2EXZA

Crystal structure of staphylococcal nuclease mutant t22c
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
b'LHKEPATLIKAIDGDCVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 39
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2exzA00
4J1MA 2F0NA 3P1HA 4KD4A 2PW7A 1TR5A 2F0IA 3TP8A 3H6MA 1EYDA 3V2TA 5KYLA 3BDLA 4R8NA 1F2YA 5I6WA 1A3VA 5C3WA 3SK6A 3C1FA 5CV4A 1JOQA 2F0SA 5C5MA 1U9RA 3MEHA 4ME5A 2SNSA 4K8IA 3S9WA 1IHZA 5EKKA 1SYDA 5CV8A 1NSNS 4RKBA 1KDCA 4KTAA 1A3UA 2F3WA 3QOJA 1EY0A 5KYIA 3D6CA 4KY7A 1AEXA 1RKNA 3EJIA 4PMCA 1F2ZA 5CV7A 5IOCA 5M9OA 1ENCA 3LX0A 1ENAA 4G57A 5J39A 4DFAA 3MZ5A 3DMUA 5KRUA 3TP7A 1SYEA 2HQEA 4NMZA 2F0EA 3OMGA 5C6AA 1SYGA 3DHQA 5JOBA 2LKVA 3EVQA 3SK8A 2F0TA 4RKLA 1SNQA 1KDBA 2SOBA 3RUZA 1SYBA 4WRDA 3MHBA 2F0MA 3E5SA 1EY9A 4I65A 4TRDA 4DGZA 2EY1A 3OSOA 3D4WA 4YIJA 5KIXA 2F0DA 2RKSA 3SXHA 1SYCA 1JOOA 2F0QA 2RDFA 2ENBA 1STGA 2F0OA 1EYAA 5E3FA 4KJOA 4B9XA 1SNDA 5EKLA 1SYFA 1STYA 4K5VA 2F0PA 2KHSA 3SK5A 4S3SA 3MVVA 1SNPA 1STNA 1TT2A 5JAVA 4ZUIA 2EYLA 1SNOA 4KHVA 4NKLA 5CV9A 5KGUA 4HMIA 3D8GA 4ODGA 5C3XA 3QB3A 5I6YA 2F0KA 4F7XA 4LAAA 5K5PA 1EY6A 5CGKA 4NDXA 3P75A 3SHLA 4KV6A 1KDAA 1EYCA 3QOLA 5IIFA 5C4ZA 2EY5A 4MIUA 4QB4A 3C1EA 5CV6A 2PQEA 2PYKA 4IUNA 4F8MA 1NUCA 2EYMA 2F0WA 4K5XA 3HEJA 2EXZA 2OEOA 2EY6A 2F0LA 3T13A 4PNYA 2WACA 2PW5A 1STBA 3ERQA 2F0UA 3NQTA 3NK9A 5IGCA 1EY7A 2OXPA 4B9WA 1TQOA 4KY6A 5IGGA 4WORA 2EYPA 2EY2A 3ITPA 2EYFA 2PZTA 3OWFA 3MXPA 4HTHA 3OMCA 4J6HA 4OL7A 1EZ8A 2RBMA 4QMGA 4K5WA 4EVOA 1II3A 3U9OA 5J22A 2F0HA 3TP6A 5NUCA 4KD3A 4EQNA 5I9OA 2O4XA 5F2DA 4EQPA 5HGTA 5HURA 3NP8A 1EY5A 2SNMA 4EQOA 1KAAA 4PMBA 3EROA 3NXWA 2OF1A 3TP5A 5DEHA 3R3OA 4DF7A 2F0VA 4KY5A 2PZWA 2KQ3A 5IGEA 2PZUA 3D4DA 2EYHA 3TMEA 1F2MA 2NUCA 2M00A 4ZQ3A 4H7BA 4IZ8A 5C4HA 5ISRA 5CC4A 1EY8A 5IGDA 5IODA 4E6IA 1STAA 4K6DA 4IALA 4KJNA 4NP5A 1A3TA 4DU9A 1KABA 3SK4A 5I9PA 5IGFA 1EY4A 5KEEA 5IGBA 5J1ZA 1A2TA 1A2UA 5CR3A 4ZUJA 1JORA 3VA5A 4N9TA 4QF4A 1JOKA 2F0FA 3BDCA 2EYOA 3PMFA 4HMJA 4K2LA 5E1FA 1EZ6A 5C5LA 1SNMA 2F3VA 2QDBA 4K14A 4N9PA 3SR1A 4ID6A 1SNCA 4K2KA 4K8JA 5DAUA 2F0GA 1EQVA 3NHHA 1STHA 2EYJA 3HZXA 3T16A 2F0JA 5EGTA 3NUCA 5CV5A
chains in the Genus database with same CATH superfamily
5C4XG 2R7FA 3I73A 1WTOA 3H6MA 1RTNA 3E6ZX 4FP5D 1F2YA 1KRSA 2R93B 5C3WA 1EIFA 4YHHQ 4DN4M 5AFWA 3M9BA 4FF2A 4G4KA 5DM73 2EOTA 1JJCB 4JBWA 1X6OA 4L5TA 5M5XB 2J0TD 4JI2Q 3ICEA 3WOFA 2YYZA 2HQEA 1GD7A 3OOCA 2F0EA 5EKIA 2JA7H 3DHQA 3DEOA 1I50B 4HIKA 1G6ZA 4CJ0B 5ELNA 4RG1A 5D3DA 3ERSX 4B3ML 4OIKA 3J80c 1GJXA 4FF3A 1QNUA 4EQ5A 4IUTA 2HIXA 1HJPA 1UE6A 4BBSB 2K33A 4FXGC 4OIJA 2XRSD 4O0AA 3NTIA 5IT9L 4FDBA 2EYLA 4KHVA 2XGTA 5I6YA 3BZDB 4IFDG 4A75A 3MXNA 2H4OA 3SHLA 4GKJL 1EYCA 1TWAB 3HG9A 4BS9A 2L55A 2PYKA 4F8MA 3FPUB 1FNVA 3J81j 2A6HC 3CQZB 3UE1A 4C1NK 2F3IA 3S9WA 1VQOA 1A6XA 1X54A 3PUWA 2L15A 3BU2A 1MI2A 4ZKBB 4JI4L 3L9AX 3RZOB 4GS3A 4ULLA 2R7ZH 3VYSA 1CT1D 1CA5A 1HNXL 5EAYA 4JYAQ 3S1NH 1ZYRD 1YHBA 4XDXA 4YWKA 3AFQA 2PZWA 4L5QA 4X62Q 3BVZA 1EQQA 3M4OB 4AYBB 3IFDA 2OTLA 2ZXOA 2PI2E 1TY2A 1X65A 2PQAA 2H1EA 2JA8B 1KAWA 1YVCA 3R8BA 1ASZA 2X69A 5ELFA 1DOLA 1Y1VH 3GTMB 4DR3L 2IJ0A 2QKIC 3VDYA 4A3KB 3TZDA 4DV2L 1TS4A 4ID6A 1PH3A 2IHEA 1SROA 2KEEA 2Y0SG 1N33Q 3BG3A 1EU3A 2F0JA 5FOBB 5G3LF 1YHAA 2X6GA 4MN3A 1WVLA 3FKIG 5FJ8H 1OXSC 2MNAA 1Y14B 1UWVA 1LUZA 3U4VA 1TWGB 2LXKA 3EJIA 4GOPA 1F2ZA 2BE5D 4CDCC 2LFNA 4G57A 1ET9A 1BKBA 4MTKA 3PV0A 3OMGA 2L11A 3J80i 4OO1H 4X65Q 4R1JA 2CW0D 2FMMA 1SEBD 3BDOA 4DR5Q 1S4ZA 3HKZG 1PH9A 1S72A 4A3IH 3D4WA 5E7NA 3UDGA 5KIXA 1QE6A 2FMCA 3OWEB 5D3IB 4X64L 1WTWA 1XMQQ 1VQIA 2CWAA 4JI6Q 3HOVH 4L63B 1SYFA 3PSIA 4CKCA 4DR6Q 3HOWH 2VXWA 3B6YA 1F9QA 2B63B 3F8TA 4DKAC 3U50C 2NZHA 5ELBA 4GLXA 4NDXA 1WD0A 2CFMA 4C3JB 4ZK9B 4XTCS 3HOXB 2EY5A 4I7AA 5FO9B 3H3VH 2B3GA 4UP7A 3Q8DA 2FHTA 4KY6A 1MD2D 1GOZA 1SFOB 1XNQL 4I7ZC 5FK9C 3KBGA 4A3MH 3C3LA 4UDUC 2VY3A 2OT2A 3WOEA 1YJNA 1O80A 4KMUC 3K80C 1KC8C 1OXUA 1OXVA 4FXKC 1Y69U 3E3XA 1CQVA 3FDTA 4DF7A 2HDLA 4A3DB 1BCPC 4QUCA 1PZID 2L9HA 4AH6A 1IYUA 1J5EL 3I7FA 4K6DA 1U4MA 3CRKC 3STBD 1H9SA 2D0PA 3H94A 1SLJA 2NVTB 1I94L 2KHIA 4XIGS 4ZUJA 1KNAA 5M5WH 1HUMA 1PDQA 1LYLA 1BUVT 1IBMQ 2NB0A 3FEWX 3F1ZA 4HN7A 1HQMC 3I56A 3HZXA 2YTVA 5ELDA 2Q2HA 2YU9B 1LT4D 2R7DA 2RCFA 5IYBG 2EJMA 5I6WA 3Q24A 2QF7A 2I0QA 3HRZC 4BY7H 3R2IA 2RDHA 4LUOA 5L37A 3M7NA 1HNWL 1VQPA 1VQ6A 2B2TC 2CQOA 1V1OA 3I4MB 2Z6KC 3ZYYX 4RHSA 3PO3B 2OCEA 1BOSA 1NNXA 4C2MB 3S2HB 4ZYSA 5FO8B 3BJUA 3A8KE 4R8IA 3UDFA 4I65A 1MJEA 4DGZA 2NVXB 3W5OA 5M5XH 4QUFA 1D1KA 2RHSB 4RWSC 2MFIA 2ZT9C 3TEHB 4KKTA 1Y1WB 4L5RC 4S3SA 4A3CG 1I50H 3RLFA 3H0GB 1VMCA 3D8GA 4DXFA 2KCNA 1UNSA 1TWFB 3AU7A 4JI8L 2A73B 4HIMA 2IY5B 3VR2A 2AUJD 4LW1A 1PZJD 1PFSA 3L7ZC 2M9VA 3BVGA 4BBSH 1GO3E 5C3EG 3G6EA 1MJCA 3AFPA 4PNYA 4LF4Q 1NAPA 2X6LA 2JN4A 4JI1L 1Y8NB 1F9SA 1KRTA 2PZTA 3RD4A 3PF4A 3OMCA 4GN5A 4KKUA 2QEXA 1TWAH 1JC7A 1IBLL 1ICWA 3HOZB 2R92H 1ESFA 2PNHA 1RD9D 2FXQA 1IKMA 4ZAIA 2Q2UA 5IYCG 3VR4A 1MHWC 3CQZH 2K7VA 1KTKA 2RA4A 4JV5Q 4UY8C 3RZOH 5BR8Q 1VDZA 5IE8A 3J81E 2ZXPA 3DM3A 1S5CD 1QNKA 1F9RA 1JOKA 4TQUS 3PMFA 2F3VA 4BXXH 3K57A 1K8GA 1E7ZA 2N3SA 5M3FG 1QB5D 4K2KA 2FJ2A 4K8JA 2F0GA 1Z6HA 3L0OA 3M4OH 1C8CA 1V43A 1TIID 4J1MA 4OEMB 3NWSA 2JA8H 4FYDA 4QIWE 2QA4A 2HHHL 3GTQB 1PTOC 4V0BA 3GTJB 1JOQA 4DPGA 4RA8A 4EGVA 3PIP3 4A3KH 3MWYW 1MIUA 4U68A 3CCQA 5IOCA 4JI7Q 1ENCA 4LFAQ 4YWMA 1SN8A 4JI5Q 1MSGA 3CMEA 3MXUA 5I2YA 1RDPD 2KCTA 2CQAA 1X3FA 4C3IH 5IY0A 3FPPA 5IWAL 5CYUA 4LF7L 1K73C 4CDDC 4OXPA 5ELOA 4CJ1B 1B50A 1TWGH 1IW7C 4OWWB 3KJPA 1I4GA 1O78A 1EYAA 2DNEA 1U5KA 3MVVA 3HOUH 3I4NB 2F0KA 1LTLA 4BA1I 3CF5A 1PFBA 1WI5A 2I5HA 1P16A 1TWCB 1QVGA 5EJWA 1SBBB 1NR4A 4XQQA 4A3GG 4G7HC 3S17B 4LNQA 1SE3A 4B3SL 2AUKA 1XTDA 4JI0L 1PYSB 2NVYH 1A0IA 1EYGA 2XSCA 4H44C 4C3JH 4P72A 1I5FA 1JJ2A 5I9OA 1HHVA 2IX1A 4A3FH 5EBCA 1AZPA 4NW2A 2F4IA 1DOKA 1PH4A 3HS0C 3S16B 4B3TQ 2QILA 5C0XJ 4DUYL 2WAQG 1SFOH 1V1PB 3S1NB 5C4HA 2OQ0A 1UUPA 4OX9Q 1JWMD 4Y7NB 5T1IA 2Y0SE 1A2TA 1A2UA 1SMYD 2E5LL 1GM5A 2E2JB 5GAGC 4C3HB 4A3LH 4DK0A 4A3DH 3P20A 4IJHA 2G9HD 1LT3D 1Y1VB 5EPKA 4EX5A 3DWAA 1NBWA 1PMRA 1UAPA 1QOHA 2HIVA 2NVTH 3OW2A 3TS2A 1Q1EA 1V8QA 1OTCA 3CPFA 1JE5A 4QY7A 2JA5B 3D3RA 5KYIA 1LO5D 4MNOA 1RKNA 4PMCA 1ASYA 4OWTB 4QIWB 5FLXE 4IO9A 4R4QA 2YU9H 2K5QA 2Q8TA 2GA4B 3RUZA 3S15B 3AB9A 1I6HH 3E5SA 4GKJQ 2KCMA 1JOOA 2XTIA 2RDFA 1TKWB 2B2TA 1STGA 2AWOA 3T1HL 2YTXA 4DA2A 1WTPA 2Z6KA 1VQ4A 1S5BD 4X6AH 4A3IB 3I4MH 4KKSA 4XXEA 4HSVA 3RLNA 4DAYA 4C2MH 3S2HH 1X32A 4JI4Q 4GNXB 1YHQA 3AMUA 3GTKB 1M4VA 2IX3A 5DLQE 3N6RA 4KV6A 3QOLA 5IYDG 4DV6L 4FF1A 1HNXQ 4J15A 3C1EA 2XRQD 2HCCA 1PYWD 3VA7A 1Y1WH 5I4DA 1E1OA 1BBWA 1K8MA 5C0XI 1S40A 4GKKL 3D6WA 2A1AA 4P75A 5FO7B 3GTGB 5C44G 2VNUD 1TWFH 3GQBA 1P8LA 1M8AA 2F0HA 1CKNB 1SJHD 2A6HD 3D4RA 5EQ0A 4DR3Q 2OF1A 1Q12A 4RFBA 4DV5L 4A3MB 4RMFA 2JA7G 4DV2Q 1VQJA 3H3VI 1LTAD 1K9MC 5FLMG 2VS1A 2NUCA 1PHJA 2IWHA 4H02A 3GTOB 1YIJA 5LHY1 3HGBA 1AE3A 1A62A 2BDNA 1STAA 2EQSA 4NP5A 3NSWA 4DU9A 5KNDA 1YJWA 2ZJQA 3HOZH 5JPMC 5IGBA 1BQQT 1DONA 1E2WA 1HCZA 4AIMA 1SNMA 4KI0A 1D5XC 4CKEA 4LF8Q 1BNZA 2Y0SB 4JCVE 3P1HA 3BZKA 2PW7A 4IPDA 1XX8A 4NXNQ 2B2VC 2K14A 2KHJA 3SK6A 4IUVA 4N8FA 2Q8IB 3FHWA 1JE4A 1VF7A 3R2TA 3W1BA 2SNSA 3E0JA 3QO2A 2BOSA 4FXDA 3IKJA 1VQAA 4X64Q 1XNRL 2K5NA 3ULPA 1WCMG 4LFCL 2HT1A 1KHIA 3EIVA 2RVLA 2MUYA 1CK1A 1SYGA 2R7ZG 3GTQH 3EVQA 4B08A 3GTJH 1CZWA 3SEBA 2PCFB 3LGJA 1SYBA 3CCLA 1DXMA 1EWCA 3CHBD 1WTXA 2ALYB 4RH6A 1E24A 4CHTB 1YJ9A 4KJOA 1U4LA 4FO2A 1IZ6A 1D5MC 3J81c 2A5HA 2KHSA 1S5ED 1SNPA 1HZ9A 5GADC 1G8ZD 1KL9A 4HMIA 1XNQQ 3OW7A 4LAAA 5K5PA 1KD1C 1SE4A 2RSNA 3PUZA 1B2TA 4IPCA 4G7OC 4DR1L 4YCUA 2Q2TA 3ND8A 1QCBD 2F0WA 4IN3A 1LTTD 3T13A 3TDQA 2QGQA 1E22A 3I4NH 2RDGA 4LF5L 5IGCA 4U673 4WORA 5FJ8G 1DM0B 2NBFA 1SE2A 1J5EQ 3KBXA 2O5IC 3HFZB 2RBMA 4QGUA 1PTOB 5J22A 2K6AA 1TWCH 4KD3A 1LTID 3OYYA 4LUVA 5JEAJ 2VUMB 1R9TH 1I94Q 3KFUA 1W6KA 2NTSA 3CCEA 5LMNL 2LMCB 3I90A 1AE2A 4X66L 2SDFA 5DEHA 3S17H 3VR5A 2ZJPA 4K0KL 1DYQA 4FNFA 3EBEA 1IYVA 1CSPA 2R92B 2Z0SA 3R93A 2R61A 4ZQ3A 4IZ8A 4KHZA 5ISRA 4A3BG 3X3MA 5D65A 2NN6H 3CKIB 5C0XG 3HOVG 1KIXA 3S16H 1Q8IA 5IP7G 4POFA 3HOWG 4GZYC 2K5DA 5K36H 3PIOA 2UXCQ 3OTOL 4ZKCB 1HNWQ 3I3CA 1XPOA 3NUCA 2XNAC 1ILPA 2DY8A 1HRJA 4MHEA 3PQIA 3X3NA 1ICFB 3EN2A 4Y7NH 4UHVA 4PZ8A 2B39A 1VQFA 2LS01 2E2JH 5EKKA 4C3HH 4C56C 5GAEC 2MPMA 2F03A 3FVQA 5JJZA 3D6CA 5H1SE 1N32L 2K32A 1T9HA 3ND9A 1GXDC 1ENAA 5J39A 3I91A 3MXNB 2ZM6L 1PRTB 1E2VA 1KDBA 4OHJA 1H9RA 4WRDA 1QUQA 1UE5A 1IBKL 4DV7L 2JA5H 3J81i 3S14B 3J7AF 2F0DA 1D7QA 4C3IB 2A6EC 1WTVA 2EIFA 3SK5A 2AMCB 4JI1Q 2K75A 5JAVA 2E75C 3S15H 4XT3B 2V1CC 3CCJA 2CVRA 3MEFA 1K8OA 1EY6A 4M8AA 3NWTA 1IBLQ 3IFTA 2K04A 1L0XB 4LWCA 3HOUB 5E4WC 4B3RQ 1FGUA 5CV6A 4DV3L 4RCNA 4QQBX 3UDXA 2PQAB 5JPNC 3K5LA 3HOYB 2F0UA 1I3QH 3OIPA 3KUPA 4TVAB 2TMPA 2I5MX 5IGGA 3KLWA 3OWFA 1EQTA 3GTKH 4BY7G 4EVOA 4IFDH 1VQBA 1WYDA 4ALPA 1TU2B 3KDFA 2WAQE 1QUQB 3KF6A 3J81L 3DEPA 2NVYB 1WD1A 3GDEA 5CBEE 2R93G 5BN3A 4UP8A 3GTGH 3D4DA 4A3FB 1VS0A 2ZTEA 4BWGB 4CKBA 4F87A 4PG3A 4GOPB 5IGFA 2HHHQ 1UE7A 5KEEA 2JK8A 2QCPX 4A3JB 4HMJA 4DR4L 2JEAI 5T1GA 1F2LA 3K5NA 3BYTB 3NTHA 3PUYA 5M3FB 3GTOH 3DWPA 4HJ9A 2WB1E 1A63A 5EPLA 1G51A 2KOLA 4LF7Q 1KLGD 1TWHB 1ET6A 1H95A 4BBRB 3I55A 2VQFL 1VCIA 4ABNA 4IOCA 1K83B 1STEA 2K4KA 3S1MB 4M1UB 1PTOD 1DJRD 2B2VA 2A8VA 4K6LA 1SYEA 1HFNA 3HP3A 3BS1A 1HR0L 2E8GA 1BDOA 1SR3A 2CKZB 3TZUA 1VF5C 2L4NA 3G6JB 1I6HB 1ZXTA 1ZYRC 3T56B 4YY3Q 4XYQA 4X3SA 1LT6D 3QIAA 3RNUA 1STNA 1TT2A 1FNUA 1XMOL 1EOTA 1L1OC 3DXJC 1IW7D 4JI0Q 4BA2I 1K0RA 4ODGA 5C3XA 4JBKA 2G5DA 4LMQD 4F7XA 1Q7YC 1I4RA 4BXXG 2JJQA 2JYOA 3MFGA 2N55A 4IUPA 3H3VC 5LL6X 4AYBG 1CM9A 1L0WA 1NUCA 4AQYL 2EXDA 1D5ZC 2JA8G 1H9SB 3NK9A 2XVSA 3M7GA 2OXPA 4B9WA 1BF4A 2E2HB 2BCOA 1GUWA 1DOMA 1X3QA 3K6OA 3U58A 4QMGA 4A3KG 5JVH3 2VQEL 2DY7A 1AP0A 4A4IA 1LV9A 2EE1A 4XT1B 3PCOB 4IQZA 4EQPA 2RHQB 2UXDQ 4X62L 2E5LQ 3J7YW 1YNXA 4P2CB 3PO2B 3KOJA 1EIHA 3F2BA 1PRTD 2HD3A 4DR2Q 2F0VA 5M3MB 1AH9A 5IGEA 1FJGL 2BE5C 2KCCA 2IPKD 5D14A 5JEAG 1LTSD 1PTOH 1QWYA 4O2DA 1CSQA 1YZ6A 2MP1A 3GO5A 3K0YA 5CBAE 2A68C 3CW2C 3SK4A 5LMUL 2UUBL 2VUMH 2CW0C 1TVXA 1ZEQX 4A3EG 1H9MA 3I8ZA 4DUZL 3A8JE 1Q90A 4RHRA 2FINB 4KD4A 3S24A 5FLXL 2LXJA 1ILQA 1WJJA 3A5ZB 4FF4A 1HZAA 3TS0A 2JSOA 1NE3A 3J7AV 1IHZA 1HA5A 3EFXD 4BY1B 4A93B 1KDCA 2WB1B 1ONLA 2B63G 4R4TA 3WDNA 1JICA 2HDMA 3I72A 3A54A 1A8VA 1PA6A 5I2XA 3IRBA 4C3JG 2L12A 1TS2A 3HOXG 4HCSA 4RKLA 1XJVA 1SNQA 5IYBH 2XWBB 1FGBD 1CFMA 4DV0Q 1PVOA 1MBYA 1Z7TA 4R9WA 1W3SA 1GUTA 4DV6Q 4DV1L 3K81C 4RGMA 1YNJD 2F0OA 4KK7A 4GLAC 3L2PA 1SNDA 3T51B 2MQHA 4GKKQ 3CPWA 1VQHA 4ZLTF 5KGUA 2ZTDA 2UUAL 3LWUA 4DK1A 1Q46A 5JJKA 5DM63 4NXML 3ULLA 3S14H 1EL0A 4A3LG 2HUGA 4HIOA 4A3DG 3G4SA 3M3YB 2A69D 4PV1C 1E3PA 1EQRA 1HH2P 1T5XD 3J80E 2PQEA 2BDOA 4DV5Q 2EXZA 1HPCA 2K1BA 1PRTF 1SXTA 4DNIA 4OGQC 2E2IB 1FNWA 1EY7A 3NELA 4DNRB 3C2PA 2ES2A 2EYPA 4JC0A 3ITPA 1VQEA 2IL8A 2J7ZA 1V9PA 5C44B 1SDFA 2Q2IA 5GQOA 1ESRA 2JXMB 5HGQA 5JJIA 5F2DA 4O42A 1B70B 2MGSA 2NZ1D 3NP8A 3H09A 3V05A 1IL2A 3CC4A 5IP9H 5KNCA 1I4XA 1CKMA 3HOYH 2PNRC 1DZ1A 2UUCQ 2RSOA 1R9TB 2JA6G 1O7YA 1EEFD 2VB2X 1J8IA 3K7AB 4LF9L 4E6IA 1D8LA 2MO1A 1JWUD 3L3OC 4IALA 1KABA 1BXTA 3D31A 5CR3A 3I4OA 2JA9A 4HSPA 2QDBA 5IYCH 1XNRQ 3PO3G 3F2CA 2QW7A 4LFCQ 1NMGA 2WKCA 3FMCA 1YNND 3NHHA 1TY0A 1TS3A 1CZGA 3NBIA 2AWNA 2F0IA 1NY4A 2O2LD 2GVBA 1LM0A 3IAYA 1N36Q 3NTKA 1U9RA 2AQ2B 4A3JH 3F2DA 4K8IA 5GAHC 3E9IA 1X55A 4KN7C 3TSSA 1CQFA 5CV8A 1Y1WG 4RKBA 1PV4A 4KTAA 1A3UA 3H0GG 1AFPA 1NJIC 1Q82C 5M3FH 3LX0A 4PQXA 1WCMB 2F1MA 4HJAA 2DNCA 2WV6D 1TWHH 3VYUA 1KXLA 1HTLD 4BBRH 3A8IE 1ENFA 3PUXA 3OSOA 2UXBL 1K83H 5C4XB 4CGYB 1M1KC 4DR1Q 3S1MH 5EBDA 1JR0D 1T5EA 4DAPA 2CHBD 1NTGA 3CCRA 4B3MQ 3M4PA 1N34L 3KF8A 3W2DA 3HOZG 1O7ZA 4DNTB 4NKLA 2LSSA 5CV9A 3TQYA 1QJOA 1YEZA 1X56A 3HKZE 3P75A 3A7AB 3RR5A 4LF4L 2CH4W 5C4ZA 4WJ4A 3TN2A 2GN5A 1SE8A 1C48A 1B1ZA 3NE5B 2BA0A 5LMNQ 1L1OA 4X66Q 4K0KQ 1PYBA 2XIWA 1MKHA 4J6HA 2K01A 4F88A 1BCPB 4ME3A 4EQNA 1B9MA 1I3QB 4X3TA 5C4JB 4LJZC 2K05A 2B29A 3PIO3 1HQRD 1Q1BA 2SNMA 4OO1I 4ZCKA 3GTPB 4KHPL 2E2HH 3EQLC 1MSHA 3DWQA 1EIYB 3OTOQ 3LWEA 2PMZE 1QG7A 3GD7A 1LT5D 5IODA 1OXXK 3I70A 4KJNA 2B2WC 1M90C 2D9UA 1YBYA 1EY4A 3RLOA 3A74A 2B2YC 4X3KA 3PO2H 3SGIA 1E1TA 5JVG3 2IX0A 4IJLA 5C5LA 1B53A 4K14A 5M3MH 1RCVD 4DR7L 4X3UA 3O13A 4DV4L 3CXCA 2ZM6Q 1NMFA 2BH8A 3MEHA 1PH8A 1IBKQ 4DV7Q 3GV6A 3EA6A 1XYIA 4DAYB 1AEXA 1JQYD 5LL6S 1EIGA 4PZ7A 3UI2A 3TBIB 1A15A 3SK8A 4GN4B 2SOBA 1RIPA 2YV5A 4BY1H 1L0YB 1AN8A 4A93H 2EY1A 3GV3A 2P5ZX 3A56A 4YIJA 3J7ZC 2CWPA 4DV3Q 3FKIB 1W2BA 1HZBA 2UU9L 3FRPB 4ZUIA 2CCZA 1SNOA 5AJ3L 4WFN3 1FL0A 1HTPA 4UP9A 4POGA 4LF6L 1FD7D 3A0JA 5FKAC 1SMYC 3K58A 4PZ6A 1X9NA 1SRUA 3GTLB 1O7IA 3ERQA 3HKZB 3RMHA 1TQOA 4JI3L 2L5TA 3URYA 4C3HG 4JBMA 3I2ZA 3FP9A 5A2QE 2AQ3B 3M3YH 2EDGA 1Y1VG 1G2SA 3S2DB 1PFMA 5LMNW 4DR4Q 1Q8KA 2A19A 3NXWA 4G7ZC 2ATWA 2G9DA 2E2IH 5CORA 2KQ3A 4WJ3M 4OX9L 1LTRD 2BA1A 2D2CC 4V190 5C44H 1XPUA 2JA5G 1EFWA 1X3PA 1L2FA 3CCUA 1A3TA 4MTNA 1TXYA 1VQCA 1EEID 1YITA 2ICEC 5E1FA 4DK6C 2VQFQ 2LY7A 1BO0A 1EZ6A 5G3LD 2PMZB 1BVSA 4OONA 2VL6A 4GLVB 1FVIA 5BN5A 3CU7A 5FLMH 3K7AH 4OO1G 1EYDA 3I4LA 2C35B 1HFGA 1EUJA 1Y8OB 2I07B 1HR0Q 4R4IA 1D1IA 3NPPA 2F4VL 2E74C 4Q0FA 1ZKOA 1CTMA 3KK7A 3LNNA 4A3IG 4P73A 1NSNS 2N49A 2WKDA 1XXGA 5M9OA 3K7UC 5ELCA 1BCPD 3DMUA 5KRUA 4APVA 3ULJA 1XMOQ 1CHPD 3OIQA 1BBUA 2L1BA 4TRDA 4ZRZA 5GROA 1O7LA 2F0QA 3RN2A 1I4PA 1PH5A 4B9XA 1WCMH 5E3FA 4AQYQ 3M4QA 3Q6SA 2AHOB 3UDIA 4IUQA 1I4QA 1C0AA 4A3MG 3JAME 5E4XA 2VQEQ 1E0BA 5C4XH 1R4PB 1OO9B 1KDAA 1C4QA 3MA2B 1N8RC 2Z4HA 3CD6A 4QB4A 4HJ8A 2DJFC 1RODA 4JI8Q 1JB3A 2EYMA 1SSOA 4L8JA 4K5XA 3NBHA 4L6TB 4LK1C 2PW5A 2MO0A 3NQTA 1FJGQ 3PF5A 3G7LA 1VQKA 2NTTA 4HTHA 4UAIA 3RZDB 1EZ8A 4K5WA 1II3A 2N78A 3CAMA 1JB7A 2UUBQ 2K5VA 5LMUQ 3AYHB 1KAAA 2N8NA 1E2ZA 4Y52H 3TP5A 4JK1C 1F77A 4HAEA 1I4HA 2WP8J 3E9HA 4DUZQ 1VQLA 3KLSA 2YTYA 1VQ8A 2EYHA 5TSSA 4IUUA 3T1YL 3NEMA 1AW7A 3NENA 4QCLA 1EY8A 5IGDA 4KLKA 5C4JH 3MXGA 1PZKD 5C3EB 4OELB 4IPGA 4RGNA 3CCVA 4LF8L 4K2LA 3A5UA 3GTPH 2O5JC 2ZXRA 5BN4A 3PUVA 5FLXc 4NXNL 1AZQA 5DAUA 4A3EB 1JCKB 1EQVA 4HJ7A 2A68D 1STHA 4Z9CB 1HNZL 2B2WA 2K52A 2KVMA 1BCPF 1J6QA 3NBHB 1X3GA 3V2TA 4A3BH 2RQXA 1UE1A 2B2YA 3AEVA 3MAQA 2CH4A 1B3QA 4ME5A 5C0XH 5ELEA 3SDZA 4JPBW 4CJ2C 2NVQH 1QZHA 1PXUA 5IP7H 2K28A 4LFBL 4KY7A 4DV1Q 2Z1CA 2KUMA 1K3RA 4DFAA 2NZOA 1K8AC 1VQ7A 4P71A 5JOBA 1CHQD 4HR7B 2F0TA 1HR0W 2JEBI 1U4PA 2PI2A 2UUAQ 4YHHL 3CC2A 2TSSA 1SMXA 5EPJA 1EY9A 4NXMQ 1CI3M 1V1QA 5IWAQ 3S1RB 2KENA 3SXHA 2ZTCA 1RTOA 1F9PA 3HKSA 3ZJYC 3S1QB 4BBSG 1RL2A 2B8FA 3J80L 1D6EC 4JI2L 2EPBA 4PMWA 2F0PA 2KEDA 2OWOA 2MJ8A 3BZCA 1Z47A 3KDFB 3P7JA 3KF6B 1U0LA 2VUMG 3T4AC 3NQIA 3KJOA 1GHKA 3K5OA 2WIIB 2R92G 3FKIH 5M5YB 3HEJA 5IT9E 1EWHA 4RCOA 5HY6A 2QDLA 2NWGA 2GVAA 2Z4IA 3QG1A 3VR6A 3Q22A 1K3BC 4GNXC 2Q8RE 2EYFA 1EU4A 2EZVA 3MFYA 1VQDA 3A7LA 1CUKA 3UE0A 4LF9Q 2Z9HA 2IW3A 4B3SQ 1NCVA 1VQMA 3N52A 2C5CA 2EJFC 4RGTA 4PMBA 3V96A 3GTLH 2F52A 3R3OA 4KY5A 1B7YB 4QJFA 3TMEA 4JOIC 1F2MA 3Q23A 2XN9C 1BBXC 4H7BA 4NPSA 2ID0A 2JA6B 1XWEA 3CP0A 4A3GB 5I9PA 1W6JA 4DUYQ 2UXCL 3S2DH 1JWSD 4JYAL 4QF4A 4JW0A 1CKOA 2F0FA 4N9PA 2HQLA 2R93H 1KNEA 4DAMA 1SJED 1UEAB 4TKOB 2K50A 2B2UC 2NYZD 3K0XA 2F0NA 3DLLA 1LTGD 3PGZA 3K59A 4C3IG 2DJGC 2C9OA 2K5WA 2PPBC 4C1NI 1WTRA 3C1FA 2F0SA 5C5MA 2OQKA 2WAQB 2IT1A 2Z6BA 4H13C 1GUNA 1ML0D 2AKWB 2UXBQ 2F3WA 1EY0A 2B8GA 3IL8A 3M85A 1DCZA 1N33L 1PH7A 3J7A5 1N34Q 1GHJA 1B9NA 3HOUG 4NMZA 5C6AA 2ZJRA 2J4XA 1Q86C 4P74A 1PTOF 5IP9G 2F0MA 3SE0A 3HOYG 2RKSA 1MGSA 2I5LX 3DUZA 4NB3A 2E76C 1STYA 4IOAA 1TS5A 1GUOA 4X65L 4H0LC 3T1HQ 4B3RL 3QB3A 1KLUD 3CRLC 1WTQA 1B8AA 4DK3C 4DR5L 3K5MA 1R4QB 2KECA 5KNBA 1IKLA 4A3FG 1XMQL 4MIUA 1IXRA 4IUNA 4JI6L 1QZGA 2K03A 4KHPQ 2KA7A 1STBA 4TSSA 4YCWA 3CMAA 4DR6L 2M2LA 4CDFC 2DGYA 4A3JG 1UEBA 2L0CA 3U9OA 2PO4A 2N88A 3QJYA 4O1NA 2RF4A 1LLRD 4JBJA 1EY5A 4EQOA 3A55A 3EROA 3STBC 1S3OA 3CCMA 4HEDA 2D0OA 4DR7Q 2PZUA 2FFKB 1VQNA 4BBRG 3RZDH 1EOVA 4DV4Q 3GTMH 3TREA 1JJGA 4ILWA 5CC4A 1HUNA 3U4ZA 4A3CH 3VYTA 1VMPA 4IURA 1VQ5A 3TRZA 3DM1A 3G71A 3VA5A 5CGKA 4A76A 3BDCA 1NR2A 2EVBA 3JAMc 3T16A 4CBVA 3F2UA 5CV5A 5JEAH 2D62A 1TR5A 4RAUC 5CMDA 5C3EH 5KYLA 3BDLA 4R8NA 1PH1A 3KLSX 2JA7B 1RF2D 1A3VA 2IHFA 4FVMA 2OTJA 1N9WA 1LACA 1H9JA 1V1PA 1RHPA 2ASBA 3QOJA 1IBML 3AQQA 4A3EH 3CC7A 1B4OA 3KYHC 2UU9Q 3K8AA 3VYRA 3MZ5A 2MHVA 1C7YA 3TP7A 3I4MG 3QR8A 5AJ3Q 1H9KA 3MHBA 4LF6Q 1GKHA 4YY3L 4GN3B 1XPRA 4UPAA 2D5DA 4L5SA 2B63H 1SYCA 4WJWA 4IFDJ 3M4YA 1PRTC 2NN6I 4K5VA 4R4OA 2JP1A 4XYOA 1LABA 3HOXH 1FR3A 4JI3Q 3PO2G 4KN4C 4J8QA 5M3MG 3S1RH 2V4DA 5IIFA 2HCIA 5A2QL 2R7ZB 3RN5A 3S1QH 2RCNA 3H15A 4HJ5A 2EY6A 2F0LA 2AQ1B 2KJXA 1RJTA 1SAPA 3H91A 2R6GA 2EJGC 1WFQA 1U4RA 2UXDL 2EY2A 3MXPA 4OL7A 5JJLA 4DAVA 1HA6A 3CCSA 4LF5Q 4DR2L 5NUCA 3U9SA 1GUSA 5M5YH 5HGTA 4XQNA 1S5DD 1YI2A 1EWIA 4JG2A 2JQOA 3E0EA 4GNXA 2XWJB 3GP7A 4BY1G 3C46A 4A93G 2WB1G 1OXTA 1GUGA 3ER0A 2F4VQ 3JAMi 3MTSA 1JORA 4LUZA 1DGSA 4N9TA 1JMCA 2EYOA 4JOIA 2WFWA 1SNCA 3OHXC 1Y8PB 1YNJC 1CKNA 1G291 4JV5L 2JA6H 4GOPC 3SVMA 3TP8A 4A3GH 4YCVA 5BR8L 1PH2A 5CV4A 3MC0B 5IT9c 1DD2A 3D0FA 1CA6A 1VQ9A 3KF8B 1SYDA 2KBNA 1X3EA 2A69C 1IYJB 4A3BB 4IPHA 1G2TA 2B2UA 3PO3H 1B3AA 5CV7A 1FYCA 4IFDI 2VB3X 3T53B 3HOVB 4DV0L 1C9OA 2NVQB 1HZCA 3WWVA 2NVXH 1N32Q 2LKVA 3HOWB 1Q3LA 1I6VC 1L1OB 2VW9A 1PLFA 2WINB 4OWXB 4QL5A 3JAML 3OPOA 2Z8LA 4RGOS 4DXGA 3JC66 3H0GH 2DUDA 2ENBA 4JI7L 1K0SA 1PFNA 3PIPA 1HXYD 1JT8A 4LFAL 5EKLA 2VZAA 3I4NG 4JI5L 1LTBD 1S5FD 1QVFA 1EFID 1WTHA 5A35A 1B44D 3G48A 3KLRA 1WOCA 4CDEC 1G91A 1GVPA 2OEOA 2BH2A 1G6PA 4HCEA 2WACA 2E2DC 1QVCA 1YNNC 3T1YQ 4N8X1 1Q81C 4R4CA 4XQJA 3TP6A 2NN6G 2O4XA 5J3BA 4AYBE 5HURA 2A6ED 2DN8A 2QEJC 2UUCL 1BR9A 1IL8A 5M5WB 2ICIA 1KQSA 5K36G 1K28A 3W3AA 1VQGA 3W1GA 1PH6A 3QWNA 1QILA 2M00A 1HNZQ 2H5XA 2R3ZA 4HIDA 4Q5VA 1XTCD 3Q0AA 3VR3A 5J1ZA 3BVMA 4JVZA 2JE6I 1Z9FA 3ONAB 4BY7B 2I46A 5DNFA 3SR1A 4LFBQ 4B3TL 3BYYB 5IYDH 2A74C 1D2BA 1J9OA 2SEBD 4YWLA 5COYA 2EYJA 4MZ9A 1N36L 5EGTA 2K5HA
chains in the Genus database with same CATH topology
3I73A 1WTOA 3H6MA 1RTNA 3E6ZX 4FP5D 1F2YA 2R93B 5C3WA 4DN4M 5AFWA 4FF2A 4G4KA 5DM73 2EOTA 4JBWA 5M5XB 2J0TD 3WOFA 2YYZA 2HQEA 3OOCA 2F0EA 5EKIA 3DHQA 3DEOA 1I50B 1G6ZA 4CJ0B 5D3DA 4OIKA 1GJXA 4FF3A 1QNUA 4IUTA 4BBSB 2K33A 4FXGC 4OIJA 2XRSD 3NTIA 5IT9L 2EYLA 4KHVA 5I6YA 3BZDB 4IFDG 3MXNA 2H4OA 3SHLA 1EYCA 1TWAB 3HG9A 4BS9A 2L55A 2PYKA 4F8MA 3FPUB 1FNVA 2A6HC 3CQZB 4C1NK 3S9WA 1A6XA 3PUWA 1MI2A 4ZKBB 3RZOB 3L9AX 4ULLA 3VYSA 1CT1D 1CA5A 1ZYRD 4XDXA 2PZWA 3BVZA 3M4OB 4AYBB 3IFDA 2ZXOA 1TY2A 2H1EA 2JA8B 3R8BA 2X69A 5ELFA 1DOLA 3GTMB 2IJ0A 2QKIC 4A3KB 3TZDA 1TS4A 4ID6A 2KEEA 3BG3A 1EU3A 2F0JA 5FOBB 5G3LF 2X6GA 4MN3A 1WVLA 1OXSC 1TWGB 3EJIA 1F2ZA 2BE5D 2LFNA 4G57A 1ET9A 3PV0A 3OMGA 2L11A 4OO1H 2CW0D 2FMMA 1SEBD 3BDOA 1S4ZA 3D4WA 5KIXA 1QE6A 2FMCA 3OWEB 5D3IB 1WTWA 4L63B 1SYFA 4CKCA 2VXWA 1F9QA 2B63B 5ELBA 4NDXA 1WD0A 4C3JB 4ZK9B 4XTCS 3HOXB 2EY5A 5FO9B 2FHTA 4KY6A 1MD2D 1GOZA 1SFOB 4I7ZC 5FK9C 3KBGA 3C3LA 4UDUC 2OT2A 3WOEA 1O80A 4KMUC 1OXUA 1OXVA 4FXKC 1Y69U 1CQVA 3FDTA 4DF7A 2HDLA 4A3DB 1BCPC 4QUCA 1PZID 2L9HA 1IYUA 4K6DA 1U4MA 3CRKC 1H9SA 3H94A 2NVTB 4XIGS 4ZUJA 1KNAA 1HUMA 1PDQA 1BUVT 2NB0A 3FEWX 4HN7A 1HQMC 3HZXA 5ELDA 2YU9B 1LT4D 2EJMA 5I6WA 3Q24A 2QF7A 3HRZC 3R2IA 2RDHA 3M7NA 2B2TC 1V1OA 3I4MB 3ZYYX 4RHSA 3PO3B 1BOSA 4C2MB 3S2HB 4ZYSA 5FO8B 3A8KE 4R8IA 4I65A 4DGZA 2NVXB 4QUFA 1D1KA 4RWSC 2ZT9C 4KKTA 1Y1WB 4S3SA 3RLFA 3H0GB 1VMCA 3D8GA 4DXFA 2KCNA 1UNSA 1TWFB 3AU7A 2A73B 3VR2A 2AUJD 1PZJD 3L7ZC 2M9VA 3BVGA 4PNYA 1NAPA 2X6LA 1Y8NB 1F9SA 2PZTA 3RD4A 3OMCA 4KKUA 1JC7A 1ICWA 3HOZB 1ESFA 1RD9D 1IKMA 4ZAIA 3VR4A 2K7VA 1KTKA 2RA4A 1VDZA 3J81E 2ZXPA 1S5CD 1QNKA 1F9RA 1JOKA 4TQUS 3PMFA 2F3VA 3K57A 1QB5D 4K2KA 2FJ2A 4K8JA 2F0GA 1Z6HA 1C8CA 1V43A 1TIID 4J1MA 3NWSA 4FYDA 3GTQB 1PTOC 4V0BA 3GTJB 1JOQA 4RA8A 4EGVA 3PIP3 3MWYW 4U68A 5IOCA 1ENCA 1MSGA 3MXUA 5I2YA 1RDPD 2CQAA 3FPPA 5CYUA 4CJ1B 1B50A 1IW7C 1I4GA 1O78A 1EYAA 2DNEA 3MVVA 3I4NB 2F0KA 4BA1I 1PFBA 1TWCB 5EJWA 1SBBB 1NR4A 4XQQA 4G7HC 3S17B 1SE3A 2AUKA 2XSCA 4H44C 5I9OA 1HHVA 2IX1A 5EBCA 1AZPA 4NW2A 2F4IA 1DOKA 3HS0C 3S16B 2QILA 5C0XJ 1V1PB 3S1NB 5C4HA 1UUPA 1JWMD 4Y7NB 5T1IA 1A2TA 1A2UA 1SMYD 2E2JB 4C3HB 4DK0A 3P20A 2G9HD 1LT3D 5EPKA 1Y1VB 3DWAA 1PMRA 1UAPA 1QOHA 1Q1EA 1V8QA 2JA5B 3D3RA 5KYIA 1LO5D 1RKNA 4PMCA 5FLXE 4QIWB 2K5QA 2Q8TA 2GA4B 3RUZA 3S15B 3AB9A 3E5SA 1JOOA 2RDFA 1TKWB 2B2TA 1STGA 2AWOA 4DA2A 1WTPA 1S5BD 4A3IB 4KKSA 4XXEA 4HSVA 4DAYA 1X32A 3AMUA 3GTKB 1M4VA 2IX3A 3N6RA 4KV6A 3QOLA 4FF1A 3C1EA 2XRQD 2HCCA 1PYWD 3VA7A 5I4DA 1K8MA 5C0XI 3D6WA 5FO7B 3GTGB 2VNUD 3GQBA 1M8AA 2F0HA 1SJHD 2A6HD 3D4RA 5EQ0A 2OF1A 1Q12A 4RFBA 4A3MB 1LTAD 2NUCA 2IWHA 3GTOB 5LHY1 3HGBA 2BDNA 1STAA 4DU9A 4NP5A 3NSWA 5KNDA 5JPMC 5IGBA 1BQQT 1DONA 1E2WA 1HCZA 1SNMA 4KI0A 1D5XC 4CKEA 1BNZA 2Y0SB 3P1HA 2PW7A 1XX8A 2B2VC 3SK6A 4IUVA 2Q8IB 1JE4A 1VF7A 3R2TA 2SNSA 3E0JA 3QO2A 2BOSA 4FXDA 3IKJA 2RVLA 2MUYA 1CK1A 1SYGA 3EVQA 4B08A 1CZWA 3SEBA 2PCFB 1SYBA 1DXMA 1EWCA 3CHBD 1WTXA 4RH6A 4CHTB 4KJOA 1U4LA 4FO2A 1D5MC 2A5HA 2KHSA 1S5ED 1SNPA 1G8ZD 4HMIA 3OW7A 4LAAA 5K5PA 1SE4A 2RSNA 3PUZA 1B2TA 4G7OC 3ND8A 1QCBD 2F0WA 4IN3A 1LTTD 3T13A 3TDQA 2RDGA 5IGCA 4U673 4WORA 1DM0B 2NBFA 1SE2A 3KBXA 2O5IC 2RBMA 1PTOB 5J22A 2K6AA 4KD3A 1LTID 5JEAJ 2VUMB 1W6KA 2NTSA 2LMCB 3I90A 2SDFA 5DEHA 3VR5A 1DYQA 4FNFA 1IYVA 2R92B 3R93A 2R61A 4ZQ3A 4IZ8A 4KHZA 5ISRA 3X3MA 5D65A 2NN6H 3CKIB 5C0XG 1Q8IA 4GZYC 2K5DA 5K36H 4ZKCB 3I3CA 3NUCA 2XNAC 1ILPA 2DY8A 1HRJA 4MHEA 3X3NA 2B39A 2LS01 5EKKA 4C56C 2MPMA 2F03A 3FVQA 5JJZA 3D6CA 2K32A 3ND9A 1GXDC 1ENAA 5J39A 3I91A 1PRTB 1E2VA 1KDBA 4OHJA 1H9RA 4WRDA 3S14B 3J7AF 2F0DA 4C3IB 2A6EC 1WTVA 3SK5A 5JAVA 2E75C 4XT3B 2CVRA 1K8OA 1EY6A 4M8AA 3NWTA 3HOUB 3IFTA 2K04A 1L0XB 5E4WC 5CV6A 4RCNA 5JPNC 3K5LA 3HOYB 2F0UA 3OIPA 3KUPA 2TMPA 5IGGA 3OWFA 1EQTA 4EVOA 4IFDH 1TU2B 3J81L 3DEPA 2NVYB 1WD1A 5CBEE 5BN3A 3D4DA 4A3FB 4BWGB 4CKBA 4F87A 5IGFA 5KEEA 2QCPX 4A3JB 4HMJA 2JEAI 5T1GA 1F2LA 3K5NA 3BYTB 3NTHA 3PUYA 5M3FB 3DWPA 5EPLA 2KOLA 1KLGD 1TWHB 1ET6A 4BBRB 1VCIA 4ABNA 1K83B 1STEA 3S1MB 4M1UB 1PTOD 1DJRD 2B2VA 4K6LA 1SYEA 1HFNA 3HP3A 3BS1A 1BDOA 3TZUA 1VF5C 2L4NA 3G6JB 1I6HB 1ZXTA 1ZYRC 3T56B 4XYQA 4X3SA 1LT6D 3QIAA 1STNA 1TT2A 1FNUA 1EOTA 3DXJC 1IW7D 4BA2I 4ODGA 5C3XA 4LMQD 4F7XA 1I4RA 2JYOA 3MFGA 2N55A 4IUPA 3H3VC 5LL6X 1CM9A 1NUCA 1D5ZC 1H9SB 3NK9A 2XVSA 3M7GA 2OXPA 4B9WA 1BF4A 2E2HB 2BCOA 1GUWA 1DOMA 1X3QA 3K6OA 4QMGA 5JVH3 1AP0A 2DY7A 1LV9A 2EE1A 4XT1B 4IQZA 4EQPA 3J7YW 4P2CB 3PO2B 1EIHA 1PRTD 2F0VA 5M3MB 5IGEA 2BE5C 2KCCA 2IPKD 5D14A 5JEAG 1LTSD 1PTOH 1QWYA 2MP1A 3GO5A 3K0YA 5CBAE 2A68C 3SK4A 2CW0C 1TVXA 1ZEQX 1H9MA 3I8ZA 3A8JE 1Q90A 4RHRA 2FINB 4KD4A 5FLXL 1ILQA 4FF4A 2JSOA 3J7AV 1IHZA 1HA5A 3EFXD 4BY1B 4A93B 1KDCA 2WB1B 1ONLA 3WDNA 1JICA 2HDMA 3I72A 3A54A 5I2XA 4C3JG 2L12A 1TS2A 4HCSA 4RKLA 1SNQA 2XWBB 1FGBD 1CFMA 1MBYA 1Z7TA 4R9WA 1GUTA 4RGMA 1YNJD 2F0OA 4KK7A 1SNDA 3T51B 4ZLTF 5KGUA 3LWUA 4DK1A 5DM63 1EL0A 2HUGA 3M3YB 2A69D 4PV1C 3J80E 1T5XD 2PQEA 2BDOA 2EXZA 1HPCA 2K1BA 1PRTF 1SXTA 4OGQC 2E2IB 1FNWA 1EY7A 4DNRB 3C2PA 2EYPA 3ITPA 2IL8A 2J7ZA 5C44B 1SDFA 1ESRA 2JXMB 5F2DA 4O42A 2NZ1D 2MGSA 3NP8A 3H09A 3V05A 5KNCA 1I4XA 2PNRC 1DZ1A 2RSOA 1R9TB 1O7YA 1EEFD 2VB2X 1J8IA 3K7AB 4E6IA 3L3OC 1JWUD 4IALA 1KABA 1BXTA 3D31A 5CR3A 4HSPA 2QDBA 2WKCA 3FMCA 1YNND 3NHHA 1TY0A 1TS3A 1CZGA 3NBIA 2AWNA 2F0IA 2O2LD 3IAYA 3NTKA 1U9RA 2AQ2B 4K8IA 3TSSA 4KN7C 1CQFA 5CV8A 4RKBA 4KTAA 1A3UA 1AFPA 3LX0A 4PQXA 1WCMB 2F1MA 2DNCA 2WV6D 3VYUA 1HTLD 3A8IE 1ENFA 3PUXA 3OSOA 5C4XB 4CGYB 5EBDA 1JR0D 1T5EA 4DAPA 2CHBD 3KF8A 3W2DA 1O7ZA 4DNTB 4NKLA 5CV9A 1QJOA 3P75A 3A7AB 5C4ZA 3TN2A 1C48A 1B1ZA 3NE5B 2BA0A 2XIWA 4J6HA 2K01A 4F88A 1BCPB 4EQNA 1B9MA 1I3QB 4X3TA 5C4JB 4LJZC 2K05A 3PIO3 1HQRD 1Q1BA 2SNMA 4OO1I 3GTPB 3EQLC 1MSHA 3DWQA 3LWEA 1QG7A 3GD7A 1LT5D 5IODA 1OXXK 3I70A 4KJNA 2B2WC 2D9UA 1EY4A 2B2YC 4X3KA 5JVG3 2IX0A 5C5LA 1B53A 4K14A 1RCVD 4X3UA 3O13A 3MEHA 3GV6A 3EA6A 1XYIA 1AEXA 1JQYD 5LL6S 1EIGA 3UI2A 3TBIB 1A15A 3SK8A 2SOBA 1L0YB 1AN8A 2EY1A 3GV3A 3A56A 4YIJA 3FKIB 3FRPB 4ZUIA 1SNOA 4WFN3 1HTPA 1FD7D 5FKAC 1SMYC 3K58A 3GTLB 3ERQA 3HKZB 3RMHA 1TQOA 2L5TA 3URYA 4C3HG 5A2QE 2AQ3B 2EDGA 1G2SA 3S2DB 1PFMA 3NXWA 4G7ZC 2G9DA 5CORA 2KQ3A 1LTRD 2BA1A 2D2CC 4V190 1X3PA 1A3TA 1EEID 2ICEC 5E1FA 2LY7A 1BO0A 1EZ6A 5G3LD 2PMZB 5BN5A 3CU7A 4OO1G 1EYDA 3I4LA 1HFGA 1Y8OB 2I07B 1D1IA 3NPPA 2E74C 4Q0FA 1ZKOA 1CTMA 3KK7A 3LNNA 1NSNS 2WKDA 1XXGA 5M9OA 5ELCA 1BCPD 3DMUA 5KRUA 1CHPD 3OIQA 2L1BA 4TRDA 4ZRZA 1O7LA 2F0QA 1I4PA 4B9XA 5E3FA 3Q6SA 4IUQA 1I4QA 3JAME 5E4XA 1E0BA 1R4PB 1OO9B 1KDAA 1C4QA 3MA2B 2Z4HA 4QB4A 1RODA 1JB3A 2EYMA 1SSOA 4L8JA 4K5XA 3NBHA 4L6TB 4LK1C 2PW5A 3NQTA 3G7LA 2NTTA 4HTHA 4UAIA 3RZDB 1EZ8A 4K5WA 1II3A 1KAAA 1E2ZA 3TP5A 4JK1C 1F77A 4HAEA 1I4HA 2WP8J 3KLSA 2EYHA 5TSSA 4IUUA 1AW7A 4QCLA 1EY8A 5IGDA 5C3EB 3MXGA 1PZKD 4RGNA 4K2LA 2O5JC 2ZXRA 5BN4A 3PUVA 1AZQA 5DAUA 4A3EB 1JCKB 1EQVA 2A68D 1STHA 4Z9CB 2KVMA 2B2WA 1BCPF 3V2TA 2RQXA 2B2YA 3MAQA 4ME5A 5C0XH 5ELEA 3SDZA 4CJ2C 1PXUA 2K28A 4KY7A 2Z1CA 2KUMA 4DFAA 5JOBA 1CHQD 4HR7B 2F0TA 2JEBI 1U4PA 2TSSA 5EPJA 1EY9A 1CI3M 3S1RB 3SXHA 1RTOA 1F9PA 3S1QB 2B8FA 3J80L 1D6EC 2EPBA 4PMWA 2F0PA 2KEDA 2MJ8A 1Z47A 3P7JA 3T4AC 3NQIA 1GHKA 3K5OA 2WIIB 5M5YB 3HEJA 5IT9E 1EWHA 4RCOA 3QG1A 2NWGA 3VR6A 2Z4IA 3Q22A 2Q8RE 2EYFA 1EU4A 2EZVA 3MFYA 3A7LA 2IW3A 1NCVA 3N52A 2C5CA 2EJFC 4RGTA 4PMBA 3V96A 3R3OA 4KY5A 3TMEA 1F2MA 3Q23A 2XN9C 1BBXC 4H7BA 2ID0A 2JA6B 1XWEA 4A3GB 5I9PA 1W6JA 1JWSD 4QF4A 2F0FA 4N9PA 1KNEA 1SJED 1UEAB 4TKOB 2B2UC 2NYZD 2F0NA 1LTGD 3K59A 4C3IG 2C9OA 2K5WA 2PPBC 4C1NI 1WTRA 3C1FA 2F0SA 5C5MA 2WAQB 2IT1A 4H13C 1GUNA 1ML0D 2F3WA 1EY0A 2B8GA 3IL8A 3M85A 1DCZA 1GHJA 1B9NA 4NMZA 5C6AA 2J4XA 1PTOF 2F0MA 3SE0A 2RKSA 1MGSA 3DUZA 2E76C 1STYA 1TS5A 1GUOA 4H0LC 3QB3A 1KLUD 3CRLC 1WTQA 3K5MA 1R4QB 2KECA 5KNBA 1IKLA 4MIUA 4IUNA 2K03A 2KA7A 1STBA 4TSSA 2M2LA 2L0CA 3U9OA 2PO4A 2N88A 3QJYA 4O1NA 1LLRD 1EY5A 4EQOA 3A55A 3EROA 4HEDA 2PZUA 2FFKB 4ILWA 5CC4A 1HUNA 3VYTA 1VMPA 4IURA 3DM1A 3VA5A 5CGKA 3BDCA 1NR2A 2EVBA 3T16A 4CBVA 3F2UA 5CV5A 5JEAH 2D62A 1TR5A 4RAUC 5CMDA 5KYLA 3BDLA 4R8NA 3KLSX 2JA7B 1RF2D 1A3VA 4FVMA 1LACA 1H9JA 1V1PA 1RHPA 3QOJA 1B4OA 3VYRA 3MZ5A 2MHVA 3TP7A 1H9KA 3MHBA 2D5DA 1SYCA 4WJWA 4IFDJ 3M4YA 1PRTC 2NN6I 4K5VA 2JP1A 4XYOA 1LABA 1FR3A 4KN4C 4J8QA 2V4DA 5IIFA 2HCIA 5A2QL 2R7ZB 2EY6A 2F0LA 2AQ1B 2KJXA 1RJTA 1SAPA 3H91A 2R6GA 2EJGC 1U4RA 2EY2A 3MXPA 4OL7A 4DAVA 1HA6A 5NUCA 3U9SA 1GUSA 5HGTA 4XQNA 1S5DD 2XWJB 3GP7A 3C46A 1OXTA 1GUGA 3MTSA 1JORA 4N9TA 2EYOA 1SNCA 1Y8PB 3OHXC 1YNJC 1G291 3SVMA 3TP8A 5CV4A 3MC0B 1DD2A 1CA6A 1SYDA 2A69C 4A3BB 1G2TA 2B2UA 1B3AA 5CV7A 1FYCA 4IFDI 2VB3X 3T53B 3HOVB 2NVQB 2LKVA 3HOWB 1Q3LA 1I6VC 1PLFA 2WINB 3JAML 3OPOA 2Z8LA 4RGOS 4DXGA 2ENBA 1PFNA 1HXYD 5EKLA 1LTBD 1S5FD 1EFID 5A35A 1B44D 3KLRA 1G91A 2OEOA 4HCEA 2WACA 2E2DC 1YNNC 4XQJA 3TP6A 2NN6G 2O4XA 5HURA 2A6ED 2DN8A 2QEJC 1BR9A 1IL8A 5M5WB 2ICIA 5K36G 3W3AA 3QWNA 1QILA 2M00A 2R3ZA 4Q5VA 1XTCD 3Q0AA 3VR3A 5J1ZA 3BVMA 2JE6I 3ONAB 4BY7B 2I46A 5DNFA 3SR1A 3BYYB 2A74C 1D2BA 1J9OA 2SEBD 5COYA 2EYJA 5EGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J1M A;  2F0N A;  3P1H A;  4KD4 A;  2PW7 A;  1TR5 A;  2F0I A;  3TP8 A;  3H6M A;  1EYD A;  3V2T A;  5KYL A;  3BDL A;  4R8N A;  1F2Y A;  5I6W A;  1A3V A;  5C3W A;  3SK6 A;  3C1F A;  5CV4 A;  1JOQ A;  2F0S A;  5C5M A;  1U9R A;  3MEH A;  4ME5 A;  2SNS A;  4K8I A;  3S9W A;  1IHZ A;  5EKK A;  1SYD A;  5CV8 A;  1NSN S;  4RKB A;  1KDC A;  4KTA A;  1A3U A;  2F3W A;  3QOJ A;  1EY0 A;  5KYI A;  3D6C A;  4KY7 A;  1AEX A;  1RKN A;  3EJI A;  4PMC A;  1F2Z A;  5CV7 A;  5IOC A;  5M9O A;  1ENC A;  3LX0 A;  1ENA A;  4G57 A;  5J39 A;  4DFA A;  3MZ5 A;  3DMU A;  5KRU A;  3TP7 A;  1SYE A;  2HQE A;  4NMZ A;  2F0E A;  3OMG A;  5C6A A;  1SYG A;  3DHQ A;  5JOB A;  2LKV A;  3EVQ A;  3SK8 A;  2F0T A;  4RKL A;  1SNQ A;  1KDB A;  2SOB A;  3RUZ A;  1SYB A;  4WRD A;  3MHB A;  2F0M A;  3E5S A;  1EY9 A;  4I65 A;  4TRD A;  4DGZ A;  2EY1 A;  3OSO A;  3D4W A;  4YIJ A;  5KIX A;  2F0D A;  2RKS A;  3SXH A;  1SYC A;  1JOO A;  2F0Q A;  2RDF A;  2ENB A;  1STG A;  2F0O A;  1EYA A;  5E3F A;  4KJO A;  4B9X A;  1SND A;  5EKL A;  1SYF A;  1STY A;  4K5V A;  2F0P A;  2KHS A;  3SK5 A;  4S3S A;  3MVV A;  1SNP A;  1STN A;  1TT2 A;  5JAV A;  4ZUI A;  2EYL A;  1SNO A;  4KHV A;  4NKL A;  5CV9 A;  5KGU A;  4HMI A;  3D8G A;  4ODG A;  5C3X A;  3QB3 A;  5I6Y A;  2F0K A;  4F7X A;  4LAA A;  5K5P A;  1EY6 A;  5CGK A;  4NDX A;  3P75 A;  3SHL A;  4KV6 A;  1KDA A;  1EYC A;  3QOL A;  5IIF A;  5C4Z A;  2EY5 A;  4MIU A;  4QB4 A;  3C1E A;  5CV6 A;  2PQE A;  2PYK A;  4IUN A;  4F8M A;  1NUC A;  2EYM A;  2F0W A;  4K5X A;  3HEJ A;  2EXZ A;  2OEO A;  2EY6 A;  2F0L A;  3T13 A;  4PNY A;  2WAC A;  2PW5 A;  1STB A;  3ERQ A;  2F0U A;  3NQT A;  3NK9 A;  5IGC A;  1EY7 A;  2OXP A;  4B9W A;  1TQO A;  4KY6 A;  5IGG A;  4WOR A;  2EYP A;  2EY2 A;  3ITP A;  2EYF A;  2PZT A;  3OWF A;  3MXP A;  4HTH A;  3OMC A;  4J6H A;  4OL7 A;  1EZ8 A;  2RBM A;  4QMG A;  4K5W A;  4EVO A;  1II3 A;  3U9O A;  5J22 A;  2F0H A;  3TP6 A;  5NUC A;  4KD3 A;  4EQN A;  5I9O A;  2O4X A;  5F2D A;  4EQP A;  5HGT A;  5HUR A;  3NP8 A;  1EY5 A;  2SNM A;  4EQO A;  1KAA A;  4PMB A;  3ERO A;  3NXW A;  2OF1 A;  3TP5 A;  5DEH A;  3R3O A;  4DF7 A;  2F0V A;  4KY5 A;  2PZW A;  2KQ3 A;  5IGE A;  2PZU A;  3D4D A;  2EYH A;  3TME A;  1F2M A;  2NUC A;  2M00 A;  4ZQ3 A;  4H7B A;  4IZ8 A;  5C4H A;  5ISR A;  5CC4 A;  1EY8 A;  5IGD A;  5IOD A;  4E6I A;  1STA A;  4K6D A;  4IAL A;  4KJN A;  4NP5 A;  1A3T A;  4DU9 A;  1KAB A;  3SK4 A;  5I9P A;  5IGF A;  1EY4 A;  5KEE A;  5IGB A;  5J1Z A;  1A2T A;  1A2U A;  5CR3 A;  4ZUJ A;  1JOR A;  3VA5 A;  4N9T A;  4QF4 A;  1JOK A;  2F0F A;  3BDC A;  2EYO A;  3PMF A;  4HMJ A;  4K2L A;  5E1F A;  1EZ6 A;  5C5L A;  1SNM A;  2F3V A;  2QDB A;  4K14 A;  4N9P A;  3SR1 A;  4ID6 A;  1SNC A;  4K2K A;  4K8J A;  5DAU A;  2F0G A;  1EQV A;  3NHH A;  1STH A;  2EYJ A;  3HZX A;  3T16 A;  2F0J A;  5EGT A;  3NUC A;  5CV5 A; 
#chains in the Genus database with same CATH topology
 5C4X G;  2R7F A;  3I73 A;  1WTO A;  3H6M A;  1RTN A;  3E6Z X;  4FP5 D;  1F2Y A;  1KRS A;  2R93 B;  5C3W A;  1EIF A;  4YHH Q;  4DN4 M;  5AFW A;  3M9B A;  4FF2 A;  4G4K A;  5DM7 3;  2EOT A;  1JJC B;  4JBW A;  1X6O A;  4L5T A;  5M5X B;  2J0T D;  4JI2 Q;  3ICE A;  3WOF A;  2YYZ A;  2HQE A;  1GD7 A;  3OOC A;  2F0E A;  5EKI A;  2JA7 H;  3DHQ A;  3DEO A;  1I50 B;  4HIK A;  1G6Z A;  4CJ0 B;  5ELN A;  4RG1 A;  5D3D A;  3ERS X;  4B3M L;  4OIK A;  3J80 c;  1GJX A;  4FF3 A;  1QNU A;  4EQ5 A;  4IUT A;  2HIX A;  1HJP A;  1UE6 A;  4BBS B;  2K33 A;  4FXG C;  4OIJ A;  2XRS D;  4O0A A;  3NTI A;  5IT9 L;  4FDB A;  2EYL A;  4KHV A;  2XGT A;  5I6Y A;  3BZD B;  4IFD G;  4A75 A;  3MXN A;  2H4O A;  3SHL A;  4GKJ L;  1EYC A;  1TWA B;  3HG9 A;  4BS9 A;  2L55 A;  2PYK A;  4F8M A;  3FPU B;  1FNV A;  3J81 j;  2A6H C;  3CQZ B;  3UE1 A;  4C1N K;  2F3I A;  3S9W A;  1VQO A;  1A6X A;  1X54 A;  3PUW A;  2L15 A;  3BU2 A;  1MI2 A;  4ZKB B;  4JI4 L;  3L9A X;  3RZO B;  4GS3 A;  4ULL A;  2R7Z H;  3VYS A;  1CT1 D;  1CA5 A;  1HNX L;  5EAY A;  4JYA Q;  3S1N H;  1ZYR D;  1YHB A;  4XDX A;  4YWK A;  3AFQ A;  2PZW A;  4L5Q A;  4X62 Q;  3BVZ A;  1EQQ A;  3M4O B;  4AYB B;  3IFD A;  2OTL A;  2ZXO A;  2PI2 E;  1TY2 A;  1X65 A;  2PQA A;  2H1E A;  2JA8 B;  1KAW A;  1YVC A;  3R8B A;  1ASZ A;  2X69 A;  5ELF A;  1DOL A;  1Y1V H;  3GTM B;  4DR3 L;  2IJ0 A;  2QKI C;  3VDY A;  4A3K B;  3TZD A;  4DV2 L;  1TS4 A;  4ID6 A;  1PH3 A;  2IHE A;  1SRO A;  2KEE A;  2Y0S G;  1N33 Q;  3BG3 A;  1EU3 A;  2F0J A;  5FOB B;  5G3L F;  1YHA A;  2X6G A;  4MN3 A;  1WVL A;  3FKI G;  5FJ8 H;  1OXS C;  2MNA A;  1Y14 B;  1UWV A;  1LUZ A;  3U4V A;  1TWG B;  2LXK A;  3EJI A;  4GOP A;  1F2Z A;  2BE5 D;  4CDC C;  2LFN A;  4G57 A;  1ET9 A;  1BKB A;  4MTK A;  3PV0 A;  3OMG A;  2L11 A;  3J80 i;  4OO1 H;  4X65 Q;  4R1J A;  2CW0 D;  2FMM A;  1SEB D;  3BDO A;  4DR5 Q;  1S4Z A;  3HKZ G;  1PH9 A;  1S72 A;  4A3I H;  3D4W A;  5E7N A;  3UDG A;  5KIX A;  1QE6 A;  2FMC A;  3OWE B;  5D3I B;  4X64 L;  1WTW A;  1XMQ Q;  1VQI A;  2CWA A;  4JI6 Q;  3HOV H;  4L63 B;  1SYF A;  3PSI A;  4CKC A;  4DR6 Q;  3HOW H;  2VXW A;  3B6Y A;  1F9Q A;  2B63 B;  3F8T A;  4DKA C;  3U50 C;  2NZH A;  5ELB A;  4GLX A;  4NDX A;  1WD0 A;  2CFM A;  4C3J B;  4ZK9 B;  4XTC S;  3HOX B;  2EY5 A;  4I7A A;  5FO9 B;  3H3V H;  2B3G A;  4UP7 A;  3Q8D A;  2FHT A;  4KY6 A;  1MD2 D;  1GOZ A;  1SFO B;  1XNQ L;  4I7Z C;  5FK9 C;  3KBG A;  4A3M H;  3C3L A;  4UDU C;  2VY3 A;  2OT2 A;  3WOE A;  1YJN A;  1O80 A;  4KMU C;  3K80 C;  1KC8 C;  1OXU A;  1OXV A;  4FXK C;  1Y69 U;  3E3X A;  1CQV A;  3FDT A;  4DF7 A;  2HDL A;  4A3D B;  1BCP C;  4QUC A;  1PZI D;  2L9H A;  4AH6 A;  1IYU A;  1J5E L;  3I7F A;  4K6D A;  1U4M A;  3CRK C;  3STB D;  1H9S A;  2D0P A;  3H94 A;  1SLJ A;  2NVT B;  1I94 L;  2KHI A;  4XIG S;  4ZUJ A;  1KNA A;  5M5W H;  1HUM A;  1PDQ A;  1LYL A;  1BUV T;  1IBM Q;  2NB0 A;  3FEW X;  3F1Z A;  4HN7 A;  1HQM C;  3I56 A;  3HZX A;  2YTV A;  5ELD A;  2Q2H A;  2YU9 B;  1LT4 D;  2R7D A;  2RCF A;  5IYB G;  2EJM A;  5I6W A;  3Q24 A;  2QF7 A;  2I0Q A;  3HRZ C;  4BY7 H;  3R2I A;  2RDH A;  4LUO A;  5L37 A;  3M7N A;  1HNW L;  1VQP A;  1VQ6 A;  2B2T C;  2CQO A;  1V1O A;  3I4M B;  2Z6K C;  3ZYY X;  4RHS A;  3PO3 B;  2OCE A;  1BOS A;  1NNX A;  4C2M B;  3S2H B;  4ZYS A;  5FO8 B;  3BJU A;  3A8K E;  4R8I A;  3UDF A;  4I65 A;  1MJE A;  4DGZ A;  2NVX B;  3W5O A;  5M5X H;  4QUF A;  1D1K A;  2RHS B;  4RWS C;  2MFI A;  2ZT9 C;  3TEH B;  4KKT A;  1Y1W B;  4L5R C;  4S3S A;  4A3C G;  1I50 H;  3RLF A;  3H0G B;  1VMC A;  3D8G A;  4DXF A;  2KCN A;  1UNS A;  1TWF B;  3AU7 A;  4JI8 L;  2A73 B;  4HIM A;  2IY5 B;  3VR2 A;  2AUJ D;  4LW1 A;  1PZJ D;  1PFS A;  3L7Z C;  2M9V A;  3BVG A;  4BBS H;  1GO3 E;  5C3E G;  3G6E A;  1MJC A;  3AFP A;  4PNY A;  4LF4 Q;  1NAP A;  2X6L A;  2JN4 A;  4JI1 L;  1Y8N B;  1F9S A;  1KRT A;  2PZT A;  3RD4 A;  3PF4 A;  3OMC A;  4GN5 A;  4KKU A;  2QEX A;  1TWA H;  1JC7 A;  1IBL L;  1ICW A;  3HOZ B;  2R92 H;  1ESF A;  2PNH A;  1RD9 D;  2FXQ A;  1IKM A;  4ZAI A;  2Q2U A;  5IYC G;  3VR4 A;  1MHW C;  3CQZ H;  2K7V A;  1KTK A;  2RA4 A;  4JV5 Q;  4UY8 C;  3RZO H;  5BR8 Q;  1VDZ A;  5IE8 A;  3J81 E;  2ZXP A;  3DM3 A;  1S5C D;  1QNK A;  1F9R A;  1JOK A;  4TQU S;  3PMF A;  2F3V A;  4BXX H;  3K57 A;  1K8G A;  1E7Z A;  2N3S A;  5M3F G;  1QB5 D;  4K2K A;  2FJ2 A;  4K8J A;  2F0G A;  1Z6H A;  3L0O A;  3M4O H;  1C8C A;  1V43 A;  1TII D;  4J1M A;  4OEM B;  3NWS A;  2JA8 H;  4FYD A;  4QIW E;  2QA4 A;  2HHH L;  3GTQ B;  1PTO C;  4V0B A;  3GTJ B;  1JOQ A;  4DPG A;  4RA8 A;  4EGV A;  3PIP 3;  4A3K H;  3MWY W;  1MIU A;  4U68 A;  3CCQ A;  5IOC A;  4JI7 Q;  1ENC A;  4LFA Q;  4YWM A;  1SN8 A;  4JI5 Q;  1MSG A;  3CME A;  3MXU A;  5I2Y A;  1RDP D;  2KCT A;  2CQA A;  1X3F A;  4C3I H;  5IY0 A;  3FPP A;  5IWA L;  5CYU A;  4LF7 L;  1K73 C;  4CDD C;  4OXP A;  5ELO A;  4CJ1 B;  1B50 A;  1TWG H;  1IW7 C;  4OWW B;  3KJP A;  1I4G A;  1O78 A;  1EYA A;  2DNE A;  1U5K A;  3MVV A;  3HOU H;  3I4N B;  2F0K A;  1LTL A;  4BA1 I;  3CF5 A;  1PFB A;  1WI5 A;  2I5H A;  1P16 A;  1TWC B;  1QVG A;  5EJW A;  1SBB B;  1NR4 A;  4XQQ A;  4A3G G;  4G7H C;  3S17 B;  4LNQ A;  1SE3 A;  4B3S L;  2AUK A;  1XTD A;  4JI0 L;  1PYS B;  2NVY H;  1A0I A;  1EYG A;  2XSC A;  4H44 C;  4C3J H;  4P72 A;  1I5F A;  1JJ2 A;  5I9O A;  1HHV A;  2IX1 A;  4A3F H;  5EBC A;  1AZP A;  4NW2 A;  2F4I A;  1DOK A;  1PH4 A;  3HS0 C;  3S16 B;  4B3T Q;  2QIL A;  5C0X J;  4DUY L;  2WAQ G;  1SFO H;  1V1P B;  3S1N B;  5C4H A;  2OQ0 A;  1UUP A;  4OX9 Q;  1JWM D;  4Y7N B;  5T1I A;  2Y0S E;  1A2T A;  1A2U A;  1SMY D;  2E5L L;  1GM5 A;  2E2J B;  5GAG C;  4C3H B;  4A3L H;  4DK0 A;  4A3D H;  3P20 A;  4IJH A;  2G9H D;  1LT3 D;  1Y1V B;  5EPK A;  4EX5 A;  3DWA A;  1NBW A;  1PMR A;  1UAP A;  1QOH A;  2HIV A;  2NVT H;  3OW2 A;  3TS2 A;  1Q1E A;  1V8Q A;  1OTC A;  3CPF A;  1JE5 A;  4QY7 A;  2JA5 B;  3D3R A;  5KYI A;  1LO5 D;  4MNO A;  1RKN A;  4PMC A;  1ASY A;  4OWT B;  4QIW B;  5FLX E;  4IO9 A;  4R4Q A;  2YU9 H;  2K5Q A;  2Q8T A;  2GA4 B;  3RUZ A;  3S15 B;  3AB9 A;  1I6H H;  3E5S A;  4GKJ Q;  2KCM A;  1JOO A;  2XTI A;  2RDF A;  1TKW B;  2B2T A;  1STG A;  2AWO A;  3T1H L;  2YTX A;  4DA2 A;  1WTP A;  2Z6K A;  1VQ4 A;  1S5B D;  4X6A H;  4A3I B;  3I4M H;  4KKS A;  4XXE A;  4HSV A;  3RLN A;  4DAY A;  4C2M H;  3S2H H;  1X32 A;  4JI4 Q;  4GNX B;  1YHQ A;  3AMU A;  3GTK B;  1M4V A;  2IX3 A;  5DLQ E;  3N6R A;  4KV6 A;  3QOL A;  5IYD G;  4DV6 L;  4FF1 A;  1HNX Q;  4J15 A;  3C1E A;  2XRQ D;  2HCC A;  1PYW D;  3VA7 A;  1Y1W H;  5I4D A;  1E1O A;  1BBW A;  1K8M A;  5C0X I;  1S40 A;  4GKK L;  3D6W A;  2A1A A;  4P75 A;  5FO7 B;  3GTG B;  5C44 G;  2VNU D;  1TWF H;  3GQB A;  1P8L A;  1M8A A;  2F0H A;  1CKN B;  1SJH D;  2A6H D;  3D4R A;  5EQ0 A;  4DR3 Q;  2OF1 A;  1Q12 A;  4RFB A;  4DV5 L;  4A3M B;  4RMF A;  2JA7 G;  4DV2 Q;  1VQJ A;  3H3V I;  1LTA D;  1K9M C;  5FLM G;  2VS1 A;  2NUC A;  1PHJ A;  2IWH A;  4H02 A;  3GTO B;  1YIJ A;  5LHY 1;  3HGB A;  1AE3 A;  1A62 A;  2BDN A;  1STA A;  2EQS A;  4NP5 A;  3NSW A;  4DU9 A;  5KND A;  1YJW A;  2ZJQ A;  3HOZ H;  5JPM C;  5IGB A;  1BQQ T;  1DON A;  1E2W A;  1HCZ A;  4AIM A;  1SNM A;  4KI0 A;  1D5X C;  4CKE A;  4LF8 Q;  1BNZ A;  2Y0S B;  4JCV E;  3P1H A;  3BZK A;  2PW7 A;  4IPD A;  1XX8 A;  4NXN Q;  2B2V C;  2K14 A;  2KHJ A;  3SK6 A;  4IUV A;  4N8F A;  2Q8I B;  3FHW A;  1JE4 A;  1VF7 A;  3R2T A;  3W1B A;  2SNS A;  3E0J A;  3QO2 A;  2BOS A;  4FXD A;  3IKJ A;  1VQA A;  4X64 Q;  1XNR L;  2K5N A;  3ULP A;  1WCM G;  4LFC L;  2HT1 A;  1KHI A;  3EIV A;  2RVL A;  2MUY A;  1CK1 A;  1SYG A;  2R7Z G;  3GTQ H;  3EVQ A;  4B08 A;  3GTJ H;  1CZW A;  3SEB A;  2PCF B;  3LGJ A;  1SYB A;  3CCL A;  1DXM A;  1EWC A;  3CHB D;  1WTX A;  2ALY B;  4RH6 A;  1E24 A;  4CHT B;  1YJ9 A;  4KJO A;  1U4L A;  4FO2 A;  1IZ6 A;  1D5M C;  3J81 c;  2A5H A;  2KHS A;  1S5E D;  1SNP A;  1HZ9 A;  5GAD C;  1G8Z D;  1KL9 A;  4HMI A;  1XNQ Q;  3OW7 A;  4LAA A;  5K5P A;  1KD1 C;  1SE4 A;  2RSN A;  3PUZ A;  1B2T A;  4IPC A;  4G7O C;  4DR1 L;  4YCU A;  2Q2T A;  3ND8 A;  1QCB D;  2F0W A;  4IN3 A;  1LTT D;  3T13 A;  3TDQ A;  2QGQ A;  1E22 A;  3I4N H;  2RDG A;  4LF5 L;  5IGC A;  4U67 3;  4WOR A;  5FJ8 G;  1DM0 B;  2NBF A;  1SE2 A;  1J5E Q;  3KBX A;  2O5I C;  3HFZ B;  2RBM A;  4QGU A;  1PTO B;  5J22 A;  2K6A A;  1TWC H;  4KD3 A;  1LTI D;  3OYY A;  4LUV A;  5JEA J;  2VUM B;  1R9T H;  1I94 Q;  3KFU A;  1W6K A;  2NTS A;  3CCE A;  5LMN L;  2LMC B;  3I90 A;  1AE2 A;  4X66 L;  2SDF A;  5DEH A;  3S17 H;  3VR5 A;  2ZJP A;  4K0K L;  1DYQ A;  4FNF A;  3EBE A;  1IYV A;  1CSP A;  2R92 B;  2Z0S A;  3R93 A;  2R61 A;  4ZQ3 A;  4IZ8 A;  4KHZ A;  5ISR A;  4A3B G;  3X3M A;  5D65 A;  2NN6 H;  3CKI B;  5C0X G;  3HOV G;  1KIX A;  3S16 H;  1Q8I A;  5IP7 G;  4POF A;  3HOW G;  4GZY C;  2K5D A;  5K36 H;  3PIO A;  2UXC Q;  3OTO L;  4ZKC B;  1HNW Q;  3I3C A;  1XPO A;  3NUC A;  2XNA C;  1ILP A;  2DY8 A;  1HRJ A;  4MHE A;  3PQI A;  3X3N A;  1ICF B;  3EN2 A;  4Y7N H;  4UHV A;  4PZ8 A;  2B39 A;  1VQF A;  2LS0 1;  2E2J H;  5EKK A;  4C3H H;  4C56 C;  5GAE C;  2MPM A;  2F03 A;  3FVQ A;  5JJZ A;  3D6C A;  5H1S E;  1N32 L;  2K32 A;  1T9H A;  3ND9 A;  1GXD C;  1ENA A;  5J39 A;  3I91 A;  3MXN B;  2ZM6 L;  1PRT B;  1E2V A;  1KDB A;  4OHJ A;  1H9R A;  4WRD A;  1QUQ A;  1UE5 A;  1IBK L;  4DV7 L;  2JA5 H;  3J81 i;  3S14 B;  3J7A F;  2F0D A;  1D7Q A;  4C3I B;  2A6E C;  1WTV A;  2EIF A;  3SK5 A;  2AMC B;  4JI1 Q;  2K75 A;  5JAV A;  2E75 C;  3S15 H;  4XT3 B;  2V1C C;  3CCJ A;  2CVR A;  3MEF A;  1K8O A;  1EY6 A;  4M8A A;  3NWT A;  1IBL Q;  3IFT A;  2K04 A;  1L0X B;  4LWC A;  3HOU B;  5E4W C;  4B3R Q;  1FGU A;  5CV6 A;  4DV3 L;  4RCN A;  4QQB X;  3UDX A;  2PQA B;  5JPN C;  3K5L A;  3HOY B;  2F0U A;  1I3Q H;  3OIP A;  3KUP A;  4TVA B;  2TMP A;  2I5M X;  5IGG A;  3KLW A;  3OWF A;  1EQT A;  3GTK H;  4BY7 G;  4EVO A;  4IFD H;  1VQB A;  1WYD A;  4ALP A;  1TU2 B;  3KDF A;  2WAQ E;  1QUQ B;  3KF6 A;  3J81 L;  3DEP A;  2NVY B;  1WD1 A;  3GDE A;  5CBE E;  2R93 G;  5BN3 A;  4UP8 A;  3GTG H;  3D4D A;  4A3F B;  1VS0 A;  2ZTE A;  4BWG B;  4CKB A;  4F87 A;  4PG3 A;  4GOP B;  5IGF A;  2HHH Q;  1UE7 A;  5KEE A;  2JK8 A;  2QCP X;  4A3J B;  4HMJ A;  4DR4 L;  2JEA I;  5T1G A;  1F2L A;  3K5N A;  3BYT B;  3NTH A;  3PUY A;  5M3F B;  3GTO H;  3DWP A;  4HJ9 A;  2WB1 E;  1A63 A;  5EPL A;  1G51 A;  2KOL A;  4LF7 Q;  1KLG D;  1TWH B;  1ET6 A;  1H95 A;  4BBR B;  3I55 A;  2VQF L;  1VCI A;  4ABN A;  4IOC A;  1K83 B;  1STE A;  2K4K A;  3S1M B;  4M1U B;  1PTO D;  1DJR D;  2B2V A;  2A8V A;  4K6L A;  1SYE A;  1HFN A;  3HP3 A;  3BS1 A;  1HR0 L;  2E8G A;  1BDO A;  1SR3 A;  2CKZ B;  3TZU A;  1VF5 C;  2L4N A;  3G6J B;  1I6H B;  1ZXT A;  1ZYR C;  3T56 B;  4YY3 Q;  4XYQ A;  4X3S A;  1LT6 D;  3QIA A;  3RNU A;  1STN A;  1TT2 A;  1FNU A;  1XMO L;  1EOT A;  1L1O C;  3DXJ C;  1IW7 D;  4JI0 Q;  4BA2 I;  1K0R A;  4ODG A;  5C3X A;  4JBK A;  2G5D A;  4LMQ D;  4F7X A;  1Q7Y C;  1I4R A;  4BXX G;  2JJQ A;  2JYO A;  3MFG A;  2N55 A;  4IUP A;  3H3V C;  5LL6 X;  4AYB G;  1CM9 A;  1L0W A;  1NUC A;  4AQY L;  2EXD A;  1D5Z C;  2JA8 G;  1H9S B;  3NK9 A;  2XVS A;  3M7G A;  2OXP A;  4B9W A;  1BF4 A;  2E2H B;  2BCO A;  1GUW A;  1DOM A;  1X3Q A;  3K6O A;  3U58 A;  4QMG A;  4A3K G;  5JVH 3;  2VQE L;  2DY7 A;  1AP0 A;  4A4I A;  1LV9 A;  2EE1 A;  4XT1 B;  3PCO B;  4IQZ A;  4EQP A;  2RHQ B;  2UXD Q;  4X62 L;  2E5L Q;  3J7Y W;  1YNX A;  4P2C B;  3PO2 B;  3KOJ A;  1EIH A;  3F2B A;  1PRT D;  2HD3 A;  4DR2 Q;  2F0V A;  5M3M B;  1AH9 A;  5IGE A;  1FJG L;  2BE5 C;  2KCC A;  2IPK D;  5D14 A;  5JEA G;  1LTS D;  1PTO H;  1QWY A;  4O2D A;  1CSQ A;  1YZ6 A;  2MP1 A;  3GO5 A;  3K0Y A;  5CBA E;  2A68 C;  3CW2 C;  3SK4 A;  5LMU L;  2UUB L;  2VUM H;  2CW0 C;  1TVX A;  1ZEQ X;  4A3E G;  1H9M A;  3I8Z A;  4DUZ L;  3A8J E;  1Q90 A;  4RHR A;  2FIN B;  4KD4 A;  3S24 A;  5FLX L;  2LXJ A;  1ILQ A;  1WJJ A;  3A5Z B;  4FF4 A;  1HZA A;  3TS0 A;  2JSO A;  1NE3 A;  3J7A V;  1IHZ A;  1HA5 A;  3EFX D;  4BY1 B;  4A93 B;  1KDC A;  2WB1 B;  1ONL A;  2B63 G;  4R4T A;  3WDN A;  1JIC A;  2HDM A;  3I72 A;  3A54 A;  1A8V A;  1PA6 A;  5I2X A;  3IRB A;  4C3J G;  2L12 A;  1TS2 A;  3HOX G;  4HCS A;  4RKL A;  1XJV A;  1SNQ A;  5IYB H;  2XWB B;  1FGB D;  1CFM A;  4DV0 Q;  1PVO A;  1MBY A;  1Z7T A;  4R9W A;  1W3S A;  1GUT A;  4DV6 Q;  4DV1 L;  3K81 C;  4RGM A;  1YNJ D;  2F0O A;  4KK7 A;  4GLA C;  3L2P A;  1SND A;  3T51 B;  2MQH A;  4GKK Q;  3CPW A;  1VQH A;  4ZLT F;  5KGU A;  2ZTD A;  2UUA L;  3LWU A;  4DK1 A;  1Q46 A;  5JJK A;  5DM6 3;  4NXM L;  3ULL A;  3S14 H;  1EL0 A;  4A3L G;  2HUG A;  4HIO A;  4A3D G;  3G4S A;  3M3Y B;  2A69 D;  4PV1 C;  1E3P A;  1EQR A;  1HH2 P;  1T5X D;  3J80 E;  2PQE A;  2BDO A;  4DV5 Q;  2EXZ A;  1HPC A;  2K1B A;  1PRT F;  1SXT A;  4DNI A;  4OGQ C;  2E2I B;  1FNW A;  1EY7 A;  3NEL A;  4DNR B;  3C2P A;  2ES2 A;  2EYP A;  4JC0 A;  3ITP A;  1VQE A;  2IL8 A;  2J7Z A;  1V9P A;  5C44 B;  1SDF A;  2Q2I A;  5GQO A;  1ESR A;  2JXM B;  5HGQ A;  5JJI A;  5F2D A;  4O42 A;  1B70 B;  2MGS A;  2NZ1 D;  3NP8 A;  3H09 A;  3V05 A;  1IL2 A;  3CC4 A;  5IP9 H;  5KNC A;  1I4X A;  1CKM A;  3HOY H;  2PNR C;  1DZ1 A;  2UUC Q;  2RSO A;  1R9T B;  2JA6 G;  1O7Y A;  1EEF D;  2VB2 X;  1J8I A;  3K7A B;  4LF9 L;  4E6I A;  1D8L A;  2MO1 A;  1JWU D;  3L3O C;  4IAL A;  1KAB A;  1BXT A;  3D31 A;  5CR3 A;  3I4O A;  2JA9 A;  4HSP A;  2QDB A;  5IYC H;  1XNR Q;  3PO3 G;  3F2C A;  2QW7 A;  4LFC Q;  1NMG A;  2WKC A;  3FMC A;  1YNN D;  3NHH A;  1TY0 A;  1TS3 A;  1CZG A;  3NBI A;  2AWN A;  2F0I A;  1NY4 A;  2O2L D;  2GVB A;  1LM0 A;  3IAY A;  1N36 Q;  3NTK A;  1U9R A;  2AQ2 B;  4A3J H;  3F2D A;  4K8I A;  5GAH C;  3E9I A;  1X55 A;  4KN7 C;  3TSS A;  1CQF A;  5CV8 A;  1Y1W G;  4RKB A;  1PV4 A;  4KTA A;  1A3U A;  3H0G G;  1AFP A;  1NJI C;  1Q82 C;  5M3F H;  3LX0 A;  4PQX A;  1WCM B;  2F1M A;  4HJA A;  2DNC A;  2WV6 D;  1TWH H;  3VYU A;  1KXL A;  1HTL D;  4BBR H;  3A8I E;  1ENF A;  3PUX A;  3OSO A;  2UXB L;  1K83 H;  5C4X B;  4CGY B;  1M1K C;  4DR1 Q;  3S1M H;  5EBD A;  1JR0 D;  1T5E A;  4DAP A;  2CHB D;  1NTG A;  3CCR A;  4B3M Q;  3M4P A;  1N34 L;  3KF8 A;  3W2D A;  3HOZ G;  1O7Z A;  4DNT B;  4NKL A;  2LSS A;  5CV9 A;  3TQY A;  1QJO A;  1YEZ A;  1X56 A;  3HKZ E;  3P75 A;  3A7A B;  3RR5 A;  4LF4 L;  2CH4 W;  5C4Z A;  4WJ4 A;  3TN2 A;  2GN5 A;  1SE8 A;  1C48 A;  1B1Z A;  3NE5 B;  2BA0 A;  5LMN Q;  1L1O A;  4X66 Q;  4K0K Q;  1PYB A;  2XIW A;  1MKH A;  4J6H A;  2K01 A;  4F88 A;  1BCP B;  4ME3 A;  4EQN A;  1B9M A;  1I3Q B;  4X3T A;  5C4J B;  4LJZ C;  2K05 A;  2B29 A;  3PIO 3;  1HQR D;  1Q1B A;  2SNM A;  4OO1 I;  4ZCK A;  3GTP B;  4KHP L;  2E2H H;  3EQL C;  1MSH A;  3DWQ A;  1EIY B;  3OTO Q;  3LWE A;  2PMZ E;  1QG7 A;  3GD7 A;  1LT5 D;  5IOD A;  1OXX K;  3I70 A;  4KJN A;  2B2W C;  1M90 C;  2D9U A;  1YBY A;  1EY4 A;  3RLO A;  3A74 A;  2B2Y C;  4X3K A;  3PO2 H;  3SGI A;  1E1T A;  5JVG 3;  2IX0 A;  4IJL A;  5C5L A;  1B53 A;  4K14 A;  5M3M H;  1RCV D;  4DR7 L;  4X3U A;  3O13 A;  4DV4 L;  3CXC A;  2ZM6 Q;  1NMF A;  2BH8 A;  3MEH A;  1PH8 A;  1IBK Q;  4DV7 Q;  3GV6 A;  3EA6 A;  1XYI A;  4DAY B;  1AEX A;  1JQY D;  5LL6 S;  1EIG A;  4PZ7 A;  3UI2 A;  3TBI B;  1A15 A;  3SK8 A;  4GN4 B;  2SOB A;  1RIP A;  2YV5 A;  4BY1 H;  1L0Y B;  1AN8 A;  4A93 H;  2EY1 A;  3GV3 A;  2P5Z X;  3A56 A;  4YIJ A;  3J7Z C;  2CWP A;  4DV3 Q;  3FKI B;  1W2B A;  1HZB A;  2UU9 L;  3FRP B;  4ZUI A;  2CCZ A;  1SNO A;  5AJ3 L;  4WFN 3;  1FL0 A;  1HTP A;  4UP9 A;  4POG A;  4LF6 L;  1FD7 D;  3A0J A;  5FKA C;  1SMY C;  3K58 A;  4PZ6 A;  1X9N A;  1SRU A;  3GTL B;  1O7I A;  3ERQ A;  3HKZ B;  3RMH A;  1TQO A;  4JI3 L;  2L5T A;  3URY A;  4C3H G;  4JBM A;  3I2Z A;  3FP9 A;  5A2Q E;  2AQ3 B;  3M3Y H;  2EDG A;  1Y1V G;  1G2S A;  3S2D B;  1PFM A;  5LMN W;  4DR4 Q;  1Q8K A;  2A19 A;  3NXW A;  4G7Z C;  2ATW A;  2G9D A;  2E2I H;  5COR A;  2KQ3 A;  4WJ3 M;  4OX9 L;  1LTR D;  2BA1 A;  2D2C C;  4V19 0;  5C44 H;  1XPU A;  2JA5 G;  1EFW A;  1X3P A;  1L2F A;  3CCU A;  1A3T A;  4MTN A;  1TXY A;  1VQC A;  1EEI D;  1YIT A;  2ICE C;  5E1F A;  4DK6 C;  2VQF Q;  2LY7 A;  1BO0 A;  1EZ6 A;  5G3L D;  2PMZ B;  1BVS A;  4OON A;  2VL6 A;  4GLV B;  1FVI A;  5BN5 A;  3CU7 A;  5FLM H;  3K7A H;  4OO1 G;  1EYD A;  3I4L A;  2C35 B;  1HFG A;  1EUJ A;  1Y8O B;  2I07 B;  1HR0 Q;  4R4I A;  1D1I A;  3NPP A;  2F4V L;  2E74 C;  4Q0F A;  1ZKO A;  1CTM A;  3KK7 A;  3LNN A;  4A3I G;  4P73 A;  1NSN S;  2N49 A;  2WKD A;  1XXG A;  5M9O A;  3K7U C;  5ELC A;  1BCP D;  3DMU A;  5KRU A;  4APV A;  3ULJ A;  1XMO Q;  1CHP D;  3OIQ A;  1BBU A;  2L1B A;  4TRD A;  4ZRZ A;  5GRO A;  1O7L A;  2F0Q A;  3RN2 A;  1I4P A;  1PH5 A;  4B9X A;  1WCM H;  5E3F A;  4AQY Q;  3M4Q A;  3Q6S A;  2AHO B;  3UDI A;  4IUQ A;  1I4Q A;  1C0A A;  4A3M G;  3JAM E;  5E4X A;  2VQE Q;  1E0B A;  5C4X H;  1R4P B;  1OO9 B;  1KDA A;  1C4Q A;  3MA2 B;  1N8R C;  2Z4H A;  3CD6 A;  4QB4 A;  4HJ8 A;  2DJF C;  1ROD A;  4JI8 Q;  1JB3 A;  2EYM A;  1SSO A;  4L8J A;  4K5X A;  3NBH A;  4L6T B;  4LK1 C;  2PW5 A;  2MO0 A;  3NQT A;  1FJG Q;  3PF5 A;  3G7L A;  1VQK A;  2NTT A;  4HTH A;  4UAI A;  3RZD B;  1EZ8 A;  4K5W A;  1II3 A;  2N78 A;  3CAM A;  1JB7 A;  2UUB Q;  2K5V A;  5LMU Q;  3AYH B;  1KAA A;  2N8N A;  1E2Z A;  4Y52 H;  3TP5 A;  4JK1 C;  1F77 A;  4HAE A;  1I4H A;  2WP8 J;  3E9H A;  4DUZ Q;  1VQL A;  3KLS A;  2YTY A;  1VQ8 A;  2EYH A;  5TSS A;  4IUU A;  3T1Y L;  3NEM A;  1AW7 A;  3NEN A;  4QCL A;  1EY8 A;  5IGD A;  4KLK A;  5C4J H;  3MXG A;  1PZK D;  5C3E B;  4OEL B;  4IPG A;  4RGN A;  3CCV A;  4LF8 L;  4K2L A;  3A5U A;  3GTP H;  2O5J C;  2ZXR A;  5BN4 A;  3PUV A;  5FLX c;  4NXN L;  1AZQ A;  5DAU A;  4A3E B;  1JCK B;  1EQV A;  4HJ7 A;  2A68 D;  1STH A;  4Z9C B;  1HNZ L;  2B2W A;  2K52 A;  2KVM A;  1BCP F;  1J6Q A;  3NBH B;  1X3G A;  3V2T A;  4A3B H;  2RQX A;  1UE1 A;  2B2Y A;  3AEV A;  3MAQ A;  2CH4 A;  1B3Q A;  4ME5 A;  5C0X H;  5ELE A;  3SDZ A;  4JPB W;  4CJ2 C;  2NVQ H;  1QZH A;  1PXU A;  5IP7 H;  2K28 A;  4LFB L;  4KY7 A;  4DV1 Q;  2Z1C A;  2KUM A;  1K3R A;  4DFA A;  2NZO A;  1K8A C;  1VQ7 A;  4P71 A;  5JOB A;  1CHQ D;  4HR7 B;  2F0T A;  1HR0 W;  2JEB I;  1U4P A;  2PI2 A;  2UUA Q;  4YHH L;  3CC2 A;  2TSS A;  1SMX A;  5EPJ A;  1EY9 A;  4NXM Q;  1CI3 M;  1V1Q A;  5IWA Q;  3S1R B;  2KEN A;  3SXH A;  2ZTC A;  1RTO A;  1F9P A;  3HKS A;  3ZJY C;  3S1Q B;  4BBS G;  1RL2 A;  2B8F A;  3J80 L;  1D6E C;  4JI2 L;  2EPB A;  4PMW A;  2F0P A;  2KED A;  2OWO A;  2MJ8 A;  3BZC A;  1Z47 A;  3KDF B;  3P7J A;  3KF6 B;  1U0L A;  2VUM G;  3T4A C;  3NQI A;  3KJO A;  1GHK A;  3K5O A;  2WII B;  2R92 G;  3FKI H;  5M5Y B;  3HEJ A;  5IT9 E;  1EWH A;  4RCO A;  5HY6 A;  2QDL A;  2NWG A;  2GVA A;  2Z4I A;  3QG1 A;  3VR6 A;  3Q22 A;  1K3B C;  4GNX C;  2Q8R E;  2EYF A;  1EU4 A;  2EZV A;  3MFY A;  1VQD A;  3A7L A;  1CUK A;  3UE0 A;  4LF9 Q;  2Z9H A;  2IW3 A;  4B3S Q;  1NCV A;  1VQM A;  3N52 A;  2C5C A;  2EJF C;  4RGT A;  4PMB A;  3V96 A;  3GTL H;  2F52 A;  3R3O A;  4KY5 A;  1B7Y B;  4QJF A;  3TME A;  4JOI C;  1F2M A;  3Q23 A;  2XN9 C;  1BBX C;  4H7B A;  4NPS A;  2ID0 A;  2JA6 B;  1XWE A;  3CP0 A;  4A3G B;  5I9P A;  1W6J A;  4DUY Q;  2UXC L;  3S2D H;  1JWS D;  4JYA L;  4QF4 A;  4JW0 A;  1CKO A;  2F0F A;  4N9P A;  2HQL A;  2R93 H;  1KNE A;  4DAM A;  1SJE D;  1UEA B;  4TKO B;  2K50 A;  2B2U C;  2NYZ D;  3K0X A;  2F0N A;  3DLL A;  1LTG D;  3PGZ A;  3K59 A;  4C3I G;  2DJG C;  2C9O A;  2K5W A;  2PPB C;  4C1N I;  1WTR A;  3C1F A;  2F0S A;  5C5M A;  2OQK A;  2WAQ B;  2IT1 A;  2Z6B A;  4H13 C;  1GUN A;  1ML0 D;  2AKW B;  2UXB Q;  2F3W A;  1EY0 A;  2B8G A;  3IL8 A;  3M85 A;  1DCZ A;  1N33 L;  1PH7 A;  3J7A 5;  1N34 Q;  1GHJ A;  1B9N A;  3HOU G;  4NMZ A;  5C6A A;  2ZJR A;  2J4X A;  1Q86 C;  4P74 A;  1PTO F;  5IP9 G;  2F0M A;  3SE0 A;  3HOY G;  2RKS A;  1MGS A;  2I5L X;  3DUZ A;  4NB3 A;  2E76 C;  1STY A;  4IOA A;  1TS5 A;  1GUO A;  4X65 L;  4H0L C;  3T1H Q;  4B3R L;  3QB3 A;  1KLU D;  3CRL C;  1WTQ A;  1B8A A;  4DK3 C;  4DR5 L;  3K5M A;  1R4Q B;  2KEC A;  5KNB A;  1IKL A;  4A3F G;  1XMQ L;  4MIU A;  1IXR A;  4IUN A;  4JI6 L;  1QZG A;  2K03 A;  4KHP Q;  2KA7 A;  1STB A;  4TSS A;  4YCW A;  3CMA A;  4DR6 L;  2M2L A;  4CDF C;  2DGY A;  4A3J G;  1UEB A;  2L0C A;  3U9O A;  2PO4 A;  2N88 A;  3QJY A;  4O1N A;  2RF4 A;  1LLR D;  4JBJ A;  1EY5 A;  4EQO A;  3A55 A;  3ERO A;  3STB C;  1S3O A;  3CCM A;  4HED A;  2D0O A;  4DR7 Q;  2PZU A;  2FFK B;  1VQN A;  4BBR G;  3RZD H;  1EOV A;  4DV4 Q;  3GTM H;  3TRE A;  1JJG A;  4ILW A;  5CC4 A;  1HUN A;  3U4Z A;  4A3C H;  3VYT A;  1VMP A;  4IUR A;  1VQ5 A;  3TRZ A;  3DM1 A;  3G71 A;  3VA5 A;  5CGK A;  4A76 A;  3BDC A;  1NR2 A;  2EVB A;  3JAM c;  3T16 A;  4CBV A;  3F2U A;  5CV5 A;  5JEA H;  2D62 A;  1TR5 A;  4RAU C;  5CMD A;  5C3E H;  5KYL A;  3BDL A;  4R8N A;  1PH1 A;  3KLS X;  2JA7 B;  1RF2 D;  1A3V A;  2IHF A;  4FVM A;  2OTJ A;  1N9W A;  1LAC A;  1H9J A;  1V1P A;  1RHP A;  2ASB A;  3QOJ A;  1IBM L;  3AQQ A;  4A3E H;  3CC7 A;  1B4O A;  3KYH C;  2UU9 Q;  3K8A A;  3VYR A;  3MZ5 A;  2MHV A;  1C7Y A;  3TP7 A;  3I4M G;  3QR8 A;  5AJ3 Q;  1H9K A;  3MHB A;  4LF6 Q;  1GKH A;  4YY3 L;  4GN3 B;  1XPR A;  4UPA A;  2D5D A;  4L5S A;  2B63 H;  1SYC A;  4WJW A;  4IFD J;  3M4Y A;  1PRT C;  2NN6 I;  4K5V A;  4R4O A;  2JP1 A;  4XYO A;  1LAB A;  3HOX H;  1FR3 A;  4JI3 Q;  3PO2 G;  4KN4 C;  4J8Q A;  5M3M G;  3S1R H;  2V4D A;  5IIF A;  2HCI A;  5A2Q L;  2R7Z B;  3RN5 A;  3S1Q H;  2RCN A;  3H15 A;  4HJ5 A;  2EY6 A;  2F0L A;  2AQ1 B;  2KJX A;  1RJT A;  1SAP A;  3H91 A;  2R6G A;  2EJG C;  1WFQ A;  1U4R A;  2UXD L;  2EY2 A;  3MXP A;  4OL7 A;  5JJL A;  4DAV A;  1HA6 A;  3CCS A;  4LF5 Q;  4DR2 L;  5NUC A;  3U9S A;  1GUS A;  5M5Y H;  5HGT A;  4XQN A;  1S5D D;  1YI2 A;  1EWI A;  4JG2 A;  2JQO A;  3E0E A;  4GNX A;  2XWJ B;  3GP7 A;  4BY1 G;  3C46 A;  4A93 G;  2WB1 G;  1OXT A;  1GUG A;  3ER0 A;  2F4V Q;  3JAM i;  3MTS A;  1JOR A;  4LUZ A;  1DGS A;  4N9T A;  1JMC A;  2EYO A;  4JOI A;  2WFW A;  1SNC A;  3OHX C;  1Y8P B;  1YNJ C;  1CKN A;  1G29 1;  4JV5 L;  2JA6 H;  4GOP C;  3SVM A;  3TP8 A;  4A3G H;  4YCV A;  5BR8 L;  1PH2 A;  5CV4 A;  3MC0 B;  5IT9 c;  1DD2 A;  3D0F A;  1CA6 A;  1VQ9 A;  3KF8 B;  1SYD A;  2KBN A;  1X3E A;  2A69 C;  1IYJ B;  4A3B B;  4IPH A;  1G2T A;  2B2U A;  3PO3 H;  1B3A A;  5CV7 A;  1FYC A;  4IFD I;  2VB3 X;  3T53 B;  3HOV B;  4DV0 L;  1C9O A;  2NVQ B;  1HZC A;  3WWV A;  2NVX H;  1N32 Q;  2LKV A;  3HOW B;  1Q3L A;  1I6V C;  1L1O B;  2VW9 A;  1PLF A;  2WIN B;  4OWX B;  4QL5 A;  3JAM L;  3OPO A;  2Z8L A;  4RGO S;  4DXG A;  3JC6 6;  3H0G H;  2DUD A;  2ENB A;  4JI7 L;  1K0S A;  1PFN A;  3PIP A;  1HXY D;  1JT8 A;  4LFA L;  5EKL A;  2VZA A;  3I4N G;  4JI5 L;  1LTB D;  1S5F D;  1QVF A;  1EFI D;  1WTH A;  5A35 A;  1B44 D;  3G48 A;  3KLR A;  1WOC A;  4CDE C;  1G91 A;  1GVP A;  2OEO A;  2BH2 A;  1G6P A;  4HCE A;  2WAC A;  2E2D C;  1QVC A;  1YNN C;  3T1Y Q;  4N8X 1;  1Q81 C;  4R4C A;  4XQJ A;  3TP6 A;  2NN6 G;  2O4X A;  5J3B A;  4AYB E;  5HUR A;  2A6E D;  2DN8 A;  2QEJ C;  2UUC L;  1BR9 A;  1IL8 A;  5M5W B;  2ICI A;  1KQS A;  5K36 G;  1K28 A;  3W3A A;  1VQG A;  3W1G A;  1PH6 A;  3QWN A;  1QIL A;  2M00 A;  1HNZ Q;  2H5X A;  2R3Z A;  4HID A;  4Q5V A;  1XTC D;  3Q0A A;  3VR3 A;  5J1Z A;  3BVM A;  4JVZ A;  2JE6 I;  1Z9F A;  3ONA B;  4BY7 B;  2I46 A;  5DNF A;  3SR1 A;  4LFB Q;  4B3T L;  3BYY B;  5IYD H;  2A74 C;  1D2B A;  1J9O A;  2SEB D;  4YWL A;  5COY A;  2EYJ A;  4MZ9 A;  1N36 L;  5EGT A;  2K5H A; 
#chains in the Genus database with same CATH homology
 3I73 A;  1WTO A;  3H6M A;  1RTN A;  3E6Z X;  4FP5 D;  1F2Y A;  2R93 B;  5C3W A;  4DN4 M;  5AFW A;  4FF2 A;  4G4K A;  5DM7 3;  2EOT A;  4JBW A;  5M5X B;  2J0T D;  3WOF A;  2YYZ A;  2HQE A;  3OOC A;  2F0E A;  5EKI A;  3DHQ A;  3DEO A;  1I50 B;  1G6Z A;  4CJ0 B;  5D3D A;  4OIK A;  1GJX A;  4FF3 A;  1QNU A;  4IUT A;  4BBS B;  2K33 A;  4FXG C;  4OIJ A;  2XRS D;  3NTI A;  5IT9 L;  2EYL A;  4KHV A;  5I6Y A;  3BZD B;  4IFD G;  3MXN A;  2H4O A;  3SHL A;  1EYC A;  1TWA B;  3HG9 A;  4BS9 A;  2L55 A;  2PYK A;  4F8M A;  3FPU B;  1FNV A;  2A6H C;  3CQZ B;  4C1N K;  3S9W A;  1A6X A;  3PUW A;  1MI2 A;  4ZKB B;  3RZO B;  3L9A X;  4ULL A;  3VYS A;  1CT1 D;  1CA5 A;  1ZYR D;  4XDX A;  2PZW A;  3BVZ A;  3M4O B;  4AYB B;  3IFD A;  2ZXO A;  1TY2 A;  2H1E A;  2JA8 B;  3R8B A;  2X69 A;  5ELF A;  1DOL A;  3GTM B;  2IJ0 A;  2QKI C;  4A3K B;  3TZD A;  1TS4 A;  4ID6 A;  2KEE A;  3BG3 A;  1EU3 A;  2F0J A;  5FOB B;  5G3L F;  2X6G A;  4MN3 A;  1WVL A;  1OXS C;  1TWG B;  3EJI A;  1F2Z A;  2BE5 D;  2LFN A;  4G57 A;  1ET9 A;  3PV0 A;  3OMG A;  2L11 A;  4OO1 H;  2CW0 D;  2FMM A;  1SEB D;  3BDO A;  1S4Z A;  3D4W A;  5KIX A;  1QE6 A;  2FMC A;  3OWE B;  5D3I B;  1WTW A;  4L63 B;  1SYF A;  4CKC A;  2VXW A;  1F9Q A;  2B63 B;  5ELB A;  4NDX A;  1WD0 A;  4C3J B;  4ZK9 B;  4XTC S;  3HOX B;  2EY5 A;  5FO9 B;  2FHT A;  4KY6 A;  1MD2 D;  1GOZ A;  1SFO B;  4I7Z C;  5FK9 C;  3KBG A;  3C3L A;  4UDU C;  2OT2 A;  3WOE A;  1O80 A;  4KMU C;  1OXU A;  1OXV A;  4FXK C;  1Y69 U;  1CQV A;  3FDT A;  4DF7 A;  2HDL A;  4A3D B;  1BCP C;  4QUC A;  1PZI D;  2L9H A;  1IYU A;  4K6D A;  1U4M A;  3CRK C;  1H9S A;  3H94 A;  2NVT B;  4XIG S;  4ZUJ A;  1KNA A;  1HUM A;  1PDQ A;  1BUV T;  2NB0 A;  3FEW X;  4HN7 A;  1HQM C;  3HZX A;  5ELD A;  2YU9 B;  1LT4 D;  2EJM A;  5I6W A;  3Q24 A;  2QF7 A;  3HRZ C;  3R2I A;  2RDH A;  3M7N A;  2B2T C;  1V1O A;  3I4M B;  3ZYY X;  4RHS A;  3PO3 B;  1BOS A;  4C2M B;  3S2H B;  4ZYS A;  5FO8 B;  3A8K E;  4R8I A;  4I65 A;  4DGZ A;  2NVX B;  4QUF A;  1D1K A;  4RWS C;  2ZT9 C;  4KKT A;  1Y1W B;  4S3S A;  3RLF A;  3H0G B;  1VMC A;  3D8G A;  4DXF A;  2KCN A;  1UNS A;  1TWF B;  3AU7 A;  2A73 B;  3VR2 A;  2AUJ D;  1PZJ D;  3L7Z C;  2M9V A;  3BVG A;  4PNY A;  1NAP A;  2X6L A;  1Y8N B;  1F9S A;  2PZT A;  3RD4 A;  3OMC A;  4KKU A;  1JC7 A;  1ICW A;  3HOZ B;  1ESF A;  1RD9 D;  1IKM A;  4ZAI A;  3VR4 A;  2K7V A;  1KTK A;  2RA4 A;  1VDZ A;  3J81 E;  2ZXP A;  1S5C D;  1QNK A;  1F9R A;  1JOK A;  4TQU S;  3PMF A;  2F3V A;  3K57 A;  1QB5 D;  4K2K A;  2FJ2 A;  4K8J A;  2F0G A;  1Z6H A;  1C8C A;  1V43 A;  1TII D;  4J1M A;  3NWS A;  4FYD A;  3GTQ B;  1PTO C;  4V0B A;  3GTJ B;  1JOQ A;  4RA8 A;  4EGV A;  3PIP 3;  3MWY W;  4U68 A;  5IOC A;  1ENC A;  1MSG A;  3MXU A;  5I2Y A;  1RDP D;  2CQA A;  3FPP A;  5CYU A;  4CJ1 B;  1B50 A;  1IW7 C;  1I4G A;  1O78 A;  1EYA A;  2DNE A;  3MVV A;  3I4N B;  2F0K A;  4BA1 I;  1PFB A;  1TWC B;  5EJW A;  1SBB B;  1NR4 A;  4XQQ A;  4G7H C;  3S17 B;  1SE3 A;  2AUK A;  2XSC A;  4H44 C;  5I9O A;  1HHV A;  2IX1 A;  5EBC A;  1AZP A;  4NW2 A;  2F4I A;  1DOK A;  3HS0 C;  3S16 B;  2QIL A;  5C0X J;  1V1P B;  3S1N B;  5C4H A;  1UUP A;  1JWM D;  4Y7N B;  5T1I A;  1A2T A;  1A2U A;  1SMY D;  2E2J B;  4C3H B;  4DK0 A;  3P20 A;  2G9H D;  1LT3 D;  5EPK A;  1Y1V B;  3DWA A;  1PMR A;  1UAP A;  1QOH A;  1Q1E A;  1V8Q A;  2JA5 B;  3D3R A;  5KYI A;  1LO5 D;  1RKN A;  4PMC A;  5FLX E;  4QIW B;  2K5Q A;  2Q8T A;  2GA4 B;  3RUZ A;  3S15 B;  3AB9 A;  3E5S A;  1JOO A;  2RDF A;  1TKW B;  2B2T A;  1STG A;  2AWO A;  4DA2 A;  1WTP A;  1S5B D;  4A3I B;  4KKS A;  4XXE A;  4HSV A;  4DAY A;  1X32 A;  3AMU A;  3GTK B;  1M4V A;  2IX3 A;  3N6R A;  4KV6 A;  3QOL A;  4FF1 A;  3C1E A;  2XRQ D;  2HCC A;  1PYW D;  3VA7 A;  5I4D A;  1K8M A;  5C0X I;  3D6W A;  5FO7 B;  3GTG B;  2VNU D;  3GQB A;  1M8A A;  2F0H A;  1SJH D;  2A6H D;  3D4R A;  5EQ0 A;  2OF1 A;  1Q12 A;  4RFB A;  4A3M B;  1LTA D;  2NUC A;  2IWH A;  3GTO B;  5LHY 1;  3HGB A;  2BDN A;  1STA A;  4DU9 A;  4NP5 A;  3NSW A;  5KND A;  5JPM C;  5IGB A;  1BQQ T;  1DON A;  1E2W A;  1HCZ A;  1SNM A;  4KI0 A;  1D5X C;  4CKE A;  1BNZ A;  2Y0S B;  3P1H A;  2PW7 A;  1XX8 A;  2B2V C;  3SK6 A;  4IUV A;  2Q8I B;  1JE4 A;  1VF7 A;  3R2T A;  2SNS A;  3E0J A;  3QO2 A;  2BOS A;  4FXD A;  3IKJ A;  2RVL A;  2MUY A;  1CK1 A;  1SYG A;  3EVQ A;  4B08 A;  1CZW A;  3SEB A;  2PCF B;  1SYB A;  1DXM A;  1EWC A;  3CHB D;  1WTX A;  4RH6 A;  4CHT B;  4KJO A;  1U4L A;  4FO2 A;  1D5M C;  2A5H A;  2KHS A;  1S5E D;  1SNP A;  1G8Z D;  4HMI A;  3OW7 A;  4LAA A;  5K5P A;  1SE4 A;  2RSN A;  3PUZ A;  1B2T A;  4G7O C;  3ND8 A;  1QCB D;  2F0W A;  4IN3 A;  1LTT D;  3T13 A;  3TDQ A;  2RDG A;  5IGC A;  4U67 3;  4WOR A;  1DM0 B;  2NBF A;  1SE2 A;  3KBX A;  2O5I C;  2RBM A;  1PTO B;  5J22 A;  2K6A A;  4KD3 A;  1LTI D;  5JEA J;  2VUM B;  1W6K A;  2NTS A;  2LMC B;  3I90 A;  2SDF A;  5DEH A;  3VR5 A;  1DYQ A;  4FNF A;  1IYV A;  2R92 B;  3R93 A;  2R61 A;  4ZQ3 A;  4IZ8 A;  4KHZ A;  5ISR A;  3X3M A;  5D65 A;  2NN6 H;  3CKI B;  5C0X G;  1Q8I A;  4GZY C;  2K5D A;  5K36 H;  4ZKC B;  3I3C A;  3NUC A;  2XNA C;  1ILP A;  2DY8 A;  1HRJ A;  4MHE A;  3X3N A;  2B39 A;  2LS0 1;  5EKK A;  4C56 C;  2MPM A;  2F03 A;  3FVQ A;  5JJZ A;  3D6C A;  2K32 A;  3ND9 A;  1GXD C;  1ENA A;  5J39 A;  3I91 A;  1PRT B;  1E2V A;  1KDB A;  4OHJ A;  1H9R A;  4WRD A;  3S14 B;  3J7A F;  2F0D A;  4C3I B;  2A6E C;  1WTV A;  3SK5 A;  5JAV A;  2E75 C;  4XT3 B;  2CVR A;  1K8O A;  1EY6 A;  4M8A A;  3NWT A;  3HOU B;  3IFT A;  2K04 A;  1L0X B;  5E4W C;  5CV6 A;  4RCN A;  5JPN C;  3K5L A;  3HOY B;  2F0U A;  3OIP A;  3KUP A;  2TMP A;  5IGG A;  3OWF A;  1EQT A;  4EVO A;  4IFD H;  1TU2 B;  3J81 L;  3DEP A;  2NVY B;  1WD1 A;  5CBE E;  5BN3 A;  3D4D A;  4A3F B;  4BWG B;  4CKB A;  4F87 A;  5IGF A;  5KEE A;  2QCP X;  4A3J B;  4HMJ A;  2JEA I;  5T1G A;  1F2L A;  3K5N A;  3BYT B;  3NTH A;  3PUY A;  5M3F B;  3DWP A;  5EPL A;  2KOL A;  1KLG D;  1TWH B;  1ET6 A;  4BBR B;  1VCI A;  4ABN A;  1K83 B;  1STE A;  3S1M B;  4M1U B;  1PTO D;  1DJR D;  2B2V A;  4K6L A;  1SYE A;  1HFN A;  3HP3 A;  3BS1 A;  1BDO A;  3TZU A;  1VF5 C;  2L4N A;  3G6J B;  1I6H B;  1ZXT A;  1ZYR C;  3T56 B;  4XYQ A;  4X3S A;  1LT6 D;  3QIA A;  1STN A;  1TT2 A;  1FNU A;  1EOT A;  3DXJ C;  1IW7 D;  4BA2 I;  4ODG A;  5C3X A;  4LMQ D;  4F7X A;  1I4R A;  2JYO A;  3MFG A;  2N55 A;  4IUP A;  3H3V C;  5LL6 X;  1CM9 A;  1NUC A;  1D5Z C;  1H9S B;  3NK9 A;  2XVS A;  3M7G A;  2OXP A;  4B9W A;  1BF4 A;  2E2H B;  2BCO A;  1GUW A;  1DOM A;  1X3Q A;  3K6O A;  4QMG A;  5JVH 3;  1AP0 A;  2DY7 A;  1LV9 A;  2EE1 A;  4XT1 B;  4IQZ A;  4EQP A;  3J7Y W;  4P2C B;  3PO2 B;  1EIH A;  1PRT D;  2F0V A;  5M3M B;  5IGE A;  2BE5 C;  2KCC A;  2IPK D;  5D14 A;  5JEA G;  1LTS D;  1PTO H;  1QWY A;  2MP1 A;  3GO5 A;  3K0Y A;  5CBA E;  2A68 C;  3SK4 A;  2CW0 C;  1TVX A;  1ZEQ X;  1H9M A;  3I8Z A;  3A8J E;  1Q90 A;  4RHR A;  2FIN B;  4KD4 A;  5FLX L;  1ILQ A;  4FF4 A;  2JSO A;  3J7A V;  1IHZ A;  1HA5 A;  3EFX D;  4BY1 B;  4A93 B;  1KDC A;  2WB1 B;  1ONL A;  3WDN A;  1JIC A;  2HDM A;  3I72 A;  3A54 A;  5I2X A;  4C3J G;  2L12 A;  1TS2 A;  4HCS A;  4RKL A;  1SNQ A;  2XWB B;  1FGB D;  1CFM A;  1MBY A;  1Z7T A;  4R9W A;  1GUT A;  4RGM A;  1YNJ D;  2F0O A;  4KK7 A;  1SND A;  3T51 B;  4ZLT F;  5KGU A;  3LWU A;  4DK1 A;  5DM6 3;  1EL0 A;  2HUG A;  3M3Y B;  2A69 D;  4PV1 C;  3J80 E;  1T5X D;  2PQE A;  2BDO A;  2EXZ A;  1HPC A;  2K1B A;  1PRT F;  1SXT A;  4OGQ C;  2E2I B;  1FNW A;  1EY7 A;  4DNR B;  3C2P A;  2EYP A;  3ITP A;  2IL8 A;  2J7Z A;  5C44 B;  1SDF A;  1ESR A;  2JXM B;  5F2D A;  4O42 A;  2NZ1 D;  2MGS A;  3NP8 A;  3H09 A;  3V05 A;  5KNC A;  1I4X A;  2PNR C;  1DZ1 A;  2RSO A;  1R9T B;  1O7Y A;  1EEF D;  2VB2 X;  1J8I A;  3K7A B;  4E6I A;  3L3O C;  1JWU D;  4IAL A;  1KAB A;  1BXT A;  3D31 A;  5CR3 A;  4HSP A;  2QDB A;  2WKC A;  3FMC A;  1YNN D;  3NHH A;  1TY0 A;  1TS3 A;  1CZG A;  3NBI A;  2AWN A;  2F0I A;  2O2L D;  3IAY A;  3NTK A;  1U9R A;  2AQ2 B;  4K8I A;  3TSS A;  4KN7 C;  1CQF A;  5CV8 A;  4RKB A;  4KTA A;  1A3U A;  1AFP A;  3LX0 A;  4PQX A;  1WCM B;  2F1M A;  2DNC A;  2WV6 D;  3VYU A;  1HTL D;  3A8I E;  1ENF A;  3PUX A;  3OSO A;  5C4X B;  4CGY B;  5EBD A;  1JR0 D;  1T5E A;  4DAP A;  2CHB D;  3KF8 A;  3W2D A;  1O7Z A;  4DNT B;  4NKL A;  5CV9 A;  1QJO A;  3P75 A;  3A7A B;  5C4Z A;  3TN2 A;  1C48 A;  1B1Z A;  3NE5 B;  2BA0 A;  2XIW A;  4J6H A;  2K01 A;  4F88 A;  1BCP B;  4EQN A;  1B9M A;  1I3Q B;  4X3T A;  5C4J B;  4LJZ C;  2K05 A;  3PIO 3;  1HQR D;  1Q1B A;  2SNM A;  4OO1 I;  3GTP B;  3EQL C;  1MSH A;  3DWQ A;  3LWE A;  1QG7 A;  3GD7 A;  1LT5 D;  5IOD A;  1OXX K;  3I70 A;  4KJN A;  2B2W C;  2D9U A;  1EY4 A;  2B2Y C;  4X3K A;  5JVG 3;  2IX0 A;  5C5L A;  1B53 A;  4K14 A;  1RCV D;  4X3U A;  3O13 A;  3MEH A;  3GV6 A;  3EA6 A;  1XYI A;  1AEX A;  1JQY D;  5LL6 S;  1EIG A;  3UI2 A;  3TBI B;  1A15 A;  3SK8 A;  2SOB A;  1L0Y B;  1AN8 A;  2EY1 A;  3GV3 A;  3A56 A;  4YIJ A;  3FKI B;  3FRP B;  4ZUI A;  1SNO A;  4WFN 3;  1HTP A;  1FD7 D;  5FKA C;  1SMY C;  3K58 A;  3GTL B;  3ERQ A;  3HKZ B;  3RMH A;  1TQO A;  2L5T A;  3URY A;  4C3H G;  5A2Q E;  2AQ3 B;  2EDG A;  1G2S A;  3S2D B;  1PFM A;  3NXW A;  4G7Z C;  2G9D A;  5COR A;  2KQ3 A;  1LTR D;  2BA1 A;  2D2C C;  4V19 0;  1X3P A;  1A3T A;  1EEI D;  2ICE C;  5E1F A;  2LY7 A;  1BO0 A;  1EZ6 A;  5G3L D;  2PMZ B;  5BN5 A;  3CU7 A;  4OO1 G;  1EYD A;  3I4L A;  1HFG A;  1Y8O B;  2I07 B;  1D1I A;  3NPP A;  2E74 C;  4Q0F A;  1ZKO A;  1CTM A;  3KK7 A;  3LNN A;  1NSN S;  2WKD A;  1XXG A;  5M9O A;  5ELC A;  1BCP D;  3DMU A;  5KRU A;  1CHP D;  3OIQ A;  2L1B A;  4TRD A;  4ZRZ A;  1O7L A;  2F0Q A;  1I4P A;  4B9X A;  5E3F A;  3Q6S A;  4IUQ A;  1I4Q A;  3JAM E;  5E4X A;  1E0B A;  1R4P B;  1OO9 B;  1KDA A;  1C4Q A;  3MA2 B;  2Z4H A;  4QB4 A;  1ROD A;  1JB3 A;  2EYM A;  1SSO A;  4L8J A;  4K5X A;  3NBH A;  4L6T B;  4LK1 C;  2PW5 A;  3NQT A;  3G7L A;  2NTT A;  4HTH A;  4UAI A;  3RZD B;  1EZ8 A;  4K5W A;  1II3 A;  1KAA A;  1E2Z A;  3TP5 A;  4JK1 C;  1F77 A;  4HAE A;  1I4H A;  2WP8 J;  3KLS A;  2EYH A;  5TSS A;  4IUU A;  1AW7 A;  4QCL A;  1EY8 A;  5IGD A;  5C3E B;  3MXG A;  1PZK D;  4RGN A;  4K2L A;  2O5J C;  2ZXR A;  5BN4 A;  3PUV A;  1AZQ A;  5DAU A;  4A3E B;  1JCK B;  1EQV A;  2A68 D;  1STH A;  4Z9C B;  2KVM A;  2B2W A;  1BCP F;  3V2T A;  2RQX A;  2B2Y A;  3MAQ A;  4ME5 A;  5C0X H;  5ELE A;  3SDZ A;  4CJ2 C;  1PXU A;  2K28 A;  4KY7 A;  2Z1C A;  2KUM A;  4DFA A;  5JOB A;  1CHQ D;  4HR7 B;  2F0T A;  2JEB I;  1U4P A;  2TSS A;  5EPJ A;  1EY9 A;  1CI3 M;  3S1R B;  3SXH A;  1RTO A;  1F9P A;  3S1Q B;  2B8F A;  3J80 L;  1D6E C;  2EPB A;  4PMW A;  2F0P A;  2KED A;  2MJ8 A;  1Z47 A;  3P7J A;  3T4A C;  3NQI A;  1GHK A;  3K5O A;  2WII B;  5M5Y B;  3HEJ A;  5IT9 E;  1EWH A;  4RCO A;  3QG1 A;  2NWG A;  3VR6 A;  2Z4I A;  3Q22 A;  2Q8R E;  2EYF A;  1EU4 A;  2EZV A;  3MFY A;  3A7L A;  2IW3 A;  1NCV A;  3N52 A;  2C5C A;  2EJF C;  4RGT A;  4PMB A;  3V96 A;  3R3O A;  4KY5 A;  3TME A;  1F2M A;  3Q23 A;  2XN9 C;  1BBX C;  4H7B A;  2ID0 A;  2JA6 B;  1XWE A;  4A3G B;  5I9P A;  1W6J A;  1JWS D;  4QF4 A;  2F0F A;  4N9P A;  1KNE A;  1SJE D;  1UEA B;  4TKO B;  2B2U C;  2NYZ D;  2F0N A;  1LTG D;  3K59 A;  4C3I G;  2C9O A;  2K5W A;  2PPB C;  4C1N I;  1WTR A;  3C1F A;  2F0S A;  5C5M A;  2WAQ B;  2IT1 A;  4H13 C;  1GUN A;  1ML0 D;  2F3W A;  1EY0 A;  2B8G A;  3IL8 A;  3M85 A;  1DCZ A;  1GHJ A;  1B9N A;  4NMZ A;  5C6A A;  2J4X A;  1PTO F;  2F0M A;  3SE0 A;  2RKS A;  1MGS A;  3DUZ A;  2E76 C;  1STY A;  1TS5 A;  1GUO A;  4H0L C;  3QB3 A;  1KLU D;  3CRL C;  1WTQ A;  3K5M A;  1R4Q B;  2KEC A;  5KNB A;  1IKL A;  4MIU A;  4IUN A;  2K03 A;  2KA7 A;  1STB A;  4TSS A;  2M2L A;  2L0C A;  3U9O A;  2PO4 A;  2N88 A;  3QJY A;  4O1N A;  1LLR D;  1EY5 A;  4EQO A;  3A55 A;  3ERO A;  4HED A;  2PZU A;  2FFK B;  4ILW A;  5CC4 A;  1HUN A;  3VYT A;  1VMP A;  4IUR A;  3DM1 A;  3VA5 A;  5CGK A;  3BDC A;  1NR2 A;  2EVB A;  3T16 A;  4CBV A;  3F2U A;  5CV5 A;  5JEA H;  2D62 A;  1TR5 A;  4RAU C;  5CMD A;  5KYL A;  3BDL A;  4R8N A;  3KLS X;  2JA7 B;  1RF2 D;  1A3V A;  4FVM A;  1LAC A;  1H9J A;  1V1P A;  1RHP A;  3QOJ A;  1B4O A;  3VYR A;  3MZ5 A;  2MHV A;  3TP7 A;  1H9K A;  3MHB A;  2D5D A;  1SYC A;  4WJW A;  4IFD J;  3M4Y A;  1PRT C;  2NN6 I;  4K5V A;  2JP1 A;  4XYO A;  1LAB A;  1FR3 A;  4KN4 C;  4J8Q A;  2V4D A;  5IIF A;  2HCI A;  5A2Q L;  2R7Z B;  2EY6 A;  2F0L A;  2AQ1 B;  2KJX A;  1RJT A;  1SAP A;  3H91 A;  2R6G A;  2EJG C;  1U4R A;  2EY2 A;  3MXP A;  4OL7 A;  4DAV A;  1HA6 A;  5NUC A;  3U9S A;  1GUS A;  5HGT A;  4XQN A;  1S5D D;  2XWJ B;  3GP7 A;  3C46 A;  1OXT A;  1GUG A;  3MTS A;  1JOR A;  4N9T A;  2EYO A;  1SNC A;  1Y8P B;  3OHX C;  1YNJ C;  1G29 1;  3SVM A;  3TP8 A;  5CV4 A;  3MC0 B;  1DD2 A;  1CA6 A;  1SYD A;  2A69 C;  4A3B B;  1G2T A;  2B2U A;  1B3A A;  5CV7 A;  1FYC A;  4IFD I;  2VB3 X;  3T53 B;  3HOV B;  2NVQ B;  2LKV A;  3HOW B;  1Q3L A;  1I6V C;  1PLF A;  2WIN B;  3JAM L;  3OPO A;  2Z8L A;  4RGO S;  4DXG A;  2ENB A;  1PFN A;  1HXY D;  5EKL A;  1LTB D;  1S5F D;  1EFI D;  5A35 A;  1B44 D;  3KLR A;  1G91 A;  2OEO A;  4HCE A;  2WAC A;  2E2D C;  1YNN C;  4XQJ A;  3TP6 A;  2NN6 G;  2O4X A;  5HUR A;  2A6E D;  2DN8 A;  2QEJ C;  1BR9 A;  1IL8 A;  5M5W B;  2ICI A;  5K36 G;  3W3A A;  3QWN A;  1QIL A;  2M00 A;  2R3Z A;  4Q5V A;  1XTC D;  3Q0A A;  3VR3 A;  5J1Z A;  3BVM A;  2JE6 I;  3ONA B;  4BY7 B;  2I46 A;  5DNF A;  3SR1 A;  3BYY B;  2A74 C;  1D2B A;  1J9O A;  2SEB D;  5COY A;  2EYJ A;  5EGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...