2EXUA

Crystal structure of saccharomyces cerevisiae transcription elongation factors spt4-spt5ngn domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
192
structure length
192
Chain Sequence
SERACMLCGIVQTTNEFNRDGCPNCQGIFEEAGVSTMECTSPSFEGLVGMCKPTKSWVAKWLSVDHSIAGMYAIKVDGRLPAEVVELLPHYKPRDGSGSATIWGVRCRPGKEKELIRKLLKKKFNLDRAMGKKKLKILSIFQRDNYTGRIYIEAPKQSVIEKFCNGVPDIYISQKLLIPVQELPLLLKPNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Saccharomyces cerevisiae transcription elongation factors Spt4-Spt5NGN domain
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Transcription initiation protein SPT4/SPT5
total genus 51
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2005-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06093 Spt4 Spt4/RpoE2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.210 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2exuA01
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 2exuA02
1NZ8A 3H7HB 1NPRA 3LPEA 2EXUA 2XHCA 4ZN1A 1M1HA 1NPPA 2LQ8A 3P8BB 3QQCD 4ZN3A 2K06A 3H7HA 2OUGA 1M1GA 3EWGA
chains in the Genus database with same CATH superfamily
5IT9Y 2YKNB 5IWAF 3KDOA 4X4PA 1ZPWX 2Z57B 4ANDA 4FF4A 1OY9A 1TKDA 1Q82T 3CDAA 1WI6A 2MLZA 3PRBA 2ATCB 3UO0A 2WK4A 4KHPJ 4LK9A 9RUBA 1SC6A 4YP3A 3ONQA 4OYXA 3CF5Q 3FQLA 3IR5B 2XOCA 3DMJA 1VQKS 2KZMA 2AZ1A 5EWEA 1N0UA 2C3YA 1VK8A 3M4XA 5L38A 1ZYQA 5EN1A 5HQ8A 2ZBPA 2O66A 1M5OC 1S59A 2XNQA 5E2QA 1SBRA 2CAJA 3GE9A 4USWA 3OSNA 2PA8D 3EGNA 1S5ZA 1ZPVA 3A1YG 3DOKA 1X4UA 3O6QA 2ZM6J 1UWBB 3PEHA 1S57A 3KHRA 2YVRA 5DKAA 2GHPA 4IFYB 5H1SV 2FVRA 2DCLA 1U25A 2X3DA 4OX8A 2ASJA 3AHPA 4ED5A 4B9MA 3LP0B 3OXGA 4XIUA 1BQXA 2HPUA 5J2PA 1LXJA 3PACA 5E3CA 1GFWB 1TMJA 2ZFHA 1FJCA 3FDSA 4LBPA 2WVEA 2E1MC 2IVFB 2WVFA 4QIEA 3H5SA 4F3MA 2KRRA 5J2QA 3KLFA 3DRSB 4B02A 1U1QA 3IMQJ 2H4YB 4HVZA 2D74B 2Z0GA 4CLPA 1RADB 4CLYA 2UU9F 3QZ8A 1NJYA 2HFUA 4ELVA 2YU4A 3KLHB 2FYXA 2G2OA 3JUEA 3WC0A 3O33A 3N9QA 1J27A 3R5JB 4WXOA 5CZVA 1KDNA 1XNQJ 3FBCA 3LGMA 1S97A 2KT2A 4LIWA 3HF5A 3ZFVA 2C3OA 2XO7A 3PUQA 3VVUA 3W60A 1RU1A 2DIUA 2DISA 3GYGA 5GADU 3BGUA 2CADA 2DGQA 2D8UA 4WFBQ 4TU9A 3CC2S 1D09B 1S7HA 2J9DA 1OPZA 3OR2A 1UTAA 4FNHA 4P71A 1VQMS 1TR0A 1HWLA 4WU2A 4B3MF 1N8RT 2DR6A 3CD7A 1HNXJ 1R8HA 2DEIA 5F9LA 1JLCA 2XHCA 3VALA 3MEGB 2MQPA 5GAEU 4K59A 3GLJA 2B0GA 5KFMA 1HNWJ 4QYZJ 3M9MB 1VBKA 2YQ1A 4WE1B 2VUGA 3I0RB 1YX2A 3SI8A 1CJKB 5F3TA 4L76A 3IWXA 4F36A 3TUZC 5F8NA 1T0TV 2HNZA 4F2SA 2QMUB 1EX8A 5BR8F 5DQGA 3D2WA 4MJKA 1T9VA 4DQIA 1RT4B 3JAMU 2FJAB 3H59A 5J2NA 2OPQA 4P2MA 4X66F 2CSVA 3DQVR 2BYCA 5HVGA 2UUTA 2Z2LA 3MUVP 4PRFA 1FESA 4F7VA 1TP7A 3M6XA 3T1AA 3PW2A 2MNYA 4FKYA 3OUYA 1C1BA 2DB1A 3J7A1 3MURP 2ILZA 2VFUA 2H0DA 2CQIA 3DDKA 4ZP7A 4A48A 2XP0A 4QF2A 3OTEA 1NSAA 3DOLA 3POTA 4UI9B 3QT5A 5K9FA 1AUSL 4WTYA 4X4RA 2V9WA 3I5BA 4PPEA 2Z30B 4R0EA 2MQQA 1SKSA 4DSKA 5GMDA 2EODA 2QSFA 4HHJA 4Q44A 2ATLA 2K17A 5DQHA 5G4DA 3MUTP 4M5JA 3BF4A 3N0VA 1KVIA 1AT1B 4ZS6A 4XAKA 5B0BA 1WG5A 1FWKA 4OFZA 3HCXA 3IN5A 1YVFA 2X7IA 2KWNA 2XWXA 3BPSP 2EGPA 4M5KA 3T6RA 4IRKA 1NSPA 2VPBA 1CS4B 2VL1A 2CA9A 2DXEA 5KFHA 2RKIA 1BY9A 1APSA 5CYMB 4B08A 3W65A 2CQHA 3RJMB 3K5PA 2P57A 4DUZF 4CNYA 2LDYA 5ETLA 3K7RA 4F1PA 3L95X 4DPTA 5JUMA 3D7SB 2Y1JA 2E9RX 3MAHA 3OL6A 1UA1A 1T05B 1TUVA 1ZA1B 4RW9A 1GTEA 3IGVA 4ZPDA 3KLGA 3T1HF 1D8YA 3N9OA 1KWMA 4YBMA 1WEXA 2V8PA 4ZCKA 5GVQA 4LSZB 5A6WA 3MM7B 2OFHX 3O5TB 2WAQD 4NA3A 4WK3A 1EHWA 2EXUA 2JNJA 3FMWA 1FI4A 2CQBA 5LSRA 1CJUB 1S1VA 2DH9A 1RHJB 2DNMA 1FD2A 2V4JA 2XMTA 4I2PA 3BR9A 5I42A 2CWXA 4CO5A 3UCZP 2QLJB 3KWMA 3WIVA 5ETKA 2BJEA 4C2MA 4OLOA 4C3KA 3EYZA 2IM0A 3HDSA 3RAQA 1P9QC 1IKWA 3E2DA 2VFRA 4ITSA 4XDCA 1VOMA 3RZAA 4AD6A 3Q2TC 2D3ZA 1IUJA 1OYDA 3GYXB 2V8HA 1HR0J 4DWIA 1RQ0A 4O4GB 1MWQA 3P8BB 2CVIA 2B4VA 4DV2J 1LFWA 2HBZB 4Y28C 3RGIA 4DUYJ 2ACMA 2CRRA 1FDNA 2VDIA 1U49A 2L5UA 5HQMA 2CPYA 3SOWA 1FDDA 3R2DJ 2ALYB 4DN9A 2ASYA 2EEYA 1L3TA 2OPPB 3CPWR 2XI3A 4WWSA 2CQ2A 5SVYA 3MM5B 1Z6UA 1Y5IB 3D1QA 4DEZA 3HHLC 2BAYA 2ZZMA 3C5KA 4AUQB 1LWFA 2HKEA 2DKOB 3A12A 1AA1B 3K89A 3NGRA 3WZ0A 2AX0A 1JXLA 1MSWD 2RSQA 2ECTA 4C0OC 4KQZA 4J91A 3I6PA 2BKOA 3ZTGA 2BEFA 3SIPB 3JSRA 4NWBA 2J76E 2ZBIA 3J80U 1ZM3A 4LF5F 2RRAA 2CONA 2D7SA 5D6GA 4IOCQ 3CCJS 1WE9A 3GJRB 4H9DA 2RDDA 2CQGA 5CZXA 4CYUA 1EP4A 4KIAA 4KGMA 4ERDA 2UXDJ 5B0DA 3ZZ0A 2NQPA 3QQCD 3JSMA 3O1LA 2V68A 2WBRA 2RUSA 4PXBA 2L41A 3BSOA 1VRUB 1WHYA 4ECUA 4OI0A 5KT4A 4RR5A 3A3NB 3KNVA 5FDLB 3BYRA 4GVBA 2CQPA 1N87A 5AE2A 2W25A 2BJ8A 5J2QB 3U5MA 1NB2A 4EK2A 4DR5J 1RTDA 1REVA 2V8DA 3M9NB 5KOWA 2KKYA 2BKPA 4I69A 3OBIA 2LXFA 5E3PA 3M62A 1X4CA 5DQIA 1TK8A 1M90T 1N5YB 1H38A 5CYQB 5CXTA 4PWDA 4JV5F 2CZ4A 4ICLB 3NWRA 5E3AA 4JI2F 4CLZA 2LRIC 2CQ1A 4MIAA 1RWMB 2GVZB 2IBKA 1FTRA 2ZBRA 4EYIB 1H0HB 2QEXS 4RW6B 2X1BA 2XOZA 3LVRE 3KV5A 4EBCA 2GV1A 2NXJA 2PEBA 1CC8A 1E6VA 3MM7A 4LF7F 5L39A 1RYSA 5IT4A 3UR0A 5IQ6A 2XGQA 2FJBB 1HR0F 3H7HA 2VDHA 4YADA 5HMZA 5ETNA 1RT2B 1VYXA 5CA5A 4Q6FA 4QWDA 3C6UB 4NLRA 2BX6A 1IVZA 4P2FA 5KFQA 5DG9A 1S6PA 5C7PA 2I50A 1YBTA 4ES2A 4RPFA 4AL7A 3ZPVE 2L9DA 3TA1A 3BO3A 3KLEB 3KLVA 2VBXA 1CS4A 3RRHA 2VOOA 5I3PA 3K17A 2HNYA 1DTTA 3IBFB 3NGSA 1NO8A 4M8LA 2J6SA 1N33J 4DCPB 3H4BA 2YKQA 3OUYB 5L9NA 1Q8IA 2EFQA 3GCWP 3JS9A 1S0NA 4JV1A 1REVB 4KHRA 1U2CA 4OI3A 1KSPA 3Q8QB 3IR7B 3T1HJ 3OR1B 1R27B 2N3LA 1RA7A 2CNOB 3GP9A 3AY0A 3KYLA 2BANB 1U02A 4BLGA 4DLEA 1SB6A 2QO3A 2Y1NA 3BKUA 3KK1B 3HPOA 3MCNA 2GQQA 3QFWA 5ETRA 3CMES 3SFGA 4NLXA 4PUOB 2RNEA 4QR2A 5J2MB 3GIKA 4DL4A 4PQUB 2LYVA 1XERA 2H9ZA 2XSJA 3HSDA 4DLGA 3NLCA 4EZ6A 2VJEA 4PCQA 3VAKA 1I1GA 4IOAQ 4LF6J 2ZH3A 1JNZB 4W92B 3T5LA 1ZM4A 2XZDB 2VG5B 3HD1A 5IC6B 2QA4S 4FVMA 4C3MA 3L1XA 2GCFA 3HSGA 1HQ2A 2V9KA 4C4WA 1R8BA 2RIJA 1DLOB 2UUAF 4F67A 4J7CA 3V2UC 2MKKA 5KT3A 1N5TA 4X64F 4ZKAA 1YHQS 3HFZB 4OZLA 3B6BA 2UZAA 5K5MA 1RT7A 2SXLA 5K20B 1SJFA 1KD1T 1WDDA 1QLNA 3NY0A 1ITPA 3JQKA 3OLAA 5IXUA 2F4FA 4WP9A 3W1YC 1N0VC 3AJDA 1UVJA 1QAJA 1G2EA 3H2UB 1IR1A 3P5BP 4DUTA 5TRBA 3TR5A 1RT5B 4JI1J 2Y0SD 1ICEB 2H5EA 5J1EB 3MHYA 1PGZA 1UMJA 3MR2A 2FJXA 4B3RJ 4K4WA 2PC6A 3TQ1A 3TEGA 5LJ5Y 4HKQA 1XQIA 3LA0A 2FJVA 5KG7A 4C97A 4Q8EA 2XCPA 3M9OB 1SJ3P 4J9MA 5BJRA 4LMZA 2ECJA 5C2CA 2BRKA 3VTIA 2XG8A 2X1AA 2DRBA 3QJJA 4DR4F 3A8IA 3HHDA 1HWKA 1QVFR 3ILOA 3EDRB 3PKYA 1FFWB 2EBEA 4OYAA 5IM0B 3FANA 3O70A 2MLXA 2RMLA 4FF3A 3JTNA 4RWWA 4IC2A 1JJ2R 4C8OA 2VPZB 2IM2A 5DO2A 5AE1A 2FD4A 2JZ5A 2HS0A 3C14B 4ID5B 2FLNA 5TABA 1CHCA 2YT5A 1U7LA 1E6YA 2KJVA 3GQCA 4K5RA 1Q81T 3Q83A 2CNKB 3KV6A 1VLOA 4RW9B 3TQEA 4CRJA 1T05A 2FUG9 3ZTSA 2DO0A 3R5GA 1XWHA 1F3VA 5D1KB 1RTDB 1NRKA 1RAEB 2KDOA 2PE8A 3LAKA 3P96A 3RYLA 3W2VB 2W2NP 4N7TA 4CIOA 5HK4A 2OSQA 3A3PB 2DHHA 3IC1A 1NK5A 2DBBA 2R3VA 2F42A 2GVDA 4YB5A 3EVOA 3HMJG 2CQ4A 3QWUA 4PXEA 2Y43A 4RO0A 3M8PB 1RBLA 5HQLA 1KVKA 3ILIA 1Y00A 3QNWB 5LSLA 4YMEA 1K73T 2DRAA 2KN4A 3H42A 3ET6B 4AL6A 1U1LA 4LLBA 4LJNA 4FF2A 3M7KA 1VIOA 4DV7F 3SQOP 2VJEB 4A8MP 2Q79A 1Q8BA 2DGOA 2XSJB 4JI6F 3NNCA 1IKYB 3GG0A 1JLFB 3MCMA 1M1KT 2ADCA 4FJCA 2F8HA 2R7VA 2HSEB 4FXVA 4NLOA 5F41A 1G1XA 2PGCA 2KKXA 1HW8A 2M13A 1HBUA 2CIMA 3HJVA 1Q16B 4PQAA 1R3NA 1HD0A 2LFVA 4O3QA 1N34F 1LDJB 3G8QA 2WW8A 4OYZA 2HVHA 2DHSA 4DPYA 5T7LB 3TO8A 1U4BA 2CJKA 2CT2A 3E01A 4RZRA 4JI8F 1L5UA 4O3SA 2R7OA 3FK4A 3QFHA 3RPGC 1SL2A 1YJTA 2BVZA 2V34A 3AQPA 4OZ1A 2NXCA 3IRWP 5KFWA 2BJ1A 4DDFA 1PC4A 1NKBA 1FNOA 2E6SA 1RYRA 1N32J 1VQ7S 2JEGA 2CRLA 1QSLA 4W98A 1PG5B 3KNGA 4RBUA 4KFBB 2MQNA 1U2FA 2QL5B 1XNRF 3JTOA 2BUNA 2YREA 2HHPA 2MB0B 1FWPA 4AFFA 1LW0B 2HQ3A 3L9ZA 5EUHA 4KKOB 4DUZJ 1JJCB 2EK6A 4KPCA 4W90B 3F0NA 1IKXB 4CP5A 1DQ8A 2WOMA 3CJTA 3NS6A 3QYYA 5HMXA 3RB3A 1XNRJ 3RPGB 4URSA 5FD1A 1UPPA 2F3JA 2EWHA 4Y3CA 1N5QA 4LF8F 1FFGB 2B4UA 4RUAA 2ECNA 2IQJA 4O44A 4BC9A 3ITHA 5H9EJ 1VQOS 2E1CA 5A8KA 2HNYB 3X1LB 5T41A 1U8SA 2V2KA 5CQGA 2EPIA 2N82B 1RTZA 2R8KA 2IFXA 2CG4A 2A0FB 4RX6A 5K14A 2WSCC 1AZSB 2XOYA 4A8YA 3IWNC 1FJ7A 1O6XA 1OQ3A 1V9OA 2HS4A 2VZ9A 1B70B 4IYQA 4P75A 5D0EA 1GXTA 2J0QD 3QO9B 1HBNB 1UKUA 4DR3J 2DHAA 3FBBA 3BDPA 4O0NA 1XR5A 2GQ2A 2VPEA 4FXWA 4OHXA 4DX7A 2ZHAA 3WC2A 3TA2A 3UVJA 2ZUGA 1DY3A 4IFYA 1BQMB 2V4RA 2OH2A 1WEQA 3IFEA 2V63A 1UWBA 3GIRA 4IKAA 2PMZD 2DNNA 2ZKTA 1WEOA 2Z8QA 1VQ8S 1CULB 4QIFA 4CA1A 3GB0A 4TU8A 3J81U 3M32B 1LW0A 2YX4A 1NHUA 1DLOA 2XYGB 1SL1A 3NAIA 1Q1KA 1QM9A 1X4GA 2ZZNA 2YNGA 4QBUA 3CD6S 1KOOA 1PCAA 4H4MA 2ROEA 1FT8A 2JC1A 2JMJA 1WOOA 3UD5A 1EKSA 1GMUA 3VR1A 2P8IA 2MKHA 3QRPA 2BOPA 4DZ6A 4WIQA 1C0UB 3WIUA 3M05A 1V5VA 3N5FA 2HQGA 4WKRA 1Y9OA 2QT7A 5D78A 1S0MA 2M7SA 3E01B 1K2FA 3ZVZB 2RS8A 4WP8A 4R8UB 3CCMS 2XHWA 2VPGA 4WBFA 4LQ3A 2D1CA 3ZVYA 2DH7A 3EVWA 3BDEA 3MPYA 3R5DA 4KH0B 2MGZB 1WTBA 1RMDA 1PAEX 4F2RA 2FGCA 3M6WA 4BWJA 1WC4A 4ZPBA 3HHLB 1T94A 2I6WA 3L11A 2PO4A 4R8UA 1MN7A 3QZ7A 4AVXA 1CJTB 2AQ4A 1FO1A 2KO1A 4V1Ak 2FLOA 3SCIE 2NLWA 3DPLR 1HQEB 3MMCA 1IKYA 3N4WA 1KQSR 1EKRA 2MQMA 2MY8A 4KGZB 2VFSA 2M0GB 3TX8A 4K4TA 3T3FA 3FFIA 1NK0A 3R5BA 3CB4A 3I0RA 4RW4B 2E9TA 3TZXA 3M2UB 2OELA 1UAWA 1NPRA 4JUZA 2HVEA 2GGPA 4QCLA 3CJRA 2VP7A 4RBVA 2DR8A 2Q66A 4HDGA 2E7XA 3MPWA 7FDRA 4ECZA 1T8EA 3W8GA 3Q1DA 1YWXA 2K2PA 2LXIA 4B9UA 2RJZA 3FMBA 4OJGA 1LXNA 2BA9A 2HRUA 4USJC 1VGYA 3TOQA 3EZ5A 1VYAA 2YKMB 5IQQA 2M5YA 1YSJA 2APOA 3IGNA 2UXBJ 4ZJLA 4CLLA 2B6AB 4KRWA 4TYBA 3QSYB 3CGIA 4ECRA 4EO8A 5D1MB 4DV0J 4I2QA 3MD1A 1OIAA 2OXQC 1YDLA 4ELUA 2Y8YA 3NS7B 1IWGA 4B17A 1Q7YT 1G3OA 3K0JA 2KM8B 5HVHA 4FO9A 1YIJS 2G0IA 2YYRA 1MMDA 1S1VB 2CDRB 2AEJA 1QD1A 5C11A 3KMQA 2KFZA 3GL6A 1WWHA 2FZCB 1LQ9A 2EKNA 3UE2A 2XLKA 4RLEA 1H98A 1NDKA 1RWNB 2DNQA 2WOMB 4P52A 4CWBA 4LVNP 5IM0A 2KJWA 2WB4A 3LGHA 3BKTA 2N4DA 5DS7A 5IOLA 2XGPA 2RDJA 2QMWA 1LDKC 2ZWPA 2HGLA 3I0SB 1HBOA 5I3LA 2QE5A 1S4EA 5LXRA 3G8SA 4O44B 1N88A 1UW4A 2VJVA 3BREA 1ZA2B 4ZMMA 1PO6A 4YBSA 4BHQA 3OL8A 3CO0P 4WFAQ 4P5OB 2RVJA 1BLUA 2VBZA 4RBTA 4Y6IA 4JI6J 2N3OA 3DRXA 4TY8A 2Z58B 3W7BA 5AXNA 1DURA 2HWTA 2OFGX 1U6FA 3I9V9 4YATA 1RHQB 5L1LA 2OSRA 3RB4A 2NSCA 2UUBF 5EYAF 4ES1A 5KFOA 2DNKA 5H1VA 3OW2R 1KBRA 3I56S 1R0CB 3LANA 2NREA 2UUCF 4Q7AA 3PO5A 1YRXA 4UOHA 3TVZA 2KYUA 4JI3J 1N4LA 1CJVB 1Q8KA 1ZOTA 3TA0A 2MZ1A 1TK5A 2ZZTA 2M3DA 3MFHA 4JYAF 3OSPA 2C1EB 2XMUA 1KTQA 1HQEA 4PUOA 2HHHF 1JLBB 1J5EJ 2IMWP 4ELTA 2ZH4A 2I2YA 4CQ1A 4P72A 5DDPC 2LGVA 2PNXA 3M8YA 2VPXB 5B0CA 4LRFA 4PPDA 2HHQA 2XS2A 5AITA 2OIHA 4X4NA 4OZJA 2IJNA 4ZCMA 1HBUB 3B8HA 5KFKA 2EI5A 4JB8B 1VQLS 1HI0P 2DPIA 4DF4A 4MVTA 2G4BA 2LEBA 1WG1A 4NA1A 1KN6A 4DV3J 1TL3A 5I3QA 5KFBA 3KLHA 1N54B 2MT5A 4NLPA 3DGPA 3N6LA 1V6HA 2GVDB 3THPA 4CTAA 1JLGA 2ZH1A 2IAJA 4UZBA 2D41A 2V69A 1VC0A 4OMFG 2FZGB 5AXLA 3TZWA 2MSSA 4I0WA 4Y00A 3KK3A 2H54B 1RXOB 4R7EA 3ET6A 1JLCB 1NU4A 4DR5F 2A3JA 2NYIA 2DIVA 1UVIA 3P4UB 4YB1P 1X5TA 5LCWB 4K4UA 3E8OA 2M85A 3EX7B 2YH0A 1AUDA 4M5IA 2RRNA 3C14A 3O34A 4ID5A 5A8WB 3Q22A 5HROA 3VQTA 5DDQC 4TLQA 2F9JA 2FHKA 4J5OA 4CO4A 1F62A 3T1YJ 4RNHA 5TDWA 3Q8SB 2OTJS 2U1AA 1YG0A 2VPWB 1WF2A 3Q8YA 2KR4A 4ZPTR 3CJ4A 3SDEA 3DNCA 4EMDA 2ZH7A 4NRTA 1VQ9S 1JLEA 4TQSA 3N9MA 4W4UA 4HH1A 4LFCJ 4U67Q 2B9YA 1EETA 2XYHB 4RW7B 2LKZA 5D8HB 1VBXA 2MKEA 1PYOB 1UFKA 4L75A 1N33F 1UEUA 1AFJA 5KFLA 2XY7A 3KJQB 3GILA 4QZVB 2M1RA 3DGPB 1MROA 1IBKF 1IXKA 4ER8A 3R6LB 2NUUG 3LPEA 2CQDA 1LKZA 2CUYA 3AD9C 3PEJA 4K7QA 4W4MA 2D8SA 4F0KA 3D6FB 1D0EA 2VV5A 1KVJA 2GC8A 4ZUXU 3LUYA 1NM2A 1RTIA 2B5JA 2H65B 4DFJA 3UNGC 1XWLA 2CPJA 3SYZA 2MJUA 2DNRA 4QIGA 5KFPA 3Q86A 4GO5X 2CWKA 1VRUA 2M70A 1U0HA 2DYAA 1OMSA 3F44A 4DHVA 4EI2A 4DV4F 2HHVA 3C66A 1JWWA 2A2CA 1RP5A 3PM9A 3EB5A 3EMTA 4FDFA 3U5OA 2K7JA 3ILJA 1WENA 4OZ0A 1FE4A 3DXBA 4CLKA 3FBFA 2VFTA 4KTQA 4I67A 2O67A 4OV6A 4JI2J 3BN7A 2RRBA 4ZK7M 4DQPA 5FERA 3D5MA 3FCVA 4NN2A 5M2RA 3W2WA 5DG7A 3ENVA 1F5AA 1S77D 4LFBF 4V3KC 1FRXA 1S6UA 1U24A 3BQ0A 2HRTA 1KONA 2MKYA 3EWGA 3FJ2A 2J9CA 1X4BA 3MECB 4ED8A 1KFDA 4DV1J 2KFNA 1MBMA 2E1AA 4NXMJ 5BYQA 4GNEA 2K7KA 2YX1A 4CT8A 3GV5B 4FYDA 3LP2B 1YBAA 1V3SA 1U8WA 2B7CB 1DHMA 2OEJA 2ZKUA 3AJ2A 4U7UK 5D4LA 3HT3A 1NK6A 4LRCA 1BQMA 1NSQA 4ED7A 3B4DA 2BJ3A 4DOZA 3ZPV1 1VJWA 3DHWC 1JLFA 2GMLA 5IV3A 2OMOA 1NSKL 1RTHA 3V6JA 1T3NA 1EB0A 3PJ9A 1H7WA 1QUPA 3MEDB 1X31C 2OEKA 5ETTA 4QPXA 3MR5A 1SKWA 3CULA 3QATA 2Y8WA 2D3OR 5DLFA 1FRMA 2D3UA 2JFDA 4QR0A 1TKZB 2YNGB 2XMAA 3IS9B 4QQ4A 5CABA 4X65F 4IG3B 1YJNS 3JTPA 2GO9A 4HR2A 5H9EK 4UY85 1TKXB 2MLYA 1RHKB 4IDKB 3IWLA 4WFZA 4I68A 3SV3A 2COLA 4CLTA 4U96A 3V6DB 1RABB 1TQLA 3BM7A 1QAXA 3C15A 4YFUA 2MQLA 3GFHA 3TAMA 5E41A 1U1OA 1VIXA 4C9ZA 3FJUB 2CZVC 2ZWOA 5EHHA 2YKMA 4DQSA 3TAPA 4ED6A 2HZVA 3QMQA 1HLWA 2JX2A 2OD4A 4PAAA 4YHHJ 3H7HB 3I82A 2A2DA 3ILLA 3OPKA 3J7ZT 3LALA 3OTBA 3HT0A 4LREA 3KDEC 1X5OA 2GMJA 3OXLA 5HL7Q 4FBTA 1RAFB 2XO6A 1WEEA 1F2HA 1HMVB 2IRYA 2JC0A 4KB7A 3TRGA 4GKJJ 4H4KC 1NUEA 3GJQB 3MAAB 4C0BA 2HVZA 3D54A 4LSNA 3TUPA 3TAQA 1UW9A 2JEJA 3UD3P 2MEWA 1WC6A 5AT1B 3ITHB 3CCLS 1N52B 3O2IA 2ASLA 3M8SA 3SOXA 1LWXA 1WFKA 2HK2A 4N56A 1Q86T 4BDPA 3ELHA 3LPYA 2K4DA 2RAQA 3Q2SC 2P6TA 3HZEA 4OYBA 4WIIA 2F8MA 2YXLA 3ZZRA 5HP1A 2D3O1 1Q5VA 1WELA 5KFAA 3KHLA 2GZOA 4QIWD 3ULHA 1W7WA 1T03A 3MECA 3HXMA 6FD1A 3TX0A 3DI6A 1RDRA 3GFYA 5A76A 1RAOA 3PVXA 2DY1A 2C28A 1L3UA 3C3LA 4KYZA 1XNQF 2DNHA 2YNIA 3IAS9 3JQJA 4HHHA 2ZH6A 1IBKJ 1OY6A 1M5KC 3EPIA 4FS1A 5A8RB 2W4DA 2EGMA 3MHSA 1FDAA 3ETMA 3OFHA 2DGUA 3PRVA 3UFCX 3DLEB 5KFEA 4UUWA 5D0RA 1YLXA 2KG1A 1HQUA 1ACMB 3AXMA 2CPHA 1MU2B 4Y2MA 3WHIA 3O36A 2XLIA 5A2QU 2EFOA 4DPWA 4M1KA 3NGTA 2E9ZA 3UN2A 1JM7B 2JUNA 1NZ8A 2JRJA 4UUXA 5C42A 1G25A 1W2BR 1YRTA 4OX6A 3O44A 4NZ7A 4PEOA 3GR0A 4YBTA 1L3VA 2BJDA 3DC2A 2NYHA 1TMMA 2AZ3A 2Q6BA 1Y4ZB 4YR2A 3G8TA 5HO4A 4FF1A 2UUWA 2G45A 4ECXA 3O3LA 4DSFA 3M2VB 4ZVEA 4MIBA 1G7CB 4QYZK 3I4PA 2BMBA 4RW7A 5E33A 1KEKA 2MKCA 1PSDA 3G87A 1IM4A 2ZDOA 1WSRA 5RUBA 1XK8A 1FEHA 3T7LA 3NP5A 3NCPA 2L43A 3AB4B 5SUHA 1MROB 4OI6A 4CO0A 4LF4J 2P5VA 4FP9A 2BJ7A 2OJ3A 1M1HA 4NYPA 2XS5A 2F63A 3G6XA 2HRYA 2B51A 3B82A 5DGAA 2AGQA 5KFZA 3DOKB 3P3DA 2VFVA 2WTFA 2GX8A 1NDCA 4NE9C 1K1SA 2BRLA 1FRKA 3E3XA 1YJ9S 2ZITA 2JLGA 2QLBB 1FK9B 4MK8A 2EFVA 2AYGA 2HHUA 1KR4A 1M1GA 4MK9A 4HDHA 2AD9A 2HFNA 4LADB 4RU9A 4YABA 3U1NA 3J7YI 4A4CA 3TW0A 1HNIA 2CSYA 1JK9B 1DVPA 5JG6A 2AKWB 1WTFA 1Y3JA 2FHJD 3GR1A 4DCOB 2V8VA 4A8SA 3IBCB 4QIVA 1CPZA 2Y3YA 2OMLA 4YN3B 2FHJA 1I94F 1YQHA 8ATCB 4PXDA 5KFVA 1NXIA 4IR9A 1ZM2A 5DZ6A 1UJ6A 2F8EX 1HNVB 1MG7A 4UF4A 3HHNB 1FKPB 4I7FA 3IRXA 2CSZA 1YZ7A 2UUCJ 4Z7CA 1V3RA 4CM0A 1S9EB 4UY8T 3FEZA 1YJWS 4RW8B 4N41A 2AYEA 4HH0A 2F40A 5FB1A 2FVSA 4LT6A 2JEFA 3DLGB 1H73A 2W9AA 3DRPB 2LDIA 3IHPA 2G2ZA 2POKA 3DOLB 4F25A 3VF0B 1BWEA 2E5JA 3ETOA 2RI7A 3M2RB 2KL8A 5KFXA 2UVUA 5C2GA 2HGMA 4QWAA 1VR6A 5TBNA 3EB6A 1CJKA 2QIFA 4CYUB 1GX6A 2LXUA 1F5CA 4CDIA 4NOHA 3V81B 1XMBA 4DV6F 3SOUA 5AIUA 1WOPA 2RT3A 1SUQA 2YQ0A 3GFZA 4ZJOA 2W2MP 4DI6A 5DDRC 4ZVFA 2OPQB 3PW5A 1JKHB 4C8KA 3DLKA 4KPYA 1RT4A 4RWXA 1Z2ZA 3VGSA 1PJ7A 2XMVA 1RAIB 1WHXA 3N28A 2R7UA 2J0WA 1UCNA 3D28A 2RDIA 4OLPA 3PJWA 2W7PA 4B3OB 1JKHA 4B3TJ 1UVMA 1ZS6A 4LSLA 4ZVPB 4AQYJ 3HVWA 3Q89A 1FRIA 5A2QY 3Q24A 1B7YB 2DNOA 3W2VA 2MIQA 2AEFA 2CPXA 3D3BJ 1FCAA 2OPPA 5KG2A 2I5JB 1K47A 2XC9A 3QJLA 3QIPA 3W8PA 3IM8A 1MM3A 3EPGA 2CG8A 2DXFA 2CPIA 1FDBA 1RT6A 3OR2B 2DR9A 2HHXA 3K8WA 3RRKA 4WTOB 5M2UA 1S6QA 1TKTB 2OUGA 3BZQA 3MEKA 4QF3A 1VISA 3QAEA 4E8UA 2HDPA 2VONA 2QA4G 1R8CA 2B7BB 4OYOA 3MMBA 1HBMB 1CQMA 4ZITA 4U6PA 3GG1A 1N32F 4WFXA 5B0EA 3R5AA 2W7OA 1PC5A 3MFIA 1YJRA 1RK8A 4N5SA 4O3PA 5KFYA 3L3CA 2MZSA 4WJBA 1KFSA 2A10A 1HBMA 2J7KA 1X0FA 3QPIA 2HMIB 3W5XA 4ETZA 1T9YA 2DGTA 4JI8J 3PYFA 3B78A 5FDLA 2MA5A 2W8LA 2KZZA 2MY7A 3M6UA 3ISNC 1Z1ZA 2RHQB 2RF2B 3IG1B 1MWZA 4URGA 1DARA 4Y65A 1SV5B 4ECSA 2ABYA 4F52B 3M30B 3NGKA 4WFNQ 2HGNA 4C0HA 3UDVA 1U48A 5DINA 4KGKA 5HI7A 2IDLA 2V2ZA 3D3CJ 3M7VA 1HYJA 3UDEA 5A8WA 3DLJA 2VOPA 2IA6A 3U02A 2HBYB 3PV8A 5M2PA 5EGYA 2V8GA 4E98A 3MMCB 1TUGB 2CZ9A 2ZHOA 3UD4P 4I6YA 1HWUA 2LGLA 1EIYB 3SHBA 4ZCLA 3DFEA 3TNVA 1TAQA 3K8VA 3KJVB 1Z4UA 1O0PA 2VG5A 1BXNA 4PYAA 3FNNA 4CLWA 2DNLA 1OQ6A 3S01A 3K5MA 3THVA 1SVDA 1WHWA 2CJ9A 4RW4A 4DL3A 3V81A 1ZZNA 4Y34A 3TI0A 1TVRA 3FFIB 2ERRA 3DDNA 3CC4S 3KHHA 2G6QA 1T9TA 3NKYA 4NCAA 3HK2A 4KR0B 2Z2ZA 5L8RC 2LXHC 2GJIA 3DI6B 4ED0A 1WC5A 4IG0A 5HLFA 2YKAA 2H0DB 5MLCV 4AL5A 3PCOB 5F3ZA 1N36J 3DHXA 2DSMA 1HPZA 2E29A 4I6AA 4ECQA 4IRCA 3CJKA 3ZZOA 2ECVA 2DNYA 2B9EA 4HT7A 4ID8A 5F8MA 5LT5A 4DR3F 3R1LA 4JI7J 4DXLA 2AJQA 4IO1A 2IVYA 4F4XA 1VQYA 1HNZF 3KDNA 4RUHA 3CC7S 2VNFA 1KHWA 2J9DE 3CMQA 3WX4A 4I7FB 3CD5A 3MR7A 1R7IA 2C2NA 5KFFA 2JMIA 2IMOA 1RWOB 2R42A 3GU0A 4F3QA 4RU2A 3C19A 4OGCA 2EBGA 4K2XA 1EQ0A 2DHGA 2AJ2A 4GC7A 1IBCB 1S1WB 5KH9A 2R7QA 2X1GA 4U9RA 1FXLA 1RTJA 1SXLA 5J2PB 2M3HA 4RKUC 3PDNA 4DV3F 2F1FA 4NLWA 4BC7A 4L58A 1JJHA 4OHWA 1HHTP 1WKKA 4I64A 2KRBA 4XPCA 2X1FA 2L80A 1U26A 2UV8G 1U0HB 3TZYA 1T03B 1EARA 2D9OA 1FERA 4KAIA 2OWAA 1BORA 1SPBP 2YWWA 4JP8A 1VBYA 4K8RA 3OJSA 1Y0HA 2JHEA 4OX9F 2HK3A 1CSJA 3PW7A 1VHFA 3PHTA 2HNDB 2JVOA 3HVTA 1EQMA 4ZVGA 3VAJA 5H1UA 2QGFB 3W5YA 4GC6A 2C22A 1NJZA 2R8GA 3MMJA 3D6TB 4OYPA 2DGSA 1R43A 3X3UA 1X9SA 1BQNA 2KVIA 5ETQA 2RF2A 4Z37A 2PFFB 3W9IA 1C1CA 3AB2B 4USVA 5E3QA 3W61A 2IY5B 1JX4A 4EU0A 4ZLLA 2BE7D 3MDBC 2IM1A 1S6QB 1TKTA 4PKDB 3UDCA 4F50A 1TV6A 1BD6A 3EXYA 1UA0A 1S10A 2LQ6A 2VICA 4X4OA 3SUBA 3POTB 3QT8A 4PXCA 4USKA 3H4DA 3MM8B 5GAGU 3CCRS 2LVWA 2PDAA 5KOXA 4P7VA 3W3SA 3MF5A 2AIRB 1VFJA 3MMBB 3V4MA 5GADI 4USUA 3M8RA 3DN9A 3VGUA 3ZTPA 2VPDA 2R2RA 3HJFA 3SV4A 2NPIA 4CT9A 2DJAA 5LKXA 2BW2A 2GO8A 3HSJA 3BH6B 1EZZB 3HKWA 3I4HX 3N01A 4HEA9 1RWWB 1E4UA 3UWTA 3T5KA 3S6EA 2IA0A 1WEVA 1X8DA 4GMKA 4M5HA 2D69A 3MI7X 3PYGA 5E7OB 1TKXA 4UQTA 2AW0A 5KG0A 2LGKA 1MW7A 2GAHC 1LWFB 4KGVB 3DU6A 2C42A 4CNZA 3I31A 4QW8A 3R7NB 1VC5A 3GV7B 3MR3A 1IQTA 2DPJA 4F0HA 4BS2A 3J81j 1RWUA 2RU3A 3DU5A 4ES3A 5J2MA 1P8GA 4DR7F 5B79A 3CO9A 1D1UA 4NLGA 1HHQA 1OY8A 2OPRB 2W2OP 5ETMA 2ZH2A 5KFCA 3DRPA 2BOAA 3RU0A 2ZC3A 4B9VA 3QGPA 2E5GA 2X51A 2W2PP 2DTJA 2NAAA 1A0OB 3AOBA 3SSSA 3PLWA 2GJ2A 2JLEA 3HCTA 2X3GA 2XMKA 4NI2B 3HTKC 4Q2MA 4DR6J 4MFBB 4NMLA 1U1PA 3PKMA 5EX0A 4AUKA 4X4VA 3I96A 3SMZA 3VVTA 1S76D 2P6SA 4BCAA 2K3IA 4X4UA 3TUJC 3W2WB 2M88A 2W9BA 1IBMF 4IR1A 3DRSA 3HVAA 2OPSB 4MKBA 4B3TF 3HX9A 1U09A 2YKOA 1O5JA 3G6ES 4DSLA 2XZWA 1AB8A 1R6YA 4K4VA 2PI5A 3MM6B 3T5JA 3MDFA 1S1UB 3EE3A 1CLFA 2Y9HA 1Z60A 4QU6A 4DQQA 1SV5A 1PBUA 3CE8A 3CJ8A 3ENAA 1OO0B 3LO3A 4LRAA 4B3RF 1N34J 4U7UD 1KP6A 2OI2A 1X4AA 3GONA 3GV8B 1X7VA 1QDUB 1Y11A 1FKAF 1QAIA 5D77A 3ZZYA 3TJ8A 5CAAA 3KK2A 5SVXA 3L7UA 3CIMA 5AXMA 2JFKA 5KT2A 2J6UA 4DSEA 1U1RA 2JMDA 2HWHA 1OYEA 4ZVTB 3LDYA 1QVGR 3CD0A 4WZQA 3ZXWA 1NB7A 3IS9A 5KT6A 3KLFB 4RUCA 4EBEA 4DL5A 1B64A 5DRKA 1UJ4A 2MA6A 4B9TA 2BE2A 3Q8VA 1HW9A 2CPDA 5HMWA 1VC6A 2IAJB 1WESA 4G3IA 3N9LA 4TQRA 3PW0A 2CQCA 4HTIA 1T02A 3HSZA 4HL9A 4N3WA 4XTTA 4ZLNA 3VAHA 1TL3B 2R7XA 1XEZA 1B0PA 3PXGa 1QTMA 3LQJA 5TDRA 4R2YA 1UWAA 3NAHA 3DWDA 5D15A 3BSAA 2A6OA 1S7IA 1NK8A 1HL6A 3MXHP 4L7XA 2KIZA 1NDPA 2UZGA 9ATCB 4ZA1A 1TU0B 1MMNA 1VDHA 5G05B 4DR2J 1REGX 4C48A 1GMWA 3RBDA 3RBXA 2IC3A 1P9YA 2CPEA 2FHOB 2K1RB 2LA6A 1U2RA 4TLRA 2I8EA 2RH3A 3VAMA 3G71S 1Y3KA 2C3PA 4NEZA 3GIIA 2VBWA 4C3LA 1WIMA 2QFJA 1Q53A 4MKAA 5A8RA 5LSOA 1SUQB 3JYTB 1KQFB 4CLFA 1OJ4A 1HI8A 1Q4RA 1ZAXA 4WE1A 4JV2A 1JLQA 2MD8C 4NX9A 3PJXA 4ZOSA 3RR7A 3TP2A 3WX8A 1N5VA 2N4CA 2J9EA 1RHUB 4KC5A 4OJ3A 1VBZA 2M8DB 3PG9A 2F4VJ 2KWJA 4X2BA 2PUYA 5LOQA 4AYCA 1PILA 3A3OB 3CEDA 4JI5J 4TKPB 2XLJA 4LF8J 4JI0J 3DLBA 3RB0A 1AROP 4NI2A 4C7QA 2NUHA 2C2MB 2A1BA 2ECWA 3PRDA 4MMOA 4USHA 3CXCR 3CCUS 1S0VA 2C2VS 3P5TL 3G4SS 4I56A 3KUGA 2J7WA 2LEPA 1HPZB 2WVDA 3NOGA 3OTCA 4WYLA 4C8MA 4ANCA 2FJWA 5KG3A 3W9HA 3TANA 5K8MA 2XY5A 2UVRA 4B9SA 4R5PA 2R7TA 3MR6A 2NXEA 2VKRA 2AYMA 3D6MB 1FX4A 3TEHB 3VV2B 3VZIA 4IRDA 3I87A 2CFXA 3PTWA 4LR8A 1T95A 4QPTA 1WG4A 4DZDA 2CJYB 3L09A 4OHZA 3LVQE 3VAIA 5JJBA 3TJ9A 1LK7A 2K1JA 2AEMA 4V19X 2IHR1 1LEOA 2ZD1A 4O3NA 3W5ZA 1KKHA 2M9KA 2BV3A 4DPOA 3ZZTA 1DTTB 3MPDA 3FZ2A 1PAUB 1JIHA 2QL9B 4Z0RA 2XM3A 2XBPA 2QFIA 3PURA 2W1BA 4YEAA 2HLUA 5J1NA 4ZDTA 5JXSA 3H0PA 5CYMA 3NMRA 2Z2MA 1XR7A 2WCXA 3K59A 4PG4A 3ISZA 1HKAA 2H4WB 4FYVB 3C15B 2FY1A 1HNIB 2UXDF 1GNKA 5HATA 2YY3A 2HQDA 2KXNB 2B8QA 2HZAA 4UOGA 4DL6A 1YI2S 1VQ5S 4LF5J 1FKOB 3D0HE 3BO4A 1VQSA 4X66J 4C11A 2DR7A 1R31A 3CJ5A 2DJWA 5B08A 1JOCA 2YWEA 1SH2A 3MM6A 4KSEB 2K3KA 4RNOA 1LK5A 1S9GB 3HKZD 3K5OA 1FRJA 5AXKA 3T19A 1N6QB 2GQCA 4M94A 1AZSA 3OL7A 2DCUB 2CKWA 4ILRA 1C1CB 2HHSA 4X62J 2GVZA 2G13A 3VGVA 2E5LJ 2DXDA 4FN5A 1GH8A 2ECGA 2W7AA 2Q3PA 1I94J 5DZ7A 2AV5A 2NXUA 1IR2A 3JSMB 4F4KA 4KO0A 3ZYQA 5K8OA 2BQUA 4Q0BA 4GB0A 3MWBA 3LWLA 5HBMB 3Q0AA 2J6TA 1FX2A 2K16A 3Q8UA 4PABA 2CYYA 4WZMA 1HWJA 2KREA 4DR2F 5DM7Q 2XS7A 1JXEA 3NOCA 2FY8A 1RI7A 1WKJA 2GIRA 2QYGA 4RL1A 3C46A 1SJ4P 2HFSA 3PX6A 3KJFB 3RBEA 3CCWA 2FC9A 3ZNUA 5B7WA 2AGPA 4MYUA 2QJ0A 1QY7A 1KQGB 1K1QA 3BSCA 2UU9J 3FC9A 4JV5J 5C25B 1GQEA 1YKWA 4UZCA 3K2YA 4M95A 4NCBA 1T7PA 2FZKB 4IO9Q 1FVQA 1LWCA 3HHLD 3OQ2A 3I55S 5HJXA 2W9CA 5D4OA 3M1VA 1HQUB 3I5CA 3KMSA 4HI1A 2HW3A 3HHLA 3VHQA 2IC3B 4NXNF 1KLMB 4H4OA 3SFUA 2KI2A 5JVGQ 2DO4A 3UN3A 1TL7A 3E51A 5D3GA 3FM8C 2ZUAA 5B0AA 1DTQA 3THTA 2FJEB 4DSJA 2DNPA 1KC8T 1RACB 3O37A 5B76A 1TFYA 5K8NA 1RBOB 3AODA 4HI2A 4Q5VA 4WF9Q 3U5NA 3JSYA 2FJDB 2AU0A 5LMNF 4I7CA 2MHNA 5HLFB 2RILA 1WF1A 5FIIA 4O4GA 2FPHX 4CH0S 1URRA 2J7UA 2BJ9A 2YHOA 2AX1A 5T14A 3KUHA 3PX4A 2E1RA 2ZOFA 1HYSA 2B43A 3CJ0A 5IZHA 3PFEA 5FJ4A 4DV1F 2EKYA 1H2VZ 4X64J 4QJVA 3CWJA 4USTA 4ZPVR 3TVYA 4ZCIA 4X65J 4H4MB 2UUAJ 3P6YC 4PG8A 4C8ZA 3CJ3A 3GIMA 2V94A 4Y2KA 1UVKA 4USIA 5DJBA 4O0IA 2ECIA 3M99A 4TN2A 2V0NA 4NLQA 5U47A 5H9FJ 4F4AA 1NH7A 2RQ4A 2RD5C 3EGZA 4Y2AA 1FXDA 3EDQB 2DX8A 1XMOF 5DGBA 5D4NA 2Q1LA 4XDDA 3NNAA 1AFIA 3LJUX 3H20A 3NG2A 2ZJRQ 1N6QA 3QRQA 4YB6A 4DV2F 3H40A 1SJ1A 1MN9A 2F65A 3OFFA 4YDXA 2KG0A 4KKOA 4JV0A 2RQCA 4J9OA 2KWKA 4WP3A 1FP0A 2YX7A 4B86C 2XY6A 4KHMA 3T41A 3W9JA 4K4ZA 2AWZA 1RT3B 2ZVSA 4J37A 1ZTWA 3UPFA 1UJ5A 2AJ0A 3BGRA 3CJQA 1LW2B 4PTBA 2LU1A 1RISA 2ZDPA 3CJSA 1RTJB 3CJ2A 2VG7B 5D4PA 2OPSA 1R8AA 2MKSA 4GRSA 3W64A 4F4WA 2W9BB 1H72C 2RSDA 1RWXB 4DPXA 2JOQA 1XIQA 1UZHA 3RAXA 3RTRB 2FFWA 1MNEA 1S9FA 2JVRA 3CSKA 5LKTA 1HFEL 3AXKA 3LP1A 4ZP6A 4RJVA 1Y10A 2L75A 4YS2A 4LFCF 3IXQA 4OIXA 4XK8C 1FA0A 1VRTA 2ZOGA 3LTOA 3M8WA 5D0HA 5I4MA 2B4PA 1RCOB 3PIOQ 3PO4A 3RW6A 3KFWX 4G1QB 4YB7A 4QWBA 1JLGB 5IV4A 3CIZA 3T1YF 2H1YA 2NR0A 1QAYA 1RT5A 2MUMA 3LQIA 1YRUA 2MYFA 2LCWA 3IAM9 3NRBA 3SZ2A 2KXHA 3KG4A 4UTGA 1H74A 4F3OA 1VQ4S 2CJBA 2LQ8A 4WFYA 4K4YA 3DLGA 1CBKA 4AYBD 1F5BA 1JLQB 4L74A 1YJUA 1RGVA 3CW2C 4A0CD 1TL7B 2C2KB 2LXPC 2DH8A 1MLAA 1Q5YA 1KLMA 1YK9A 3D1HA 3DOMB 1TL1B 4H4OB 5HVFA 6FDRA 3ADAC 1DQAA 2D9PA 5KFTA 4AXIA 1AW0A 3NXZA 2QL7B 4X4QA 3OTOF 2HURA 4AYCB 3H25A 3T5HA 2Z4PA 3BGLA 5L46A 1TL1A 3H2LA 2R7RA 5ETPA 2M52A 2XCAA 1WKLA 3MM5A 3NS5A 4PYDA 4I7DA 3HCUA 2G1DA 3DKDA 1TTHB 2LU2A 2BM0A 3EJMA 3RR8A 4YUDA 2MTLA 3ASLA 3O47A 1P1TA 3C6WA 2HHWA 5G0RA 2G0JA 4N8OA 2HFZA 1JXVA 2F7VA 4LBIA 1BHNA 2B0OE 5SVIA 3AOCA 3IG1A 2EG1A 3FSXA 1M0SA 2E1PA 2W01A 1IJFB 1RLDA 4DSIA 5E0OA 4L3KA 2LECA 2V4QA 4DPUA 4HYKA 1NKEA 2Y1LB 4HLBA 4P6QA 3RW7A 2QTWA 3R6GB 1Q7LB 5I3UA 2ZJQQ 1DZ5A 1RU2A 4KO0B 5B0FA 5IC4B 4LFBJ 4FIPA 1NHKL 1IN0A 3M8PA 2LGGA 3O35A 4OZ5A 1NK4A 1IBMJ 1RKIA 1F60B 3IR6B 4WPAA 5H9FK 2BXJA 3LRQA 3OT9A 4UOCA 1HNWF 2VODA 3KLEA 3KK2B 2BE2B 4ECWA 2XWYA 1UEKA 1I51B 3SQGB 3UCUP 1W2IA 3I32A 1RT3A 3M2VA 2MQ8A 2VJUA 4B3MJ 1X9MA 1WSVA 1JLEB 3TARA 3CVKA 2GAGC 3TWZA 3R2CJ 3R5CA 4IH6A 4C8LA 3HCSA 1SKUB 1U6ZA 2VQFJ 2L9NA 4C98A 2GIFA 1WNEA 1SCJB 1N36F 3LOUA 1T11A 4TYAA 5B8DA 3NBPA 4JI4F 1SH3A 1U1NA 3KK3B 1X5PA 3EM1A 7AT1B 1CEZA 2O01C 4FKXA 4ALZA 3MMAA 3FEHA 3BN4A 4OYIA 4X62F 4QR1A 4CO1A 1P6TA 1R89A 4UT4A 3US5A 2YH1A 1NK7A 4EZ9A 2EC0A 1QSSA 1X4IA 2HYED 2BKNA 1SI9A 2ZD1B 2OO4A 2YPZA 1K0VA 2VC0A 1S1TA 3NMAA 3M8ZA 2AMCB 2KU7A 4ZP9A 2HFOA 4ZVHA 2H5IB 5LXYA 4Q43A 3V4IA 1DFDA 4UQGA 3KTQA 1JLAA 4M5DA 1YJVA 4HTJA 5CCMA 4DFKA 2AGOA 3U27A 2KH9A 2P9EA 1S48A 4CLSA 2O3DA 3GV4A 4A49A 2DITA 3MGJA 4F26A 2PSZA 2LA4A 4B3SF 2QLWA 2DVIA 2G1HA 1RAAB 1VJQA 4AXJA 1VS3A 1JM7A 1B4SA 1B99A 5HP1B 4KT0C 1OSCA 3H2VE 4URQU 3G6VA 1RA6A 3MPVA 4CH1A 5IS2A 3LP1B 5J2NB 2VJFB 1L3KA 4ZHRA 4NZ0A 1JNRB 2MD7B 4X3GA 1KOHA 3CDEA 3D9BA 1VK3A 3M1VB 2ILYA 3WQPA 4ZLPA 2VQEF 2HQCA 5LMUJ 4EBDA 1TUWA 3PHEA 2E5IA 4LR9A 4C6AA 1SQFA 3G2XA 4LFAJ 4XO0A 4DBQA 3FAOA 4OI2A 4J90A 2F5GA 2YNIB 8RUCA 1VI7A 1IBLJ 4L73A 3M63A 3Q8RB 4R0JA 3KG0A 3QGHA 2HHTA 1QE1A 3I0SA 3QZVA 5HAOA 3CTRA 3MM8A 5CYJA 3AD7C 3CDWA 1RE1B 1NAQA 3R27A 1E6YB 3BSNA 4GNFA 4FNIA 2IYGA 5CHCB 4OI1A 3R7SB 3ZC4A 2E61A 1CULA 4DS4A 2FDNA 3SQGA 1RHMB 3VZHA 4L6V3 2ZNZA 1BGXT 3RG6A 3J7Z5 1LNQA 4NEYA 4OX7A 3UQSA 2F4VF 4NL5A 4DG1B 1TK0A 4DU8A 3HO1A 1H7XA 4I7BA 2EC2A 1OS5A 5A8KB 2CPFA 4F0MA 2YKPA 1V3ZA 2XSFA 3W63A 2AP6A 4DX5A 5FB0A 3DLLQ 3SCKE 2KFTA 4WCEQ 5KFDA 3AOAA 1PIEA 1VLYA 1KQKA 5K14B 1HNXF 5L1JA 1U0SA 1WJ9A 2HZCA 2MSTA 2BBEA 2VH7A 1NLKL 3A8KA 3S7RA 2XTJP 4Z7YA 4Q45A 3V6KA 3NGDA 3M6VA 1BQNB 5SVIB 1HYIA 4C11B 1BE4A 4QU7A 8AT1B 3LP0A 1B0TA 4XI1A 1FTCA 2FIUA 1FJEB 2WZ1A 5LKZA 3IM9A 4I2QB 1EP4B 1R0AA 4KBIA 1E6VB 1U1MA 5GAGI 1F6TA 4QYRA 1RT7B 1Q79A 4L3NA 5HANA 2VF3A 1MU2A 4Y2IA 5KFIA 2E7WA 1CVJA 2N7CA 1N48A 1SIWB 4GNDA 2YTCA 4C8NA 1FF2A 2PT0A 2XMWA 3EXCX 3T9ZA 3ENWA 2FUIA 3B4MA 4WU3A 3GWCA 3IBWA 2FLPA 2GGPB 2B8PA 2HQIA 4WK1A 1SIZA 4A8WA 1T1HA 4PPZA 1UL3A 3M8QB 2ZJPQ 3D0IE 2KFYA 1YITS 3NWGA 4U8YA 3JQMA 4CI0B 1SH0A 4FYXB 2FD2A 2HVDA 2EG2A 2NCKL 3BPDA 1C0UA 1WOSA 4P10A 4IQXA 3AT1B 3M8QA 4X84A 2ZE2A 3MM9B 2YNHA 2BANA 2UV8A 2DRDA 4NPOA 2LP4A 4BBYA 4LF9F 4S0MA 2LLZA 3ZO7A 1FE0A 3FKBA 4RW8A 5F9NA 4GNGA 5DETA 5HMYA 2HIYA 2ZEJA 2R8JA 1WGMA 2L08A 3EZUA 4LVOP 4A8XA 4ZDNA 2HNZB 2B3TB 3M32A 4KHPF 1U1KA 2KHDA 4LFAF 4NRUA 1LWEA 3EUNA 1ZH5A 3PX0A 3MOZA 2HYIB 2IYIA 3TZZA 1NJXA 1U45A 1URNA 2RUGA 5GAHI 1RZMA 5A0YA 3T9NA 2KGIA 1OPIA 3R3TA 3R8YA 2FVPA 2BZ2A 1DCQA 1KHVA 3SDEB 4LBHA 3KLIB 4ZPAA 4USMA 2G43A 3FRYA 5G04B 1H2UX 2OGUA 3G82A 2LEAA 5L1KA 2FHMA 2EFPA 1NEEA 2ZNYA 4TY8B 3ZTRA 1T9WA 2U2FA 3GJSB 2B5JB 3MEEA 5B0GA 1X4DA 4P74A 3GSDA 3HULA 2J0XA 3UVJB 2EK1A 2IJFA 2Y1RI 3M30A 4UP5A 2XEXA 4OYWA 1TFWA 3T9KA 1NCLA 1XTZA 2MQOA 4K4SA 2DGVA 4DV7J 4O62A 3D0GE 1VFYA 5HN0A 3HP6A 3DDTA 3L7OA 1VQNS 3OVAA 3RUBL 1F1BB 4F4ZA 1KLNA 2FVQA 1HA1A 4WXWA 2IRXA 3C2PA 5J1PA 2ZH9A 4LR7A 4J9PA 2NZCA 1X4HA 1RTHB 2MKIA 2BQRA 4LF6F 2RB7A 2BE9B 2KGGA 2KHCA 1B3TA 2YWFA 1S0OA 3HHKA 1WHVA 3V5RA 2XEUA 4LRBA 4O23A 2GFFA 4GKKJ 3GZ7A 2MZTA 3FGVA 3AA9A 3N6MA 3OHAA 4IOBA 4A8FA 1YBUA 1GT8A 2I9SA 3GJTB 1NBEB 3O8WA 4MTPA 1WC0A 4PWUA 2HAIA 5C24A 4JI4J 1EAYC 1X0PA 2B6AA 2KTQA 1WI8A 4P2XA 5THWA 1I6JA 5IT9U 1G6BA 1RWKB 4KGXB 4M5NA 2B9XA 1PKUA 3DXSX 1Y5NB 3KLIA 2JH3A 5EWGA 1NJWA 3W66A 4BHWA 1FXRA 3N9NA 5KG4A 4QW9A 1J5OA 1F2GA 1ZAWA 3DLEA 2LQ5A 3QIPB 2IPOB 2M8HA 4QQBA 4RUBA 5EDWA 2CPZA 2CVEA 3FQKA 4DCJB 1JJ4A 1CJVA 5B75A 1F3FA 2VPYB 3A8JA 2C3MA 3DYAB 4DX6A 4Z2XA 3Q23A 4E2FB 3EICA 3CCVS 2CDQA 4MSXA 4PQUA 2KE1A 2XMMA 2CQ0A 2BW7A 2FC8A 2Y0BB 1ZBDB 1HI1A 3F41A 1N5YA 2WSFC 5K3QA 2I38A 2V6AA 3M2RA 2GA7A 3HD2A 4NZ6A 4BBQA 4DR7J 4YHHF 3WBZA 2Q43A 1UFLA 1CQNA 4RNNA 1LV5A 2LAUA 1I3OB 3VQSA 1VRTB 1VHIA 2DHXA 5GAEI 2M2BA 3SSQA 2G0CA 1RAHB 2FVCA 3AJ1A 2JSXA 3R1HA 1X5SA 2MMYA 1FKPA 2DNGA 1QTNB 3U7JA 4ED1A 4P73A 2Y1IA 3J81Y 4OQJA 3KK1A 2YQMA 3I2DA 2B56A 1RCXB 3NG8A 2CKLA 3GTYX 3P45B 5AE3A 4AQYF 1ZTTA 1S1XA 2LQ9A 3GFXA 4OHVA 3OR1A 3QT6A 3G96A 3D66A 1UVNA 3OVBA 5K8PA 4OI4A 4NLVA 2VQEJ 1N5SA 1GTHA 1S9EA 1S9GA 2FB0A 1M5PC 5B77A 3WDOA 3BQ1A 3MPUB 4DFPA 3NL0A 3BGOP 3MAQA 3C6TB 1J5OB 4TY9A 2QLXA 1JMTA 5KT5A 4NYZA 1FK9A 2CJQA 4U95A 5DM6Q 3N5BA 2FUUA 4CH7A 4DV6J 4EEYA 2YURA 2PMWA 4EGLA 4WZ3B 4M5LA 4EWTA 4NASA 4NYOA 5LMNJ 1SKRA 5HROB 2ZH5A 4B9LA 1X9WA 4FK5A 5B78A 3LQVA 2OD6A 1A7GE 4I6WA 2EW9A 5KG1A 3L4BC 2ALZA 2C2DA 1MWYA 1T9XA 1XR6A 5ITHA 1XMQJ 2R2TA 2YWHA 3OHBA 5CYQA 2L0BA 3SSRA 3U5PA 1FVSA 3NGUA 2VD3A 1RWPB 4IG3A 2KXFA 3V43A 2GNKA 1WEMA 1P27B 1TKZA 3OXFA 5A0YB 5MAOA 1TAUA 4CO3A 1AXQA 3CNQP 2ROPA 4A4BA 3ENQA 5KFSA 4ATNA 3AD8C 1BUXA 1TELA 4FZVA 2IBOA 3JXOA 4IC3A 3HVRA 1GMWD 4EFAC 2HWIA 2Y1MA 1FRLA 2LDRA 4B9NA 1U6BA 1SC4B 2WVCA 4DJBA 2JLFA 1NK9A 4OJ1A 1DTQB 2CNNB 2AHOB 2C2OB 1PYSB 2VQFF 4K4XA 2VHGA 3VK6A 1SC1B 1NH8A 1WC1A 4ZJQA 4ENOA 3H5UA 5F8IA 4FXDA 2OPRA 2QLFB 2R8HA 4DV5F 2AJ4A 4O3RA 2C3UA 3DLHA 1S72S 1NDLA 1NMEB 3EZOA 3FCHA 1K8AT 4ILMA 1RB0A 2CJXB 5KFJA 5GAHU 1XMOJ 2WB1D 5JVHQ 1Z2QA 2IIHA 2DT9A 3DRRA 3LH2S 4PG7A 2PA3A 4DV4J 2CRWA 1TL5A 4DL2A 4K50A 4KJIA 1DJ0A 1A6LA 2N7YA 3A13A 4YDDB 4NCGA 4N8NA 4FS2A 4GKJF 2IDEA 4RNMA 5D0GA 2ZETC 3NCQA 1Q78A 3PW4A 1WUUA 1WEYA 1BMQB 3AA8A 1LWCB 1JB0C 3CCTA 3GMGA 3UN5A 2HBRB 2K1RA 5BXIA 4G1QA 5T7LA 2QN6B 3MOJB 2MNZA 1RTIB 1R0AB 1UVLA 3AAWB 1LOUA 4OZ2A 3UCGA 4WZ0A 4DFMA 4LF7J 1XN9A 4O64A 1T3OA 3FSYA 3FSIA 3QAUA 3KXDA 3PY8A 2VBYA 2YWKA 2RR4A 2QG9B 4I2PB 2J5AA 3BS9A 3OFEA 4PZVA 1CJUA 1TZ0A 1C4AA 2NSBA 2QV6A 1TV6B 2V4JB 2XYPB 1TL4A 3MAAA 1U6GB 2VG7A 3MCOA 4G1PA 1FJGF 5FLXU 3G86A 3UNYA 2EA6A 3BGRB 3U1LA 3BBCA 3OTOJ 3Q8PB 3SXLA 1VRQC 1RJJA 2W4PA 3BEGB 5F8GA 4B7YC 3IO1A 4FPRA 3MTJA 4O3OA 4A8QA 1WD6A 4ZVOB 4MIWA 2ZBQA 4IFVA 3H90A 1NPPA 2RQKA 3BV8A 4NLDA 1S12A 5HSPA 4J9NA 1SQGA 2UVVA 3MEEB 3SCJE 2RE1A 4Y0FA 1HWIA 3HFVA 2DEJA 3G6YA 1NHVA 5KTQA 3NBPB 4D3GA 1RAJA 4LIRA 3L1ZB 4DMZA 2YVSA 2VU5A 3OFGA 3PNIA 4M5MA 2H48B 3QGGA 3U1MA 3KLGB 5F8HA 4V19J 4PWDB 2GS8A 4S3OC 2KU3A 3C6TA 3CUNA 1S79A 1DRZA 3BB5A 3QO9A 4KFBA 1O8BA 3DDIA 4QOTA 4CCGX 3BR8A 3MHHA 5G0FA 5BR8J 4JI5F 2VA2A 1P1LA 3RTVA 1UFWA 3FUYA 3H5XA 2RS2A 1Y5LB 2RQMA 1LWEB 1SJRA 1S1WA 3ZZUA 2F6JA 2MPUA 2ZH8A 1HYSB 4IH7A 1N56A 1S49A 1IWAA 4P9SA 3UI3A 4CZCA 1D9FA 5KH7A 2LMIA 4IDKA 1CJTA 3QLHA 2R4FA 3DCAA 1GXUA 5EWFA 3KQIA 2R7SA 3TJAA 4YAXA 3K57A 2QJ3A 3A4TA 4N77A 1FEEA 2HEKA 2CQ3A 4KE5A 4DV5J 2CXEA 1DQ9A 4S3OB 3BBFA 2MZQA 4GVBB 1Z2LA 2XMJA 2ACYA 4YOEA 2YUCA 1SC3B 2FTRA 3SBMA 1GEHA 2K8GA 4PR6A 2W9CB 2W8KA 4TXSA 5G0RB 2DD8S 2OEMA 2G2YA 2FSAA 2VASA 4TKTA 4ANEA 1BC6A 2YQLA 1C1BB 5LM7E 4GKKF 1ZM9A 4DU7A 2AYBA 1L3SA 2E5LF 4U8VA 5D3GB 1NNDA 3HI9A 3LGNA 4F4YA 4LF4F 3KJNB 2Q6CA 4NA2A 2IRUA 4K5SA 3MEGA 4YC9A 4ETXA 4MKVA 3BO2A 1RWVB 1HD1A 5IFMA 5E5NA 2G9OA 3C16B 2QA2A 4HACA 4TNOA 5CH7B 1NJIT 2C2ZB 4EUVA 4WKYA 2P9GA 2EFNA 3MUMP 4DQRA 1IJEB 1D9DA 1FJGJ 3EGVA 3DOMA 3JAMY 2KM8C 4MK7A 2V2QA 3QIDA 2QYCA 1WEUA 1R0BG 4LF1A 3RAMA 4A8OA 1QSYA 4Q8FA 2ZVIA 2WRMA 5C24B 3JYTA 3FBEA 3KKFA 2QMXA 1GK8A 1H2TZ 2AJ1A 1GXLA 4ZPCA 1UEVA 1IKVA 3DM2B 2R8IA 3BH7B 1HBOB 1WILA 1X60A 4YQWA 2HVIA 4YR0A 2V50A 2I1RA 3VAFA 2XQCA 4NLYA 1TVRB 3HHEA 5H9MA 4UOFA 1JQGA 4OGEA 2VB6A 2HG4A 4ZIVA 1XC9A 4NXNJ 4DL7A 4JI0F 1S6OA 1ZAVA 2KKHA 5DLGA 1EETB 3QWPA 2JDJA 2QZ8A 4ZN3A 1VQPS 4J9QA 2L7PA 3IRXB 5F8LA 4E0DA 2DNZA 3CCSS 3G9CA 1FKOA 1WORA 5FEYA 4M63A 3T6BA 4TU7A 3KNAA 2QSWA 1HIYA 4A46A 4CO2A 5DG8A 3PFOA 5I42B 2ZOMA 4R8PK 1IYMA 1GX5A 4LSNB 5LL6d 5KFNA 2XI2A 3ICLA 2L9WA 2RHSB 5I3UB 1B7FA 1BWVA 5GMEA 4A4JA 1LW2A 3QGIA 1M5SA 5SZTA 4DUYF 1IKXA 1S6PB 5IT0A 2IJRA 4J9LA 3TVKA 1GAOA 3C6UA 3H8YA 4L72B 4OHYA 1QE1B 1U47A 7FD1A 4C8YA 3PIPQ 2B9WA 1IQZA 1W25A 4GVLA 1W26A 5KAKA 1KTVA 3PR5B 2Z2YB 4OL8A 4OZNA 5ETSA 1O51A 3PZPA 1J5EF 1UPMB 1RBAA 3M2UA 3D6HB 4ZP8A 3I9ZA 3TAMB 3I5AA 3OTDA 4JYAJ 2JEIA 1F0XA 1F9EB 1S1XB 2H5JB 2QX0A 2CKLB 1ZETA 3QJPA 2L48A 1QJHA 1RUSA 2OHDA 4IFVB 4ED4A 3N9UC 4B3OA 4ICLA 2XZTB 3V6DA 4MH8A 2B4OA 3T6JA 3VWSA 4R5PB 1V87A 2IVMA 2W24A 3F73A 2C2LA 3FL2A 2VJFA 1RHRB 4ZVQB 4ZHRB 4C9DA 5EX3A 2E7VA 5HJYA 3O7AA 2ROGA 3FRZA 4NLUA 4DX8H 4KY3A 2MGZA 2QIZA 2GMHA 4KH1B 1FWLA 4FYYB 5F0WA 3MEDA 3BYPA 2C2RA 1X4JA 1IR0A 2ZE2B 3IA0A 3MM9A 4K2JA 4KV8A 2YSJA 1HHSA 1RT6B 4RNFA 5A6PA 3BJYA 1QUVA 2VG6B 4MFBA 3ZZZA 1I5OB 3RBZA 5B09A 3S8SA 3HM9A 1K44A 4PWWA 3NCRA 4OYMA 2NPFA 5C42B 4J9KA 4N76A 1A9NB 4ZVSB 3BBBA 3ZTOA 1RLCL 3SCLE 5F8JA 4M5GA 3UR3C 3KJVA 5F0UA 4LJMA 4LQ9A 3R9LA 1HARA 2DGXA 4PG6A 3VCDA 3KOAA 1FHTA 3VGTA 3KUEA 1FBVA 3ZTQA 1YGYA 4UW2A 2DY9A 3CT9A 2LQBA 4NCGB 2R7WA 3MMAB 2AT1B 2WSEC 4DR1F 3HZGA 5C25A 1LFPA 2VC1A 1RT1A 1SJQA 1Q95G 2XULA 4NLSA 1CC7A 3QRRA 2UXCJ 5C13A 1WEZA 2C2EA 4IQMA 2JJ4D 1XBWA 1G4CA 2JRSA 3MD3A 4ED2A 4DR6F 1B0VA 3F56A 2YPYA 3NEKA 4LUBA 3CMAS 5AJ3J 3OL9A 3GSIA 4HT5A 1OSDA 3N79A 1AYEA 1D3WA 5LJ3Y 4DS5A 4NXMF 2BR0A 1R8PA 3MTKA 3K5LA 3J7AN 5L1IA 3OD2A 5L9XA 2AN6A 5H1TA 5HBMA 1M5HA 1MMLA 2YNFA 3OLBA 2HHHJ 2EVZA 4Q0BB 1WACA 4MKYA 2ZBCA 3QLHB 1C0TB 4G65A 2R2UA 4ED3A 1GMVA 3CDUA 5ETOA 2VA3A 4OZ3A 3UW1A 2OAUA 1WEWA 4K0KF 2JL9A 4DG1A 3R7BB 5IWAJ 3GIJA 4FPIA 2ZM6F 4YY3F 2MJNA 5LMUF 4A8KA 3HFKA 2BDPA 1FD8A 1ROFA 4HHUA 3ZZPA 3K58A 3BGFA 4ECTA 2KT5A 2GJFA 2QC3A 3GPAA 4QWEA 3VAGA 4TVAB 2LN0A 3H5YA 1K9MT 5J1EA 3V6HA 3P49B 3C8YA 1KS2A 3TUIC 2KWOA 4UP0A 2I0XA 3ISND 2WONB 3PR4A 2CJAA 2H51B 3EGWB 3PYDA 1FNMA 4ZLJA 5KT7A 3KHGA 3DMJB 2HNDA 2I5JA 2GIQA 3HVTB 3L7PA 3LF0A 1YJ7A 1Y7PA 2H3EB 4WYWA 4ZVUB 2V2VA 3HLUA 1ULRA 1ZZFA 2O5DA 5E3RA 4J9RA 4N4FA 3BQ2A 4DN0A 2RU9A 3FEXB 4DF8A 4HACB 4J9UE 2MKJA 5KFRA 2HMIA 5LKUA 3DRYA 1RSCA 1F9FA 2KYZA 2P2CB 3DLKB 1S4FA 3MZIA 4JOUA 2BM1A 3PYEA 4ZIWA 1OWXA 1R6VA 2BACA 2BABA 4IH5A 4A47A 2MXYA 4MAKA 4QWCA 3LWMA 2EFGA 3H98A 1UP1A 2M4MA 4G6VB 5ADZA 3OV7A 1RAGB 4MYTA 1X4FA 2R2SA 1XMQF 4CTAB 1F9HA 2YKNA 5KH3A 1D8ZA 2GHVC 2R9LA 4OX9J 3CCQS 3AFGA 3D1OA 2HAFA 4R25A 1H6KX 2YWGA 3J80Y 4F04B 2VIHA 2PI4A 2UXBF 4ECVA 4PG5A 3UDLA 1S99A 1WDTA 1WF0A 1YZ6A 2YW8A 5KFGA 1VD4A 5JMNA 3NNHA 2OLWA 1VMBA 1PBAA 3LP2A 2NZ4A 2HLTA 2JWNA 4P2SA 3CJKB 4CCHA 2YNHB 4F8RA 2UP1A 2V5HG 1VQ6S 2Z56B 1DAXA 3CDBA 2WW4A 2KVQE 1NZAA 2E44A 2QA1A 4LRDA 1HNVA 2HIQA 4AT1B 1JLBA 4N47A 2V67A 3C16A 2XB1A 3LAMA 4AP4A 2PEHA 2HBQB 2NXNA 4FBUA 2MDAA 4K0KJ 1KRPA 2E5HA 4DL0C 4DR4J 5DDOC 1DBDA 3DYAA 1J2VA 4WA6A 3DRRB 3MCSA 3OVSA 4X4TA 4EYHB 3QSIA 4FYWB 4V3LC 3E2EA 3SEOA 3J7YU 3RB6A 2UVWA 2YBVA 2YQ3A 2IDAA 3LQHA 1RT2A 2OKQA 2ZC4A 3IP0A 4Q2LA 3R97A 3CCES 2MHEA 2J8AA 4ZPWR 4JI7F 4I4BA 2HFVA 2M6MA 4ECYA 4ZQLA 4LF9J 4F02A 1UZDA 1MM2A 5BYSA 1SL0A 4JI1F 1SQEA 1PYTA 3AH6A 4FVCA 5AJ3F 1NKCA 1FNXH 2FLLA 1KNZA 4I1TA 4WZ2A 2HQFA 4OJHA 4RW6A 5FLXY 4XPEA 2E66A 4IUFA 1H3DA 1WC3A 2OP5A 1WEPA 4O4RA 1IM6A 5KG5A 3RRGA 2UXCF 3AQOA 2WONA 4GO7X 2VKZG 2PN6A 2NS1B 1HBNA 4JBCA 4DR1J 3A8EA 4JI3F 1FFSB 1PJ6A 5J3XA 2BQ3A 2YSMA 3LW5C 4LKAA 4Z0OA 1X4EA 1XJWB 1ZBTA 5KFUA 5D1LB 5GMKa 1HMVA 2GW8A 1V5IB 2PFDA 1ELOA 3DGVA 5BYRA 2UUBJ 2WBMA 2A6MA 3D4JA 4Y2CA 2GHWA 4YR3A 1HNZJ 3FVYA 1EJ7L 2PIIA 3QT7A 2L3MA 4D3HA 1C0TA 1IKVB 3DM2A 4AE5A 2F6NA 2PD1A 1M5VC 2P9CA 4B3SJ 2ADBA 4CM2A 1PJ5A 2YNFB 2YHNA 1K0TA 5CD4A 2MZRA 2DGWA 2MZJA 3GYNA 2E6RA 4ILLA 2RKIB 3W62A 6AT1B 4LSLB 4BWMA 1FRHA 1T9UA 3N6NA 3G82B 1Q0NA 2W4CA 2CNLB 4EO6A 3QBCA 4J9SA 2LQJA 1VCTA 2FQQB 3FCWA 2J8SA 3GCXP 2KT3A 3EVMA 3KG1A 3JSBA 1C4CA 2AF6A 4H4KA 4LF2A 5ETVA 1S1UA 3S1TA 5CCLA 5C5JA 2WVBA 2PMHA 4YY3J 4ZVRB 3ZNJ1 4G1IA 2QICA 3BKFA 2O1PA 2LV9A 2XNRA 1YTYA 2W2QP 1RT1B 1D9AA 2F9DA 2WHOA 3CCZA 2OTLS 4J9VA 2HS3A 3FZBA 1UETA 3PHDA 1CG2A 4NLTA 4OV1A 2VG6A 2ZHBA 4DV0F 4NMXA 1RKJA 2DR5A 3JB9k 2XB2D 2A18A 1Q8LA 2AJFE 2J0SD 4KV8B 2ASDA 2JM3A 2FGOA 2KB2A 3TYTA 1NPKA 2K06A 2KYXA 5KG6A 1JLAB 3FEYB 4M5DB 3B54A 3D67A 3D68A 4H54A 4MT1A 3V4IB 3N9PA 4U7CA 1IKWB 1S1TB 2IM3A 5CD4H 4ZN1A 3K5NA 2QRRA 4CLUA 4X4SA 1C2PA 1IBLF 3OJUA 3ZNIA 4P7TA 4IG0B 2DK2A
chains in the Genus database with same CATH topology
2XP0A 2CRRA 4OGCA 2B0OE 5SVIA 2XHCA 3LPEA 1M1HA 1NPPA 2KKXA 2LQ8A 2M13A 2E61A 4Z0OA 5SVYA 2LAUA 2JUNA 3MDBC 3LVQE 1NZ8A 2OUGA 2EXUA 2KKYA 3FJUB 2XOCA 3FEHA 3SUBA 2IQJA 3T9KA 1M1GA 3JUEA 2FFWA 2RR4A 4O62A 3H7HB 4Z0RA 2JM3A 2OWAA 3DDTA 3DWDA 2CSVA 3KDEC 2K06A 4OGEA 2XOZA 3E2DA 2CONA 3LJUX 3LVRE 3FM8C 2MKEA 2CRWA 2XOYA 3M7KA 4H9DA 2FD4A 1NPRA 5SVXA 2DJAA 2P57A 2EGMA 4ZN1A 2D8UA 2YVRA 4ZN3A 3PLWA 4QQ4A 4F1PA 3QQCD 2L7PA 3O47A 5SVIB 3H7HA 3P8BB 1DCQA 3LDYA 5K3QA 2YREA 3Q1DA 3EWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NZ8 A;  3H7H B;  1NPR A;  3LPE A;  2EXU A;  2XHC A;  4ZN1 A;  1M1H A;  1NPP A;  2LQ8 A;  3P8B B;  3QQC D;  4ZN3 A;  2K06 A;  3H7H A;  2OUG A;  1M1G A;  3EWG A; 
#chains in the Genus database with same CATH topology
 5IT9 Y;  2YKN B;  5IWA F;  3KDO A;  4X4P A;  1ZPW X;  2Z57 B;  4AND A;  4FF4 A;  1OY9 A;  1TKD A;  1Q82 T;  3CDA A;  1WI6 A;  2MLZ A;  3PRB A;  2ATC B;  3UO0 A;  2WK4 A;  4KHP J;  4LK9 A;  9RUB A;  1SC6 A;  4YP3 A;  3ONQ A;  4OYX A;  3CF5 Q;  3FQL A;  3IR5 B;  2XOC A;  3DMJ A;  1VQK S;  2KZM A;  2AZ1 A;  5EWE A;  1N0U A;  2C3Y A;  1VK8 A;  3M4X A;  5L38 A;  1ZYQ A;  5EN1 A;  5HQ8 A;  2ZBP A;  2O66 A;  1M5O C;  1S59 A;  2XNQ A;  5E2Q A;  1SBR A;  2CAJ A;  3GE9 A;  4USW A;  3OSN A;  2PA8 D;  3EGN A;  1S5Z A;  1ZPV A;  3A1Y G;  3DOK A;  1X4U A;  3O6Q A;  2ZM6 J;  1UWB B;  3PEH A;  1S57 A;  3KHR A;  2YVR A;  5DKA A;  2GHP A;  4IFY B;  5H1S V;  2FVR A;  2DCL A;  1U25 A;  2X3D A;  4OX8 A;  2ASJ A;  3AHP A;  4ED5 A;  4B9M A;  3LP0 B;  3OXG A;  4XIU A;  1BQX A;  2HPU A;  5J2P A;  1LXJ A;  3PAC A;  5E3C A;  1GFW B;  1TMJ A;  2ZFH A;  1FJC A;  3FDS A;  4LBP A;  2WVE A;  2E1M C;  2IVF B;  2WVF A;  4QIE A;  3H5S A;  4F3M A;  2KRR A;  5J2Q A;  3KLF A;  3DRS B;  4B02 A;  1U1Q A;  3IMQ J;  2H4Y B;  4HVZ A;  2D74 B;  2Z0G A;  4CLP A;  1RAD B;  4CLY A;  2UU9 F;  3QZ8 A;  1NJY A;  2HFU A;  4ELV A;  2YU4 A;  3KLH B;  2FYX A;  2G2O A;  3JUE A;  3WC0 A;  3O33 A;  3N9Q A;  1J27 A;  3R5J B;  4WXO A;  5CZV A;  1KDN A;  1XNQ J;  3FBC A;  3LGM A;  1S97 A;  2KT2 A;  4LIW A;  3HF5 A;  3ZFV A;  2C3O A;  2XO7 A;  3PUQ A;  3VVU A;  3W60 A;  1RU1 A;  2DIU A;  2DIS A;  3GYG A;  5GAD U;  3BGU A;  2CAD A;  2DGQ A;  2D8U A;  4WFB Q;  4TU9 A;  3CC2 S;  1D09 B;  1S7H A;  2J9D A;  1OPZ A;  3OR2 A;  1UTA A;  4FNH A;  4P71 A;  1VQM S;  1TR0 A;  1HWL A;  4WU2 A;  4B3M F;  1N8R T;  2DR6 A;  3CD7 A;  1HNX J;  1R8H A;  2DEI A;  5F9L A;  1JLC A;  2XHC A;  3VAL A;  3MEG B;  2MQP A;  5GAE U;  4K59 A;  3GLJ A;  2B0G A;  5KFM A;  1HNW J;  4QYZ J;  3M9M B;  1VBK A;  2YQ1 A;  4WE1 B;  2VUG A;  3I0R B;  1YX2 A;  3SI8 A;  1CJK B;  5F3T A;  4L76 A;  3IWX A;  4F36 A;  3TUZ C;  5F8N A;  1T0T V;  2HNZ A;  4F2S A;  2QMU B;  1EX8 A;  5BR8 F;  5DQG A;  3D2W A;  4MJK A;  1T9V A;  4DQI A;  1RT4 B;  3JAM U;  2FJA B;  3H59 A;  5J2N A;  2OPQ A;  4P2M A;  4X66 F;  2CSV A;  3DQV R;  2BYC A;  5HVG A;  2UUT A;  2Z2L A;  3MUV P;  4PRF A;  1FES A;  4F7V A;  1TP7 A;  3M6X A;  3T1A A;  3PW2 A;  2MNY A;  4FKY A;  3OUY A;  1C1B A;  2DB1 A;  3J7A 1;  3MUR P;  2ILZ A;  2VFU A;  2H0D A;  2CQI A;  3DDK A;  4ZP7 A;  4A48 A;  2XP0 A;  4QF2 A;  3OTE A;  1NSA A;  3DOL A;  3POT A;  4UI9 B;  3QT5 A;  5K9F A;  1AUS L;  4WTY A;  4X4R A;  2V9W A;  3I5B A;  4PPE A;  2Z30 B;  4R0E A;  2MQQ A;  1SKS A;  4DSK A;  5GMD A;  2EOD A;  2QSF A;  4HHJ A;  4Q44 A;  2ATL A;  2K17 A;  5DQH A;  5G4D A;  3MUT P;  4M5J A;  3BF4 A;  3N0V A;  1KVI A;  1AT1 B;  4ZS6 A;  4XAK A;  5B0B A;  1WG5 A;  1FWK A;  4OFZ A;  3HCX A;  3IN5 A;  1YVF A;  2X7I A;  2KWN A;  2XWX A;  3BPS P;  2EGP A;  4M5K A;  3T6R A;  4IRK A;  1NSP A;  2VPB A;  1CS4 B;  2VL1 A;  2CA9 A;  2DXE A;  5KFH A;  2RKI A;  1BY9 A;  1APS A;  5CYM B;  4B08 A;  3W65 A;  2CQH A;  3RJM B;  3K5P A;  2P57 A;  4DUZ F;  4CNY A;  2LDY A;  5ETL A;  3K7R A;  4F1P A;  3L95 X;  4DPT A;  5JUM A;  3D7S B;  2Y1J A;  2E9R X;  3MAH A;  3OL6 A;  1UA1 A;  1T05 B;  1TUV A;  1ZA1 B;  4RW9 A;  1GTE A;  3IGV A;  4ZPD A;  3KLG A;  3T1H F;  1D8Y A;  3N9O A;  1KWM A;  4YBM A;  1WEX A;  2V8P A;  4ZCK A;  5GVQ A;  4LSZ B;  5A6W A;  3MM7 B;  2OFH X;  3O5T B;  2WAQ D;  4NA3 A;  4WK3 A;  1EHW A;  2EXU A;  2JNJ A;  3FMW A;  1FI4 A;  2CQB A;  5LSR A;  1CJU B;  1S1V A;  2DH9 A;  1RHJ B;  2DNM A;  1FD2 A;  2V4J A;  2XMT A;  4I2P A;  3BR9 A;  5I42 A;  2CWX A;  4CO5 A;  3UCZ P;  2QLJ B;  3KWM A;  3WIV A;  5ETK A;  2BJE A;  4C2M A;  4OLO A;  4C3K A;  3EYZ A;  2IM0 A;  3HDS A;  3RAQ A;  1P9Q C;  1IKW A;  3E2D A;  2VFR A;  4ITS A;  4XDC A;  1VOM A;  3RZA A;  4AD6 A;  3Q2T C;  2D3Z A;  1IUJ A;  1OYD A;  3GYX B;  2V8H A;  1HR0 J;  4DWI A;  1RQ0 A;  4O4G B;  1MWQ A;  3P8B B;  2CVI A;  2B4V A;  4DV2 J;  1LFW A;  2HBZ B;  4Y28 C;  3RGI A;  4DUY J;  2ACM A;  2CRR A;  1FDN A;  2VDI A;  1U49 A;  2L5U A;  5HQM A;  2CPY A;  3SOW A;  1FDD A;  3R2D J;  2ALY B;  4DN9 A;  2ASY A;  2EEY A;  1L3T A;  2OPP B;  3CPW R;  2XI3 A;  4WWS A;  2CQ2 A;  5SVY A;  3MM5 B;  1Z6U A;  1Y5I B;  3D1Q A;  4DEZ A;  3HHL C;  2BAY A;  2ZZM A;  3C5K A;  4AUQ B;  1LWF A;  2HKE A;  2DKO B;  3A12 A;  1AA1 B;  3K89 A;  3NGR A;  3WZ0 A;  2AX0 A;  1JXL A;  1MSW D;  2RSQ A;  2ECT A;  4C0O C;  4KQZ A;  4J91 A;  3I6P A;  2BKO A;  3ZTG A;  2BEF A;  3SIP B;  3JSR A;  4NWB A;  2J76 E;  2ZBI A;  3J80 U;  1ZM3 A;  4LF5 F;  2RRA A;  2CON A;  2D7S A;  5D6G A;  4IOC Q;  3CCJ S;  1WE9 A;  3GJR B;  4H9D A;  2RDD A;  2CQG A;  5CZX A;  4CYU A;  1EP4 A;  4KIA A;  4KGM A;  4ERD A;  2UXD J;  5B0D A;  3ZZ0 A;  2NQP A;  3QQC D;  3JSM A;  3O1L A;  2V68 A;  2WBR A;  2RUS A;  4PXB A;  2L41 A;  3BSO A;  1VRU B;  1WHY A;  4ECU A;  4OI0 A;  5KT4 A;  4RR5 A;  3A3N B;  3KNV A;  5FDL B;  3BYR A;  4GVB A;  2CQP A;  1N87 A;  5AE2 A;  2W25 A;  2BJ8 A;  5J2Q B;  3U5M A;  1NB2 A;  4EK2 A;  4DR5 J;  1RTD A;  1REV A;  2V8D A;  3M9N B;  5KOW A;  2KKY A;  2BKP A;  4I69 A;  3OBI A;  2LXF A;  5E3P A;  3M62 A;  1X4C A;  5DQI A;  1TK8 A;  1M90 T;  1N5Y B;  1H38 A;  5CYQ B;  5CXT A;  4PWD A;  4JV5 F;  2CZ4 A;  4ICL B;  3NWR A;  5E3A A;  4JI2 F;  4CLZ A;  2LRI C;  2CQ1 A;  4MIA A;  1RWM B;  2GVZ B;  2IBK A;  1FTR A;  2ZBR A;  4EYI B;  1H0H B;  2QEX S;  4RW6 B;  2X1B A;  2XOZ A;  3LVR E;  3KV5 A;  4EBC A;  2GV1 A;  2NXJ A;  2PEB A;  1CC8 A;  1E6V A;  3MM7 A;  4LF7 F;  5L39 A;  1RYS A;  5IT4 A;  3UR0 A;  5IQ6 A;  2XGQ A;  2FJB B;  1HR0 F;  3H7H A;  2VDH A;  4YAD A;  5HMZ A;  5ETN A;  1RT2 B;  1VYX A;  5CA5 A;  4Q6F A;  4QWD A;  3C6U B;  4NLR A;  2BX6 A;  1IVZ A;  4P2F A;  5KFQ A;  5DG9 A;  1S6P A;  5C7P A;  2I50 A;  1YBT A;  4ES2 A;  4RPF A;  4AL7 A;  3ZPV E;  2L9D A;  3TA1 A;  3BO3 A;  3KLE B;  3KLV A;  2VBX A;  1CS4 A;  3RRH A;  2VOO A;  5I3P A;  3K17 A;  2HNY A;  1DTT A;  3IBF B;  3NGS A;  1NO8 A;  4M8L A;  2J6S A;  1N33 J;  4DCP B;  3H4B A;  2YKQ A;  3OUY B;  5L9N A;  1Q8I A;  2EFQ A;  3GCW P;  3JS9 A;  1S0N A;  4JV1 A;  1REV B;  4KHR A;  1U2C A;  4OI3 A;  1KSP A;  3Q8Q B;  3IR7 B;  3T1H J;  3OR1 B;  1R27 B;  2N3L A;  1RA7 A;  2CNO B;  3GP9 A;  3AY0 A;  3KYL A;  2BAN B;  1U02 A;  4BLG A;  4DLE A;  1SB6 A;  2QO3 A;  2Y1N A;  3BKU A;  3KK1 B;  3HPO A;  3MCN A;  2GQQ A;  3QFW A;  5ETR A;  3CME S;  3SFG A;  4NLX A;  4PUO B;  2RNE A;  4QR2 A;  5J2M B;  3GIK A;  4DL4 A;  4PQU B;  2LYV A;  1XER A;  2H9Z A;  2XSJ A;  3HSD A;  4DLG A;  3NLC A;  4EZ6 A;  2VJE A;  4PCQ A;  3VAK A;  1I1G A;  4IOA Q;  4LF6 J;  2ZH3 A;  1JNZ B;  4W92 B;  3T5L A;  1ZM4 A;  2XZD B;  2VG5 B;  3HD1 A;  5IC6 B;  2QA4 S;  4FVM A;  4C3M A;  3L1X A;  2GCF A;  3HSG A;  1HQ2 A;  2V9K A;  4C4W A;  1R8B A;  2RIJ A;  1DLO B;  2UUA F;  4F67 A;  4J7C A;  3V2U C;  2MKK A;  5KT3 A;  1N5T A;  4X64 F;  4ZKA A;  1YHQ S;  3HFZ B;  4OZL A;  3B6B A;  2UZA A;  5K5M A;  1RT7 A;  2SXL A;  5K20 B;  1SJF A;  1KD1 T;  1WDD A;  1QLN A;  3NY0 A;  1ITP A;  3JQK A;  3OLA A;  5IXU A;  2F4F A;  4WP9 A;  3W1Y C;  1N0V C;  3AJD A;  1UVJ A;  1QAJ A;  1G2E A;  3H2U B;  1IR1 A;  3P5B P;  4DUT A;  5TRB A;  3TR5 A;  1RT5 B;  4JI1 J;  2Y0S D;  1ICE B;  2H5E A;  5J1E B;  3MHY A;  1PGZ A;  1UMJ A;  3MR2 A;  2FJX A;  4B3R J;  4K4W A;  2PC6 A;  3TQ1 A;  3TEG A;  5LJ5 Y;  4HKQ A;  1XQI A;  3LA0 A;  2FJV A;  5KG7 A;  4C97 A;  4Q8E A;  2XCP A;  3M9O B;  1SJ3 P;  4J9M A;  5BJR A;  4LMZ A;  2ECJ A;  5C2C A;  2BRK A;  3VTI A;  2XG8 A;  2X1A A;  2DRB A;  3QJJ A;  4DR4 F;  3A8I A;  3HHD A;  1HWK A;  1QVF R;  3ILO A;  3EDR B;  3PKY A;  1FFW B;  2EBE A;  4OYA A;  5IM0 B;  3FAN A;  3O70 A;  2MLX A;  2RML A;  4FF3 A;  3JTN A;  4RWW A;  4IC2 A;  1JJ2 R;  4C8O A;  2VPZ B;  2IM2 A;  5DO2 A;  5AE1 A;  2FD4 A;  2JZ5 A;  2HS0 A;  3C14 B;  4ID5 B;  2FLN A;  5TAB A;  1CHC A;  2YT5 A;  1U7L A;  1E6Y A;  2KJV A;  3GQC A;  4K5R A;  1Q81 T;  3Q83 A;  2CNK B;  3KV6 A;  1VLO A;  4RW9 B;  3TQE A;  4CRJ A;  1T05 A;  2FUG 9;  3ZTS A;  2DO0 A;  3R5G A;  1XWH A;  1F3V A;  5D1K B;  1RTD B;  1NRK A;  1RAE B;  2KDO A;  2PE8 A;  3LAK A;  3P96 A;  3RYL A;  3W2V B;  2W2N P;  4N7T A;  4CIO A;  5HK4 A;  2OSQ A;  3A3P B;  2DHH A;  3IC1 A;  1NK5 A;  2DBB A;  2R3V A;  2F42 A;  2GVD A;  4YB5 A;  3EVO A;  3HMJ G;  2CQ4 A;  3QWU A;  4PXE A;  2Y43 A;  4RO0 A;  3M8P B;  1RBL A;  5HQL A;  1KVK A;  3ILI A;  1Y00 A;  3QNW B;  5LSL A;  4YME A;  1K73 T;  2DRA A;  2KN4 A;  3H42 A;  3ET6 B;  4AL6 A;  1U1L A;  4LLB A;  4LJN A;  4FF2 A;  3M7K A;  1VIO A;  4DV7 F;  3SQO P;  2VJE B;  4A8M P;  2Q79 A;  1Q8B A;  2DGO A;  2XSJ B;  4JI6 F;  3NNC A;  1IKY B;  3GG0 A;  1JLF B;  3MCM A;  1M1K T;  2ADC A;  4FJC A;  2F8H A;  2R7V A;  2HSE B;  4FXV A;  4NLO A;  5F41 A;  1G1X A;  2PGC A;  2KKX A;  1HW8 A;  2M13 A;  1HBU A;  2CIM A;  3HJV A;  1Q16 B;  4PQA A;  1R3N A;  1HD0 A;  2LFV A;  4O3Q A;  1N34 F;  1LDJ B;  3G8Q A;  2WW8 A;  4OYZ A;  2HVH A;  2DHS A;  4DPY A;  5T7L B;  3TO8 A;  1U4B A;  2CJK A;  2CT2 A;  3E01 A;  4RZR A;  4JI8 F;  1L5U A;  4O3S A;  2R7O A;  3FK4 A;  3QFH A;  3RPG C;  1SL2 A;  1YJT A;  2BVZ A;  2V34 A;  3AQP A;  4OZ1 A;  2NXC A;  3IRW P;  5KFW A;  2BJ1 A;  4DDF A;  1PC4 A;  1NKB A;  1FNO A;  2E6S A;  1RYR A;  1N32 J;  1VQ7 S;  2JEG A;  2CRL A;  1QSL A;  4W98 A;  1PG5 B;  3KNG A;  4RBU A;  4KFB B;  2MQN A;  1U2F A;  2QL5 B;  1XNR F;  3JTO A;  2BUN A;  2YRE A;  2HHP A;  2MB0 B;  1FWP A;  4AFF A;  1LW0 B;  2HQ3 A;  3L9Z A;  5EUH A;  4KKO B;  4DUZ J;  1JJC B;  2EK6 A;  4KPC A;  4W90 B;  3F0N A;  1IKX B;  4CP5 A;  1DQ8 A;  2WOM A;  3CJT A;  3NS6 A;  3QYY A;  5HMX A;  3RB3 A;  1XNR J;  3RPG B;  4URS A;  5FD1 A;  1UPP A;  2F3J A;  2EWH A;  4Y3C A;  1N5Q A;  4LF8 F;  1FFG B;  2B4U A;  4RUA A;  2ECN A;  2IQJ A;  4O44 A;  4BC9 A;  3ITH A;  5H9E J;  1VQO S;  2E1C A;  5A8K A;  2HNY B;  3X1L B;  5T41 A;  1U8S A;  2V2K A;  5CQG A;  2EPI A;  2N82 B;  1RTZ A;  2R8K A;  2IFX A;  2CG4 A;  2A0F B;  4RX6 A;  5K14 A;  2WSC C;  1AZS B;  2XOY A;  4A8Y A;  3IWN C;  1FJ7 A;  1O6X A;  1OQ3 A;  1V9O A;  2HS4 A;  2VZ9 A;  1B70 B;  4IYQ A;  4P75 A;  5D0E A;  1GXT A;  2J0Q D;  3QO9 B;  1HBN B;  1UKU A;  4DR3 J;  2DHA A;  3FBB A;  3BDP A;  4O0N A;  1XR5 A;  2GQ2 A;  2VPE A;  4FXW A;  4OHX A;  4DX7 A;  2ZHA A;  3WC2 A;  3TA2 A;  3UVJ A;  2ZUG A;  1DY3 A;  4IFY A;  1BQM B;  2V4R A;  2OH2 A;  1WEQ A;  3IFE A;  2V63 A;  1UWB A;  3GIR A;  4IKA A;  2PMZ D;  2DNN A;  2ZKT A;  1WEO A;  2Z8Q A;  1VQ8 S;  1CUL B;  4QIF A;  4CA1 A;  3GB0 A;  4TU8 A;  3J81 U;  3M32 B;  1LW0 A;  2YX4 A;  1NHU A;  1DLO A;  2XYG B;  1SL1 A;  3NAI A;  1Q1K A;  1QM9 A;  1X4G A;  2ZZN A;  2YNG A;  4QBU A;  3CD6 S;  1KOO A;  1PCA A;  4H4M A;  2ROE A;  1FT8 A;  2JC1 A;  2JMJ A;  1WOO A;  3UD5 A;  1EKS A;  1GMU A;  3VR1 A;  2P8I A;  2MKH A;  3QRP A;  2BOP A;  4DZ6 A;  4WIQ A;  1C0U B;  3WIU A;  3M05 A;  1V5V A;  3N5F A;  2HQG A;  4WKR A;  1Y9O A;  2QT7 A;  5D78 A;  1S0M A;  2M7S A;  3E01 B;  1K2F A;  3ZVZ B;  2RS8 A;  4WP8 A;  4R8U B;  3CCM S;  2XHW A;  2VPG A;  4WBF A;  4LQ3 A;  2D1C A;  3ZVY A;  2DH7 A;  3EVW A;  3BDE A;  3MPY A;  3R5D A;  4KH0 B;  2MGZ B;  1WTB A;  1RMD A;  1PAE X;  4F2R A;  2FGC A;  3M6W A;  4BWJ A;  1WC4 A;  4ZPB A;  3HHL B;  1T94 A;  2I6W A;  3L11 A;  2PO4 A;  4R8U A;  1MN7 A;  3QZ7 A;  4AVX A;  1CJT B;  2AQ4 A;  1FO1 A;  2KO1 A;  4V1A k;  2FLO A;  3SCI E;  2NLW A;  3DPL R;  1HQE B;  3MMC A;  1IKY A;  3N4W A;  1KQS R;  1EKR A;  2MQM A;  2MY8 A;  4KGZ B;  2VFS A;  2M0G B;  3TX8 A;  4K4T A;  3T3F A;  3FFI A;  1NK0 A;  3R5B A;  3CB4 A;  3I0R A;  4RW4 B;  2E9T A;  3TZX A;  3M2U B;  2OEL A;  1UAW A;  1NPR A;  4JUZ A;  2HVE A;  2GGP A;  4QCL A;  3CJR A;  2VP7 A;  4RBV A;  2DR8 A;  2Q66 A;  4HDG A;  2E7X A;  3MPW A;  7FDR A;  4ECZ A;  1T8E A;  3W8G A;  3Q1D A;  1YWX A;  2K2P A;  2LXI A;  4B9U A;  2RJZ A;  3FMB A;  4OJG A;  1LXN A;  2BA9 A;  2HRU A;  4USJ C;  1VGY A;  3TOQ A;  3EZ5 A;  1VYA A;  2YKM B;  5IQQ A;  2M5Y A;  1YSJ A;  2APO A;  3IGN A;  2UXB J;  4ZJL A;  4CLL A;  2B6A B;  4KRW A;  4TYB A;  3QSY B;  3CGI A;  4ECR A;  4EO8 A;  5D1M B;  4DV0 J;  4I2Q A;  3MD1 A;  1OIA A;  2OXQ C;  1YDL A;  4ELU A;  2Y8Y A;  3NS7 B;  1IWG A;  4B17 A;  1Q7Y T;  1G3O A;  3K0J A;  2KM8 B;  5HVH A;  4FO9 A;  1YIJ S;  2G0I A;  2YYR A;  1MMD A;  1S1V B;  2CDR B;  2AEJ A;  1QD1 A;  5C11 A;  3KMQ A;  2KFZ A;  3GL6 A;  1WWH A;  2FZC B;  1LQ9 A;  2EKN A;  3UE2 A;  2XLK A;  4RLE A;  1H98 A;  1NDK A;  1RWN B;  2DNQ A;  2WOM B;  4P52 A;  4CWB A;  4LVN P;  5IM0 A;  2KJW A;  2WB4 A;  3LGH A;  3BKT A;  2N4D A;  5DS7 A;  5IOL A;  2XGP A;  2RDJ A;  2QMW A;  1LDK C;  2ZWP A;  2HGL A;  3I0S B;  1HBO A;  5I3L A;  2QE5 A;  1S4E A;  5LXR A;  3G8S A;  4O44 B;  1N88 A;  1UW4 A;  2VJV A;  3BRE A;  1ZA2 B;  4ZMM A;  1PO6 A;  4YBS A;  4BHQ A;  3OL8 A;  3CO0 P;  4WFA Q;  4P5O B;  2RVJ A;  1BLU A;  2VBZ A;  4RBT A;  4Y6I A;  4JI6 J;  2N3O A;  3DRX A;  4TY8 A;  2Z58 B;  3W7B A;  5AXN A;  1DUR A;  2HWT A;  2OFG X;  1U6F A;  3I9V 9;  4YAT A;  1RHQ B;  5L1L A;  2OSR A;  3RB4 A;  2NSC A;  2UUB F;  5EYA F;  4ES1 A;  5KFO A;  2DNK A;  5H1V A;  3OW2 R;  1KBR A;  3I56 S;  1R0C B;  3LAN A;  2NRE A;  2UUC F;  4Q7A A;  3PO5 A;  1YRX A;  4UOH A;  3TVZ A;  2KYU A;  4JI3 J;  1N4L A;  1CJV B;  1Q8K A;  1ZOT A;  3TA0 A;  2MZ1 A;  1TK5 A;  2ZZT A;  2M3D A;  3MFH A;  4JYA F;  3OSP A;  2C1E B;  2XMU A;  1KTQ A;  1HQE A;  4PUO A;  2HHH F;  1JLB B;  1J5E J;  2IMW P;  4ELT A;  2ZH4 A;  2I2Y A;  4CQ1 A;  4P72 A;  5DDP C;  2LGV A;  2PNX A;  3M8Y A;  2VPX B;  5B0C A;  4LRF A;  4PPD A;  2HHQ A;  2XS2 A;  5AIT A;  2OIH A;  4X4N A;  4OZJ A;  2IJN A;  4ZCM A;  1HBU B;  3B8H A;  5KFK A;  2EI5 A;  4JB8 B;  1VQL S;  1HI0 P;  2DPI A;  4DF4 A;  4MVT A;  2G4B A;  2LEB A;  1WG1 A;  4NA1 A;  1KN6 A;  4DV3 J;  1TL3 A;  5I3Q A;  5KFB A;  3KLH A;  1N54 B;  2MT5 A;  4NLP A;  3DGP A;  3N6L A;  1V6H A;  2GVD B;  3THP A;  4CTA A;  1JLG A;  2ZH1 A;  2IAJ A;  4UZB A;  2D41 A;  2V69 A;  1VC0 A;  4OMF G;  2FZG B;  5AXL A;  3TZW A;  2MSS A;  4I0W A;  4Y00 A;  3KK3 A;  2H54 B;  1RXO B;  4R7E A;  3ET6 A;  1JLC B;  1NU4 A;  4DR5 F;  2A3J A;  2NYI A;  2DIV A;  1UVI A;  3P4U B;  4YB1 P;  1X5T A;  5LCW B;  4K4U A;  3E8O A;  2M85 A;  3EX7 B;  2YH0 A;  1AUD A;  4M5I A;  2RRN A;  3C14 A;  3O34 A;  4ID5 A;  5A8W B;  3Q22 A;  5HRO A;  3VQT A;  5DDQ C;  4TLQ A;  2F9J A;  2FHK A;  4J5O A;  4CO4 A;  1F62 A;  3T1Y J;  4RNH A;  5TDW A;  3Q8S B;  2OTJ S;  2U1A A;  1YG0 A;  2VPW B;  1WF2 A;  3Q8Y A;  2KR4 A;  4ZPT R;  3CJ4 A;  3SDE A;  3DNC A;  4EMD A;  2ZH7 A;  4NRT A;  1VQ9 S;  1JLE A;  4TQS A;  3N9M A;  4W4U A;  4HH1 A;  4LFC J;  4U67 Q;  2B9Y A;  1EET A;  2XYH B;  4RW7 B;  2LKZ A;  5D8H B;  1VBX A;  2MKE A;  1PYO B;  1UFK A;  4L75 A;  1N33 F;  1UEU A;  1AFJ A;  5KFL A;  2XY7 A;  3KJQ B;  3GIL A;  4QZV B;  2M1R A;  3DGP B;  1MRO A;  1IBK F;  1IXK A;  4ER8 A;  3R6L B;  2NUU G;  3LPE A;  2CQD A;  1LKZ A;  2CUY A;  3AD9 C;  3PEJ A;  4K7Q A;  4W4M A;  2D8S A;  4F0K A;  3D6F B;  1D0E A;  2VV5 A;  1KVJ A;  2GC8 A;  4ZUX U;  3LUY A;  1NM2 A;  1RTI A;  2B5J A;  2H65 B;  4DFJ A;  3UNG C;  1XWL A;  2CPJ A;  3SYZ A;  2MJU A;  2DNR A;  4QIG A;  5KFP A;  3Q86 A;  4GO5 X;  2CWK A;  1VRU A;  2M70 A;  1U0H A;  2DYA A;  1OMS A;  3F44 A;  4DHV A;  4EI2 A;  4DV4 F;  2HHV A;  3C66 A;  1JWW A;  2A2C A;  1RP5 A;  3PM9 A;  3EB5 A;  3EMT A;  4FDF A;  3U5O A;  2K7J A;  3ILJ A;  1WEN A;  4OZ0 A;  1FE4 A;  3DXB A;  4CLK A;  3FBF A;  2VFT A;  4KTQ A;  4I67 A;  2O67 A;  4OV6 A;  4JI2 J;  3BN7 A;  2RRB A;  4ZK7 M;  4DQP A;  5FER A;  3D5M A;  3FCV A;  4NN2 A;  5M2R A;  3W2W A;  5DG7 A;  3ENV A;  1F5A A;  1S77 D;  4LFB F;  4V3K C;  1FRX A;  1S6U A;  1U24 A;  3BQ0 A;  2HRT A;  1KON A;  2MKY A;  3EWG A;  3FJ2 A;  2J9C A;  1X4B A;  3MEC B;  4ED8 A;  1KFD A;  4DV1 J;  2KFN A;  1MBM A;  2E1A A;  4NXM J;  5BYQ A;  4GNE A;  2K7K A;  2YX1 A;  4CT8 A;  3GV5 B;  4FYD A;  3LP2 B;  1YBA A;  1V3S A;  1U8W A;  2B7C B;  1DHM A;  2OEJ A;  2ZKU A;  3AJ2 A;  4U7U K;  5D4L A;  3HT3 A;  1NK6 A;  4LRC A;  1BQM A;  1NSQ A;  4ED7 A;  3B4D A;  2BJ3 A;  4DOZ A;  3ZPV 1;  1VJW A;  3DHW C;  1JLF A;  2GML A;  5IV3 A;  2OMO A;  1NSK L;  1RTH A;  3V6J A;  1T3N A;  1EB0 A;  3PJ9 A;  1H7W A;  1QUP A;  3MED B;  1X31 C;  2OEK A;  5ETT A;  4QPX A;  3MR5 A;  1SKW A;  3CUL A;  3QAT A;  2Y8W A;  2D3O R;  5DLF A;  1FRM A;  2D3U A;  2JFD A;  4QR0 A;  1TKZ B;  2YNG B;  2XMA A;  3IS9 B;  4QQ4 A;  5CAB A;  4X65 F;  4IG3 B;  1YJN S;  3JTP A;  2GO9 A;  4HR2 A;  5H9E K;  4UY8 5;  1TKX B;  2MLY A;  1RHK B;  4IDK B;  3IWL A;  4WFZ A;  4I68 A;  3SV3 A;  2COL A;  4CLT A;  4U96 A;  3V6D B;  1RAB B;  1TQL A;  3BM7 A;  1QAX A;  3C15 A;  4YFU A;  2MQL A;  3GFH A;  3TAM A;  5E41 A;  1U1O A;  1VIX A;  4C9Z A;  3FJU B;  2CZV C;  2ZWO A;  5EHH A;  2YKM A;  4DQS A;  3TAP A;  4ED6 A;  2HZV A;  3QMQ A;  1HLW A;  2JX2 A;  2OD4 A;  4PAA A;  4YHH J;  3H7H B;  3I82 A;  2A2D A;  3ILL A;  3OPK A;  3J7Z T;  3LAL A;  3OTB A;  3HT0 A;  4LRE A;  3KDE C;  1X5O A;  2GMJ A;  3OXL A;  5HL7 Q;  4FBT A;  1RAF B;  2XO6 A;  1WEE A;  1F2H A;  1HMV B;  2IRY A;  2JC0 A;  4KB7 A;  3TRG A;  4GKJ J;  4H4K C;  1NUE A;  3GJQ B;  3MAA B;  4C0B A;  2HVZ A;  3D54 A;  4LSN A;  3TUP A;  3TAQ A;  1UW9 A;  2JEJ A;  3UD3 P;  2MEW A;  1WC6 A;  5AT1 B;  3ITH B;  3CCL S;  1N52 B;  3O2I A;  2ASL A;  3M8S A;  3SOX A;  1LWX A;  1WFK A;  2HK2 A;  4N56 A;  1Q86 T;  4BDP A;  3ELH A;  3LPY A;  2K4D A;  2RAQ A;  3Q2S C;  2P6T A;  3HZE A;  4OYB A;  4WII A;  2F8M A;  2YXL A;  3ZZR A;  5HP1 A;  2D3O 1;  1Q5V A;  1WEL A;  5KFA A;  3KHL A;  2GZO A;  4QIW D;  3ULH A;  1W7W A;  1T03 A;  3MEC A;  3HXM A;  6FD1 A;  3TX0 A;  3DI6 A;  1RDR A;  3GFY A;  5A76 A;  1RAO A;  3PVX A;  2DY1 A;  2C28 A;  1L3U A;  3C3L A;  4KYZ A;  1XNQ F;  2DNH A;  2YNI A;  3IAS 9;  3JQJ A;  4HHH A;  2ZH6 A;  1IBK J;  1OY6 A;  1M5K C;  3EPI A;  4FS1 A;  5A8R B;  2W4D A;  2EGM A;  3MHS A;  1FDA A;  3ETM A;  3OFH A;  2DGU A;  3PRV A;  3UFC X;  3DLE B;  5KFE A;  4UUW A;  5D0R A;  1YLX A;  2KG1 A;  1HQU A;  1ACM B;  3AXM A;  2CPH A;  1MU2 B;  4Y2M A;  3WHI A;  3O36 A;  2XLI A;  5A2Q U;  2EFO A;  4DPW A;  4M1K A;  3NGT A;  2E9Z A;  3UN2 A;  1JM7 B;  2JUN A;  1NZ8 A;  2JRJ A;  4UUX A;  5C42 A;  1G25 A;  1W2B R;  1YRT A;  4OX6 A;  3O44 A;  4NZ7 A;  4PEO A;  3GR0 A;  4YBT A;  1L3V A;  2BJD A;  3DC2 A;  2NYH A;  1TMM A;  2AZ3 A;  2Q6B A;  1Y4Z B;  4YR2 A;  3G8T A;  5HO4 A;  4FF1 A;  2UUW A;  2G45 A;  4ECX A;  3O3L A;  4DSF A;  3M2V B;  4ZVE A;  4MIB A;  1G7C B;  4QYZ K;  3I4P A;  2BMB A;  4RW7 A;  5E33 A;  1KEK A;  2MKC A;  1PSD A;  3G87 A;  1IM4 A;  2ZDO A;  1WSR A;  5RUB A;  1XK8 A;  1FEH A;  3T7L A;  3NP5 A;  3NCP A;  2L43 A;  3AB4 B;  5SUH A;  1MRO B;  4OI6 A;  4CO0 A;  4LF4 J;  2P5V A;  4FP9 A;  2BJ7 A;  2OJ3 A;  1M1H A;  4NYP A;  2XS5 A;  2F63 A;  3G6X A;  2HRY A;  2B51 A;  3B82 A;  5DGA A;  2AGQ A;  5KFZ A;  3DOK B;  3P3D A;  2VFV A;  2WTF A;  2GX8 A;  1NDC A;  4NE9 C;  1K1S A;  2BRL A;  1FRK A;  3E3X A;  1YJ9 S;  2ZIT A;  2JLG A;  2QLB B;  1FK9 B;  4MK8 A;  2EFV A;  2AYG A;  2HHU A;  1KR4 A;  1M1G A;  4MK9 A;  4HDH A;  2AD9 A;  2HFN A;  4LAD B;  4RU9 A;  4YAB A;  3U1N A;  3J7Y I;  4A4C A;  3TW0 A;  1HNI A;  2CSY A;  1JK9 B;  1DVP A;  5JG6 A;  2AKW B;  1WTF A;  1Y3J A;  2FHJ D;  3GR1 A;  4DCO B;  2V8V A;  4A8S A;  3IBC B;  4QIV A;  1CPZ A;  2Y3Y A;  2OML A;  4YN3 B;  2FHJ A;  1I94 F;  1YQH A;  8ATC B;  4PXD A;  5KFV A;  1NXI A;  4IR9 A;  1ZM2 A;  5DZ6 A;  1UJ6 A;  2F8E X;  1HNV B;  1MG7 A;  4UF4 A;  3HHN B;  1FKP B;  4I7F A;  3IRX A;  2CSZ A;  1YZ7 A;  2UUC J;  4Z7C A;  1V3R A;  4CM0 A;  1S9E B;  4UY8 T;  3FEZ A;  1YJW S;  4RW8 B;  4N41 A;  2AYE A;  4HH0 A;  2F40 A;  5FB1 A;  2FVS A;  4LT6 A;  2JEF A;  3DLG B;  1H73 A;  2W9A A;  3DRP B;  2LDI A;  3IHP A;  2G2Z A;  2POK A;  3DOL B;  4F25 A;  3VF0 B;  1BWE A;  2E5J A;  3ETO A;  2RI7 A;  3M2R B;  2KL8 A;  5KFX A;  2UVU A;  5C2G A;  2HGM A;  4QWA A;  1VR6 A;  5TBN A;  3EB6 A;  1CJK A;  2QIF A;  4CYU B;  1GX6 A;  2LXU A;  1F5C A;  4CDI A;  4NOH A;  3V81 B;  1XMB A;  4DV6 F;  3SOU A;  5AIU A;  1WOP A;  2RT3 A;  1SUQ A;  2YQ0 A;  3GFZ A;  4ZJO A;  2W2M P;  4DI6 A;  5DDR C;  4ZVF A;  2OPQ B;  3PW5 A;  1JKH B;  4C8K A;  3DLK A;  4KPY A;  1RT4 A;  4RWX A;  1Z2Z A;  3VGS A;  1PJ7 A;  2XMV A;  1RAI B;  1WHX A;  3N28 A;  2R7U A;  2J0W A;  1UCN A;  3D28 A;  2RDI A;  4OLP A;  3PJW A;  2W7P A;  4B3O B;  1JKH A;  4B3T J;  1UVM A;  1ZS6 A;  4LSL A;  4ZVP B;  4AQY J;  3HVW A;  3Q89 A;  1FRI A;  5A2Q Y;  3Q24 A;  1B7Y B;  2DNO A;  3W2V A;  2MIQ A;  2AEF A;  2CPX A;  3D3B J;  1FCA A;  2OPP A;  5KG2 A;  2I5J B;  1K47 A;  2XC9 A;  3QJL A;  3QIP A;  3W8P A;  3IM8 A;  1MM3 A;  3EPG A;  2CG8 A;  2DXF A;  2CPI A;  1FDB A;  1RT6 A;  3OR2 B;  2DR9 A;  2HHX A;  3K8W A;  3RRK A;  4WTO B;  5M2U A;  1S6Q A;  1TKT B;  2OUG A;  3BZQ A;  3MEK A;  4QF3 A;  1VIS A;  3QAE A;  4E8U A;  2HDP A;  2VON A;  2QA4 G;  1R8C A;  2B7B B;  4OYO A;  3MMB A;  1HBM B;  1CQM A;  4ZIT A;  4U6P A;  3GG1 A;  1N32 F;  4WFX A;  5B0E A;  3R5A A;  2W7O A;  1PC5 A;  3MFI A;  1YJR A;  1RK8 A;  4N5S A;  4O3P A;  5KFY A;  3L3C A;  2MZS A;  4WJB A;  1KFS A;  2A10 A;  1HBM A;  2J7K A;  1X0F A;  3QPI A;  2HMI B;  3W5X A;  4ETZ A;  1T9Y A;  2DGT A;  4JI8 J;  3PYF A;  3B78 A;  5FDL A;  2MA5 A;  2W8L A;  2KZZ A;  2MY7 A;  3M6U A;  3ISN C;  1Z1Z A;  2RHQ B;  2RF2 B;  3IG1 B;  1MWZ A;  4URG A;  1DAR A;  4Y65 A;  1SV5 B;  4ECS A;  2ABY A;  4F52 B;  3M30 B;  3NGK A;  4WFN Q;  2HGN A;  4C0H A;  3UDV A;  1U48 A;  5DIN A;  4KGK A;  5HI7 A;  2IDL A;  2V2Z A;  3D3C J;  3M7V A;  1HYJ A;  3UDE A;  5A8W A;  3DLJ A;  2VOP A;  2IA6 A;  3U02 A;  2HBY B;  3PV8 A;  5M2P A;  5EGY A;  2V8G A;  4E98 A;  3MMC B;  1TUG B;  2CZ9 A;  2ZHO A;  3UD4 P;  4I6Y A;  1HWU A;  2LGL A;  1EIY B;  3SHB A;  4ZCL A;  3DFE A;  3TNV A;  1TAQ A;  3K8V A;  3KJV B;  1Z4U A;  1O0P A;  2VG5 A;  1BXN A;  4PYA A;  3FNN A;  4CLW A;  2DNL A;  1OQ6 A;  3S01 A;  3K5M A;  3THV A;  1SVD A;  1WHW A;  2CJ9 A;  4RW4 A;  4DL3 A;  3V81 A;  1ZZN A;  4Y34 A;  3TI0 A;  1TVR A;  3FFI B;  2ERR A;  3DDN A;  3CC4 S;  3KHH A;  2G6Q A;  1T9T A;  3NKY A;  4NCA A;  3HK2 A;  4KR0 B;  2Z2Z A;  5L8R C;  2LXH C;  2GJI A;  3DI6 B;  4ED0 A;  1WC5 A;  4IG0 A;  5HLF A;  2YKA A;  2H0D B;  5MLC V;  4AL5 A;  3PCO B;  5F3Z A;  1N36 J;  3DHX A;  2DSM A;  1HPZ A;  2E29 A;  4I6A A;  4ECQ A;  4IRC A;  3CJK A;  3ZZO A;  2ECV A;  2DNY A;  2B9E A;  4HT7 A;  4ID8 A;  5F8M A;  5LT5 A;  4DR3 F;  3R1L A;  4JI7 J;  4DXL A;  2AJQ A;  4IO1 A;  2IVY A;  4F4X A;  1VQY A;  1HNZ F;  3KDN A;  4RUH A;  3CC7 S;  2VNF A;  1KHW A;  2J9D E;  3CMQ A;  3WX4 A;  4I7F B;  3CD5 A;  3MR7 A;  1R7I A;  2C2N A;  5KFF A;  2JMI A;  2IMO A;  1RWO B;  2R42 A;  3GU0 A;  4F3Q A;  4RU2 A;  3C19 A;  4OGC A;  2EBG A;  4K2X A;  1EQ0 A;  2DHG A;  2AJ2 A;  4GC7 A;  1IBC B;  1S1W B;  5KH9 A;  2R7Q A;  2X1G A;  4U9R A;  1FXL A;  1RTJ A;  1SXL A;  5J2P B;  2M3H A;  4RKU C;  3PDN A;  4DV3 F;  2F1F A;  4NLW A;  4BC7 A;  4L58 A;  1JJH A;  4OHW A;  1HHT P;  1WKK A;  4I64 A;  2KRB A;  4XPC A;  2X1F A;  2L80 A;  1U26 A;  2UV8 G;  1U0H B;  3TZY A;  1T03 B;  1EAR A;  2D9O A;  1FER A;  4KAI A;  2OWA A;  1BOR A;  1SPB P;  2YWW A;  4JP8 A;  1VBY A;  4K8R A;  3OJS A;  1Y0H A;  2JHE A;  4OX9 F;  2HK3 A;  1CSJ A;  3PW7 A;  1VHF A;  3PHT A;  2HND B;  2JVO A;  3HVT A;  1EQM A;  4ZVG A;  3VAJ A;  5H1U A;  2QGF B;  3W5Y A;  4GC6 A;  2C22 A;  1NJZ A;  2R8G A;  3MMJ A;  3D6T B;  4OYP A;  2DGS A;  1R43 A;  3X3U A;  1X9S A;  1BQN A;  2KVI A;  5ETQ A;  2RF2 A;  4Z37 A;  2PFF B;  3W9I A;  1C1C A;  3AB2 B;  4USV A;  5E3Q A;  3W61 A;  2IY5 B;  1JX4 A;  4EU0 A;  4ZLL A;  2BE7 D;  3MDB C;  2IM1 A;  1S6Q B;  1TKT A;  4PKD B;  3UDC A;  4F50 A;  1TV6 A;  1BD6 A;  3EXY A;  1UA0 A;  1S10 A;  2LQ6 A;  2VIC A;  4X4O A;  3SUB A;  3POT B;  3QT8 A;  4PXC A;  4USK A;  3H4D A;  3MM8 B;  5GAG U;  3CCR S;  2LVW A;  2PDA A;  5KOX A;  4P7V A;  3W3S A;  3MF5 A;  2AIR B;  1VFJ A;  3MMB B;  3V4M A;  5GAD I;  4USU A;  3M8R A;  3DN9 A;  3VGU A;  3ZTP A;  2VPD A;  2R2R A;  3HJF A;  3SV4 A;  2NPI A;  4CT9 A;  2DJA A;  5LKX A;  2BW2 A;  2GO8 A;  3HSJ A;  3BH6 B;  1EZZ B;  3HKW A;  3I4H X;  3N01 A;  4HEA 9;  1RWW B;  1E4U A;  3UWT A;  3T5K A;  3S6E A;  2IA0 A;  1WEV A;  1X8D A;  4GMK A;  4M5H A;  2D69 A;  3MI7 X;  3PYG A;  5E7O B;  1TKX A;  4UQT A;  2AW0 A;  5KG0 A;  2LGK A;  1MW7 A;  2GAH C;  1LWF B;  4KGV B;  3DU6 A;  2C42 A;  4CNZ A;  3I31 A;  4QW8 A;  3R7N B;  1VC5 A;  3GV7 B;  3MR3 A;  1IQT A;  2DPJ A;  4F0H A;  4BS2 A;  3J81 j;  1RWU A;  2RU3 A;  3DU5 A;  4ES3 A;  5J2M A;  1P8G A;  4DR7 F;  5B79 A;  3CO9 A;  1D1U A;  4NLG A;  1HHQ A;  1OY8 A;  2OPR B;  2W2O P;  5ETM A;  2ZH2 A;  5KFC A;  3DRP A;  2BOA A;  3RU0 A;  2ZC3 A;  4B9V A;  3QGP A;  2E5G A;  2X51 A;  2W2P P;  2DTJ A;  2NAA A;  1A0O B;  3AOB A;  3SSS A;  3PLW A;  2GJ2 A;  2JLE A;  3HCT A;  2X3G A;  2XMK A;  4NI2 B;  3HTK C;  4Q2M A;  4DR6 J;  4MFB B;  4NML A;  1U1P A;  3PKM A;  5EX0 A;  4AUK A;  4X4V A;  3I96 A;  3SMZ A;  3VVT A;  1S76 D;  2P6S A;  4BCA A;  2K3I A;  4X4U A;  3TUJ C;  3W2W B;  2M88 A;  2W9B A;  1IBM F;  4IR1 A;  3DRS A;  3HVA A;  2OPS B;  4MKB A;  4B3T F;  3HX9 A;  1U09 A;  2YKO A;  1O5J A;  3G6E S;  4DSL A;  2XZW A;  1AB8 A;  1R6Y A;  4K4V A;  2PI5 A;  3MM6 B;  3T5J A;  3MDF A;  1S1U B;  3EE3 A;  1CLF A;  2Y9H A;  1Z60 A;  4QU6 A;  4DQQ A;  1SV5 A;  1PBU A;  3CE8 A;  3CJ8 A;  3ENA A;  1OO0 B;  3LO3 A;  4LRA A;  4B3R F;  1N34 J;  4U7U D;  1KP6 A;  2OI2 A;  1X4A A;  3GON A;  3GV8 B;  1X7V A;  1QDU B;  1Y11 A;  1FKA F;  1QAI A;  5D77 A;  3ZZY A;  3TJ8 A;  5CAA A;  3KK2 A;  5SVX A;  3L7U A;  3CIM A;  5AXM A;  2JFK A;  5KT2 A;  2J6U A;  4DSE A;  1U1R A;  2JMD A;  2HWH A;  1OYE A;  4ZVT B;  3LDY A;  1QVG R;  3CD0 A;  4WZQ A;  3ZXW A;  1NB7 A;  3IS9 A;  5KT6 A;  3KLF B;  4RUC A;  4EBE A;  4DL5 A;  1B64 A;  5DRK A;  1UJ4 A;  2MA6 A;  4B9T A;  2BE2 A;  3Q8V A;  1HW9 A;  2CPD A;  5HMW A;  1VC6 A;  2IAJ B;  1WES A;  4G3I A;  3N9L A;  4TQR A;  3PW0 A;  2CQC A;  4HTI A;  1T02 A;  3HSZ A;  4HL9 A;  4N3W A;  4XTT A;  4ZLN A;  3VAH A;  1TL3 B;  2R7X A;  1XEZ A;  1B0P A;  3PXG a;  1QTM A;  3LQJ A;  5TDR A;  4R2Y A;  1UWA A;  3NAH A;  3DWD A;  5D15 A;  3BSA A;  2A6O A;  1S7I A;  1NK8 A;  1HL6 A;  3MXH P;  4L7X A;  2KIZ A;  1NDP A;  2UZG A;  9ATC B;  4ZA1 A;  1TU0 B;  1MMN A;  1VDH A;  5G05 B;  4DR2 J;  1REG X;  4C48 A;  1GMW A;  3RBD A;  3RBX A;  2IC3 A;  1P9Y A;  2CPE A;  2FHO B;  2K1R B;  2LA6 A;  1U2R A;  4TLR A;  2I8E A;  2RH3 A;  3VAM A;  3G71 S;  1Y3K A;  2C3P A;  4NEZ A;  3GII A;  2VBW A;  4C3L A;  1WIM A;  2QFJ A;  1Q53 A;  4MKA A;  5A8R A;  5LSO A;  1SUQ B;  3JYT B;  1KQF B;  4CLF A;  1OJ4 A;  1HI8 A;  1Q4R A;  1ZAX A;  4WE1 A;  4JV2 A;  1JLQ A;  2MD8 C;  4NX9 A;  3PJX A;  4ZOS A;  3RR7 A;  3TP2 A;  3WX8 A;  1N5V A;  2N4C A;  2J9E A;  1RHU B;  4KC5 A;  4OJ3 A;  1VBZ A;  2M8D B;  3PG9 A;  2F4V J;  2KWJ A;  4X2B A;  2PUY A;  5LOQ A;  4AYC A;  1PIL A;  3A3O B;  3CED A;  4JI5 J;  4TKP B;  2XLJ A;  4LF8 J;  4JI0 J;  3DLB A;  3RB0 A;  1ARO P;  4NI2 A;  4C7Q A;  2NUH A;  2C2M B;  2A1B A;  2ECW A;  3PRD A;  4MMO A;  4USH A;  3CXC R;  3CCU S;  1S0V A;  2C2V S;  3P5T L;  3G4S S;  4I56 A;  3KUG A;  2J7W A;  2LEP A;  1HPZ B;  2WVD A;  3NOG A;  3OTC A;  4WYL A;  4C8M A;  4ANC A;  2FJW A;  5KG3 A;  3W9H A;  3TAN A;  5K8M A;  2XY5 A;  2UVR A;  4B9S A;  4R5P A;  2R7T A;  3MR6 A;  2NXE A;  2VKR A;  2AYM A;  3D6M B;  1FX4 A;  3TEH B;  3VV2 B;  3VZI A;  4IRD A;  3I87 A;  2CFX A;  3PTW A;  4LR8 A;  1T95 A;  4QPT A;  1WG4 A;  4DZD A;  2CJY B;  3L09 A;  4OHZ A;  3LVQ E;  3VAI A;  5JJB A;  3TJ9 A;  1LK7 A;  2K1J A;  2AEM A;  4V19 X;  2IHR 1;  1LEO A;  2ZD1 A;  4O3N A;  3W5Z A;  1KKH A;  2M9K A;  2BV3 A;  4DPO A;  3ZZT A;  1DTT B;  3MPD A;  3FZ2 A;  1PAU B;  1JIH A;  2QL9 B;  4Z0R A;  2XM3 A;  2XBP A;  2QFI A;  3PUR A;  2W1B A;  4YEA A;  2HLU A;  5J1N A;  4ZDT A;  5JXS A;  3H0P A;  5CYM A;  3NMR A;  2Z2M A;  1XR7 A;  2WCX A;  3K59 A;  4PG4 A;  3ISZ A;  1HKA A;  2H4W B;  4FYV B;  3C15 B;  2FY1 A;  1HNI B;  2UXD F;  1GNK A;  5HAT A;  2YY3 A;  2HQD A;  2KXN B;  2B8Q A;  2HZA A;  4UOG A;  4DL6 A;  1YI2 S;  1VQ5 S;  4LF5 J;  1FKO B;  3D0H E;  3BO4 A;  1VQS A;  4X66 J;  4C11 A;  2DR7 A;  1R31 A;  3CJ5 A;  2DJW A;  5B08 A;  1JOC A;  2YWE A;  1SH2 A;  3MM6 A;  4KSE B;  2K3K A;  4RNO A;  1LK5 A;  1S9G B;  3HKZ D;  3K5O A;  1FRJ A;  5AXK A;  3T19 A;  1N6Q B;  2GQC A;  4M94 A;  1AZS A;  3OL7 A;  2DCU B;  2CKW A;  4ILR A;  1C1C B;  2HHS A;  4X62 J;  2GVZ A;  2G13 A;  3VGV A;  2E5L J;  2DXD A;  4FN5 A;  1GH8 A;  2ECG A;  2W7A A;  2Q3P A;  1I94 J;  5DZ7 A;  2AV5 A;  2NXU A;  1IR2 A;  3JSM B;  4F4K A;  4KO0 A;  3ZYQ A;  5K8O A;  2BQU A;  4Q0B A;  4GB0 A;  3MWB A;  3LWL A;  5HBM B;  3Q0A A;  2J6T A;  1FX2 A;  2K16 A;  3Q8U A;  4PAB A;  2CYY A;  4WZM A;  1HWJ A;  2KRE A;  4DR2 F;  5DM7 Q;  2XS7 A;  1JXE A;  3NOC A;  2FY8 A;  1RI7 A;  1WKJ A;  2GIR A;  2QYG A;  4RL1 A;  3C46 A;  1SJ4 P;  2HFS A;  3PX6 A;  3KJF B;  3RBE A;  3CCW A;  2FC9 A;  3ZNU A;  5B7W A;  2AGP A;  4MYU A;  2QJ0 A;  1QY7 A;  1KQG B;  1K1Q A;  3BSC A;  2UU9 J;  3FC9 A;  4JV5 J;  5C25 B;  1GQE A;  1YKW A;  4UZC A;  3K2Y A;  4M95 A;  4NCB A;  1T7P A;  2FZK B;  4IO9 Q;  1FVQ A;  1LWC A;  3HHL D;  3OQ2 A;  3I55 S;  5HJX A;  2W9C A;  5D4O A;  3M1V A;  1HQU B;  3I5C A;  3KMS A;  4HI1 A;  2HW3 A;  3HHL A;  3VHQ A;  2IC3 B;  4NXN F;  1KLM B;  4H4O A;  3SFU A;  2KI2 A;  5JVG Q;  2DO4 A;  3UN3 A;  1TL7 A;  3E51 A;  5D3G A;  3FM8 C;  2ZUA A;  5B0A A;  1DTQ A;  3THT A;  2FJE B;  4DSJ A;  2DNP A;  1KC8 T;  1RAC B;  3O37 A;  5B76 A;  1TFY A;  5K8N A;  1RBO B;  3AOD A;  4HI2 A;  4Q5V A;  4WF9 Q;  3U5N A;  3JSY A;  2FJD B;  2AU0 A;  5LMN F;  4I7C A;  2MHN A;  5HLF B;  2RIL A;  1WF1 A;  5FII A;  4O4G A;  2FPH X;  4CH0 S;  1URR A;  2J7U A;  2BJ9 A;  2YHO A;  2AX1 A;  5T14 A;  3KUH A;  3PX4 A;  2E1R A;  2ZOF A;  1HYS A;  2B43 A;  3CJ0 A;  5IZH A;  3PFE A;  5FJ4 A;  4DV1 F;  2EKY A;  1H2V Z;  4X64 J;  4QJV A;  3CWJ A;  4UST A;  4ZPV R;  3TVY A;  4ZCI A;  4X65 J;  4H4M B;  2UUA J;  3P6Y C;  4PG8 A;  4C8Z A;  3CJ3 A;  3GIM A;  2V94 A;  4Y2K A;  1UVK A;  4USI A;  5DJB A;  4O0I A;  2ECI A;  3M99 A;  4TN2 A;  2V0N A;  4NLQ A;  5U47 A;  5H9F J;  4F4A A;  1NH7 A;  2RQ4 A;  2RD5 C;  3EGZ A;  4Y2A A;  1FXD A;  3EDQ B;  2DX8 A;  1XMO F;  5DGB A;  5D4N A;  2Q1L A;  4XDD A;  3NNA A;  1AFI A;  3LJU X;  3H20 A;  3NG2 A;  2ZJR Q;  1N6Q A;  3QRQ A;  4YB6 A;  4DV2 F;  3H40 A;  1SJ1 A;  1MN9 A;  2F65 A;  3OFF A;  4YDX A;  2KG0 A;  4KKO A;  4JV0 A;  2RQC A;  4J9O A;  2KWK A;  4WP3 A;  1FP0 A;  2YX7 A;  4B86 C;  2XY6 A;  4KHM A;  3T41 A;  3W9J A;  4K4Z A;  2AWZ A;  1RT3 B;  2ZVS A;  4J37 A;  1ZTW A;  3UPF A;  1UJ5 A;  2AJ0 A;  3BGR A;  3CJQ A;  1LW2 B;  4PTB A;  2LU1 A;  1RIS A;  2ZDP A;  3CJS A;  1RTJ B;  3CJ2 A;  2VG7 B;  5D4P A;  2OPS A;  1R8A A;  2MKS A;  4GRS A;  3W64 A;  4F4W A;  2W9B B;  1H72 C;  2RSD A;  1RWX B;  4DPX A;  2JOQ A;  1XIQ A;  1UZH A;  3RAX A;  3RTR B;  2FFW A;  1MNE A;  1S9F A;  2JVR A;  3CSK A;  5LKT A;  1HFE L;  3AXK A;  3LP1 A;  4ZP6 A;  4RJV A;  1Y10 A;  2L75 A;  4YS2 A;  4LFC F;  3IXQ A;  4OIX A;  4XK8 C;  1FA0 A;  1VRT A;  2ZOG A;  3LTO A;  3M8W A;  5D0H A;  5I4M A;  2B4P A;  1RCO B;  3PIO Q;  3PO4 A;  3RW6 A;  3KFW X;  4G1Q B;  4YB7 A;  4QWB A;  1JLG B;  5IV4 A;  3CIZ A;  3T1Y F;  2H1Y A;  2NR0 A;  1QAY A;  1RT5 A;  2MUM A;  3LQI A;  1YRU A;  2MYF A;  2LCW A;  3IAM 9;  3NRB A;  3SZ2 A;  2KXH A;  3KG4 A;  4UTG A;  1H74 A;  4F3O A;  1VQ4 S;  2CJB A;  2LQ8 A;  4WFY A;  4K4Y A;  3DLG A;  1CBK A;  4AYB D;  1F5B A;  1JLQ B;  4L74 A;  1YJU A;  1RGV A;  3CW2 C;  4A0C D;  1TL7 B;  2C2K B;  2LXP C;  2DH8 A;  1MLA A;  1Q5Y A;  1KLM A;  1YK9 A;  3D1H A;  3DOM B;  1TL1 B;  4H4O B;  5HVF A;  6FDR A;  3ADA C;  1DQA A;  2D9P A;  5KFT A;  4AXI A;  1AW0 A;  3NXZ A;  2QL7 B;  4X4Q A;  3OTO F;  2HUR A;  4AYC B;  3H25 A;  3T5H A;  2Z4P A;  3BGL A;  5L46 A;  1TL1 A;  3H2L A;  2R7R A;  5ETP A;  2M52 A;  2XCA A;  1WKL A;  3MM5 A;  3NS5 A;  4PYD A;  4I7D A;  3HCU A;  2G1D A;  3DKD A;  1TTH B;  2LU2 A;  2BM0 A;  3EJM A;  3RR8 A;  4YUD A;  2MTL A;  3ASL A;  3O47 A;  1P1T A;  3C6W A;  2HHW A;  5G0R A;  2G0J A;  4N8O A;  2HFZ A;  1JXV A;  2F7V A;  4LBI A;  1BHN A;  2B0O E;  5SVI A;  3AOC A;  3IG1 A;  2EG1 A;  3FSX A;  1M0S A;  2E1P A;  2W01 A;  1IJF B;  1RLD A;  4DSI A;  5E0O A;  4L3K A;  2LEC A;  2V4Q A;  4DPU A;  4HYK A;  1NKE A;  2Y1L B;  4HLB A;  4P6Q A;  3RW7 A;  2QTW A;  3R6G B;  1Q7L B;  5I3U A;  2ZJQ Q;  1DZ5 A;  1RU2 A;  4KO0 B;  5B0F A;  5IC4 B;  4LFB J;  4FIP A;  1NHK L;  1IN0 A;  3M8P A;  2LGG A;  3O35 A;  4OZ5 A;  1NK4 A;  1IBM J;  1RKI A;  1F60 B;  3IR6 B;  4WPA A;  5H9F K;  2BXJ A;  3LRQ A;  3OT9 A;  4UOC A;  1HNW F;  2VOD A;  3KLE A;  3KK2 B;  2BE2 B;  4ECW A;  2XWY A;  1UEK A;  1I51 B;  3SQG B;  3UCU P;  1W2I A;  3I32 A;  1RT3 A;  3M2V A;  2MQ8 A;  2VJU A;  4B3M J;  1X9M A;  1WSV A;  1JLE B;  3TAR A;  3CVK A;  2GAG C;  3TWZ A;  3R2C J;  3R5C A;  4IH6 A;  4C8L A;  3HCS A;  1SKU B;  1U6Z A;  2VQF J;  2L9N A;  4C98 A;  2GIF A;  1WNE A;  1SCJ B;  1N36 F;  3LOU A;  1T11 A;  4TYA A;  5B8D A;  3NBP A;  4JI4 F;  1SH3 A;  1U1N A;  3KK3 B;  1X5P A;  3EM1 A;  7AT1 B;  1CEZ A;  2O01 C;  4FKX A;  4ALZ A;  3MMA A;  3FEH A;  3BN4 A;  4OYI A;  4X62 F;  4QR1 A;  4CO1 A;  1P6T A;  1R89 A;  4UT4 A;  3US5 A;  2YH1 A;  1NK7 A;  4EZ9 A;  2EC0 A;  1QSS A;  1X4I A;  2HYE D;  2BKN A;  1SI9 A;  2ZD1 B;  2OO4 A;  2YPZ A;  1K0V A;  2VC0 A;  1S1T A;  3NMA A;  3M8Z A;  2AMC B;  2KU7 A;  4ZP9 A;  2HFO A;  4ZVH A;  2H5I B;  5LXY A;  4Q43 A;  3V4I A;  1DFD A;  4UQG A;  3KTQ A;  1JLA A;  4M5D A;  1YJV A;  4HTJ A;  5CCM A;  4DFK A;  2AGO A;  3U27 A;  2KH9 A;  2P9E A;  1S48 A;  4CLS A;  2O3D A;  3GV4 A;  4A49 A;  2DIT A;  3MGJ A;  4F26 A;  2PSZ A;  2LA4 A;  4B3S F;  2QLW A;  2DVI A;  2G1H A;  1RAA B;  1VJQ A;  4AXJ A;  1VS3 A;  1JM7 A;  1B4S A;  1B99 A;  5HP1 B;  4KT0 C;  1OSC A;  3H2V E;  4URQ U;  3G6V A;  1RA6 A;  3MPV A;  4CH1 A;  5IS2 A;  3LP1 B;  5J2N B;  2VJF B;  1L3K A;  4ZHR A;  4NZ0 A;  1JNR B;  2MD7 B;  4X3G A;  1KOH A;  3CDE A;  3D9B A;  1VK3 A;  3M1V B;  2ILY A;  3WQP A;  4ZLP A;  2VQE F;  2HQC A;  5LMU J;  4EBD A;  1TUW A;  3PHE A;  2E5I A;  4LR9 A;  4C6A A;  1SQF A;  3G2X A;  4LFA J;  4XO0 A;  4DBQ A;  3FAO A;  4OI2 A;  4J90 A;  2F5G A;  2YNI B;  8RUC A;  1VI7 A;  1IBL J;  4L73 A;  3M63 A;  3Q8R B;  4R0J A;  3KG0 A;  3QGH A;  2HHT A;  1QE1 A;  3I0S A;  3QZV A;  5HAO A;  3CTR A;  3MM8 A;  5CYJ A;  3AD7 C;  3CDW A;  1RE1 B;  1NAQ A;  3R27 A;  1E6Y B;  3BSN A;  4GNF A;  4FNI A;  2IYG A;  5CHC B;  4OI1 A;  3R7S B;  3ZC4 A;  2E61 A;  1CUL A;  4DS4 A;  2FDN A;  3SQG A;  1RHM B;  3VZH A;  4L6V 3;  2ZNZ A;  1BGX T;  3RG6 A;  3J7Z 5;  1LNQ A;  4NEY A;  4OX7 A;  3UQS A;  2F4V F;  4NL5 A;  4DG1 B;  1TK0 A;  4DU8 A;  3HO1 A;  1H7X A;  4I7B A;  2EC2 A;  1OS5 A;  5A8K B;  2CPF A;  4F0M A;  2YKP A;  1V3Z A;  2XSF A;  3W63 A;  2AP6 A;  4DX5 A;  5FB0 A;  3DLL Q;  3SCK E;  2KFT A;  4WCE Q;  5KFD A;  3AOA A;  1PIE A;  1VLY A;  1KQK A;  5K14 B;  1HNX F;  5L1J A;  1U0S A;  1WJ9 A;  2HZC A;  2MST A;  2BBE A;  2VH7 A;  1NLK L;  3A8K A;  3S7R A;  2XTJ P;  4Z7Y A;  4Q45 A;  3V6K A;  3NGD A;  3M6V A;  1BQN B;  5SVI B;  1HYI A;  4C11 B;  1BE4 A;  4QU7 A;  8AT1 B;  3LP0 A;  1B0T A;  4XI1 A;  1FTC A;  2FIU A;  1FJE B;  2WZ1 A;  5LKZ A;  3IM9 A;  4I2Q B;  1EP4 B;  1R0A A;  4KBI A;  1E6V B;  1U1M A;  5GAG I;  1F6T A;  4QYR A;  1RT7 B;  1Q79 A;  4L3N A;  5HAN A;  2VF3 A;  1MU2 A;  4Y2I A;  5KFI A;  2E7W A;  1CVJ A;  2N7C A;  1N48 A;  1SIW B;  4GND A;  2YTC A;  4C8N A;  1FF2 A;  2PT0 A;  2XMW A;  3EXC X;  3T9Z A;  3ENW A;  2FUI A;  3B4M A;  4WU3 A;  3GWC A;  3IBW A;  2FLP A;  2GGP B;  2B8P A;  2HQI A;  4WK1 A;  1SIZ A;  4A8W A;  1T1H A;  4PPZ A;  1UL3 A;  3M8Q B;  2ZJP Q;  3D0I E;  2KFY A;  1YIT S;  3NWG A;  4U8Y A;  3JQM A;  4CI0 B;  1SH0 A;  4FYX B;  2FD2 A;  2HVD A;  2EG2 A;  2NCK L;  3BPD A;  1C0U A;  1WOS A;  4P10 A;  4IQX A;  3AT1 B;  3M8Q A;  4X84 A;  2ZE2 A;  3MM9 B;  2YNH A;  2BAN A;  2UV8 A;  2DRD A;  4NPO A;  2LP4 A;  4BBY A;  4LF9 F;  4S0M A;  2LLZ A;  3ZO7 A;  1FE0 A;  3FKB A;  4RW8 A;  5F9N A;  4GNG A;  5DET A;  5HMY A;  2HIY A;  2ZEJ A;  2R8J A;  1WGM A;  2L08 A;  3EZU A;  4LVO P;  4A8X A;  4ZDN A;  2HNZ B;  2B3T B;  3M32 A;  4KHP F;  1U1K A;  2KHD A;  4LFA F;  4NRU A;  1LWE A;  3EUN A;  1ZH5 A;  3PX0 A;  3MOZ A;  2HYI B;  2IYI A;  3TZZ A;  1NJX A;  1U45 A;  1URN A;  2RUG A;  5GAH I;  1RZM A;  5A0Y A;  3T9N A;  2KGI A;  1OPI A;  3R3T A;  3R8Y A;  2FVP A;  2BZ2 A;  1DCQ A;  1KHV A;  3SDE B;  4LBH A;  3KLI B;  4ZPA A;  4USM A;  2G43 A;  3FRY A;  5G04 B;  1H2U X;  2OGU A;  3G82 A;  2LEA A;  5L1K A;  2FHM A;  2EFP A;  1NEE A;  2ZNY A;  4TY8 B;  3ZTR A;  1T9W A;  2U2F A;  3GJS B;  2B5J B;  3MEE A;  5B0G A;  1X4D A;  4P74 A;  3GSD A;  3HUL A;  2J0X A;  3UVJ B;  2EK1 A;  2IJF A;  2Y1R I;  3M30 A;  4UP5 A;  2XEX A;  4OYW A;  1TFW A;  3T9K A;  1NCL A;  1XTZ A;  2MQO A;  4K4S A;  2DGV A;  4DV7 J;  4O62 A;  3D0G E;  1VFY A;  5HN0 A;  3HP6 A;  3DDT A;  3L7O A;  1VQN S;  3OVA A;  3RUB L;  1F1B B;  4F4Z A;  1KLN A;  2FVQ A;  1HA1 A;  4WXW A;  2IRX A;  3C2P A;  5J1P A;  2ZH9 A;  4LR7 A;  4J9P A;  2NZC A;  1X4H A;  1RTH B;  2MKI A;  2BQR A;  4LF6 F;  2RB7 A;  2BE9 B;  2KGG A;  2KHC A;  1B3T A;  2YWF A;  1S0O A;  3HHK A;  1WHV A;  3V5R A;  2XEU A;  4LRB A;  4O23 A;  2GFF A;  4GKK J;  3GZ7 A;  2MZT A;  3FGV A;  3AA9 A;  3N6M A;  3OHA A;  4IOB A;  4A8F A;  1YBU A;  1GT8 A;  2I9S A;  3GJT B;  1NBE B;  3O8W A;  4MTP A;  1WC0 A;  4PWU A;  2HAI A;  5C24 A;  4JI4 J;  1EAY C;  1X0P A;  2B6A A;  2KTQ A;  1WI8 A;  4P2X A;  5THW A;  1I6J A;  5IT9 U;  1G6B A;  1RWK B;  4KGX B;  4M5N A;  2B9X A;  1PKU A;  3DXS X;  1Y5N B;  3KLI A;  2JH3 A;  5EWG A;  1NJW A;  3W66 A;  4BHW A;  1FXR A;  3N9N A;  5KG4 A;  4QW9 A;  1J5O A;  1F2G A;  1ZAW A;  3DLE A;  2LQ5 A;  3QIP B;  2IPO B;  2M8H A;  4QQB A;  4RUB A;  5EDW A;  2CPZ A;  2CVE A;  3FQK A;  4DCJ B;  1JJ4 A;  1CJV A;  5B75 A;  1F3F A;  2VPY B;  3A8J A;  2C3M A;  3DYA B;  4DX6 A;  4Z2X A;  3Q23 A;  4E2F B;  3EIC A;  3CCV S;  2CDQ A;  4MSX A;  4PQU A;  2KE1 A;  2XMM A;  2CQ0 A;  2BW7 A;  2FC8 A;  2Y0B B;  1ZBD B;  1HI1 A;  3F41 A;  1N5Y A;  2WSF C;  5K3Q A;  2I38 A;  2V6A A;  3M2R A;  2GA7 A;  3HD2 A;  4NZ6 A;  4BBQ A;  4DR7 J;  4YHH F;  3WBZ A;  2Q43 A;  1UFL A;  1CQN A;  4RNN A;  1LV5 A;  2LAU A;  1I3O B;  3VQS A;  1VRT B;  1VHI A;  2DHX A;  5GAE I;  2M2B A;  3SSQ A;  2G0C A;  1RAH B;  2FVC A;  3AJ1 A;  2JSX A;  3R1H A;  1X5S A;  2MMY A;  1FKP A;  2DNG A;  1QTN B;  3U7J A;  4ED1 A;  4P73 A;  2Y1I A;  3J81 Y;  4OQJ A;  3KK1 A;  2YQM A;  3I2D A;  2B56 A;  1RCX B;  3NG8 A;  2CKL A;  3GTY X;  3P45 B;  5AE3 A;  4AQY F;  1ZTT A;  1S1X A;  2LQ9 A;  3GFX A;  4OHV A;  3OR1 A;  3QT6 A;  3G96 A;  3D66 A;  1UVN A;  3OVB A;  5K8P A;  4OI4 A;  4NLV A;  2VQE J;  1N5S A;  1GTH A;  1S9E A;  1S9G A;  2FB0 A;  1M5P C;  5B77 A;  3WDO A;  3BQ1 A;  3MPU B;  4DFP A;  3NL0 A;  3BGO P;  3MAQ A;  3C6T B;  1J5O B;  4TY9 A;  2QLX A;  1JMT A;  5KT5 A;  4NYZ A;  1FK9 A;  2CJQ A;  4U95 A;  5DM6 Q;  3N5B A;  2FUU A;  4CH7 A;  4DV6 J;  4EEY A;  2YUR A;  2PMW A;  4EGL A;  4WZ3 B;  4M5L A;  4EWT A;  4NAS A;  4NYO A;  5LMN J;  1SKR A;  5HRO B;  2ZH5 A;  4B9L A;  1X9W A;  4FK5 A;  5B78 A;  3LQV A;  2OD6 A;  1A7G E;  4I6W A;  2EW9 A;  5KG1 A;  3L4B C;  2ALZ A;  2C2D A;  1MWY A;  1T9X A;  1XR6 A;  5ITH A;  1XMQ J;  2R2T A;  2YWH A;  3OHB A;  5CYQ A;  2L0B A;  3SSR A;  3U5P A;  1FVS A;  3NGU A;  2VD3 A;  1RWP B;  4IG3 A;  2KXF A;  3V43 A;  2GNK A;  1WEM A;  1P27 B;  1TKZ A;  3OXF A;  5A0Y B;  5MAO A;  1TAU A;  4CO3 A;  1AXQ A;  3CNQ P;  2ROP A;  4A4B A;  3ENQ A;  5KFS A;  4ATN A;  3AD8 C;  1BUX A;  1TEL A;  4FZV A;  2IBO A;  3JXO A;  4IC3 A;  3HVR A;  1GMW D;  4EFA C;  2HWI A;  2Y1M A;  1FRL A;  2LDR A;  4B9N A;  1U6B A;  1SC4 B;  2WVC A;  4DJB A;  2JLF A;  1NK9 A;  4OJ1 A;  1DTQ B;  2CNN B;  2AHO B;  2C2O B;  1PYS B;  2VQF F;  4K4X A;  2VHG A;  3VK6 A;  1SC1 B;  1NH8 A;  1WC1 A;  4ZJQ A;  4ENO A;  3H5U A;  5F8I A;  4FXD A;  2OPR A;  2QLF B;  2R8H A;  4DV5 F;  2AJ4 A;  4O3R A;  2C3U A;  3DLH A;  1S72 S;  1NDL A;  1NME B;  3EZO A;  3FCH A;  1K8A T;  4ILM A;  1RB0 A;  2CJX B;  5KFJ A;  5GAH U;  1XMO J;  2WB1 D;  5JVH Q;  1Z2Q A;  2IIH A;  2DT9 A;  3DRR A;  3LH2 S;  4PG7 A;  2PA3 A;  4DV4 J;  2CRW A;  1TL5 A;  4DL2 A;  4K50 A;  4KJI A;  1DJ0 A;  1A6L A;  2N7Y A;  3A13 A;  4YDD B;  4NCG A;  4N8N A;  4FS2 A;  4GKJ F;  2IDE A;  4RNM A;  5D0G A;  2ZET C;  3NCQ A;  1Q78 A;  3PW4 A;  1WUU A;  1WEY A;  1BMQ B;  3AA8 A;  1LWC B;  1JB0 C;  3CCT A;  3GMG A;  3UN5 A;  2HBR B;  2K1R A;  5BXI A;  4G1Q A;  5T7L A;  2QN6 B;  3MOJ B;  2MNZ A;  1RTI B;  1R0A B;  1UVL A;  3AAW B;  1LOU A;  4OZ2 A;  3UCG A;  4WZ0 A;  4DFM A;  4LF7 J;  1XN9 A;  4O64 A;  1T3O A;  3FSY A;  3FSI A;  3QAU A;  3KXD A;  3PY8 A;  2VBY A;  2YWK A;  2RR4 A;  2QG9 B;  4I2P B;  2J5A A;  3BS9 A;  3OFE A;  4PZV A;  1CJU A;  1TZ0 A;  1C4A A;  2NSB A;  2QV6 A;  1TV6 B;  2V4J B;  2XYP B;  1TL4 A;  3MAA A;  1U6G B;  2VG7 A;  3MCO A;  4G1P A;  1FJG F;  5FLX U;  3G86 A;  3UNY A;  2EA6 A;  3BGR B;  3U1L A;  3BBC A;  3OTO J;  3Q8P B;  3SXL A;  1VRQ C;  1RJJ A;  2W4P A;  3BEG B;  5F8G A;  4B7Y C;  3IO1 A;  4FPR A;  3MTJ A;  4O3O A;  4A8Q A;  1WD6 A;  4ZVO B;  4MIW A;  2ZBQ A;  4IFV A;  3H90 A;  1NPP A;  2RQK A;  3BV8 A;  4NLD A;  1S12 A;  5HSP A;  4J9N A;  1SQG A;  2UVV A;  3MEE B;  3SCJ E;  2RE1 A;  4Y0F A;  1HWI A;  3HFV A;  2DEJ A;  3G6Y A;  1NHV A;  5KTQ A;  3NBP B;  4D3G A;  1RAJ A;  4LIR A;  3L1Z B;  4DMZ A;  2YVS A;  2VU5 A;  3OFG A;  3PNI A;  4M5M A;  2H48 B;  3QGG A;  3U1M A;  3KLG B;  5F8H A;  4V19 J;  4PWD B;  2GS8 A;  4S3O C;  2KU3 A;  3C6T A;  3CUN A;  1S79 A;  1DRZ A;  3BB5 A;  3QO9 A;  4KFB A;  1O8B A;  3DDI A;  4QOT A;  4CCG X;  3BR8 A;  3MHH A;  5G0F A;  5BR8 J;  4JI5 F;  2VA2 A;  1P1L A;  3RTV A;  1UFW A;  3FUY A;  3H5X A;  2RS2 A;  1Y5L B;  2RQM A;  1LWE B;  1SJR A;  1S1W A;  3ZZU A;  2F6J A;  2MPU A;  2ZH8 A;  1HYS B;  4IH7 A;  1N56 A;  1S49 A;  1IWA A;  4P9S A;  3UI3 A;  4CZC A;  1D9F A;  5KH7 A;  2LMI A;  4IDK A;  1CJT A;  3QLH A;  2R4F A;  3DCA A;  1GXU A;  5EWF A;  3KQI A;  2R7S A;  3TJA A;  4YAX A;  3K57 A;  2QJ3 A;  3A4T A;  4N77 A;  1FEE A;  2HEK A;  2CQ3 A;  4KE5 A;  4DV5 J;  2CXE A;  1DQ9 A;  4S3O B;  3BBF A;  2MZQ A;  4GVB B;  1Z2L A;  2XMJ A;  2ACY A;  4YOE A;  2YUC A;  1SC3 B;  2FTR A;  3SBM A;  1GEH A;  2K8G A;  4PR6 A;  2W9C B;  2W8K A;  4TXS A;  5G0R B;  2DD8 S;  2OEM A;  2G2Y A;  2FSA A;  2VAS A;  4TKT A;  4ANE A;  1BC6 A;  2YQL A;  1C1B B;  5LM7 E;  4GKK F;  1ZM9 A;  4DU7 A;  2AYB A;  1L3S A;  2E5L F;  4U8V A;  5D3G B;  1NND A;  3HI9 A;  3LGN A;  4F4Y A;  4LF4 F;  3KJN B;  2Q6C A;  4NA2 A;  2IRU A;  4K5S A;  3MEG A;  4YC9 A;  4ETX A;  4MKV A;  3BO2 A;  1RWV B;  1HD1 A;  5IFM A;  5E5N A;  2G9O A;  3C16 B;  2QA2 A;  4HAC A;  4TNO A;  5CH7 B;  1NJI T;  2C2Z B;  4EUV A;  4WKY A;  2P9G A;  2EFN A;  3MUM P;  4DQR A;  1IJE B;  1D9D A;  1FJG J;  3EGV A;  3DOM A;  3JAM Y;  2KM8 C;  4MK7 A;  2V2Q A;  3QID A;  2QYC A;  1WEU A;  1R0B G;  4LF1 A;  3RAM A;  4A8O A;  1QSY A;  4Q8F A;  2ZVI A;  2WRM A;  5C24 B;  3JYT A;  3FBE A;  3KKF A;  2QMX A;  1GK8 A;  1H2T Z;  2AJ1 A;  1GXL A;  4ZPC A;  1UEV A;  1IKV A;  3DM2 B;  2R8I A;  3BH7 B;  1HBO B;  1WIL A;  1X60 A;  4YQW A;  2HVI A;  4YR0 A;  2V50 A;  2I1R A;  3VAF A;  2XQC A;  4NLY A;  1TVR B;  3HHE A;  5H9M A;  4UOF A;  1JQG A;  4OGE A;  2VB6 A;  2HG4 A;  4ZIV A;  1XC9 A;  4NXN J;  4DL7 A;  4JI0 F;  1S6O A;  1ZAV A;  2KKH A;  5DLG A;  1EET B;  3QWP A;  2JDJ A;  2QZ8 A;  4ZN3 A;  1VQP S;  4J9Q A;  2L7P A;  3IRX B;  5F8L A;  4E0D A;  2DNZ A;  3CCS S;  3G9C A;  1FKO A;  1WOR A;  5FEY A;  4M63 A;  3T6B A;  4TU7 A;  3KNA A;  2QSW A;  1HIY A;  4A46 A;  4CO2 A;  5DG8 A;  3PFO A;  5I42 B;  2ZOM A;  4R8P K;  1IYM A;  1GX5 A;  4LSN B;  5LL6 d;  5KFN A;  2XI2 A;  3ICL A;  2L9W A;  2RHS B;  5I3U B;  1B7F A;  1BWV A;  5GME A;  4A4J A;  1LW2 A;  3QGI A;  1M5S A;  5SZT A;  4DUY F;  1IKX A;  1S6P B;  5IT0 A;  2IJR A;  4J9L A;  3TVK A;  1GAO A;  3C6U A;  3H8Y A;  4L72 B;  4OHY A;  1QE1 B;  1U47 A;  7FD1 A;  4C8Y A;  3PIP Q;  2B9W A;  1IQZ A;  1W25 A;  4GVL A;  1W26 A;  5KAK A;  1KTV A;  3PR5 B;  2Z2Y B;  4OL8 A;  4OZN A;  5ETS A;  1O51 A;  3PZP A;  1J5E F;  1UPM B;  1RBA A;  3M2U A;  3D6H B;  4ZP8 A;  3I9Z A;  3TAM B;  3I5A A;  3OTD A;  4JYA J;  2JEI A;  1F0X A;  1F9E B;  1S1X B;  2H5J B;  2QX0 A;  2CKL B;  1ZET A;  3QJP A;  2L48 A;  1QJH A;  1RUS A;  2OHD A;  4IFV B;  4ED4 A;  3N9U C;  4B3O A;  4ICL A;  2XZT B;  3V6D A;  4MH8 A;  2B4O A;  3T6J A;  3VWS A;  4R5P B;  1V87 A;  2IVM A;  2W24 A;  3F73 A;  2C2L A;  3FL2 A;  2VJF A;  1RHR B;  4ZVQ B;  4ZHR B;  4C9D A;  5EX3 A;  2E7V A;  5HJY A;  3O7A A;  2ROG A;  3FRZ A;  4NLU A;  4DX8 H;  4KY3 A;  2MGZ A;  2QIZ A;  2GMH A;  4KH1 B;  1FWL A;  4FYY B;  5F0W A;  3MED A;  3BYP A;  2C2R A;  1X4J A;  1IR0 A;  2ZE2 B;  3IA0 A;  3MM9 A;  4K2J A;  4KV8 A;  2YSJ A;  1HHS A;  1RT6 B;  4RNF A;  5A6P A;  3BJY A;  1QUV A;  2VG6 B;  4MFB A;  3ZZZ A;  1I5O B;  3RBZ A;  5B09 A;  3S8S A;  3HM9 A;  1K44 A;  4PWW A;  3NCR A;  4OYM A;  2NPF A;  5C42 B;  4J9K A;  4N76 A;  1A9N B;  4ZVS B;  3BBB A;  3ZTO A;  1RLC L;  3SCL E;  5F8J A;  4M5G A;  3UR3 C;  3KJV A;  5F0U A;  4LJM A;  4LQ9 A;  3R9L A;  1HAR A;  2DGX A;  4PG6 A;  3VCD A;  3KOA A;  1FHT A;  3VGT A;  3KUE A;  1FBV A;  3ZTQ A;  1YGY A;  4UW2 A;  2DY9 A;  3CT9 A;  2LQB A;  4NCG B;  2R7W A;  3MMA B;  2AT1 B;  2WSE C;  4DR1 F;  3HZG A;  5C25 A;  1LFP A;  2VC1 A;  1RT1 A;  1SJQ A;  1Q95 G;  2XUL A;  4NLS A;  1CC7 A;  3QRR A;  2UXC J;  5C13 A;  1WEZ A;  2C2E A;  4IQM A;  2JJ4 D;  1XBW A;  1G4C A;  2JRS A;  3MD3 A;  4ED2 A;  4DR6 F;  1B0V A;  3F56 A;  2YPY A;  3NEK A;  4LUB A;  3CMA S;  5AJ3 J;  3OL9 A;  3GSI A;  4HT5 A;  1OSD A;  3N79 A;  1AYE A;  1D3W A;  5LJ3 Y;  4DS5 A;  4NXM F;  2BR0 A;  1R8P A;  3MTK A;  3K5L A;  3J7A N;  5L1I A;  3OD2 A;  5L9X A;  2AN6 A;  5H1T A;  5HBM A;  1M5H A;  1MML A;  2YNF A;  3OLB A;  2HHH J;  2EVZ A;  4Q0B B;  1WAC A;  4MKY A;  2ZBC A;  3QLH B;  1C0T B;  4G65 A;  2R2U A;  4ED3 A;  1GMV A;  3CDU A;  5ETO A;  2VA3 A;  4OZ3 A;  3UW1 A;  2OAU A;  1WEW A;  4K0K F;  2JL9 A;  4DG1 A;  3R7B B;  5IWA J;  3GIJ A;  4FPI A;  2ZM6 F;  4YY3 F;  2MJN A;  5LMU F;  4A8K A;  3HFK A;  2BDP A;  1FD8 A;  1ROF A;  4HHU A;  3ZZP A;  3K58 A;  3BGF A;  4ECT A;  2KT5 A;  2GJF A;  2QC3 A;  3GPA A;  4QWE A;  3VAG A;  4TVA B;  2LN0 A;  3H5Y A;  1K9M T;  5J1E A;  3V6H A;  3P49 B;  3C8Y A;  1KS2 A;  3TUI C;  2KWO A;  4UP0 A;  2I0X A;  3ISN D;  2WON B;  3PR4 A;  2CJA A;  2H51 B;  3EGW B;  3PYD A;  1FNM A;  4ZLJ A;  5KT7 A;  3KHG A;  3DMJ B;  2HND A;  2I5J A;  2GIQ A;  3HVT B;  3L7P A;  3LF0 A;  1YJ7 A;  1Y7P A;  2H3E B;  4WYW A;  4ZVU B;  2V2V A;  3HLU A;  1ULR A;  1ZZF A;  2O5D A;  5E3R A;  4J9R A;  4N4F A;  3BQ2 A;  4DN0 A;  2RU9 A;  3FEX B;  4DF8 A;  4HAC B;  4J9U E;  2MKJ A;  5KFR A;  2HMI A;  5LKU A;  3DRY A;  1RSC A;  1F9F A;  2KYZ A;  2P2C B;  3DLK B;  1S4F A;  3MZI A;  4JOU A;  2BM1 A;  3PYE A;  4ZIW A;  1OWX A;  1R6V A;  2BAC A;  2BAB A;  4IH5 A;  4A47 A;  2MXY A;  4MAK A;  4QWC A;  3LWM A;  2EFG A;  3H98 A;  1UP1 A;  2M4M A;  4G6V B;  5ADZ A;  3OV7 A;  1RAG B;  4MYT A;  1X4F A;  2R2S A;  1XMQ F;  4CTA B;  1F9H A;  2YKN A;  5KH3 A;  1D8Z A;  2GHV C;  2R9L A;  4OX9 J;  3CCQ S;  3AFG A;  3D1O A;  2HAF A;  4R25 A;  1H6K X;  2YWG A;  3J80 Y;  4F04 B;  2VIH A;  2PI4 A;  2UXB F;  4ECV A;  4PG5 A;  3UDL A;  1S99 A;  1WDT A;  1WF0 A;  1YZ6 A;  2YW8 A;  5KFG A;  1VD4 A;  5JMN A;  3NNH A;  2OLW A;  1VMB A;  1PBA A;  3LP2 A;  2NZ4 A;  2HLT A;  2JWN A;  4P2S A;  3CJK B;  4CCH A;  2YNH B;  4F8R A;  2UP1 A;  2V5H G;  1VQ6 S;  2Z56 B;  1DAX A;  3CDB A;  2WW4 A;  2KVQ E;  1NZA A;  2E44 A;  2QA1 A;  4LRD A;  1HNV A;  2HIQ A;  4AT1 B;  1JLB A;  4N47 A;  2V67 A;  3C16 A;  2XB1 A;  3LAM A;  4AP4 A;  2PEH A;  2HBQ B;  2NXN A;  4FBU A;  2MDA A;  4K0K J;  1KRP A;  2E5H A;  4DL0 C;  4DR4 J;  5DDO C;  1DBD A;  3DYA A;  1J2V A;  4WA6 A;  3DRR B;  3MCS A;  3OVS A;  4X4T A;  4EYH B;  3QSI A;  4FYW B;  4V3L C;  3E2E A;  3SEO A;  3J7Y U;  3RB6 A;  2UVW A;  2YBV A;  2YQ3 A;  2IDA A;  3LQH A;  1RT2 A;  2OKQ A;  2ZC4 A;  3IP0 A;  4Q2L A;  3R97 A;  3CCE S;  2MHE A;  2J8A A;  4ZPW R;  4JI7 F;  4I4B A;  2HFV A;  2M6M A;  4ECY A;  4ZQL A;  4LF9 J;  4F02 A;  1UZD A;  1MM2 A;  5BYS A;  1SL0 A;  4JI1 F;  1SQE A;  1PYT A;  3AH6 A;  4FVC A;  5AJ3 F;  1NKC A;  1FNX H;  2FLL A;  1KNZ A;  4I1T A;  4WZ2 A;  2HQF A;  4OJH A;  4RW6 A;  5FLX Y;  4XPE A;  2E66 A;  4IUF A;  1H3D A;  1WC3 A;  2OP5 A;  1WEP A;  4O4R A;  1IM6 A;  5KG5 A;  3RRG A;  2UXC F;  3AQO A;  2WON A;  4GO7 X;  2VKZ G;  2PN6 A;  2NS1 B;  1HBN A;  4JBC A;  4DR1 J;  3A8E A;  4JI3 F;  1FFS B;  1PJ6 A;  5J3X A;  2BQ3 A;  2YSM A;  3LW5 C;  4LKA A;  4Z0O A;  1X4E A;  1XJW B;  1ZBT A;  5KFU A;  5D1L B;  5GMK a;  1HMV A;  2GW8 A;  1V5I B;  2PFD A;  1ELO A;  3DGV A;  5BYR A;  2UUB J;  2WBM A;  2A6M A;  3D4J A;  4Y2C A;  2GHW A;  4YR3 A;  1HNZ J;  3FVY A;  1EJ7 L;  2PII A;  3QT7 A;  2L3M A;  4D3H A;  1C0T A;  1IKV B;  3DM2 A;  4AE5 A;  2F6N A;  2PD1 A;  1M5V C;  2P9C A;  4B3S J;  2ADB A;  4CM2 A;  1PJ5 A;  2YNF B;  2YHN A;  1K0T A;  5CD4 A;  2MZR A;  2DGW A;  2MZJ A;  3GYN A;  2E6R A;  4ILL A;  2RKI B;  3W62 A;  6AT1 B;  4LSL B;  4BWM A;  1FRH A;  1T9U A;  3N6N A;  3G82 B;  1Q0N A;  2W4C A;  2CNL B;  4EO6 A;  3QBC A;  4J9S A;  2LQJ A;  1VCT A;  2FQQ B;  3FCW A;  2J8S A;  3GCX P;  2KT3 A;  3EVM A;  3KG1 A;  3JSB A;  1C4C A;  2AF6 A;  4H4K A;  4LF2 A;  5ETV A;  1S1U A;  3S1T A;  5CCL A;  5C5J A;  2WVB A;  2PMH A;  4YY3 J;  4ZVR B;  3ZNJ 1;  4G1I A;  2QIC A;  3BKF A;  2O1P A;  2LV9 A;  2XNR A;  1YTY A;  2W2Q P;  1RT1 B;  1D9A A;  2F9D A;  2WHO A;  3CCZ A;  2OTL S;  4J9V A;  2HS3 A;  3FZB A;  1UET A;  3PHD A;  1CG2 A;  4NLT A;  4OV1 A;  2VG6 A;  2ZHB A;  4DV0 F;  4NMX A;  1RKJ A;  2DR5 A;  3JB9 k;  2XB2 D;  2A18 A;  1Q8L A;  2AJF E;  2J0S D;  4KV8 B;  2ASD A;  2JM3 A;  2FGO A;  2KB2 A;  3TYT A;  1NPK A;  2K06 A;  2KYX A;  5KG6 A;  1JLA B;  3FEY B;  4M5D B;  3B54 A;  3D67 A;  3D68 A;  4H54 A;  4MT1 A;  3V4I B;  3N9P A;  4U7C A;  1IKW B;  1S1T B;  2IM3 A;  5CD4 H;  4ZN1 A;  3K5N A;  2QRR A;  4CLU A;  4X4S A;  1C2P A;  1IBL F;  3OJU A;  3ZNI A;  4P7T A;  4IG0 B;  2DK2 A; 
#chains in the Genus database with same CATH homology
 2XP0 A;  2CRR A;  4OGC A;  2B0O E;  5SVI A;  2XHC A;  3LPE A;  1M1H A;  1NPP A;  2KKX A;  2LQ8 A;  2M13 A;  2E61 A;  4Z0O A;  5SVY A;  2LAU A;  2JUN A;  3MDB C;  3LVQ E;  1NZ8 A;  2OUG A;  2EXU A;  2KKY A;  3FJU B;  2XOC A;  3FEH A;  3SUB A;  2IQJ A;  3T9K A;  1M1G A;  3JUE A;  2FFW A;  2RR4 A;  4O62 A;  3H7H B;  4Z0R A;  2JM3 A;  2OWA A;  3DDT A;  3DWD A;  2CSV A;  3KDE C;  2K06 A;  4OGE A;  2XOZ A;  3E2D A;  2CON A;  3LJU X;  3LVR E;  3FM8 C;  2MKE A;  2CRW A;  2XOY A;  3M7K A;  4H9D A;  2FD4 A;  1NPR A;  5SVX A;  2DJA A;  2P57 A;  2EGM A;  4ZN1 A;  2D8U A;  2YVR A;  4ZN3 A;  3PLW A;  4QQ4 A;  4F1P A;  3QQC D;  2L7P A;  3O47 A;  5SVI B;  3H7H A;  3P8B B;  1DCQ A;  3LDY A;  5K3Q A;  2YRE A;  3Q1D A;  3EWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...