2EXZA

Crystal structure of staphylococcal nuclease mutant t22c
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDCVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 39
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2exzA00
1KDBA 4K14A 4K6DA 4PMBA 3SK6A 3NQTA 4ZUIA 4ZUJA 3D4DA 3SK4A 2EYMA 5J1ZA 3SXHA 5I6WA 5KIXA 1A3VA 2F0HA 4MIUA 2PZUA 3EVQA 3QB3A 5J39A 1JOKA 4HMJA 5DAUA 2PYKA 1SYEA 2EYHA 3D4WA 5CV5A 2EYFA 2F0LA 3LX0A 5I6YA 3HEJA 3NUCA 4KY6A 3NP8A 4J6HA 2WACA 4IUNA 5IGGA 2F0QA 3EROA 4QMGA 1EYAA 1KAAA 2F0WA 4K5VA 1EY7A 1JOOA 1F2ZA 1EY6A 5E1FA 3MXPA 5K5PA 1SNDA 1KABA 5CV8A 4H7BA 4KHVA 2F0OA 5F2DA 3S9WA 1A2TA 3TMEA 1SNOA 2O4XA 2PZWA 4N9PA 4S3SA 4PMCA 4DU9A 2NUCA 3OMGA 1TR5A 1ENAA 1EYCA 4F7XA 2HQEA 1SYFA 5IOCA 3TP8A 1SYDA 2F0FA 2QDBA 2F0IA 2F0EA 3ITPA 2F0JA 2OF1A 4NKLA 4HMIA 5CV7A 5C3WA 2EXZA 2F0GA 3QOJA 4I65A 3U9OA 2F0SA 3ERQA 4KJNA 1II3A 4YIJA 3RUZA 5C3XA 2EYLA 3BDCA 5CV9A 5IODA 4KTAA 1NUCA 2F0VA 3T13A 1ENCA 4R8NA 2LKVA 2SOBA 4ODGA 3C1EA 1EZ6A 3OSOA 4RKLA 5DEHA 5C5MA 4EQNA 1SNMA 4KV6A 3HZXA 1NSNS 5KYLA 3NHHA 5M9OA 4HTHA 1SNPA 3MEHA 4KY7A 4RKBA 5I9OA 5KGUA 4E6IA 5KYIA 2OXPA 4K5WA 5IGDA 5JAVA 3E5SA 1EYDA 5IGFA 5E3FA 4ID6A 4J1MA 4K8JA 2PZTA 5CGKA 5IGBA 1TT2A 4B9WA 4F8MA 1STGA 5IIFA 2OEOA 2F0KA 2RDFA 1RKNA 3C1FA 4ME5A 3SK5A 3TP6A 4DFAA 4EQOA 5KRUA 3R3OA 2ENBA 2SNMA 2RBMA 1EY8A 1AEXA 1A3TA 1SYCA 1SYBA 2EYJA 2PQEA 2EYOA 2F3VA 5IGCA 5C4HA 1STAA 5J22A 2KHSA 3DHQA 4IALA 5JOBA 4PNYA 2PW7A 3MZ5A 3P1HA 3V2TA 2F3WA 3VA5A 4DF7A 1F2YA 4ZQ3A 2EYPA 4QB4A 1STBA 2EY5A 1JOQA 4G57A 4K2KA 5IGEA 4NMZA 2F0MA 1SNCA 4WRDA 5CR3A 1F2MA 3TP7A 1JORA 3QOLA 2KQ3A 1KDAA 1EY5A 1IHZA 3MVVA 5KEEA 2PW5A 2F0TA 1U9RA 3DMUA 3TP5A 1KDCA 3D6CA 1EY0A 3EJIA 3H6MA 5HURA 4IZ8A 1SNQA 2EY2A 3D8GA 4KD3A 4OL7A 5EKLA 1EQVA 4LAAA 5C6AA 2M00A 4K5XA 3MHBA 4K2LA 4WORA 1A2UA 5NUCA 5EKKA 1STYA 2F0NA 5CV6A 1EY4A 2F0PA 4TRDA 4DGZA 3OWFA 4K8IA 2EY6A 1STHA 4NDXA 4NP5A 4QF4A 4EQPA 2F0DA 3BDLA 1TQOA 2RKSA 3SR1A 1STNA 5HGTA 2F0UA 1EY9A 1EZ8A 3P75A 5CV4A 5EGTA 3SK8A 3SHLA 3NK9A 5CC4A 4KJOA 1A3UA 4KY5A 3T16A 4B9XA 1SYGA 2EY1A 4KD4A 3PMFA 4N9TA 5I9PA 4EVOA 3NXWA 2SNSA 3OMCA 5ISRA 5C5LA 5C4ZA
chains in the Genus database with same CATH superfamily
4IFDJ 2J0TD 5M5WB 1I3QH 1KC8C 3T51B 1SE3A 1CQFA 2JEAI 4HJAA 2B2TC 2F0HA 4MIUA 1I4XA 1H9KA 1HTPA 3EVQA 5DM73 3JAMi 1VQOA 1KXLA 4C3JG 2UUBQ 4A3EB 2NZ1D 2I5LX 3CCRA 2JA6H 1QJOA 2Z6BA 3AMUA 2XGTA 1K0RA 1SLJA 1HUMA 4CJ1B 3E3XA 4HEDA 1KABA 1DOMA 3S9WA 1A2TA 1LTGD 1GVPA 1FR3A 1PZJD 3G71A 2MPMA 1GOZA 1TS3A 4X65L 1SBBB 3PUZA 2UUCL 3RLOA 5EPKA 1SJED 4K0KL 4JI1L 2CHBD 3L9AX 2OWOA 2F0FA 5FLMH 3OYYA 2EXZA 2NVTB 2A19A 1EUJA 2IL8A 1HR0Q 4B3RQ 4DV6Q 3HOZB 3DXJC 1MJEA 1U5KA 5IWAL 2RCFA 1SNMA 2KEDA 4KV6A 1KRTA 1ASZA 1BUVT 5EBCA 3NHHA 2ZJQA 4KY7A 2C35B 5JAVA 1Q1EA 5I2YA 5IGFA 1QCBD 1VQNA 3DEPA 5CGKA 1LTAD 1MD2D 1KIXA 1QVCA 4DFAA 5IT9c 4DR5L 2V1CC 4LMQD 1SRUA 3S2DH 2R6GA 1AEXA 4P75A 3KDFB 1I4GA 5JOBA 5HY6A 2RHSB 1XWEA 2JQOA 3PUYA 4QB4A 4JI1Q 3UDIA 2R92G 5IGEA 2JK8A 3U4ZA 1SN8A 1UE7A 4WRDA 2VZAA 4ABNA 4X3TA 1IHZA 3GP7A 2Q8IB 3GTPH 5HURA 4KD3A 5M5XH 4AYBG 1Q8IA 4RCOA 4B3TL 3VR4A 2F0PA 1VMPA 3OWEB 1UE6A 3ICEA 3F2DA 1E1OA 3CCVA 1XMOL 5CC4A 1A3UA 1K73C 1HUNA 4RGMA 4K6LA 4AIMA 2EY1A 1S5BD 4OO1I 2KHIA 4C3IB 4E6IA 5C4ZA 1I5FA 2R7ZB 1XNRL 2R7ZH 4KK7A 3SK6A 2FHTA 4ZUIA 2F4VL 3RZOH 3KJPA 5I6WA 3FDTA 2DUDA 1IYVA 1PTOD 4OWTB 5JEAJ 1X54A 5D14A 5GAHC 4BY1H 1S5DD 4QY7A 4BWGB 2F0WA 4B3ML 1CHPD 1L0YB 2PMZE 1RODA 3CCEA 3MXPA 1SNDA 3KUPA 1TKWB 3LWEA 4IJLA 2A69C 5JEAG 1ENFA 2B29A 3FEWX 5T1GA 2KCTA 4ZKBB 3R8BA 2PI2A 5I2XA 4DR1L 3M9BA 1WTHA 4ILWA 5CMDA 4GN5A 3HOVH 3DUZA 4H44C 4NKLA 2I5HA 1HFNA 3SGIA 4HJ5A 2UU9L 1AFPA 3BDCA 3D0FA 4R8NA 3S1NH 4AQYL 4RMFA 2Y0SE 3HKSA 3OSOA 4JI5L 1ICFB 1YJNA 5IE8A 5C4XG 1X32A 2UUAL 1A6XA 2RSNA 3ZYYX 2OEOA 2F0KA 5JVH3 1MIUA 2NVYB 5KRUA 2HDLA 1G51A 2X6LA 3S2HB 1Y1WB 1D7QA 1JE4A 2CH4W 1PH6A 2PQEA 5DNFA 2PI2E 1PXUA 4RGTA 2RCNA 3I70A 5GROA 2A73B 3D3RA 3A5ZB 1JORA 2E74C 1PRTB 4HIDA 2IX3A 2LS01 5A2QL 1P16A 4UP9A 1HH2P 4YHHL 1M90C 3GTLB 3H6MA 2EY2A 4HJ8A 5IP7H 4DV5L 5JEAH 3BG3A 4RGOS 3I4LA 4IURA 4A3FH 4L5TA 1WOCA 4NP5A 1A62A 4Q0FA 4BBSG 1EZ8A 3L0OA 1BOSA 2WINB 3DEOA 3MAQA 2QCPX 5GAGC 1VQHA 5I9PA 2LMCB 2F3IA 3EBEA 4DV6L 3PUVA 2AUJD 3K6OA 2B8GA 5J1ZA 1NY4A 3HP3A 1X9NA 4IPCA 2LFNA 2EQSA 2MHVA 4DR7L 2ZTDA 2TSSA 5JPMC 1Z47A 2RF4A 1CHQD 1BCPC 2WACA 1PYWD 1TS2A 5FO8B 3PGZA 1YITA 1IYJB 4LF4L 5IYCH 1VCIA 1QVFA 5IY0A 1TWGH 4C3JH 4EX5A 2F03A 3NSWA 4LF4Q 2PO4A 3A55A 4DU9A 4F88A 3K0XA 1Q7YC 4A3JB 1V9PA 5BR8Q 2ZTEA 4BBRB 2A74C 3K81C 4RGNA 3KDFA 4GOPA 2VNUD 1EFWA 3TS0A 2WFWA 5CV7A 2L1BA 4GNXC 4MTNA 4KN7C 1L1OC 3I3CA 4A3GH 1Q12A 1X56A 2R7FA 2CW0D 4JI0L 1VQCA 3WWVA 3KYHC 4KTAA 1WTVA 3E9IA 1M4VA 1VQ7A 4ODGA 1EZ6A 1WFQA 3HZXA 4GKJQ 1HFGA 4HTHA 2NN6G 3K7AB 5I9OA 2E2JH 1H9SB 1MBYA 3JAMc 1CKOA 4A93H 5IGBA 3STBC 1M1KC 5ELBA 1XXGA 2GA4B 3OOCA 2JA6B 1JJCB 4R4CA 3HKZE 1KAWA 1PTOC 1EYGA 3K5MA 3J7ZC 4LFBL 3RN5A 1G6ZA 2EYOA 1BR9A 3MZ5A 2AHOB 1GD7A 3Q8DA 3VYUA 3CMEA 1HNWQ 1RDPD 3QOLA 2QEXA 1HNXL 1PH4A 5KEEA 3Q24A 3K80C 4DPGA 1K8AC 4IZ8A 1SNQA 3TZUA 3T1YL 4LF8Q 4DAYB 4K2LA 5M3FG 1NBWA 3QO2A 2XTIA 1HNZQ 1D5ZC 2NBFA 5M3FH 4L5RC 5JJIA 5ELFA 4O0AA 1LTLA 1X3QA 2F0DA 3BYTB 1DXMA 3FHWA 3ND9A 4UPAA 1STEA 3CPFA 1SMYD 4HJ9A 4CKBA 4R4TA 2PCFB 1Z7TA 3PMFA 3FKIG 2A6HD 4Q5VA 1KDBA 1Z6HA 4K14A 4LW1A 4IPHA 3GTKH 2VQFL 1QZHA 2KJXA 4YY3L 2QA4A 3K58A 3GTQB 3MXNB 1VQMA 1CZGA 2B2WA 2BDOA 3J7AF 3PV0A 3RD4A 1TY2A 1VQ4A 1PH9A 3UDXA 3CQZB 3GO5A 4OIKA 4XQJA 4N9PA 2K33A 5IT9L 2SDFA 2NUCA 4PZ7A 1EIHA 2X6GA 2OCEA 3TS2A 2TMPA 4Y7NH 1DONA 1VS0A 3HOUH 4A3FG 1TVXA 2F0GA 1PFBA 1II3A 4QCLA 4DV7Q 1D8LA 1TWAH 1N8RC 1RCVD 1B1ZA 3MWYW 1WVLA 2BCOA 4CGYB 1S5ED 3GQBA 1L1OB 3RLNA 4CJ0B 3NBHB 3HOYB 5IGDA 4ID6A 5IP9G 2F52A 1EU4A 3KF8A 2R7ZG 4A3MB 2FINB 3EIVA 1RKNA 4NXNL 3I7FA 5EPJA 1HNWL 1SYCA 1FL0A 3KJOA 2ZJRA 3S1RH 5J22A 3J7A5 4JV5L 1UE1A 4R4QA 2JA8G 3NWSA 4B3TQ 4LFBQ 4OO1H 1B70B 2N49A 4DUZQ 5A35A 4XXEA 3Q6SA 3U4VA 3K59A 2AWNA 4MZ9A 1NTGA 4A3FB 1I6HB 4OL7A 4DV3Q 1X55A 2ZT9C 1LV9A 1EQRA 3LWUA 1BBWA 5CORA 4L5SA 4TKOB 4BY7B 1SSOA 4H02A 2E2HB 1K0SA 5EGTA 1WTXA 5LL6X 2NZHA 4LF9Q 4HSPA 3H15A 2VL6A 3VA7A 1SAPA 3DWPA 4X64Q 3NXWA 3S15B 3I91A 4EQOA 4GNXA 3AFPA 1V1PB 4UHVA 4DNTB 2WAQE 5J39A 4PZ6A 1H9RA 1Y1WH 1KRSA 1CSQA 2F0LA 2Z6KA 1YJ9A 2XSCA 5IP9H 2M9VA 1F2LA 3GTKB 5L37A 2EJMA 5G3LD 2F0OA 4JI7Q 1T5XD 3CCSA 1UE5A 3QG1A 4NPSA 3S24A 1Y8OB 4YCUA 2HD3A 5IOCA 1I4HA 1MI2A 3KFUA 5FLXc 2L12A 2R92H 4DK0A 2UXDQ 5C3WA 1XNRQ 3ERQA 4LF8L 4IOAA 3D4RA 2F0VA 2CVRA 4DA2A 2FMMA 1WTWA 4QIWB 1GHKA 3CMAA 2PMZB 2Z4IA 5EJWA 1ML0D 4CDDC 1JCKB 5KYLA 2WAQG 4CBVA 4GKKQ 4RKBA 3CD6A 4IPDA 2OQ0A 1WCMG 4TQUS 4A3IH 4JI7L 2D2CC 5IIFA 3PIP3 4IFDH 4ME5A 2JJQA 4JOIC 4NXML 1C4QA 1DOLA 5E4XA 2E2HH 3BJUA 2JA9A 2Y0SG 2PW7A 3NPPA 2K5NA 5C0XH 4XT1B 3OPOA 4IUPA 1HPCA 1WD0A 1GUNA 3JC66 1PZID 3HOWB 2K14A 4HCSA 1PRTF 2K4KA 3IAYA 4A3GB 5LHY1 2F0TA 4JOIA 3D6WA 3VYTA 1TY0A 1BVSA 1EY0A 5C44B 1VQPA 3S17H 5C6AA 3GTMH 3GV3A 1SE4A 2GVAA 1QB5D 1STYA 2F0NA 1BCPF 3OWFA 4K8IA 4QF4A 3FP9A 1Q3LA 2XRQD 2RKSA 5HGTA 3OTOQ 1S3OA 3MXGA 1S5CD 5DM63 4UY8C 2QDLA 2YTXA 1QVGA 1DM0B 4FXKC 1S5FD 2SNSA 3L3OC 3OMCA 1Q1BA 4DR4Q 3CAMA 1RTOA 2LXKA 2D0PA 4DR3L 4ZRZA 4PMBA 2RSOA 3BYYB 4ZUJA 2O5IC 1PFNA 2A69D 2Z8LA 5LMUL 1JOKA 2R93H 5IT9E 5JVG3 2B8FA 2RHQB 4A93G 1WCMH 4A3IG 1VQ8A 4KKUA 1Y14B 1EY6A 1PFSA 4DAPA 3H0GG 5M3MG 3BDOA 4GLVB 1KNEA 4M1UB 1VQ5A 3F2BA 1YI2A 1GM5A 2X69A 1H9JA 2HQEA 1AH9A 1Q46A 4KMUC 3S17B 3TP8A 3PIO3 1K3BC 3NENA 2QDBA 1PH2A 2OF1A 4HIOA 3E0JA 3I4NG 4DR4L 4C2MB 1PYSB 1JE5A 1FNVA 4JI2L 3GTOB 2A6ED 4A3EG 4FYDA 3AB9A 2R7DA 5KGUA 2ID0A 3OTOL 1K8OA 3E5SA 4BY1B 4IPGA 1YIJA 1HHVA 4B9WA 2C5CA 4X3KA 1XPRA 4G4KA 3C1FA 3PCOB 3SK5A 2Z9HA 3CQZH 1R9TH 4A3MG 3DWAA 3K8AA 2BA1A 1R9TB 4KI0A 4BY1G 4YCVA 4DV0Q 3DM3A 3VR5A 4L8JA 3VA5A 2F3WA 1I94Q 1CT1D 1AE3A 3CW2C 4ZQ3A 2E2JB 1PMRA 4CKEA 3S15H 2EZVA 5C3EH 1BCPD 5EPLA 3AYHB 3HFZB 3S1NB 3BVZA 4KHPL 4FF3A 4CDFC 4XDXA 5M3MH 2BA0A 1PVOA 5EKKA 4JCVE 1DGSA 1PRTD 1HXYD 1STHA 4IUQA 1FJGQ 1A63A 2F0UA 3EN2A 4CDCC 4JG2A 1HNZL 4KY5A 2PPBC 2JEBI 1ASYA 2JXMB 1L0WA 2NVQB 3F1ZA 2VY3A 2KENA 1LTRD 3WOEA 4LF5Q 4BXXG 4P72A 1W6JA 4A3MH 4DK1A 2MUYA 4L6TB 1AE2A 4PV1C 2Z0SA 4PQXA 4X62Q 4OX9Q 3K7AH 4QMGA 4YHHQ 4P71A 1O80A 1EIFA 5K5PA 2B39A 2WKDA 4H7BA 3VR3A 3ER0A 3TMEA 1O78A 3NE5B 2PZWA 3DLLA 1YNJD 3UI2A 1TR5A 3A0JA 1TU2B 1VQDA 3STBD 4BY7H 3CPWA 3F8TA 5IWAQ 2K1BA 4PG3A 2Z1CA 3GTPB 1A15A 1BDOA 1HA6A 3HOXG 3RUZA 1VQGA 5IODA 2OQKA 2E5LQ 1FJGL 1J5EQ 2UUAQ 4L63B 4C3HG 3E9HA 1V43A 4IN3A 2A68C 3J80i 5IP7G 1N33L 1K83B 1LT4D 1LM0A 3A74A 1I4QA 2DN8A 1U4PA 3S16B 4A3KG 1BO0A 1GUOA 1XNQQ 4R9WA 2OT2A 1FYCA 2ENBA 2SNMA 1PRTC 2K05A 5D3DA 4LF7L 4L5QA 3VR2A 1Y8NB 1LTTD 5C4HA 4YWMA 4PNYA 3S1MB 3AU7A 1N32Q 1N36Q 1RTNA 1HRJA 2NN6H 2YU9H 5C44G 1SE2A 1VMCA 4DV0L 4KHPQ 1N9WA 3CCUA 3I4NB 3TP5A 3T56B 3BZCA 1G6PA 2K6AA 5EKLA 3WDNA 1Q86C 4FDBA 4LAAA 3X3MA 2EDGA 1BF4A 4LNQA 4BA2I 3UDGA 2L0CA 1QOHA 4NDXA 4GLXA 2A68D 3NEMA 5BN4A 1OXVA 3KF6A 2IY5B 3URYA 3SHLA 1Q81C 3I8ZA 1NE3A 2IHEA 2MO0A 3MXNA 3TREA 4XQNA 2IPKD 3EFXD 3D4DA 1RJTA 1EQTA 4C3IG 2K03A 3A56A 4LK1C 4GN4B 3TQYA 3J81E 3ULPA 1K8MA 4G7OC 3I2ZA 4MTKA 1H95A 5CV5A 4KY6A 4DV3L 2MJ8A 5KNDA 1JMCA 3C3LA 1NNXA 3CRLC 1RIPA 2YV5A 3TDQA 4HIKA 1V8QA 3RMHA 3J7YW 2K50A 1IYUA 2NB0A 4DV4Q 3M3YB 4LF6L 3SVMA 1CM9A 2HDMA 1G91A 4S3SA 4GNXB 1VQAA 4DAYA 4DK6C 4IOCA 1TIID 3PIPA 4FVMA 3HOWG 2IW3A 3NWTA 4JI5Q 2MFIA 4JC0A 1LT5D 4XT3B 2CQOA 1NAPA 1GXDC 4RA8A 2EIFA 3FRPB 4KJNA 3E0EA 1I6HH 1U0LA 1C48A 2B2TA 2IJ0A 1NUCA 2I0QA 3J80c 2FFKB 3MFYA 5C0XJ 5KYIA 3MEHA 4QL5A 3H91A 1J8IA 1WCMB 2AWOA 1QNKA 4TVAB 1SMYC 2QKIC 3KLSA 2ZXOA 4V190 5FLXE 2ATWA 4DR2L 4IFDG 3NBIA 3WOFA 1F9QA 4A3CG 1SYBA 2ZTCA 2FMCA 3NTKA 2NVTH 2KHSA 4B08A 1OXTA 4X65Q 4A3DB 1AZQA 1LTBD 4UDUC 4ME3A 3IL8A 2KCMA 4U68A 1SNCA 3BS1A 4A4IA 1SDFA 1PYBA 5JPNC 1EY5A 2R61A 2CWAA 1MJCA 2J7ZA 1KLGD 4A3BG 1YJWA 3S16H 4DV4L 1EQVA 2M00A 4MHEA 2I5MX 5C4JB 3DWQA 2JA8B 4TRDA 2K5WA 4ZLTF 2N55A 2ALYB 3IFDA 1JWMD 3HOWH 2F4IA 3HOXH 3NK9A 1EIYB 1PH3A 4JPBW 3OHXC 2F4VQ 2YU9B 1QILA 5ELEA 2JA6G 3M4OH 1SE8A 2JA7G 1DZ1A 3NQTA 2Q2UA 3SK4A 2ZXRA 5KIXA 2PNRC 4OXPA 4A3CH 1LUZA 3NBHA 1Z9FA 4I7ZC 1BKBA 2E2DC 3LX0A 1I50B 4IUNA 1DD2A 1H9MA 1HZAA 1KAAA 3NTHA 2PQAA 1F2ZA 1K3RA 1E1TA 5M3MB 5CV8A 4JBWA 4F87A 1CUKA 2CFMA 1FGBD 1VQBA 1XX8A 2VUMB 3Q0AA 2O4XA 4KKSA 2K5QA 4FF2A 3T4AC 5KNCA 4BY7G 1OO9B 2Y0SB 1G8ZD 1S72A 2K7VA 3W2DA 3KOJA 2VQEQ 4RHSA 4OELB 4MN3A 4HN7A 2F0JA 3MA2B 2O2LD 4DR3Q 3QOJA 2VXWA 3VDYA 2K5DA 1KD1C 1CK1A 1X6OA 4DNRB 3G4SA 1QE6A 3HOXB 1KHIA 5ELCA 4OX9L 1EIGA 1RL2A 5DEHA 1PFMA 4Y52H 3PO3B 5IYBG 4JI8L 4J1MA 1HR0L 2BDNA 1TWCH 1SFOB 2AQ1B 4XIGS 4DUZL 4ZYSA 4DXGA 2G9DA 3N52A 4PZ8A 4KHZA 4FO2A 4IJHA 4QUFA 1G2TA 1LT3D 1X3FA 1ESRA 3AFQA 1EQQA 1JJGA 3IKJA 2B2YC 2F1MA 2GN5A 1YZ6A 3SEBA 1T9HA 3RZDH 4LFAL 1VQLA 4NMZA 1LLRD 1OXSC 1QG7A 3I55A 1PH7A 1VQKA 2NTTA 1Y1VG 4HAEA 1D5MC 2WV6D 3PO2G 1QUQB 4B3MQ 3F2UA 3D8GA 1E2VA 4A3BH 1IKLA 5IYDH 2LSSA 3BU2A 1V1QA 3A7AB 1DCZA 3W1BA 4OO1G 5BN5A 1SXTA 3MFGA 1K28A 1MGSA 2V4DA 4A75A 4GKJL 5FO7B 2ASBA 1TWGB 3HOUG 2B2UC 3P20A 2N78A 2P5ZX 1E3PA 5D65A 4K6DA 1E24A 4JI6L 5COYA 4JI3Q 1WTRA 1TWAB 2PZUA 3M4YA 3QB3A 2MNAA 3RZOB 1W2BA 3J80L 3PIOA 4XTCS 2A5HA 2WB1E 4A3KH 4DV5Q 2XWJB 1D2BA 4O1NA 3EROA 3S1MH 4K5VA 4GS3A 4RAUC 3FKIH 3PF5A 1EOVA 2KUMA 3TN2A 1FGUA 1MHWC 1IBKL 1CA6A 2RVLA 3A8IE 4RWSC 4LUVA 1LTID 2ZXPA 3CKIB 3B6YA 5LMUQ 1C9OA 2M2LA 3CC4A 4X6AH 4RG1A 4A93B 1X3EA 3MXUA 1F9SA 1XTDA 2D9UA 2HQLA 1EL0A 1HTLD 2F0EA 4YY3Q 1KTKA 1JICA 2R3ZA 2XRSD 4HMIA 2CKZB 2UXBL 1F9PA 4ZAIA 3CC7A 4X64L 1QZGA 1ENCA 1L2FA 1XMQL 4LFCQ 1JT8A 2L9HA 1NMFA 3H3VH 4FF4A 3HOUB 3X3NA 2FJ2A 1IBMQ 2SEBD 1W3SA 2K5HA 4OONA 2EVBA 4OWXB 2ICIA 5M5XB 2DNCA 3U58A 2I46A 1G2SA 3FMCA 4KKTA 2E5LL 2O5JC 1TT2A 4HCEA 2EE1A 2KOLA 3TP6A 1RF2D 2YTVA 3UDFA 2NN6I 1GUSA 1NCVA 2EYJA 2NVQH 4IALA 2IHFA 2K04A 4G57A 1DOKA 3ND8A 3MVVA 3TRZA 4BBSH 4OHJA 2H1EA 1Q8KA 3MHBA 3RZDB 4DXFA 3ERSX 1U4LA 5IGCA 2R92B 2BE5D 3E6ZX 1WTOA 4FNFA 4UP8A 4OEMB 1IKMA 1JR0D 1EY9A 4J15A 1GUWA 2J4XA 1SYGA 2L5TA 1XMQQ 5K36H 1ZXTA 5AFWA 2JYOA 4IQZA 2D0OA 2B2UA 2CH4A 4DNIA 1B3AA 5FK9C 2EYMA 1LT6D 5FJ8H 1PV4A 1BNZA 1B3QA 4JBMA 4H13C 3Q23A 3U9SA 5C3EB 2AQ3B 4HMJA 3TZDA 4C3HB 1N34L 2OTLA 4DUYQ 2EYFA 4C3HH 3NP8A 2QILA 4AH6A 4A3IB 3I72A 4LUZA 1JJ2A 4I7AA 3PO3H 1SROA 2A1AA 2OTJA 1J9OA 1SNOA 4A3JH 1UEAB 2VB3X 3GDEA 1DJRD 2HHHL 2K52A 1N33Q 3H3VC 4GKKL 1UNSA 2UUBL 4ZKCB 1JQYD 5LMNL 3I73A 2XVSA 3ITPA 2VQFQ 4M8AA 2K01A 3N6RA 1JB7A 2MGSA 1CTMA 1IBLL 2EYLA 4JI8Q 4QJFA 3T1HL 1FD7D 3GTJB 4DV1L 3H94A 1B53A 3F2CA 1TWFB 1XNQL 1N34Q 1PTOB 1CQVA 3EQLC 2NVXB 1E7ZA 1I50H 3M4OB 2EXDA 3S2DB 2DJGC 3J81L 1EYDA 4YCWA 2CWPA 3KLWA 5T1IA 1OXXK 2PZTA 2Q8RE 3C46A 2E2IH 5LMNW 1LABA 1J5EL 3T1YQ 3CCLA 3OW2A 2R93B 2QEJC 1BBUA 4LF9L 1STAA 3J80E 5C4XH 1B44D 1F2YA 4FP5D 4PMWA 4DR6Q 1E2WA 3GD7A 1O7LA 2UXCL 4AYBB 1SMXA 3G7LA 2ES2A 2CW0C 3D6CA 4OGQC 1XJVA 3EJIA 3M7GA 4FF1A 3AEVA 3PO3G 4APVA 5NUCA 1E2ZA 4IFDI 1OTCA 3PO2H 2HT1A 3R2TA 1CI3M 3P75A 3UE1A 1B2TA 4KJOA 1ICWA 4JYAL 1BXTA 4KD4A 4DV1Q 4EVOA 4AQYQ 1HJPA 3CP0A 5ISRA 1PA6A 1ESFA 4A76A 3RNUA 4P74A 4C56C 4A3KB 4BBRH 1U4MA 2UU9Q 3I56A 4B3SL 3A8KE 1SEBD 1G291 4QQBX 4FXGC 1LYLA 1IBML 2JA5G 2UUCQ 2BH2A 3UE0A 2Q2HA 4CHTB 3GTQH 3NUCA 1PHJA 4DV2L 4J6HA 5FJ8G 4BXXH 1EY7A 2UXBQ 1I3QB 3OIQA 1ILPA 2H4OA 3K5LA 3G48A 2NVXH 2KA7A 3L7ZC 1IBKQ 2B2YA 2NWGA 3JAML 5GQOA 2D62A 2E76C 1ENAA 1IW7C 2XN9C 4F7XA 1B4OA 2VB2X 1D1IA 1A8VA 1I6VC 1JB3A 2BH8A 1I94L 4CJ2C 5M3FB 2BOSA 3W1GA 4DR2Q 4Y7NB 3HGBA 3ULJA 3H0GH 1GHJA 5C3XA 1AP0A 1ZYRD 2AMCB 1U4RA 4JW0A 1WTPA 2C9OA 4Z9CB 1NSNS 5C3EG 2NYZD 4P2CB 4DK3C 5GADC 1XMOQ 1SNPA 1ET6A 5LL6S 2WB1B 4C1NI 4K5WA 2KEEA 5EAYA 4JI3L 2Z4HA 4DN4M 5E3FA 5FO9B 3IFTA 1OXUA 4FXDA 1GUGA 2K5VA 5EBDA 4DR6L 1EY8A 4LFAQ 2F3VA 5FKAC 1BQQT 1Y1VB 2WIIB 3KBGA 1D6EC 3DM1A 1QUQA 2LY7A 4IUVA 1V1OA 5ELOA 4ZCKA 3CC2A 2IX1A 3K57A 1KLUD 4A3LH 4EQ5A 4WJ4A 1KDCA 1YBYA 3H09A 3L2PA 4WORA 5HGQA 1EOTA 1R4QB 1NR4A 1B9MA 5CV6A 1DYQA 2B2WC 1F9RA 1L0XB 1EWCA 2NZOA 3VYSA 3SR1A 3A7LA 3V96A 5C0XG 4LF5L 1UEBA 3KBXA 4C3JB 1NR2A 1IBLQ 1WTQA 3M7NA 4DR5Q 5CBAE 4AYBE 1IL2A 5C5LA 1PLFA 4K0KQ 2K75A 3HOYH 2DY8A 3PF4A 1T5EA 1A3VA 2HIVA 3CHBD 4JYAQ 1EEID 1YVCA 2KHJA 3H3VI 3M3YH 1IL8A 1GJXA 2EYHA 2ICEC 5J3BA 1K83H 3P7JA 2F0QA 2E75C 4C3IH 1CKNB 4CDEC 3CXCA 3BZKA 1NJIC 2E8GA 3TEHB 1RD9D 4V0BA 4QUCA 4DR7Q 2AQ2B 5BN3A 2VQEL 4PMCA 5EKIA 1HNXQ 4G7ZC 2AUKA 3U50C 4LWCA 3GTMB 2RDHA 1C8CA 1LTSD 3FKIB 3ULLA 1MSGA 1P8LA 3CU7A 3T53B 4N8FA 3MC0B 1YEZA 1HZBA 5KNBA 3NQIA 2DNEA 4LJZC 3C1EA 2EJFC 4POGA 2JE6I 2E2IB 3A54A 5I4DA 4RFBA 1LO5D 5ELNA 3J81i 1VF5C 5ELDA 4A3DH 4X66L 1VQ9A 3LNNA 3MTSA 4WJ3M 2JA5H 4ULLA 1J6QA 4RCNA 1Q90A 2RBMA 2L4NA 1A3TA 2XNAC 3A5UA 4IUTA 4DKAC 4GOPB 3KK7A 4WJWA 1K9MC 3CCMA 2QF7A 5M5YB 1A0IA 2HCIA 2PQAB 4BA1I 2B63B 2K28A 1O7IA 4K2KA 5E7NA 5G3LF 3M85A 1KDAA 1VF7A 3CCJA 1KL9A 1MSHA 3CF5A 1PH8A 1VQEA 4K5XA 2A8VA 1PTOH 1TS5A 5AJ3Q 5JJZA 1TWFH 4BBSB 3J7AV 3QR8A 1STNA 1E0BA 1WI5A 5CV4A 3SK8A 4LUOA 3BZDB 3J81j 4YWKA 2MQHA 2VS1A 3W5OA 1L1OA 4U673 4N8X1 4KN4C 2ZM6L 3KLRA 3J81c 1PH1A 2PYKA 4LF6Q 3D4WA 2JA5B 4ZK9B 3HEJA 1YHBA 1D5XC 1EYAA 4RH6A 4X3SA 1VDZA 2HUGA 2GVBA 1JOOA 4NW2A 1CSPA 3HRZC 1CZWA 4QIWE 4CKCA 4EGVA 4QGUA 2FXQA 4JBJA 3S2HH 5F2DA 3FVQA 1TXYA 2B3GA 5JJKA 2NVYH 1BCPB 5C0XI 1IZ6A 3PO2B 1XPOA 2I07B 4XYQA 1FVIA 4X62L 4A3GG 5EQ0A 1GO3E 3OMGA 1EYCA 1LACA 1EFID 2A6EC 3KF8B 3H0GB 4X3UA 1SYDA 4KLKA 2L15A 2ZM6Q 3K7UC 1PDQA 5A2QE 3S1RB 1JWSD 2F0SA 4YIJA 3GTGH 3S14H 2SOBA 1ET9A 1S4ZA 4R8IA 1AW7A 3PUWA 2KCCA 5C5MA 2BE5C 1NMGA 3FPPA 1HZ9A 4P73A 2YTYA 5IYCG 3K5NA 2L11A 4K8JA 2WAQB 4F8MA 4JI0Q 1JWUD 4J8QA 1UWVA 3I4MB 2Q2IA 3KF6B 2UXDL 2H5XA 3M4PA 3GTJH 3PUXA 1GUTA 2JA7H 5LMNQ 4OIJA 1B9NA 1HA5A 3HG9A 3DHQA 5BR8L 3CCQA 4DF7A 1JC7A 1EWHA 2EY5A 5M9OA 1O7ZA 1EWIA 2F0MA 1F2MA 2MO1A 4JBKA 1UUPA 2Z6KC 3I4OA 3NTIA 3VYRA 4GLAC 1D1KA 4LF7Q 1ZKOA 3ZJYC 1YHQA 3SDZA 1VQFA 2AKWB 1Y69U 5C4XB 1B7YB 4GZYC 4DGZA 4GN3B 1QNUA 1YNJC 4IO9A 1N36L 4A3LG 2DGYA 1PZKD 4A3JG 2B2VA 1B8AA 3A8JE 4B3SQ 5H1SE 1CKNA 4B3RL 4JK1C 3QIAA 1PTOF 2N3SA 4ALPA 4R4OA 2JA8H 4N9TA 4JI4Q 1HQRD 5JJLA 3G6EA 1S40A 1M8AA 5C44H 2G9HD 2UXCQ 2Q2TA 5CYUA 2N8NA 3SXHA 3I4MH 2B2VC 1PH5A 2B63G 1YNXA 4C1NK 5I6YA 4C2MH 2EJGC 3TBIB 3K5OA 2LXJA 3HKZB 3HOVB 3LGJA 4UP7A 5TSSA 2XIWA 2JP1A 1FNWA 4A3EH 2IX0A 1ONLA 1SJHD 1ZYRC 2YYZA 4DAVA 2WKCA 3BVMA 1EU3A 2VUMH 2L55A 3CRKC 3V05A 2VUMG 4JVZA 2F0IA 3GV6A 4JI4L 3T1HQ 3C2PA 4I65A 1XTCD 3U9OA 1YHAA 3HOZG 4A3BB 1TWHH 5CV9A 3FPUB 1GKHA 1TWHB 2IT1A 2LKVA 4RKLA 4WFN3 4DAMA 1B50A 5FOBB 3Q22A 4A3DG 1MKHA 3SE0A 1UAPA 2DJFC 2RA4A 4GOPC 1WJJA 2JSOA 1XYIA 3QWNA 3QJYA 4TSSA 1Y8PB 5E4WC 3R3OA 3AQQA 5FLXL 1HQMC 1TWCB 1SFOH 2HHHQ 3HKZG 4DR1Q 3V2TA 2QW7A 3M4QA 3GTOH 3OW7A 1STBA 5IYBH 1JOQA 3RN2A 2PNHA 2WP8J 2G5DA 2D5DA 2QGQA 5CR3A 3TP7A 1FNUA 3I4NH 1HZCA 1WYDA 4O42A 2KECA 2RDGA 3W3AA 5CBEE 3TSSA 2RQXA 4NXMQ 1WD1A 3D31A 2A6HC 4HJ7A 1A2UA 1I4RA 1EEFD 3S1QB 1SR3A 1EY4A 4EQPA 1C7YA 2KBNA 1TQOA 3PQIA 4UAIA 1R4PB 1HR0W 4DUYL 3I90A 4YWLA 1V1PA 1Y1WG 3T16A 4B9XA 4JI2Q 1BBXC 3HS0C 1VQJA 1ILQA 1XPUA 3HOYG 2N88A 4XQQA 1CFMA 1TS4A 1X65A 5DAUA 1SYEA 2HIXA 4XYOA 2HCCA 4O2DA 2B63H 3RR5A 1O7YA 2CQAA 1ZEQX 5IGGA 1K8GA 2MP1A 1HCZA 1KQSA 3EA6A 1CKMA 5E1FA 3K0YA 4H0LC 1IXRA 2ZJPA 1X3GA 3RLFA 4KHVA 2Q8TA 4MNOA 3HOVG 1YNND 3R2IA 4DV2Q 4HR7B 4JV5Q 3JAME 1SYFA 4BS9A 5FLMG 5C4JH 3S1QH 3IRBA 4OWWB 2EPBA 3GTLH 3T13A 3VR6A 4EQNA 1VQ6A 1AN8A 4IUUA 2JN4A 5IYDG 5AJ3L 3G6JB 2OXPA 5M5WH 2JA7B 4DV7L 3R93A 1C0AA 1Q82C 1STGA 2RDFA 3ONAB 4LFCL 3I4MG 1RHPA 1F77A 4R1JA 2IWHA 3KLSX 4HIMA 3PSIA 1YNNC 2WB1G 3P1HA 2EYPA 5K36G 2KCNA 4BBRG 1KNAA 2KQ3A 3OIPA 4JI6Q 2EOTA 1QWYA 2PW5A 5D3IB 2CCZA 4RHRA 1U9RA 3DMUA 1W6KA 3S14B 1VQIA 1IW7D 3NELA 4NXNQ 3GTGB 2NTSA 1X3PA 4POFA 1H9SA 2DY7A 4NB3A 5M5YH 2XWBB 4X66Q 4G7HC 1CA5A 2EY6A 2K32A 2KVMA 3BDLA 3MEFA 1N32L 2VW9A 5GAEC 3O13A 3BVGA 3HOZH 4HSVA 1E22A 5DLQE 2R93G 1AZPA 1I4PA 1Y1VH 4R4IA
chains in the Genus database with same CATH topology
4IFDJ 2J0TD 5M5WB 3T51B 1SE3A 1CQFA 2JEAI 2B2TC 2F0HA 4MIUA 1I4XA 1H9KA 1HTPA 3EVQA 5DM73 4C3JG 4A3EB 2NZ1D 1QJOA 3AMUA 1HUMA 4CJ1B 4HEDA 1KABA 1DOMA 3S9WA 1A2TA 1LTGD 1FR3A 1PZJD 2MPMA 1GOZA 1TS3A 1SBBB 3PUZA 5EPKA 1SJED 2CHBD 3L9AX 2F0FA 2EXZA 2NVTB 2IL8A 3HOZB 3DXJC 1SNMA 2KEDA 4KV6A 1BUVT 5EBCA 3NHHA 4KY7A 5JAVA 1Q1EA 5I2YA 5IGFA 1QCBD 3DEPA 5CGKA 1LTAD 1MD2D 4DFAA 4LMQD 2R6GA 1AEXA 1I4GA 5JOBA 1XWEA 3PUYA 4QB4A 5IGEA 4WRDA 4ABNA 4X3TA 1IHZA 3GP7A 2Q8IB 5HURA 4KD3A 1Q8IA 4RCOA 3VR4A 2F0PA 1VMPA 3OWEB 5CC4A 1A3UA 1HUNA 4RGMA 4K6LA 2EY1A 1S5BD 4OO1I 4C3IB 4E6IA 5C4ZA 2R7ZB 4KK7A 3SK6A 2FHTA 4ZUIA 5I6WA 3FDTA 1IYVA 1PTOD 5JEAJ 5D14A 1S5DD 4BWGB 2F0WA 1CHPD 1L0YB 1RODA 3MXPA 1SNDA 3KUPA 1TKWB 3LWEA 2A69C 5JEAG 1ENFA 3FEWX 5T1GA 4ZKBB 3R8BA 5I2XA 4ILWA 5CMDA 3DUZA 4H44C 4NKLA 1HFNA 1AFPA 3BDCA 4R8NA 3OSOA 1X32A 1A6XA 2RSNA 3ZYYX 2OEOA 2F0KA 5JVH3 2NVYB 5KRUA 2HDLA 2X6LA 3S2HB 1Y1WB 1JE4A 2PQEA 5DNFA 1PXUA 4RGTA 3I70A 2A73B 3D3RA 1JORA 2E74C 1PRTB 2IX3A 2LS01 5A2QL 3GTLB 3H6MA 2EY2A 5JEAH 3BG3A 4RGOS 3I4LA 4IURA 4NP5A 4Q0FA 1EZ8A 1BOSA 2WINB 3DEOA 3MAQA 2QCPX 5I9PA 2LMCB 3PUVA 2AUJD 3K6OA 2B8GA 5J1ZA 3HP3A 2LFNA 2MHVA 2TSSA 5JPMC 1Z47A 1CHQD 1BCPC 2WACA 1PYWD 1TS2A 5FO8B 1VCIA 2F03A 3NSWA 2PO4A 3A55A 4DU9A 4F88A 4A3JB 4BBRB 2A74C 4RGNA 2VNUD 5CV7A 2L1BA 4KN7C 3I3CA 1Q12A 2CW0D 4KTAA 1WTVA 1M4VA 4ODGA 1EZ6A 3HZXA 1HFGA 4HTHA 2NN6G 3K7AB 5I9OA 1H9SB 1MBYA 5IGBA 5ELBA 1XXGA 2GA4B 3OOCA 2JA6B 1PTOC 3K5MA 1G6ZA 2EYOA 1BR9A 3MZ5A 3VYUA 1RDPD 3QOLA 5KEEA 3Q24A 4IZ8A 1SNQA 3TZUA 4K2LA 3QO2A 1D5ZC 2NBFA 5ELFA 1X3QA 2F0DA 3BYTB 1DXMA 3ND9A 1STEA 1SMYD 4CKBA 2PCFB 1Z7TA 3PMFA 2A6HD 4Q5VA 1KDBA 1Z6HA 4K14A 2KJXA 3K58A 3GTQB 1CZGA 2B2WA 2BDOA 3J7AF 3PV0A 3RD4A 1TY2A 3CQZB 3GO5A 4OIKA 4XQJA 4N9PA 2K33A 5IT9L 2SDFA 2NUCA 1EIHA 2X6GA 2TMPA 1DONA 1TVXA 2F0GA 1PFBA 1II3A 4QCLA 1RCVD 1B1ZA 3MWYW 1WVLA 2BCOA 4CGYB 1S5ED 3GQBA 4CJ0B 3HOYB 5IGDA 4ID6A 3KF8A 1EU4A 4A3MB 2FINB 1RKNA 5EPJA 1SYCA 5J22A 3NWSA 4OO1H 5A35A 4XXEA 3Q6SA 3K59A 2AWNA 4A3FB 1I6HB 4OL7A 2ZT9C 1LV9A 3LWUA 5CORA 4TKOB 4BY7B 1SSOA 2E2HB 5EGTA 1WTXA 5LL6X 4HSPA 3VA7A 1SAPA 3DWPA 3NXWA 3S15B 3I91A 4EQOA 1V1PB 4DNTB 5J39A 1H9RA 2F0LA 2XSCA 2M9VA 1F2LA 3GTKB 2EJMA 5G3LD 2F0OA 1T5XD 3QG1A 1Y8OB 5IOCA 1I4HA 1MI2A 2L12A 4DK0A 5C3WA 3ERQA 3D4RA 2F0VA 2CVRA 4DA2A 2FMMA 1WTWA 4QIWB 1GHKA 2PMZB 2Z4IA 5EJWA 1ML0D 1JCKB 5KYLA 4CBVA 4RKBA 4TQUS 2D2CC 5IIFA 3PIP3 4IFDH 4ME5A 1C4QA 1DOLA 5E4XA 2PW7A 3NPPA 5C0XH 4XT1B 3OPOA 4IUPA 1HPCA 1WD0A 1GUNA 3HOWB 1PZID 4HCSA 1PRTF 3IAYA 4A3GB 5LHY1 2F0TA 3D6WA 3VYTA 1TY0A 1EY0A 5C44B 5C6AA 3GV3A 1SE4A 1STYA 1QB5D 2F0NA 1BCPF 3OWFA 4K8IA 4QF4A 1Q3LA 2XRQD 2RKSA 5HGTA 3MXGA 1S5CD 5DM63 1DM0B 4FXKC 1S5FD 2SNSA 3L3OC 3OMCA 1Q1BA 1RTOA 4ZRZA 4PMBA 2RSOA 3BYYB 4ZUJA 2O5IC 1PFNA 2A69D 2Z8LA 1JOKA 5IT9E 5JVG3 2B8FA 4KKUA 1EY6A 4DAPA 3BDOA 1KNEA 4M1UB 2X69A 1H9JA 2HQEA 4KMUC 3S17B 3TP8A 3PIO3 2QDBA 2OF1A 3E0JA 4C2MB 1FNVA 3GTOB 2A6ED 4FYDA 3AB9A 5KGUA 2ID0A 1K8OA 3E5SA 4BY1B 1HHVA 4B9WA 2C5CA 4X3KA 4G4KA 3C1FA 3SK5A 3DWAA 2BA1A 1R9TB 4KI0A 3VR5A 4L8JA 3VA5A 2F3WA 1CT1D 2E2JB 4ZQ3A 1PMRA 4CKEA 2EZVA 1BCPD 5EPLA 3S1NB 3BVZA 4FF3A 4XDXA 2BA0A 5EKKA 1PRTD 1HXYD 1STHA 4IUQA 2F0UA 4KY5A 2PPBC 2JEBI 2JXMB 2NVQB 1LTRD 3WOEA 1W6JA 4DK1A 2MUYA 4L6TB 4PV1C 4PQXA 4QMGA 1O80A 5K5PA 2B39A 2WKDA 4H7BA 3VR3A 3TMEA 1O78A 3NE5B 2PZWA 1YNJD 3UI2A 1TR5A 1TU2B 2K1BA 2Z1CA 3GTPB 1BDOA 1A15A 1HA6A 3RUZA 5IODA 4L63B 4C3HG 1V43A 4IN3A 2A68C 1K83B 1LT4D 1I4QA 2DN8A 1U4PA 3S16B 1BO0A 1GUOA 4R9WA 2OT2A 1FYCA 2ENBA 2SNMA 1PRTC 2K05A 5D3DA 3VR2A 1Y8NB 1LTTD 5C4HA 4PNYA 3S1MB 3AU7A 1RTNA 1HRJA 2NN6H 1SE2A 1VMCA 3I4NB 3TP5A 3T56B 2K6AA 5EKLA 3WDNA 4LAAA 3X3MA 2EDGA 1BF4A 4BA2I 2L0CA 1QOHA 4NDXA 2A68D 5BN4A 1OXVA 3URYA 3SHLA 3I8ZA 3MXNA 4XQNA 2IPKD 3EFXD 3D4DA 1RJTA 1EQTA 4C3IG 2K03A 3A56A 4LK1C 3J81E 1K8MA 4G7OC 5CV5A 4KY6A 2MJ8A 5KNDA 3C3LA 3CRLC 3TDQA 1V8QA 3RMHA 3J7YW 1IYUA 2NB0A 3M3YB 3SVMA 1CM9A 2HDMA 1G91A 4S3SA 4DAYA 1TIID 4FVMA 2IW3A 3NWTA 1LT5D 4XT3B 1NAPA 1GXDC 4RA8A 3FRPB 4KJNA 1C48A 2B2TA 2IJ0A 1NUCA 2FFKB 3MFYA 5C0XJ 5KYIA 3MEHA 1J8IA 3H91A 1WCMB 2AWOA 1QNKA 1SMYC 2QKIC 3KLSA 2ZXOA 4V190 5FLXE 4IFDG 3NBIA 3WOFA 1F9QA 1SYBA 3NTKA 2FMCA 2KHSA 4B08A 1OXTA 4A3DB 1AZQA 1LTBD 4UDUC 3IL8A 4U68A 1SNCA 3BS1A 1SDFA 5JPNC 1EY5A 2R61A 2J7ZA 1KLGD 1EQVA 2M00A 4MHEA 5C4JB 2JA8B 3DWQA 4TRDA 2K5WA 4ZLTF 2N55A 3IFDA 1JWMD 2F4IA 3NK9A 3OHXC 2YU9B 1QILA 5ELEA 1DZ1A 3NQTA 3SK4A 2ZXRA 5KIXA 2PNRC 3NBHA 4I7ZC 2E2DC 3LX0A 1I50B 4IUNA 1DD2A 1H9MA 1KAAA 3NTHA 1F2ZA 5M3MB 5CV8A 4JBWA 4F87A 1FGBD 2VUMB 1XX8A 3Q0AA 2O4XA 4KKSA 2K5QA 4FF2A 3T4AC 5KNCA 1OO9B 2Y0SB 1G8ZD 2K7VA 3W2DA 4RHSA 4MN3A 4HN7A 2F0JA 3MA2B 2O2LD 3QOJA 2VXWA 2K5DA 1CK1A 4DNRB 1QE6A 3HOXB 5ELCA 1EIGA 5DEHA 1PFMA 3PO3B 4J1MA 2BDNA 1SFOB 2AQ1B 4XIGS 4ZYSA 4DXGA 2G9DA 3N52A 4KHZA 4FO2A 4QUFA 1G2TA 1LT3D 1ESRA 3IKJA 2B2YC 2F1MA 3SEBA 1LLRD 4NMZA 1OXSC 1QG7A 2NTTA 4HAEA 1D5MC 2WV6D 3F2UA 3D8GA 1E2VA 1IKLA 3A7AB 1DCZA 4OO1G 5BN5A 1SXTA 3MFGA 1MGSA 2V4DA 5FO7B 1TWGB 2B2UC 3P20A 5D65A 4K6DA 5COYA 1WTRA 1TWAB 2PZUA 3M4YA 3QB3A 3RZOB 3J80L 4XTCS 2A5HA 2XWJB 1D2BA 4O1NA 3EROA 4K5VA 4RAUC 2KUMA 3TN2A 1CA6A 2RVLA 3A8IE 4RWSC 1LTID 2ZXPA 3CKIB 2M2LA 4A93B 3MXUA 1F9SA 2D9UA 1EL0A 1HTLD 2F0EA 1KTKA 1JICA 2R3ZA 2XRSD 4HMIA 1F9PA 4ZAIA 1ENCA 2L9HA 4FF4A 3HOUB 3X3NA 2FJ2A 2SEBD 2EVBA 5M5XB 2ICIA 2DNCA 2I46A 1G2SA 3FMCA 4KKTA 2O5JC 1TT2A 4HCEA 2EE1A 2KOLA 3TP6A 1RF2D 2NN6I 1GUSA 1NCVA 2EYJA 4IALA 2K04A 4G57A 1DOKA 3ND8A 3MVVA 4OHJA 2H1EA 3MHBA 3RZDB 4DXFA 1U4LA 5IGCA 2R92B 2BE5D 3E6ZX 1WTOA 4FNFA 1IKMA 1JR0D 1EY9A 1GUWA 2J4XA 1SYGA 2L5TA 5K36H 1ZXTA 5AFWA 2JYOA 4IQZA 2B2UA 1B3AA 5FK9C 2EYMA 1LT6D 1BNZA 4H13C 3Q23A 3U9SA 5C3EB 2AQ3B 4HMJA 3TZDA 4C3HB 2EYFA 3NP8A 2QILA 4A3IB 3I72A 1J9OA 1SNOA 1UEAB 2VB3X 1DJRD 3H3VC 1UNSA 4ZKCB 1JQYD 3I73A 2XVSA 3ITPA 4M8AA 2K01A 3N6RA 2MGSA 1CTMA 2EYLA 1FD7D 3GTJB 3H94A 1B53A 1TWFB 1PTOB 1CQVA 3EQLC 2NVXB 3M4OB 3S2DB 3J81L 1EYDA 5T1IA 1OXXK 2PZTA 2Q8RE 3C46A 1LABA 2R93B 2QEJC 1STAA 3J80E 1B44D 1F2YA 4FP5D 4PMWA 1E2WA 3GD7A 1O7LA 4AYBB 3G7LA 2CW0C 3D6CA 4OGQC 3EJIA 3M7GA 4FF1A 5NUCA 1E2ZA 4IFDI 3R2TA 1CI3M 3P75A 1B2TA 4KJOA 1ICWA 1BXTA 4KD4A 4EVOA 5ISRA 1ESFA 4C56C 4A3KB 1U4MA 3A8KE 1SEBD 1G291 4FXGC 4CHTB 3NUCA 4J6HA 1EY7A 1I3QB 3OIQA 1ILPA 2H4OA 3K5LA 2KA7A 3L7ZC 2B2YA 2NWGA 3JAML 2D62A 2E76C 1ENAA 1IW7C 2XN9C 4F7XA 1B4OA 2VB2X 1D1IA 1I6VC 1JB3A 4CJ2C 5M3FB 2BOSA 4Y7NB 3HGBA 1GHJA 5C3XA 1AP0A 1ZYRD 1U4RA 1WTPA 2C9OA 4Z9CB 1NSNS 2NYZD 4P2CB 1SNPA 1ET6A 5LL6S 2WB1B 4C1NI 4K5WA 2KEEA 2Z4HA 4DN4M 5E3FA 5FO9B 3IFTA 1OXUA 4FXDA 1GUGA 5EBDA 1EY8A 2F3VA 5FKAC 1BQQT 1Y1VB 2WIIB 3KBGA 1D6EC 3DM1A 2LY7A 4IUVA 1V1OA 2IX1A 3K57A 1KLUD 1KDCA 3H09A 4WORA 1EOTA 1R4QB 1NR4A 1B9MA 5CV6A 1DYQA 2B2WC 1F9RA 1L0XB 1EWCA 3VYSA 3SR1A 3A7LA 3V96A 5C0XG 3KBXA 4C3JB 1NR2A 1WTQA 3M7NA 5CBAE 5C5LA 1PLFA 2DY8A 1T5EA 1A3VA 3CHBD 1EEID 1IL8A 1GJXA 2EYHA 2ICEC 3P7JA 2F0QA 2E75C 1RD9D 4V0BA 4QUCA 2AQ2B 5BN3A 4PMCA 5EKIA 4G7ZC 2AUKA 3GTMB 2RDHA 1C8CA 1LTSD 3FKIB 1MSGA 3CU7A 3T53B 3MC0B 5KNBA 3NQIA 2DNEA 4LJZC 3C1EA 2EJFC 2JE6I 2E2IB 3A54A 5I4DA 4RFBA 1LO5D 1VF5C 5ELDA 3LNNA 3MTSA 4ULLA 4RCNA 1Q90A 2RBMA 2L4NA 1A3TA 2XNAC 4IUTA 3KK7A 4WJWA 2QF7A 5M5YB 4BA1I 2HCIA 2B63B 2K28A 4K2KA 5G3LF 3M85A 1KDAA 1VF7A 1MSHA 4K5XA 1TS5A 1PTOH 5JJZA 4BBSB 3J7AV 1STNA 1E0BA 5CV4A 3SK8A 3BZDB 4U673 4KN4C 3KLRA 2PYKA 3D4WA 2JA5B 4ZK9B 3HEJA 1D5XC 1EYAA 4RH6A 4X3SA 1VDZA 2HUGA 1JOOA 4NW2A 4CKCA 3HRZC 1CZWA 4EGVA 5F2DA 3FVQA 1BCPB 5C0XI 3PO2B 2I07B 4XYQA 5EQ0A 3OMGA 1EYCA 1LACA 1EFID 2A6EC 3H0GB 4X3UA 1SYDA 1PDQA 5A2QE 3S1RB 1JWSD 2F0SA 4YIJA 2SOBA 1ET9A 1S4ZA 4R8IA 1AW7A 3PUWA 2KCCA 5C5MA 2BE5C 3FPPA 3K5NA 2L11A 4K8JA 2WAQB 4F8MA 1JWUD 4J8QA 3I4MB 3PUXA 1GUTA 4OIJA 1B9NA 1HA5A 3HG9A 3DHQA 4DF7A 1JC7A 1EWHA 2EY5A 5M9OA 1O7ZA 2F0MA 1F2MA 1UUPA 3NTIA 3VYRA 1D1KA 1ZKOA 3SDZA 1Y69U 5C4XB 4GZYC 4DGZA 1QNUA 1YNJC 1PZKD 2B2VA 3A8JE 4JK1C 3QIAA 1PTOF 4N9TA 1HQRD 1M8AA 2G9HD 5CYUA 3SXHA 2B2VC 4C1NK 5I6YA 2EJGC 3TBIB 3K5OA 3HKZB 3HOVB 5TSSA 2XIWA 2JP1A 1FNWA 2IX0A 1ONLA 1SJHD 1ZYRC 2YYZA 4DAVA 2WKCA 3BVMA 1EU3A 2L55A 3CRKC 3V05A 2F0IA 3GV6A 3C2PA 4I65A 1XTCD 3U9OA 4A3BB 5CV9A 3FPUB 1TWHB 2IT1A 2LKVA 4RKLA 4WFN3 1B50A 5FOBB 3Q22A 3SE0A 1UAPA 2RA4A 2JSOA 1XYIA 3QWNA 3QJYA 4TSSA 1Y8PB 5E4WC 3R3OA 5FLXL 1HQMC 1TWCB 3V2TA 3OW7A 1STBA 1JOQA 2WP8J 3TP7A 2D5DA 5CR3A 1FNUA 4O42A 2KECA 2RDGA 3W3AA 5CBEE 3TSSA 2RQXA 1WD1A 3D31A 2A6HC 1A2UA 1I4RA 1EEFD 3S1QB 1EY4A 4EQPA 1TQOA 4UAIA 1R4PB 3I90A 1V1PA 3T16A 4B9XA 1BBXC 3HS0C 1ILQA 2N88A 4XQQA 1CFMA 1TS4A 5DAUA 1SYEA 4XYOA 2HCCA 1O7YA 2CQAA 1ZEQX 5IGGA 2MP1A 1HCZA 3EA6A 5E1FA 3K0YA 4H0LC 3RLFA 4KHVA 2Q8TA 1YNND 3R2IA 4HR7B 3JAME 1SYFA 4BS9A 2EPBA 3T13A 3VR6A 4EQNA 1AN8A 4IUUA 3G6JB 2OXPA 2JA7B 3R93A 1STGA 2RDFA 3ONAB 1RHPA 1F77A 2IWHA 3KLSX 1YNNC 3P1HA 2EYPA 5K36G 2KCNA 1KNAA 2KQ3A 3OIPA 2EOTA 1QWYA 2PW5A 5D3IB 4RHRA 1U9RA 3DMUA 1W6KA 3S14B 1IW7D 3GTGB 2NTSA 1X3PA 1H9SA 2DY7A 2XWBB 4G7HC 1CA5A 2EY6A 2K32A 2KVMA 3BDLA 3O13A 3BVGA 4HSVA 1AZPA 1I4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KDB A;  4K14 A;  4K6D A;  4PMB A;  3SK6 A;  3NQT A;  4ZUI A;  4ZUJ A;  3D4D A;  3SK4 A;  2EYM A;  5J1Z A;  3SXH A;  5I6W A;  5KIX A;  1A3V A;  2F0H A;  4MIU A;  2PZU A;  3EVQ A;  3QB3 A;  5J39 A;  1JOK A;  4HMJ A;  5DAU A;  2PYK A;  1SYE A;  2EYH A;  3D4W A;  5CV5 A;  2EYF A;  2F0L A;  3LX0 A;  5I6Y A;  3HEJ A;  3NUC A;  4KY6 A;  3NP8 A;  4J6H A;  2WAC A;  4IUN A;  5IGG A;  2F0Q A;  3ERO A;  4QMG A;  1EYA A;  1KAA A;  2F0W A;  4K5V A;  1EY7 A;  1JOO A;  1F2Z A;  1EY6 A;  5E1F A;  3MXP A;  5K5P A;  1SND A;  1KAB A;  5CV8 A;  4H7B A;  4KHV A;  2F0O A;  5F2D A;  3S9W A;  1A2T A;  3TME A;  1SNO A;  2O4X A;  2PZW A;  4N9P A;  4S3S A;  4PMC A;  4DU9 A;  2NUC A;  3OMG A;  1TR5 A;  1ENA A;  1EYC A;  4F7X A;  2HQE A;  1SYF A;  5IOC A;  3TP8 A;  1SYD A;  2F0F A;  2QDB A;  2F0I A;  2F0E A;  3ITP A;  2F0J A;  2OF1 A;  4NKL A;  4HMI A;  5CV7 A;  5C3W A;  2EXZ A;  2F0G A;  3QOJ A;  4I65 A;  3U9O A;  2F0S A;  3ERQ A;  4KJN A;  1II3 A;  4YIJ A;  3RUZ A;  5C3X A;  2EYL A;  3BDC A;  5CV9 A;  5IOD A;  4KTA A;  1NUC A;  2F0V A;  3T13 A;  1ENC A;  4R8N A;  2LKV A;  2SOB A;  4ODG A;  3C1E A;  1EZ6 A;  3OSO A;  4RKL A;  5DEH A;  5C5M A;  4EQN A;  1SNM A;  4KV6 A;  3HZX A;  1NSN S;  5KYL A;  3NHH A;  5M9O A;  4HTH A;  1SNP A;  3MEH A;  4KY7 A;  4RKB A;  5I9O A;  5KGU A;  4E6I A;  5KYI A;  2OXP A;  4K5W A;  5IGD A;  5JAV A;  3E5S A;  1EYD A;  5IGF A;  5E3F A;  4ID6 A;  4J1M A;  4K8J A;  2PZT A;  5CGK A;  5IGB A;  1TT2 A;  4B9W A;  4F8M A;  1STG A;  5IIF A;  2OEO A;  2F0K A;  2RDF A;  1RKN A;  3C1F A;  4ME5 A;  3SK5 A;  3TP6 A;  4DFA A;  4EQO A;  5KRU A;  3R3O A;  2ENB A;  2SNM A;  2RBM A;  1EY8 A;  1AEX A;  1A3T A;  1SYC A;  1SYB A;  2EYJ A;  2PQE A;  2EYO A;  2F3V A;  5IGC A;  5C4H A;  1STA A;  5J22 A;  2KHS A;  3DHQ A;  4IAL A;  5JOB A;  4PNY A;  2PW7 A;  3MZ5 A;  3P1H A;  3V2T A;  2F3W A;  3VA5 A;  4DF7 A;  1F2Y A;  4ZQ3 A;  2EYP A;  4QB4 A;  1STB A;  2EY5 A;  1JOQ A;  4G57 A;  4K2K A;  5IGE A;  4NMZ A;  2F0M A;  1SNC A;  4WRD A;  5CR3 A;  1F2M A;  3TP7 A;  1JOR A;  3QOL A;  2KQ3 A;  1KDA A;  1EY5 A;  1IHZ A;  3MVV A;  5KEE A;  2PW5 A;  2F0T A;  1U9R A;  3DMU A;  3TP5 A;  1KDC A;  3D6C A;  1EY0 A;  3EJI A;  3H6M A;  5HUR A;  4IZ8 A;  1SNQ A;  2EY2 A;  3D8G A;  4KD3 A;  4OL7 A;  5EKL A;  1EQV A;  4LAA A;  5C6A A;  2M00 A;  4K5X A;  3MHB A;  4K2L A;  4WOR A;  1A2U A;  5NUC A;  5EKK A;  1STY A;  2F0N A;  5CV6 A;  1EY4 A;  2F0P A;  4TRD A;  4DGZ A;  3OWF A;  4K8I A;  2EY6 A;  1STH A;  4NDX A;  4NP5 A;  4QF4 A;  4EQP A;  2F0D A;  3BDL A;  1TQO A;  2RKS A;  3SR1 A;  1STN A;  5HGT A;  2F0U A;  1EY9 A;  1EZ8 A;  3P75 A;  5CV4 A;  5EGT A;  3SK8 A;  3SHL A;  3NK9 A;  5CC4 A;  4KJO A;  1A3U A;  4KY5 A;  3T16 A;  4B9X A;  1SYG A;  2EY1 A;  4KD4 A;  3PMF A;  4N9T A;  5I9P A;  4EVO A;  3NXW A;  2SNS A;  3OMC A;  5ISR A;  5C5L A;  5C4Z A; 
#chains in the Genus database with same CATH topology
 4IFD J;  2J0T D;  5M5W B;  1I3Q H;  1KC8 C;  3T51 B;  1SE3 A;  1CQF A;  2JEA I;  4HJA A;  2B2T C;  2F0H A;  4MIU A;  1I4X A;  1H9K A;  1HTP A;  3EVQ A;  5DM7 3;  3JAM i;  1VQO A;  1KXL A;  4C3J G;  2UUB Q;  4A3E B;  2NZ1 D;  2I5L X;  3CCR A;  2JA6 H;  1QJO A;  2Z6B A;  3AMU A;  2XGT A;  1K0R A;  1SLJ A;  1HUM A;  4CJ1 B;  3E3X A;  4HED A;  1KAB A;  1DOM A;  3S9W A;  1A2T A;  1LTG D;  1GVP A;  1FR3 A;  1PZJ D;  3G71 A;  2MPM A;  1GOZ A;  1TS3 A;  4X65 L;  1SBB B;  3PUZ A;  2UUC L;  3RLO A;  5EPK A;  1SJE D;  4K0K L;  4JI1 L;  2CHB D;  3L9A X;  2OWO A;  2F0F A;  5FLM H;  3OYY A;  2EXZ A;  2NVT B;  2A19 A;  1EUJ A;  2IL8 A;  1HR0 Q;  4B3R Q;  4DV6 Q;  3HOZ B;  3DXJ C;  1MJE A;  1U5K A;  5IWA L;  2RCF A;  1SNM A;  2KED A;  4KV6 A;  1KRT A;  1ASZ A;  1BUV T;  5EBC A;  3NHH A;  2ZJQ A;  4KY7 A;  2C35 B;  5JAV A;  1Q1E A;  5I2Y A;  5IGF A;  1QCB D;  1VQN A;  3DEP A;  5CGK A;  1LTA D;  1MD2 D;  1KIX A;  1QVC A;  4DFA A;  5IT9 c;  4DR5 L;  2V1C C;  4LMQ D;  1SRU A;  3S2D H;  2R6G A;  1AEX A;  4P75 A;  3KDF B;  1I4G A;  5JOB A;  5HY6 A;  2RHS B;  1XWE A;  2JQO A;  3PUY A;  4QB4 A;  4JI1 Q;  3UDI A;  2R92 G;  5IGE A;  2JK8 A;  3U4Z A;  1SN8 A;  1UE7 A;  4WRD A;  2VZA A;  4ABN A;  4X3T A;  1IHZ A;  3GP7 A;  2Q8I B;  3GTP H;  5HUR A;  4KD3 A;  5M5X H;  4AYB G;  1Q8I A;  4RCO A;  4B3T L;  3VR4 A;  2F0P A;  1VMP A;  3OWE B;  1UE6 A;  3ICE A;  3F2D A;  1E1O A;  3CCV A;  1XMO L;  5CC4 A;  1A3U A;  1K73 C;  1HUN A;  4RGM A;  4K6L A;  4AIM A;  2EY1 A;  1S5B D;  4OO1 I;  2KHI A;  4C3I B;  4E6I A;  5C4Z A;  1I5F A;  2R7Z B;  1XNR L;  2R7Z H;  4KK7 A;  3SK6 A;  2FHT A;  4ZUI A;  2F4V L;  3RZO H;  3KJP A;  5I6W A;  3FDT A;  2DUD A;  1IYV A;  1PTO D;  4OWT B;  5JEA J;  1X54 A;  5D14 A;  5GAH C;  4BY1 H;  1S5D D;  4QY7 A;  4BWG B;  2F0W A;  4B3M L;  1CHP D;  1L0Y B;  2PMZ E;  1ROD A;  3CCE A;  3MXP A;  1SND A;  3KUP A;  1TKW B;  3LWE A;  4IJL A;  2A69 C;  5JEA G;  1ENF A;  2B29 A;  3FEW X;  5T1G A;  2KCT A;  4ZKB B;  3R8B A;  2PI2 A;  5I2X A;  4DR1 L;  3M9B A;  1WTH A;  4ILW A;  5CMD A;  4GN5 A;  3HOV H;  3DUZ A;  4H44 C;  4NKL A;  2I5H A;  1HFN A;  3SGI A;  4HJ5 A;  2UU9 L;  1AFP A;  3BDC A;  3D0F A;  4R8N A;  3S1N H;  4AQY L;  4RMF A;  2Y0S E;  3HKS A;  3OSO A;  4JI5 L;  1ICF B;  1YJN A;  5IE8 A;  5C4X G;  1X32 A;  2UUA L;  1A6X A;  2RSN A;  3ZYY X;  2OEO A;  2F0K A;  5JVH 3;  1MIU A;  2NVY B;  5KRU A;  2HDL A;  1G51 A;  2X6L A;  3S2H B;  1Y1W B;  1D7Q A;  1JE4 A;  2CH4 W;  1PH6 A;  2PQE A;  5DNF A;  2PI2 E;  1PXU A;  4RGT A;  2RCN A;  3I70 A;  5GRO A;  2A73 B;  3D3R A;  3A5Z B;  1JOR A;  2E74 C;  1PRT B;  4HID A;  2IX3 A;  2LS0 1;  5A2Q L;  1P16 A;  4UP9 A;  1HH2 P;  4YHH L;  1M90 C;  3GTL B;  3H6M A;  2EY2 A;  4HJ8 A;  5IP7 H;  4DV5 L;  5JEA H;  3BG3 A;  4RGO S;  3I4L A;  4IUR A;  4A3F H;  4L5T A;  1WOC A;  4NP5 A;  1A62 A;  4Q0F A;  4BBS G;  1EZ8 A;  3L0O A;  1BOS A;  2WIN B;  3DEO A;  3MAQ A;  2QCP X;  5GAG C;  1VQH A;  5I9P A;  2LMC B;  2F3I A;  3EBE A;  4DV6 L;  3PUV A;  2AUJ D;  3K6O A;  2B8G A;  5J1Z A;  1NY4 A;  3HP3 A;  1X9N A;  4IPC A;  2LFN A;  2EQS A;  2MHV A;  4DR7 L;  2ZTD A;  2TSS A;  5JPM C;  1Z47 A;  2RF4 A;  1CHQ D;  1BCP C;  2WAC A;  1PYW D;  1TS2 A;  5FO8 B;  3PGZ A;  1YIT A;  1IYJ B;  4LF4 L;  5IYC H;  1VCI A;  1QVF A;  5IY0 A;  1TWG H;  4C3J H;  4EX5 A;  2F03 A;  3NSW A;  4LF4 Q;  2PO4 A;  3A55 A;  4DU9 A;  4F88 A;  3K0X A;  1Q7Y C;  4A3J B;  1V9P A;  5BR8 Q;  2ZTE A;  4BBR B;  2A74 C;  3K81 C;  4RGN A;  3KDF A;  4GOP A;  2VNU D;  1EFW A;  3TS0 A;  2WFW A;  5CV7 A;  2L1B A;  4GNX C;  4MTN A;  4KN7 C;  1L1O C;  3I3C A;  4A3G H;  1Q12 A;  1X56 A;  2R7F A;  2CW0 D;  4JI0 L;  1VQC A;  3WWV A;  3KYH C;  4KTA A;  1WTV A;  3E9I A;  1M4V A;  1VQ7 A;  4ODG A;  1EZ6 A;  1WFQ A;  3HZX A;  4GKJ Q;  1HFG A;  4HTH A;  2NN6 G;  3K7A B;  5I9O A;  2E2J H;  1H9S B;  1MBY A;  3JAM c;  1CKO A;  4A93 H;  5IGB A;  3STB C;  1M1K C;  5ELB A;  1XXG A;  2GA4 B;  3OOC A;  2JA6 B;  1JJC B;  4R4C A;  3HKZ E;  1KAW A;  1PTO C;  1EYG A;  3K5M A;  3J7Z C;  4LFB L;  3RN5 A;  1G6Z A;  2EYO A;  1BR9 A;  3MZ5 A;  2AHO B;  1GD7 A;  3Q8D A;  3VYU A;  3CME A;  1HNW Q;  1RDP D;  3QOL A;  2QEX A;  1HNX L;  1PH4 A;  5KEE A;  3Q24 A;  3K80 C;  4DPG A;  1K8A C;  4IZ8 A;  1SNQ A;  3TZU A;  3T1Y L;  4LF8 Q;  4DAY B;  4K2L A;  5M3F G;  1NBW A;  3QO2 A;  2XTI A;  1HNZ Q;  1D5Z C;  2NBF A;  5M3F H;  4L5R C;  5JJI A;  5ELF A;  4O0A A;  1LTL A;  1X3Q A;  2F0D A;  3BYT B;  1DXM A;  3FHW A;  3ND9 A;  4UPA A;  1STE A;  3CPF A;  1SMY D;  4HJ9 A;  4CKB A;  4R4T A;  2PCF B;  1Z7T A;  3PMF A;  3FKI G;  2A6H D;  4Q5V A;  1KDB A;  1Z6H A;  4K14 A;  4LW1 A;  4IPH A;  3GTK H;  2VQF L;  1QZH A;  2KJX A;  4YY3 L;  2QA4 A;  3K58 A;  3GTQ B;  3MXN B;  1VQM A;  1CZG A;  2B2W A;  2BDO A;  3J7A F;  3PV0 A;  3RD4 A;  1TY2 A;  1VQ4 A;  1PH9 A;  3UDX A;  3CQZ B;  3GO5 A;  4OIK A;  4XQJ A;  4N9P A;  2K33 A;  5IT9 L;  2SDF A;  2NUC A;  4PZ7 A;  1EIH A;  2X6G A;  2OCE A;  3TS2 A;  2TMP A;  4Y7N H;  1DON A;  1VS0 A;  3HOU H;  4A3F G;  1TVX A;  2F0G A;  1PFB A;  1II3 A;  4QCL A;  4DV7 Q;  1D8L A;  1TWA H;  1N8R C;  1RCV D;  1B1Z A;  3MWY W;  1WVL A;  2BCO A;  4CGY B;  1S5E D;  3GQB A;  1L1O B;  3RLN A;  4CJ0 B;  3NBH B;  3HOY B;  5IGD A;  4ID6 A;  5IP9 G;  2F52 A;  1EU4 A;  3KF8 A;  2R7Z G;  4A3M B;  2FIN B;  3EIV A;  1RKN A;  4NXN L;  3I7F A;  5EPJ A;  1HNW L;  1SYC A;  1FL0 A;  3KJO A;  2ZJR A;  3S1R H;  5J22 A;  3J7A 5;  4JV5 L;  1UE1 A;  4R4Q A;  2JA8 G;  3NWS A;  4B3T Q;  4LFB Q;  4OO1 H;  1B70 B;  2N49 A;  4DUZ Q;  5A35 A;  4XXE A;  3Q6S A;  3U4V A;  3K59 A;  2AWN A;  4MZ9 A;  1NTG A;  4A3F B;  1I6H B;  4OL7 A;  4DV3 Q;  1X55 A;  2ZT9 C;  1LV9 A;  1EQR A;  3LWU A;  1BBW A;  5COR A;  4L5S A;  4TKO B;  4BY7 B;  1SSO A;  4H02 A;  2E2H B;  1K0S A;  5EGT A;  1WTX A;  5LL6 X;  2NZH A;  4LF9 Q;  4HSP A;  3H15 A;  2VL6 A;  3VA7 A;  1SAP A;  3DWP A;  4X64 Q;  3NXW A;  3S15 B;  3I91 A;  4EQO A;  4GNX A;  3AFP A;  1V1P B;  4UHV A;  4DNT B;  2WAQ E;  5J39 A;  4PZ6 A;  1H9R A;  1Y1W H;  1KRS A;  1CSQ A;  2F0L A;  2Z6K A;  1YJ9 A;  2XSC A;  5IP9 H;  2M9V A;  1F2L A;  3GTK B;  5L37 A;  2EJM A;  5G3L D;  2F0O A;  4JI7 Q;  1T5X D;  3CCS A;  1UE5 A;  3QG1 A;  4NPS A;  3S24 A;  1Y8O B;  4YCU A;  2HD3 A;  5IOC A;  1I4H A;  1MI2 A;  3KFU A;  5FLX c;  2L12 A;  2R92 H;  4DK0 A;  2UXD Q;  5C3W A;  1XNR Q;  3ERQ A;  4LF8 L;  4IOA A;  3D4R A;  2F0V A;  2CVR A;  4DA2 A;  2FMM A;  1WTW A;  4QIW B;  1GHK A;  3CMA A;  2PMZ B;  2Z4I A;  5EJW A;  1ML0 D;  4CDD C;  1JCK B;  5KYL A;  2WAQ G;  4CBV A;  4GKK Q;  4RKB A;  3CD6 A;  4IPD A;  2OQ0 A;  1WCM G;  4TQU S;  4A3I H;  4JI7 L;  2D2C C;  5IIF A;  3PIP 3;  4IFD H;  4ME5 A;  2JJQ A;  4JOI C;  4NXM L;  1C4Q A;  1DOL A;  5E4X A;  2E2H H;  3BJU A;  2JA9 A;  2Y0S G;  2PW7 A;  3NPP A;  2K5N A;  5C0X H;  4XT1 B;  3OPO A;  4IUP A;  1HPC A;  1WD0 A;  1GUN A;  3JC6 6;  1PZI D;  3HOW B;  2K14 A;  4HCS A;  1PRT F;  2K4K A;  3IAY A;  4A3G B;  5LHY 1;  2F0T A;  4JOI A;  3D6W A;  3VYT A;  1TY0 A;  1BVS A;  1EY0 A;  5C44 B;  1VQP A;  3S17 H;  5C6A A;  3GTM H;  3GV3 A;  1SE4 A;  2GVA A;  1QB5 D;  1STY A;  2F0N A;  1BCP F;  3OWF A;  4K8I A;  4QF4 A;  3FP9 A;  1Q3L A;  2XRQ D;  2RKS A;  5HGT A;  3OTO Q;  1S3O A;  3MXG A;  1S5C D;  5DM6 3;  4UY8 C;  2QDL A;  2YTX A;  1QVG A;  1DM0 B;  4FXK C;  1S5F D;  2SNS A;  3L3O C;  3OMC A;  1Q1B A;  4DR4 Q;  3CAM A;  1RTO A;  2LXK A;  2D0P A;  4DR3 L;  4ZRZ A;  4PMB A;  2RSO A;  3BYY B;  4ZUJ A;  2O5I C;  1PFN A;  2A69 D;  2Z8L A;  5LMU L;  1JOK A;  2R93 H;  5IT9 E;  5JVG 3;  2B8F A;  2RHQ B;  4A93 G;  1WCM H;  4A3I G;  1VQ8 A;  4KKU A;  1Y14 B;  1EY6 A;  1PFS A;  4DAP A;  3H0G G;  5M3M G;  3BDO A;  4GLV B;  1KNE A;  4M1U B;  1VQ5 A;  3F2B A;  1YI2 A;  1GM5 A;  2X69 A;  1H9J A;  2HQE A;  1AH9 A;  1Q46 A;  4KMU C;  3S17 B;  3TP8 A;  3PIO 3;  1K3B C;  3NEN A;  2QDB A;  1PH2 A;  2OF1 A;  4HIO A;  3E0J A;  3I4N G;  4DR4 L;  4C2M B;  1PYS B;  1JE5 A;  1FNV A;  4JI2 L;  3GTO B;  2A6E D;  4A3E G;  4FYD A;  3AB9 A;  2R7D A;  5KGU A;  2ID0 A;  3OTO L;  1K8O A;  3E5S A;  4BY1 B;  4IPG A;  1YIJ A;  1HHV A;  4B9W A;  2C5C A;  4X3K A;  1XPR A;  4G4K A;  3C1F A;  3PCO B;  3SK5 A;  2Z9H A;  3CQZ H;  1R9T H;  4A3M G;  3DWA A;  3K8A A;  2BA1 A;  1R9T B;  4KI0 A;  4BY1 G;  4YCV A;  4DV0 Q;  3DM3 A;  3VR5 A;  4L8J A;  3VA5 A;  2F3W A;  1I94 Q;  1CT1 D;  1AE3 A;  3CW2 C;  4ZQ3 A;  2E2J B;  1PMR A;  4CKE A;  3S15 H;  2EZV A;  5C3E H;  1BCP D;  5EPL A;  3AYH B;  3HFZ B;  3S1N B;  3BVZ A;  4KHP L;  4FF3 A;  4CDF C;  4XDX A;  5M3M H;  2BA0 A;  1PVO A;  5EKK A;  4JCV E;  1DGS A;  1PRT D;  1HXY D;  1STH A;  4IUQ A;  1FJG Q;  1A63 A;  2F0U A;  3EN2 A;  4CDC C;  4JG2 A;  1HNZ L;  4KY5 A;  2PPB C;  2JEB I;  1ASY A;  2JXM B;  1L0W A;  2NVQ B;  3F1Z A;  2VY3 A;  2KEN A;  1LTR D;  3WOE A;  4LF5 Q;  4BXX G;  4P72 A;  1W6J A;  4A3M H;  4DK1 A;  2MUY A;  4L6T B;  1AE2 A;  4PV1 C;  2Z0S A;  4PQX A;  4X62 Q;  4OX9 Q;  3K7A H;  4QMG A;  4YHH Q;  4P71 A;  1O80 A;  1EIF A;  5K5P A;  2B39 A;  2WKD A;  4H7B A;  3VR3 A;  3ER0 A;  3TME A;  1O78 A;  3NE5 B;  2PZW A;  3DLL A;  1YNJ D;  3UI2 A;  1TR5 A;  3A0J A;  1TU2 B;  1VQD A;  3STB D;  4BY7 H;  3CPW A;  3F8T A;  5IWA Q;  2K1B A;  4PG3 A;  2Z1C A;  3GTP B;  1A15 A;  1BDO A;  1HA6 A;  3HOX G;  3RUZ A;  1VQG A;  5IOD A;  2OQK A;  2E5L Q;  1FJG L;  1J5E Q;  2UUA Q;  4L63 B;  4C3H G;  3E9H A;  1V43 A;  4IN3 A;  2A68 C;  3J80 i;  5IP7 G;  1N33 L;  1K83 B;  1LT4 D;  1LM0 A;  3A74 A;  1I4Q A;  2DN8 A;  1U4P A;  3S16 B;  4A3K G;  1BO0 A;  1GUO A;  1XNQ Q;  4R9W A;  2OT2 A;  1FYC A;  2ENB A;  2SNM A;  1PRT C;  2K05 A;  5D3D A;  4LF7 L;  4L5Q A;  3VR2 A;  1Y8N B;  1LTT D;  5C4H A;  4YWM A;  4PNY A;  3S1M B;  3AU7 A;  1N32 Q;  1N36 Q;  1RTN A;  1HRJ A;  2NN6 H;  2YU9 H;  5C44 G;  1SE2 A;  1VMC A;  4DV0 L;  4KHP Q;  1N9W A;  3CCU A;  3I4N B;  3TP5 A;  3T56 B;  3BZC A;  1G6P A;  2K6A A;  5EKL A;  3WDN A;  1Q86 C;  4FDB A;  4LAA A;  3X3M A;  2EDG A;  1BF4 A;  4LNQ A;  4BA2 I;  3UDG A;  2L0C A;  1QOH A;  4NDX A;  4GLX A;  2A68 D;  3NEM A;  5BN4 A;  1OXV A;  3KF6 A;  2IY5 B;  3URY A;  3SHL A;  1Q81 C;  3I8Z A;  1NE3 A;  2IHE A;  2MO0 A;  3MXN A;  3TRE A;  4XQN A;  2IPK D;  3EFX D;  3D4D A;  1RJT A;  1EQT A;  4C3I G;  2K03 A;  3A56 A;  4LK1 C;  4GN4 B;  3TQY A;  3J81 E;  3ULP A;  1K8M A;  4G7O C;  3I2Z A;  4MTK A;  1H95 A;  5CV5 A;  4KY6 A;  4DV3 L;  2MJ8 A;  5KND A;  1JMC A;  3C3L A;  1NNX A;  3CRL C;  1RIP A;  2YV5 A;  3TDQ A;  4HIK A;  1V8Q A;  3RMH A;  3J7Y W;  2K50 A;  1IYU A;  2NB0 A;  4DV4 Q;  3M3Y B;  4LF6 L;  3SVM A;  1CM9 A;  2HDM A;  1G91 A;  4S3S A;  4GNX B;  1VQA A;  4DAY A;  4DK6 C;  4IOC A;  1TII D;  3PIP A;  4FVM A;  3HOW G;  2IW3 A;  3NWT A;  4JI5 Q;  2MFI A;  4JC0 A;  1LT5 D;  4XT3 B;  2CQO A;  1NAP A;  1GXD C;  4RA8 A;  2EIF A;  3FRP B;  4KJN A;  3E0E A;  1I6H H;  1U0L A;  1C48 A;  2B2T A;  2IJ0 A;  1NUC A;  2I0Q A;  3J80 c;  2FFK B;  3MFY A;  5C0X J;  5KYI A;  3MEH A;  4QL5 A;  3H91 A;  1J8I A;  1WCM B;  2AWO A;  1QNK A;  4TVA B;  1SMY C;  2QKI C;  3KLS A;  2ZXO A;  4V19 0;  5FLX E;  2ATW A;  4DR2 L;  4IFD G;  3NBI A;  3WOF A;  1F9Q A;  4A3C G;  1SYB A;  2ZTC A;  2FMC A;  3NTK A;  2NVT H;  2KHS A;  4B08 A;  1OXT A;  4X65 Q;  4A3D B;  1AZQ A;  1LTB D;  4UDU C;  4ME3 A;  3IL8 A;  2KCM A;  4U68 A;  1SNC A;  3BS1 A;  4A4I A;  1SDF A;  1PYB A;  5JPN C;  1EY5 A;  2R61 A;  2CWA A;  1MJC A;  2J7Z A;  1KLG D;  4A3B G;  1YJW A;  3S16 H;  4DV4 L;  1EQV A;  2M00 A;  4MHE A;  2I5M X;  5C4J B;  3DWQ A;  2JA8 B;  4TRD A;  2K5W A;  4ZLT F;  2N55 A;  2ALY B;  3IFD A;  1JWM D;  3HOW H;  2F4I A;  3HOX H;  3NK9 A;  1EIY B;  1PH3 A;  4JPB W;  3OHX C;  2F4V Q;  2YU9 B;  1QIL A;  5ELE A;  2JA6 G;  3M4O H;  1SE8 A;  2JA7 G;  1DZ1 A;  3NQT A;  2Q2U A;  3SK4 A;  2ZXR A;  5KIX A;  2PNR C;  4OXP A;  4A3C H;  1LUZ A;  3NBH A;  1Z9F A;  4I7Z C;  1BKB A;  2E2D C;  3LX0 A;  1I50 B;  4IUN A;  1DD2 A;  1H9M A;  1HZA A;  1KAA A;  3NTH A;  2PQA A;  1F2Z A;  1K3R A;  1E1T A;  5M3M B;  5CV8 A;  4JBW A;  4F87 A;  1CUK A;  2CFM A;  1FGB D;  1VQB A;  1XX8 A;  2VUM B;  3Q0A A;  2O4X A;  4KKS A;  2K5Q A;  4FF2 A;  3T4A C;  5KNC A;  4BY7 G;  1OO9 B;  2Y0S B;  1G8Z D;  1S72 A;  2K7V A;  3W2D A;  3KOJ A;  2VQE Q;  4RHS A;  4OEL B;  4MN3 A;  4HN7 A;  2F0J A;  3MA2 B;  2O2L D;  4DR3 Q;  3QOJ A;  2VXW A;  3VDY A;  2K5D A;  1KD1 C;  1CK1 A;  1X6O A;  4DNR B;  3G4S A;  1QE6 A;  3HOX B;  1KHI A;  5ELC A;  4OX9 L;  1EIG A;  1RL2 A;  5DEH A;  1PFM A;  4Y52 H;  3PO3 B;  5IYB G;  4JI8 L;  4J1M A;  1HR0 L;  2BDN A;  1TWC H;  1SFO B;  2AQ1 B;  4XIG S;  4DUZ L;  4ZYS A;  4DXG A;  2G9D A;  3N52 A;  4PZ8 A;  4KHZ A;  4FO2 A;  4IJH A;  4QUF A;  1G2T A;  1LT3 D;  1X3F A;  1ESR A;  3AFQ A;  1EQQ A;  1JJG A;  3IKJ A;  2B2Y C;  2F1M A;  2GN5 A;  1YZ6 A;  3SEB A;  1T9H A;  3RZD H;  4LFA L;  1VQL A;  4NMZ A;  1LLR D;  1OXS C;  1QG7 A;  3I55 A;  1PH7 A;  1VQK A;  2NTT A;  1Y1V G;  4HAE A;  1D5M C;  2WV6 D;  3PO2 G;  1QUQ B;  4B3M Q;  3F2U A;  3D8G A;  1E2V A;  4A3B H;  1IKL A;  5IYD H;  2LSS A;  3BU2 A;  1V1Q A;  3A7A B;  1DCZ A;  3W1B A;  4OO1 G;  5BN5 A;  1SXT A;  3MFG A;  1K28 A;  1MGS A;  2V4D A;  4A75 A;  4GKJ L;  5FO7 B;  2ASB A;  1TWG B;  3HOU G;  2B2U C;  3P20 A;  2N78 A;  2P5Z X;  1E3P A;  5D65 A;  4K6D A;  1E24 A;  4JI6 L;  5COY A;  4JI3 Q;  1WTR A;  1TWA B;  2PZU A;  3M4Y A;  3QB3 A;  2MNA A;  3RZO B;  1W2B A;  3J80 L;  3PIO A;  4XTC S;  2A5H A;  2WB1 E;  4A3K H;  4DV5 Q;  2XWJ B;  1D2B A;  4O1N A;  3ERO A;  3S1M H;  4K5V A;  4GS3 A;  4RAU C;  3FKI H;  3PF5 A;  1EOV A;  2KUM A;  3TN2 A;  1FGU A;  1MHW C;  1IBK L;  1CA6 A;  2RVL A;  3A8I E;  4RWS C;  4LUV A;  1LTI D;  2ZXP A;  3CKI B;  3B6Y A;  5LMU Q;  1C9O A;  2M2L A;  3CC4 A;  4X6A H;  4RG1 A;  4A93 B;  1X3E A;  3MXU A;  1F9S A;  1XTD A;  2D9U A;  2HQL A;  1EL0 A;  1HTL D;  2F0E A;  4YY3 Q;  1KTK A;  1JIC A;  2R3Z A;  2XRS D;  4HMI A;  2CKZ B;  2UXB L;  1F9P A;  4ZAI A;  3CC7 A;  4X64 L;  1QZG A;  1ENC A;  1L2F A;  1XMQ L;  4LFC Q;  1JT8 A;  2L9H A;  1NMF A;  3H3V H;  4FF4 A;  3HOU B;  3X3N A;  2FJ2 A;  1IBM Q;  2SEB D;  1W3S A;  2K5H A;  4OON A;  2EVB A;  4OWX B;  2ICI A;  5M5X B;  2DNC A;  3U58 A;  2I46 A;  1G2S A;  3FMC A;  4KKT A;  2E5L L;  2O5J C;  1TT2 A;  4HCE A;  2EE1 A;  2KOL A;  3TP6 A;  1RF2 D;  2YTV A;  3UDF A;  2NN6 I;  1GUS A;  1NCV A;  2EYJ A;  2NVQ H;  4IAL A;  2IHF A;  2K04 A;  4G57 A;  1DOK A;  3ND8 A;  3MVV A;  3TRZ A;  4BBS H;  4OHJ A;  2H1E A;  1Q8K A;  3MHB A;  3RZD B;  4DXF A;  3ERS X;  1U4L A;  5IGC A;  2R92 B;  2BE5 D;  3E6Z X;  1WTO A;  4FNF A;  4UP8 A;  4OEM B;  1IKM A;  1JR0 D;  1EY9 A;  4J15 A;  1GUW A;  2J4X A;  1SYG A;  2L5T A;  1XMQ Q;  5K36 H;  1ZXT A;  5AFW A;  2JYO A;  4IQZ A;  2D0O A;  2B2U A;  2CH4 A;  4DNI A;  1B3A A;  5FK9 C;  2EYM A;  1LT6 D;  5FJ8 H;  1PV4 A;  1BNZ A;  1B3Q A;  4JBM A;  4H13 C;  3Q23 A;  3U9S A;  5C3E B;  2AQ3 B;  4HMJ A;  3TZD A;  4C3H B;  1N34 L;  2OTL A;  4DUY Q;  2EYF A;  4C3H H;  3NP8 A;  2QIL A;  4AH6 A;  4A3I B;  3I72 A;  4LUZ A;  1JJ2 A;  4I7A A;  3PO3 H;  1SRO A;  2A1A A;  2OTJ A;  1J9O A;  1SNO A;  4A3J H;  1UEA B;  2VB3 X;  3GDE A;  1DJR D;  2HHH L;  2K52 A;  1N33 Q;  3H3V C;  4GKK L;  1UNS A;  2UUB L;  4ZKC B;  1JQY D;  5LMN L;  3I73 A;  2XVS A;  3ITP A;  2VQF Q;  4M8A A;  2K01 A;  3N6R A;  1JB7 A;  2MGS A;  1CTM A;  1IBL L;  2EYL A;  4JI8 Q;  4QJF A;  3T1H L;  1FD7 D;  3GTJ B;  4DV1 L;  3H94 A;  1B53 A;  3F2C A;  1TWF B;  1XNQ L;  1N34 Q;  1PTO B;  1CQV A;  3EQL C;  2NVX B;  1E7Z A;  1I50 H;  3M4O B;  2EXD A;  3S2D B;  2DJG C;  3J81 L;  1EYD A;  4YCW A;  2CWP A;  3KLW A;  5T1I A;  1OXX K;  2PZT A;  2Q8R E;  3C46 A;  2E2I H;  5LMN W;  1LAB A;  1J5E L;  3T1Y Q;  3CCL A;  3OW2 A;  2R93 B;  2QEJ C;  1BBU A;  4LF9 L;  1STA A;  3J80 E;  5C4X H;  1B44 D;  1F2Y A;  4FP5 D;  4PMW A;  4DR6 Q;  1E2W A;  3GD7 A;  1O7L A;  2UXC L;  4AYB B;  1SMX A;  3G7L A;  2ES2 A;  2CW0 C;  3D6C A;  4OGQ C;  1XJV A;  3EJI A;  3M7G A;  4FF1 A;  3AEV A;  3PO3 G;  4APV A;  5NUC A;  1E2Z A;  4IFD I;  1OTC A;  3PO2 H;  2HT1 A;  3R2T A;  1CI3 M;  3P75 A;  3UE1 A;  1B2T A;  4KJO A;  1ICW A;  4JYA L;  1BXT A;  4KD4 A;  4DV1 Q;  4EVO A;  4AQY Q;  1HJP A;  3CP0 A;  5ISR A;  1PA6 A;  1ESF A;  4A76 A;  3RNU A;  4P74 A;  4C56 C;  4A3K B;  4BBR H;  1U4M A;  2UU9 Q;  3I56 A;  4B3S L;  3A8K E;  1SEB D;  1G29 1;  4QQB X;  4FXG C;  1LYL A;  1IBM L;  2JA5 G;  2UUC Q;  2BH2 A;  3UE0 A;  2Q2H A;  4CHT B;  3GTQ H;  3NUC A;  1PHJ A;  4DV2 L;  4J6H A;  5FJ8 G;  4BXX H;  1EY7 A;  2UXB Q;  1I3Q B;  3OIQ A;  1ILP A;  2H4O A;  3K5L A;  3G48 A;  2NVX H;  2KA7 A;  3L7Z C;  1IBK Q;  2B2Y A;  2NWG A;  3JAM L;  5GQO A;  2D62 A;  2E76 C;  1ENA A;  1IW7 C;  2XN9 C;  4F7X A;  1B4O A;  2VB2 X;  1D1I A;  1A8V A;  1I6V C;  1JB3 A;  2BH8 A;  1I94 L;  4CJ2 C;  5M3F B;  2BOS A;  3W1G A;  4DR2 Q;  4Y7N B;  3HGB A;  3ULJ A;  3H0G H;  1GHJ A;  5C3X A;  1AP0 A;  1ZYR D;  2AMC B;  1U4R A;  4JW0 A;  1WTP A;  2C9O A;  4Z9C B;  1NSN S;  5C3E G;  2NYZ D;  4P2C B;  4DK3 C;  5GAD C;  1XMO Q;  1SNP A;  1ET6 A;  5LL6 S;  2WB1 B;  4C1N I;  4K5W A;  2KEE A;  5EAY A;  4JI3 L;  2Z4H A;  4DN4 M;  5E3F A;  5FO9 B;  3IFT A;  1OXU A;  4FXD A;  1GUG A;  2K5V A;  5EBD A;  4DR6 L;  1EY8 A;  4LFA Q;  2F3V A;  5FKA C;  1BQQ T;  1Y1V B;  2WII B;  3KBG A;  1D6E C;  3DM1 A;  1QUQ A;  2LY7 A;  4IUV A;  1V1O A;  5ELO A;  4ZCK A;  3CC2 A;  2IX1 A;  3K57 A;  1KLU D;  4A3L H;  4EQ5 A;  4WJ4 A;  1KDC A;  1YBY A;  3H09 A;  3L2P A;  4WOR A;  5HGQ A;  1EOT A;  1R4Q B;  1NR4 A;  1B9M A;  5CV6 A;  1DYQ A;  2B2W C;  1F9R A;  1L0X B;  1EWC A;  2NZO A;  3VYS A;  3SR1 A;  3A7L A;  3V96 A;  5C0X G;  4LF5 L;  1UEB A;  3KBX A;  4C3J B;  1NR2 A;  1IBL Q;  1WTQ A;  3M7N A;  4DR5 Q;  5CBA E;  4AYB E;  1IL2 A;  5C5L A;  1PLF A;  4K0K Q;  2K75 A;  3HOY H;  2DY8 A;  3PF4 A;  1T5E A;  1A3V A;  2HIV A;  3CHB D;  4JYA Q;  1EEI D;  1YVC A;  2KHJ A;  3H3V I;  3M3Y H;  1IL8 A;  1GJX A;  2EYH A;  2ICE C;  5J3B A;  1K83 H;  3P7J A;  2F0Q A;  2E75 C;  4C3I H;  1CKN B;  4CDE C;  3CXC A;  3BZK A;  1NJI C;  2E8G A;  3TEH B;  1RD9 D;  4V0B A;  4QUC A;  4DR7 Q;  2AQ2 B;  5BN3 A;  2VQE L;  4PMC A;  5EKI A;  1HNX Q;  4G7Z C;  2AUK A;  3U50 C;  4LWC A;  3GTM B;  2RDH A;  1C8C A;  1LTS D;  3FKI B;  3ULL A;  1MSG A;  1P8L A;  3CU7 A;  3T53 B;  4N8F A;  3MC0 B;  1YEZ A;  1HZB A;  5KNB A;  3NQI A;  2DNE A;  4LJZ C;  3C1E A;  2EJF C;  4POG A;  2JE6 I;  2E2I B;  3A54 A;  5I4D A;  4RFB A;  1LO5 D;  5ELN A;  3J81 i;  1VF5 C;  5ELD A;  4A3D H;  4X66 L;  1VQ9 A;  3LNN A;  3MTS A;  4WJ3 M;  2JA5 H;  4ULL A;  1J6Q A;  4RCN A;  1Q90 A;  2RBM A;  2L4N A;  1A3T A;  2XNA C;  3A5U A;  4IUT A;  4DKA C;  4GOP B;  3KK7 A;  4WJW A;  1K9M C;  3CCM A;  2QF7 A;  5M5Y B;  1A0I A;  2HCI A;  2PQA B;  4BA1 I;  2B63 B;  2K28 A;  1O7I A;  4K2K A;  5E7N A;  5G3L F;  3M85 A;  1KDA A;  1VF7 A;  3CCJ A;  1KL9 A;  1MSH A;  3CF5 A;  1PH8 A;  1VQE A;  4K5X A;  2A8V A;  1PTO H;  1TS5 A;  5AJ3 Q;  5JJZ A;  1TWF H;  4BBS B;  3J7A V;  3QR8 A;  1STN A;  1E0B A;  1WI5 A;  5CV4 A;  3SK8 A;  4LUO A;  3BZD B;  3J81 j;  4YWK A;  2MQH A;  2VS1 A;  3W5O A;  1L1O A;  4U67 3;  4N8X 1;  4KN4 C;  2ZM6 L;  3KLR A;  3J81 c;  1PH1 A;  2PYK A;  4LF6 Q;  3D4W A;  2JA5 B;  4ZK9 B;  3HEJ A;  1YHB A;  1D5X C;  1EYA A;  4RH6 A;  4X3S A;  1VDZ A;  2HUG A;  2GVB A;  1JOO A;  4NW2 A;  1CSP A;  3HRZ C;  1CZW A;  4QIW E;  4CKC A;  4EGV A;  4QGU A;  2FXQ A;  4JBJ A;  3S2H H;  5F2D A;  3FVQ A;  1TXY A;  2B3G A;  5JJK A;  2NVY H;  1BCP B;  5C0X I;  1IZ6 A;  3PO2 B;  1XPO A;  2I07 B;  4XYQ A;  1FVI A;  4X62 L;  4A3G G;  5EQ0 A;  1GO3 E;  3OMG A;  1EYC A;  1LAC A;  1EFI D;  2A6E C;  3KF8 B;  3H0G B;  4X3U A;  1SYD A;  4KLK A;  2L15 A;  2ZM6 Q;  3K7U C;  1PDQ A;  5A2Q E;  3S1R B;  1JWS D;  2F0S A;  4YIJ A;  3GTG H;  3S14 H;  2SOB A;  1ET9 A;  1S4Z A;  4R8I A;  1AW7 A;  3PUW A;  2KCC A;  5C5M A;  2BE5 C;  1NMG A;  3FPP A;  1HZ9 A;  4P73 A;  2YTY A;  5IYC G;  3K5N A;  2L11 A;  4K8J A;  2WAQ B;  4F8M A;  4JI0 Q;  1JWU D;  4J8Q A;  1UWV A;  3I4M B;  2Q2I A;  3KF6 B;  2UXD L;  2H5X A;  3M4P A;  3GTJ H;  3PUX A;  1GUT A;  2JA7 H;  5LMN Q;  4OIJ A;  1B9N A;  1HA5 A;  3HG9 A;  3DHQ A;  5BR8 L;  3CCQ A;  4DF7 A;  1JC7 A;  1EWH A;  2EY5 A;  5M9O A;  1O7Z A;  1EWI A;  2F0M A;  1F2M A;  2MO1 A;  4JBK A;  1UUP A;  2Z6K C;  3I4O A;  3NTI A;  3VYR A;  4GLA C;  1D1K A;  4LF7 Q;  1ZKO A;  3ZJY C;  1YHQ A;  3SDZ A;  1VQF A;  2AKW B;  1Y69 U;  5C4X B;  1B7Y B;  4GZY C;  4DGZ A;  4GN3 B;  1QNU A;  1YNJ C;  4IO9 A;  1N36 L;  4A3L G;  2DGY A;  1PZK D;  4A3J G;  2B2V A;  1B8A A;  3A8J E;  4B3S Q;  5H1S E;  1CKN A;  4B3R L;  4JK1 C;  3QIA A;  1PTO F;  2N3S A;  4ALP A;  4R4O A;  2JA8 H;  4N9T A;  4JI4 Q;  1HQR D;  5JJL A;  3G6E A;  1S40 A;  1M8A A;  5C44 H;  2G9H D;  2UXC Q;  2Q2T A;  5CYU A;  2N8N A;  3SXH A;  3I4M H;  2B2V C;  1PH5 A;  2B63 G;  1YNX A;  4C1N K;  5I6Y A;  4C2M H;  2EJG C;  3TBI B;  3K5O A;  2LXJ A;  3HKZ B;  3HOV B;  3LGJ A;  4UP7 A;  5TSS A;  2XIW A;  2JP1 A;  1FNW A;  4A3E H;  2IX0 A;  1ONL A;  1SJH D;  1ZYR C;  2YYZ A;  4DAV A;  2WKC A;  3BVM A;  1EU3 A;  2VUM H;  2L55 A;  3CRK C;  3V05 A;  2VUM G;  4JVZ A;  2F0I A;  3GV6 A;  4JI4 L;  3T1H Q;  3C2P A;  4I65 A;  1XTC D;  3U9O A;  1YHA A;  3HOZ G;  4A3B B;  1TWH H;  5CV9 A;  3FPU B;  1GKH A;  1TWH B;  2IT1 A;  2LKV A;  4RKL A;  4WFN 3;  4DAM A;  1B50 A;  5FOB B;  3Q22 A;  4A3D G;  1MKH A;  3SE0 A;  1UAP A;  2DJF C;  2RA4 A;  4GOP C;  1WJJ A;  2JSO A;  1XYI A;  3QWN A;  3QJY A;  4TSS A;  1Y8P B;  5E4W C;  3R3O A;  3AQQ A;  5FLX L;  1HQM C;  1TWC B;  1SFO H;  2HHH Q;  3HKZ G;  4DR1 Q;  3V2T A;  2QW7 A;  3M4Q A;  3GTO H;  3OW7 A;  1STB A;  5IYB H;  1JOQ A;  3RN2 A;  2PNH A;  2WP8 J;  2G5D A;  2D5D A;  2QGQ A;  5CR3 A;  3TP7 A;  1FNU A;  3I4N H;  1HZC A;  1WYD A;  4O42 A;  2KEC A;  2RDG A;  3W3A A;  5CBE E;  3TSS A;  2RQX A;  4NXM Q;  1WD1 A;  3D31 A;  2A6H C;  4HJ7 A;  1A2U A;  1I4R A;  1EEF D;  3S1Q B;  1SR3 A;  1EY4 A;  4EQP A;  1C7Y A;  2KBN A;  1TQO A;  3PQI A;  4UAI A;  1R4P B;  1HR0 W;  4DUY L;  3I90 A;  4YWL A;  1V1P A;  1Y1W G;  3T16 A;  4B9X A;  4JI2 Q;  1BBX C;  3HS0 C;  1VQJ A;  1ILQ A;  1XPU A;  3HOY G;  2N88 A;  4XQQ A;  1CFM A;  1TS4 A;  1X65 A;  5DAU A;  1SYE A;  2HIX A;  4XYO A;  2HCC A;  4O2D A;  2B63 H;  3RR5 A;  1O7Y A;  2CQA A;  1ZEQ X;  5IGG A;  1K8G A;  2MP1 A;  1HCZ A;  1KQS A;  3EA6 A;  1CKM A;  5E1F A;  3K0Y A;  4H0L C;  1IXR A;  2ZJP A;  1X3G A;  3RLF A;  4KHV A;  2Q8T A;  4MNO A;  3HOV G;  1YNN D;  3R2I A;  4DV2 Q;  4HR7 B;  4JV5 Q;  3JAM E;  1SYF A;  4BS9 A;  5FLM G;  5C4J H;  3S1Q H;  3IRB A;  4OWW B;  2EPB A;  3GTL H;  3T13 A;  3VR6 A;  4EQN A;  1VQ6 A;  1AN8 A;  4IUU A;  2JN4 A;  5IYD G;  5AJ3 L;  3G6J B;  2OXP A;  5M5W H;  2JA7 B;  4DV7 L;  3R93 A;  1C0A A;  1Q82 C;  1STG A;  2RDF A;  3ONA B;  4LFC L;  3I4M G;  1RHP A;  1F77 A;  4R1J A;  2IWH A;  3KLS X;  4HIM A;  3PSI A;  1YNN C;  2WB1 G;  3P1H A;  2EYP A;  5K36 G;  2KCN A;  4BBR G;  1KNA A;  2KQ3 A;  3OIP A;  4JI6 Q;  2EOT A;  1QWY A;  2PW5 A;  5D3I B;  2CCZ A;  4RHR A;  1U9R A;  3DMU A;  1W6K A;  3S14 B;  1VQI A;  1IW7 D;  3NEL A;  4NXN Q;  3GTG B;  2NTS A;  1X3P A;  4POF A;  1H9S A;  2DY7 A;  4NB3 A;  5M5Y H;  2XWB B;  4X66 Q;  4G7H C;  1CA5 A;  2EY6 A;  2K32 A;  2KVM A;  3BDL A;  3MEF A;  1N32 L;  2VW9 A;  5GAE C;  3O13 A;  3BVG A;  3HOZ H;  4HSV A;  1E22 A;  5DLQ E;  2R93 G;  1AZP A;  1I4P A;  1Y1V H;  4R4I A; 
#chains in the Genus database with same CATH homology
 4IFD J;  2J0T D;  5M5W B;  3T51 B;  1SE3 A;  1CQF A;  2JEA I;  2B2T C;  2F0H A;  4MIU A;  1I4X A;  1H9K A;  1HTP A;  3EVQ A;  5DM7 3;  4C3J G;  4A3E B;  2NZ1 D;  1QJO A;  3AMU A;  1HUM A;  4CJ1 B;  4HED A;  1KAB A;  1DOM A;  3S9W A;  1A2T A;  1LTG D;  1FR3 A;  1PZJ D;  2MPM A;  1GOZ A;  1TS3 A;  1SBB B;  3PUZ A;  5EPK A;  1SJE D;  2CHB D;  3L9A X;  2F0F A;  2EXZ A;  2NVT B;  2IL8 A;  3HOZ B;  3DXJ C;  1SNM A;  2KED A;  4KV6 A;  1BUV T;  5EBC A;  3NHH A;  4KY7 A;  5JAV A;  1Q1E A;  5I2Y A;  5IGF A;  1QCB D;  3DEP A;  5CGK A;  1LTA D;  1MD2 D;  4DFA A;  4LMQ D;  2R6G A;  1AEX A;  1I4G A;  5JOB A;  1XWE A;  3PUY A;  4QB4 A;  5IGE A;  4WRD A;  4ABN A;  4X3T A;  1IHZ A;  3GP7 A;  2Q8I B;  5HUR A;  4KD3 A;  1Q8I A;  4RCO A;  3VR4 A;  2F0P A;  1VMP A;  3OWE B;  5CC4 A;  1A3U A;  1HUN A;  4RGM A;  4K6L A;  2EY1 A;  1S5B D;  4OO1 I;  4C3I B;  4E6I A;  5C4Z A;  2R7Z B;  4KK7 A;  3SK6 A;  2FHT A;  4ZUI A;  5I6W A;  3FDT A;  1IYV A;  1PTO D;  5JEA J;  5D14 A;  1S5D D;  4BWG B;  2F0W A;  1CHP D;  1L0Y B;  1ROD A;  3MXP A;  1SND A;  3KUP A;  1TKW B;  3LWE A;  2A69 C;  5JEA G;  1ENF A;  3FEW X;  5T1G A;  4ZKB B;  3R8B A;  5I2X A;  4ILW A;  5CMD A;  3DUZ A;  4H44 C;  4NKL A;  1HFN A;  1AFP A;  3BDC A;  4R8N A;  3OSO A;  1X32 A;  1A6X A;  2RSN A;  3ZYY X;  2OEO A;  2F0K A;  5JVH 3;  2NVY B;  5KRU A;  2HDL A;  2X6L A;  3S2H B;  1Y1W B;  1JE4 A;  2PQE A;  5DNF A;  1PXU A;  4RGT A;  3I70 A;  2A73 B;  3D3R A;  1JOR A;  2E74 C;  1PRT B;  2IX3 A;  2LS0 1;  5A2Q L;  3GTL B;  3H6M A;  2EY2 A;  5JEA H;  3BG3 A;  4RGO S;  3I4L A;  4IUR A;  4NP5 A;  4Q0F A;  1EZ8 A;  1BOS A;  2WIN B;  3DEO A;  3MAQ A;  2QCP X;  5I9P A;  2LMC B;  3PUV A;  2AUJ D;  3K6O A;  2B8G A;  5J1Z A;  3HP3 A;  2LFN A;  2MHV A;  2TSS A;  5JPM C;  1Z47 A;  1CHQ D;  1BCP C;  2WAC A;  1PYW D;  1TS2 A;  5FO8 B;  1VCI A;  2F03 A;  3NSW A;  2PO4 A;  3A55 A;  4DU9 A;  4F88 A;  4A3J B;  4BBR B;  2A74 C;  4RGN A;  2VNU D;  5CV7 A;  2L1B A;  4KN7 C;  3I3C A;  1Q12 A;  2CW0 D;  4KTA A;  1WTV A;  1M4V A;  4ODG A;  1EZ6 A;  3HZX A;  1HFG A;  4HTH A;  2NN6 G;  3K7A B;  5I9O A;  1H9S B;  1MBY A;  5IGB A;  5ELB A;  1XXG A;  2GA4 B;  3OOC A;  2JA6 B;  1PTO C;  3K5M A;  1G6Z A;  2EYO A;  1BR9 A;  3MZ5 A;  3VYU A;  1RDP D;  3QOL A;  5KEE A;  3Q24 A;  4IZ8 A;  1SNQ A;  3TZU A;  4K2L A;  3QO2 A;  1D5Z C;  2NBF A;  5ELF A;  1X3Q A;  2F0D A;  3BYT B;  1DXM A;  3ND9 A;  1STE A;  1SMY D;  4CKB A;  2PCF B;  1Z7T A;  3PMF A;  2A6H D;  4Q5V A;  1KDB A;  1Z6H A;  4K14 A;  2KJX A;  3K58 A;  3GTQ B;  1CZG A;  2B2W A;  2BDO A;  3J7A F;  3PV0 A;  3RD4 A;  1TY2 A;  3CQZ B;  3GO5 A;  4OIK A;  4XQJ A;  4N9P A;  2K33 A;  5IT9 L;  2SDF A;  2NUC A;  1EIH A;  2X6G A;  2TMP A;  1DON A;  1TVX A;  2F0G A;  1PFB A;  1II3 A;  4QCL A;  1RCV D;  1B1Z A;  3MWY W;  1WVL A;  2BCO A;  4CGY B;  1S5E D;  3GQB A;  4CJ0 B;  3HOY B;  5IGD A;  4ID6 A;  3KF8 A;  1EU4 A;  4A3M B;  2FIN B;  1RKN A;  5EPJ A;  1SYC A;  5J22 A;  3NWS A;  4OO1 H;  5A35 A;  4XXE A;  3Q6S A;  3K59 A;  2AWN A;  4A3F B;  1I6H B;  4OL7 A;  2ZT9 C;  1LV9 A;  3LWU A;  5COR A;  4TKO B;  4BY7 B;  1SSO A;  2E2H B;  5EGT A;  1WTX A;  5LL6 X;  4HSP A;  3VA7 A;  1SAP A;  3DWP A;  3NXW A;  3S15 B;  3I91 A;  4EQO A;  1V1P B;  4DNT B;  5J39 A;  1H9R A;  2F0L A;  2XSC A;  2M9V A;  1F2L A;  3GTK B;  2EJM A;  5G3L D;  2F0O A;  1T5X D;  3QG1 A;  1Y8O B;  5IOC A;  1I4H A;  1MI2 A;  2L12 A;  4DK0 A;  5C3W A;  3ERQ A;  3D4R A;  2F0V A;  2CVR A;  4DA2 A;  2FMM A;  1WTW A;  4QIW B;  1GHK A;  2PMZ B;  2Z4I A;  5EJW A;  1ML0 D;  1JCK B;  5KYL A;  4CBV A;  4RKB A;  4TQU S;  2D2C C;  5IIF A;  3PIP 3;  4IFD H;  4ME5 A;  1C4Q A;  1DOL A;  5E4X A;  2PW7 A;  3NPP A;  5C0X H;  4XT1 B;  3OPO A;  4IUP A;  1HPC A;  1WD0 A;  1GUN A;  3HOW B;  1PZI D;  4HCS A;  1PRT F;  3IAY A;  4A3G B;  5LHY 1;  2F0T A;  3D6W A;  3VYT A;  1TY0 A;  1EY0 A;  5C44 B;  5C6A A;  3GV3 A;  1SE4 A;  1STY A;  1QB5 D;  2F0N A;  1BCP F;  3OWF A;  4K8I A;  4QF4 A;  1Q3L A;  2XRQ D;  2RKS A;  5HGT A;  3MXG A;  1S5C D;  5DM6 3;  1DM0 B;  4FXK C;  1S5F D;  2SNS A;  3L3O C;  3OMC A;  1Q1B A;  1RTO A;  4ZRZ A;  4PMB A;  2RSO A;  3BYY B;  4ZUJ A;  2O5I C;  1PFN A;  2A69 D;  2Z8L A;  1JOK A;  5IT9 E;  5JVG 3;  2B8F A;  4KKU A;  1EY6 A;  4DAP A;  3BDO A;  1KNE A;  4M1U B;  2X69 A;  1H9J A;  2HQE A;  4KMU C;  3S17 B;  3TP8 A;  3PIO 3;  2QDB A;  2OF1 A;  3E0J A;  4C2M B;  1FNV A;  3GTO B;  2A6E D;  4FYD A;  3AB9 A;  5KGU A;  2ID0 A;  1K8O A;  3E5S A;  4BY1 B;  1HHV A;  4B9W A;  2C5C A;  4X3K A;  4G4K A;  3C1F A;  3SK5 A;  3DWA A;  2BA1 A;  1R9T B;  4KI0 A;  3VR5 A;  4L8J A;  3VA5 A;  2F3W A;  1CT1 D;  2E2J B;  4ZQ3 A;  1PMR A;  4CKE A;  2EZV A;  1BCP D;  5EPL A;  3S1N B;  3BVZ A;  4FF3 A;  4XDX A;  2BA0 A;  5EKK A;  1PRT D;  1HXY D;  1STH A;  4IUQ A;  2F0U A;  4KY5 A;  2PPB C;  2JEB I;  2JXM B;  2NVQ B;  1LTR D;  3WOE A;  1W6J A;  4DK1 A;  2MUY A;  4L6T B;  4PV1 C;  4PQX A;  4QMG A;  1O80 A;  5K5P A;  2B39 A;  2WKD A;  4H7B A;  3VR3 A;  3TME A;  1O78 A;  3NE5 B;  2PZW A;  1YNJ D;  3UI2 A;  1TR5 A;  1TU2 B;  2K1B A;  2Z1C A;  3GTP B;  1BDO A;  1A15 A;  1HA6 A;  3RUZ A;  5IOD A;  4L63 B;  4C3H G;  1V43 A;  4IN3 A;  2A68 C;  1K83 B;  1LT4 D;  1I4Q A;  2DN8 A;  1U4P A;  3S16 B;  1BO0 A;  1GUO A;  4R9W A;  2OT2 A;  1FYC A;  2ENB A;  2SNM A;  1PRT C;  2K05 A;  5D3D A;  3VR2 A;  1Y8N B;  1LTT D;  5C4H A;  4PNY A;  3S1M B;  3AU7 A;  1RTN A;  1HRJ A;  2NN6 H;  1SE2 A;  1VMC A;  3I4N B;  3TP5 A;  3T56 B;  2K6A A;  5EKL A;  3WDN A;  4LAA A;  3X3M A;  2EDG A;  1BF4 A;  4BA2 I;  2L0C A;  1QOH A;  4NDX A;  2A68 D;  5BN4 A;  1OXV A;  3URY A;  3SHL A;  3I8Z A;  3MXN A;  4XQN A;  2IPK D;  3EFX D;  3D4D A;  1RJT A;  1EQT A;  4C3I G;  2K03 A;  3A56 A;  4LK1 C;  3J81 E;  1K8M A;  4G7O C;  5CV5 A;  4KY6 A;  2MJ8 A;  5KND A;  3C3L A;  3CRL C;  3TDQ A;  1V8Q A;  3RMH A;  3J7Y W;  1IYU A;  2NB0 A;  3M3Y B;  3SVM A;  1CM9 A;  2HDM A;  1G91 A;  4S3S A;  4DAY A;  1TII D;  4FVM A;  2IW3 A;  3NWT A;  1LT5 D;  4XT3 B;  1NAP A;  1GXD C;  4RA8 A;  3FRP B;  4KJN A;  1C48 A;  2B2T A;  2IJ0 A;  1NUC A;  2FFK B;  3MFY A;  5C0X J;  5KYI A;  3MEH A;  1J8I A;  3H91 A;  1WCM B;  2AWO A;  1QNK A;  1SMY C;  2QKI C;  3KLS A;  2ZXO A;  4V19 0;  5FLX E;  4IFD G;  3NBI A;  3WOF A;  1F9Q A;  1SYB A;  3NTK A;  2FMC A;  2KHS A;  4B08 A;  1OXT A;  4A3D B;  1AZQ A;  1LTB D;  4UDU C;  3IL8 A;  4U68 A;  1SNC A;  3BS1 A;  1SDF A;  5JPN C;  1EY5 A;  2R61 A;  2J7Z A;  1KLG D;  1EQV A;  2M00 A;  4MHE A;  5C4J B;  2JA8 B;  3DWQ A;  4TRD A;  2K5W A;  4ZLT F;  2N55 A;  3IFD A;  1JWM D;  2F4I A;  3NK9 A;  3OHX C;  2YU9 B;  1QIL A;  5ELE A;  1DZ1 A;  3NQT A;  3SK4 A;  2ZXR A;  5KIX A;  2PNR C;  3NBH A;  4I7Z C;  2E2D C;  3LX0 A;  1I50 B;  4IUN A;  1DD2 A;  1H9M A;  1KAA A;  3NTH A;  1F2Z A;  5M3M B;  5CV8 A;  4JBW A;  4F87 A;  1FGB D;  2VUM B;  1XX8 A;  3Q0A A;  2O4X A;  4KKS A;  2K5Q A;  4FF2 A;  3T4A C;  5KNC A;  1OO9 B;  2Y0S B;  1G8Z D;  2K7V A;  3W2D A;  4RHS A;  4MN3 A;  4HN7 A;  2F0J A;  3MA2 B;  2O2L D;  3QOJ A;  2VXW A;  2K5D A;  1CK1 A;  4DNR B;  1QE6 A;  3HOX B;  5ELC A;  1EIG A;  5DEH A;  1PFM A;  3PO3 B;  4J1M A;  2BDN A;  1SFO B;  2AQ1 B;  4XIG S;  4ZYS A;  4DXG A;  2G9D A;  3N52 A;  4KHZ A;  4FO2 A;  4QUF A;  1G2T A;  1LT3 D;  1ESR A;  3IKJ A;  2B2Y C;  2F1M A;  3SEB A;  1LLR D;  4NMZ A;  1OXS C;  1QG7 A;  2NTT A;  4HAE A;  1D5M C;  2WV6 D;  3F2U A;  3D8G A;  1E2V A;  1IKL A;  3A7A B;  1DCZ A;  4OO1 G;  5BN5 A;  1SXT A;  3MFG A;  1MGS A;  2V4D A;  5FO7 B;  1TWG B;  2B2U C;  3P20 A;  5D65 A;  4K6D A;  5COY A;  1WTR A;  1TWA B;  2PZU A;  3M4Y A;  3QB3 A;  3RZO B;  3J80 L;  4XTC S;  2A5H A;  2XWJ B;  1D2B A;  4O1N A;  3ERO A;  4K5V A;  4RAU C;  2KUM A;  3TN2 A;  1CA6 A;  2RVL A;  3A8I E;  4RWS C;  1LTI D;  2ZXP A;  3CKI B;  2M2L A;  4A93 B;  3MXU A;  1F9S A;  2D9U A;  1EL0 A;  1HTL D;  2F0E A;  1KTK A;  1JIC A;  2R3Z A;  2XRS D;  4HMI A;  1F9P A;  4ZAI A;  1ENC A;  2L9H A;  4FF4 A;  3HOU B;  3X3N A;  2FJ2 A;  2SEB D;  2EVB A;  5M5X B;  2ICI A;  2DNC A;  2I46 A;  1G2S A;  3FMC A;  4KKT A;  2O5J C;  1TT2 A;  4HCE A;  2EE1 A;  2KOL A;  3TP6 A;  1RF2 D;  2NN6 I;  1GUS A;  1NCV A;  2EYJ A;  4IAL A;  2K04 A;  4G57 A;  1DOK A;  3ND8 A;  3MVV A;  4OHJ A;  2H1E A;  3MHB A;  3RZD B;  4DXF A;  1U4L A;  5IGC A;  2R92 B;  2BE5 D;  3E6Z X;  1WTO A;  4FNF A;  1IKM A;  1JR0 D;  1EY9 A;  1GUW A;  2J4X A;  1SYG A;  2L5T A;  5K36 H;  1ZXT A;  5AFW A;  2JYO A;  4IQZ A;  2B2U A;  1B3A A;  5FK9 C;  2EYM A;  1LT6 D;  1BNZ A;  4H13 C;  3Q23 A;  3U9S A;  5C3E B;  2AQ3 B;  4HMJ A;  3TZD A;  4C3H B;  2EYF A;  3NP8 A;  2QIL A;  4A3I B;  3I72 A;  1J9O A;  1SNO A;  1UEA B;  2VB3 X;  1DJR D;  3H3V C;  1UNS A;  4ZKC B;  1JQY D;  3I73 A;  2XVS A;  3ITP A;  4M8A A;  2K01 A;  3N6R A;  2MGS A;  1CTM A;  2EYL A;  1FD7 D;  3GTJ B;  3H94 A;  1B53 A;  1TWF B;  1PTO B;  1CQV A;  3EQL C;  2NVX B;  3M4O B;  3S2D B;  3J81 L;  1EYD A;  5T1I A;  1OXX K;  2PZT A;  2Q8R E;  3C46 A;  1LAB A;  2R93 B;  2QEJ C;  1STA A;  3J80 E;  1B44 D;  1F2Y A;  4FP5 D;  4PMW A;  1E2W A;  3GD7 A;  1O7L A;  4AYB B;  3G7L A;  2CW0 C;  3D6C A;  4OGQ C;  3EJI A;  3M7G A;  4FF1 A;  5NUC A;  1E2Z A;  4IFD I;  3R2T A;  1CI3 M;  3P75 A;  1B2T A;  4KJO A;  1ICW A;  1BXT A;  4KD4 A;  4EVO A;  5ISR A;  1ESF A;  4C56 C;  4A3K B;  1U4M A;  3A8K E;  1SEB D;  1G29 1;  4FXG C;  4CHT B;  3NUC A;  4J6H A;  1EY7 A;  1I3Q B;  3OIQ A;  1ILP A;  2H4O A;  3K5L A;  2KA7 A;  3L7Z C;  2B2Y A;  2NWG A;  3JAM L;  2D62 A;  2E76 C;  1ENA A;  1IW7 C;  2XN9 C;  4F7X A;  1B4O A;  2VB2 X;  1D1I A;  1I6V C;  1JB3 A;  4CJ2 C;  5M3F B;  2BOS A;  4Y7N B;  3HGB A;  1GHJ A;  5C3X A;  1AP0 A;  1ZYR D;  1U4R A;  1WTP A;  2C9O A;  4Z9C B;  1NSN S;  2NYZ D;  4P2C B;  1SNP A;  1ET6 A;  5LL6 S;  2WB1 B;  4C1N I;  4K5W A;  2KEE A;  2Z4H A;  4DN4 M;  5E3F A;  5FO9 B;  3IFT A;  1OXU A;  4FXD A;  1GUG A;  5EBD A;  1EY8 A;  2F3V A;  5FKA C;  1BQQ T;  1Y1V B;  2WII B;  3KBG A;  1D6E C;  3DM1 A;  2LY7 A;  4IUV A;  1V1O A;  2IX1 A;  3K57 A;  1KLU D;  1KDC A;  3H09 A;  4WOR A;  1EOT A;  1R4Q B;  1NR4 A;  1B9M A;  5CV6 A;  1DYQ A;  2B2W C;  1F9R A;  1L0X B;  1EWC A;  3VYS A;  3SR1 A;  3A7L A;  3V96 A;  5C0X G;  3KBX A;  4C3J B;  1NR2 A;  1WTQ A;  3M7N A;  5CBA E;  5C5L A;  1PLF A;  2DY8 A;  1T5E A;  1A3V A;  3CHB D;  1EEI D;  1IL8 A;  1GJX A;  2EYH A;  2ICE C;  3P7J A;  2F0Q A;  2E75 C;  1RD9 D;  4V0B A;  4QUC A;  2AQ2 B;  5BN3 A;  4PMC A;  5EKI A;  4G7Z C;  2AUK A;  3GTM B;  2RDH A;  1C8C A;  1LTS D;  3FKI B;  1MSG A;  3CU7 A;  3T53 B;  3MC0 B;  5KNB A;  3NQI A;  2DNE A;  4LJZ C;  3C1E A;  2EJF C;  2JE6 I;  2E2I B;  3A54 A;  5I4D A;  4RFB A;  1LO5 D;  1VF5 C;  5ELD A;  3LNN A;  3MTS A;  4ULL A;  4RCN A;  1Q90 A;  2RBM A;  2L4N A;  1A3T A;  2XNA C;  4IUT A;  3KK7 A;  4WJW A;  2QF7 A;  5M5Y B;  4BA1 I;  2HCI A;  2B63 B;  2K28 A;  4K2K A;  5G3L F;  3M85 A;  1KDA A;  1VF7 A;  1MSH A;  4K5X A;  1TS5 A;  1PTO H;  5JJZ A;  4BBS B;  3J7A V;  1STN A;  1E0B A;  5CV4 A;  3SK8 A;  3BZD B;  4U67 3;  4KN4 C;  3KLR A;  2PYK A;  3D4W A;  2JA5 B;  4ZK9 B;  3HEJ A;  1D5X C;  1EYA A;  4RH6 A;  4X3S A;  1VDZ A;  2HUG A;  1JOO A;  4NW2 A;  4CKC A;  3HRZ C;  1CZW A;  4EGV A;  5F2D A;  3FVQ A;  1BCP B;  5C0X I;  3PO2 B;  2I07 B;  4XYQ A;  5EQ0 A;  3OMG A;  1EYC A;  1LAC A;  1EFI D;  2A6E C;  3H0G B;  4X3U A;  1SYD A;  1PDQ A;  5A2Q E;  3S1R B;  1JWS D;  2F0S A;  4YIJ A;  2SOB A;  1ET9 A;  1S4Z A;  4R8I A;  1AW7 A;  3PUW A;  2KCC A;  5C5M A;  2BE5 C;  3FPP A;  3K5N A;  2L11 A;  4K8J A;  2WAQ B;  4F8M A;  1JWU D;  4J8Q A;  3I4M B;  3PUX A;  1GUT A;  4OIJ A;  1B9N A;  1HA5 A;  3HG9 A;  3DHQ A;  4DF7 A;  1JC7 A;  1EWH A;  2EY5 A;  5M9O A;  1O7Z A;  2F0M A;  1F2M A;  1UUP A;  3NTI A;  3VYR A;  1D1K A;  1ZKO A;  3SDZ A;  1Y69 U;  5C4X B;  4GZY C;  4DGZ A;  1QNU A;  1YNJ C;  1PZK D;  2B2V A;  3A8J E;  4JK1 C;  3QIA A;  1PTO F;  4N9T A;  1HQR D;  1M8A A;  2G9H D;  5CYU A;  3SXH A;  2B2V C;  4C1N K;  5I6Y A;  2EJG C;  3TBI B;  3K5O A;  3HKZ B;  3HOV B;  5TSS A;  2XIW A;  2JP1 A;  1FNW A;  2IX0 A;  1ONL A;  1SJH D;  1ZYR C;  2YYZ A;  4DAV A;  2WKC A;  3BVM A;  1EU3 A;  2L55 A;  3CRK C;  3V05 A;  2F0I A;  3GV6 A;  3C2P A;  4I65 A;  1XTC D;  3U9O A;  4A3B B;  5CV9 A;  3FPU B;  1TWH B;  2IT1 A;  2LKV A;  4RKL A;  4WFN 3;  1B50 A;  5FOB B;  3Q22 A;  3SE0 A;  1UAP A;  2RA4 A;  2JSO A;  1XYI A;  3QWN A;  3QJY A;  4TSS A;  1Y8P B;  5E4W C;  3R3O A;  5FLX L;  1HQM C;  1TWC B;  3V2T A;  3OW7 A;  1STB A;  1JOQ A;  2WP8 J;  3TP7 A;  2D5D A;  5CR3 A;  1FNU A;  4O42 A;  2KEC A;  2RDG A;  3W3A A;  5CBE E;  3TSS A;  2RQX A;  1WD1 A;  3D31 A;  2A6H C;  1A2U A;  1I4R A;  1EEF D;  3S1Q B;  1EY4 A;  4EQP A;  1TQO A;  4UAI A;  1R4P B;  3I90 A;  1V1P A;  3T16 A;  4B9X A;  1BBX C;  3HS0 C;  1ILQ A;  2N88 A;  4XQQ A;  1CFM A;  1TS4 A;  5DAU A;  1SYE A;  4XYO A;  2HCC A;  1O7Y A;  2CQA A;  1ZEQ X;  5IGG A;  2MP1 A;  1HCZ A;  3EA6 A;  5E1F A;  3K0Y A;  4H0L C;  3RLF A;  4KHV A;  2Q8T A;  1YNN D;  3R2I A;  4HR7 B;  3JAM E;  1SYF A;  4BS9 A;  2EPB A;  3T13 A;  3VR6 A;  4EQN A;  1AN8 A;  4IUU A;  3G6J B;  2OXP A;  2JA7 B;  3R93 A;  1STG A;  2RDF A;  3ONA B;  1RHP A;  1F77 A;  2IWH A;  3KLS X;  1YNN C;  3P1H A;  2EYP A;  5K36 G;  2KCN A;  1KNA A;  2KQ3 A;  3OIP A;  2EOT A;  1QWY A;  2PW5 A;  5D3I B;  4RHR A;  1U9R A;  3DMU A;  1W6K A;  3S14 B;  1IW7 D;  3GTG B;  2NTS A;  1X3P A;  1H9S A;  2DY7 A;  2XWB B;  4G7H C;  1CA5 A;  2EY6 A;  2K32 A;  2KVM A;  3BDL A;  3O13 A;  3BVG A;  4HSV A;  1AZP A;  1I4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...