;  1C1B B;  2C3M A;  4YB1 P;  2DNK A;  3OFH A;  3SDE A;  1KON A;  5DQG A;  5LM7 E;  4FF4 A;  4WA6 A;  1YZ6 A;  4J9U E;  4OZN A;  4CT8 A;  1RAJ A;  1VBK A;  4WZ2 A;  1Z2L A;  2IFX A;  4NML A;  1FTR A;  4ANC A;  1HR0 J;  3N28 A;  3OR2 A;  1FRI A;  1HW8 A;  3PLW A;  1IKV A;  4KH0 B;  2LGL A;  2Q79 A;  2LEB A;  2HND B;  3CT9 A;  4PYD A;  1I3O B;  2QL7 B;  4RR5 A;  2MLZ A;  2W1B A;  3DGP B;  2FYX A;  4B02 A;  2XMA A;  4B9U A;  3UW1 A;  4QQB A;  1LFP A;  5KT7 A;  3HZE A;  2QL5 B;  1F9F A;  3ZTQ A;  4JI8 F;  2MLX A;  2BAN A;  2ZKT A;  3BJY A;  4DV2 J;  4L75 A;  4DQP A;  1NCL A;  3QT5 A;  3EX7 B;  2HZC A;  2GHP A;  1S1X B;  2VPB A;  5LCW B;  3BB5 A;  3E01 B;  1X0P A;  2F7V A;  3JQM A;  4OYM A;  3T7L A;  1KN6 A;  3AH6 A;  3TQE A;  5KFM A;  3KV5 A;  2AJ0 A;  1WFK A;  2YPY A;  4DSI A;  1OMS A;  2VG5 B;  2MQM A;  4RJV A;  2ASD A;  4OZ1 A;  4B3S J;  1EX8 A;  5K8O A;  3C6W A;  4YC9 A;  4N5S A;  4UZB A;  1M5O C;  1X4G A;  1S1V B;  3AB2 B;  4NOH A;  2I5J A;  2FLO A;  5AIU A;  4I2P A;  4Y28 C;  2I2Y A;  2KDO A;  1NU4 A;  3RGI A;  3VR1 A;  4GKK J;  4ED3 A;  1RHK B;  3GLJ A;  1I1G A;  2RRB A;  4AXI A;  1XR5 A;  2D8U A;  2ZC3 A;  4H54 A;  3ZTP A;  4DFJ A;  4FO9 A;  1WEZ A;  3MI7 X;  3TR5 A;  4AQY F;  3P5B P;  2YWW A;  1HFE L;  2XY6 A;  2NCK L;  2A2C A;  1B64 A;  1ZM2 A;  3AY0 A;  2BUN A;  4WKR A;  4J9O A;  3PV8 A;  3FZB A;  4J7C A;  2M85 A;  2LQJ A;  3AOD A;  1SQG A;  2LN0 A;  3TX0 A;  2ZE2 B;  2OPP B;  3V2U C;  2UUA J;  1UW9 A;  2DNO A;  2JLE A;  4NYZ A;  5KT6 A;  4C9Z A;  4L6V 3;  2QA2 A;  1H2U X;  1SCJ B;  1WEP A;  1KTQ A;  2MZR A;  2YUR A;  2XMU A;  3MM6 B;  3MOZ A;  1FKO A;  3CO9 A;  2LDY A;  3PNI A;  3WX8 A;  4EGL A;  2XQC A;  3HSD A;  1DTT B;  4C6A A;  5F8L A;  2B3T B;  1N54 B;  4EYI B;  3QMQ A;  4OYA A;  4F25 A;  4ZP7 A;  2RR4 A;  1SH0 A;  2HHP A;  3D7S B;  3EXY A;  4UQT A;  3UN5 A;  4ZIW A;  1E6V B;  3KMQ A;  1RHM B;  4OV6 A;  3PW4 A;  2KZM A;  4NN2 A;  4P6Q A;  4YAD A;  3ZVZ B;  3KLG B;  1NKC A;  3HK2 A;  2J0S D;  3O35 A;  3FJ2 A;  3KLI A;  4C4W A;  3T1A A;  3G71 S;  1QDU B;  1KR4 A;  5F9N A;  2RQK A;  3KJN B;  5KT4 A;  1T8E A;  3PY8 A;  2HYE D;  3RRG A;  4NAS A;  2GVZ B;  4WE1 A;  2CJB A;  2EFP A;  1XMQ F;  4QWB A;  4NWB A;  2HDP A;  2UV8 A;  4MIA A;  2HFU A;  3B4D A;  2CRL A;  3K2Y A;  3POT A;  3AA9 A;  4Y65 A;  4DOZ A;  2YQ1 A;  5HSP A;  3H98 A;  3PHD A;  4F4W A;  5A8K A;  1TV6 A;  2B43 A;  4F36 A;  1FXD A;  3CE8 A;  1LW2 A;  4DSE A;  4AD6 A;  1NPR A;  2GML A;  3FNN A;  1ARO P;  2LA4 A;  4USH A;  3KLF A;  3W8G A;  4A8W A;  2DPJ A;  2VV5 A;  4B9T A;  2MKJ A;  3GYX B;  3QRP A;  4I68 A;  4RW9 A;  2I6W A;  1B7F A;  1SIZ A;  3PJX A;  3OJS A;  2HHV A;  2G13 A;  4P73 A;  1WEV A;  2NXU A;  2OEL A;  2UVV A;  5LXR A;  1HNX F;  1SJF A;  3IRX B;  1X4D A;  2Y1N A;  1G6B A;  4ITS A;  3SXL A;  2G2O A;  4ZVQ B;  1RQ0 A;  2NPI A;  2DNN A;  2YNI B;  4LF9 F;  3KUH A;  4QBU A;  3N9Q A;  4WZ0 A;  2C3P A;  2JDJ A;  3TWZ A;  3RBE A;  2CDQ A;  5FB0 A;  1ELO A;  1Y0H A;  2DNL A;  2JZ5 A;  3R7N B;  1GXL A;  1S4F A;  2IM1 A;  4RU9 A;  4X84 A;  3NS7 B;  4Q44 A;  1XNQ J;  3P6Y C;  1KTV A;  2AV5 A;  2R42 A;  3GIL A;  5C42 B;  3EPI A;  4G1Q A;  1WHW A;  1BHN A;  2HK3 A;  2V8D A;  1RTJ B;  2CNO B;  4MFB A;  1U0S A;  3GQC A;  3C6T A;  5KFB A;  2KO1 A;  3IXQ A;  3SCI E;  3DU6 A;  3C14 A;  3RJM B;  1S6P A;  1IBM F;  1AZS A;  1B70 B;  4L76 A;  1PAE X;  3DC2 A;  1WEU A;  2JH3 A;  3GG0 A;  1WC3 A;  1RIS A;  2Q6B A;  3KUE A;  2DNZ A;  1NJZ A;  2CG8 A;  3QJP A;  1XMQ J;  3KLH A;  3GIM A;  3LP0 B;  2CQD A;  3M2U A;  3R5D A;  1FRJ A;  2HAF A;  3CB4 A;  4WJB A;  3L7O A;  5DM6 Q;  3VZH A;  2M6M A;  2DT9 A;  4RO0 A;  3WZ0 A;  2IPO B;  4ECZ A;  1L3U A;  2DCL A;  5C25 A;  4FNH A;  1LWF A;  4U7U K;  2CXE A;  1CJU B;  3W62 A;  3JYT A;  4IQX A;  3K17 A;  4FF1 A;  4URS A;  2OMO A;  4X62 J;  1HI0 P;  3FFI B;  4ECX A;  5G04 B;  2EKN A;  3RB3 A;  2OJ3 A;  2G0C A;  1S1U A;  2Z57 B;  1PYT A;  5B0G A;  1Q0N A;  3DDN A;  4H4O B;  5L1J A;  5AXK A;  4DSF A;  2C2O B;  3W9I A;  5DKA A;  1TEL A;  2BMB A;  2QG9 B;  4Z0R A;  3KHG A;  5KG6 A;  3A8K A;  3HSZ A;  3IR7 B;  4CLL A;  5K8P A;  4ZPA A;  5D6G A;  1GNK A;  2GV1 A;  3GJR B;  1TUG B;  2NS1 B;  1UPM B;  5D0E A;  2X1A A;  2HFN A;  1OY9 A;  4JI0 F;  1EIY B;  2ECT A;  1C4A A;  2AMC B;  1S1V A;  2DXF A;  2Z2L A;  4WK1 A;  1SQF A;  2ABY A;  2D3Z A;  2NUH A;  2ZUA A;  3DNC A;  3GON A;  3T6B A;  3ZC4 A;  3ONQ A;  2L43 A;  5E3R A;  3W60 A;  4LQ9 A;  5A8W B;  3UD4 P;  1D09 B;  2OTJ S;  2GVD A;  2KXH A;  1SKR A;  3A1Y G;  3QAT A;  2MQP A;  2QLB B;  1KNZ A;  1FVQ A;  2P9E A;  2LRI C;  1RU1 A;  3ASL A;  2B9X A;  3I82 A;  3ISN C;  5E2Q A;  4ANE A;  2XOY A;  2HHS A;  2PA8 D;  2WK4 A;  1FFG B;  2LP4 A;  2XMW A;  2Y0S D;  4ZVO B;  1KOH A;  3GYG A;  3KOA A;  4P10 A;  3ENV A;  3LWM A;  3VTI A;  4F1P A;  1JXV A;  3H0P A;  5H9E J;  2IRY A;  2YYR A;  1C0T A;  1IN0 A;  1DVP A;  1FKO B;  2KJW A;  2YKQ A;  2VPY B;  4TYA A;  4ICL A;  2R2S A;  2MDA A;  2VBX A;  2FHO B;  4CLW A;  2EXU A;  4A4B A;  2B8P A;  2RE1 A;  4MFB B;  3RU0 A;  3ZXW A;  4RNF A;  2XGQ A;  2DNY A;  2OPQ A;  3L9Z A;  2D41 A;  4G3I A;  3D67 A;  1T03 B;  4ZP8 A;  2FQQ B;  2BR0 A;  2W9B A;  2R8G A;  1EJ7 L;  2EFO A;  4MKA A;  5I3P A;  2BJ7 A;  3EVW A;  4KHP F;  3C15 A;  2FVQ A;  3PUR A;  4JI7 J;  2P6T A;  2ZZM A;  2U1A A;  4TY8 B;  1VRT A;  1FCA A;  1OPI A;  2XMJ A;  3KLI B;  3DN9 A;  3NGD A;  3PW0 A;  2EEY A;  2VJV A;  4DR6 F;  4M5D A;  2PFD A;  3CCQ S;  4ZVP B;  2XMV A;  3FEZ A;  4ECV A;  3MHY A;  3R5A A;  4X65 F;  4YBT A;  2CPZ A;  5H1T A;  3HHL C;  1XMB A;  1JLF A;  3FDS A;  1A6L A;  1Y00 A;  3I9V 9;  4RPF A;  1FK9 B;  3FCW A;  2B4V A;  3QNW B;  3LUY A;  4CLP A;  3CJ4 A;  2KU7 A;  4DXL A;  5I42 A;  2VOD A;  1AFJ A;  4OZL A;  1IM4 A;  5HI7 A;  2LYV A;  1SV5 B;  3MF5 A;  3PIO Q;  4DLE A;  3EMT A;  2QYG A;  2HSE B;  1WOO A;  2YWE A;  2VH7 A;  2VAS A;  2MT5 A;  3ELH A;  3RTR B;  2G4B A;  4PWD A;  3EJM A;  3P8B B;  2MKE A;  3HCX A;  3V6D B;  3DLG A;  1OYD A;  2F4V F;  2YRE A;  2OFG X;  5KH7 A;  1WEQ A;  5A2Q Y;  2LMI A;  2XBP A;  4K0K F;  1FHT A;  1RWU A;  3Q2T C;  3F56 A;  1L3K A;  1XWH A;  2B4P A;  2KU3 A;  3FC9 A;  2OPR A;  1HW9 A;  2Y1I A;  4L73 A;  4LF7 J;  2GA7 A;  1NPK A;  3BPS P;  3OTO F;  3R2D J;  3ZTR A;  3MWB A;  4YP3 A;  4X2B A;  3EZO A;  2HHU A;  4ZJQ A;  2QV6 A;  3N9P A;  1X9S A;  1T0T V;  2L7P A;  1F3F A;  5AIT A;  4R5P A;  1HHT P;  4U8Y A;  3OVB A;  5HP1 A;  4ZCI A;  3Q24 A;  1OS5 A;  2IBO A;  1H98 A;  4QWD A;  1N0V C;  3K7R A;  1MRO B;  3EXC X;  5B0E A;  4JI5 F;  4HHH A;  1RKJ A;  2K17 A;  3AJD A;  3OVA A;  4YME A;  2H54 B;  3LF0 A;  2WBR A;  4USV A;  3T1H J;  3LGM A;  1WEW A;  4V3L C;  1VK3 A;  2DHA A;  2YX4 A;  2ATL A;  1FES A;  7FD1 A;  3CDU A;  1ZET A;  2HMI A;  1WC6 A;  3ILL A;  2EBE A;  3OXL A;  2CQ2 A;  3KLH B;  4BCA A;  4ED2 A;  1RTD B;  5DGA A;  2HYI B;  2FD4 A;  4C9D A;  1V3S A;  2EA6 A;  1VCT A;  4UOG A;  3O33 A;  2HZA A;  3DGP A;  2J6S A;  1N4L A;  4F02 A;  3JQJ A;  2CQ0 A;  4IG3 A;  4ETZ A;  2V2Q A;  2CPY A;  3G82 A;  3FEX B;  3NLC A;  4GRS A;  2MKC A;  4I1T A;  2KXN B;  1T9X A;  2DTJ A;  2R7R A;  3SZ2 A;  5D77 A;  2L3M A;  1XNR J;  3FBC A;  2YWG A;  2MA5 A;  3EB6 A;  2D74 B;  3LA0 A;  4A8K A;  4PQU A;  3UPF A;  5D78 A;  1IXK A;  2IA0 A;  4HYK A;  3MM5 B;  2L9W A;  2ZIT A;  2VFR A;  3U27 A;  5IC4 B;  2HG4 A;  4DCP B;  3JB9 k;  2MB0 B;  2FSA A;  4NLR A;  1RSC A;  3QID A;  2GW8 A;  4BDP A;  1BQM B;  4RW7 B;  5G0R A;  3H2L A;  3H5U A;  3ENQ A;  4H9D A;  3MEG B;  2PT0 A;  1AW0 A;  4KAI A;  5JJB A;  3AXK A;  2YKM B;  4RLE A;  1O5J A;  2R7V A;  2MA6 A;  1MN7 A;  1DTQ A;  1RBA A;  3ZZR A;  1R0A B;  2AW0 A;  1YRT A;  1H3D A;  4E8U A;  3GL6 A;  1X60 A;  4RKU C;  4ZA1 A;  2Y8W A;  2AEF A;  2RKI A;  1V5I B;  3D5M A;  4IRC A;  4RNO A;  3A12 A;  1CJV B;  1KVJ A;  1HNI A;  4DFM A;  1G3O A;  2V8P A;  3IA0 A;  2R7Q A;  4AVX A;  2HVZ A;  1IKY B;  5DDO C;  2OH2 A;  1VQP S;  2MTL A;  3B4M A;  2B56 A;  1BQN B;  1HBO B;  3IR6 B;  3QGP A;  2VJF B;  1JLE B;  3N79 A;  3Q8S B;  4DV0 F;  2MIQ A;  4O3S A;  2W7O A;  3TA0 A;  3TVY A;  4GO5 X;  5ETS A;  3DI6 A;  2XYH B;  4Q5V A;  3CVK A;  3LQV A;  4DSJ A;  4R25 A;  3SSR A;  4ZP6 A;  4C8L A;  2J9C A;  2YKN A;  4LJN A;  4A47 A;  1RE1 B;  3W2V B;  4NZ0 A;  1HD0 A;  2LV9 A;  4Y6I A;  3SCL E;  4I64 A;  5E3P A;  3NGS A;  3KK2 B;  4OI6 A;  1IYM A;  2Z2Y B;  1WI8 A;  1S12 A;  2JRS A;  1VHF A;  5B0A A;  3WHI A;  1JNZ B;  4PXD A;  4O3P A;  3FGV A;  2X51 A;  1SL0 A;  1SC4 B;  4OYB A;  3H42 A;  4DUT A;  2R7W A;  1RGV A;  2HWT A;  2QFI A;  4OZ5 A;  3PEH A;  4X4P A;  1KSP A;  2GIQ A;  1OO0 B;  1T1H A;  3GFX A;  4WP3 A;  3PX0 A;  4S3O B;  3OTO J;  4C8M A;  4JI3 J;  1S10 A;  2HBQ B;  4PG5 A;  2KGI A;  1M5S A;  2WW4 A;  2B9Y A;  2JLF A;  2W25 A;  4HHU A;  4FN5 A;  1RWP B;  1WOR A;  2Z56 B;  4YAB A;  4TU9 A;  4U9R A;  3LAN A;  1HWK A;  1LEO A;  1TV6 B;  3FEY B;  4O4G B;  3GFZ A;  4OZ0 A;  3SFG A;  1HI1 A;  2R8J A;  4GKJ J;  1TAU A;  1S57 A;  1SJR A;  4ID5 A;  2ECJ A;  2B4O A;  2F4F A;  1WJ9 A;  2BE9 B;  2I5J B;  4W98 A;  1L3T A;  4EZ9 A;  3IWN C;  2UXD J;  2IQJ A;  1FA0 A;  2A3J A;  3RW7 A;  3IN5 A;  2XNR A;  3CJT A;  4GMK A;  3MR5 A;  4DV4 F;  2V0N A;  1FBV A;  2HAI A;  3R1H A;  4L3N A;  2UVW A;  4AUK A;  4LSN A;  3N9U C;  5H9M A;  3BGF A;  1A9N B;  3N9O A;  4HL9 A;  2K7J A;  3IRX A;  1RTZ A;  2BVZ A;  1CJU A;  1VQ5 S;  3I31 A;  3HUL A;  3CTR A;  4CYU B;  4CCG X;  2V4R A;  3HCS A;  5DQH A;  3BQ2 A;  2BDP A;  1NK9 A;  2VD3 A;  2IVF B;  1U09 A;  4L72 B;  3TO8 A;  4Z37 A;  5D8H B;  3QPI A;  5CZV A;  1YDL A;  3MFI A;  5L8R C;  3DHW C;  4ECU A;  3TI0 A;  1N88 A;  4GC7 A;  2HS0 A;  4HAC A;  4LAD B;  1DTT A;  3FBB A;  3M1V A;  4AE5 A;  1TFW A;  1N33 J;  2ZFH A;  3E3X A;  2YHN A;  1VDH A;  1EET A;  2X1G A;  1YJU A;  1WF0 A;  3QWU A;  4IKA A;  1F2H A;  1VQ8 S;  1FRL A;  3PHE A;  3CC4 S;  4K4S A;  2AT1 B;  5L46 A;  3SV3 A;  2FJW A;  5TRB A;  2CIM A;  5K14 B;  2AGQ A;  2DGV A;  5A8W A;  1YBT A;  2JRJ A;  2JWN A;  3N5F A;  1WC0 A;  2WVF A;  4TKP B;  5C7P A;  4LQ3 A;  5D4L A;  4QYZ J;  4P72 A;  2JEF A;  3KHH A;  5F8J A;  3G82 B;  4UW2 A;  3M9N B;  4IO1 A;  4YR2 A;  1T7P A;  4J5O A;  2VBY A;  2H0D B;  2DO4 A;  4XK8 C;  5B0D A;  2ZJQ Q;  3FBE A;  2XS2 A;  4F50 A;  3V6H A;  4TU8 A;  1K47 A;  2KT3 A;  3BH6 B;  4QR2 A;  3NOC A;  3LAM A;  4KBI A;  4PXB A;  1XQI A;  5HN0 A;  4AT1 B;  4YFU A;  3J7Y U;  3PRD A;  1RTH B;  2AJF E;  2IRX A;  3QLH A;  2E1M C;  5HVF A;  8AT1 B;  3MM8 B;  4WYL A;  5DDR C;  1NK0 A;  1J5E F;  2LKZ A;  1E6Y A;  1FWL A;  2LEA A;  4HTI A;  4NZ7 A;  3Q8R B;  3P49 B;  3O70 A;  4J9L A;  4J9Q A;  1DCQ A;  2NZC A;  4KGK A;  4MTP A;  2E7X A;  3GJS B;  3SV4 A;  2VKR A;  3OR1 A;  3ILO A;  1XER A;  5ITH A;  2MGZ B;  4IH5 A;  1Q1K A;  4CWB A;  2XTJ P;  3BO4 A;  5H9F J;  3I4P A;  3OR2 B;  1Y7P A;  3T41 A;  2E6S A;  2OIH A;  2ZH7 A;  2GVD B;  2CRW A;  1H7W A;  1WTF A;  1XJW B;  3HFZ B;  4O4R A;  3GE9 A;  2QJ0 A;  3M30 B;  5GAE U;  2XLI A;  2J0Q D;  1J5O A;  4ZVE A;  2FJB B;  4OV1 A;  3UD3 P;  3OFF A;  2W8K A;  3T1H F;  1S7H A;  1N5V A;  2XO6 A;  3UWT A;  1ZYQ A;  2HNZ A;  2VQF F;  2BQ3 A;  1VIO A;  1NB7 A;  5C42 A;  1IR0 A;  2ASY A;  4EUV A;  4YB7 A;  2WSF C;  4I7B A;  4I2Q B;  1YJW S;  3FSX A;  4WK3 A;  1YSJ A;  2YX7 A;  3NG2 A;  2XS5 A;  1SIW B;  5J2N B;  4PPZ A;  5M2U A;  3QT8 A;  2C3O A;  2FGC A;  2QA1 A;  1M5K C;  3KDE C;  3Q22 A;  3H8Y A;  4HEA 9;  1YG0 A;  3DLG B;  1W25 A;  1FDN A;  1KLM A;  4ZQL A;  1T9U A;  2VDI A;  4EO8 A;  3TQ1 A;  2IAJ A;  5BJR A;  3KK1 B;  2RIL A;  4LFB J;  4PAB A;  1UAW A;  2DGQ A;  1RAF B;  2DY1 A;  3CGI A;  4U6P A;  3T5J A;  1DLO B;  1DUR A;  4USK A;  5D15 A;  5DG8 A;  1IKV B;  1SKW A;  1KFS A;  3I0S B;  1WEO A;  4U95 A;  4NLT A;  3MMJ A;  3MCS A;  1NO8 A;  4WFX A;  1Q4R A;  2MZQ A;  3AT1 B;  4PEO A;  5LXY A;  5T14 A;  4ZLN A;  4A8S A;  3I5C A;  3T5K A;  2ECG A;  4ID8 A;  4Y00 A;  1TK8 A;  3SMZ A;  4A8F A;  1CQN A;  2ROG A;  3DRS B;  4IFY A;  2W2M P;  2OHD A;  3W8P A;  2UXC J;  2YQM A;  5TAB A;  4F7V A;  1TKT B;  4JOU A;  4XDC A;  2RU9 A;  3G8T A;  1TTH B;  2YVR A;  2QIF A;  3H2V E;  5KG4 A;  2Y3Y A;  1WC4 A;  4X4S A;  4ELU A;  3ULH A;  1HNV B;  4AXJ A;  2BJD A;  2L5U A;  1IKX B;  4ZVF A;  5IT9 Y;  2BJ8 A;  2MKI A;  5D3G B;  3WQP A;  4CO5 A;  2XEU A;  5EYA F;  1GFW B;  5D4P A;  4ZN1 A;  2XWY A;  1RYS A;  2HVI A;  3ZTS A;  1JLG A;  2GGP A;  3CW2 C;  3SQO P;  3QJL A;  2HMI B;  5D0G A;  1QSY A;  1IBM J;  4QF2 A;  3DDK A;  2QA4 S;  4FK5 A;  1UVK A;  4XAK A;  1VHI A;  5B8D A;  3CD5 A;  4OI1 A;  2DO0 A;  4DR5 F;  5TBN A;  2UXD F;  4JI7 F;  5CYM B;  1VGY A;  4WFB Q;  4OYZ A;  2BM1 A;  3RBZ A;  2CSY A;  3HT3 A;  4YEA A;  2KHC A;  4NYP A;  4EZ6 A;  3HKZ D;  3X3U A;  4LF4 F;  3DLK B;  3EDQ B;  3OV7 A;  1YJT A;  1U4B A;  4O3R A;  1V6H A;  5KFJ A;  3H4B A;  3RPG B;  1BE4 A;  1FWK A;  2H4W B;  3VVT A;  2VC1 A;  3BRE A;  4OMF G;  5IC6 B;  5ADZ A;  4D3G A;  3C3L A;  3HCU A;  4PWU A;  3POT B;  4JI3 F;  2L9D A;  1N87 A;  2CON A;  4R7E A;  4UI9 B;  2B5J B;  2J76 E;  2V2V A;  1PJ5 A;  2XWX A;  3HFV A;  3MEC A;  2JVR A;  2RJZ A;  3UN2 A;  3LJU X;  4ZDT A;  3BGO P;  3TA1 A;  4HKQ A;  2HUR A;  4NA1 A;  5I4M A;  1K1Q A;  3G6E S;  3UD5 A;  1BQX A;  3DU5 A;  3GP9 A;  3GU0 A;  2EC0 A;  1AFI A;  4F52 B;  2XSJ B;  1KOO A;  3M2V B;  2ZH9 A;  2LFV A;  4N47 A;  1OQ6 A;  3RTV A;  2QZ8 A;  3FQL A;  3PW5 A;  4F2S A;  1RT7 B;  4DCO B;  5KG1 A;  2YX1 A;  4CDI A;  3T1Y J;  5SVX A;  2IC3 B;  4MH8 A;  2AJ2 A;  2QMW A;  2RSQ A;  3MM9 A;  5BYR A;  4C0O C;  2V4Q A;  2ZH4 A;  4MYU A;  5GMK a;  3DPL R;  4B7Y C;  1TQL A;  3T9K A;  3MCO A;  2P6S A;  3N6M A;  5E5N A;  4KKO A;  5C2C A;  3Q1D A;  1WSR A;  2N82 B;  2XO7 A;  3E51 A;  4FVM A;  2GNK A;  3RB0 A;  3ETM A;  1M1K T;  4NMX A;  3F0N A;  3NWR A;  3VGV A;  3H5S A;  3BO3 A;  1X4C A;  4YOE A;  2RNE A;  2ZOG A;  4P2X A;  3UVJ A;  2BW7 A;  3WC0 A;  2V2Z A;  2Z8Q A;  4M5N A;  4PG4 A;  2FUI A;  5CHC B;  2YHO A;  5E3A A;  3MPY A;  3L11 A;  5IM0 B;  2XMM A;  3MAQ A;  2Q66 A;  1R8B A;  4CTA A;  2ALZ A;  2BQR A;  2YKA A;  5DO2 A;  4DEZ A;  3PR5 B;  4JI6 J;  1VI7 A;  5D0R A;  3Q8V A;  1QVG R;  2HHX A;  2MKY A;  2G45 A;  1OY8 A;  4CA1 A;  1UL3 A;  3Q2S C;  1PYS B;  2DH9 A;  3MTJ A;  4HT7 A;  3NGT A;  1F1B B;  1LQ9 A;  1UEU A;  4Z0O A;  2KKX A;  2M8H A;  2VG6 B;  4OJ3 A;  4F0K A;  3I56 S;  2QX0 A;  1B4S A;  4M5G A;  4ES2 A;  1AXQ A;  3IO1 A;  1UA0 A;  4DR4 F;  1DQA A;  5AE3 A;  5KOW A;  4DSK A;  4B3T J;  4WZ3 B;  2LA6 A;  2BKN A;  2EGP A;  3MPV A;  3TRG A;  1KD1 T;  1SI9 A;  2KT5 A;  1WKK A;  3D66 A;  2MYF A;  1LK5 A;  1HWI A;  2H1Y A;  2O66 A;  2K06 A;  3OFG A;  3SOU A;  2FZC B;  3S7R A;  1T94 A;  1UW4 A;  4ALZ A;  3M9O B;  1DAX A;  2FLP A;  4GB0 A;  4LKA A;  5K5M A;  3D4J A;  5K8N A;  3M4X A;  1KS2 A;  2CPI A;  5B77 A;  4TNO A;  1REV A;  3DGV A;  4U67 Q;  1NSA A;  3TZW A;  2MQ8 A;  1TL1 B;  5HMW A;  1RHQ B;  2F8E X;  3UE2 A;  3JSR A;  3KLF B;  1W2B R;  4W4M A;  2QGF B;  3DOK B;  2CJA A;  2CQ4 A;  2ZD1 A;  1WHX A;  3N0V A;  3Q89 A;  4ZMM A;  3CCR S;  2JMJ A;  3SHB A;  4JYA J;  4MYT A;  3NEK A;  4O44 B;  4EU0 A;  5RUB A;  2WOM B;  4DPU A;  2CJQ A;  2CKL B;  2PMZ D;  4X65 J;  5A76 A;  1T95 A;  1K73 T;  2GVZ A;  4USI A;  1NLK L;  1X5S A;  3R9L A;  1F5A A;  4PG8 A;  5H1S V;  1NK8 A;  2M3D A;  5HMY A;  2WB1 D;  2BZ2 A;  4QQ4 A;  5KFV A;  3NNH A;  1PIL A;  1S1U B;  4OHZ A;  1B99 A;  1VC0 A;  4RW4 A;  1HBM A;  2DEJ A;  1RT2 B;  2FVC A;  2HHH F;  2VHG A;  4P2S A;  3TEH B;  1U1K A;  5LKT A;  1VQM S;  1NK7 A;  1Y5I B;  2RRN A;  3M8P A;  3HFK A;  4IYQ A;  2ZZT A;  3NCQ A;  4NYO A;  2XY5 A;  1K9M T;  1U45 A;  1HR0 F;  2M9K A;  1TKZ A;  2DEI A;  1KVI A;  4CP5 A;  4N76 A;  1U2F A;  5FJ4 A;  4F8R A;  1XMO J;  2KIZ A;  1WC1 A;  2C2D A;  1WC5 A;  3EVO A;  3H7H B;  4Q6F A;  2NXE A;  2V8H A;  3BS9 A;  4JB8 B;  1LWC B;  5IWA J;  2K2P A;  2QC3 A;  3PTW A;  4OYW A;  3FMB A;  4DMZ A;  3BGR A;  4X4R A;  3CED A;  3OL7 A;  3MAH A;  4FS2 A;  2K7K A;  4I6W A;  4FYD A;  4LF4 J;  4HVZ A;  3BPD A;  3IBF B;  2F5G A;  1GTE A;  4JI2 F;  4B3M F;  4DR7 F;  3LVR E;  4BBY A;  4LFB F;  3W2W B;  4OX9 F;  1N6Q A;  4OIX A;  3I2D A;  5GMD A;  4CZC A;  3DI6 B;  2FC9 A;  4RW6 A;  1U8W A;  2E5J A;  4NCG A;  2R9L A;  1B3T A;  4DPT A;  1U26 A;  1Q8I A;  2MQQ A;  3R6G B;  3FSY A;  4JI0 J;  5AXM A;  1ROF A;  3N9M A;  2G1H A;  3NWG A;  5KFT A;  2BRL A;  1SC6 A;  2NSC A;  4F4Y A;  3O8W A;  3OLA A;  2DCU B;  1LWF B;  3NGU A;  4EK2 A;  3EB5 A;  2OEM A;  3HZG A;  3UNY A;  3CCU S;  1N5Y B;  2MHE A;  2RDI A;  4B3S F;  1S48 A;  4B3O B;  1S9F A;  5JG6 A;  1X4J A;  4ZPV R;  4L7X A;  1RAG B;  1BUX A;  2EFV A;  2J7W A;  2EK1 A;  3CDB A;  1H6K X;  3IBC B;  4JP8 A;  3S1T A;  1QTN B;  4ED4 A;  4Y2K A;  2V8V A;  2YVS A;  1FXR A;  1RT2 A;  3OXF A;  1FO1 A;  3D3C J;  3RRK A;  3CJ3 A;  3TJA A;  5KOX A;  5KT3 A;  2M1R A;  5T7L B;  2M4M A;  4AL5 A;  1D8Y A;  1N8R T;  1H38 A;  2CNK B;  3MR6 A;  4ZIT A;  1S49 A;  3BBC A;  1FT8 A;  2X1B A;  3CIZ A;  2X3G A;  5A2Q U;  5FDL B;  2A18 A;  4IFV B;  3RYL A;  2ZBC A;  3IWX A;  3U1L A;  3J7A N;  2VPZ B;  1RTD A;  2ZBI A;  1DLO A;  1IBC B;  2ECN A;  1CVJ A;  1VQ6 S;  2QFJ A;  4WU2 A;  3H7H A;  2UVR A;  1VOM A;  3FEH A;  3ET6 B;  4LT6 A;  2FVP A;  1UVI A;  4X4Q A;  3OTC A;  3HP6 A;  2C2L A;  5I3Q A;  4LRD A;  3B82 A;  3EGZ A;  3MED A;  2VPG A;  2EOD A;  5DS7 A;  3D2W A;  1YZ7 A;  1N34 F;  3ETO A;  2OAU A;  1OJ4 A;  2QA4 G;  9RUB A;  2VIH A;  1MRO A;  3K5O A;  1TL4 A;  1X5T A;  3CME S;  4I2Q A;  2IIH A;  2C42 A;  2ZEJ A;  2DRA A;  2EFN A;  3CD0 A;  5EUH A;  2D1C A;  3VAJ A;  3SCK E;  1T02 A;  2HGN A;  1Q7Y T;  3HHE A;  4KY3 A;  3T5L A;  4RW8 A;  2J0W A;  1U0H B;  3N6L A;  1VS3 A;  1K2F A;  1JNR B;  3KUG A;  2ZNZ A;  3GCW P;  4NPO A;  4IOB A;  1X0F A;  1JIH A;  2VDH A;  3C15 B;  4FZV A;  2XOC A;  1AA1 B;  1T05 B;  3EE3 A;  2XOZ A;  5DZ6 A;  3GJQ B;  4BLG A;  3GJT B;  3VAH A;  5I3U B;  1MM2 A;  3IM8 A;  4B9S A;  1Y5L B;  1U6Z A;  1TL7 A;  4IG3 B;  1Q78 A;  2UUB F;  2CQH A;  2B4U A;  3EGW B;  2LGK A;  4DF8 A;  2AWZ A;  3UR3 C;  2HW3 A;  1IVZ A;  2ZBQ A;  2KT2 A;  4F3M A;  1SV5 A;  4ZS6 A;  4QCL A;  2V63 A;  2WVB A;  2IJN A;  3GR0 A;  1RTH A;  3MPW A;  1MG7 A;  5B78 A;  2CYY A;  2QMX A;  2QL9 B;  2YY3 A;  3MM7 A;  1S0O A;  3DLL Q;  3TYT A;  2QRR A;  5CA5 A;  4PPE A;  1U8S A;  2RHQ B;  3G4S S;  4CNZ A;  4QWA A;  4ZHR B;  4H4M A;  2YKN B;  4J9N A;  2RS8 A;  2MY8 A;  3DRP B;  3FKB A;  5KH3 A;  2M2B A;  3M6V A;  3M8Q A;  4NLV A;  2F4V J;  2RH3 A;  4QZV B;  4ZLP A;  4CLK A;  5BYQ A;  3BYP A;  4YAX A;  3OSN A;  1VBZ A;  1E4U A;  1UEK A;  3HF5 A;  4ES3 A;  1M90 T;  5K3Q A;  2BXJ A;  3GYN A;  1MLA A;  4K7Q A;  4OYO A;  4UOH A;  5KFR A;  1DQ8 A;  4IDK B;  3LGH A;  5EWF A;  4ELV A;  5ETK A;  2UUB J;  1HI8 A;  3NGR A;  2D9P A;  3MDB C;  1N36 F;  5H1U A;  2BJ1 A;  2C1E B;  2WW8 A;  4WZM A;  2J9D A;  2J5A A;  3LH2 S;  1KFD A;  3OL8 A;  1YVF A;  2W2P P;  4LSZ B;  1PO6 A;  5FD1 A;  4IRD A;  2R4F A;  4O3Q A;  2OEJ A;  2Q3P A;  2KFZ A;  1ZAV A;  2RQ4 A;  3CJ2 A;  4NA3 A;  3HD1 A;  3M99 A;  2LQ8 A;  1WAC A;  3OL6 A;  2K4D A;  3VK6 A;  1YQH A;  2YSJ A;  1CC7 A;  1XWL A;  2GO8 A;  4WYW A;  5EGY A;  1KLM B;  2D69 A;  4HT5 A;  4C7Q A;  1JKH A;  4LFA J;  4DPW A;  1UMJ A;  1HKA A;  2MQL A;  1M5H A;  2YKM A;  3FCH A;  3OQ2 A;  4NLW A;  1HAR A;  3P3D A;  2ADC A;  1C1C A;  1GX6 A;  2IYI A;  3DYA B;  4PAA A;  4WP8 A;  1TAQ A;  1Y4Z B;  3GIR A;  1SQE A;  4JV1 A;  1HYS A;  4DPY A;  3TAN A;  4LRB A;  1RT1 B;  2J6T A;  2BE2 A;  4DR3 J;  2Z30 B;  4HTJ A;  2MLY A;  3TUP A;  3VAK A;  1RAO A;  1R43 A;  3AQO A;  3CJQ A;  3QO9 A;  3T9Z A;  5LSO A;  3SI8 A;  4FDF A;  1U1O A;  2DRB A;  4PQU B;  4FKY A;  5HQM A;  2ECV A;  1JLE A;  3NNC A;  1O51 A;  1OSC A;  1L3V A;  2RAQ A;  2FZG B;  2HGM A;  2OGU A;  4X66 F;  1S97 A;  1KC8 T;  4B9V A;  3P4U B;  3RW6 A;  1U1R A;  3PO5 A;  2HQC A;  2RVJ A;  2DVI A;  1QD1 A;  4LMZ A;  5KFP A;  3G8Q A;  1EET B;  3L4B C;  1G25 A;  5EWG A;  5ETP A;  1DFD A;  4CO4 A;  3KNG A;  2CT2 A;  4AYC B;  3TJ9 A;  2F6N A;  1N5T A;  3DRR A;  1D9A A;  3KJQ B;  4RNH A;  3IGN A;  2DNM A;  2YNF A;  3D9B A;  1HWU A;  2RHS B;  2YH0 A;  3NY0 A;  3VV2 B;  5B0C A;  3JYT B;  4FPI A;  4TKT A;  4DR3 F;  1EQM A;  3ZFV A;  4O62 A;  1RWN B;  3W66 A;  4OHV A;  4DHV A;  1TMJ A;  2AU0 A;  1S0M A;  4B17 A;  2QO3 A;  2KHD A;  2RML A;  1RWV B;  1S79 A;  4CYU A;  2DRD A;  1F9H A;  2POK A;  1FF2 A;  1Q5V A;  1Z4U A;  2DHX A;  2YSM A;  2K1J A;  2IDL A;  3PDN A;  4G1Q B;  3J7Z 5;  3QRQ A;  2LGV A;  5DJB A;  2ZM6 J;  1RK8 A;  3F44 A;  1YWX A;  4K8R A;  5FLX U;  2QMU B;  3CJR A;  4QU7 A;  1U0H A;  2KWN A;  1TK5 A;  4B08 A;  1M5P C;  5IQ6 A;  3MDF A;  2MQN A;  5IZH A;  1SJ3 P;  1A7G E;  1GXU A;  2WON A;  1WNE A;  3HO1 A;  1NKE A;  2CZ4 A;  2XI2 A;  1IWA A;  4MK7 A;  1VFY A;  2HQD A;  3TVK A;  4DV1 J;  1NJX A;  4IRK A;  1F2G A;  2ZH1 A;  5DG9 A;  4S3O C;  4UQG A;  3HXM A;  3RAX A;  2PO4 A;  2OD4 A;  4LF1 A;  4PYA A;  4USJ C;  4ZVG A;  4ZCK A;  1DJ0 A;  3DDT A;  2XG8 A;  4QIV A;  1YX2 A;  5F8N A;  1RJJ A;  2EWH A;  3JS9 A;  1LKZ A;  4DDF A;  4TQS A;  4DR1 F;  1OWX A;  2DR8 A;  3DLB A;  4YDX A;  5KTQ A;  1IJE B;  2GIR A;  3I0R B;  2VKZ G;  4DS4 A;  2H0D A;  2PDA A;  4KGZ B;  1C2P A;  4DV7 J;  1X5P A;  1JWW A;  4KQZ A;  3CDE A;  1LXJ A;  4M1K A;  5HVG A;  4XPE A;  1GMU A;  1HPZ A;  3KV6 A;  3UDV A;  4EEY A;  5SUH A;  2HBR B;  4NXM J;  3NBP B;  2A0F B;  1SC1 B;  2AZ1 A;  4FYY B;  4CO3 A;  1HNX J;  3S01 A;  1JLB A;  5HJY A;  1RAC B;  4RW6 B;  1RAH B;  5DLF A;  1RAB B;  1WEX A;  4QR0 A;  2B8Q A;  2ADB A;  3CJ5 A;  1VK8 A;  1GAO A;  1VRU A;  2CSZ A;  1X5O A;  1R7I A;  5C5J A;  3KDN A;  4PQA A;  4P5O B;  5M2R A;  5KFZ A;  3VCD A;  4ECQ A;  3US5 A;  2CZ9 A;  4CO0 A;  1NKB A;  1QSS A;  3IR5 B;  3T3F A;  1H2V Z;  3CJS A;  4QOT A;  1LW0 A;  2N7C A;  4DX7 A;  3QZ8 A;  5L1I A;  4A0C D;  2BAY A;  2QE5 A;  4AL7 A;  2VQF J;  2FZK B;  2BOA A;  2XI3 A;  4RNM A;  5L38 A;  3NP5 A;  3MUM P;  1HYI A;  2DNP A;  1S1X A;  1K8A T;  2KFN A;  3J7A 1;  1F3V A;  1C0T B;  1B0P A;  1YLX A;  4X4V A;  5A0Y A;  1WDD A;  4DU7 A;  1AUD A;  5DM7 Q;  1BOR A;  4K4V A;  3QLH B;  4LRC A;  2ZET C;  3MM8 A;  3NS6 A;  1JJ4 A;  2HBZ B;  3PJW A;  3NMA A;  2NYH A;  1GQE A;  2QLJ B;  4P71 A;  3I87 A;  5T7L A;  3ZO7 A;  4NCG B;  3MR3 A;  1K0V A;  3GWC A;  3HHD A;  4PPD A;  2HIQ A;  2O67 A;  4QPX A;  1D9D A;  3BKU A;  1YIJ S;  3MUT P;  3PW7 A;  3ZPV E;  1B7Y B;  1Q79 A;  5FDL A;  3SSS A;  1PYO B;  3MPD A;  2V9W A;  4QU6 A;  3O47 A;  4LF5 F;  1UFL A;  1OY6 A;  2GZO A;  3CCM S;  1BWE A;  3LP1 A;  1FFW B;  3PYF A;  4P52 A;  4ES1 A;  4YHH F;  5ETV A;  3SFU A;  1IWG A;  3F41 A;  2DBB A;  4DJB A;  4ZP9 A;  3Q8Q B;  2KYZ A;  3NOG A;  4X62 F;  4I69 A;  3V4M A;  1HNI B;  3D6H B;  2VL1 A;  2F1F A;  3ZZT A;  2VQE F;  4RU2 A;  5EWE A;  4WU3 A;  3BQ0 A;  3CUL A;  3N5B A;  4CT9 A;  4WP9 A;  3W63 A;  3TP2 A;  1Z2Q A;  4ATN A;  2BAB A;  3JXO A;  3PEJ A;  4XDD A;  5B08 A;  2YWF A;  3EVM A;  1QE1 B;  1WG5 A;  3LPE A;  4LR9 A;  1NZ8 A;  1VQS A;  3S8S A;  2VG7 A;  4Y2A A;  4LVO P;  1J27 A;  1KQS R;  1RHR B;  2M5Y A;  4UZC A;  1S6P B;  1BQM A;  4RW7 A;  5G0R B;  4NEY A;  3VHQ A;  1CEZ A;  5JUM A;  4N7T A;  2BQU A;  3GTY X;  5HAN A;  1JJ2 R;  7FDR A;  2YXL A;  2FJV A;  1NH7 A;  5LMU F;  1ZA1 B;  2ZHO A;  1S7I A;  3OHB A;  1N56 A;  1QUV A;  3I96 A;  1KWM A;  3P5T L;  8ATC B;  2RF2 A;  3PRV A;  4OZ2 A;  2ALY B;  3PUQ A;  4USM A;  3CCS S;  5HP1 B;  2Y9H A;  3QFH A;  1JJC B;  2AN6 A;  4LBH A;  1CJV A;  1TKT A;  4NLS A;  3DOM A;  4TQR A;  2E1P A;  3C19 A;  2F3J A; 
#chains in the Genus database with same CATH homology
 2YVR A;  2CRR A;  3LVR E;  2EGM A;  2CON A;  2JM3 A;  4Z0R A;  3FJU B;  3LJU X;  2LQ8 A;  3LPE A;  2EXU A;  1NZ8 A;  3P8B B;  2MKE A;  2KKY A;  3EWG A;  3KDE C;  1NPR A;  4ZN1 A;  2YRE A;  2RR4 A;  1DCQ A;  2OWA A;  1M1G A;  4H9D A;  5SVY A;  2IQJ A;  2FFW A;  2XOC A;  3SUB A;  3PLW A;  2XOZ A;  4OGC A;  3JUE A;  2FD4 A;  2M13 A;  3LDY A;  3QQC D;  3O47 A;  5K3Q A;  4Z0O A;  2CRW A;  2D8U A;  2KKX A;  5SVX A;  3H7H A;  3DDT A;  1M1H A;  2CSV A;  3FEH A;  2DJA A;  2JUN A;  3M7K A;  1NPP A;  4O62 A;  2L7P A;  4OGE A;  3T9K A;  2XOY A;  3MDB C;  3Q1D A;  2XP0 A;  2XHC A;  4ZN3 A;  2E61 A;  3LVQ E;  4QQ4 A;  2P57 A;  5SVI A;  3FM8 C;  3DWD A;  3H7H B;  5SVI B;  3E2D A;  2OUG A;  4F1P A;  2B0O E;  2K06 A;  2LAU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...