2EXUA

Crystal structure of saccharomyces cerevisiae transcription elongation factors spt4-spt5ngn domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
192
structure length
192
Chain Sequence
b'SERACMLCGIVQTTNEFNRDGCPNCQGIFEEAGVSTMECTSPSFEGLVGMCKPTKSWVAKWLSVDHSIAGMYAIKVDGRLPAEVVELLPHYKPRDGSGSATIWGVRCRPGKEKELIRKLLKKKFNLDRAMGKKKLKILSIFQRDNYTGRIYIEAPKQSVIEKFCNGVPDIYISQKLLIPVQELPLLLKPNLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription initiation protein SPT4/SPT5
publication title Crystal Structure of Saccharomyces cerevisiae transcription elongation factors Spt4-Spt5NGN domain
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 51
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2005-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06093 Spt4 Spt4/RpoE2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.210 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2exuA01
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 2exuA02
1NZ8A 3H7HA 2K06A 3QQCD 4ZN3A 1M1GA 4ZN1A 2LQ8A 1NPRA 3LPEA 3P8BB 1NPPA 3H7HB 1M1HA 2OUGA 2EXUA 2XHCA 3EWGA
chains in the Genus database with same CATH superfamily
2O67A 1YTYA 5H1UA 4ATNA 4RNNA 1PIEA 3M8ZA 2FJEB 5D0GA 3M6VA 3CIMA 4NLVA 3I2DA 2AN6A 1TR0A 1XR6A 4DL3A 3LPYA 4B3OA 4MSXA 5CYMB 4LRDA 1XWHA 2A1BA 3NRBA 3M6WA 2XY7A 5LL6d 2HMIA 3KK1B 1DQAA 1Y4ZB 3W2VB 1LDJB 2PMWA 1U25A 2H9ZA 3O5TB 5D0RA 4WPAA 3CEDA 2GVDA 3MHHA 4XDCA 2FLOA 3W65A 5I42B 2MZJA 5B78A 4G3IA 5C42A 5FDLB 2F7VA 2L5UA 3I4PA 5EGYA 1WC5A 3OLAA 3LOUA 3HHNB 5I3QA 1Y10A 1RQ0A 3O1LA 2EVZA 3HO1A 2YVSA 3PFOA 3QSYB 4TQSA 2CQ0A 3M05A 1B70B 2N3OA 4PXEA 1DBDA 4K2XA 2Y1NA 1OWXA 2F65A 3W9IA 4K7QA 2XYHB 3U5PA 1RTIA 2ZD1A 3VGUA 5B0EA 3KMSA 3R7NB 2UVUA 4I7FB 3NWGA 3IR5B 5A6PA 3D68A 3CJRA 1T8EA 2DD8S 1VS3A 3THVA 1L5UA 4ZMMA 4AYCB 5E3RA 4DEZA 4F2RA 2DO4A 5LJ3Y 2Y43A 2IVYA 1K8AT 7FDRA 4OI0A 2DH7A 1P6TA 3D2WA 2ECIA 3MOJB 5M2PA 4PQUA 1AYEA 4QIWD 5F8HA 2VQEJ 3UPFA 2BZ2A 1UPMB 2XHCA 1UEUA 5GADI 3ZZYA 3U1NA 3BQ2A 4J9QA 1IJFB 4OI3A 3QLHA 1YDLA 1XBWA 3M8RA 1R31A 3UD5A 4LQ9A 1K73T 4XIUA 3PJWA 2E1CA 3IFEA 1WORA 2V69A 3EUNA 1U47A 4C6AA 1MMNA 4K4VA 3MEKA 2RUSA 4HT7A 3G6ES 2KZZA 2GQCA 2IBKA 1TV6B 2HK3A 3KXDA 3SYZA 1FXRA 4O4GA 4ED2A 1DLOA 4YABA 3ELHA 1EJ7L 2HVEA 3JS9A 4NMLA 1IKWA 2EPIA 4M5IA 2ZM6J 1N8RT 2WCXA 3SCIE 2HFSA 4NEZA 4F3OA 3OTOJ 1BQMA 1DARA 1NZAA 4MVTA 3FRYA 4O3SA 2XULA 4F0KA 4TY8B 2W7AA 1EP4A 3IS9A 1GXUA 5LXRA 2XYPB 1K9MT 1TL7A 2FTRA 2RRNA 2KTQA 2LKZA 1KKHA 3HCUA 7AT1B 4DN0A 4QF3A 3UCUP 1VQ4S 1NK5A 1TKZA 2A10A 1RT7B 3QGPA 4FKYA 4A49A 3TZYA 3K7RA 2C3UA 1JLEB 2J6TA 4QWCA 1HWIA 3R5AA 5KFCA 5D1KB 1PJ7A 5E3AA 4OHZA 3FKBA 1PG5B 2J7KA 3B6BA 2VQEF 4ZVQB 1VC5A 1Q8LA 5C25A 3NBPB 3BSCA 4RLEA 1JLAB 1GMWA 3MMJA 1CJKA 2HWTA 4JI5J 1H0HB 3DRSA 2IDLA 1RAAB 1Q16B 2E9RX 2J9DE 4IRKA 2JZ5A 2DITA 5LCWB 4LRFA 2BJDA 4LIRA 1SJQA 3CO9A 2BOPA 2V0NA 2Z2LA 4PWDB 2XMKA 2EFNA 2ZE2A 2MKYA 2KVQE 3D6HB 1PYTA 1TMMA 3NG8A 1H6KX 2MMYA 1DTQA 4IDKB 3Q86A 2ZM6F 1E4UA 5GAHU 4YBMA 2OEJA 3OTOF 4JP8A 3JYTB 2HFZA 2IC3A 2JMDA 3QNWB 4L75A 2FD2A 3FEYB 1IBKF 3GV8B 2B4PA 5CZXA 3M99A 4X4NA 4PEOA 3TYTA 3RAMA 3TAQA 1P1TA 2CG8A 3BR8A 1WDDA 3GB0A 2BJ3A 4Q0BB 4NOHA 3GCWP 3OFGA 1NXIA 3M4XA 4JI6F 4BS2A 2G1DA 3I0SB 4BBQA 3ZNUA 1ZYQA 2W25A 2KB2A 2LN0A 2PA3A 4K0KF 3UFCX 3KHGA 8ATCB 2YX1A 1XNRF 3J81U 4USUA 1MW7A 2XI3A 2A0FB 4JV5J 4C0OC 2DH8A 4MTPA 3H4BA 3D1QA 2PI4A 3K59A 4NWBA 2C2KB 1RWVB 3KMQA 3GYXB 1QTMA 1IJEB 2V4QA 1TFWA 3MMBA 3C15B 4ZCLA 3RUBL 5K14A 3GYNA 1YJVA 3A13A 2Q79A 4RX6A 2L80A 3DLGB 2DX8A 2JEFA 2VOPA 2MJUA 4USIA 4QOTA 2FHMA 4QU6A 2BW2A 4J5OA 5I3LA 4B02A 4PUOB 4Z7YA 1V87A 3T5HA 2MZQA 4FYDA 4P71A 5KFOA 2I50A 5DDPC 2MSSA 4LFAJ 2UXBJ 2LP4A 1KLMB 2FDNA 1JKHB 4M5KA 1WG5A 2CPEA 2YQ0A 2I6WA 1BWVA 2HPUA 3C66A 1NSPA 2XMVA 3Q2TC 4DF4A 3CB4A 2VG6A 4AQYF 2JVRA 2CJKA 3LGMA 4P5OB 1XMQF 3OR1A 4YR0A 2Y1LB 1VK3A 2PUYA 2OPPB 1M1KT 2W7PA 1I94J 4J9KA 4LRBA 3ILIA 5HMXA 1BORA 2I5JA 4FPRA 2DTJA 4F0HA 2LDRA 4YQWA 1GQEA 2YQMA 3PTWA 3UVJB 4WU2A 4EK2A 4DV2F 2X7IA 2WTFA 3C8YA 2R2TA 4GVBA 4ZLPA 1TKTA 5KFRA 2ZJQQ 3PW0A 4FF3A 2Q66A 3C14B 4GO7X 5KOWA 3VF0B 3G71S 4B3TJ 2MUMA 1RBOB 2DNGA 3ZFVA 4OZJA 4WF9Q 4FK5A 2DHGA 4JI3J 4DQQA 2Q6BA 4G1PA 1VYAA 2NXUA 5HN0A 3K57A 3Q24A 4DV3F 1JLFA 1RTJB 2FYXA 3BJYA 2ZH2A 5TDWA 5E5NA 1VQKS 4YY3J 2ZVSA 3W1YC 4NASA 1RWNB 1SXLA 2FHJA 4ID5B 4M5JA 4XPCA 1GAOA 2UXBF 1CHCA 2KVIA 1L3VA 1K0TA 5A0YA 1FRHA 2RQMA 4H4KA 3ZZ0A 2DGOA 1SH3A 3HHEA 2UXCJ 2QICA 4MYUA 2P9EA 2B6AA 2MQOA 3SHBA 1C0UA 2F3JA 2EEYA 3V6DB 1VRUA 4B3RF 3UWTA 4PZVA 5E41A 2BMBA 5J2MA 2ZH9A 1JLQB 5KFFA 2LGLA 1I94F 3N79A 1DZ5A 3TJ9A 5E3CA 1XQIA 3J81j 3CCSS 3EJMA 2OJ3A 2OFHX 2ZOMA 3QAUA 3O7AA 1YJRA 5CHCB 2CZVC 1EZZB 2FPHX 2KYUA 3SSRA 2HWIA 3VAKA 3HSDA 3CWJA 3B8HA 1PILA 2YNIA 4OJ3A 4LKAA 4WYWA 5DGBA 1ZZNA 1RT1A 1UA0A 3A8KA 4USWA 5L46A 4B3TF 1ZM2A 3EPGA 1N6QA 5F3ZA 2CJBA 4JI3F 4IR9A 1B0TA 3KDEC 5AT1B 2YHNA 3A4TA 4ZS6A 2MQPA 5E3QA 2BM1A 5LMNJ 4KFBA 4ZVRB 4OZ0A 1QE1B 2QMUB 4UUXA 6FDRA 4OGCA 3KK2A 3OD2A 4YY3F 4U96A 3EGZA 5G0RA 2ZNYA 1RA6A 2HNDA 2DJAA 4C11B 3BF4A 2U2FA 3HSJA 3OPKA 4Y2KA 2ROGA 3T19A 4ZK7M 1RAGB 3LP2B 5G0FA 2ERRA 2AEFA 2B4UA 2JC1A 4KRWA 1YIJS 5IC6B 1UFLA 4WP3A 3IG1B 2P2CB 3AB4B 1MSWD 1X7VA 2Z2YB 4PG5A 3T5LA 3BBCA 1QLNA 4HH1A 5H9EK 1LWFB 1F60B 4C0HA 3F56A 5ETTA 1JJCB 3GFYA 3NNHA 5CYMA 4U67Q 2MKCA 4ITSA 4AL5A 4OQJA 3R5CA 1N4LA 1UPPA 3SQGA 3TWZA 4CLPA 1F3FA 2VJVA 2IBOA 3MM9B 2OD6A 4ZPCA 3WZ0A 1XR5A 1LW2B 1NHVA 4RNFA 1TAUA 1HQEB 4LF6J 2MKIA 1RA7A 2QX0A 3OFHA 2PDAA 3PY8A 1SUQB 1F2GA 1VBXA 1JNZB 2OI2A 3FCHA 3L4BC 2Q3PA 1T95A 3ZZOA 1HD0A 1GTEA 3HD1A 4B9SA 4JYAF 2YNHB 3EXYA 2SXLA 2OD4A 3HHLB 5LMNF 3H5YA 1F5CA 2ZUGA 2EFGA 3DOMB 2MB0B 1J5OB 1DFDA 4P2SA 1PAEX 3K5OA 3GJSB 5C11A 1TZ0A 4J37A 4F25A 2YH0A 3MTKA 3VVTA 3ETOA 5GAHI 2F42A 4I6YA 1X5SA 4P2MA 3SFUA 2L43A 2G2OA 2BE2B 3FEXB 4ZVSB 3HJFA 2DEIA 1U1NA 2XZWA 2Y1JA 1KFSA 5F8JA 1S1XB 1F2HA 3LP0A 1U09A 1QAYA 1FVQA 3ENAA 4RU2A 1SKSA 2MZTA 1ROFA 2ASYA 2B51A 2JHEA 2DT9A 1ZZFA 1HNXJ 2JJ4D 4EFAC 4HR2A 3HI9A 2HYIB 3QAEA 2F6NA 4X65J 3D0GE 1IM4A 3QSIA 2G4BA 2DIVA 2RF2B 2L0BA 2E29A 1VQ9S 4MKYA 3KK3B 4WKYA 2KWJA 5FD1A 1HBNA 2ZH7A 4ZPAA 5J2NA 4E2FB 1GNKA 4BDPA 4NCGB 1H72C 1CSJA 1BLUA 3L7OA 4B9TA 3M8PA 4C98A 1MU2B 3GV4A 1V6HA 3ENQA 1ZAXA 2WVCA 3R6LB 4ZIVA 3TX0A 1KQSR 1RAOA 4ZVEA 4DMZA 1SL2A 1R8HA 1KR4A 4ECUA 2QL5B 2B3TB 3KLVA 2QO3A 4UZBA 4ZVUB 1LXNA 2AYMA 2I9SA 2RQKA 2H5EA 3MECA 4A4JA 1C1CA 1LK5A 2QSFA 4IG3B 4QW9A 3QO9B 3CMQA 2D3ZA 5HP1A 4I67A 4JI1J 1S7HA 4DJBA 2YSJA 4CYUB 3SSQA 5F8GA 4PG7A 3KUHA 3MAQA 4FVCA 3D3CJ 2VP7A 4GKKJ 3MD1A 4U7UK 5RUBA 1GMVA 3VK6A 2N3LA 2NZCA 3DGPA 4KGMA 1TUGB 4DQPA 2CJ9A 1TL4A 1PBAA 1RKJA 2G0IA 4R8UB 1WEOA 3FFIB 5DG8A 5CYQB 1FP0A 4CT8A 4KQZA 1JLEA 3LQJA 3VZIA 1CULB 4A8XA 2OWAA 3VQSA 3HCXA 2CNLB 3CXCR 4Z7CA 4X65F 1WF0A 2AX0A 2VKZG 5KFSA 4OX9J 1HYJA 1XIQA 3POTA 1B3TA 4PPZA 1UL3A 2YWFA 4ZQLA 4CCGX 2ECGA 3DLEB 2LQ6A 4KKOB 3QPIA 2QFIA 3CIZA 5F0WA 2UXDJ 1W7WA 4FXDA 2C2VS 1AB8A 4OJ1A 1A9NB 4RL1A 4C8LA 1UWAA 3OUYB 2V9WA 1FT8A 4S0MA 3SEOA 4QIEA 2ILYA 3OT9A 3SCKE 1KVJA 2QLJB 4CDIA 4U95A 2YKNA 4U8YA 5AITA 3N9UC 3G8QA 3OL6A 2YKMA 3FK4A 1RT6B 2HNYB 4IDKA 4JI1F 2ZDOA 4LF2A 3TR5A 4NCAA 2HNZA 2F63A 2XMUA 4PG8A 3RPGC 1TUVA 3RW6A 3I0RA 1CS4A 1FXLA 4QYZJ 3GU0A 4X84A 3HHLD 3V81B 2UZGA 4ZPBA 1FVSA 2YBVA 4DL6A 3HSZA 1WEWA 1FTCA 3KLFB 3M8SA 4CO2A 1XC9A 2AJQA 2QYCA 2RH3A 3JQMA 2CKLB 2VHGA 4DR2J 1RT4B 3OR2B 5B0GA 4NZ6A 5EN1A 4EZ6A 1C4AA 2J8SA 4F4AA 1IWGA 2KHCA 1HNWJ 4ANCA 1VHFA 4O64A 4HI1A 4WIQA 2M1RA 3RRGA 1HI1A 5I3UA 4NL5A 4I69A 3RTVA 5ETMA 3SOWA 4DR1F 4LF7J 3CSKA 3OJUA 2VG7B 4DX6A 3IWLA 2BJ9A 4GNEA 5DETA 3CVKA 2LECA 1CJTA 2ZZMA 4JOUA 3PW2A 4LREA 1Q81T 3W63A 1HL6A 2GA7A 2UVWA 3PW4A 1WEQA 3TO8A 2LV9A 3DOKB 3LVQE 5DQHA 4ZLNA 2CRLA 3ENWA 4PTBA 3G9CA 2W9CA 3W60A 3PJXA 4JI4J 3FDSA 1KN6A 2KGIA 2NLWA 2LEAA 2MGZB 2FJVA 5LMUF 4ZVFA 2ZNZA 1WOOA 2E6SA 5DDOC 3PW5A 4TLQA 3HHKA 3FJ2A 3G8SA 4DWIA 2LEPA 3U27A 5CAAA 2CPDA 4ZVOB 3KJFB 2XZTB 1WHXA 1JKHA 2YX4A 3QRQA 3RU0A 2MQ8A 4ES2A 2VPEA 3UN5A 4Y3CA 1QAJA 2ZH6A 3MCMA 4J9SA 2BJ8A 4NLWA 4YMEA 4IH5A 1SH2A 4N5SA 3BN7A 1KVIA 2BAYA 3G82A 2XG8A 1S1WA 4RPFA 6FD1A 3PIOQ 5IOLA 1N32F 1HNZJ 3T7LA 1LK7A 4QJVA 1KTVA 3A8EA 5SZTA 4JV2A 2V8HA 2Z0GA 2ZJRQ 1Q8KA 1Q8BA 1HNWF 2WOMA 5AXNA 2JLGA 4P52A 1RCXB 1U0HA 3BV8A 4C9ZA 3QGHA 3I4HX 2UVRA 3DXSX 1VIXA 2RR4A 3V6HA 5JUMA 5KFKA 2E5LF 4RW7B 2MNZA 1ZM3A 3N9PA 3Q0AA 3KLGA 5HQ8A 4ELUA 1Y5NB 2LQ9A 2P9CA 2VJFA 2L48A 2HS4A 2GHVC 2VFTA 4UZCA 1RTJA 4WZQA 1CEZA 2GNKA 3NOGA 4CNZA 2X3DA 4JI4F 1XNQJ 2CADA 5AJ3F 5LT5A 4ID5A 2R7RA 3QWPA 4ICLA 3D1OA 3MHYA 2YKAA 2C3PA 2IAJA 1V5IB 4DCJB 4CO3A 3BS9A 4F0MA 3W2WA 3GLJA 1RB0A 1VR6A 2ZHBA 1RT2B 2CPFA 2X1GA 3O6QA 2YWKA 3C5KA 3KV6A 2CWKA 1WHVA 3DXBA 3E01B 4ANDA 3FEHA 2BJEA 1RLCL 3V6DA 3NLCA 4FF2A 3PV8A 3CDUA 1Q95G 1HPZB 1RP5A 2LQ5A 2CPYA 1Y00A 2QC3A 4Z0OA 1YBUA 1UZDA 2WSEC 4CLUA 1TP7A 2L9NA 4DXLA 1JX4A 3Q89A 4B9UA 4RBTA 5A8RB 3KHRA 2EC0A 2DYAA 2ZJPQ 3BKTA 1FK9B 3DFEA 2AX1A 3OL7A 3O3LA 1NDCA 2MY7A 2OPSA 1R6YA 4YEAA 2RDDA 2RRBA 1TQLA 4TYBA 3CD0A 2BXJA 1IBCB 1Z60A 3ET6B 4ZP8A 4IC3A 4NLOA 1SC3B 4I7BA 3TJ8A 1REGX 3ZVYA 3QYYA 4FNHA 1FERA 1XNQF 4B3SJ 5J1NA 5DZ7A 2FC9A 4N4FA 4K50A 2N7CA 1WC1A 4DV0F 4X66F 4X3GA 1RJJA 2J6SA 2DNMA 2I1RA 1O51A 1R0AA 3ILJA 1YX2A 5J2QB 4PYDA 4MAKA 5A76A 4ED3A 3PO4A 3T6RA 1HQ2A 3Q8VA 3NAIA 4X4UA 1G7CB 4NYZA 1JLCB 3M8QB 4LBHA 3M32A 2OAUA 3W9JA 3PEJA 3LAMA 4FF4A 1HR0F 1W26A 1VJQA 2GO9A 5ADZA 2QLXA 3PX4A 3EDQB 3MPDA 4N3WA 5D3GA 1KRPA 2KKXA 3Q22A 4I2QB 1MMDA 3ZZUA 4EWTA 4H9DA 1LW2A 2BYCA 1WF2A 1IN0A 3SMZA 4P74A 2ALZA 4DPOA 1HNIB 1N48A 1SUQA 3HP6A 4NPOA 3H5XA 3EWGA 4RW6B 1B99A 1RHJB 5F8MA 4UI9B 5HROB 2D8UA 4UOGA 1BD6A 4QPXA 5HLFA 3PX6A 1PSDA 3DDTA 5FERA 1T9XA 5D15A 5KG5A 3PURA 5HSPA 2CNKB 4B3SF 1BY9A 4C3KA 4KHPJ 1KVKA 3A3PB 2H4YB 2BE2A 4L3NA 1CJVB 3EMTA 2VFVA 1D1UA 1CLFA 4TQRA 5F8LA 4WKRA 2FGCA 4XK8C 4P2XA 1L3KA 5AE3A 2FZGB 1WC4A 1HHTP 1FRXA 1C4CA 3BGOP 2KFTA 4RW9B 2KHDA 4NMXA 4G65A 4W90B 1NH8A 4ZKAA 5FJ4A 2HRTA 3D54A 3OHAA 2FQQB 2DNRA 4F4XA 3PLWA 1R27B 4DV1F 5H9EJ 2QJ3A 2MXYA 3J80U 3SCLE 5L38A 3E51A 1PYOB 2BV3A 4LFCF 4WZ0A 2CG4A 5AXLA 2VBYA 1S4EA 2JM3A 3PKYA 3QT8A 5L1JA 4NCGA 3HTKC 2AP6A 4URQU 3MOZA 4B9VA 1P8GA 3CPWR 1UP1A 3L3CA 1WOSA 4C8YA 1RMDA 4LQ3A 2V68A 1VRTA 3TNVA 3MM5B 2GQQA 2CWXA 2BRLA 2GW8A 3DGVA 5LKXA 3KLIA 3TX8A 1DTTB 2NUUG 4H54A 1OQ3A 3DYAB 5BR8J 1G2EA 4K5RA 1FKAF 3TQEA 4KE5A 1FRMA 3ULHA 1JJ2R 2GZOA 4KHPF 2EODA 4A8FA 1Y5LB 2J7WA 2A18A 4L7XA 3RR7A 3DWDA 3IGNA 4QWEA 1N88A 5KFZA 4LVNP 4RJVA 1JM7B 4LLBA 3LALA 3QGGA 4ZPDA 4P6QA 2J9CA 2CVEA 2IM1A 4P9SA 1VDHA 3DLLQ 3D3BJ 3MGJA 2FFWA 1O0PA 2K3IA 2BJ7A 2W24A 2LAUA 4CLYA 3GMGA 1NHUA 3MEDA 2HQDA 2DEJA 4I2PB 2LXUA 1QD1A 2Y1IA 1KDNA 4H4OB 5B0AA 4UOCA 1HMVB 4TVAB 2ZFHA 5B0CA 2D3OR 1NK9A 4DX7A 3RPGB 3D1HA 4W98A 2CPZA 3DRPB 4QPTA 4CCHA 4USTA 2BW7A 2UVVA 3AD9C 1F9FA 1C2PA 3R5BA 1DURA 3CJQA 5AIUA 5T14A 4NCBA 3T5JA 3QBCA 5A2QY 5IC4B 4HVZA 1S6QB 3DC2A 3FJUB 2B4VA 2K4DA 3OL8A 4PWWA 2R7QA 3LDYA 4QQ4A 2OMOA 4LSLB 1TFYA 3C6TA 4KIAA 2M6MA 5JVHQ 2X3GA 1S9GB 3UO0A 1C0TB 2DRBA 4NLSA 3JAMY 1ZAVA 3MD3A 1S6PA 1RAIB 5BR8F 2M4MA 2HNYA 4W4UA 5HBMB 1RABB 4J91A 1S97A 2RIJA 3JUEA 4KO0B 4ZHRB 3PR5B 4R5PA 1MM2A 3MUTP 2CYYA 2VU5A 3DM2B 4DV4F 3NCPA 1SI9A 1MM3A 2IJFA 2D7SA 3M2UB 2I0XA 3RRHA 4F4YA 5KTQA 4L76A 1M5KC 4GNFA 1HYSB 5KFWA 2XZDB 4RR5A 3S01A 1OYDA 2DXFA 1TL5A 5H1TA 4PCQA 5E7OB 3KOAA 1UVKA 4HACA 3HDSA 1TVRA 4DR6F 2DGQA 2APOA 1JLGA 4K4TA 1T11A 3CCES 2FJWA 2W4DA 4RW8A 3KNGA 3AOBA 4KV8B 2GGPA 2DSMA 4I6WA 2HFVA 4AVXA 2GJFA 3LF0A 4DFMA 5D6GA 3CCRS 3OFFA 1X31C 4FP9A 2XTJP 2PI5A 2ABYA 4JI8J 3HCSA 5D4NA 4OX6A 5TRBA 4AXJA 4RUCA 1OQ6A 2HLUA 4LMZA 2PEBA 3ZO7A 5L39A 1L3TA 3CMAS 5JG6A 3D28A 2RE1A 2IA6A 1NEEA 1IQTA 2GX8A 2KE1A 3KJVB 4K5SA 3S6EA 1LDKC 2RQ4A 4YC9A 1Q53A 4NRTA 4ZIWA 1IKXA 3GIIA 2XNRA 4XTTA 2H0DB 3P5TL 2DO0A 2QT7A 3R9LA 1SJFA 4ANEA 3FBBA 3DDKA 3GIRA 1FDDA 1NKBA 4WE1A 4G6VB 2GIFA 3OHBA 4ZN3A 1IUJA 1DAXA 1TL3A 4Q2MA 3GIJA 4Q2LA 2YPZA 3CDEA 3DRRB 4RU9A 5DJBA 1ZTTA 3GG1A 1U7LA 4ILMA 2WBRA 5KT7A 2K1RB 2WB4A 2ZBQA 5G4DA 3ZTQA 3BGRB 4DZ6A 3C6UA 4NXMJ 5HATA 1Z6UA 2W9BB 2YREA 3CULA 4G1QA 5CCMA 3ZC4A 2V2VA 4GNDA 2Y1MA 2W2QP 2L41A 2XI2A 4IFYB 4DFJA 1NKCA 2E1RA 2BANA 4K8RA 3O47A 3PKMA 3R3TA 3QWUA 2P6SA 3Q23A 2YWGA 3D0HE 3QT6A 3JB9k 3TAMB 1SV5A 4AUKA 2MKSA 2VQFJ 4WBFA 5F41A 4LSZB 3OSNA 5B0BA 3K5LA 3H4DA 1HQUB 2PGCA 1T03B 4RNMA 3MR7A 2ACYA 5DQIA 5ETOA 4PWUA 4LF8J 5KFIA 4A8QA 5ETNA 2F4FA 1KP6A 2DR7A 1FJGJ 5D78A 5HAOA 3ZTRA 4KPYA 3C16B 3NS5A 3PO5A 3M30B 2AT1B 3EX7B 1TKXA 3ZZRA 2ZWPA 2MLZA 3SV3A 1BHNA 2Z56B 5ETKA 4RW4B 4IFVB 3KLEB 1VC0A 1U8SA 2PA8D 5L1LA 4R0EA 1EX8A 2R4FA 2VDIA 2IM3A 1JWWA 2DIUA 1HHQA 3QIPB 4JI7F 1OSDA 3U1LA 3QFHA 2V50A 5D77A 4DG1B 3CF5Q 4N41A 1FWPA 3NAHA 3THPA 4F2SA 4NXMF 4ER8A 1PYSB 4TNOA 1SPBP 1LXJA 1RWOB 1NDPA 1Q1KA 4USMA 1H98A 4PPDA 2E1MC 4C4WA 1CJUA 2D69A 1NPRA 3NS7B 1E6VB 1UWBA 4J9RA 2HHWA 3L95X 4O44A 4Q5VA 4LF9J 2EG2A 1TL1A 2RU9A 3OTDA 4NYPA 2Z2MA 4ETZA 3ITHB 4Z0RA 2HBYB 2XY6A 3NXZA 3H5SA 2KN4A 1EQ0A 4H4MB 4KB7A 1Y5IB 3TZXA 1VC6A 4LF8F 1EETB 1FF2A 2PC6A 1HIYA 1BQNB 2DCLA 1X4BA 2FGOA 3AJDA 3CCMS 1X4FA 1FJGF 4B9NA 1NNDA 3EDRB 1WEMA 3Q8SB 1F3VA 4OI6A 3JTNA 2QE5A 3VTIA 4C0BA 1S0OA 2FD4A 3W5YA 3MM8A 1R8CA 1U48A 1FO1A 3I9V9 1RHRB 2YWWA 4HEA9 3GILA 1D0EA 2CSZA 4EO8A 2AGPA 1RTHB 5J1EB 2HAFA 4NLQA 1SJ1A 1T3OA 2OPQA 5E2QA 2WRMA 4FVMA 1VYXA 4K4SA 4MFBB 5DO2A 3AY0A 3CD6S 3T1AA 2AV5A 4DUYF 1SQFA 1FI4A 2HBRB 3BR9A 1N5YA 2WONB 3BKFA 1A0OB 3ZPV1 1V3SA 3DOLB 1HNVB 3I82A 2YNGB 1NAQA 1TTHB 1VCTA 5D4LA 2GHPA 2C3OA 2FUG9 1R0BG 2KXNB 2FUIA 3BQ0A 3HCTA 4ECRA 3MWBA 1XK8A 2LGVA 1LWEB 2UUAF 1Y3JA 4ZJLA 4OJGA 2CNOB 2V8GA 1DY3A 1M5VC 4X4PA 2FC8A 2YNFB 2ZVIA 1LWCB 1VFJA 2BBEA 4XDDA 1IKYB 4TXSA 1RU2A 1YJUA 2GIRA 1U1LA 1PBUA 1NK0A 2JC0A 2M5YA 4EUVA 2B56A 3UW1A 2V8PA 2YH1A 1S6OA 5A6WA 3TZWA 2CDQA 1RTDB 2XB1A 3BB5A 2BABA 3MM7A 4DU8A 1S0MA 3Q8PB 1KFDA 2Y9HA 3I87A 4NI2A 4V1Ak 2PT0A 1TUWA 1RT3B 2IM2A 4MIAA 2VDHA 3CDWA 5HANA 3KHHA 4R8PK 2HHHJ 3EXCX 2B9XA 1RXOB 2KIZA 2IYGA 1U1MA 5FEYA 3BO2A 4FF1A 1QSSA 4CWBA 1OIAA 2VIHA 1WKKA 2IMWP 1S1VB 1HBMB 1WDTA 2V9KA 3WIVA 5HVFA 1U6BA 5EX3A 3L7UA 5B0DA 1X0PA 3C46A 2HQGA 3ZNJ1 4DR7J 1FTRA 4IRCA 4FIPA 4MMOA 2OP5A 1VGYA 2E44A 2BA9A 1RAJA 3O33A 4KSEB 4L3KA 4KPCA 1G4CA 1EKRA 3H2UB 2H5JB 1KOHA 3OXGA 2JEIA 1KOOA 3GFZA 4WP9A 3DYAA 5G05B 3HLUA 2VL1A 2MKKA 2V4JA 1AFIA 2IRUA 2BJ1A 1Q0NA 2PMHA 2QMWA 1OJ4A 4ES1A 5EWFA 4YS2A 3RTRB 4QZVB 4O3QA 2AJ4A 1JK9B 3M2RA 2Y3YA 2KWNA 5IQQA 3D6FB 5DZ6A 4DQRA 4KJIA 5I4MA 1SJRA 1YRTA 3E2EA 4DLGA 1ZOTA 1LW0B 2PEHA 4WU3A 2VBXA 1HLWA 3F73A 1AA1B 2DXDA 4ES3A 4Q43A 3CGIA 2DK2A 1YZ7A 3L11A 3B54A 3CJSA 1ZAWA 3MAAA 4KYZA 4B9LA 1RK8A 2O5DA 5JJBA 5EWEA 2CPJA 2M8DB 2YKQA 5HK4A 2VV5A 1G3OA 3QT5A 2KDOA 3DRPA 4RKUC 5D4OA 4O3RA 4WK3A 1DRZA 3GP9A 1MROB 3QMQA 1GTHA 3QATA 1L3UA 1T05A 3RG6A 1RT5A 1EQMA 1F0XA 4W4MA 2DNPA 3BGFA 2OTJS 4DR4F 5EWGA 1REVA 4J9UE 1BC6A 3JSRA 3O37A 1KNZA 4OZ5A 5HMWA 4N56A 3EGVA 1S9GA 1R8BA 8RUCA 4C9DA 4URGA 5HL7Q 1XTZA 3BQ1A 3BH7B 3RRKA 4CRJA 4LF1A 4B17A 4QR0A 3AFGA 2MQLA 5D1LB 1TK5A 1Z2LA 5HBMA 9ATCB 1FKPB 4M5DB 5L1IA 3UQSA 5FLXY 2C2LA 4I56A 2DNLA 4P75A 2XSJA 3DM2A 4W92B 4EU0A 3DQVR 2ROPA 1JJ4A 4X62F 4WTYA 2B7CB 4Y28C 1P9YA 3NCRA 2C42A 1N34J 2RNEA 3VGTA 2DB1A 4B86C 4F3QA 3P4UB 4DPXA 3DRXA 2RQCA 1YWXA 4DPUA 3GR0A 4CLSA 3LAKA 3FZ2A 1JLBA 4NZ7A 3IWNC 1T94A 1YK9A 4GNGA 2QJ0A 3L09A 2UUTA 3UNGC 5A8KB 5B79A 3FBEA 3BYRA 1C1BB 2NYIA 5IQ6A 4LSNB 4CLLA 2C2MB 2KR4A 2F40A 1FFSB 4CM2A 2P9GA 3TEHB 2XCPA 2FJBB 1MLAA 2MQMA 1S79A 4DPYA 2HIYA 2G13A 5A8WA 3MEGA 2DGTA 4ZOSA 4ZVHA 4OHWA 4ZP7A 3TI0A 1VQSA 1CVJA 2DR5A 1UA1A 2VFRA 3NNCA 4WP8A 3VWSA 3L7PA 5IXUA 2FVRA 5D4PA 1DCQA 4O0NA 2BQ3A 3BO4A 3N6LA 3MAHA 3DKDA 1QDUB 2NAAA 1Q5VA 3ICLA 3DLBA 2P6TA 2ZBPA 3HHLC 1NCLA 4K4UA 3VGSA 1T9UA 1HBOB 4M5HA 2L3MA 4DUTA 3R5DA 2BKPA 2GC8A 4IKAA 4S3OB 3M6XA 1FKOB 1FRLA 3H2VE 3CDAA 3HD2A 1X4EA 3RYLA 2GHWA 2C2RA 5KG3A 4DSJA 1WTBA 4MIBA 2D41A 3OFEA 1GT8A 3GWCA 1S9EA 3LQIA 5DG7A 2WHOA 5J2PA 4MJKA 4AYBD 3PEHA 1N34F 4CZCA 1YZ6A 5KT4A 2F8MA 4YFUA 1KONA 2IJNA 2ASLA 2IM0A 2DXEA 3LW5C 2E7WA 2VF3A 2GO8A 4M94A 4Y2AA 2ZC3A 4A8SA 3ZZTA 4RBUA 2ECTA 3T5KA 3IM9A 1SVDA 3FSIA 1PAUB 2MD7B 3IBFB 4QYZK 3MEEB 1EKSA 2HVZA 3ETMA 4LIWA 4WWSA 1WGMA 1YJWS 4DLEA 5TABA 2J0XA 3TVYA 2YWHA 5ETVA 2KT5A 3MZIA 3H7HA 4XPEA 5TDRA 1YJTA 2CVIA 1T9WA 4ZVTB 1WKJA 1FNOA 2QIFA 2WZ1A 3O36A 5SVIB 3HVTA 2CJYB 5CXTA 3PHTA 4DV7J 4DOZA 4ZA1A 1VJWA 2XO6A 1IR2A 2R8GA 3CD5A 3V5RA 1X9MA 2QA2A 4NYOA 4X4VA 2E66A 2DNKA 1J5EJ 1OYEA 4B3OB 1UZHA 4OI4A 2PFFB 1HQUA 5U47A 3LJUX 5DKAA 4KGKA 1O5JA 2C3MA 3EE3A 4TKTA 3IN5A 3SDEA 4WFYA 1YJ9S 3IRXA 2F5GA 3DHWC 3ONQA 2HMIB 5IM0A 1WHWA 4I7DA 4UY8T 1H38A 1X8DA 3L9ZA 2FLPA 2LYVA 2VOOA 4UTGA 3KLHA 2D3UA 5K8NA 2XLIA 3V43A 5KFPA 2C2DA 1AUSL 2MIQA 3HPOA 3KHLA 2GVDB 1VFYA 4OYWA 1YBTA 1RU1A 2VPGA 3OTEA 2HWHA 1FEHA 2LU1A 3R1LA 1CBKA 3PXGa 3J7ZT 4PABA 3LH2S 4OFZA 1Y7PA 4R7EA 5B09A 1WEZA 1IKVA 3TUZC 1T02A 2NPFA 1F9EB 4R0JA 1UW9A 2Z4PA 4OV6A 4WZ2A 1P1LA 4CO0A 1GXTA 4TLRA 4MK7A 2JH3A 1MBMA 3VAFA 2K8GA 2XS5A 3HULA 2VFUA 1ZH5A 1FCAA 1FDAA 4F26A 1Z4UA 2OMLA 4FXVA 4RZRA 2MQNA 4OZ3A 2ZD1B 1RISA 2DGUA 4JB8B 3KQIA 3A3NB 3I5CA 1FFGB 4WK1A 4TU8A 3GG0A 2W1BA 1WSVA 2XOCA 1QUVA 2VA3A 3MM6A 4IO1A 2R8KA 4MIWA 1T3NA 1WC0A 1I51B 5B08A 4YOEA 1YQHA 1ZA2B 2V2QA 4PPEA 4BHWA 2WW8A 4ILRA 1I3OB 1D09B 3C3LA 2YSMA 1J5EF 3T9NA 2DBBA 5M2UA 2QLFB 4DS5A 2O01C 4Q6FA 2QSWA 2R2SA 4DX8H 4M95A 3DLKA 3K2YA 3DCAA 1BUXA 1YHQS 5LKZA 4JI5F 2B5JA 3QLHB 3CE8A 4MKBA 2R7TA 1M0SA 2KYZA 4YUDA 7FD1A 1NK7A 3OXFA 5KFXA 4F7VA 2CPXA 3ILLA 2XYGB 2CNNB 2RVJA 3ZVZB 2VZ9A 4NLUA 1H74A 4PKDB 5DS7A 3VQTA 2QV6A 4O4GB 1DLOB 4UP0A 2BQRA 2ZC4A 1WEXA 5D8HB 2DNOA 5B8DA 2LMIA 2VASA 4P7TA 2J0SD 4CH7A 1IKWB 2OPRA 4C8NA 2GVZB 1BQMB 3NMRA 3UCZP 1FE0A 4OYXA 1HYIA 4JV0A 1EP4B 3IS9B 5LSLA 2MSTA 2RKIB 4UUWA 2FHOB 5IT9Y 1TL7B 1WILA 2NSCA 4R25A 3NGKA 2E1PA 4HTJA 2OUGA 2HS3A 3DDIA 3JTOA 3TZZA 4FXWA 2DKOB 1YGYA 3PRVA 1NK6A 4MK8A 3DOLA 4NLGA 2M9KA 2YYRA 4HL9A 3N6NA 3W62A 2OSQA 3HX9A 2Y1RI 2B8PA 3WBZA 4X4RA 3IHPA 3TEGA 2VPWB 1B4SA 4EZ9A 1A6LA 2JMJA 3GV5B 1YRXA 4KH0B 4JV5F 1IKYA 3MDBC 2H1YA 3D6TB 2XLJA 5C7PA 4O4RA 1LEOA 2C28A 5C25B 5T7LA 5GAGU 4P7VA 1U1OA 1NHKL 2XWYA 1CJKB 2AQ4A 3DRSB 1RYRA 4ALZA 5L9XA 4ZJQA 4K4XA 1QVFR 4MYTA 4K4WA 2HGMA 4GC7A 1AZSA 2YPYA 3DI6A 4EGLA 2JEGA 4FPIA 4IG0A 3GFXA 2KFNA 3TJAA 1RT3A 3CJKA 2EKNA 2ZE2B 3NGUA 2JDJA 5EHHA 3IO1A 4OI1A 4F4ZA 1N36J 3M7KA 3CJ3A 4F3MA 2P8IA 5F8NA 4Q8EA 1DTQB 2UUCJ 2JOQA 4LFAF 4ED1A 5HMZA 3N01A 1OS5A 3K89A 2IC3B 5I3PA 4LF5J 4HYKA 4N47A 1D9AA 2ZEJA 1QY7A 1BMQB 1U2CA 4OYZA 1ZA1B 4ECXA 1JB0C 2JLEA 2V63A 1JMTA 3MFIA 1BXNA 1U8WA 4OMFG 3ADAC 2R8JA 3EICA 2CZ4A 4ZP9A 1HWKA 1XWLA 5KG0A 2MZ1A 4HHJA 3RB3A 2W2NP 2IYIA 3BN4A 1B0VA 5IFMA 3NMAA 4NLYA 3R5JB 4PXBA 4Q7AA 4K2JA 1S1TA 2VA2A 2K06A 4MH8A 2AMCB 1D9FA 1WTFA 1S5ZA 1HBUA 3DRYA 1WI8A 2M88A 2E1AA 2W2MP 4WXOA 2X51A 4QWAA 2HHVA 1GFWB 3LUYA 4DV6J 3P8BB 4PAAA 3MMBB 4K59A 5HVGA 4YB6A 5K14B 4FYWB 1UEKA 1M5OC 1WESA 2M85A 3HMJG 2AEJA 1RACB 1PGZA 2E61A 4FNIA 3T6BA 4N8OA 3V6KA 2LLZA 1WJ9A 2HBQB 1SC1B 3EYZA 4QWDA 2R42A 2PFDA 3P6YC 4QR1A 4P73A 4FO9A 2UUCF 1J27A 1S1UA 3UCGA 4CIOA 2OEKA 1U1RA 2F9JA 3M1VA 5KFJA 2VFSA 1N54B 1PJ6A 4ED5A 2DJWA 2RSDA 5HJYA 1X9WA 2UXCF 3NOCA 4BWMA 2K1JA 3IR7B 2QL7B 3HXMA 1FDBA 2HHXA 2OXQC 2VG6B 5F3TA 5LJ5Y 2G9OA 3H98A 4FBTA 3OR1B 1FWKA 4CO5A 3R2CJ 1WUUA 3VAJA 4XAKA 1SQEA 1S57A 3LANA 4M5GA 1IWAA 5KT2A 1XMBA 1NMEB 4DL0C 3NNAA 2I5JB 3Q8RB 3A3OB 4X4OA 4GVLA 3KK1A 4JUZA 4AD6A 1S4FA 1WOPA 2BDPA 2O3DA 3W2VA 4GVBB 3LA0A 1TKTB 4DCPB 4HDGA 3ZTPA 3M9NB 1NPKA 3MUVP 1R8PA 4I4BA 2VH7A 3X1LB 2QA4G 4M8LA 2B9EA 2ADCA 3FBCA 2YHOA 5KH7A 2ZDPA 4CLFA 2VONA 1PO6A 4DV6F 5I42A 2R7XA 2AJ1A 3PFEA 1X9SA 2Y0SD 5FDLA 4DSLA 5AXKA 1JLFB 1WEVA 1UFKA 1UJ5A 3Q8QB 1EB0A 2AHOB 3GV7B 2MYFA 1RHQB 2VC0A 4PQAA 1UVJA 1RBAA 2KM8C 4O0IA 1GMWD 3IXQA 3TUIC 2AJ2A 3NEKA 2XS7A 1GK8A 2FJAB 4V3KC 1W25A 3OVAA 1UW4A 2DY9A 2XY5A 2M8HA 1NSKL 1DQ9A 2XM3A 4OLPA 3KG4A 3QFWA 3P45B 3VAIA 4I7FA 4MT1A 1RWXB 1WEEA 2EW9A 1P9QC 4ED4A 3BBFA 2B6AB 3SUBA 1TELA 3ZPVE 2CQDA 3KUEA 4FZVA 4UP5A 4KT0C 4AYCA 1C0UB 4OX8A 2JMIA 2C2EA 4FBUA 2NXNA 2ZHAA 1VRUB 4DF8A 3MURP 2PIIA 1U24A 1WEPA 4LR9A 3FSYA 5J2MB 2KWOA 4CP5A 2VNFA 3EVWA 1EAYC 1QAIA 2BE7D 4ZITA 3TA0A 2QA1A 4NA1A 2XMAA 2E7XA 3PVXA 1VD4A 4YR2A 1W2BR 3VCDA 5DRKA 2EFPA 1NJIT 3KG0A 3K5PA 4PYAA 2LRIC 2POKA 3UDVA 4LF6F 4LR8A 2JRSA 1V3ZA 1ELOA 1RT1B 4OYPA 2LQJA 3TAPA 1M5SA 3QZ7A 2L9DA 3AD8C 4WFAQ 3O2IA 1PC5A 1N6QB 4DSEA 1M1GA 3PYEA 5C24B 2HVDA 1TV6A 2X1BA 1S49A 4KFBB 2DR6A 2EI5A 3KK2B 3DPLR 1S59A 1EARA 3U5OA 4UOFA 3MXHP 4GKJJ 4DBQA 2OHDA 5G0RB 1T9YA 2ZUAA 3FMBA 1LKZA 2XO7A 3F0NA 1RLDA 2HNDB 4NLPA 2XCAA 3H25A 1WKLA 2YWEA 4TY8A 3FRZA 3MPVA 1X4UA 2NREA 2ILZA 3T41A 2AWZA 2GJ2A 4TYAA 2CXEA 4UT4A 3Q8YA 3MR6A 3TRGA 2MZSA 1RT7A 5CQGA 1HNXF 3L1XA 4O3NA 4L73A 2X1AA 3HZEA 2R7UA 3QRRA 4WZMA 4DL2A 1WC6A 2HKEA 1WC3A 4HHUA 1QM9A 1FA0A 4OZNA 4DFKA 2KREA 4O62A 4MKVA 2B8QA 4OHYA 1RBLA 2VJUA 3LGHA 1LQ9A 3SQGB 3VV2B 2DGVA 3NBPA 1JLAA 3T9ZA 1N5SA 1VISA 1U6FA 4QIFA 1HI8A 1FDNA 2RS8A 1SKUB 1SH0A 2EBEA 5GAGI 5KFHA 2D1CA 2FY1A 2KKYA 3R1HA 4YHHJ 4P72A 4WCEQ 2IVMA 4PWDA 4FYYB 1MG7A 3HZGA 5AE2A 1IQZA 3MPYA 3MTJA 2VPBA 3GJQB 5LKTA 1UVLA 4DPTA 1RI7A 3V2UC 4NX9A 2I38A 4M1KA 2KYXA 4GKJF 2PMZD 3JYTA 3VAHA 4YBTA 3H8YA 5BXIA 4U7CA 3CCZA 4GKKF 2V34A 4FS2A 2EC2A 1SKWA 3BO3A 4I1TA 4YDXA 4LRAA 2JNJA 4DCOB 3MR5A 3R2DJ 2E7VA 2OFGX 2M3HA 3O34A 4A0CD 3LP0B 3PDNA 2MD8C 4NA3A 2FHJD 4YB1P 4Q0BA 3JSBA 3W66A 5H1VA 2B9YA 3VAGA 2GAGC 4F8RA 1RADB 1K47A 3PIPQ 5C5JA 1YJNS 3I0SA 1NB2A 3RB4A 3OL9A 2XQCA 2KH9A 2C22A 1NRKA 5MAOA 3HJVA 2HURA 1NO8A 2CONA 4OX9F 2ZKUA 3TA2A 2ZH3A 1HWUA 2MPUA 1Z2QA 1HBNB 2QLWA 3AJ2A 3BPDA 5J2NB 1VBKA 2DVIA 5BYRA 1Q82T 4OIXA 1SIZA 4A8OA 2UXDF 4DL5A 5L1KA 1RAFB 3TVKA 3FMWA 1VBYA 4UQGA 2BR0A 3M8PB 4A8KA 1BE4A 2VPZB 1RAEB 3C15A 4YADA 2CQIA 4ENOA 1J2VA 5KFDA 3PJ9A 2EA6A 3A8JA 3DLGA 1NPPA 4YHHF 3AXMA 2VBWA 3DU5A 2R2RA 4A8WA 5JMNA 2NS1B 2GV1A 4BC9A 3FNNA 2CQHA 3MECB 1XEZA 1C1CB 4EYHB 2DR8A 3ASLA 3HFKA 2P5VA 1RHUB 3UE2A 3W64A 4PUOA 1AW0A 2DNHA 2HQCA 1DVPA 5KFNA 1U45A 5HP1B 8AT1B 1FD2A 2H3EB 1MN9A 1KSPA 2GVZA 1T1HA 2D74B 1XR7A 1V9OA 4RWXA 3B78A 1KLMA 4J9OA 3GL6A 4ZJOA 1BWEA 4ZN1A 3ZYQA 2RKIA 1NSQA 1IBKJ 1MWYA 3Q83A 3AQPA 1WNEA 1S99A 2YUCA 1CPZA 3N9MA 4K4YA 1LV5A 2GIQA 3UN2A 3DGPB 4DR2F 5D1MB 3H42A 2OPPA 5GMKa 3DNCA 1MWQA 3BM7A 2J0WA 3ZZZA 4JI6J 3ISZA 5E0OA 1UMJA 3NGSA 2MNYA 3N9OA 3ZXWA 2R8IA 3EB6A 3DDNA 1FNXH 3GPAA 4K0KJ 4CM0A 3POTB 5AXMA 3UVJA 1XNRJ 2FZCB 4LF7F 2HQ3A 3C14A 2HDPA 1KC8T 2HAIA 2M52A 1I6JA 4RNOA 2ALYB 1R6VA 2V5HG 2GS8A 3V4MA 5LXYA 1S12A 2N82B 3G96A 1UTAA 5KFAA 2GAHC 2GQ2A 1VQ5S 4HTIA 2LCWA 2E5HA 1DHMA 1VIOA 1T9VA 2L75A 3RBXA 1T7PA 2YKNB 4ELVA 3SCJE 2KG1A 1D8ZA 2DH9A 3PRDA 1U2FA 2ZKTA 2YKMB 3R6GB 1OY9A 2ZOFA 3ENVA 4B3MJ 4AL6A 1OMSA 2FLNA 5EUHA 5CD4H 2HNZB 2CQ4A 1SIWB 1JXVA 2RJZA 3OSPA 3I0RB 1CS4B 2AZ1A 3G4SS 4KHRA 1GX5A 4NLXA 2NXEA 2EXUA 1WD6A 1Q86T 4Q8FA 1QSYA 2QZ8A 3NS6A 4AQYJ 3SOUA 2RU3A 3RW7A 2N4DA 2KKHA 1XMQJ 2CQGA 4BCAA 1HFEL 4V19X 2RMLA 1JLQA 3GE9A 2HHTA 4IH6A 1HNZF 2L7PA 2VPXB 2O1PA 3W9HA 1FHTA 1U4BA 2E5GA 4U7UD 4IC2A 2BKOA 3DLJA 4ECVA 5I3UB 3V4IB 1FXDA 4DV2J 4D3HA 1R8AA 2PNXA 1CJTB 4LUBA 4X4TA 4OZ2A 3SXLA 2JX2A 3HHDA 2LFVA 2DHSA 2NXJA 2R2UA 2CQBA 1H2UX 2DR9A 4DV3J 3KUGA 1F5AA 2V4RA 3HKWA 2KG0A 3P49B 3W8GA 4C3MA 4RUAA 2W9CB 1QE1A 1SL0A 3JSYA 2LVWA 2WAQD 3VVUA 2UUWA 3J81Y 4WJBA 2FHKA 4IOAQ 3M63A 2Q43A 4B3MF 1JOCA 3BSNA 1ZM4A 4C11A 5IWAJ 3O35A 1S7IA 4CQ1A 2XSFA 2VKRA 5IT4A 3LP2A 2R7WA 3CW2C 5KFYA 3HM9A 3EGWB 2XLKA 5BJRA 2WBMA 2BUNA 1NKEA 2HQIA 2J0QD 3N5FA 1U49A 3IG1A 4D3GA 2HHQA 5DDRC 1IBLJ 2HYED 4B3RJ 3HFVA 1LWFA 3KDNA 2KM8B 3CJ0A 3G82B 2K7KA 3OJSA 1S1WB 1B7FA 2CAJA 1G6BA 4TU7A 1VI7A 2OEMA 5E33A 2ZH4A 2WOMB 3FSXA 3ZZPA 2N4CA 2ATLA 3W8PA 4RBVA 3MM9A 3RB6A 3HVWA 2CQ1A 3IP0A 1U0HB 5KG1A 2Z2ZA 1UKUA 2XGQA 2G43A 4AXIA 1HQEA 1M5HA 3EZUA 1OY8A 3PX0A 5ETRA 2CT2A 2AIRB 2D8SA 3KLGB 3Q8UA 5AE1A 1GMUA 2VJFB 1NBEB 2G0JA 4F50A 2YNHA 2CJXB 3HHLA 2J5AA 1JQGA 2W7OA 1WF1A 3BSAA 3CJ5A 3N9QA 3B4MA 3DOMA 1S48A 2ZETC 4OGEA 1J5OA 1AFJA 4QCLA 2LXIA 3CCTA 3RGIA 2OKQA 1S6UA 3J7YU 3HK2A 5IV3A 4DSKA 4RO0A 5IWAF 4ICLB 4IQMA 3RR8A 1VOMA 1VLOA 2GMLA 4TY9A 2IAJB 5LKUA 1O6XA 1RTZA 3TA1A 1S1XA 1N87A 4QR2A 1IBMJ 3VGVA 2EGPA 3J7AN 3W2WB 1UEVA 2WVEA 2KL8A 3KYLA 4ED8A 4ED6A 4Y65A 1X60A 1IBLF 3OW2R 3PRBA 4KGZB 3M62A 3C19A 3IR6B 3F44A 2M3DA 1KHWA 3JSMB 3TUPA 1CG2A 3OQ2A 1B7YB 2RF2A 2MA5A 1RKIA 4OZLA 4A8MP 1WG4A 5B77A 3P3DA 4OYAA 2KJVA 3KK3A 4WFZA 4A4BA 1AT1B 2KT3A 1SC6A 2HIQA 2Z30B 4WXWA 3G87A 3NL0A 1VQ7S 5FB1A 4HT5A 5DLGA 4IYQA 1MU2A 2OPSB 3IBWA 5KFVA 3CC2S 1NDLA 5B0FA 1ACMB 4C7QA 2BQUA 3ZNIA 2MLYA 2ZH1A 5C24A 2V2ZA 3IWXA 2CPHA 4AP4A 2DGXA 1OO0B 4JYAJ 2GMHA 3BKUA 4EYIB 3I9ZA 2QLBB 4IG3A 3GR1A 1RHKB 5CABA 3QO9A 4Q44A 2UUBJ 3MDFA 4F36A 5GAEU 4CYUA 1RWMB 2PE8A 3VAMA 1CC8A 2CUYA 2JFKA 4F4KA 2XC9A 5KT6A 1RDRA 3FEZA 2KJWA 5BYSA 1X4DA 1WEYA 4DL4A 3KNVA 1IBMF 1R0AB 1X5OA 1ZPWX 4J9PA 5A2QU 5CYJA 5K20B 5H9FJ 4R8UA 3FFIA 2B9WA 3DHXA 5CYQA 3G6XA 3TP2A 2HS0A 2YT5A 2W01A 1H73A 1CULA 4WFNQ 2F1FA 1LNQA 2HLTA 2HZAA 1ZBTA 3IM8A 4PG4A 4B08A 3WC0A 1UVIA 1Y9OA 3GTYX 3M32B 1P27B 4EI2A 2Y8YA 3JAMU 4YR3A 1VQ8S 1URNA 3DLEA 3CT9A 4KKOA 2MTLA 5D3GB 3M6UA 5KT5A 3HVRA 2AYEA 3O70A 3JTPA 1FFWB 5KG4A 3OUYA 4FYXB 3M9MB 2PSZA 1VQMS 1IVZA 9RUBA 3RB0A 3L1ZB 3N0VA 2ECJA 4R2YA 3O8WA 3AA9A 2YX7A 2C3YA 1QJHA 5GMDA 1QSLA 4M63A 3K17A 3GJTB 4CO1A 2KI2A 2IFXA 4ED0A 1UFWA 4KC5A 4ILLA 5HLFB 4C8OA 2BE9B 1F62A 3W5XA 1RT6A 4ETXA 4X64J 4CO4A 2XBPA 3QRPA 1IR1A 2UUBF 3FUYA 2YW8A 2M0GB 2M7SA 4XO0A 2R7SA 3GSDA 1E6YB 4DX5A 3CNQP 4LJNA 1H2TZ 3GONA 3PM9A 3V81A 3NGRA 1U0SA 2IY5B 4L58A 2A6MA 1HI0P 4X4SA 4OHXA 1U1KA 1H7XA 3D9BA 1ZBDB 2F4VJ 4C8KA 3KLFA 2YKOA 3EZOA 1UETA 5KG2A 3FBFA 3D0IE 1KWMA 2CKLA 3ILOA 4JBCA 4QU7A 1RT4A 4J7CA 3OR2A 1PCAA 1RWWB 2CIMA 5KT3A 2IRYA 1U02A 2I2YA 3ZTGA 5K5MA 4FS1A 2QA4S 3CCQS 3UNYA 4OV1A 1XERA 2OIHA 1UJ6A 2VG7A 3OVSA 2ECNA 3CCWA 4ZCKA 3AQOA 3DOKA 2Y8WA 5BYQA 2JLFA 4B9MA 2YURA 5L9NA 5THWA 1VRTB 4C8ZA 4Y2CA 1FRIA 2LQBA 3MPUB 4YBSA 1WELA 4QYRA 2LEBA 4WZ3B 3KLIB 2MGZA 3GJRB 2V8VA 4OX7A 2VBZA 2YKPA 1Y11A 2MY8A 4QQBA 1X4AA 1GXLA 4X64F 3UDEA 2MZRA 2LA4A 5SUHA 2Q6CA 5HO4A 2MLXA 3T1HJ 3A12A 1Y3KA 1U2RA 2Z58B 1WI6A 2W9AA 2G45A 4TU9A 4BBYA 2XB2D 3V6JA 3OLBA 2VPYB 2XEUA 1NM2A 1X5PA 2RSQA 2LXPC 1FJCA 1NJYA 2LXHC 3EVOA 3CJ4A 4NRUA 1ITPA 4OLOA 2F4VF 3DN9A 4ZVPB 3MMCB 2YVRA 4DHVA 4UQTA 1NLKL 4YN3B 3U5NA 3KV5A 3MEDB 1RGVA 3R7SB 3PYGA 2FSAA 1X4GA 2COLA 2MA6A 3S8SA 3A8IA 1FESA 2KFZA 1GH8A 2HVHA 4ZVGA 5IV4A 5KG7A 2ZH5A 2OSRA 3VALA 4S3OC 4UOHA 3EZ5A 4DR1J 3KNAA 2JVOA 2ZZNA 2AEMA 3N6MA 5CD4A 1K1SA 4RW7A 3KJQB 3P96A 2AJFE 3HVAA 3ISNC 4A48A 3PCOB 2DY1A 2UZAA 3PHEA 1WSRA 2AGQA 2WVDA 3BGUA 1HWLA 3RBZA 4JI8F 2R8HA 4NXNJ 2CRRA 2V6AA 1OPIA 4CH1A 1FX4A 4NZ0A 3NY0A 3C6TB 2EFVA 4F04B 4TKPB 4NLTA 2PD1A 5LMUJ 4QIVA 5KH3A 1S6PB 4A46A 5SVYA 5HQMA 2R9LA 2QL9B 3T1HF 1U1PA 1Q4RA 2HRUA 4R5PB 3UN3A 3J7YI 2E5JA 1H3DA 4DUZJ 1R7IA 1IM6A 4LK9A 2YQ1A 5HVHA 1RT2A 3IRWP 3BGLA 3OV7A 3E01A 1YJ7A 1FNMA 2ASDA 4CA1A 1XJWB 3UR3C 2RHQB 1HPZA 5K3QA 4ZLJA 3PW7A 3CC4S 3IMQJ 1N32J 2EWHA 2EK6A 1JIHA 3DMJB 2C2NA 4HACB 2PN6A 2BRKA 4PRFA 1TVRB 4PR6A 3BDEA 3H90A 3I56S 1JLGB 1RE1B 4YDDB 2CFXA 3M2VB 5A8RA 1EIYB 3V4IA 2D9PA 1NSAA 4RW8B 4ZP6A 1FK9A 3WQPA 3O44A 4DI6A 1R43A 1LFWA 2GGPB 4DS4A 2GCFA 2E5LJ 4L72B 2K3KA 1KQFB 2G6QA 4N77A 1X5TA 3TUJC 1KQKA 3ET6A 1TK8A 1Z1ZA 2XMWA 1IYMA 4GO5X 1WG1A 4LVOP 2ADBA 4JV1A 4NXNF 2VD3A 2HBZB 3ZTSA 3W61A 5FB0A 5KFLA 1K2FA 3R27A 2VQFF 4QBUA 1X4IA 2DNYA 1RSCA 2CSVA 3I55S 1U6GB 5F9NA 1S10A 3EB5A 3G2XA 5AJ3J 2G1HA 3FQLA 4GMKA 3PUQA 2EFOA 3D4JA 2XWXA 5GAEI 1YI2S 3CCVS 3AHPA 2EKYA 2R7VA 1IKXB 5LSOA 3LP1B 2BKNA 3EPIA 1SQGA 4DUZF 1F5BA 4WFXA 5J2QA 1VQLS 4ECSA 2Z57B 5EYAF 2WVBA 1KD1T 3GFHA 4WE1B 3AB2B 3GSIA 2NYHA 3MR2A 4I6AA 5H9MA 2X1FA 1TL3B 3MHSA 1JLCA 4USJC 4DL7A 3M8QA 3GQCA 1KQGB 2FY8A 1N5QA 3H0PA 2HGLA 4ECQA 5F0UA 2C2ZB 4J9NA 4KR0B 2YXLA 1GEHA 2DRDA 3S1TA 2ECVA 4USHA 2MKJA 2IIHA 2BOAA 2CKWA 2Q1LA 4O3PA 2VG5B 4E98A 3C6UB 4AUQB 3A1YG 4I2QA 4G1QB 2H4WB 3H2LA 3W7BA 4LBIA 5KFMA 2A2DA 1HNIA 3AAWB 3MR3A 2JUNA 5IZHA 2H51B 2CRWA 2QTWA 4CLZA 2BANB 4RW6A 1JXLA 1VRQC 2B43A 3TOQA 3VHQA 5HROA 4NN2A 4LF9F 3SSSA 1SV5B 2MDAA 2M2BA 1AROP 3TANA 3NWRA 1N56A 2HGNA 3MCNA 1ZS6A 2OH2A 1G25A 4DR5J 2KT2A 2FLLA 4IR1A 2IRXA 2ROEA 1CQMA 4DV0J 3R97A 4X66J 1FJ7A 1SCJB 3T1YJ 2KU3A 4M5LA 2AW0A 2K16A 3CCLS 1CJVA 3WIUA 2MT5A 1FRKA 3OBIA 5K8MA 3CUNA 4WA6A 1DQ8A 5DG9A 2N7YA 2AGOA 1HW8A 3UR0A 4FJCA 3T9KA 4P2FA 5CH7B 4RW9A 1TKXB 4V19J 3E3XA 3K8WA 3CO0P 3H59A 4XI1A 5MLCV 3CCUS 3G6YA 3JSMA 3UDCA 3E8OA 1Q7LB 2H54B 2KFYA 1HR0J 4DN9A 5CA5A 3IC1A 2IJRA 4F1PA 3R8YA 5CCLA 2FJXA 2WVFA 1CQNA 3MPWA 2OELA 2HRYA 4ECWA 2NCKL 1YKWA 2W8LA 3LTOA 5D0EA 3W3SA 4ED7A 2MJNA 3LWMA 1S0VA 2Z8QA 2V67A 1L3SA 2CQPA 2QIZA 1FWLA 4N76A 3MM5A 1HW9A 1CJUB 3DU6A 4J9MA 1UWBB 4Z2XA 2FVCA 4IQXA 1NJZA 1DTTA 3C2PA 4O44B 2B0OE 2EK1A 4OJHA 3D7SB 3IAS9 1HA1A 1TL1B 4BC7A 5TBNA 4ZPWR 2ZBIA 2XS2A 3WX4A 2YU4A 4DR5F 5DGAA 3EM1A 3FANA 3H20A 5ETLA 3T1YF 2ZOGA 4ZPTR 2J9EA 2J8AA 1NZ8A 1PKUA 1RUSA 2W2OP 1JM7A 2ZBCA 2DNNA 2AF6A 4ZLLA 6AT1B 3TQ1A 2VUGA 1F1BB 3G6VA 5GMEA 2AYBA 2HZVA 4AL7A 2MKEA 2VJEB 1SBRA 1UCNA 3F41A 3CJTA 4I2PA 1H7WA 4H4OA 3MM8B 1N33J 1HMVA 1NH7A 1M5PC 4ELTA 2HHHF 4ECYA 2FVPA 5FIIA 4ECTA 3PZPA 2MKHA 2DNQA 3GZ7A 1CC7A 3BBBA 3UD3P 4O3OA 2NUHA 4CLKA 4DV1J 2DPJA 2XHWA 3BREA 5GVQA 2M70A 4LRCA 4LFCJ 3AA8A 3CD7A 3UI3A 2OPQB 4ZCIA 1X4HA 1LFPA 2I8EA 1NDKA 5FLXU 4ZCMA 4ID8A 3TVZA 2ZHOA 4DR7F 1RAHB 1S6QA 4EBDA 4BHQA 1U6ZA 3CJ2A 1I5OB 5HQLA 1XMOJ 2CJQA 3AODA 1FE4A 3BEGB 1DJ0A 1T0TV 4N7TA 2B7BB 1N5YB 4LSLA 3KG1A 2LQ8A 1JXEA 2DHHA 1C0TA 3GCXP 4DSIA 3K5MA 3D5MA 2XEXA 4NEYA 4ZPVR 2A3JA 4PXCA 4KO0A 1N0UA 2YQLA 4ZHRA 2ASJA 2G2ZA 2JWNA 4DV5J 3M8YA 2EGMA 3N9LA 5KOXA 5J1PA 4HLBA 4J9LA 1E6YA 4YATA 1JJHA 3M7VA 2QMXA 1TMJA 4AE5A 3M2UA 2OGUA 4LF4J 1K44A 1SB6A 1Q5YA 1NK4A 1HYSA 3MM7B 4OYMA 1VQNS 2BX6A 2CSYA 3J7A1 2JRJA 1UAWA 1WIMA 2B4OA 2RT3A 5B76A 4NI2B 3FL2A 3SIPB 1R89A 2IDEA 2F6JA 2EFQA 1N33F 2FB0A 2RDJA 2IPOB 1UJ4A 2DPIA 4E0DA 2DRAA 4OHVA 3MUMP 5T41A 2XP0A 1ULRA 2UP1A 1LWXA 4IH7A 4KV8A 2FIUA 3VR1A 3FC9A 2CQ2A 3QT7A 2KXHA 1SJ3P 5KFGA 2QRRA 2VPDA 3HSGA 3LWLA 4K4ZA 1XMOF 1H2VZ 1JNRB 1PJ5A 4QW8A 1G1XA 4CNYA 4HKQA 3UD4P 1VQ6S 2PO4A 2CJAA 3IA0A 2MHEA 3QJLA 2RB7A 3B4DA 2L9WA 5DLFA 1VK8A 2WSCC 3J80Y 2Y0BB 3CMES 2LGGA 4C3LA 4KTQA 3AH6A 3KJVA 3WDOA 2V4JB 3GIMA 1KEKA 4OYBA 4WTOB 4DV5F 3NG2A 5KFBA 2IVFB 2OO4A 4DV4J 3IAM9 2H0DA 4CTAB 3M2RB 4CLTA 3T3FA 2IA0A 2QGFB 4DQSA 2P57A 1Q7YT 4X4QA 4H4KC 2IHR1 4LF4F 4L6V3 4JI0J 3ZTOA 2MHNA 3KFWX 4KAIA 1ICEB 3MMCA 3MMAB 1VHIA 2DGWA 3DRRA 3RBDA 2C1EB 3KDOA 4KBIA 1TKDA 2UU9J 2ZH8A 2KXFA 3CC7S 5C2GA 5KFQA 2K1RA 3MAAB 2G2YA 3DLHA 4DR6J 3LPEA 3PACA 3BGRA 5KFTA 3OXLA 3GYGA 2AJ0A 2W9BA 3PYFA 4IOCQ 5SVXA 1ZTWA 2CA9A 3SBMA 2K7JA 3OTBA 2RD5C 1A7GE 3IGVA 2RRAA 2H65B 2VB6A 3N28A 2FJDB 1T05B 1RT5B 5DINA 1YITS 1R0CB 2YQ3A 1BQXA 2MEWA 2A2CA 4IFYA 3K0JA 4G1IA 2NZ4A 5JVGQ 3LGNA 1SJ4P 1MN7A 2WW4A 4I0WA 1REVB 2H48B 3PR4A 3TAMA 2XGPA 4V3LC 2KRRA 3EVMA 4B7YC 2AYGA 1WWHA 4P10A 4C97A 3LQHA 3I32A 1T03A 3LRQA 3SI8A 4GRSA 1N0VC 3QGIA 1VBZA 3QJJA 3CDBA 3SFGA 1MNEA 2QN6B 3KJNB 1KBRA 1WHYA 4PG6A 2ZBRA 2XSJB 1W2IA 1APSA 4N8NA 5C2CA 1N5TA 1VQOS 3NKYA 1D3WA 2HW3A 1RWUA 3QZVA 3NGTA 3C16A 5CZVA 3M30A 4JI0F 2XNQA 3US5A 2A6OA 3JQKA 4DSFA 4RW4A 1JLBB 3WX8A 1NU4A 5C42B 2GFFA 2NXCA 4YP3A 4IFVA 3NP5A 3KLEA 1I1GA 3FQKA 2UU9F 1F6TA 3CCJS 4Q45A 2ECWA 4EBCA 2BEFA 3OVBA 4J90A 1S72S 3CJ8A 1VQPS 4LT6A 4IO9Q 3QIPA 3DMJA 3NCQA 4I64A 3E2DA 3MF5A 4DG1A 3SOXA 4DDFA 1YLXA 1HWJA 2CPIA 2V94A 3M2VA 2QG9B 3AT1B 2QEXS 5A8WB 3MEGB 3K8VA 2R7OA 2GJIA 1URRA 5B75A 1RTIB 3FZBA 3BYPA 4C8MA 1MMLA 1AUDA 3PG9A 4Z37A 4ZUXU 2DNZA 4DV7F 1E6VA 1KLNA 2XOYA 1RZMA 5HMYA 4OYIA 3AOCA 5G04B 4RWWA 1WE9A 3HT0A 1YVFA 5HJXA 2KZMA 4WIIA 4HH0A 3ITHA 4PQUB 3KKFA 4CLWA 3QJPA 4YB7A 2W8KA 4H4MA 2V8DA 1HARA 3TARA 3FCWA 1EETA 1V3RA 5C13A 3LP1A 1BQNA 3I5AA 1BGXT 2FZKB 3H5UA 2JEJA 3QQCD 1X4CA 2JFDA 1S9EB 4NLDA 5KFEA 1FJEB 3H40A 5J2PB 4RUHA 4LJMA 3I31A 3QZ8A 2EBGA 5KG6A 2LA6A 5IT9U 2KGGA 4WFBQ 2UV8A 2FVQA 2BVZA 4KY3A 3FCVA 4EO6A 1TAQA 3ISND 4Y2MA 4M5MA 3I96A 4NE9C 5HI7A 4UW2A 2J6UA 2KRBA 4CT9A 4LR7A 4FKXA 2WK4A 1YRUA 1RCOB 3HFZB 1RTHA 4JI7J 3I6PA 5J1EA 4C48A 4I7CA 4YAXA 5KAKA 2VG5A 1VMBA 2E5IA 5IT0A 1U1QA 4A4CA 4MFBA 3H7HB 2G0CA 1RWKB 3JXOA 2XMMA 2CDRB 1SL1A 4DPWA 4EMDA 3AOAA 2NR0A 5M2RA 3HVTB 4Y6IA 4MK9A 4L74A 2WONA 1HHSA 4KH1B 2YY3A 1TKZB 4AFFA 1U26A 1HNVA 2YNGA 5K8OA 4UY85 3D67A 4BLGA 4HDHA 2R3VA 4A8YA 1NUEA 4IRDA 1LWEA 4RNHA 1KHVA 3AXKA 1QAXA 4TN2A 2HHPA 3BZQA 2AD9A 5J3XA 4YB5A 2YNFA 1LWCA 3K58A 3OTCA 3EGNA 1KS2A 1VLYA 2QYGA 2UV8G 1RWPB 3J7Z5 3JQJA 1D9DA 3SDEB 1SC4B 3IRXB 1S9FA 4Y00A 5IM0B 3BPSP 5EX0A 1X0FA 1Z2ZA 2HEKA 1NJXA 1RTDA 4DR3J 3KLHB 1V5VA 1EHWA 5LSRA 4U9RA 5DDQC 2RDIA 5EDWA 3U02A 3UDLA 3U7JA 4HHHA 2DISA 3N5BA 1SKRA 3QIDA 3BDPA 2OTLS 3MCSA 2DHXA 4BWJA 3AD7C 2BM0A 2EG1A 5F9LA 1TU0B 4QWBA 1K0VA 1IKVB 2QFJA 4LFBJ 1UVNA 4FYVB 2LGKA 4EEYA 3FM8C 5DM7Q 2H5IB 1S1VA 1HBMA 2YTCA 5B7WA 4CI0B 4DZDA 2KWKA 4HI2A 4KGVB 2E6RA 2F8EX 4DUYJ 4RUBA 1FX2A 1Q78A 2M13A 1LOUA 2HK2A 2GMJA 3IBCB 3G86A 2NSBA 1NK8A 2RI7A 3MM6B 4Y0FA 4USVA 4ZDTA 4KHMA 1ZM9A 3NGDA 4IOBA 4AT1B 2DHAA 2HG4A 2W2PP 2UUAJ 1FD8A 1OSCA 5JXSA 3C6WA 5GADU 2ZITA 2RS2A 4I68A 2E9ZA 1FBVA 2VICA 3DLKB 3K5NA 2CQCA 4WYLA 1QTNB 2ATCB 1N5VA 3PHDA 4UF4A 4DU7A 5H1SV 4Y2IA 2JSXA 1MWZA 2J7UA 2B5JB 2XOZA 1LW0A 3R5GA 4DR3F 4CH0S 2V2KA 4DQIA 3TW0A 4F02A 3RJMB 2VJEA 2L08A 1K1QA 1FEEA 3T6JA 1M1HA 3P5BP 4O23A 5L8RC 4OZ1A 1IXKA 3RBEA 1N36F 1M90T 2W4PA 4KGXB 1VQYA 4U6PA 4F52B 2BACA 1F9HA 4LFBF 1S0NA 4X2BA 2OPRB 1OPZA 2RHSB 3RAXA 1WFKA 1MROA 3MFHA 3CTRA 4NA2A 2D3O1 4A47A 5KFUA 4LF5F 1Q79A 1NJWA 3WC2A 3N9NA 2D9OA 2RUGA 4PXDA 2VC1A 4USKA 2ACMA 4QIGA 3PYDA 1KTQA 5ITHA 2CZ9A 4QF2A 3LVRE 4E8UA 1Y0HA 2HHUA 3VZHA 3B82A 3AJ1A 3HKZD 3N4WA 1Q8IA 3M9OB 2ZWOA 4JI2J 4EBEA 2B0GA 1HD1A 2RILA 3FAOA 5LM7E 4F67A 4OI2A 1ZETA 2E9TA 1FKPA 4M5NA 4M5DA 2F9DA 2MQQA 4J9VA 2WB1D 1B0PA 2WSFC 3U5MA 3X3UA 5T7LB 2IQJA 3GIKA 4NLRA 2C2OB 3U1MA 2HFOA 4FN5A 5DM6Q 1PC4A 1NB7A 1HKAA 1R3NA 5ETPA 1AZSB 2W4CA 3G8TA 2HFNA 3R7BB 5A8KA 2LXFA 3DI6B 4U8VA 2XMTA 4IG0B 2LDYA 1C1BA 3MCOA 3CJKB 1UVMA 3SV4A 1RYSA 4LSNA 5K9FA 3RAQA 4LADB 4F4WA 5E3PA 3S7RA 3D6MB 1QUPA 2NQPA 5A0YB 2OLWA 2LU2A 2XMJA 2CQ3A 1O8BA 5H9FK 3LQVA 2HFUA 5LOQA 3BH6B 3RZAA 1WACA 1B64A 4DR4J 2J76E 2F8HA 3M8WA 3W5ZA 3BSOA 2IDAA 3WHIA 4OL8A 2RAQA 4ERDA 2HSEB 1N52B 2U1AA 4GC6A 1HBOA 1TK0A 4GB0A 5ETQA 1WEUA 4ECZA 5D0HA 1RHMB 2DGSA 1XN9A 3PNIA 4JI2F 1OY6A 1S1TB 1FKOA 3KTQA 3Q1DA 2K2PA 1IR0A 3LO3A 2AU0A 1T9TA 1YSJA 1HBUB 2VODA 4CTAA 1FRJA 3HT3A 2JL9A 2YNIB 4C2MA 4FDFA 4X62J 2LDIA 5F8IA 2K17A 4IUFA 1WENA 3MI7X 4ZDNA 3SZ2A 2J9DA 2AZ3A 3MMAA 1GX6A 2HQFA 3I5BA 2HVIA 4DFPA 1QVGR 4Y34A 2ZZTA 1YG0A 1X4JA 3MEEA 4OYOA 4MKAA 1ZPVA 2NPIA 2O66A 3KWMA 1S76D 4URSA 5K8PA 3Q2SC 4LBPA 3FVYA 1YBAA 5DQGA 5KH9A 3D66A 2FVSA 1S1UB 2DCUB 2AKWB 2IMOA 2KU7A 5IS2A 2HZCA 2HHSA 3THTA 3M1VB 3SQOP 2KO1A 1AXQA 3HF5A 5ETSA 5SVIA 3FGVA 1S77D 1D8YA 2FUUA
chains in the Genus database with same CATH topology
4QQ4A 2OUGA 3QQCD 3Q1DA 2M13A 2EXUA 3E2DA 1DCQA 5K3QA 2KKXA 3DWDA 2E61A 3H7HA 4H9DA 4Z0RA 3KDEC 1NPPA 3PLWA 3JUEA 4OGEA 2YREA 5SVIB 2FFWA 2L7PA 2LAUA 2CRRA 4OGCA 3EWGA 2P57A 3LVQE 3FEHA 2B0OE 2JM3A 3MDBC 2D8UA 3LVRE 4O62A 2XP0A 2RR4A 2MKEA 3DDTA 2DJAA 3O47A 3H7HB 1M1GA 4Z0OA 2XOYA 3T9KA 2OWAA 2FD4A 2K06A 5SVYA 2XOZA 4ZN1A 2LQ8A 2YVRA 2XHCA 1NZ8A 3LJUX 2XOCA 3FM8C 3LPEA 2CONA 2CSVA 1NPRA 3FJUB 2JUNA 1M1HA 3M7KA 2KKYA 5SVIA 4ZN3A 3SUBA 2CRWA 2EGMA 3P8BB 5SVXA 2IQJA 4F1PA 3LDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NZ8 A;  3H7H A;  2K06 A;  3QQC D;  4ZN3 A;  1M1G A;  4ZN1 A;  2LQ8 A;  1NPR A;  3LPE A;  3P8B B;  1NPP A;  3H7H B;  1M1H A;  2OUG A;  2EXU A;  2XHC A;  3EWG A; 
#chains in the Genus database with same CATH topology
 2O67 A;  1YTY A;  5H1U A;  4ATN A;  4RNN A;  1PIE A;  3M8Z A;  2FJE B;  5D0G A;  3M6V A;  3CIM A;  4NLV A;  3I2D A;  2AN6 A;  1TR0 A;  1XR6 A;  4DL3 A;  3LPY A;  4B3O A;  4MSX A;  5CYM B;  4LRD A;  1XWH A;  2A1B A;  3NRB A;  3M6W A;  2XY7 A;  5LL6 d;  2HMI A;  3KK1 B;  1DQA A;  1Y4Z B;  3W2V B;  1LDJ B;  2PMW A;  1U25 A;  2H9Z A;  3O5T B;  5D0R A;  4WPA A;  3CED A;  2GVD A;  3MHH A;  4XDC A;  2FLO A;  3W65 A;  5I42 B;  2MZJ A;  5B78 A;  4G3I A;  5C42 A;  5FDL B;  2F7V A;  2L5U A;  3I4P A;  5EGY A;  1WC5 A;  3OLA A;  3LOU A;  3HHN B;  5I3Q A;  1Y10 A;  1RQ0 A;  3O1L A;  2EVZ A;  3HO1 A;  2YVS A;  3PFO A;  3QSY B;  4TQS A;  2CQ0 A;  3M05 A;  1B70 B;  2N3O A;  4PXE A;  1DBD A;  4K2X A;  2Y1N A;  1OWX A;  2F65 A;  3W9I A;  4K7Q A;  2XYH B;  3U5P A;  1RTI A;  2ZD1 A;  3VGU A;  5B0E A;  3KMS A;  3R7N B;  2UVU A;  4I7F B;  3NWG A;  3IR5 B;  5A6P A;  3D68 A;  3CJR A;  1T8E A;  2DD8 S;  1VS3 A;  3THV A;  1L5U A;  4ZMM A;  4AYC B;  5E3R A;  4DEZ A;  4F2R A;  2DO4 A;  5LJ3 Y;  2Y43 A;  2IVY A;  1K8A T;  7FDR A;  4OI0 A;  2DH7 A;  1P6T A;  3D2W A;  2ECI A;  3MOJ B;  5M2P A;  4PQU A;  1AYE A;  4QIW D;  5F8H A;  2VQE J;  3UPF A;  2BZ2 A;  1UPM B;  2XHC A;  1UEU A;  5GAD I;  3ZZY A;  3U1N A;  3BQ2 A;  4J9Q A;  1IJF B;  4OI3 A;  3QLH A;  1YDL A;  1XBW A;  3M8R A;  1R31 A;  3UD5 A;  4LQ9 A;  1K73 T;  4XIU A;  3PJW A;  2E1C A;  3IFE A;  1WOR A;  2V69 A;  3EUN A;  1U47 A;  4C6A A;  1MMN A;  4K4V A;  3MEK A;  2RUS A;  4HT7 A;  3G6E S;  2KZZ A;  2GQC A;  2IBK A;  1TV6 B;  2HK3 A;  3KXD A;  3SYZ A;  1FXR A;  4O4G A;  4ED2 A;  1DLO A;  4YAB A;  3ELH A;  1EJ7 L;  2HVE A;  3JS9 A;  4NML A;  1IKW A;  2EPI A;  4M5I A;  2ZM6 J;  1N8R T;  2WCX A;  3SCI E;  2HFS A;  4NEZ A;  4F3O A;  3OTO J;  1BQM A;  1DAR A;  1NZA A;  4MVT A;  3FRY A;  4O3S A;  2XUL A;  4F0K A;  4TY8 B;  2W7A A;  1EP4 A;  3IS9 A;  1GXU A;  5LXR A;  2XYP B;  1K9M T;  1TL7 A;  2FTR A;  2RRN A;  2KTQ A;  2LKZ A;  1KKH A;  3HCU A;  7AT1 B;  4DN0 A;  4QF3 A;  3UCU P;  1VQ4 S;  1NK5 A;  1TKZ A;  2A10 A;  1RT7 B;  3QGP A;  4FKY A;  4A49 A;  3TZY A;  3K7R A;  2C3U A;  1JLE B;  2J6T A;  4QWC A;  1HWI A;  3R5A A;  5KFC A;  5D1K B;  1PJ7 A;  5E3A A;  4OHZ A;  3FKB A;  1PG5 B;  2J7K A;  3B6B A;  2VQE F;  4ZVQ B;  1VC5 A;  1Q8L A;  5C25 A;  3NBP B;  3BSC A;  4RLE A;  1JLA B;  1GMW A;  3MMJ A;  1CJK A;  2HWT A;  4JI5 J;  1H0H B;  3DRS A;  2IDL A;  1RAA B;  1Q16 B;  2E9R X;  2J9D E;  4IRK A;  2JZ5 A;  2DIT A;  5LCW B;  4LRF A;  2BJD A;  4LIR A;  1SJQ A;  3CO9 A;  2BOP A;  2V0N A;  2Z2L A;  4PWD B;  2XMK A;  2EFN A;  2ZE2 A;  2MKY A;  2KVQ E;  3D6H B;  1PYT A;  1TMM A;  3NG8 A;  1H6K X;  2MMY A;  1DTQ A;  4IDK B;  3Q86 A;  2ZM6 F;  1E4U A;  5GAH U;  4YBM A;  2OEJ A;  3OTO F;  4JP8 A;  3JYT B;  2HFZ A;  2IC3 A;  2JMD A;  3QNW B;  4L75 A;  2FD2 A;  3FEY B;  1IBK F;  3GV8 B;  2B4P A;  5CZX A;  3M99 A;  4X4N A;  4PEO A;  3TYT A;  3RAM A;  3TAQ A;  1P1T A;  2CG8 A;  3BR8 A;  1WDD A;  3GB0 A;  2BJ3 A;  4Q0B B;  4NOH A;  3GCW P;  3OFG A;  1NXI A;  3M4X A;  4JI6 F;  4BS2 A;  2G1D A;  3I0S B;  4BBQ A;  3ZNU A;  1ZYQ A;  2W25 A;  2KB2 A;  2LN0 A;  2PA3 A;  4K0K F;  3UFC X;  3KHG A;  8ATC B;  2YX1 A;  1XNR F;  3J81 U;  4USU A;  1MW7 A;  2XI3 A;  2A0F B;  4JV5 J;  4C0O C;  2DH8 A;  4MTP A;  3H4B A;  3D1Q A;  2PI4 A;  3K59 A;  4NWB A;  2C2K B;  1RWV B;  3KMQ A;  3GYX B;  1QTM A;  1IJE B;  2V4Q A;  1TFW A;  3MMB A;  3C15 B;  4ZCL A;  3RUB L;  5K14 A;  3GYN A;  1YJV A;  3A13 A;  2Q79 A;  4RX6 A;  2L80 A;  3DLG B;  2DX8 A;  2JEF A;  2VOP A;  2MJU A;  4USI A;  4QOT A;  2FHM A;  4QU6 A;  2BW2 A;  4J5O A;  5I3L A;  4B02 A;  4PUO B;  4Z7Y A;  1V87 A;  3T5H A;  2MZQ A;  4FYD A;  4P71 A;  5KFO A;  2I50 A;  5DDP C;  2MSS A;  4LFA J;  2UXB J;  2LP4 A;  1KLM B;  2FDN A;  1JKH B;  4M5K A;  1WG5 A;  2CPE A;  2YQ0 A;  2I6W A;  1BWV A;  2HPU A;  3C66 A;  1NSP A;  2XMV A;  3Q2T C;  4DF4 A;  3CB4 A;  2VG6 A;  4AQY F;  2JVR A;  2CJK A;  3LGM A;  4P5O B;  1XMQ F;  3OR1 A;  4YR0 A;  2Y1L B;  1VK3 A;  2PUY A;  2OPP B;  1M1K T;  2W7P A;  1I94 J;  4J9K A;  4LRB A;  3ILI A;  5HMX A;  1BOR A;  2I5J A;  4FPR A;  2DTJ A;  4F0H A;  2LDR A;  4YQW A;  1GQE A;  2YQM A;  3PTW A;  3UVJ B;  4WU2 A;  4EK2 A;  4DV2 F;  2X7I A;  2WTF A;  3C8Y A;  2R2T A;  4GVB A;  4ZLP A;  1TKT A;  5KFR A;  2ZJQ Q;  3PW0 A;  4FF3 A;  2Q66 A;  3C14 B;  4GO7 X;  5KOW A;  3VF0 B;  3G71 S;  4B3T J;  2MUM A;  1RBO B;  2DNG A;  3ZFV A;  4OZJ A;  4WF9 Q;  4FK5 A;  2DHG A;  4JI3 J;  4DQQ A;  2Q6B A;  4G1P A;  1VYA A;  2NXU A;  5HN0 A;  3K57 A;  3Q24 A;  4DV3 F;  1JLF A;  1RTJ B;  2FYX A;  3BJY A;  2ZH2 A;  5TDW A;  5E5N A;  1VQK S;  4YY3 J;  2ZVS A;  3W1Y C;  4NAS A;  1RWN B;  1SXL A;  2FHJ A;  4ID5 B;  4M5J A;  4XPC A;  1GAO A;  2UXB F;  1CHC A;  2KVI A;  1L3V A;  1K0T A;  5A0Y A;  1FRH A;  2RQM A;  4H4K A;  3ZZ0 A;  2DGO A;  1SH3 A;  3HHE A;  2UXC J;  2QIC A;  4MYU A;  2P9E A;  2B6A A;  2MQO A;  3SHB A;  1C0U A;  2F3J A;  2EEY A;  3V6D B;  1VRU A;  4B3R F;  3UWT A;  4PZV A;  5E41 A;  2BMB A;  5J2M A;  2ZH9 A;  1JLQ B;  5KFF A;  2LGL A;  1I94 F;  3N79 A;  1DZ5 A;  3TJ9 A;  5E3C A;  1XQI A;  3J81 j;  3CCS S;  3EJM A;  2OJ3 A;  2OFH X;  2ZOM A;  3QAU A;  3O7A A;  1YJR A;  5CHC B;  2CZV C;  1EZZ B;  2FPH X;  2KYU A;  3SSR A;  2HWI A;  3VAK A;  3HSD A;  3CWJ A;  3B8H A;  1PIL A;  2YNI A;  4OJ3 A;  4LKA A;  4WYW A;  5DGB A;  1ZZN A;  1RT1 A;  1UA0 A;  3A8K A;  4USW A;  5L46 A;  4B3T F;  1ZM2 A;  3EPG A;  1N6Q A;  5F3Z A;  2CJB A;  4JI3 F;  4IR9 A;  1B0T A;  3KDE C;  5AT1 B;  2YHN A;  3A4T A;  4ZS6 A;  2MQP A;  5E3Q A;  2BM1 A;  5LMN J;  4KFB A;  4ZVR B;  4OZ0 A;  1QE1 B;  2QMU B;  4UUX A;  6FDR A;  4OGC A;  3KK2 A;  3OD2 A;  4YY3 F;  4U96 A;  3EGZ A;  5G0R A;  2ZNY A;  1RA6 A;  2HND A;  2DJA A;  4C11 B;  3BF4 A;  2U2F A;  3HSJ A;  3OPK A;  4Y2K A;  2ROG A;  3T19 A;  4ZK7 M;  1RAG B;  3LP2 B;  5G0F A;  2ERR A;  2AEF A;  2B4U A;  2JC1 A;  4KRW A;  1YIJ S;  5IC6 B;  1UFL A;  4WP3 A;  3IG1 B;  2P2C B;  3AB4 B;  1MSW D;  1X7V A;  2Z2Y B;  4PG5 A;  3T5L A;  3BBC A;  1QLN A;  4HH1 A;  5H9E K;  1LWF B;  1F60 B;  4C0H A;  3F56 A;  5ETT A;  1JJC B;  3GFY A;  3NNH A;  5CYM A;  4U67 Q;  2MKC A;  4ITS A;  4AL5 A;  4OQJ A;  3R5C A;  1N4L A;  1UPP A;  3SQG A;  3TWZ A;  4CLP A;  1F3F A;  2VJV A;  2IBO A;  3MM9 B;  2OD6 A;  4ZPC A;  3WZ0 A;  1XR5 A;  1LW2 B;  1NHV A;  4RNF A;  1TAU A;  1HQE B;  4LF6 J;  2MKI A;  1RA7 A;  2QX0 A;  3OFH A;  2PDA A;  3PY8 A;  1SUQ B;  1F2G A;  1VBX A;  1JNZ B;  2OI2 A;  3FCH A;  3L4B C;  2Q3P A;  1T95 A;  3ZZO A;  1HD0 A;  1GTE A;  3HD1 A;  4B9S A;  4JYA F;  2YNH B;  3EXY A;  2SXL A;  2OD4 A;  3HHL B;  5LMN F;  3H5Y A;  1F5C A;  2ZUG A;  2EFG A;  3DOM B;  2MB0 B;  1J5O B;  1DFD A;  4P2S A;  1PAE X;  3K5O A;  3GJS B;  5C11 A;  1TZ0 A;  4J37 A;  4F25 A;  2YH0 A;  3MTK A;  3VVT A;  3ETO A;  5GAH I;  2F42 A;  4I6Y A;  1X5S A;  4P2M A;  3SFU A;  2L43 A;  2G2O A;  2BE2 B;  3FEX B;  4ZVS B;  3HJF A;  2DEI A;  1U1N A;  2XZW A;  2Y1J A;  1KFS A;  5F8J A;  1S1X B;  1F2H A;  3LP0 A;  1U09 A;  1QAY A;  1FVQ A;  3ENA A;  4RU2 A;  1SKS A;  2MZT A;  1ROF A;  2ASY A;  2B51 A;  2JHE A;  2DT9 A;  1ZZF A;  1HNX J;  2JJ4 D;  4EFA C;  4HR2 A;  3HI9 A;  2HYI B;  3QAE A;  2F6N A;  4X65 J;  3D0G E;  1IM4 A;  3QSI A;  2G4B A;  2DIV A;  2RF2 B;  2L0B A;  2E29 A;  1VQ9 S;  4MKY A;  3KK3 B;  4WKY A;  2KWJ A;  5FD1 A;  1HBN A;  2ZH7 A;  4ZPA A;  5J2N A;  4E2F B;  1GNK A;  4BDP A;  4NCG B;  1H72 C;  1CSJ A;  1BLU A;  3L7O A;  4B9T A;  3M8P A;  4C98 A;  1MU2 B;  3GV4 A;  1V6H A;  3ENQ A;  1ZAX A;  2WVC A;  3R6L B;  4ZIV A;  3TX0 A;  1KQS R;  1RAO A;  4ZVE A;  4DMZ A;  1SL2 A;  1R8H A;  1KR4 A;  4ECU A;  2QL5 B;  2B3T B;  3KLV A;  2QO3 A;  4UZB A;  4ZVU B;  1LXN A;  2AYM A;  2I9S A;  2RQK A;  2H5E A;  3MEC A;  4A4J A;  1C1C A;  1LK5 A;  2QSF A;  4IG3 B;  4QW9 A;  3QO9 B;  3CMQ A;  2D3Z A;  5HP1 A;  4I67 A;  4JI1 J;  1S7H A;  4DJB A;  2YSJ A;  4CYU B;  3SSQ A;  5F8G A;  4PG7 A;  3KUH A;  3MAQ A;  4FVC A;  3D3C J;  2VP7 A;  4GKK J;  3MD1 A;  4U7U K;  5RUB A;  1GMV A;  3VK6 A;  2N3L A;  2NZC A;  3DGP A;  4KGM A;  1TUG B;  4DQP A;  2CJ9 A;  1TL4 A;  1PBA A;  1RKJ A;  2G0I A;  4R8U B;  1WEO A;  3FFI B;  5DG8 A;  5CYQ B;  1FP0 A;  4CT8 A;  4KQZ A;  1JLE A;  3LQJ A;  3VZI A;  1CUL B;  4A8X A;  2OWA A;  3VQS A;  3HCX A;  2CNL B;  3CXC R;  4Z7C A;  4X65 F;  1WF0 A;  2AX0 A;  2VKZ G;  5KFS A;  4OX9 J;  1HYJ A;  1XIQ A;  3POT A;  1B3T A;  4PPZ A;  1UL3 A;  2YWF A;  4ZQL A;  4CCG X;  2ECG A;  3DLE B;  2LQ6 A;  4KKO B;  3QPI A;  2QFI A;  3CIZ A;  5F0W A;  2UXD J;  1W7W A;  4FXD A;  2C2V S;  1AB8 A;  4OJ1 A;  1A9N B;  4RL1 A;  4C8L A;  1UWA A;  3OUY B;  2V9W A;  1FT8 A;  4S0M A;  3SEO A;  4QIE A;  2ILY A;  3OT9 A;  3SCK E;  1KVJ A;  2QLJ B;  4CDI A;  4U95 A;  2YKN A;  4U8Y A;  5AIT A;  3N9U C;  3G8Q A;  3OL6 A;  2YKM A;  3FK4 A;  1RT6 B;  2HNY B;  4IDK A;  4JI1 F;  2ZDO A;  4LF2 A;  3TR5 A;  4NCA A;  2HNZ A;  2F63 A;  2XMU A;  4PG8 A;  3RPG C;  1TUV A;  3RW6 A;  3I0R A;  1CS4 A;  1FXL A;  4QYZ J;  3GU0 A;  4X84 A;  3HHL D;  3V81 B;  2UZG A;  4ZPB A;  1FVS A;  2YBV A;  4DL6 A;  3HSZ A;  1WEW A;  1FTC A;  3KLF B;  3M8S A;  4CO2 A;  1XC9 A;  2AJQ A;  2QYC A;  2RH3 A;  3JQM A;  2CKL B;  2VHG A;  4DR2 J;  1RT4 B;  3OR2 B;  5B0G A;  4NZ6 A;  5EN1 A;  4EZ6 A;  1C4A A;  2J8S A;  4F4A A;  1IWG A;  2KHC A;  1HNW J;  4ANC A;  1VHF A;  4O64 A;  4HI1 A;  4WIQ A;  2M1R A;  3RRG A;  1HI1 A;  5I3U A;  4NL5 A;  4I69 A;  3RTV A;  5ETM A;  3SOW A;  4DR1 F;  4LF7 J;  3CSK A;  3OJU A;  2VG7 B;  4DX6 A;  3IWL A;  2BJ9 A;  4GNE A;  5DET A;  3CVK A;  2LEC A;  1CJT A;  2ZZM A;  4JOU A;  3PW2 A;  4LRE A;  1Q81 T;  3W63 A;  1HL6 A;  2GA7 A;  2UVW A;  3PW4 A;  1WEQ A;  3TO8 A;  2LV9 A;  3DOK B;  3LVQ E;  5DQH A;  4ZLN A;  2CRL A;  3ENW A;  4PTB A;  3G9C A;  2W9C A;  3W60 A;  3PJX A;  4JI4 J;  3FDS A;  1KN6 A;  2KGI A;  2NLW A;  2LEA A;  2MGZ B;  2FJV A;  5LMU F;  4ZVF A;  2ZNZ A;  1WOO A;  2E6S A;  5DDO C;  3PW5 A;  4TLQ A;  3HHK A;  3FJ2 A;  3G8S A;  4DWI A;  2LEP A;  3U27 A;  5CAA A;  2CPD A;  4ZVO B;  3KJF B;  2XZT B;  1WHX A;  1JKH A;  2YX4 A;  3QRQ A;  3RU0 A;  2MQ8 A;  4ES2 A;  2VPE A;  3UN5 A;  4Y3C A;  1QAJ A;  2ZH6 A;  3MCM A;  4J9S A;  2BJ8 A;  4NLW A;  4YME A;  4IH5 A;  1SH2 A;  4N5S A;  3BN7 A;  1KVI A;  2BAY A;  3G82 A;  2XG8 A;  1S1W A;  4RPF A;  6FD1 A;  3PIO Q;  5IOL A;  1N32 F;  1HNZ J;  3T7L A;  1LK7 A;  4QJV A;  1KTV A;  3A8E A;  5SZT A;  4JV2 A;  2V8H A;  2Z0G A;  2ZJR Q;  1Q8K A;  1Q8B A;  1HNW F;  2WOM A;  5AXN A;  2JLG A;  4P52 A;  1RCX B;  1U0H A;  3BV8 A;  4C9Z A;  3QGH A;  3I4H X;  2UVR A;  3DXS X;  1VIX A;  2RR4 A;  3V6H A;  5JUM A;  5KFK A;  2E5L F;  4RW7 B;  2MNZ A;  1ZM3 A;  3N9P A;  3Q0A A;  3KLG A;  5HQ8 A;  4ELU A;  1Y5N B;  2LQ9 A;  2P9C A;  2VJF A;  2L48 A;  2HS4 A;  2GHV C;  2VFT A;  4UZC A;  1RTJ A;  4WZQ A;  1CEZ A;  2GNK A;  3NOG A;  4CNZ A;  2X3D A;  4JI4 F;  1XNQ J;  2CAD A;  5AJ3 F;  5LT5 A;  4ID5 A;  2R7R A;  3QWP A;  4ICL A;  3D1O A;  3MHY A;  2YKA A;  2C3P A;  2IAJ A;  1V5I B;  4DCJ B;  4CO3 A;  3BS9 A;  4F0M A;  3W2W A;  3GLJ A;  1RB0 A;  1VR6 A;  2ZHB A;  1RT2 B;  2CPF A;  2X1G A;  3O6Q A;  2YWK A;  3C5K A;  3KV6 A;  2CWK A;  1WHV A;  3DXB A;  3E01 B;  4AND A;  3FEH A;  2BJE A;  1RLC L;  3V6D A;  3NLC A;  4FF2 A;  3PV8 A;  3CDU A;  1Q95 G;  1HPZ B;  1RP5 A;  2LQ5 A;  2CPY A;  1Y00 A;  2QC3 A;  4Z0O A;  1YBU A;  1UZD A;  2WSE C;  4CLU A;  1TP7 A;  2L9N A;  4DXL A;  1JX4 A;  3Q89 A;  4B9U A;  4RBT A;  5A8R B;  3KHR A;  2EC0 A;  2DYA A;  2ZJP Q;  3BKT A;  1FK9 B;  3DFE A;  2AX1 A;  3OL7 A;  3O3L A;  1NDC A;  2MY7 A;  2OPS A;  1R6Y A;  4YEA A;  2RDD A;  2RRB A;  1TQL A;  4TYB A;  3CD0 A;  2BXJ A;  1IBC B;  1Z60 A;  3ET6 B;  4ZP8 A;  4IC3 A;  4NLO A;  1SC3 B;  4I7B A;  3TJ8 A;  1REG X;  3ZVY A;  3QYY A;  4FNH A;  1FER A;  1XNQ F;  4B3S J;  5J1N A;  5DZ7 A;  2FC9 A;  4N4F A;  4K50 A;  2N7C A;  1WC1 A;  4DV0 F;  4X66 F;  4X3G A;  1RJJ A;  2J6S A;  2DNM A;  2I1R A;  1O51 A;  1R0A A;  3ILJ A;  1YX2 A;  5J2Q B;  4PYD A;  4MAK A;  5A76 A;  4ED3 A;  3PO4 A;  3T6R A;  1HQ2 A;  3Q8V A;  3NAI A;  4X4U A;  1G7C B;  4NYZ A;  1JLC B;  3M8Q B;  4LBH A;  3M32 A;  2OAU A;  3W9J A;  3PEJ A;  3LAM A;  4FF4 A;  1HR0 F;  1W26 A;  1VJQ A;  2GO9 A;  5ADZ A;  2QLX A;  3PX4 A;  3EDQ B;  3MPD A;  4N3W A;  5D3G A;  1KRP A;  2KKX A;  3Q22 A;  4I2Q B;  1MMD A;  3ZZU A;  4EWT A;  4H9D A;  1LW2 A;  2BYC A;  1WF2 A;  1IN0 A;  3SMZ A;  4P74 A;  2ALZ A;  4DPO A;  1HNI B;  1N48 A;  1SUQ A;  3HP6 A;  4NPO A;  3H5X A;  3EWG A;  4RW6 B;  1B99 A;  1RHJ B;  5F8M A;  4UI9 B;  5HRO B;  2D8U A;  4UOG A;  1BD6 A;  4QPX A;  5HLF A;  3PX6 A;  1PSD A;  3DDT A;  5FER A;  1T9X A;  5D15 A;  5KG5 A;  3PUR A;  5HSP A;  2CNK B;  4B3S F;  1BY9 A;  4C3K A;  4KHP J;  1KVK A;  3A3P B;  2H4Y B;  2BE2 A;  4L3N A;  1CJV B;  3EMT A;  2VFV A;  1D1U A;  1CLF A;  4TQR A;  5F8L A;  4WKR A;  2FGC A;  4XK8 C;  4P2X A;  1L3K A;  5AE3 A;  2FZG B;  1WC4 A;  1HHT P;  1FRX A;  1C4C A;  3BGO P;  2KFT A;  4RW9 B;  2KHD A;  4NMX A;  4G65 A;  4W90 B;  1NH8 A;  4ZKA A;  5FJ4 A;  2HRT A;  3D54 A;  3OHA A;  2FQQ B;  2DNR A;  4F4X A;  3PLW A;  1R27 B;  4DV1 F;  5H9E J;  2QJ3 A;  2MXY A;  3J80 U;  3SCL E;  5L38 A;  3E51 A;  1PYO B;  2BV3 A;  4LFC F;  4WZ0 A;  2CG4 A;  5AXL A;  2VBY A;  1S4E A;  2JM3 A;  3PKY A;  3QT8 A;  5L1J A;  4NCG A;  3HTK C;  2AP6 A;  4URQ U;  3MOZ A;  4B9V A;  1P8G A;  3CPW R;  1UP1 A;  3L3C A;  1WOS A;  4C8Y A;  1RMD A;  4LQ3 A;  2V68 A;  1VRT A;  3TNV A;  3MM5 B;  2GQQ A;  2CWX A;  2BRL A;  2GW8 A;  3DGV A;  5LKX A;  3KLI A;  3TX8 A;  1DTT B;  2NUU G;  4H54 A;  1OQ3 A;  3DYA B;  5BR8 J;  1G2E A;  4K5R A;  1FKA F;  3TQE A;  4KE5 A;  1FRM A;  3ULH A;  1JJ2 R;  2GZO A;  4KHP F;  2EOD A;  4A8F A;  1Y5L B;  2J7W A;  2A18 A;  4L7X A;  3RR7 A;  3DWD A;  3IGN A;  4QWE A;  1N88 A;  5KFZ A;  4LVN P;  4RJV A;  1JM7 B;  4LLB A;  3LAL A;  3QGG A;  4ZPD A;  4P6Q A;  2J9C A;  2CVE A;  2IM1 A;  4P9S A;  1VDH A;  3DLL Q;  3D3B J;  3MGJ A;  2FFW A;  1O0P A;  2K3I A;  2BJ7 A;  2W24 A;  2LAU A;  4CLY A;  3GMG A;  1NHU A;  3MED A;  2HQD A;  2DEJ A;  4I2P B;  2LXU A;  1QD1 A;  2Y1I A;  1KDN A;  4H4O B;  5B0A A;  4UOC A;  1HMV B;  4TVA B;  2ZFH A;  5B0C A;  2D3O R;  1NK9 A;  4DX7 A;  3RPG B;  3D1H A;  4W98 A;  2CPZ A;  3DRP B;  4QPT A;  4CCH A;  4UST A;  2BW7 A;  2UVV A;  3AD9 C;  1F9F A;  1C2P A;  3R5B A;  1DUR A;  3CJQ A;  5AIU A;  5T14 A;  4NCB A;  3T5J A;  3QBC A;  5A2Q Y;  5IC4 B;  4HVZ A;  1S6Q B;  3DC2 A;  3FJU B;  2B4V A;  2K4D A;  3OL8 A;  4PWW A;  2R7Q A;  3LDY A;  4QQ4 A;  2OMO A;  4LSL B;  1TFY A;  3C6T A;  4KIA A;  2M6M A;  5JVH Q;  2X3G A;  1S9G B;  3UO0 A;  1C0T B;  2DRB A;  4NLS A;  3JAM Y;  1ZAV A;  3MD3 A;  1S6P A;  1RAI B;  5BR8 F;  2M4M A;  2HNY A;  4W4U A;  5HBM B;  1RAB B;  4J91 A;  1S97 A;  2RIJ A;  3JUE A;  4KO0 B;  4ZHR B;  3PR5 B;  4R5P A;  1MM2 A;  3MUT P;  2CYY A;  2VU5 A;  3DM2 B;  4DV4 F;  3NCP A;  1SI9 A;  1MM3 A;  2IJF A;  2D7S A;  3M2U B;  2I0X A;  3RRH A;  4F4Y A;  5KTQ A;  4L76 A;  1M5K C;  4GNF A;  1HYS B;  5KFW A;  2XZD B;  4RR5 A;  3S01 A;  1OYD A;  2DXF A;  1TL5 A;  5H1T A;  4PCQ A;  5E7O B;  3KOA A;  1UVK A;  4HAC A;  3HDS A;  1TVR A;  4DR6 F;  2DGQ A;  2APO A;  1JLG A;  4K4T A;  1T11 A;  3CCE S;  2FJW A;  2W4D A;  4RW8 A;  3KNG A;  3AOB A;  4KV8 B;  2GGP A;  2DSM A;  4I6W A;  2HFV A;  4AVX A;  2GJF A;  3LF0 A;  4DFM A;  5D6G A;  3CCR S;  3OFF A;  1X31 C;  4FP9 A;  2XTJ P;  2PI5 A;  2ABY A;  4JI8 J;  3HCS A;  5D4N A;  4OX6 A;  5TRB A;  4AXJ A;  4RUC A;  1OQ6 A;  2HLU A;  4LMZ A;  2PEB A;  3ZO7 A;  5L39 A;  1L3T A;  3CMA S;  5JG6 A;  3D28 A;  2RE1 A;  2IA6 A;  1NEE A;  1IQT A;  2GX8 A;  2KE1 A;  3KJV B;  4K5S A;  3S6E A;  1LDK C;  2RQ4 A;  4YC9 A;  1Q53 A;  4NRT A;  4ZIW A;  1IKX A;  3GII A;  2XNR A;  4XTT A;  2H0D B;  3P5T L;  2DO0 A;  2QT7 A;  3R9L A;  1SJF A;  4ANE A;  3FBB A;  3DDK A;  3GIR A;  1FDD A;  1NKB A;  4WE1 A;  4G6V B;  2GIF A;  3OHB A;  4ZN3 A;  1IUJ A;  1DAX A;  1TL3 A;  4Q2M A;  3GIJ A;  4Q2L A;  2YPZ A;  3CDE A;  3DRR B;  4RU9 A;  5DJB A;  1ZTT A;  3GG1 A;  1U7L A;  4ILM A;  2WBR A;  5KT7 A;  2K1R B;  2WB4 A;  2ZBQ A;  5G4D A;  3ZTQ A;  3BGR B;  4DZ6 A;  3C6U A;  4NXM J;  5HAT A;  1Z6U A;  2W9B B;  2YRE A;  3CUL A;  4G1Q A;  5CCM A;  3ZC4 A;  2V2V A;  4GND A;  2Y1M A;  2W2Q P;  2L41 A;  2XI2 A;  4IFY B;  4DFJ A;  1NKC A;  2E1R A;  2BAN A;  4K8R A;  3O47 A;  3PKM A;  3R3T A;  3QWU A;  2P6S A;  3Q23 A;  2YWG A;  3D0H E;  3QT6 A;  3JB9 k;  3TAM B;  1SV5 A;  4AUK A;  2MKS A;  2VQF J;  4WBF A;  5F41 A;  4LSZ B;  3OSN A;  5B0B A;  3K5L A;  3H4D A;  1HQU B;  2PGC A;  1T03 B;  4RNM A;  3MR7 A;  2ACY A;  5DQI A;  5ETO A;  4PWU A;  4LF8 J;  5KFI A;  4A8Q A;  5ETN A;  2F4F A;  1KP6 A;  2DR7 A;  1FJG J;  5D78 A;  5HAO A;  3ZTR A;  4KPY A;  3C16 B;  3NS5 A;  3PO5 A;  3M30 B;  2AT1 B;  3EX7 B;  1TKX A;  3ZZR A;  2ZWP A;  2MLZ A;  3SV3 A;  1BHN A;  2Z56 B;  5ETK A;  4RW4 B;  4IFV B;  3KLE B;  1VC0 A;  1U8S A;  2PA8 D;  5L1L A;  4R0E A;  1EX8 A;  2R4F A;  2VDI A;  2IM3 A;  1JWW A;  2DIU A;  1HHQ A;  3QIP B;  4JI7 F;  1OSD A;  3U1L A;  3QFH A;  2V50 A;  5D77 A;  4DG1 B;  3CF5 Q;  4N41 A;  1FWP A;  3NAH A;  3THP A;  4F2S A;  4NXM F;  4ER8 A;  1PYS B;  4TNO A;  1SPB P;  1LXJ A;  1RWO B;  1NDP A;  1Q1K A;  4USM A;  1H98 A;  4PPD A;  2E1M C;  4C4W A;  1CJU A;  2D69 A;  1NPR A;  3NS7 B;  1E6V B;  1UWB A;  4J9R A;  2HHW A;  3L95 X;  4O44 A;  4Q5V A;  4LF9 J;  2EG2 A;  1TL1 A;  2RU9 A;  3OTD A;  4NYP A;  2Z2M A;  4ETZ A;  3ITH B;  4Z0R A;  2HBY B;  2XY6 A;  3NXZ A;  3H5S A;  2KN4 A;  1EQ0 A;  4H4M B;  4KB7 A;  1Y5I B;  3TZX A;  1VC6 A;  4LF8 F;  1EET B;  1FF2 A;  2PC6 A;  1HIY A;  1BQN B;  2DCL A;  1X4B A;  2FGO A;  3AJD A;  3CCM S;  1X4F A;  1FJG F;  4B9N A;  1NND A;  3EDR B;  1WEM A;  3Q8S B;  1F3V A;  4OI6 A;  3JTN A;  2QE5 A;  3VTI A;  4C0B A;  1S0O A;  2FD4 A;  3W5Y A;  3MM8 A;  1R8C A;  1U48 A;  1FO1 A;  3I9V 9;  1RHR B;  2YWW A;  4HEA 9;  3GIL A;  1D0E A;  2CSZ A;  4EO8 A;  2AGP A;  1RTH B;  5J1E B;  2HAF A;  4NLQ A;  1SJ1 A;  1T3O A;  2OPQ A;  5E2Q A;  2WRM A;  4FVM A;  1VYX A;  4K4S A;  4MFB B;  5DO2 A;  3AY0 A;  3CD6 S;  3T1A A;  2AV5 A;  4DUY F;  1SQF A;  1FI4 A;  2HBR B;  3BR9 A;  1N5Y A;  2WON B;  3BKF A;  1A0O B;  3ZPV 1;  1V3S A;  3DOL B;  1HNV B;  3I82 A;  2YNG B;  1NAQ A;  1TTH B;  1VCT A;  5D4L A;  2GHP A;  2C3O A;  2FUG 9;  1R0B G;  2KXN B;  2FUI A;  3BQ0 A;  3HCT A;  4ECR A;  3MWB A;  1XK8 A;  2LGV A;  1LWE B;  2UUA F;  1Y3J A;  4ZJL A;  4OJG A;  2CNO B;  2V8G A;  1DY3 A;  1M5V C;  4X4P A;  2FC8 A;  2YNF B;  2ZVI A;  1LWC B;  1VFJ A;  2BBE A;  4XDD A;  1IKY B;  4TXS A;  1RU2 A;  1YJU A;  2GIR A;  1U1L A;  1PBU A;  1NK0 A;  2JC0 A;  2M5Y A;  4EUV A;  2B56 A;  3UW1 A;  2V8P A;  2YH1 A;  1S6O A;  5A6W A;  3TZW A;  2CDQ A;  1RTD B;  2XB1 A;  3BB5 A;  2BAB A;  3MM7 A;  4DU8 A;  1S0M A;  3Q8P B;  1KFD A;  2Y9H A;  3I87 A;  4NI2 A;  4V1A k;  2PT0 A;  1TUW A;  1RT3 B;  2IM2 A;  4MIA A;  2VDH A;  3CDW A;  5HAN A;  3KHH A;  4R8P K;  2HHH J;  3EXC X;  2B9X A;  1RXO B;  2KIZ A;  2IYG A;  1U1M A;  5FEY A;  3BO2 A;  4FF1 A;  1QSS A;  4CWB A;  1OIA A;  2VIH A;  1WKK A;  2IMW P;  1S1V B;  1HBM B;  1WDT A;  2V9K A;  3WIV A;  5HVF A;  1U6B A;  5EX3 A;  3L7U A;  5B0D A;  1X0P A;  3C46 A;  2HQG A;  3ZNJ 1;  4DR7 J;  1FTR A;  4IRC A;  4FIP A;  4MMO A;  2OP5 A;  1VGY A;  2E44 A;  2BA9 A;  1RAJ A;  3O33 A;  4KSE B;  4L3K A;  4KPC A;  1G4C A;  1EKR A;  3H2U B;  2H5J B;  1KOH A;  3OXG A;  2JEI A;  1KOO A;  3GFZ A;  4WP9 A;  3DYA A;  5G05 B;  3HLU A;  2VL1 A;  2MKK A;  2V4J A;  1AFI A;  2IRU A;  2BJ1 A;  1Q0N A;  2PMH A;  2QMW A;  1OJ4 A;  4ES1 A;  5EWF A;  4YS2 A;  3RTR B;  4QZV B;  4O3Q A;  2AJ4 A;  1JK9 B;  3M2R A;  2Y3Y A;  2KWN A;  5IQQ A;  3D6F B;  5DZ6 A;  4DQR A;  4KJI A;  5I4M A;  1SJR A;  1YRT A;  3E2E A;  4DLG A;  1ZOT A;  1LW0 B;  2PEH A;  4WU3 A;  2VBX A;  1HLW A;  3F73 A;  1AA1 B;  2DXD A;  4ES3 A;  4Q43 A;  3CGI A;  2DK2 A;  1YZ7 A;  3L11 A;  3B54 A;  3CJS A;  1ZAW A;  3MAA A;  4KYZ A;  4B9L A;  1RK8 A;  2O5D A;  5JJB A;  5EWE A;  2CPJ A;  2M8D B;  2YKQ A;  5HK4 A;  2VV5 A;  1G3O A;  3QT5 A;  2KDO A;  3DRP A;  4RKU C;  5D4O A;  4O3R A;  4WK3 A;  1DRZ A;  3GP9 A;  1MRO B;  3QMQ A;  1GTH A;  3QAT A;  1L3U A;  1T05 A;  3RG6 A;  1RT5 A;  1EQM A;  1F0X A;  4W4M A;  2DNP A;  3BGF A;  2OTJ S;  4DR4 F;  5EWG A;  1REV A;  4J9U E;  1BC6 A;  3JSR A;  3O37 A;  1KNZ A;  4OZ5 A;  5HMW A;  4N56 A;  3EGV A;  1S9G A;  1R8B A;  8RUC A;  4C9D A;  4URG A;  5HL7 Q;  1XTZ A;  3BQ1 A;  3BH7 B;  3RRK A;  4CRJ A;  4LF1 A;  4B17 A;  4QR0 A;  3AFG A;  2MQL A;  5D1L B;  1TK5 A;  1Z2L A;  5HBM A;  9ATC B;  1FKP B;  4M5D B;  5L1I A;  3UQS A;  5FLX Y;  2C2L A;  4I56 A;  2DNL A;  4P75 A;  2XSJ A;  3DM2 A;  4W92 B;  4EU0 A;  3DQV R;  2ROP A;  1JJ4 A;  4X62 F;  4WTY A;  2B7C B;  4Y28 C;  1P9Y A;  3NCR A;  2C42 A;  1N34 J;  2RNE A;  3VGT A;  2DB1 A;  4B86 C;  4F3Q A;  3P4U B;  4DPX A;  3DRX A;  2RQC A;  1YWX A;  4DPU A;  3GR0 A;  4CLS A;  3LAK A;  3FZ2 A;  1JLB A;  4NZ7 A;  3IWN C;  1T94 A;  1YK9 A;  4GNG A;  2QJ0 A;  3L09 A;  2UUT A;  3UNG C;  5A8K B;  5B79 A;  3FBE A;  3BYR A;  1C1B B;  2NYI A;  5IQ6 A;  4LSN B;  4CLL A;  2C2M B;  2KR4 A;  2F40 A;  1FFS B;  4CM2 A;  2P9G A;  3TEH B;  2XCP A;  2FJB B;  1MLA A;  2MQM A;  1S79 A;  4DPY A;  2HIY A;  2G13 A;  5A8W A;  3MEG A;  2DGT A;  4ZOS A;  4ZVH A;  4OHW A;  4ZP7 A;  3TI0 A;  1VQS A;  1CVJ A;  2DR5 A;  1UA1 A;  2VFR A;  3NNC A;  4WP8 A;  3VWS A;  3L7P A;  5IXU A;  2FVR A;  5D4P A;  1DCQ A;  4O0N A;  2BQ3 A;  3BO4 A;  3N6L A;  3MAH A;  3DKD A;  1QDU B;  2NAA A;  1Q5V A;  3ICL A;  3DLB A;  2P6T A;  2ZBP A;  3HHL C;  1NCL A;  4K4U A;  3VGS A;  1T9U A;  1HBO B;  4M5H A;  2L3M A;  4DUT A;  3R5D A;  2BKP A;  2GC8 A;  4IKA A;  4S3O B;  3M6X A;  1FKO B;  1FRL A;  3H2V E;  3CDA A;  3HD2 A;  1X4E A;  3RYL A;  2GHW A;  2C2R A;  5KG3 A;  4DSJ A;  1WTB A;  4MIB A;  2D41 A;  3OFE A;  1GT8 A;  3GWC A;  1S9E A;  3LQI A;  5DG7 A;  2WHO A;  5J2P A;  4MJK A;  4AYB D;  3PEH A;  1N34 F;  4CZC A;  1YZ6 A;  5KT4 A;  2F8M A;  4YFU A;  1KON A;  2IJN A;  2ASL A;  2IM0 A;  2DXE A;  3LW5 C;  2E7W A;  2VF3 A;  2GO8 A;  4M94 A;  4Y2A A;  2ZC3 A;  4A8S A;  3ZZT A;  4RBU A;  2ECT A;  3T5K A;  3IM9 A;  1SVD A;  3FSI A;  1PAU B;  2MD7 B;  3IBF B;  4QYZ K;  3MEE B;  1EKS A;  2HVZ A;  3ETM A;  4LIW A;  4WWS A;  1WGM A;  1YJW S;  4DLE A;  5TAB A;  2J0X A;  3TVY A;  2YWH A;  5ETV A;  2KT5 A;  3MZI A;  3H7H A;  4XPE A;  5TDR A;  1YJT A;  2CVI A;  1T9W A;  4ZVT B;  1WKJ A;  1FNO A;  2QIF A;  2WZ1 A;  3O36 A;  5SVI B;  3HVT A;  2CJY B;  5CXT A;  3PHT A;  4DV7 J;  4DOZ A;  4ZA1 A;  1VJW A;  2XO6 A;  1IR2 A;  2R8G A;  3CD5 A;  3V5R A;  1X9M A;  2QA2 A;  4NYO A;  4X4V A;  2E66 A;  2DNK A;  1J5E J;  1OYE A;  4B3O B;  1UZH A;  4OI4 A;  2PFF B;  1HQU A;  5U47 A;  3LJU X;  5DKA A;  4KGK A;  1O5J A;  2C3M A;  3EE3 A;  4TKT A;  3IN5 A;  3SDE A;  4WFY A;  1YJ9 S;  3IRX A;  2F5G A;  3DHW C;  3ONQ A;  2HMI B;  5IM0 A;  1WHW A;  4I7D A;  4UY8 T;  1H38 A;  1X8D A;  3L9Z A;  2FLP A;  2LYV A;  2VOO A;  4UTG A;  3KLH A;  2D3U A;  5K8N A;  2XLI A;  3V43 A;  5KFP A;  2C2D A;  1AUS L;  2MIQ A;  3HPO A;  3KHL A;  2GVD B;  1VFY A;  4OYW A;  1YBT A;  1RU1 A;  2VPG A;  3OTE A;  2HWH A;  1FEH A;  2LU1 A;  3R1L A;  1CBK A;  3PXG a;  3J7Z T;  4PAB A;  3LH2 S;  4OFZ A;  1Y7P A;  4R7E A;  5B09 A;  1WEZ A;  1IKV A;  3TUZ C;  1T02 A;  2NPF A;  1F9E B;  4R0J A;  1UW9 A;  2Z4P A;  4OV6 A;  4WZ2 A;  1P1L A;  4CO0 A;  1GXT A;  4TLR A;  4MK7 A;  2JH3 A;  1MBM A;  3VAF A;  2K8G A;  2XS5 A;  3HUL A;  2VFU A;  1ZH5 A;  1FCA A;  1FDA A;  4F26 A;  1Z4U A;  2OML A;  4FXV A;  4RZR A;  2MQN A;  4OZ3 A;  2ZD1 B;  1RIS A;  2DGU A;  4JB8 B;  3KQI A;  3A3N B;  3I5C A;  1FFG B;  4WK1 A;  4TU8 A;  3GG0 A;  2W1B A;  1WSV A;  2XOC A;  1QUV A;  2VA3 A;  3MM6 A;  4IO1 A;  2R8K A;  4MIW A;  1T3N A;  1WC0 A;  1I51 B;  5B08 A;  4YOE A;  1YQH A;  1ZA2 B;  2V2Q A;  4PPE A;  4BHW A;  2WW8 A;  4ILR A;  1I3O B;  1D09 B;  3C3L A;  2YSM A;  1J5E F;  3T9N A;  2DBB A;  5M2U A;  2QLF B;  4DS5 A;  2O01 C;  4Q6F A;  2QSW A;  2R2S A;  4DX8 H;  4M95 A;  3DLK A;  3K2Y A;  3DCA A;  1BUX A;  1YHQ S;  5LKZ A;  4JI5 F;  2B5J A;  3QLH B;  3CE8 A;  4MKB A;  2R7T A;  1M0S A;  2KYZ A;  4YUD A;  7FD1 A;  1NK7 A;  3OXF A;  5KFX A;  4F7V A;  2CPX A;  3ILL A;  2XYG B;  2CNN B;  2RVJ A;  3ZVZ B;  2VZ9 A;  4NLU A;  1H74 A;  4PKD B;  5DS7 A;  3VQT A;  2QV6 A;  4O4G B;  1DLO B;  4UP0 A;  2BQR A;  2ZC4 A;  1WEX A;  5D8H B;  2DNO A;  5B8D A;  2LMI A;  2VAS A;  4P7T A;  2J0S D;  4CH7 A;  1IKW B;  2OPR A;  4C8N A;  2GVZ B;  1BQM B;  3NMR A;  3UCZ P;  1FE0 A;  4OYX A;  1HYI A;  4JV0 A;  1EP4 B;  3IS9 B;  5LSL A;  2MST A;  2RKI B;  4UUW A;  2FHO B;  5IT9 Y;  1TL7 B;  1WIL A;  2NSC A;  4R25 A;  3NGK A;  2E1P A;  4HTJ A;  2OUG A;  2HS3 A;  3DDI A;  3JTO A;  3TZZ A;  4FXW A;  2DKO B;  1YGY A;  3PRV A;  1NK6 A;  4MK8 A;  3DOL A;  4NLG A;  2M9K A;  2YYR A;  4HL9 A;  3N6N A;  3W62 A;  2OSQ A;  3HX9 A;  2Y1R I;  2B8P A;  3WBZ A;  4X4R A;  3IHP A;  3TEG A;  2VPW B;  1B4S A;  4EZ9 A;  1A6L A;  2JMJ A;  3GV5 B;  1YRX A;  4KH0 B;  4JV5 F;  1IKY A;  3MDB C;  2H1Y A;  3D6T B;  2XLJ A;  5C7P A;  4O4R A;  1LEO A;  2C28 A;  5C25 B;  5T7L A;  5GAG U;  4P7V A;  1U1O A;  1NHK L;  2XWY A;  1CJK B;  2AQ4 A;  3DRS B;  1RYR A;  4ALZ A;  5L9X A;  4ZJQ A;  4K4X A;  1QVF R;  4MYT A;  4K4W A;  2HGM A;  4GC7 A;  1AZS A;  2YPY A;  3DI6 A;  4EGL A;  2JEG A;  4FPI A;  4IG0 A;  3GFX A;  2KFN A;  3TJA A;  1RT3 A;  3CJK A;  2EKN A;  2ZE2 B;  3NGU A;  2JDJ A;  5EHH A;  3IO1 A;  4OI1 A;  4F4Z A;  1N36 J;  3M7K A;  3CJ3 A;  4F3M A;  2P8I A;  5F8N A;  4Q8E A;  1DTQ B;  2UUC J;  2JOQ A;  4LFA F;  4ED1 A;  5HMZ A;  3N01 A;  1OS5 A;  3K89 A;  2IC3 B;  5I3P A;  4LF5 J;  4HYK A;  4N47 A;  1D9A A;  2ZEJ A;  1QY7 A;  1BMQ B;  1U2C A;  4OYZ A;  1ZA1 B;  4ECX A;  1JB0 C;  2JLE A;  2V63 A;  1JMT A;  3MFI A;  1BXN A;  1U8W A;  4OMF G;  3ADA C;  2R8J A;  3EIC A;  2CZ4 A;  4ZP9 A;  1HWK A;  1XWL A;  5KG0 A;  2MZ1 A;  4HHJ A;  3RB3 A;  2W2N P;  2IYI A;  3BN4 A;  1B0V A;  5IFM A;  3NMA A;  4NLY A;  3R5J B;  4PXB A;  4Q7A A;  4K2J A;  1S1T A;  2VA2 A;  2K06 A;  4MH8 A;  2AMC B;  1D9F A;  1WTF A;  1S5Z A;  1HBU A;  3DRY A;  1WI8 A;  2M88 A;  2E1A A;  2W2M P;  4WXO A;  2X51 A;  4QWA A;  2HHV A;  1GFW B;  3LUY A;  4DV6 J;  3P8B B;  4PAA A;  3MMB B;  4K59 A;  5HVG A;  4YB6 A;  5K14 B;  4FYW B;  1UEK A;  1M5O C;  1WES A;  2M85 A;  3HMJ G;  2AEJ A;  1RAC B;  1PGZ A;  2E61 A;  4FNI A;  3T6B A;  4N8O A;  3V6K A;  2LLZ A;  1WJ9 A;  2HBQ B;  1SC1 B;  3EYZ A;  4QWD A;  2R42 A;  2PFD A;  3P6Y C;  4QR1 A;  4P73 A;  4FO9 A;  2UUC F;  1J27 A;  1S1U A;  3UCG A;  4CIO A;  2OEK A;  1U1R A;  2F9J A;  3M1V A;  5KFJ A;  2VFS A;  1N54 B;  1PJ6 A;  4ED5 A;  2DJW A;  2RSD A;  5HJY A;  1X9W A;  2UXC F;  3NOC A;  4BWM A;  2K1J A;  3IR7 B;  2QL7 B;  3HXM A;  1FDB A;  2HHX A;  2OXQ C;  2VG6 B;  5F3T A;  5LJ5 Y;  2G9O A;  3H98 A;  4FBT A;  3OR1 B;  1FWK A;  4CO5 A;  3R2C J;  1WUU A;  3VAJ A;  4XAK A;  1SQE A;  1S57 A;  3LAN A;  4M5G A;  1IWA A;  5KT2 A;  1XMB A;  1NME B;  4DL0 C;  3NNA A;  2I5J B;  3Q8R B;  3A3O B;  4X4O A;  4GVL A;  3KK1 A;  4JUZ A;  4AD6 A;  1S4F A;  1WOP A;  2BDP A;  2O3D A;  3W2V A;  4GVB B;  3LA0 A;  1TKT B;  4DCP B;  4HDG A;  3ZTP A;  3M9N B;  1NPK A;  3MUV P;  1R8P A;  4I4B A;  2VH7 A;  3X1L B;  2QA4 G;  4M8L A;  2B9E A;  2ADC A;  3FBC A;  2YHO A;  5KH7 A;  2ZDP A;  4CLF A;  2VON A;  1PO6 A;  4DV6 F;  5I42 A;  2R7X A;  2AJ1 A;  3PFE A;  1X9S A;  2Y0S D;  5FDL A;  4DSL A;  5AXK A;  1JLF B;  1WEV A;  1UFK A;  1UJ5 A;  3Q8Q B;  1EB0 A;  2AHO B;  3GV7 B;  2MYF A;  1RHQ B;  2VC0 A;  4PQA A;  1UVJ A;  1RBA A;  2KM8 C;  4O0I A;  1GMW D;  3IXQ A;  3TUI C;  2AJ2 A;  3NEK A;  2XS7 A;  1GK8 A;  2FJA B;  4V3K C;  1W25 A;  3OVA A;  1UW4 A;  2DY9 A;  2XY5 A;  2M8H A;  1NSK L;  1DQ9 A;  2XM3 A;  4OLP A;  3KG4 A;  3QFW A;  3P45 B;  3VAI A;  4I7F A;  4MT1 A;  1RWX B;  1WEE A;  2EW9 A;  1P9Q C;  4ED4 A;  3BBF A;  2B6A B;  3SUB A;  1TEL A;  3ZPV E;  2CQD A;  3KUE A;  4FZV A;  4UP5 A;  4KT0 C;  4AYC A;  1C0U B;  4OX8 A;  2JMI A;  2C2E A;  4FBU A;  2NXN A;  2ZHA A;  1VRU B;  4DF8 A;  3MUR P;  2PII A;  1U24 A;  1WEP A;  4LR9 A;  3FSY A;  5J2M B;  2KWO A;  4CP5 A;  2VNF A;  3EVW A;  1EAY C;  1QAI A;  2BE7 D;  4ZIT A;  3TA0 A;  2QA1 A;  4NA1 A;  2XMA A;  2E7X A;  3PVX A;  1VD4 A;  4YR2 A;  1W2B R;  3VCD A;  5DRK A;  2EFP A;  1NJI T;  3KG0 A;  3K5P A;  4PYA A;  2LRI C;  2POK A;  3UDV A;  4LF6 F;  4LR8 A;  2JRS A;  1V3Z A;  1ELO A;  1RT1 B;  4OYP A;  2LQJ A;  3TAP A;  1M5S A;  3QZ7 A;  2L9D A;  3AD8 C;  4WFA Q;  3O2I A;  1PC5 A;  1N6Q B;  4DSE A;  1M1G A;  3PYE A;  5C24 B;  2HVD A;  1TV6 A;  2X1B A;  1S49 A;  4KFB B;  2DR6 A;  2EI5 A;  3KK2 B;  3DPL R;  1S59 A;  1EAR A;  3U5O A;  4UOF A;  3MXH P;  4GKJ J;  4DBQ A;  2OHD A;  5G0R B;  1T9Y A;  2ZUA A;  3FMB A;  1LKZ A;  2XO7 A;  3F0N A;  1RLD A;  2HND B;  4NLP A;  2XCA A;  3H25 A;  1WKL A;  2YWE A;  4TY8 A;  3FRZ A;  3MPV A;  1X4U A;  2NRE A;  2ILZ A;  3T41 A;  2AWZ A;  2GJ2 A;  4TYA A;  2CXE A;  4UT4 A;  3Q8Y A;  3MR6 A;  3TRG A;  2MZS A;  1RT7 A;  5CQG A;  1HNX F;  3L1X A;  4O3N A;  4L73 A;  2X1A A;  3HZE A;  2R7U A;  3QRR A;  4WZM A;  4DL2 A;  1WC6 A;  2HKE A;  1WC3 A;  4HHU A;  1QM9 A;  1FA0 A;  4OZN A;  4DFK A;  2KRE A;  4O62 A;  4MKV A;  2B8Q A;  4OHY A;  1RBL A;  2VJU A;  3LGH A;  1LQ9 A;  3SQG B;  3VV2 B;  2DGV A;  3NBP A;  1JLA A;  3T9Z A;  1N5S A;  1VIS A;  1U6F A;  4QIF A;  1HI8 A;  1FDN A;  2RS8 A;  1SKU B;  1SH0 A;  2EBE A;  5GAG I;  5KFH A;  2D1C A;  2FY1 A;  2KKY A;  3R1H A;  4YHH J;  4P72 A;  4WCE Q;  2IVM A;  4PWD A;  4FYY B;  1MG7 A;  3HZG A;  5AE2 A;  1IQZ A;  3MPY A;  3MTJ A;  2VPB A;  3GJQ B;  5LKT A;  1UVL A;  4DPT A;  1RI7 A;  3V2U C;  4NX9 A;  2I38 A;  4M1K A;  2KYX A;  4GKJ F;  2PMZ D;  3JYT A;  3VAH A;  4YBT A;  3H8Y A;  5BXI A;  4U7C A;  3CCZ A;  4GKK F;  2V34 A;  4FS2 A;  2EC2 A;  1SKW A;  3BO3 A;  4I1T A;  4YDX A;  4LRA A;  2JNJ A;  4DCO B;  3MR5 A;  3R2D J;  2E7V A;  2OFG X;  2M3H A;  3O34 A;  4A0C D;  3LP0 B;  3PDN A;  2MD8 C;  4NA3 A;  2FHJ D;  4YB1 P;  4Q0B A;  3JSB A;  3W66 A;  5H1V A;  2B9Y A;  3VAG A;  2GAG C;  4F8R A;  1RAD B;  1K47 A;  3PIP Q;  5C5J A;  1YJN S;  3I0S A;  1NB2 A;  3RB4 A;  3OL9 A;  2XQC A;  2KH9 A;  2C22 A;  1NRK A;  5MAO A;  3HJV A;  2HUR A;  1NO8 A;  2CON A;  4OX9 F;  2ZKU A;  3TA2 A;  2ZH3 A;  1HWU A;  2MPU A;  1Z2Q A;  1HBN B;  2QLW A;  3AJ2 A;  3BPD A;  5J2N B;  1VBK A;  2DVI A;  5BYR A;  1Q82 T;  4OIX A;  1SIZ A;  4A8O A;  2UXD F;  4DL5 A;  5L1K A;  1RAF B;  3TVK A;  3FMW A;  1VBY A;  4UQG A;  2BR0 A;  3M8P B;  4A8K A;  1BE4 A;  2VPZ B;  1RAE B;  3C15 A;  4YAD A;  2CQI A;  4ENO A;  1J2V A;  5KFD A;  3PJ9 A;  2EA6 A;  3A8J A;  3DLG A;  1NPP A;  4YHH F;  3AXM A;  2VBW A;  3DU5 A;  2R2R A;  4A8W A;  5JMN A;  2NS1 B;  2GV1 A;  4BC9 A;  3FNN A;  2CQH A;  3MEC B;  1XEZ A;  1C1C B;  4EYH B;  2DR8 A;  3ASL A;  3HFK A;  2P5V A;  1RHU B;  3UE2 A;  3W64 A;  4PUO A;  1AW0 A;  2DNH A;  2HQC A;  1DVP A;  5KFN A;  1U45 A;  5HP1 B;  8AT1 B;  1FD2 A;  2H3E B;  1MN9 A;  1KSP A;  2GVZ A;  1T1H A;  2D74 B;  1XR7 A;  1V9O A;  4RWX A;  3B78 A;  1KLM A;  4J9O A;  3GL6 A;  4ZJO A;  1BWE A;  4ZN1 A;  3ZYQ A;  2RKI A;  1NSQ A;  1IBK J;  1MWY A;  3Q83 A;  3AQP A;  1WNE A;  1S99 A;  2YUC A;  1CPZ A;  3N9M A;  4K4Y A;  1LV5 A;  2GIQ A;  3UN2 A;  3DGP B;  4DR2 F;  5D1M B;  3H42 A;  2OPP A;  5GMK a;  3DNC A;  1MWQ A;  3BM7 A;  2J0W A;  3ZZZ A;  4JI6 J;  3ISZ A;  5E0O A;  1UMJ A;  3NGS A;  2MNY A;  3N9O A;  3ZXW A;  2R8I A;  3EB6 A;  3DDN A;  1FNX H;  3GPA A;  4K0K J;  4CM0 A;  3POT B;  5AXM A;  3UVJ A;  1XNR J;  2FZC B;  4LF7 F;  2HQ3 A;  3C14 A;  2HDP A;  1KC8 T;  2HAI A;  2M52 A;  1I6J A;  4RNO A;  2ALY B;  1R6V A;  2V5H G;  2GS8 A;  3V4M A;  5LXY A;  1S12 A;  2N82 B;  3G96 A;  1UTA A;  5KFA A;  2GAH C;  2GQ2 A;  1VQ5 S;  4HTI A;  2LCW A;  2E5H A;  1DHM A;  1VIO A;  1T9V A;  2L75 A;  3RBX A;  1T7P A;  2YKN B;  4ELV A;  3SCJ E;  2KG1 A;  1D8Z A;  2DH9 A;  3PRD A;  1U2F A;  2ZKT A;  2YKM B;  3R6G B;  1OY9 A;  2ZOF A;  3ENV A;  4B3M J;  4AL6 A;  1OMS A;  2FLN A;  5EUH A;  5CD4 H;  2HNZ B;  2CQ4 A;  1SIW B;  1JXV A;  2RJZ A;  3OSP A;  3I0R B;  1CS4 B;  2AZ1 A;  3G4S S;  4KHR A;  1GX5 A;  4NLX A;  2NXE A;  2EXU A;  1WD6 A;  1Q86 T;  4Q8F A;  1QSY A;  2QZ8 A;  3NS6 A;  4AQY J;  3SOU A;  2RU3 A;  3RW7 A;  2N4D A;  2KKH A;  1XMQ J;  2CQG A;  4BCA A;  1HFE L;  4V19 X;  2RML A;  1JLQ A;  3GE9 A;  2HHT A;  4IH6 A;  1HNZ F;  2L7P A;  2VPX B;  2O1P A;  3W9H A;  1FHT A;  1U4B A;  2E5G A;  4U7U D;  4IC2 A;  2BKO A;  3DLJ A;  4ECV A;  5I3U B;  3V4I B;  1FXD A;  4DV2 J;  4D3H A;  1R8A A;  2PNX A;  1CJT B;  4LUB A;  4X4T A;  4OZ2 A;  3SXL A;  2JX2 A;  3HHD A;  2LFV A;  2DHS A;  2NXJ A;  2R2U A;  2CQB A;  1H2U X;  2DR9 A;  4DV3 J;  3KUG A;  1F5A A;  2V4R A;  3HKW A;  2KG0 A;  3P49 B;  3W8G A;  4C3M A;  4RUA A;  2W9C B;  1QE1 A;  1SL0 A;  3JSY A;  2LVW A;  2WAQ D;  3VVU A;  2UUW A;  3J81 Y;  4WJB A;  2FHK A;  4IOA Q;  3M63 A;  2Q43 A;  4B3M F;  1JOC A;  3BSN A;  1ZM4 A;  4C11 A;  5IWA J;  3O35 A;  1S7I A;  4CQ1 A;  2XSF A;  2VKR A;  5IT4 A;  3LP2 A;  2R7W A;  3CW2 C;  5KFY A;  3HM9 A;  3EGW B;  2XLK A;  5BJR A;  2WBM A;  2BUN A;  1NKE A;  2HQI A;  2J0Q D;  3N5F A;  1U49 A;  3IG1 A;  4D3G A;  2HHQ A;  5DDR C;  1IBL J;  2HYE D;  4B3R J;  3HFV A;  1LWF A;  3KDN A;  2KM8 B;  3CJ0 A;  3G82 B;  2K7K A;  3OJS A;  1S1W B;  1B7F A;  2CAJ A;  1G6B A;  4TU7 A;  1VI7 A;  2OEM A;  5E33 A;  2ZH4 A;  2WOM B;  3FSX A;  3ZZP A;  2N4C A;  2ATL A;  3W8P A;  4RBV A;  3MM9 A;  3RB6 A;  3HVW A;  2CQ1 A;  3IP0 A;  1U0H B;  5KG1 A;  2Z2Z A;  1UKU A;  2XGQ A;  2G43 A;  4AXI A;  1HQE A;  1M5H A;  3EZU A;  1OY8 A;  3PX0 A;  5ETR A;  2CT2 A;  2AIR B;  2D8S A;  3KLG B;  3Q8U A;  5AE1 A;  1GMU A;  2VJF B;  1NBE B;  2G0J A;  4F50 A;  2YNH A;  2CJX B;  3HHL A;  2J5A A;  1JQG A;  2W7O A;  1WF1 A;  3BSA A;  3CJ5 A;  3N9Q A;  3B4M A;  3DOM A;  1S48 A;  2ZET C;  4OGE A;  1J5O A;  1AFJ A;  4QCL A;  2LXI A;  3CCT A;  3RGI A;  2OKQ A;  1S6U A;  3J7Y U;  3HK2 A;  5IV3 A;  4DSK A;  4RO0 A;  5IWA F;  4ICL B;  4IQM A;  3RR8 A;  1VOM A;  1VLO A;  2GML A;  4TY9 A;  2IAJ B;  5LKU A;  1O6X A;  1RTZ A;  3TA1 A;  1S1X A;  1N87 A;  4QR2 A;  1IBM J;  3VGV A;  2EGP A;  3J7A N;  3W2W B;  1UEV A;  2WVE A;  2KL8 A;  3KYL A;  4ED8 A;  4ED6 A;  4Y65 A;  1X60 A;  1IBL F;  3OW2 R;  3PRB A;  4KGZ B;  3M62 A;  3C19 A;  3IR6 B;  3F44 A;  2M3D A;  1KHW A;  3JSM B;  3TUP A;  1CG2 A;  3OQ2 A;  1B7Y B;  2RF2 A;  2MA5 A;  1RKI A;  4OZL A;  4A8M P;  1WG4 A;  5B77 A;  3P3D A;  4OYA A;  2KJV A;  3KK3 A;  4WFZ A;  4A4B A;  1AT1 B;  2KT3 A;  1SC6 A;  2HIQ A;  2Z30 B;  4WXW A;  3G87 A;  3NL0 A;  1VQ7 S;  5FB1 A;  4HT5 A;  5DLG A;  4IYQ A;  1MU2 A;  2OPS B;  3IBW A;  5KFV A;  3CC2 S;  1NDL A;  5B0F A;  1ACM B;  4C7Q A;  2BQU A;  3ZNI A;  2MLY A;  2ZH1 A;  5C24 A;  2V2Z A;  3IWX A;  2CPH A;  4AP4 A;  2DGX A;  1OO0 B;  4JYA J;  2GMH A;  3BKU A;  4EYI B;  3I9Z A;  2QLB B;  4IG3 A;  3GR1 A;  1RHK B;  5CAB A;  3QO9 A;  4Q44 A;  2UUB J;  3MDF A;  4F36 A;  5GAE U;  4CYU A;  1RWM B;  2PE8 A;  3VAM A;  1CC8 A;  2CUY A;  2JFK A;  4F4K A;  2XC9 A;  5KT6 A;  1RDR A;  3FEZ A;  2KJW A;  5BYS A;  1X4D A;  1WEY A;  4DL4 A;  3KNV A;  1IBM F;  1R0A B;  1X5O A;  1ZPW X;  4J9P A;  5A2Q U;  5CYJ A;  5K20 B;  5H9F J;  4R8U A;  3FFI A;  2B9W A;  3DHX A;  5CYQ A;  3G6X A;  3TP2 A;  2HS0 A;  2YT5 A;  2W01 A;  1H73 A;  1CUL A;  4WFN Q;  2F1F A;  1LNQ A;  2HLT A;  2HZA A;  1ZBT A;  3IM8 A;  4PG4 A;  4B08 A;  3WC0 A;  1UVI A;  1Y9O A;  3GTY X;  3M32 B;  1P27 B;  4EI2 A;  2Y8Y A;  3JAM U;  4YR3 A;  1VQ8 S;  1URN A;  3DLE A;  3CT9 A;  4KKO A;  2MTL A;  5D3G B;  3M6U A;  5KT5 A;  3HVR A;  2AYE A;  3O70 A;  3JTP A;  1FFW B;  5KG4 A;  3OUY A;  4FYX B;  3M9M B;  2PSZ A;  1VQM S;  1IVZ A;  9RUB A;  3RB0 A;  3L1Z B;  3N0V A;  2ECJ A;  4R2Y A;  3O8W A;  3AA9 A;  2YX7 A;  2C3Y A;  1QJH A;  5GMD A;  1QSL A;  4M63 A;  3K17 A;  3GJT B;  4CO1 A;  2KI2 A;  2IFX A;  4ED0 A;  1UFW A;  4KC5 A;  4ILL A;  5HLF B;  4C8O A;  2BE9 B;  1F62 A;  3W5X A;  1RT6 A;  4ETX A;  4X64 J;  4CO4 A;  2XBP A;  3QRP A;  1IR1 A;  2UUB F;  3FUY A;  2YW8 A;  2M0G B;  2M7S A;  4XO0 A;  2R7S A;  3GSD A;  1E6Y B;  4DX5 A;  3CNQ P;  4LJN A;  1H2T Z;  3GON A;  3PM9 A;  3V81 A;  3NGR A;  1U0S A;  2IY5 B;  4L58 A;  2A6M A;  1HI0 P;  4X4S A;  4OHX A;  1U1K A;  1H7X A;  3D9B A;  1ZBD B;  2F4V J;  4C8K A;  3KLF A;  2YKO A;  3EZO A;  1UET A;  5KG2 A;  3FBF A;  3D0I E;  1KWM A;  2CKL A;  3ILO A;  4JBC A;  4QU7 A;  1RT4 A;  4J7C A;  3OR2 A;  1PCA A;  1RWW B;  2CIM A;  5KT3 A;  2IRY A;  1U02 A;  2I2Y A;  3ZTG A;  5K5M A;  4FS1 A;  2QA4 S;  3CCQ S;  3UNY A;  4OV1 A;  1XER A;  2OIH A;  1UJ6 A;  2VG7 A;  3OVS A;  2ECN A;  3CCW A;  4ZCK A;  3AQO A;  3DOK A;  2Y8W A;  5BYQ A;  2JLF A;  4B9M A;  2YUR A;  5L9N A;  5THW A;  1VRT B;  4C8Z A;  4Y2C A;  1FRI A;  2LQB A;  3MPU B;  4YBS A;  1WEL A;  4QYR A;  2LEB A;  4WZ3 B;  3KLI B;  2MGZ A;  3GJR B;  2V8V A;  4OX7 A;  2VBZ A;  2YKP A;  1Y11 A;  2MY8 A;  4QQB A;  1X4A A;  1GXL A;  4X64 F;  3UDE A;  2MZR A;  2LA4 A;  5SUH A;  2Q6C A;  5HO4 A;  2MLX A;  3T1H J;  3A12 A;  1Y3K A;  1U2R A;  2Z58 B;  1WI6 A;  2W9A A;  2G45 A;  4TU9 A;  4BBY A;  2XB2 D;  3V6J A;  3OLB A;  2VPY B;  2XEU A;  1NM2 A;  1X5P A;  2RSQ A;  2LXP C;  1FJC A;  1NJY A;  2LXH C;  3EVO A;  3CJ4 A;  4NRU A;  1ITP A;  4OLO A;  2F4V F;  3DN9 A;  4ZVP B;  3MMC B;  2YVR A;  4DHV A;  4UQT A;  1NLK L;  4YN3 B;  3U5N A;  3KV5 A;  3MED B;  1RGV A;  3R7S B;  3PYG A;  2FSA A;  1X4G A;  2COL A;  2MA6 A;  3S8S A;  3A8I A;  1FES A;  2KFZ A;  1GH8 A;  2HVH A;  4ZVG A;  5IV4 A;  5KG7 A;  2ZH5 A;  2OSR A;  3VAL A;  4S3O C;  4UOH A;  3EZ5 A;  4DR1 J;  3KNA A;  2JVO A;  2ZZN A;  2AEM A;  3N6M A;  5CD4 A;  1K1S A;  4RW7 A;  3KJQ B;  3P96 A;  2AJF E;  3HVA A;  3ISN C;  4A48 A;  3PCO B;  2DY1 A;  2UZA A;  3PHE A;  1WSR A;  2AGQ A;  2WVD A;  3BGU A;  1HWL A;  3RBZ A;  4JI8 F;  2R8H A;  4NXN J;  2CRR A;  2V6A A;  1OPI A;  4CH1 A;  1FX4 A;  4NZ0 A;  3NY0 A;  3C6T B;  2EFV A;  4F04 B;  4TKP B;  4NLT A;  2PD1 A;  5LMU J;  4QIV A;  5KH3 A;  1S6P B;  4A46 A;  5SVY A;  5HQM A;  2R9L A;  2QL9 B;  3T1H F;  1U1P A;  1Q4R A;  2HRU A;  4R5P B;  3UN3 A;  3J7Y I;  2E5J A;  1H3D A;  4DUZ J;  1R7I A;  1IM6 A;  4LK9 A;  2YQ1 A;  5HVH A;  1RT2 A;  3IRW P;  3BGL A;  3OV7 A;  3E01 A;  1YJ7 A;  1FNM A;  2ASD A;  4CA1 A;  1XJW B;  3UR3 C;  2RHQ B;  1HPZ A;  5K3Q A;  4ZLJ A;  3PW7 A;  3CC4 S;  3IMQ J;  1N32 J;  2EWH A;  2EK6 A;  1JIH A;  3DMJ B;  2C2N A;  4HAC B;  2PN6 A;  2BRK A;  4PRF A;  1TVR B;  4PR6 A;  3BDE A;  3H90 A;  3I56 S;  1JLG B;  1RE1 B;  4YDD B;  2CFX A;  3M2V B;  5A8R A;  1EIY B;  3V4I A;  2D9P A;  1NSA A;  4RW8 B;  4ZP6 A;  1FK9 A;  3WQP A;  3O44 A;  4DI6 A;  1R43 A;  1LFW A;  2GGP B;  4DS4 A;  2GCF A;  2E5L J;  4L72 B;  2K3K A;  1KQF B;  2G6Q A;  4N77 A;  1X5T A;  3TUJ C;  1KQK A;  3ET6 A;  1TK8 A;  1Z1Z A;  2XMW A;  1IYM A;  4GO5 X;  1WG1 A;  4LVO P;  2ADB A;  4JV1 A;  4NXN F;  2VD3 A;  2HBZ B;  3ZTS A;  3W61 A;  5FB0 A;  5KFL A;  1K2F A;  3R27 A;  2VQF F;  4QBU A;  1X4I A;  2DNY A;  1RSC A;  2CSV A;  3I55 S;  1U6G B;  5F9N A;  1S10 A;  3EB5 A;  3G2X A;  5AJ3 J;  2G1H A;  3FQL A;  4GMK A;  3PUQ A;  2EFO A;  3D4J A;  2XWX A;  5GAE I;  1YI2 S;  3CCV S;  3AHP A;  2EKY A;  2R7V A;  1IKX B;  5LSO A;  3LP1 B;  2BKN A;  3EPI A;  1SQG A;  4DUZ F;  1F5B A;  4WFX A;  5J2Q A;  1VQL S;  4ECS A;  2Z57 B;  5EYA F;  2WVB A;  1KD1 T;  3GFH A;  4WE1 B;  3AB2 B;  3GSI A;  2NYH A;  3MR2 A;  4I6A A;  5H9M A;  2X1F A;  1TL3 B;  3MHS A;  1JLC A;  4USJ C;  4DL7 A;  3M8Q A;  3GQC A;  1KQG B;  2FY8 A;  1N5Q A;  3H0P A;  2HGL A;  4ECQ A;  5F0U A;  2C2Z B;  4J9N A;  4KR0 B;  2YXL A;  1GEH A;  2DRD A;  3S1T A;  2ECV A;  4USH A;  2MKJ A;  2IIH A;  2BOA A;  2CKW A;  2Q1L A;  4O3P A;  2VG5 B;  4E98 A;  3C6U B;  4AUQ B;  3A1Y G;  4I2Q A;  4G1Q B;  2H4W B;  3H2L A;  3W7B A;  4LBI A;  5KFM A;  2A2D A;  1HNI A;  3AAW B;  3MR3 A;  2JUN A;  5IZH A;  2H51 B;  2CRW A;  2QTW A;  4CLZ A;  2BAN B;  4RW6 A;  1JXL A;  1VRQ C;  2B43 A;  3TOQ A;  3VHQ A;  5HRO A;  4NN2 A;  4LF9 F;  3SSS A;  1SV5 B;  2MDA A;  2M2B A;  1ARO P;  3TAN A;  3NWR A;  1N56 A;  2HGN A;  3MCN A;  1ZS6 A;  2OH2 A;  1G25 A;  4DR5 J;  2KT2 A;  2FLL A;  4IR1 A;  2IRX A;  2ROE A;  1CQM A;  4DV0 J;  3R97 A;  4X66 J;  1FJ7 A;  1SCJ B;  3T1Y J;  2KU3 A;  4M5L A;  2AW0 A;  2K16 A;  3CCL S;  1CJV A;  3WIU A;  2MT5 A;  1FRK A;  3OBI A;  5K8M A;  3CUN A;  4WA6 A;  1DQ8 A;  5DG9 A;  2N7Y A;  2AGO A;  1HW8 A;  3UR0 A;  4FJC A;  3T9K A;  4P2F A;  5CH7 B;  4RW9 A;  1TKX B;  4V19 J;  3E3X A;  3K8W A;  3CO0 P;  3H59 A;  4XI1 A;  5MLC V;  3CCU S;  3G6Y A;  3JSM A;  3UDC A;  3E8O A;  1Q7L B;  2H54 B;  2KFY A;  1HR0 J;  4DN9 A;  5CA5 A;  3IC1 A;  2IJR A;  4F1P A;  3R8Y A;  5CCL A;  2FJX A;  2WVF A;  1CQN A;  3MPW A;  2OEL A;  2HRY A;  4ECW A;  2NCK L;  1YKW A;  2W8L A;  3LTO A;  5D0E A;  3W3S A;  4ED7 A;  2MJN A;  3LWM A;  1S0V A;  2Z8Q A;  2V67 A;  1L3S A;  2CQP A;  2QIZ A;  1FWL A;  4N76 A;  3MM5 A;  1HW9 A;  1CJU B;  3DU6 A;  4J9M A;  1UWB B;  4Z2X A;  2FVC A;  4IQX A;  1NJZ A;  1DTT A;  3C2P A;  4O44 B;  2B0O E;  2EK1 A;  4OJH A;  3D7S B;  3IAS 9;  1HA1 A;  1TL1 B;  4BC7 A;  5TBN A;  4ZPW R;  2ZBI A;  2XS2 A;  3WX4 A;  2YU4 A;  4DR5 F;  5DGA A;  3EM1 A;  3FAN A;  3H20 A;  5ETL A;  3T1Y F;  2ZOG A;  4ZPT R;  2J9E A;  2J8A A;  1NZ8 A;  1PKU A;  1RUS A;  2W2O P;  1JM7 A;  2ZBC A;  2DNN A;  2AF6 A;  4ZLL A;  6AT1 B;  3TQ1 A;  2VUG A;  1F1B B;  3G6V A;  5GME A;  2AYB A;  2HZV A;  4AL7 A;  2MKE A;  2VJE B;  1SBR A;  1UCN A;  3F41 A;  3CJT A;  4I2P A;  1H7W A;  4H4O A;  3MM8 B;  1N33 J;  1HMV A;  1NH7 A;  1M5P C;  4ELT A;  2HHH F;  4ECY A;  2FVP A;  5FII A;  4ECT A;  3PZP A;  2MKH A;  2DNQ A;  3GZ7 A;  1CC7 A;  3BBB A;  3UD3 P;  4O3O A;  2NUH A;  4CLK A;  4DV1 J;  2DPJ A;  2XHW A;  3BRE A;  5GVQ A;  2M70 A;  4LRC A;  4LFC J;  3AA8 A;  3CD7 A;  3UI3 A;  2OPQ B;  4ZCI A;  1X4H A;  1LFP A;  2I8E A;  1NDK A;  5FLX U;  4ZCM A;  4ID8 A;  3TVZ A;  2ZHO A;  4DR7 F;  1RAH B;  1S6Q A;  4EBD A;  4BHQ A;  1U6Z A;  3CJ2 A;  1I5O B;  5HQL A;  1XMO J;  2CJQ A;  3AOD A;  1FE4 A;  3BEG B;  1DJ0 A;  1T0T V;  4N7T A;  2B7B B;  1N5Y B;  4LSL A;  3KG1 A;  2LQ8 A;  1JXE A;  2DHH A;  1C0T A;  3GCX P;  4DSI A;  3K5M A;  3D5M A;  2XEX A;  4NEY A;  4ZPV R;  2A3J A;  4PXC A;  4KO0 A;  1N0U A;  2YQL A;  4ZHR A;  2ASJ A;  2G2Z A;  2JWN A;  4DV5 J;  3M8Y A;  2EGM A;  3N9L A;  5KOX A;  5J1P A;  4HLB A;  4J9L A;  1E6Y A;  4YAT A;  1JJH A;  3M7V A;  2QMX A;  1TMJ A;  4AE5 A;  3M2U A;  2OGU A;  4LF4 J;  1K44 A;  1SB6 A;  1Q5Y A;  1NK4 A;  1HYS A;  3MM7 B;  4OYM A;  1VQN S;  2BX6 A;  2CSY A;  3J7A 1;  2JRJ A;  1UAW A;  1WIM A;  2B4O A;  2RT3 A;  5B76 A;  4NI2 B;  3FL2 A;  3SIP B;  1R89 A;  2IDE A;  2F6J A;  2EFQ A;  1N33 F;  2FB0 A;  2RDJ A;  2IPO B;  1UJ4 A;  2DPI A;  4E0D A;  2DRA A;  4OHV A;  3MUM P;  5T41 A;  2XP0 A;  1ULR A;  2UP1 A;  1LWX A;  4IH7 A;  4KV8 A;  2FIU A;  3VR1 A;  3FC9 A;  2CQ2 A;  3QT7 A;  2KXH A;  1SJ3 P;  5KFG A;  2QRR A;  2VPD A;  3HSG A;  3LWL A;  4K4Z A;  1XMO F;  1H2V Z;  1JNR B;  1PJ5 A;  4QW8 A;  1G1X A;  4CNY A;  4HKQ A;  3UD4 P;  1VQ6 S;  2PO4 A;  2CJA A;  3IA0 A;  2MHE A;  3QJL A;  2RB7 A;  3B4D A;  2L9W A;  5DLF A;  1VK8 A;  2WSC C;  3J80 Y;  2Y0B B;  3CME S;  2LGG A;  4C3L A;  4KTQ A;  3AH6 A;  3KJV A;  3WDO A;  2V4J B;  3GIM A;  1KEK A;  4OYB A;  4WTO B;  4DV5 F;  3NG2 A;  5KFB A;  2IVF B;  2OO4 A;  4DV4 J;  3IAM 9;  2H0D A;  4CTA B;  3M2R B;  4CLT A;  3T3F A;  2IA0 A;  2QGF B;  4DQS A;  2P57 A;  1Q7Y T;  4X4Q A;  4H4K C;  2IHR 1;  4LF4 F;  4L6V 3;  4JI0 J;  3ZTO A;  2MHN A;  3KFW X;  4KAI A;  1ICE B;  3MMC A;  3MMA B;  1VHI A;  2DGW A;  3DRR A;  3RBD A;  2C1E B;  3KDO A;  4KBI A;  1TKD A;  2UU9 J;  2ZH8 A;  2KXF A;  3CC7 S;  5C2G A;  5KFQ A;  2K1R A;  3MAA B;  2G2Y A;  3DLH A;  4DR6 J;  3LPE A;  3PAC A;  3BGR A;  5KFT A;  3OXL A;  3GYG A;  2AJ0 A;  2W9B A;  3PYF A;  4IOC Q;  5SVX A;  1ZTW A;  2CA9 A;  3SBM A;  2K7J A;  3OTB A;  2RD5 C;  1A7G E;  3IGV A;  2RRA A;  2H65 B;  2VB6 A;  3N28 A;  2FJD B;  1T05 B;  1RT5 B;  5DIN A;  1YIT S;  1R0C B;  2YQ3 A;  1BQX A;  2MEW A;  2A2C A;  4IFY A;  3K0J A;  4G1I A;  2NZ4 A;  5JVG Q;  3LGN A;  1SJ4 P;  1MN7 A;  2WW4 A;  4I0W A;  1REV B;  2H48 B;  3PR4 A;  3TAM A;  2XGP A;  4V3L C;  2KRR A;  3EVM A;  4B7Y C;  2AYG A;  1WWH A;  4P10 A;  4C97 A;  3LQH A;  3I32 A;  1T03 A;  3LRQ A;  3SI8 A;  4GRS A;  1N0V C;  3QGI A;  1VBZ A;  3QJJ A;  3CDB A;  3SFG A;  1MNE A;  2QN6 B;  3KJN B;  1KBR A;  1WHY A;  4PG6 A;  2ZBR A;  2XSJ B;  1W2I A;  1APS A;  4N8N A;  5C2C A;  1N5T A;  1VQO S;  3NKY A;  1D3W A;  2HW3 A;  1RWU A;  3QZV A;  3NGT A;  3C16 A;  5CZV A;  3M30 A;  4JI0 F;  2XNQ A;  3US5 A;  2A6O A;  3JQK A;  4DSF A;  4RW4 A;  1JLB B;  3WX8 A;  1NU4 A;  5C42 B;  2GFF A;  2NXC A;  4YP3 A;  4IFV A;  3NP5 A;  3KLE A;  1I1G A;  3FQK A;  2UU9 F;  1F6T A;  3CCJ S;  4Q45 A;  2ECW A;  4EBC A;  2BEF A;  3OVB A;  4J90 A;  1S72 S;  3CJ8 A;  1VQP S;  4LT6 A;  4IO9 Q;  3QIP A;  3DMJ A;  3NCQ A;  4I64 A;  3E2D A;  3MF5 A;  4DG1 A;  3SOX A;  4DDF A;  1YLX A;  1HWJ A;  2CPI A;  2V94 A;  3M2V A;  2QG9 B;  3AT1 B;  2QEX S;  5A8W B;  3MEG B;  3K8V A;  2R7O A;  2GJI A;  1URR A;  5B75 A;  1RTI B;  3FZB A;  3BYP A;  4C8M A;  1MML A;  1AUD A;  3PG9 A;  4Z37 A;  4ZUX U;  2DNZ A;  4DV7 F;  1E6V A;  1KLN A;  2XOY A;  1RZM A;  5HMY A;  4OYI A;  3AOC A;  5G04 B;  4RWW A;  1WE9 A;  3HT0 A;  1YVF A;  5HJX A;  2KZM A;  4WII A;  4HH0 A;  3ITH A;  4PQU B;  3KKF A;  4CLW A;  3QJP A;  4YB7 A;  2W8K A;  4H4M A;  2V8D A;  1HAR A;  3TAR A;  3FCW A;  1EET A;  1V3R A;  5C13 A;  3LP1 A;  1BQN A;  3I5A A;  1BGX T;  2FZK B;  3H5U A;  2JEJ A;  3QQC D;  1X4C A;  2JFD A;  1S9E B;  4NLD A;  5KFE A;  1FJE B;  3H40 A;  5J2P B;  4RUH A;  4LJM A;  3I31 A;  3QZ8 A;  2EBG A;  5KG6 A;  2LA6 A;  5IT9 U;  2KGG A;  4WFB Q;  2UV8 A;  2FVQ A;  2BVZ A;  4KY3 A;  3FCV A;  4EO6 A;  1TAQ A;  3ISN D;  4Y2M A;  4M5M A;  3I96 A;  4NE9 C;  5HI7 A;  4UW2 A;  2J6U A;  2KRB A;  4CT9 A;  4LR7 A;  4FKX A;  2WK4 A;  1YRU A;  1RCO B;  3HFZ B;  1RTH A;  4JI7 J;  3I6P A;  5J1E A;  4C48 A;  4I7C A;  4YAX A;  5KAK A;  2VG5 A;  1VMB A;  2E5I A;  5IT0 A;  1U1Q A;  4A4C A;  4MFB A;  3H7H B;  2G0C A;  1RWK B;  3JXO A;  2XMM A;  2CDR B;  1SL1 A;  4DPW A;  4EMD A;  3AOA A;  2NR0 A;  5M2R A;  3HVT B;  4Y6I A;  4MK9 A;  4L74 A;  2WON A;  1HHS A;  4KH1 B;  2YY3 A;  1TKZ B;  4AFF A;  1U26 A;  1HNV A;  2YNG A;  5K8O A;  4UY8 5;  3D67 A;  4BLG A;  4HDH A;  2R3V A;  4A8Y A;  1NUE A;  4IRD A;  1LWE A;  4RNH A;  1KHV A;  3AXK A;  1QAX A;  4TN2 A;  2HHP A;  3BZQ A;  2AD9 A;  5J3X A;  4YB5 A;  2YNF A;  1LWC A;  3K58 A;  3OTC A;  3EGN A;  1KS2 A;  1VLY A;  2QYG A;  2UV8 G;  1RWP B;  3J7Z 5;  3JQJ A;  1D9D A;  3SDE B;  1SC4 B;  3IRX B;  1S9F A;  4Y00 A;  5IM0 B;  3BPS P;  5EX0 A;  1X0F A;  1Z2Z A;  2HEK A;  1NJX A;  1RTD A;  4DR3 J;  3KLH B;  1V5V A;  1EHW A;  5LSR A;  4U9R A;  5DDQ C;  2RDI A;  5EDW A;  3U02 A;  3UDL A;  3U7J A;  4HHH A;  2DIS A;  3N5B A;  1SKR A;  3QID A;  3BDP A;  2OTL S;  3MCS A;  2DHX A;  4BWJ A;  3AD7 C;  2BM0 A;  2EG1 A;  5F9L A;  1TU0 B;  4QWB A;  1K0V A;  1IKV B;  2QFJ A;  4LFB J;  1UVN A;  4FYV B;  2LGK A;  4EEY A;  3FM8 C;  5DM7 Q;  2H5I B;  1S1V A;  1HBM A;  2YTC A;  5B7W A;  4CI0 B;  4DZD A;  2KWK A;  4HI2 A;  4KGV B;  2E6R A;  2F8E X;  4DUY J;  4RUB A;  1FX2 A;  1Q78 A;  2M13 A;  1LOU A;  2HK2 A;  2GMJ A;  3IBC B;  3G86 A;  2NSB A;  1NK8 A;  2RI7 A;  3MM6 B;  4Y0F A;  4USV A;  4ZDT A;  4KHM A;  1ZM9 A;  3NGD A;  4IOB A;  4AT1 B;  2DHA A;  2HG4 A;  2W2P P;  2UUA J;  1FD8 A;  1OSC A;  5JXS A;  3C6W A;  5GAD U;  2ZIT A;  2RS2 A;  4I68 A;  2E9Z A;  1FBV A;  2VIC A;  3DLK B;  3K5N A;  2CQC A;  4WYL A;  1QTN B;  2ATC B;  1N5V A;  3PHD A;  4UF4 A;  4DU7 A;  5H1S V;  4Y2I A;  2JSX A;  1MWZ A;  2J7U A;  2B5J B;  2XOZ A;  1LW0 A;  3R5G A;  4DR3 F;  4CH0 S;  2V2K A;  4DQI A;  3TW0 A;  4F02 A;  3RJM B;  2VJE A;  2L08 A;  1K1Q A;  1FEE A;  3T6J A;  1M1H A;  3P5B P;  4O23 A;  5L8R C;  4OZ1 A;  1IXK A;  3RBE A;  1N36 F;  1M90 T;  2W4P A;  4KGX B;  1VQY A;  4U6P A;  4F52 B;  2BAC A;  1F9H A;  4LFB F;  1S0N A;  4X2B A;  2OPR B;  1OPZ A;  2RHS B;  3RAX A;  1WFK A;  1MRO A;  3MFH A;  3CTR A;  4NA2 A;  2D3O 1;  4A47 A;  5KFU A;  4LF5 F;  1Q79 A;  1NJW A;  3WC2 A;  3N9N A;  2D9O A;  2RUG A;  4PXD A;  2VC1 A;  4USK A;  2ACM A;  4QIG A;  3PYD A;  1KTQ A;  5ITH A;  2CZ9 A;  4QF2 A;  3LVR E;  4E8U A;  1Y0H A;  2HHU A;  3VZH A;  3B82 A;  3AJ1 A;  3HKZ D;  3N4W A;  1Q8I A;  3M9O B;  2ZWO A;  4JI2 J;  4EBE A;  2B0G A;  1HD1 A;  2RIL A;  3FAO A;  5LM7 E;  4F67 A;  4OI2 A;  1ZET A;  2E9T A;  1FKP A;  4M5N A;  4M5D A;  2F9D A;  2MQQ A;  4J9V A;  2WB1 D;  1B0P A;  2WSF C;  3U5M A;  3X3U A;  5T7L B;  2IQJ A;  3GIK A;  4NLR A;  2C2O B;  3U1M A;  2HFO A;  4FN5 A;  5DM6 Q;  1PC4 A;  1NB7 A;  1HKA A;  1R3N A;  5ETP A;  1AZS B;  2W4C A;  3G8T A;  2HFN A;  3R7B B;  5A8K A;  2LXF A;  3DI6 B;  4U8V A;  2XMT A;  4IG0 B;  2LDY A;  1C1B A;  3MCO A;  3CJK B;  1UVM A;  3SV4 A;  1RYS A;  4LSN A;  5K9F A;  3RAQ A;  4LAD B;  4F4W A;  5E3P A;  3S7R A;  3D6M B;  1QUP A;  2NQP A;  5A0Y B;  2OLW A;  2LU2 A;  2XMJ A;  2CQ3 A;  1O8B A;  5H9F K;  3LQV A;  2HFU A;  5LOQ A;  3BH6 B;  3RZA A;  1WAC A;  1B64 A;  4DR4 J;  2J76 E;  2F8H A;  3M8W A;  3W5Z A;  3BSO A;  2IDA A;  3WHI A;  4OL8 A;  2RAQ A;  4ERD A;  2HSE B;  1N52 B;  2U1A A;  4GC6 A;  1HBO A;  1TK0 A;  4GB0 A;  5ETQ A;  1WEU A;  4ECZ A;  5D0H A;  1RHM B;  2DGS A;  1XN9 A;  3PNI A;  4JI2 F;  1OY6 A;  1S1T B;  1FKO A;  3KTQ A;  3Q1D A;  2K2P A;  1IR0 A;  3LO3 A;  2AU0 A;  1T9T A;  1YSJ A;  1HBU B;  2VOD A;  4CTA A;  1FRJ A;  3HT3 A;  2JL9 A;  2YNI B;  4C2M A;  4FDF A;  4X62 J;  2LDI A;  5F8I A;  2K17 A;  4IUF A;  1WEN A;  3MI7 X;  4ZDN A;  3SZ2 A;  2J9D A;  2AZ3 A;  3MMA A;  1GX6 A;  2HQF A;  3I5B A;  2HVI A;  4DFP A;  1QVG R;  4Y34 A;  2ZZT A;  1YG0 A;  1X4J A;  3MEE A;  4OYO A;  4MKA A;  1ZPV A;  2NPI A;  2O66 A;  3KWM A;  1S76 D;  4URS A;  5K8P A;  3Q2S C;  4LBP A;  3FVY A;  1YBA A;  5DQG A;  5KH9 A;  3D66 A;  2FVS A;  1S1U B;  2DCU B;  2AKW B;  2IMO A;  2KU7 A;  5IS2 A;  2HZC A;  2HHS A;  3THT A;  3M1V B;  3SQO P;  2KO1 A;  1AXQ A;  3HF5 A;  5ETS A;  5SVI A;  3FGV A;  1S77 D;  1D8Y A;  2FUU A; 
#chains in the Genus database with same CATH homology
 4QQ4 A;  2OUG A;  3QQC D;  3Q1D A;  2M13 A;  2EXU A;  3E2D A;  1DCQ A;  5K3Q A;  2KKX A;  3DWD A;  2E61 A;  3H7H A;  4H9D A;  4Z0R A;  3KDE C;  1NPP A;  3PLW A;  3JUE A;  4OGE A;  2YRE A;  5SVI B;  2FFW A;  2L7P A;  2LAU A;  2CRR A;  4OGC A;  3EWG A;  2P57 A;  3LVQ E;  3FEH A;  2B0O E;  2JM3 A;  3MDB C;  2D8U A;  3LVR E;  4O62 A;  2XP0 A;  2RR4 A;  2MKE A;  3DDT A;  2DJA A;  3O47 A;  3H7H B;  1M1G A;  4Z0O A;  2XOY A;  3T9K A;  2OWA A;  2FD4 A;  2K06 A;  5SVY A;  2XOZ A;  4ZN1 A;  2LQ8 A;  2YVR A;  2XHC A;  1NZ8 A;  3LJU X;  2XOC A;  3FM8 C;  3LPE A;  2CON A;  2CSV A;  1NPR A;  3FJU B;  2JUN A;  1M1H A;  3M7K A;  2KKY A;  5SVI A;  4ZN3 A;  3SUB A;  2CRW A;  2EGM A;  3P8B B;  5SVX A;  2IQJ A;  4F1P A;  3LDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...