2EXZA

Crystal structure of staphylococcal nuclease mutant t22c
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDCVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 39
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2exzA00
2F0JA 5EGTA 5IOCA 1EY6A 4J1MA 3PMFA 5J1ZA 3D6CA 2EYJA 4YIJA 4WRDA 3TMEA 2F0VA 3EROA 4K5XA 1KDBA 3MXPA 2RKSA 1EZ8A 5KYLA 2EY5A 4EQNA 4KY7A 1IHZA 3T16A 1EQVA 2SNSA 5IGBA 2KHSA 2NUCA 5IGEA 5HURA 4KD3A 5C3XA 5CV9A 1SYCA 2OEOA 2F0QA 3MEHA 3SHLA 4I65A 5I9OA 4KY5A 2F0NA 5EKKA 4F8MA 2F0OA 4K5VA 3C1EA 2EY1A 2O4XA 5C6AA 3QOLA 5I9PA 4OL7A 5I6YA 5IGFA 4KY6A 5C3WA 3BDCA 4TRDA 4NDXA 4PNYA 4KJNA 2EYFA 2EYHA 3HEJA 5C5MA 3ITPA 3RUZA 2F3VA 4DFAA 4WORA 4H7BA 2HQEA 2OXPA 4KD4A 1SNCA 5CGKA 1TT2A 3NUCA 4HMIA 4KV6A 2F0EA 1F2MA 3DHQA 2PW7A 3D4WA 4NP5A 1ENCA 3TP5A 3SR1A 2PZTA 3MHBA 3SK5A 3H6MA 1A3TA 3NXWA 4RKLA 4ZUIA 4DU9A 5I6WA 5CV4A 3NHHA 5C4HA 5IGCA 1STBA 5IGDA 1JORA 5KGUA 2F0FA 1JOKA 1KDCA 5CV8A 1EY8A 1A2UA 3TP6A 2LKVA 3D4DA 5CV7A 4K8JA 2RDFA 1STGA 3NK9A 4G57A 1A3UA 2F0DA 1RKNA 4DF7A 5KRUA 3U9OA 1SYFA 1EYDA 5IIFA 4QMGA 1KAAA 2EY2A 4EQOA 3OMGA 5KYIA 3T13A 5HGTA 3QB3A 3OWFA 4IZ8A 5DAUA 3LX0A 1SNQA 3NQTA 4HMJA 5K5PA 1EY0A 2RBMA 2F0MA 3ERQA 4K14A 1SYDA 4K8IA 4QF4A 1TQOA 2EYMA 4IUNA 4R8NA 4F7XA 1ENAA 1EZ6A 2PQEA 3S9WA 1KABA 1EYCA 1STHA 2PW5A 4MIUA 2F0TA 2ENBA 5CV5A 2M00A 4ID6A 3EVQA 4QB4A 5M9OA 4PMBA 5IODA 4N9TA 1A3VA 1EY5A 3VA5A 1EYAA 2EYOA 3TP7A 1TR5A 5NUCA 4K2LA 4K5WA 2EY6A 2EYPA 2F0KA 2F0IA 5C4ZA 1STNA 1SYEA 1EY4A 2PZWA 3NP8A 4NMZA 5IGGA 4KJOA 3EJIA 5JOBA 2KQ3A 3SK4A 3SK8A 3P75A 2SNMA 2SOBA 1EY7A 2QDBA 5CR3A 4EQPA 4ODGA 4B9WA 2PYKA 5J39A 5E3FA 3SK6A 5CV6A 5E1FA 1F2ZA 1SYBA 5ISRA 2EYLA 1NSNS 1II3A 4LAAA 2F0PA 1SNOA 4KTAA 5C5LA 1A2TA 4E6IA 3MVVA 4KHVA 4NKLA 4K6DA 1SNPA 4DGZA 3R3OA 1JOOA 5KIXA 5EKLA 1SNDA 2WACA 4B9XA 1EY9A 2F0GA 3TP8A 4N9PA 4ZUJA 3MZ5A 2OF1A 3V2TA 1KDAA 4ZQ3A 3E5SA 3QOJA 3DMUA 4K2KA 1SNMA 2EXZA 2F0SA 3OMCA 1NUCA 5CC4A 1F2YA 1STAA 2F0HA 1AEXA 4HTHA 3D8GA 5DEHA 1JOQA 2F0LA 5JAVA 4J6HA 4RKBA 4EVOA 1SYGA 4S3SA 5J22A 3BDLA 1U9RA 4ME5A 1STYA 2F0WA 5F2DA 2F3WA 2PZUA 3P1HA 5KEEA 3HZXA 4PMCA 3SXHA 4IALA 3OSOA 2F0UA 3C1FA
chains in the Genus database with same CATH superfamily
1AFPA 3NTHA 3MEFA 2TSSA 4R8IA 4YIJA 4ZKCB 1RIPA 2BE5C 4OX9L 3J7AF 3JAMi 1R9TH 2E5LL 3BU2A 2OEOA 2C9OA 2NTSA 2M2LA 1VQ5A 4H44C 2OTJA 3ERSX 2DJGC 3BVMA 3VR2A 1V1OA 1LTLA 5I9PA 1IBLQ 2VXWA 1MI2A 1YHAA 3EBEA 2A6ED 2E2HH 1XPOA 5C5MA 1IYVA 4FDBA 3OIPA 2F3VA 1T5EA 2A74C 4FF4A 3K80C 4GLAC 2FJ2A 2Y0SG 4KV6A 4DXGA 2I0QA 5CORA 5I6WA 4YHHL 3S2DH 1LT3D 1MIUA 3PCOB 4DAYA 2MQHA 2JN4A 3HRZC 3DXJC 1VQPA 1E0BA 2CH4A 1BUVT 4L63B 3C2PA 1DONA 1Z9FA 1ESRA 3MWYW 3KBGA 2R7ZG 2B2VA 3CHBD 4JI1L 4C3IG 3S1QB 3GDEA 5CYUA 1HA5A 1SYDA 3CMAA 4QY7A 3TRZA 4A3MB 1AE3A 2ENBA 1I94L 4IPCA 4BY1H 1X3PA 3VA5A 3HOXG 1IL8A 4A3KB 4K2LA 2D5DA 3P7JA 5FJ8G 2ZJRA 4NMZA 2WB1B 1XNQQ 1SJED 3LWUA 4CKBA 4GS3A 5JOBA 5IGGA 1N33Q 4DAVA 1JC7A 1EWCA 4JBJA 4R4IA 4WFN3 3J81i 2RCFA 3CP0A 4B9WA 2PYKA 3TREA 2JSOA 2UU9Q 4TKOB 5C4XG 4X64Q 4LF7Q 1SFOB 3PGZA 2ZT9C 4QJFA 2KEEA 1VQKA 3M4YA 3S15H 1KDAA 2J4XA 5BR8Q 1EIHA 2XRQD 1F9PA 1BBUA 4FVMA 2A73B 2XTIA 3TS0A 1FGUA 1SDFA 4L5QA 4O42A 1DOKA 3IAYA 2AKWB 1H95A 4IJHA 2F3IA 1I6HB 2MHVA 1OXUA 4YWLA 2F0LA 3L3OC 1SMYD 1HR0W 3N6RA 3GTGH 4LFCQ 1WTVA 3P1HA 4CDEC 1XTDA 2K52A 1TS2A 5BN5A 4OO1H 1TWFB 3KFUA 2EYJA 2Q2IA 1M90C 3G7LA 1TY2A 4EQNA 4HJ8A 4DKAC 1WD1A 1EEFD 5K36H 1K0SA 5IY0A 3EQLC 1K8GA 2F0NA 1AZPA 1BCPF 5C6AA 4KKUA 2B2UC 4C1NI 4DR4L 1NAPA 1YITA 3HEJA 1Q1EA 1LACA 4KD4A 2J7ZA 3KLSA 2NWGA 5CGKA 4A3FG 2CWAA 3D4WA 3D0FA 4UDUC 3QJYA 1NMFA 1YNJC 1FJGL 3I4LA 2B2YA 4FXKC 2UXDL 1OXSC 2QEXA 4A3JB 3LGJA 1VF5C 2R6GA 3NK9A 2CH4W 2OT2A 3QG1A 5D65A 1Z47A 4XYQA 1R4PB 1KRTA 4P75A 1W3SA 4YY3Q 1I5FA 5HGTA 2ASBA 4H0LC 3URYA 4BBSH 4QIWE 4KMUC 2RSOA 4LFAQ 1EYCA 5KNBA 4U68A 4BS9A 2KCCA 3HKZB 1JR0D 2K5HA 1GUTA 4PMBA 1SROA 1TS5A 5IT9E 2GN5A 3VR3A 1BR9A 4LF9L 1E3PA 1ZEQX 3M85A 1EWHA 3S2HB 4DV4L 4C2MB 3PIPA 3S1QH 1DYQA 2GVBA 1VF7A 2WAQE 3D6WA 4XTCS 1JWMD 2PNRC 2ICIA 1X55A 1JOOA 3VR5A 2WFWA 5D3IB 5BN3A 1EU4A 1UAPA 1Q82C 2WV6D 4A3KH 2EE1A 4OHJA 3D3RA 1O7ZA 1PFMA 1E2ZA 4C3JG 2DNCA 1VQ4A 3PO2B 4IFDI 2HCCA 2LXJA 2Q2UA 3BDOA 4J6HA 1X54A 1EFWA 3BDLA 4JV5L 3K6OA 1WCMG 2R7FA 4YCVA 5KEEA 1GUGA 3I55A 2N49A 1SFOH 4JI8Q 3J7A5 3TN2A 1HR0Q 3KLWA 3HG9A 4HCEA 2A6HD 1Q46A 2ICEC 2NZHA 3GV3A 5IGEA 4IUQA 2N3SA 1SMYC 4FXDA 2QCPX 3L7ZC 2UXCQ 1QUQA 1I6HH 2CQAA 3G48A 4LMQD 1IYUA 4JI4L 1PTOD 2E2IB 3A56A 1D2BA 5IP9G 4FF1A 3NBHB 4KJNA 3PIP3 2Z6KC 1BO0A 4WORA 3Q23A 3CKIB 5CMDA 1SNCA 3GP7A 3AQQA 4JYAL 3FDTA 4JOIA 1T9HA 1QE6A 4OELB 1XMQL 5CV4A 1SRUA 1VS0A 2B39A 1S3OA 5CV8A 4KHPL 4X3TA 4NW2A 5CV7A 4K8JA 4I7AA 1R4QB 2DN8A 4BBRB 4LF8Q 1HNWL 3OHXC 2KOLA 1OXVA 1ONLA 1KAAA 1KQSA 1V1QA 1G91A 4A4IA 2VQEL 2K1BA 2RBMA 4IUUA 4DNIA 2EYMA 3MXNB 2UXBQ 3HOYG 2ZJQA 2TMPA 2QGQA 5IYBH 4KI0A 1ML0D 2JA7G 1Q86C 1HJPA 1LTSD 3E9HA 4A3JH 4RAUC 2F0KA 4LNQA 1WFQA 1F9QA 3BZKA 3J80E 4RGNA 3GTKB 3M4OB 4EQPA 1JMCA 2MO0A 2HUGA 1H9RA 1F2ZA 1BBXC 5M3FB 3S1MB 2R92B 1B9NA 1GKHA 2PQAA 1M1KC 2LMCB 5LMNW 3MXUA 3S1NB 2F1MA 4KN4C 1HTPA 2VQFQ 1L0WA 1B50A 2Z6BA 2D2CC 3MFYA 4DV2L 4FNFA 4JI2Q 4P2CB 1STAA 1AEXA 4JBWA 3S2HH 2H4OA 4Y7NB 1XYIA 1QVCA 1GVPA 1O80A 3RLOA 2QA4A 1IHZA 4B3TQ 5E7NA 1AN8A 1O7YA 5IGBA 1UE1A 3PO2H 1PRTB 5EKKA 1LO5D 4B3ML 2PNHA 2O4XA 4PZ6A 1BDOA 2L0CA 3J81j 4A3EB 1XMOL 1CKNB 4GNXA 3HGBA 4XIGS 3CCEA 4WJ4A 4LF4Q 1KRSA 1WTRA 2IHFA 3NUCA 3NWSA 2PMZE 1ASYA 4V190 4V0BA 1VQDA 1W6KA 3A54A 3X3NA 4DR2L 4ZUIA 3NHHA 4NXNQ 5IGDA 4XDXA 3CCMA 3J80i 5C3EG 1KNAA 2JA5B 2A1AA 3D4DA 4PV1C 4U673 2EQSA 1RF2D 4KN7C 2E2IH 1PRTF 1MBYA 4ZRZA 3T1HL 3K81C 4JI7Q 4OWXB 1IBMQ 4JI6Q 2CKZB 3QB3A 3BVGA 2EVBA 3NTKA 4RA8A 1PDQA 1A8VA 4M1UB 1EYAA 2HD3A 5FO7B 1J9OA 5EAYA 2QDLA 2EYPA 4BBRH 3W1BA 2JA8B 1WTWA 2VB3X 3K7AH 5C4JB 4QCLA 1BNZA 4AYBB 2AQ1B 1G6ZA 5ELFA 3KYHC 1A2TA 2H5XA 2KA7A 5A2QE 3K5LA 1WTXA 5ELEA 1G291 4DV1L 1RHPA 4R1JA 1H9SA 4N9PA 1TIID 1B3AA 3V2TA 3E5SA 2NVQH 3FKIH 4K2KA 2A68C 2L55A 3GTKH 3M4OH 1DXMA 1EEID 1JWSD 2VL6A 3UDFA 3W1GA 1WTOA 4UPAA 1QZGA 3AU7A 4A3BG 2NYZD 2GVAA 4ABNA 3OYYA 3T1YL 2XWJB 1LT5D 3HOZB 4A93B 5M3FH 3S1MH 2R92H 3OSOA 3I3CA 5EGTA 5M5XH 1EY6A 4X65L 4G7OC 4LF6L 4DAPA 1I50B 2K4KA 5LL6S 2RKSA 4CJ2C 3OPOA 4KY7A 1L1OB 3S1NH 4A76A 3ND8A 4RMFA 3WOEA 3K57A 1WI5A 2OWOA 2VZAA 1EQRA 2EY1A 3S1RB 3OOCA 1V9PA 2WAQG 4OL7A 4Y7NH 2V1CC 1EWIA 4NB3A 5JVH3 2EYHA 4A3LH 1G2TA 3DLLA 4DV3L 4IO9A 4RCOA 2A8VA 3TEHB 4X3KA 1ICFB 4DR3L 1B70B 1I3QB 1PYSB 2JP1A 1S5DD 1UUPA 4ULLA 4A3EH 5LMUQ 4DV6L 4P73A 1SYFA 4KKSA 5C0XI 4B3SQ 4QMGA 3C46A 3CCUA 4DR7Q 2NVXB 1TWHB 3I4OA 4NXML 2ATWA 2E2JB 1GUNA 2DNEA 3PF4A 4QF4A 4R8NA 3S9WA 4FP5D 2PO4A 5CV5A 3EVQA 1Z7TA 4G7ZC 1EY5A 2NN6I 2ZM6Q 4A3DB 2JA5H 1TR5A 4JI0Q 5ELDA 1M4VA 1D1IA 4PZ7A 1C48A 3DM1A 2PZWA 3I91A 1F9RA 4GOPA 3U58A 3P75A 3J7ZC 2NB0A 1Q90A 5E3FA 3JAML 1Y1WH 1CA6A 2ZXPA 4DUYQ 4GKKL 2EYLA 1FNWA 1NCVA 2EJFC 4KHVA 1CZWA 3GTMB 2B63B 2K05A 1ILQA 5JPMC 4GLXA 1SR3A 2RHSB 3STBC 2YU9B 4BY1G 1I4XA 2CQOA 3FPUB 1SNMA 1IKMA 2QW7A 4Y52H 2JA8H 2OQ0A 4CBVA 4DK6C 4POGA 4EVOA 1SYGA 1CHPD 1Y8OB 4IPGA 3SXHA 2F0UA 2F0JA 3AFPA 1NE3A 3D6CA 1IBKQ 4K5XA 1IXRA 3ZJYC 1E2WA 3RZOB 2EY5A 1OO9B 1TWCB 4XT1B 5JJZA 3KJOA 2L12A 3FHWA 5CV9A 1CFMA 3MEHA 4LWCA 2O5JC 1YJNA 4HIMA 3HOWB 4HSVA 2SEBD 4BA1I 2HDLA 4JC0A 5T1IA 1CTMA 4KY6A 1J5EL 2K04A 4GN3B 4X66Q 4DR1L 1SAPA 3BDCA 4TRDA 2HIVA 4NPSA 3HOZH 4A93H 1X65A 1SXTA 1PHJA 4OO1G 1DOLA 3CC7A 3TDQA 5C44G 1I50H 1RODA 1GO3E 4NP5A 1C8CA 2KJXA 1ESFA 2I46A 2VUMG 5COYA 3J81L 2FMCA 1VQMA 3G6EA 1K83H 3RR5A 2FHTA 3RLFA 5IYDH 1XJVA 5K36G 2XSCA 5M5YB 2LKVA 3S1RH 4HIOA 4ZCKA 1LTBD 1UE6A 1YNJD 1TU2B 3GTLB 1B1ZA 4HMJA 2IX3A 1C9OA 1FGBD 4K14A 4B3RL 1EUJA 2Y0SB 1TKWB 4YWKA 1STHA 1L0YB 4JCVE 5M9OA 1JQYD 5IODA 1B9MA 1KHIA 4AIMA 4EX5A 4FXGC 2B3GA 2Z9HA 2EYOA 3JAMc 1BQQT 1O7IA 2IX0A 3K58A 1B3QA 5JEAJ 2SOBA 2NVXH 1IL2A 3KDFB 4ZAIA 2R7ZB 3MFGA 4LAAA 4XQJA 4B3MQ 4BBSG 1PTOF 3ULLA 3E0EA 3KLRA 1EU3A 3KBXA 1HXYD 4MZ9A 3MZ5A 3FMCA 3L0OA 4A3DH 2D0OA 1V1PB 2IHEA 3HP3A 3HOXB 4XXEA 2RA4A 1LUZA 1BOSA 2B2VC 3A55A 4R4OA 4Q0FA 4DR6L 4CDDC 5FLMH 1GUOA 4CHTB 1K28A 1X3FA 4GN4B 4DR2Q 1N34Q 4C3HH 2UUCL 1N36L 5JJIA 1TVXA 3GTOB 2XIWA 3CPFA 1HPCA 3H91A 3T56B 4BY7B 1K8OA 3GTMH 1OTCA 4J1MA 3T53B 2UUBL 2G9HD 1ILPA 3KK7A 2YU9H 5FO8B 2UUAL 3EROA 4MNOA 2IPKD 1NNXA 3CU7A 5KYLA 4UAIA 3A5UA 2MFIA 1D7QA 1NMGA 3TZDA 2RSNA 4DPGA 4A3KG 5C3XA 2AQ2B 1BCPB 1DCZA 5JEAH 4LFBQ 2L1BA 4I65A 2WB1G 4F8MA 1SBBB 2I5LX 1LTTD 1YVCA 3AMUA 3H3VI 2L5TA 5D3DA 2D62A 4X62L 1TXYA 3J81c 3RZOH 1F2MA 3DHQA 3TP5A 1CUKA 1TWCH 4DU9A 3WWVA 5C4HA 2JEAI 5KGUA 1JOKA 3M4QA 2EXDA 1K8AC 1MGSA 3HOWH 4X6AH 1A3UA 4IOAA 3U9OA 2MJ8A 2F4VL 3GTQH 1SN8A 2EY2A 2D9UA 4K0KQ 3BJUA 3T13A 3GD7A 1NBWA 5DAUA 3PO3H 1E24A 2QF7A 1PRTC 1GM5A 1HNZQ 2F0MA 2E8GA 3KOJA 1A15A 2PQEA 4LUZA 3HOUB 3S16B 2PW5A 2B2UA 2P5ZX 5G3LF 2M00A 4JI5L 4UY8C 3GTPB 1VQBA 5I4DA 4ME3A 5M5YH 4KKTA 4ALPA 3PQIA 4EQ5A 4HJAA 4P72A 4WJWA 1XNRQ 3SK8A 3GO5A 1EQQA 2SNMA 4IJLA 3GTLH 2QDBA 5CR3A 3VYUA 5CV6A 4DUZL 3PIOA 4DK3C 1PZKD 5GROA 3C3LA 4IFDJ 2WIIB 3MXGA 4DGZA 1N32Q 5FLXE 4L8JA 1EQTA 5LMNL 5EPKA 2OTLA 5IYBG 4GKJQ 2OF1A 4DV7Q 5AJ3Q 4A3JG 1F2YA 2J0TD 5IWAQ 1QVFA 4O2DA 4RGMA 5EQ0A 3CPWA 2WKDA 5IT9L 1QB5D 4IOCA 5F2DA 5M5WB 1OXTA 2R7ZH 3S14B 1RJTA 2HHHQ 2EJGC 2AQ3B 3CCRA 4XQQA 4A3MH 4WRDA 2BDNA 2F0VA 5ELOA 3DWQA 5EBDA 5IE8A 2B2WA 3CAMA 5EPLA 4DV0Q 1IZ6A 1RD9D 4RGTA 1DJRD 2F0QA 2NZ1D 3HOVB 1KL9A 2A5HA 3HFZB 2XWBB 1CSQA 4K5VA 5JJLA 3QOLA 3MC0B 4AH6A 2EZVA 4IFDH 2RHQB 1QNKA 3J7AV 4BY7H 3PIO3 3OTOQ 1HNXQ 3IL8A 2RCNA 3D31A 4J8QA 2BDOA 2IL8A 1PZJD 3G6JB 1GUWA 1G8ZD 2VS1A 2PI2E 4EGVA 3I56A 1VDZA 1RTOA 2Z4HA 1YHQA 3PO2G 1C0AA 1A2UA 2CW0C 4IUPA 1UE7A 2JXMB 1IYJB 2X6GA 5IYCH 1PH7A 1L1OC 3R93A 2MGSA 3UDIA 3RZDB 1X6OA 3SDZA 2KHJA 5KNDA 1TWFH 4DV5Q 1V8QA 1HHVA 1I4GA 2VB2X 3UE0A 3QWNA 1QWYA 1DD2A 4YCUA 2F0IA 4POFA 1MSHA 4DAYB 3SK4A 4Z9CB 5HGQA 1EY7A 4XQNA 4ODGA 1S5BD 4UP7A 3RMHA 1J6QA 1E1OA 4IUVA 2PI2A 4YWMA 5C5LA 1T5XD 3HOUH 4K6DA 3S16H 4AQYQ 3R3OA 3FP9A 4CKCA 5EKLA 1SNDA 3RLNA 2AMCB 5JVG3 3GTPH 3N52A 4RGOS 2GA4B 1CI3M 2FXQA 2QEJC 3IRBA 4PQXA 2JA6G 2EXZA 1FVIA 5IT9c 3H09A 1Q3LA 1JOQA 5DEHA 1C7YA 4OX9Q 1EIGA 2A68D 3PUZA 2E5LQ 3K59A 3E9IA 4RHSA 3J80L 3H0GB 2ZXRA 5GAHC 1XPRA 5JJKA 4DR5L 2LFNA 1GHKA 3W3AA 1SLJA 4JI3L 1JJ2A 1FNUA 3NELA 2SNSA 4HSPA 3CRKC 3FKIG 4KD3A 1FNVA 3QR8A 4OEMB 2K14A 3KJPA 1H9MA 4CJ0B 1M8AA 1GHJA 5I6YA 1ICWA 1CKMA 1WJJA 1OXXK 3S14H 4YHHQ 4UP8A 3CRLC 4C2MH 3CF5A 1KTKA 2YTXA 4OXPA 3DEOA 3NTIA 2R92G 3NENA 1O7LA 5GADC 2JE6I 3PF5A 2QKIC 2XN9C 1UE5A 1IBLL 1UEBA 3OWEB 1I6VC 3LWEA 1YEZA 4IUTA 5I2XA 3SGIA 1JORA 3HOVH 3H3VC 2F0FA 1S5CD 5EPJA 4JI1Q 4G57A 5KRUA 2BA0A 2N8NA 1I94Q 4P74A 5KYIA 2D0PA 2EIFA 3TZUA 1NJIC 4HIDA 3F1ZA 1U0LA 3OWFA 1ASZA 4IZ8A 3LX0A 1MHWC 1KD1C 4A3LG 3KF8A 4DK1A 4IUNA 2UUCQ 3MTSA 4KLKA 4GNXC 4N9TA 1A3VA 1S40A 3NE5B 1GD7A 2MO1A 2EY6A 1SYEA 4A3EG 3M3YB 2K7VA 1DM0B 3NBIA 5IP9H 3RZDH 1Y1VB 2E2DC 3PV0A 1QG7A 3ER0A 3A7LA 1SNOA 4X3SA 4FF3A 1LTRD 3BYYB 4QUCA 1PYWD 1E22A 1XNQL 4JBMA 2MP1A 5KIXA 1N33L 2B2TA 3KUPA 3JC66 1HQRD 5DM63 3QOJA 1DGSA 3DMUA 1SE2A 3MAQA 1X3GA 2VY3A 2JA5G 4X64L 1NUCA 1TY0A 4LF7L 1VQHA 4K6LA 3STBD 4IQZA 4HTHA 1SE4A 1AZQA 1V43A 2IWHA 3J80c 1NR4A 3I2ZA 1MKHA 3V96A 3L2PA 2KCMA 2N88A 3R2TA 1Y1WG 2WB1E 2IW3A 5ELNA 5BR8L 1G6PA 1CQVA 2KENA 4XT3B 1KDBA 4DR4Q 2MPMA 4IN3A 3NQIA 3CCLA 3KF6B 4LFCL 5AFWA 5A2QL 2MUYA 1SYCA 1HQMC 1XX8A 5I9OA 2BA1A 2F0OA 5IGFA 1YI2A 1PH6A 4A3BB 4JVZA 4QIWB 4UHVA 5L37A 4AYBG 1FJGQ 2YV5A 2UXDQ 3H0GH 2NTTA 2KVMA 2R61A 1TT2A 5C0XJ 1EOTA 3VR6A 1WTQA 3SR1A 3G71A 2KECA 3M9BA 2A69C 3GV6A 3I72A 2JEBI 1Q81C 4LUVA 3I73A 1PH4A 1VMPA 2WAQB 2ZJPA 1HUMA 3OMGA 3HOZG 3ULJA 4RCNA 4A3GB 4A93G 1JICA 4DN4M 1BCPC 3A8JE 2HDMA 4K8IA 1B8AA 4F7XA 4F87A 4HAEA 4LF9Q 1KAWA 3L9AX 3T51B 1D6EC 4DV4Q 4G4KA 3MA2B 4IPDA 5NUCA 4K5WA 1Q7YC 5TSSA 5IYDG 5M3MB 4MN3A 1A0IA 3EJIA 1B2TA 3Q24A 4H02A 4JBKA 3HKSA 1JE4A 1Q8IA 5C0XH 2HT1A 1II3A 3I7FA 3RD4A 2F0PA 3VYRA 4L6TB 4OGQC 3BS1A 2B8FA 4B08A 4JV5Q 2FMMA 2HQLA 2C35B 3OMCA 4HIKA 3T4AC 1IKLA 1YNNC 5CC4A 3M3YH 2F0HA 3K8AA 3D8GA 1YZ6A 2NN6H 4RKBA 4IPHA 2WKCA 3I4NB 1U9RA 1Y1VH 5DM73 4BXXH 3EIVA 2SDFA 4PMCA 1IW7C 2CHBD 4B9XA 1QILA 1D1KA 4JG2A 4HJ5A 2PQAB 4JI4Q 5IP7H 2JA9A 2K33A 1RDPD 4A3DG 5D14A 3SVMA 1BVSA 2ES2A 1JB3A 3U4ZA 1LTGD 2JQOA 5EKIA 3NPPA 3IFDA 4JI8L 3TBIB 3M7NA 1PFSA 5FLMG 3C1EA 4J15A 4JYAQ 1HR0L 1TWGB 4C3HG 5C4JH 1XMQQ 4NDXA 1CKOA 1LT6D 4PNYA 3ICEA 2LSSA 3U9SA 4KHPQ 2G5DA 2HQEA 1WTPA 2UXCL 3VA7A 3CXCA 1SE8A 2K75A 1HNWQ 4N8X1 4A3IB 3VYTA 2PW7A 2ZXOA 3I4MB 2Q8TA 4L5TA 2VQEQ 1PH2A 4CDCC 5JEAG 2QILA 2RDFA 3I70A 4DF7A 3K5MA 1QCBD 2I5MX 1KXLA 2R93B 1ZKOA 4LK1C 1MSGA 4GNXB 2F4IA 1PA6A 3CCSA 3O13A 3VDYA 1U4PA 1I4HA 1QVGA 4CJ1B 5C44B 1EZ6A 1PLFA 4LF8L 2Z8LA 2F0TA 2VUMB 1PRTD 3CC4A 2F52A 4LJZC 2Q8RE 3HOWG 4DR5Q 1YJWA 2UXBL 2KQ3A 4LUOA 1UWVA 2DY8A 1U5KA 2EJMA 5J39A 4A3GH 1KLUD 2K32A 1KC8C 2L9HA 1PTOB 3PO3G 4QL5A 4DV2Q 2DGYA 3IFTA 4Q5VA 1EY9A 2Q8IB 3AB9A 1B44D 5M3MH 1I3QH 1VQIA 3R2IA 4FO2A 2Z4IA 4MTNA 1FD7D 4S3SA 1TWHH 2F0WA 1LV9A 3NBHA 3SE0A 2PMZB 4TQUS 2E2JH 5CBAE 2VQFL 1YJ9A 2ID0A 4BBSB 5IOCA 4C3IB 1TS4A 3PMFA 4JI2L 1HFGA 3CCQA 1XMOQ 1VMCA 4MHEA 5JPNC 1G2SA 3W2DA 4A3CH 2EPBA 1H9SB 1EQVA 3CW2C 1WOCA 4P71A 3OIQA 3BG3A 1X32A 1SEBD 3DEPA 2L4NA 4B3TL 3I4NH 2BCOA 3V05A 1MJEA 1GJXA 3U50C 4F88A 4RWSC 1HZCA 4H7BA 1GOZA 5C4XB 3MXNA 3PUXA 4LW1A 4FF2A 1D5ZC 2B63H 1E1TA 4C1NK 4A3MG 1X56A 1C4QA 1K9MC 3T1HQ 1RL2A 1BXTA 3H6MA 3PUWA 3PUYA 1VQLA 4TSSA 1WYDA 4LF4L 4A75A 4ILWA 1STGA 3WOFA 1HRJA 1TWGH 1LYLA 4IFDG 2LXKA 2CW0D 1X3EA 4NXNL 3BZCA 4BY7G 1PFBA 3H3VH 1EY0A 3VYSA 2IX1A 1WVLA 2ZTEA 1LM0A 1S5ED 4A3IH 1Y8PB 2KHIA 1VQCA 3I4MH 4MIUA 3EFXD 3UDXA 4ID6A 4QB4A 4LF5L 4JI7L 1IBML 4R9WA 4JI6L 5KNCA 1YBYA 1O78A 2K5NA 1STNA 1AW7A 3FRPB 1ZYRC 4DV1Q 4OO1I 3B6YA 5IYCG 2R93H 1S5FD 3CMEA 2XGTA 3A8IE 4UP9A 4DNRB 5ISRA 1Z6HA 1A63A 3U4VA 3P20A 5C44H 1K73C 5ELCA 3AFQA 4A3FB 2JYOA 2VUMH 3T1YQ 3R8BA 4C56C 2F0SA 4OIKA 4X65Q 3WDNA 3TSSA 4LF6Q 1CKNA 4CGYB 5JAVA 1VQ8A 1GUSA 4GOPB 4JPBW 1H9JA 1STYA 1TWAB 3E6ZX 1U4MA 1PTOH 2H1EA 4IALA 5EBCA 2B2YC 2ZTDA 3F2BA 3HOUG 3E3XA 2I07B 1CSPA 4AYBE 1E7ZA 3TMEA 3E0JA 4H13C 2RVLA 3UI2A 3T16A 1K0RA 1VQ7A 2KHSA 1JJCB 2XRSD 5FLXL 1SJHD 2A6EC 2E76C 4DV3Q 4OONA 2DUDA 5J3BA 1YIJA 2IY5B 3A8KE 3M4PA 1XXGA 4R4CA 4OIJA 4CKEA 2PCFB 1WTHA 4DR3Q 5FO9B 4C3IH 1UEAB 3M7GA 4DV6Q 2PPBC 1D5MC 4X3UA 3K5OA 3K5NA 3MHBA 3NXWA 4JW0A 3D4RA 3HKZG 1JWUD 4NXMQ 5ELBA 3RNUA 2N78A 3HOXH 3GTJB 4YCWA 1WD0A 5FJ8H 2RDHA 4C3JB 1VQNA 3A74A 1RKNA 4HEDA 1EYDA 1XPUA 4QUFA 3W5OA 1KLGD 2K5VA 4ZK9B 2B2WC 3GTOH 2JK8A 1U4LA 3S17B 2K5QA 1WCMB 1PH3A 5C4XH 1J8IA 2CVRA 3ERQA 4L5RC 5LMUL 1KABA 3I8ZA 1CM9A 3KF6A 3NWTA 4WJ3M 4B3SL 1A62A 4DR7L 1HUNA 4GKKQ 3HOVG 1PVOA 2N55A 3SEBA 3AYHB 4R4TA 1AH9A 1QOHA 2X6LA 2ZTCA 4PZ8A 1X9NA 4BA2I 3SK6A 2HCIA 5E1FA 1LTAD 2ZM6L 4JI0L 3MVVA 4HCSA 2Z1CA 2WACA 1L1OA 1G51A 1AE2A 4DUYL 2Z6KA 1K3RA 1HTLD 3A0JA 5J22A 4JOIC 1VCIA 1VQGA 2F3WA 3HZXA 1LLRD 1CT1D 2EOTA 2YTYA 4RH6A 5FK9C 4QGUA 4A3FH 5J1ZA 2KCTA 5FLXc 3HOYB 2O2LD 1J5EQ 4DR1Q 1VQFA 4OWTB 2JA7B 2JA6B 1EIYB 1SMXA 2NVTB 2B8GA 2EDGA 1I4PA 4MTKA 2DY7A 4ZKBB 4BBRG 3K7AB 3RN2A 1IBKL 1B7YB 1TWAH 5C3WA 3H15A 2K5WA 3K7UC 1VQAA 1S72A 3CQZB 3FEWX 2RQXA 2YYZA 1PMRA 5GQOA 2Q2HA 1NY4A 1PH1A 2F0EA 2VNUD 4RKLA 1SSOA 4X66L 5GAGC 4QQBX 1YNXA 1STBA 3FKIB 2NVQB 1NTGA 3Q8DA 3FVQA 4B3RQ 2K01A 1XWEA 2K28A 2F0DA 1XTCD 1UNSA 2A69D 4EQOA 2XVSA 3I90A 5A35A 5M5WH 2O5IC 1P16A 2L15A 3H0GG 3HS0C 5M3FG 1EIFA 1MD2D 3BZDB 5M5XB 5E4WC 5CBEE 1JE5A 1STEA 1BF4A 4ZLTF 1BCPD 1ENFA 3GTJH 3OW7A 3UDGA 1B4OA 4C3JH 4ZYSA 4FYDA 1FL0A 4DAMA 1EFID 3DUZA 1F77A 1KNEA 3TQYA 1QJOA 1U4RA 2K50A 3S17H 5G3LD 1WCMH 2K03A 2B29A 1N8RC 4DR6Q 2AHOB 5DLQE 4XYOA 1VQJA 1SNPA 1EYGA 3CCJA 1N36Q 2F0GA 3OW2A 3CD6A 3UE1A 2Y0SE 2YTVA 4GLVB 2CFMA 1CK1A 5C3EB 1VQOA 2UUBQ 2UUAQ 1TS3A 1PH8A 1LTID 2ALYB 2G9DA 4KHZA 2NZOA 3TS2A 3J7YW 2BH2A 2LS01 1YNND 1Y69U 1DOMA 4R4QA 3PSIA 4JK1C 1E2VA 2A6HC 2E74C 5C0XG 2F03A 3PUVA 4O1NA 1K3BC 2AUJD 4RHRA 2KEDA 2A19A 4RG1A 4DXFA 1N34L 1IW7D 5H1SE 4GZYC 2VW9A 2NUCA 1PTOC 5HURA 4X62Q 1GXDC 1Q12A 2Z0SA 3DWPA 3SHLA 2UU9L 3FPPA 3F2UA 4M8AA 3K0XA 1L2FA 2NN6G 4LF5Q 2B2TC 5I2YA 1Y1VG 1Y1WB 4BXXG 2EYFA 3RUZA 2HIXA 3IKJA 4LFBL 4HJ9A 1PFNA 2BOSA 2KBNA 3HOYH 1N9WA 4HMIA 2F4VQ 1ENCA 1VQ6A 2AWNA 5IP7G 2JA7H 2JA6H 2NVYB 5IGCA 1PYBA 2NVTH 1PH5A 2WINB 1KDCA 1CHQD 1Q1BA 1DZ1A 1S4ZA 1W6JA 2JA8G 2OCEA 3Q6SA 3KDFA 5IIFA 4DNTB 1CZGA 4TVAB 4JI5Q 1BBWA 1FYCA 1YHBA 2E75C 3F2DA 2CCZA 3CQZH 1SNQA 5K5PA 4HN7A 3S24A 1HCZA 2I5HA 1ENAA 3NSWA 2AUKA 1VQ9A 1D5XC 1B53A 1ET9A 2CWPA 1V1PA 4DUZQ 4K0KL 2M9VA 3TP7A 1HNZL 1CA5A 1EY4A 3ND9A 1I4RA 5DNFA 2BH8A 3X3MA 1QUQB 5LMNQ 4GN5A 5HY6A 3ULPA 4DK0A 1HZAA 3ONAB 4DA2A 3Q0AA 3A5ZB 2DJFC 4E6IA 3F2CA 1HZBA 2X69A 1XNRL 5LHY1 5LL6X 2OQKA 1FR3A 4ZUJA 1LT4D 3QIAA 1SE3A 1R9TB 4ZQ3A 2IT1A 1K83B 1HH2P 2RF4A 4YY3L 5BN4A 4PG3A 2BE5D 1EOVA 1NR2A 1HFNA 1N32L 4LFAL 4A3GG 1KIXA 4GKJL 1AP0A 2NBFA 3LNNA 3CCVA 4DV7L 2AWOA 5AJ3L 1F9SA 2E2HB 3C1FA 4OWWB 3ZYYX 2KCNA 1PV4A 5IWAL 3EN2A 2FINB 3MXPA 1RCVD 1EZ8A 3G4SA 2WP8J 5C3EH 3S2DB 5M3MG 2HHHL 3QO2A 4KK7A 4KY5A 5FOBB 3HKZE 5T1GA 3F8TA 4RFBA 1HZ9A 1LABA 4CDFC 2RDGA 2R3ZA 2C5CA 3DWAA 5EJWA 4G7HC 4O0AA 4DV0L 3ITPA 3BVZA 1BKBA 4DFAA 1W2BA 2OXPA 1JT8A 1PXUA 1Y8NB 1L0XB 4GOPC 2PZTA 3SK5A 3A7AB 1A3TA 4BWGB 4A3CG 2V4DA 4APVA 5GAEC 3KLSX 4BY1B 1JCKB 1Q8KA 3K0YA 3JAME 3OTOL 1PH9A 1EY8A 2KUMA 3TP6A 1MJCA 2K5DA 3GQBA 4HR7B 3Q22A 1HNXL 1P8LA 1QZHA 3I4NG 4C3HB 1D8LA 3H94A 3RN5A 3NQTA 2FFKB 1I4QA 1TQOA 1QNUA 1EL0A 2B63G 1PZID 1ZXTA 3DM3A 2JJQA 2NVYH 3CC2A 4PMWA 1CQFA 3S15B 4DV5L 5C4ZA 3NP8A 2IJ0A 2K6AA 4KJOA 4A3BH 5E4XA 2Q2TA 1HA6A 1VQEA 1JB7A 3GTGB 4HJ7A 1SYBA 1A6XA 1ZYRD 1NSNS 2L11A 2R7DA 4KTAA 1X3QA 4I7ZC 4NKLA 4IURA 4A3IG 3KF8B 3EA6A 3I4MG 3TP8A 1Y14B 3NEMA 1ET6A 1F2LA 3BYTB 1H9KA 2MNAA 3VR4A 5FKAC 4AQYL 1RTNA 4JI3Q 3GTQB 2XNAC 4ME5A 2R93G 1JJGA 2LY7A 4L5SA 1K8MA 2PZUA 3AEVA 3PO3B 4N8FA 3J81E
chains in the Genus database with same CATH topology
1AFPA 3NTHA 2TSSA 4R8IA 4YIJA 4ZKCB 2BE5C 3J7AF 2OEOA 2C9OA 2NTSA 2M2LA 4H44C 3BVMA 3VR2A 1V1OA 5I9PA 2VXWA 1MI2A 2A6ED 5C5MA 1IYVA 3OIPA 2F3VA 1T5EA 2A74C 4FF4A 2FJ2A 4KV6A 4DXGA 5CORA 5I6WA 1LT3D 4DAYA 3HRZC 3DXJC 1E0BA 1BUVT 4L63B 3C2PA 1DONA 1ESRA 3MWYW 3KBGA 2B2VA 3CHBD 4C3IG 3S1QB 5CYUA 1HA5A 1SYDA 4A3MB 2ENBA 1X3PA 3VA5A 1IL8A 4A3KB 4K2LA 2D5DA 3P7JA 4NMZA 2WB1B 1SJED 3LWUA 4CKBA 5JOBA 5IGGA 4DAVA 1JC7A 1EWCA 4WFN3 4B9WA 2PYKA 2JSOA 4TKOB 1SFOB 2ZT9C 2KEEA 3M4YA 1KDAA 2J4XA 1EIHA 2XRQD 1F9PA 4FVMA 2A73B 1SDFA 4O42A 1DOKA 3IAYA 1I6HB 2MHVA 1OXUA 2F0LA 3L3OC 1SMYD 3N6RA 1WTVA 3P1HA 5BN5A 4OO1H 1TS2A 1TWFB 2EYJA 3G7LA 1TY2A 4EQNA 1WD1A 1EEFD 5K36H 3EQLC 2F0NA 1AZPA 1BCPF 5C6AA 4KKUA 2B2UC 4C1NI 1NAPA 3HEJA 1Q1EA 1LACA 4KD4A 2J7ZA 3KLSA 2NWGA 5CGKA 3D4WA 4UDUC 3QJYA 1YNJC 3I4LA 2B2YA 4FXKC 1OXSC 4A3JB 1VF5C 2R6GA 3NK9A 2OT2A 3QG1A 5D65A 1Z47A 4XYQA 1R4PB 5HGTA 4H0LC 3URYA 4KMUC 2RSOA 1EYCA 5KNBA 4U68A 4BS9A 2KCCA 3HKZB 1JR0D 4PMBA 1GUTA 1TS5A 5IT9E 3VR3A 1BR9A 1ZEQX 3M85A 1EWHA 3S2HB 4C2MB 1DYQA 1VF7A 3D6WA 4XTCS 1JWMD 2PNRC 2ICIA 1JOOA 3VR5A 5D3IB 5BN3A 1EU4A 1UAPA 2WV6D 2EE1A 4OHJA 3D3RA 1O7ZA 1PFMA 1E2ZA 4C3JG 2DNCA 3PO2B 4IFDI 2HCCA 3BDOA 4J6HA 3BDLA 3K6OA 5KEEA 1GUGA 3TN2A 3HG9A 4HCEA 2A6HD 2ICEC 3GV3A 5IGEA 4IUQA 1SMYC 4FXDA 2QCPX 3L7ZC 2CQAA 4LMQD 1IYUA 1PTOD 2E2IB 3A56A 1D2BA 4FF1A 4KJNA 3PIP3 1BO0A 4WORA 3Q23A 3CKIB 5CMDA 1SNCA 3GP7A 3FDTA 1QE6A 5CV4A 2B39A 5CV8A 4X3TA 4NW2A 5CV7A 4K8JA 1R4QB 2DN8A 4BBRB 3OHXC 2KOLA 1OXVA 1ONLA 1KAAA 1G91A 2K1BA 2RBMA 4IUUA 2EYMA 2TMPA 4KI0A 1ML0D 1LTSD 4RAUC 2F0KA 1F9QA 3J80E 3GTKB 4RGNA 3M4OB 4EQPA 2HUGA 1H9RA 1F2ZA 1BBXC 5M3FB 3S1MB 2R92B 1B9NA 2LMCB 3MXUA 3S1NB 2F1MA 4KN4C 1HTPA 1B50A 2D2CC 3MFYA 4FNFA 4P2CB 1STAA 1AEXA 4JBWA 2H4OA 4Y7NB 1XYIA 1O80A 1IHZA 1AN8A 1O7YA 5IGBA 1PRTB 5EKKA 1LO5D 2O4XA 1BDOA 2L0CA 4A3EB 3HGBA 4XIGS 1WTRA 3NUCA 3NWSA 4V190 3X3NA 4V0BA 1W6KA 3A54A 4ZUIA 3NHHA 5IGDA 4XDXA 1KNAA 2JA5B 3D4DA 4PV1C 4U673 1RF2D 4KN7C 1PRTF 1MBYA 4ZRZA 3QB3A 3BVGA 2EVBA 3NTKA 4RA8A 1PDQA 4M1UB 1EYAA 5FO7B 1J9OA 2EYPA 2JA8B 1WTWA 2VB3X 5C4JB 4QCLA 1BNZA 4AYBB 2AQ1B 1G6ZA 5ELFA 1A2TA 2KA7A 5A2QE 3K5LA 1WTXA 5ELEA 1G291 1RHPA 1H9SA 4N9PA 1TIID 1B3AA 3V2TA 3E5SA 4K2KA 2A68C 2L55A 1DXMA 1EEID 1JWSD 1WTOA 3AU7A 2NYZD 4ABNA 2XWJB 1LT5D 3HOZB 4A93B 3OSOA 3I3CA 5EGTA 1EY6A 4G7OC 4DAPA 1I50B 4CJ2C 5LL6S 2RKSA 3OPOA 4KY7A 3ND8A 3WOEA 3K57A 2EY1A 3S1RB 3OOCA 4OL7A 5JVH3 2EYHA 1G2TA 4RCOA 4X3KA 1I3QB 2JP1A 1S5DD 1UUPA 4ULLA 1SYFA 4KKSA 5C0XI 4QMGA 3C46A 2NVXB 1TWHB 2E2JB 1GUNA 2DNEA 4QF4A 4R8NA 3S9WA 4FP5D 2PO4A 5CV5A 3EVQA 1Z7TA 4G7ZC 1EY5A 2NN6I 4A3DB 1TR5A 5ELDA 1M4VA 1D1IA 1C48A 3DM1A 2PZWA 3I91A 1F9RA 3P75A 2NB0A 1Q90A 5E3FA 3JAML 1CA6A 2ZXPA 2EYLA 1FNWA 1NCVA 2EJFC 4KHVA 1CZWA 3GTMB 2B63B 2K05A 1ILQA 5JPMC 2YU9B 1I4XA 3FPUB 1SNMA 1IKMA 4CBVA 4EVOA 1SYGA 1CHPD 1Y8OB 3SXHA 2F0UA 2F0JA 3D6CA 4K5XA 3RZOB 1E2WA 2EY5A 1OO9B 1TWCB 4XT1B 5JJZA 2L12A 5CV9A 1CFMA 3MEHA 2O5JC 3HOWB 4HSVA 2SEBD 4BA1I 2HDLA 5T1IA 1CTMA 4KY6A 2K04A 1SAPA 3BDCA 4TRDA 1SXTA 4OO1G 1DOLA 3TDQA 1RODA 4NP5A 1C8CA 2KJXA 1ESFA 2I46A 5COYA 3J81L 2FMCA 2FHTA 3RLFA 5K36G 2XSCA 5M5YB 2LKVA 1LTBD 1YNJD 1TU2B 3GTLB 1B1ZA 4HMJA 2IX3A 4K14A 1FGBD 2Y0SB 1TKWB 1STHA 1L0YB 5M9OA 1JQYD 5IODA 1B9MA 4FXGC 2EYOA 1BQQT 2IX0A 3K58A 5JEAJ 2SOBA 4ZAIA 2R7ZB 3MFGA 4LAAA 4XQJA 1PTOF 3KLRA 1EU3A 3KBXA 1HXYD 3MZ5A 3FMCA 1V1PB 3HP3A 3HOXB 4XXEA 2RA4A 1BOSA 2B2VC 3A55A 4Q0FA 1GUOA 4CHTB 1TVXA 3GTOB 2XIWA 1HPCA 3H91A 3T56B 4BY7B 1K8OA 4J1MA 3T53B 2G9HD 1ILPA 3KK7A 5FO8B 3EROA 2IPKD 3CU7A 5KYLA 4UAIA 3TZDA 2RSNA 5C3XA 2AQ2B 1BCPB 1DCZA 5JEAH 2L1BA 4I65A 4F8MA 1SBBB 1LTTD 3AMUA 2L5TA 5D3DA 2D62A 1F2MA 3DHQA 3TP5A 4DU9A 5C4HA 2JEAI 5KGUA 1JOKA 1MGSA 1A3UA 3U9OA 2MJ8A 2EY2A 2D9UA 3T13A 3GD7A 5DAUA 2QF7A 1PRTC 2F0MA 1A15A 2PQEA 3HOUB 3S16B 2PW5A 2B2UA 5G3LF 2M00A 3GTPB 5I4DA 4KKTA 4WJWA 3SK8A 3GO5A 2SNMA 2QDBA 5CR3A 3VYUA 5CV6A 1PZKD 3C3LA 4IFDJ 2WIIB 3MXGA 4DGZA 5FLXE 4L8JA 1EQTA 5EPKA 2OF1A 1F2YA 2J0TD 4RGMA 5EQ0A 2WKDA 5IT9L 1QB5D 5F2DA 5M5WB 1OXTA 3S14B 1RJTA 2EJGC 2AQ3B 4XQQA 4WRDA 2BDNA 2F0VA 3DWQA 5EBDA 2B2WA 5EPLA 1RD9D 4RGTA 1DJRD 2F0QA 2NZ1D 3HOVB 2A5HA 2XWBB 4K5VA 3QOLA 3MC0B 2EZVA 4IFDH 1QNKA 3J7AV 3PIO3 3IL8A 3D31A 4J8QA 2BDOA 2IL8A 1PZJD 3G6JB 1GUWA 1G8ZD 4EGVA 1VDZA 1RTOA 2Z4HA 1A2UA 2CW0C 4IUPA 2JXMB 2X6GA 3R93A 2MGSA 3RZDB 3SDZA 5KNDA 1V8QA 1HHVA 1I4GA 2VB2X 3QWNA 1QWYA 1DD2A 2F0IA 1MSHA 3SK4A 4Z9CB 1EY7A 4XQNA 4ODGA 1S5BD 3RMHA 4IUVA 5C5LA 1T5XD 4K6DA 3R3OA 4CKCA 5EKLA 1SNDA 5JVG3 3N52A 4RGOS 2GA4B 1CI3M 4PQXA 2QEJC 2EXZA 3H09A 1Q3LA 1JOQA 5DEHA 1EIGA 2A68D 3PUZA 3K59A 4RHSA 3J80L 3H0GB 2ZXRA 2LFNA 1GHKA 3W3AA 1FNUA 2SNSA 4HSPA 3CRKC 4KD3A 1FNVA 1H9MA 4CJ0B 1M8AA 1GHJA 5I6YA 1ICWA 1OXXK 3CRLC 1KTKA 3DEOA 3NTIA 1O7LA 2JE6I 2QKIC 2XN9C 3OWEB 1I6VC 3LWEA 4IUTA 5I2XA 1JORA 3H3VC 2F0FA 1S5CD 5EPJA 4G57A 5KRUA 2BA0A 5KYIA 3TZUA 3OWFA 4IZ8A 3LX0A 3KF8A 4DK1A 4IUNA 3MTSA 4N9TA 1A3VA 3NE5B 2EY6A 1SYEA 3M3YB 2K7VA 1DM0B 3NBIA 1Y1VB 2E2DC 3PV0A 1QG7A 3A7LA 1SNOA 4X3SA 4FF3A 1LTRD 3BYYB 4QUCA 1PYWD 2MP1A 5KIXA 2B2TA 3KUPA 1HQRD 5DM63 3QOJA 3DMUA 1SE2A 3MAQA 1NUCA 1TY0A 4K6LA 4IQZA 4HTHA 1SE4A 1AZQA 1V43A 2IWHA 1NR4A 3V96A 2N88A 3R2TA 2IW3A 1CQVA 4XT3B 1KDBA 2MPMA 4IN3A 3NQIA 5AFWA 5A2QL 2MUYA 1SYCA 1HQMC 1XX8A 5I9OA 2BA1A 2F0OA 5IGFA 4A3BB 4QIWB 2NTTA 2KVMA 2R61A 1TT2A 5C0XJ 1EOTA 3VR6A 1WTQA 3SR1A 2KECA 2A69C 3GV6A 3I72A 2JEBI 3I73A 1VMPA 2WAQB 1HUMA 3OMGA 4RCNA 4A3GB 1JICA 4DN4M 1BCPC 3A8JE 2HDMA 4K8IA 4F7XA 4F87A 4HAEA 3L9AX 3T51B 1D6EC 4G4KA 3MA2B 5NUCA 4K5WA 5TSSA 5M3MB 4MN3A 3EJIA 1B2TA 3Q24A 1JE4A 1Q8IA 5C0XH 1II3A 3RD4A 2F0PA 3VYRA 4L6TB 4OGQC 3BS1A 2B8FA 4B08A 2FMMA 3OMCA 3T4AC 1IKLA 1YNNC 5CC4A 2F0HA 3D8GA 2NN6H 4RKBA 2WKCA 3I4NB 1U9RA 5DM73 2SDFA 4PMCA 1IW7C 2CHBD 4B9XA 1QILA 1D1KA 2K33A 1RDPD 5D14A 3SVMA 1JB3A 1LTGD 5EKIA 3NPPA 3IFDA 3TBIB 3M7NA 3C1EA 1TWGB 4C3HG 4NDXA 1LT6D 4PNYA 3U9SA 2HQEA 1WTPA 3VA7A 4A3IB 3VYTA 2PW7A 2ZXOA 3I4MB 2Q8TA 5JEAG 2QILA 2RDFA 3I70A 4DF7A 3K5MA 1QCBD 2R93B 1ZKOA 4LK1C 1MSGA 2F4IA 3O13A 1U4PA 1I4HA 4CJ1B 5C44B 1EZ6A 1PLFA 2Z8LA 2F0TA 2VUMB 1PRTD 4LJZC 2Q8RE 2KQ3A 2DY8A 2EJMA 5J39A 1KLUD 2K32A 2L9HA 1PTOB 3IFTA 4Q5VA 1EY9A 2Q8IB 3AB9A 1B44D 3R2IA 4FO2A 2Z4IA 1FD7D 4S3SA 2F0WA 3NBHA 1LV9A 3SE0A 2PMZB 4TQUS 5CBAE 2ID0A 4BBSB 5IOCA 4C3IB 1TS4A 3PMFA 1HFGA 1VMCA 4MHEA 5JPNC 1G2SA 3W2DA 2EPBA 1H9SB 1EQVA 3OIQA 3BG3A 1X32A 1SEBD 3DEPA 2L4NA 2BCOA 3V05A 1GJXA 4F88A 4RWSC 4H7BA 1GOZA 5C4XB 3MXNA 3PUXA 4FF2A 1D5ZC 4C1NK 1C4QA 1BXTA 3H6MA 3PUWA 3PUYA 4TSSA 4ILWA 1STGA 3WOFA 1HRJA 4IFDG 2CW0D 1PFBA 1EY0A 3VYSA 2IX1A 1WVLA 1S5ED 1Y8PB 4MIUA 3EFXD 4ID6A 4QB4A 4R9WA 5KNCA 1O78A 1STNA 1AW7A 3FRPB 1ZYRC 4OO1I 1S5FD 3A8IE 4DNRB 5ISRA 1Z6HA 3P20A 5ELCA 4A3FB 2JYOA 3R8BA 4C56C 2F0SA 4OIKA 3WDNA 3TSSA 4CGYB 5JAVA 1GUSA 1H9JA 1STYA 1TWAB 3E6ZX 1U4MA 1PTOH 2H1EA 5EBCA 4IALA 2B2YC 2I07B 3TMEA 3E0JA 4H13C 2RVLA 3UI2A 3T16A 2KHSA 2XRSD 5FLXL 1SJHD 2A6EC 2E76C 3A8KE 1XXGA 4CKEA 4OIJA 2PCFB 5FO9B 1UEAB 3M7GA 2PPBC 1D5MC 4X3UA 3K5OA 3K5NA 3MHBA 3NXWA 3D4RA 1JWUD 5ELBA 3GTJB 1WD0A 2RDHA 4C3JB 1RKNA 4HEDA 1EYDA 4QUFA 1KLGD 4ZK9B 2B2WC 1U4LA 3S17B 2K5QA 1WCMB 1J8IA 2CVRA 3ERQA 1KABA 3I8ZA 1CM9A 3NWTA 1HUNA 2N55A 3SEBA 1QOHA 2X6LA 4BA2I 3SK6A 2HCIA 5E1FA 1LTAD 3MVVA 4HCSA 2Z1CA 2WACA 1HTLD 5J22A 1VCIA 2F3WA 3HZXA 1LLRD 1CT1D 2EOTA 4RH6A 5FK9C 5J1ZA 3HOYB 2O2LD 2JA7B 2JA6B 2NVTB 2B8GA 2EDGA 1I4PA 2DY7A 4ZKBB 3K7AB 5C3WA 2K5WA 3CQZB 3FEWX 2RQXA 2YYZA 1PMRA 2F0EA 2VNUD 4RKLA 1SSOA 1STBA 3FKIB 2NVQB 3FVQA 2K01A 1XWEA 2K28A 2F0DA 1XTCD 1UNSA 2A69D 4EQOA 2XVSA 3I90A 5A35A 2O5IC 3HS0C 1MD2D 3BZDB 5M5XB 5E4WC 5CBEE 1STEA 1BF4A 4ZLTF 1BCPD 1ENFA 3OW7A 1B4OA 4ZYSA 4FYDA 1EFID 3DUZA 1F77A 1KNEA 1QJOA 1U4RA 5G3LD 2K03A 4XYOA 1SNPA 2F0GA 1CK1A 5C3EB 1TS3A 1LTID 4KHZA 2G9DA 3J7YW 2LS01 1YNND 1Y69U 1DOMA 4JK1C 1E2VA 2A6HC 2E74C 5C0XG 2F03A 3PUVA 4O1NA 2AUJD 4RHRA 2KEDA 4DXFA 1IW7D 4GZYC 2NUCA 1PTOC 5HURA 1GXDC 1Q12A 3DWPA 3SHLA 3FPPA 3F2UA 4M8AA 2NN6G 2B2TC 5I2YA 1Y1WB 2EYFA 3RUZA 3IKJA 1PFNA 2BOSA 4HMIA 1ENCA 2AWNA 2NVYB 5IGCA 2WINB 1KDCA 1CHQD 1Q1BA 1DZ1A 1S4ZA 1W6JA 3Q6SA 5IIFA 4DNTB 1CZGA 1FYCA 2E75C 1SNQA 5K5PA 4HN7A 1HCZA 1ENAA 3NSWA 2AUKA 1D5XC 1B53A 1ET9A 1V1PA 2M9VA 3TP7A 1CA5A 1EY4A 3ND9A 1I4RA 5DNFA 3X3MA 4DK0A 3ONAB 4DA2A 3Q0AA 4E6IA 2X69A 5LHY1 5LL6X 1FR3A 4ZUJA 1LT4D 3QIAA 1SE3A 1R9TB 4ZQ3A 2IT1A 1K83B 5BN4A 2BE5D 1NR2A 1HFNA 1AP0A 2NBFA 3LNNA 2AWOA 1F9SA 2E2HB 3C1FA 3ZYYX 2KCNA 2FINB 3MXPA 1RCVD 1EZ8A 2WP8J 3S2DB 3QO2A 4KK7A 4KY5A 5FOBB 5T1GA 4RFBA 1LABA 2RDGA 2R3ZA 2C5CA 3DWAA 5EJWA 4G7HC 3ITPA 3BVZA 4DFAA 2OXPA 1PXUA 1Y8NB 1L0XB 2PZTA 3SK5A 4BWGB 1A3TA 3A7AB 2V4DA 3KLSX 4BY1B 1JCKB 3K0YA 3JAME 1EY8A 2KUMA 3TP6A 3GQBA 2K5DA 4HR7B 3Q22A 4C3HB 3H94A 3NQTA 2FFKB 1I4QA 1TQOA 1QNUA 1EL0A 1PZID 1ZXTA 4PMWA 1CQFA 3S15B 5C4ZA 3NP8A 2IJ0A 2K6AA 4KJOA 5E4XA 1HA6A 3GTGB 1SYBA 1A6XA 1ZYRD 1NSNS 2L11A 4KTAA 1X3QA 4I7ZC 4NKLA 4IURA 3EA6A 3TP8A 1ET6A 1F2LA 3BYTB 1H9KA 3VR4A 5FKAC 1RTNA 3GTQB 2XNAC 4ME5A 2LY7A 1K8MA 2PZUA 3PO3B 3J81E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0J A;  5EGT A;  5IOC A;  1EY6 A;  4J1M A;  3PMF A;  5J1Z A;  3D6C A;  2EYJ A;  4YIJ A;  4WRD A;  3TME A;  2F0V A;  3ERO A;  4K5X A;  1KDB A;  3MXP A;  2RKS A;  1EZ8 A;  5KYL A;  2EY5 A;  4EQN A;  4KY7 A;  1IHZ A;  3T16 A;  1EQV A;  2SNS A;  5IGB A;  2KHS A;  2NUC A;  5IGE A;  5HUR A;  4KD3 A;  5C3X A;  5CV9 A;  1SYC A;  2OEO A;  2F0Q A;  3MEH A;  3SHL A;  4I65 A;  5I9O A;  4KY5 A;  2F0N A;  5EKK A;  4F8M A;  2F0O A;  4K5V A;  3C1E A;  2EY1 A;  2O4X A;  5C6A A;  3QOL A;  5I9P A;  4OL7 A;  5I6Y A;  5IGF A;  4KY6 A;  5C3W A;  3BDC A;  4TRD A;  4NDX A;  4PNY A;  4KJN A;  2EYF A;  2EYH A;  3HEJ A;  5C5M A;  3ITP A;  3RUZ A;  2F3V A;  4DFA A;  4WOR A;  4H7B A;  2HQE A;  2OXP A;  4KD4 A;  1SNC A;  5CGK A;  1TT2 A;  3NUC A;  4HMI A;  4KV6 A;  2F0E A;  1F2M A;  3DHQ A;  2PW7 A;  3D4W A;  4NP5 A;  1ENC A;  3TP5 A;  3SR1 A;  2PZT A;  3MHB A;  3SK5 A;  3H6M A;  1A3T A;  3NXW A;  4RKL A;  4ZUI A;  4DU9 A;  5I6W A;  5CV4 A;  3NHH A;  5C4H A;  5IGC A;  1STB A;  5IGD A;  1JOR A;  5KGU A;  2F0F A;  1JOK A;  1KDC A;  5CV8 A;  1EY8 A;  1A2U A;  3TP6 A;  2LKV A;  3D4D A;  5CV7 A;  4K8J A;  2RDF A;  1STG A;  3NK9 A;  4G57 A;  1A3U A;  2F0D A;  1RKN A;  4DF7 A;  5KRU A;  3U9O A;  1SYF A;  1EYD A;  5IIF A;  4QMG A;  1KAA A;  2EY2 A;  4EQO A;  3OMG A;  5KYI A;  3T13 A;  5HGT A;  3QB3 A;  3OWF A;  4IZ8 A;  5DAU A;  3LX0 A;  1SNQ A;  3NQT A;  4HMJ A;  5K5P A;  1EY0 A;  2RBM A;  2F0M A;  3ERQ A;  4K14 A;  1SYD A;  4K8I A;  4QF4 A;  1TQO A;  2EYM A;  4IUN A;  4R8N A;  4F7X A;  1ENA A;  1EZ6 A;  2PQE A;  3S9W A;  1KAB A;  1EYC A;  1STH A;  2PW5 A;  4MIU A;  2F0T A;  2ENB A;  5CV5 A;  2M00 A;  4ID6 A;  3EVQ A;  4QB4 A;  5M9O A;  4PMB A;  5IOD A;  4N9T A;  1A3V A;  1EY5 A;  3VA5 A;  1EYA A;  2EYO A;  3TP7 A;  1TR5 A;  5NUC A;  4K2L A;  4K5W A;  2EY6 A;  2EYP A;  2F0K A;  2F0I A;  5C4Z A;  1STN A;  1SYE A;  1EY4 A;  2PZW A;  3NP8 A;  4NMZ A;  5IGG A;  4KJO A;  3EJI A;  5JOB A;  2KQ3 A;  3SK4 A;  3SK8 A;  3P75 A;  2SNM A;  2SOB A;  1EY7 A;  2QDB A;  5CR3 A;  4EQP A;  4ODG A;  4B9W A;  2PYK A;  5J39 A;  5E3F A;  3SK6 A;  5CV6 A;  5E1F A;  1F2Z A;  1SYB A;  5ISR A;  2EYL A;  1NSN S;  1II3 A;  4LAA A;  2F0P A;  1SNO A;  4KTA A;  5C5L A;  1A2T A;  4E6I A;  3MVV A;  4KHV A;  4NKL A;  4K6D A;  1SNP A;  4DGZ A;  3R3O A;  1JOO A;  5KIX A;  5EKL A;  1SND A;  2WAC A;  4B9X A;  1EY9 A;  2F0G A;  3TP8 A;  4N9P A;  4ZUJ A;  3MZ5 A;  2OF1 A;  3V2T A;  1KDA A;  4ZQ3 A;  3E5S A;  3QOJ A;  3DMU A;  4K2K A;  1SNM A;  2EXZ A;  2F0S A;  3OMC A;  1NUC A;  5CC4 A;  1F2Y A;  1STA A;  2F0H A;  1AEX A;  4HTH A;  3D8G A;  5DEH A;  1JOQ A;  2F0L A;  5JAV A;  4J6H A;  4RKB A;  4EVO A;  1SYG A;  4S3S A;  5J22 A;  3BDL A;  1U9R A;  4ME5 A;  1STY A;  2F0W A;  5F2D A;  2F3W A;  2PZU A;  3P1H A;  5KEE A;  3HZX A;  4PMC A;  3SXH A;  4IAL A;  3OSO A;  2F0U A;  3C1F A; 
#chains in the Genus database with same CATH topology
 1AFP A;  3NTH A;  3MEF A;  2TSS A;  4R8I A;  4YIJ A;  4ZKC B;  1RIP A;  2BE5 C;  4OX9 L;  3J7A F;  3JAM i;  1R9T H;  2E5L L;  3BU2 A;  2OEO A;  2C9O A;  2NTS A;  2M2L A;  1VQ5 A;  4H44 C;  2OTJ A;  3ERS X;  2DJG C;  3BVM A;  3VR2 A;  1V1O A;  1LTL A;  5I9P A;  1IBL Q;  2VXW A;  1MI2 A;  1YHA A;  3EBE A;  2A6E D;  2E2H H;  1XPO A;  5C5M A;  1IYV A;  4FDB A;  3OIP A;  2F3V A;  1T5E A;  2A74 C;  4FF4 A;  3K80 C;  4GLA C;  2FJ2 A;  2Y0S G;  4KV6 A;  4DXG A;  2I0Q A;  5COR A;  5I6W A;  4YHH L;  3S2D H;  1LT3 D;  1MIU A;  3PCO B;  4DAY A;  2MQH A;  2JN4 A;  3HRZ C;  3DXJ C;  1VQP A;  1E0B A;  2CH4 A;  1BUV T;  4L63 B;  3C2P A;  1DON A;  1Z9F A;  1ESR A;  3MWY W;  3KBG A;  2R7Z G;  2B2V A;  3CHB D;  4JI1 L;  4C3I G;  3S1Q B;  3GDE A;  5CYU A;  1HA5 A;  1SYD A;  3CMA A;  4QY7 A;  3TRZ A;  4A3M B;  1AE3 A;  2ENB A;  1I94 L;  4IPC A;  4BY1 H;  1X3P A;  3VA5 A;  3HOX G;  1IL8 A;  4A3K B;  4K2L A;  2D5D A;  3P7J A;  5FJ8 G;  2ZJR A;  4NMZ A;  2WB1 B;  1XNQ Q;  1SJE D;  3LWU A;  4CKB A;  4GS3 A;  5JOB A;  5IGG A;  1N33 Q;  4DAV A;  1JC7 A;  1EWC A;  4JBJ A;  4R4I A;  4WFN 3;  3J81 i;  2RCF A;  3CP0 A;  4B9W A;  2PYK A;  3TRE A;  2JSO A;  2UU9 Q;  4TKO B;  5C4X G;  4X64 Q;  4LF7 Q;  1SFO B;  3PGZ A;  2ZT9 C;  4QJF A;  2KEE A;  1VQK A;  3M4Y A;  3S15 H;  1KDA A;  2J4X A;  5BR8 Q;  1EIH A;  2XRQ D;  1F9P A;  1BBU A;  4FVM A;  2A73 B;  2XTI A;  3TS0 A;  1FGU A;  1SDF A;  4L5Q A;  4O42 A;  1DOK A;  3IAY A;  2AKW B;  1H95 A;  4IJH A;  2F3I A;  1I6H B;  2MHV A;  1OXU A;  4YWL A;  2F0L A;  3L3O C;  1SMY D;  1HR0 W;  3N6R A;  3GTG H;  4LFC Q;  1WTV A;  3P1H A;  4CDE C;  1XTD A;  2K52 A;  1TS2 A;  5BN5 A;  4OO1 H;  1TWF B;  3KFU A;  2EYJ A;  2Q2I A;  1M90 C;  3G7L A;  1TY2 A;  4EQN A;  4HJ8 A;  4DKA C;  1WD1 A;  1EEF D;  5K36 H;  1K0S A;  5IY0 A;  3EQL C;  1K8G A;  2F0N A;  1AZP A;  1BCP F;  5C6A A;  4KKU A;  2B2U C;  4C1N I;  4DR4 L;  1NAP A;  1YIT A;  3HEJ A;  1Q1E A;  1LAC A;  4KD4 A;  2J7Z A;  3KLS A;  2NWG A;  5CGK A;  4A3F G;  2CWA A;  3D4W A;  3D0F A;  4UDU C;  3QJY A;  1NMF A;  1YNJ C;  1FJG L;  3I4L A;  2B2Y A;  4FXK C;  2UXD L;  1OXS C;  2QEX A;  4A3J B;  3LGJ A;  1VF5 C;  2R6G A;  3NK9 A;  2CH4 W;  2OT2 A;  3QG1 A;  5D65 A;  1Z47 A;  4XYQ A;  1R4P B;  1KRT A;  4P75 A;  1W3S A;  4YY3 Q;  1I5F A;  5HGT A;  2ASB A;  4H0L C;  3URY A;  4BBS H;  4QIW E;  4KMU C;  2RSO A;  4LFA Q;  1EYC A;  5KNB A;  4U68 A;  4BS9 A;  2KCC A;  3HKZ B;  1JR0 D;  2K5H A;  1GUT A;  4PMB A;  1SRO A;  1TS5 A;  5IT9 E;  2GN5 A;  3VR3 A;  1BR9 A;  4LF9 L;  1E3P A;  1ZEQ X;  3M85 A;  1EWH A;  3S2H B;  4DV4 L;  4C2M B;  3PIP A;  3S1Q H;  1DYQ A;  2GVB A;  1VF7 A;  2WAQ E;  3D6W A;  4XTC S;  1JWM D;  2PNR C;  2ICI A;  1X55 A;  1JOO A;  3VR5 A;  2WFW A;  5D3I B;  5BN3 A;  1EU4 A;  1UAP A;  1Q82 C;  2WV6 D;  4A3K H;  2EE1 A;  4OHJ A;  3D3R A;  1O7Z A;  1PFM A;  1E2Z A;  4C3J G;  2DNC A;  1VQ4 A;  3PO2 B;  4IFD I;  2HCC A;  2LXJ A;  2Q2U A;  3BDO A;  4J6H A;  1X54 A;  1EFW A;  3BDL A;  4JV5 L;  3K6O A;  1WCM G;  2R7F A;  4YCV A;  5KEE A;  1GUG A;  3I55 A;  2N49 A;  1SFO H;  4JI8 Q;  3J7A 5;  3TN2 A;  1HR0 Q;  3KLW A;  3HG9 A;  4HCE A;  2A6H D;  1Q46 A;  2ICE C;  2NZH A;  3GV3 A;  5IGE A;  4IUQ A;  2N3S A;  1SMY C;  4FXD A;  2QCP X;  3L7Z C;  2UXC Q;  1QUQ A;  1I6H H;  2CQA A;  3G48 A;  4LMQ D;  1IYU A;  4JI4 L;  1PTO D;  2E2I B;  3A56 A;  1D2B A;  5IP9 G;  4FF1 A;  3NBH B;  4KJN A;  3PIP 3;  2Z6K C;  1BO0 A;  4WOR A;  3Q23 A;  3CKI B;  5CMD A;  1SNC A;  3GP7 A;  3AQQ A;  4JYA L;  3FDT A;  4JOI A;  1T9H A;  1QE6 A;  4OEL B;  1XMQ L;  5CV4 A;  1SRU A;  1VS0 A;  2B39 A;  1S3O A;  5CV8 A;  4KHP L;  4X3T A;  4NW2 A;  5CV7 A;  4K8J A;  4I7A A;  1R4Q B;  2DN8 A;  4BBR B;  4LF8 Q;  1HNW L;  3OHX C;  2KOL A;  1OXV A;  1ONL A;  1KAA A;  1KQS A;  1V1Q A;  1G91 A;  4A4I A;  2VQE L;  2K1B A;  2RBM A;  4IUU A;  4DNI A;  2EYM A;  3MXN B;  2UXB Q;  3HOY G;  2ZJQ A;  2TMP A;  2QGQ A;  5IYB H;  4KI0 A;  1ML0 D;  2JA7 G;  1Q86 C;  1HJP A;  1LTS D;  3E9H A;  4A3J H;  4RAU C;  2F0K A;  4LNQ A;  1WFQ A;  1F9Q A;  3BZK A;  3J80 E;  4RGN A;  3GTK B;  3M4O B;  4EQP A;  1JMC A;  2MO0 A;  2HUG A;  1H9R A;  1F2Z A;  1BBX C;  5M3F B;  3S1M B;  2R92 B;  1B9N A;  1GKH A;  2PQA A;  1M1K C;  2LMC B;  5LMN W;  3MXU A;  3S1N B;  2F1M A;  4KN4 C;  1HTP A;  2VQF Q;  1L0W A;  1B50 A;  2Z6B A;  2D2C C;  3MFY A;  4DV2 L;  4FNF A;  4JI2 Q;  4P2C B;  1STA A;  1AEX A;  4JBW A;  3S2H H;  2H4O A;  4Y7N B;  1XYI A;  1QVC A;  1GVP A;  1O80 A;  3RLO A;  2QA4 A;  1IHZ A;  4B3T Q;  5E7N A;  1AN8 A;  1O7Y A;  5IGB A;  1UE1 A;  3PO2 H;  1PRT B;  5EKK A;  1LO5 D;  4B3M L;  2PNH A;  2O4X A;  4PZ6 A;  1BDO A;  2L0C A;  3J81 j;  4A3E B;  1XMO L;  1CKN B;  4GNX A;  3HGB A;  4XIG S;  3CCE A;  4WJ4 A;  4LF4 Q;  1KRS A;  1WTR A;  2IHF A;  3NUC A;  3NWS A;  2PMZ E;  1ASY A;  4V19 0;  4V0B A;  1VQD A;  1W6K A;  3A54 A;  3X3N A;  4DR2 L;  4ZUI A;  3NHH A;  4NXN Q;  5IGD A;  4XDX A;  3CCM A;  3J80 i;  5C3E G;  1KNA A;  2JA5 B;  2A1A A;  3D4D A;  4PV1 C;  4U67 3;  2EQS A;  1RF2 D;  4KN7 C;  2E2I H;  1PRT F;  1MBY A;  4ZRZ A;  3T1H L;  3K81 C;  4JI7 Q;  4OWX B;  1IBM Q;  4JI6 Q;  2CKZ B;  3QB3 A;  3BVG A;  2EVB A;  3NTK A;  4RA8 A;  1PDQ A;  1A8V A;  4M1U B;  1EYA A;  2HD3 A;  5FO7 B;  1J9O A;  5EAY A;  2QDL A;  2EYP A;  4BBR H;  3W1B A;  2JA8 B;  1WTW A;  2VB3 X;  3K7A H;  5C4J B;  4QCL A;  1BNZ A;  4AYB B;  2AQ1 B;  1G6Z A;  5ELF A;  3KYH C;  1A2T A;  2H5X A;  2KA7 A;  5A2Q E;  3K5L A;  1WTX A;  5ELE A;  1G29 1;  4DV1 L;  1RHP A;  4R1J A;  1H9S A;  4N9P A;  1TII D;  1B3A A;  3V2T A;  3E5S A;  2NVQ H;  3FKI H;  4K2K A;  2A68 C;  2L55 A;  3GTK H;  3M4O H;  1DXM A;  1EEI D;  1JWS D;  2VL6 A;  3UDF A;  3W1G A;  1WTO A;  4UPA A;  1QZG A;  3AU7 A;  4A3B G;  2NYZ D;  2GVA A;  4ABN A;  3OYY A;  3T1Y L;  2XWJ B;  1LT5 D;  3HOZ B;  4A93 B;  5M3F H;  3S1M H;  2R92 H;  3OSO A;  3I3C A;  5EGT A;  5M5X H;  1EY6 A;  4X65 L;  4G7O C;  4LF6 L;  4DAP A;  1I50 B;  2K4K A;  5LL6 S;  2RKS A;  4CJ2 C;  3OPO A;  4KY7 A;  1L1O B;  3S1N H;  4A76 A;  3ND8 A;  4RMF A;  3WOE A;  3K57 A;  1WI5 A;  2OWO A;  2VZA A;  1EQR A;  2EY1 A;  3S1R B;  3OOC A;  1V9P A;  2WAQ G;  4OL7 A;  4Y7N H;  2V1C C;  1EWI A;  4NB3 A;  5JVH 3;  2EYH A;  4A3L H;  1G2T A;  3DLL A;  4DV3 L;  4IO9 A;  4RCO A;  2A8V A;  3TEH B;  4X3K A;  1ICF B;  4DR3 L;  1B70 B;  1I3Q B;  1PYS B;  2JP1 A;  1S5D D;  1UUP A;  4ULL A;  4A3E H;  5LMU Q;  4DV6 L;  4P73 A;  1SYF A;  4KKS A;  5C0X I;  4B3S Q;  4QMG A;  3C46 A;  3CCU A;  4DR7 Q;  2NVX B;  1TWH B;  3I4O A;  4NXM L;  2ATW A;  2E2J B;  1GUN A;  2DNE A;  3PF4 A;  4QF4 A;  4R8N A;  3S9W A;  4FP5 D;  2PO4 A;  5CV5 A;  3EVQ A;  1Z7T A;  4G7Z C;  1EY5 A;  2NN6 I;  2ZM6 Q;  4A3D B;  2JA5 H;  1TR5 A;  4JI0 Q;  5ELD A;  1M4V A;  1D1I A;  4PZ7 A;  1C48 A;  3DM1 A;  2PZW A;  3I91 A;  1F9R A;  4GOP A;  3U58 A;  3P75 A;  3J7Z C;  2NB0 A;  1Q90 A;  5E3F A;  3JAM L;  1Y1W H;  1CA6 A;  2ZXP A;  4DUY Q;  4GKK L;  2EYL A;  1FNW A;  1NCV A;  2EJF C;  4KHV A;  1CZW A;  3GTM B;  2B63 B;  2K05 A;  1ILQ A;  5JPM C;  4GLX A;  1SR3 A;  2RHS B;  3STB C;  2YU9 B;  4BY1 G;  1I4X A;  2CQO A;  3FPU B;  1SNM A;  1IKM A;  2QW7 A;  4Y52 H;  2JA8 H;  2OQ0 A;  4CBV A;  4DK6 C;  4POG A;  4EVO A;  1SYG A;  1CHP D;  1Y8O B;  4IPG A;  3SXH A;  2F0U A;  2F0J A;  3AFP A;  1NE3 A;  3D6C A;  1IBK Q;  4K5X A;  1IXR A;  3ZJY C;  1E2W A;  3RZO B;  2EY5 A;  1OO9 B;  1TWC B;  4XT1 B;  5JJZ A;  3KJO A;  2L12 A;  3FHW A;  5CV9 A;  1CFM A;  3MEH A;  4LWC A;  2O5J C;  1YJN A;  4HIM A;  3HOW B;  4HSV A;  2SEB D;  4BA1 I;  2HDL A;  4JC0 A;  5T1I A;  1CTM A;  4KY6 A;  1J5E L;  2K04 A;  4GN3 B;  4X66 Q;  4DR1 L;  1SAP A;  3BDC A;  4TRD A;  2HIV A;  4NPS A;  3HOZ H;  4A93 H;  1X65 A;  1SXT A;  1PHJ A;  4OO1 G;  1DOL A;  3CC7 A;  3TDQ A;  5C44 G;  1I50 H;  1ROD A;  1GO3 E;  4NP5 A;  1C8C A;  2KJX A;  1ESF A;  2I46 A;  2VUM G;  5COY A;  3J81 L;  2FMC A;  1VQM A;  3G6E A;  1K83 H;  3RR5 A;  2FHT A;  3RLF A;  5IYD H;  1XJV A;  5K36 G;  2XSC A;  5M5Y B;  2LKV A;  3S1R H;  4HIO A;  4ZCK A;  1LTB D;  1UE6 A;  1YNJ D;  1TU2 B;  3GTL B;  1B1Z A;  4HMJ A;  2IX3 A;  1C9O A;  1FGB D;  4K14 A;  4B3R L;  1EUJ A;  2Y0S B;  1TKW B;  4YWK A;  1STH A;  1L0Y B;  4JCV E;  5M9O A;  1JQY D;  5IOD A;  1B9M A;  1KHI A;  4AIM A;  4EX5 A;  4FXG C;  2B3G A;  2Z9H A;  2EYO A;  3JAM c;  1BQQ T;  1O7I A;  2IX0 A;  3K58 A;  1B3Q A;  5JEA J;  2SOB A;  2NVX H;  1IL2 A;  3KDF B;  4ZAI A;  2R7Z B;  3MFG A;  4LAA A;  4XQJ A;  4B3M Q;  4BBS G;  1PTO F;  3ULL A;  3E0E A;  3KLR A;  1EU3 A;  3KBX A;  1HXY D;  4MZ9 A;  3MZ5 A;  3FMC A;  3L0O A;  4A3D H;  2D0O A;  1V1P B;  2IHE A;  3HP3 A;  3HOX B;  4XXE A;  2RA4 A;  1LUZ A;  1BOS A;  2B2V C;  3A55 A;  4R4O A;  4Q0F A;  4DR6 L;  4CDD C;  5FLM H;  1GUO A;  4CHT B;  1K28 A;  1X3F A;  4GN4 B;  4DR2 Q;  1N34 Q;  4C3H H;  2UUC L;  1N36 L;  5JJI A;  1TVX A;  3GTO B;  2XIW A;  3CPF A;  1HPC A;  3H91 A;  3T56 B;  4BY7 B;  1K8O A;  3GTM H;  1OTC A;  4J1M A;  3T53 B;  2UUB L;  2G9H D;  1ILP A;  3KK7 A;  2YU9 H;  5FO8 B;  2UUA L;  3ERO A;  4MNO A;  2IPK D;  1NNX A;  3CU7 A;  5KYL A;  4UAI A;  3A5U A;  2MFI A;  1D7Q A;  1NMG A;  3TZD A;  2RSN A;  4DPG A;  4A3K G;  5C3X A;  2AQ2 B;  1BCP B;  1DCZ A;  5JEA H;  4LFB Q;  2L1B A;  4I65 A;  2WB1 G;  4F8M A;  1SBB B;  2I5L X;  1LTT D;  1YVC A;  3AMU A;  3H3V I;  2L5T A;  5D3D A;  2D62 A;  4X62 L;  1TXY A;  3J81 c;  3RZO H;  1F2M A;  3DHQ A;  3TP5 A;  1CUK A;  1TWC H;  4DU9 A;  3WWV A;  5C4H A;  2JEA I;  5KGU A;  1JOK A;  3M4Q A;  2EXD A;  1K8A C;  1MGS A;  3HOW H;  4X6A H;  1A3U A;  4IOA A;  3U9O A;  2MJ8 A;  2F4V L;  3GTQ H;  1SN8 A;  2EY2 A;  2D9U A;  4K0K Q;  3BJU A;  3T13 A;  3GD7 A;  1NBW A;  5DAU A;  3PO3 H;  1E24 A;  2QF7 A;  1PRT C;  1GM5 A;  1HNZ Q;  2F0M A;  2E8G A;  3KOJ A;  1A15 A;  2PQE A;  4LUZ A;  3HOU B;  3S16 B;  2PW5 A;  2B2U A;  2P5Z X;  5G3L F;  2M00 A;  4JI5 L;  4UY8 C;  3GTP B;  1VQB A;  5I4D A;  4ME3 A;  5M5Y H;  4KKT A;  4ALP A;  3PQI A;  4EQ5 A;  4HJA A;  4P72 A;  4WJW A;  1XNR Q;  3SK8 A;  3GO5 A;  1EQQ A;  2SNM A;  4IJL A;  3GTL H;  2QDB A;  5CR3 A;  3VYU A;  5CV6 A;  4DUZ L;  3PIO A;  4DK3 C;  1PZK D;  5GRO A;  3C3L A;  4IFD J;  2WII B;  3MXG A;  4DGZ A;  1N32 Q;  5FLX E;  4L8J A;  1EQT A;  5LMN L;  5EPK A;  2OTL A;  5IYB G;  4GKJ Q;  2OF1 A;  4DV7 Q;  5AJ3 Q;  4A3J G;  1F2Y A;  2J0T D;  5IWA Q;  1QVF A;  4O2D A;  4RGM A;  5EQ0 A;  3CPW A;  2WKD A;  5IT9 L;  1QB5 D;  4IOC A;  5F2D A;  5M5W B;  1OXT A;  2R7Z H;  3S14 B;  1RJT A;  2HHH Q;  2EJG C;  2AQ3 B;  3CCR A;  4XQQ A;  4A3M H;  4WRD A;  2BDN A;  2F0V A;  5ELO A;  3DWQ A;  5EBD A;  5IE8 A;  2B2W A;  3CAM A;  5EPL A;  4DV0 Q;  1IZ6 A;  1RD9 D;  4RGT A;  1DJR D;  2F0Q A;  2NZ1 D;  3HOV B;  1KL9 A;  2A5H A;  3HFZ B;  2XWB B;  1CSQ A;  4K5V A;  5JJL A;  3QOL A;  3MC0 B;  4AH6 A;  2EZV A;  4IFD H;  2RHQ B;  1QNK A;  3J7A V;  4BY7 H;  3PIO 3;  3OTO Q;  1HNX Q;  3IL8 A;  2RCN A;  3D31 A;  4J8Q A;  2BDO A;  2IL8 A;  1PZJ D;  3G6J B;  1GUW A;  1G8Z D;  2VS1 A;  2PI2 E;  4EGV A;  3I56 A;  1VDZ A;  1RTO A;  2Z4H A;  1YHQ A;  3PO2 G;  1C0A A;  1A2U A;  2CW0 C;  4IUP A;  1UE7 A;  2JXM B;  1IYJ B;  2X6G A;  5IYC H;  1PH7 A;  1L1O C;  3R93 A;  2MGS A;  3UDI A;  3RZD B;  1X6O A;  3SDZ A;  2KHJ A;  5KND A;  1TWF H;  4DV5 Q;  1V8Q A;  1HHV A;  1I4G A;  2VB2 X;  3UE0 A;  3QWN A;  1QWY A;  1DD2 A;  4YCU A;  2F0I A;  4POF A;  1MSH A;  4DAY B;  3SK4 A;  4Z9C B;  5HGQ A;  1EY7 A;  4XQN A;  4ODG A;  1S5B D;  4UP7 A;  3RMH A;  1J6Q A;  1E1O A;  4IUV A;  2PI2 A;  4YWM A;  5C5L A;  1T5X D;  3HOU H;  4K6D A;  3S16 H;  4AQY Q;  3R3O A;  3FP9 A;  4CKC A;  5EKL A;  1SND A;  3RLN A;  2AMC B;  5JVG 3;  3GTP H;  3N52 A;  4RGO S;  2GA4 B;  1CI3 M;  2FXQ A;  2QEJ C;  3IRB A;  4PQX A;  2JA6 G;  2EXZ A;  1FVI A;  5IT9 c;  3H09 A;  1Q3L A;  1JOQ A;  5DEH A;  1C7Y A;  4OX9 Q;  1EIG A;  2A68 D;  3PUZ A;  2E5L Q;  3K59 A;  3E9I A;  4RHS A;  3J80 L;  3H0G B;  2ZXR A;  5GAH C;  1XPR A;  5JJK A;  4DR5 L;  2LFN A;  1GHK A;  3W3A A;  1SLJ A;  4JI3 L;  1JJ2 A;  1FNU A;  3NEL A;  2SNS A;  4HSP A;  3CRK C;  3FKI G;  4KD3 A;  1FNV A;  3QR8 A;  4OEM B;  2K14 A;  3KJP A;  1H9M A;  4CJ0 B;  1M8A A;  1GHJ A;  5I6Y A;  1ICW A;  1CKM A;  1WJJ A;  1OXX K;  3S14 H;  4YHH Q;  4UP8 A;  3CRL C;  4C2M H;  3CF5 A;  1KTK A;  2YTX A;  4OXP A;  3DEO A;  3NTI A;  2R92 G;  3NEN A;  1O7L A;  5GAD C;  2JE6 I;  3PF5 A;  2QKI C;  2XN9 C;  1UE5 A;  1IBL L;  1UEB A;  3OWE B;  1I6V C;  3LWE A;  1YEZ A;  4IUT A;  5I2X A;  3SGI A;  1JOR A;  3HOV H;  3H3V C;  2F0F A;  1S5C D;  5EPJ A;  4JI1 Q;  4G57 A;  5KRU A;  2BA0 A;  2N8N A;  1I94 Q;  4P74 A;  5KYI A;  2D0P A;  2EIF A;  3TZU A;  1NJI C;  4HID A;  3F1Z A;  1U0L A;  3OWF A;  1ASZ A;  4IZ8 A;  3LX0 A;  1MHW C;  1KD1 C;  4A3L G;  3KF8 A;  4DK1 A;  4IUN A;  2UUC Q;  3MTS A;  4KLK A;  4GNX C;  4N9T A;  1A3V A;  1S40 A;  3NE5 B;  1GD7 A;  2MO1 A;  2EY6 A;  1SYE A;  4A3E G;  3M3Y B;  2K7V A;  1DM0 B;  3NBI A;  5IP9 H;  3RZD H;  1Y1V B;  2E2D C;  3PV0 A;  1QG7 A;  3ER0 A;  3A7L A;  1SNO A;  4X3S A;  4FF3 A;  1LTR D;  3BYY B;  4QUC A;  1PYW D;  1E22 A;  1XNQ L;  4JBM A;  2MP1 A;  5KIX A;  1N33 L;  2B2T A;  3KUP A;  3JC6 6;  1HQR D;  5DM6 3;  3QOJ A;  1DGS A;  3DMU A;  1SE2 A;  3MAQ A;  1X3G A;  2VY3 A;  2JA5 G;  4X64 L;  1NUC A;  1TY0 A;  4LF7 L;  1VQH A;  4K6L A;  3STB D;  4IQZ A;  4HTH A;  1SE4 A;  1AZQ A;  1V43 A;  2IWH A;  3J80 c;  1NR4 A;  3I2Z A;  1MKH A;  3V96 A;  3L2P A;  2KCM A;  2N88 A;  3R2T A;  1Y1W G;  2WB1 E;  2IW3 A;  5ELN A;  5BR8 L;  1G6P A;  1CQV A;  2KEN A;  4XT3 B;  1KDB A;  4DR4 Q;  2MPM A;  4IN3 A;  3NQI A;  3CCL A;  3KF6 B;  4LFC L;  5AFW A;  5A2Q L;  2MUY A;  1SYC A;  1HQM C;  1XX8 A;  5I9O A;  2BA1 A;  2F0O A;  5IGF A;  1YI2 A;  1PH6 A;  4A3B B;  4JVZ A;  4QIW B;  4UHV A;  5L37 A;  4AYB G;  1FJG Q;  2YV5 A;  2UXD Q;  3H0G H;  2NTT A;  2KVM A;  2R61 A;  1TT2 A;  5C0X J;  1EOT A;  3VR6 A;  1WTQ A;  3SR1 A;  3G71 A;  2KEC A;  3M9B A;  2A69 C;  3GV6 A;  3I72 A;  2JEB I;  1Q81 C;  4LUV A;  3I73 A;  1PH4 A;  1VMP A;  2WAQ B;  2ZJP A;  1HUM A;  3OMG A;  3HOZ G;  3ULJ A;  4RCN A;  4A3G B;  4A93 G;  1JIC A;  4DN4 M;  1BCP C;  3A8J E;  2HDM A;  4K8I A;  1B8A A;  4F7X A;  4F87 A;  4HAE A;  4LF9 Q;  1KAW A;  3L9A X;  3T51 B;  1D6E C;  4DV4 Q;  4G4K A;  3MA2 B;  4IPD A;  5NUC A;  4K5W A;  1Q7Y C;  5TSS A;  5IYD G;  5M3M B;  4MN3 A;  1A0I A;  3EJI A;  1B2T A;  3Q24 A;  4H02 A;  4JBK A;  3HKS A;  1JE4 A;  1Q8I A;  5C0X H;  2HT1 A;  1II3 A;  3I7F A;  3RD4 A;  2F0P A;  3VYR A;  4L6T B;  4OGQ C;  3BS1 A;  2B8F A;  4B08 A;  4JV5 Q;  2FMM A;  2HQL A;  2C35 B;  3OMC A;  4HIK A;  3T4A C;  1IKL A;  1YNN C;  5CC4 A;  3M3Y H;  2F0H A;  3K8A A;  3D8G A;  1YZ6 A;  2NN6 H;  4RKB A;  4IPH A;  2WKC A;  3I4N B;  1U9R A;  1Y1V H;  5DM7 3;  4BXX H;  3EIV A;  2SDF A;  4PMC A;  1IW7 C;  2CHB D;  4B9X A;  1QIL A;  1D1K A;  4JG2 A;  4HJ5 A;  2PQA B;  4JI4 Q;  5IP7 H;  2JA9 A;  2K33 A;  1RDP D;  4A3D G;  5D14 A;  3SVM A;  1BVS A;  2ES2 A;  1JB3 A;  3U4Z A;  1LTG D;  2JQO A;  5EKI A;  3NPP A;  3IFD A;  4JI8 L;  3TBI B;  3M7N A;  1PFS A;  5FLM G;  3C1E A;  4J15 A;  4JYA Q;  1HR0 L;  1TWG B;  4C3H G;  5C4J H;  1XMQ Q;  4NDX A;  1CKO A;  1LT6 D;  4PNY A;  3ICE A;  2LSS A;  3U9S A;  4KHP Q;  2G5D A;  2HQE A;  1WTP A;  2UXC L;  3VA7 A;  3CXC A;  1SE8 A;  2K75 A;  1HNW Q;  4N8X 1;  4A3I B;  3VYT A;  2PW7 A;  2ZXO A;  3I4M B;  2Q8T A;  4L5T A;  2VQE Q;  1PH2 A;  4CDC C;  5JEA G;  2QIL A;  2RDF A;  3I70 A;  4DF7 A;  3K5M A;  1QCB D;  2I5M X;  1KXL A;  2R93 B;  1ZKO A;  4LK1 C;  1MSG A;  4GNX B;  2F4I A;  1PA6 A;  3CCS A;  3O13 A;  3VDY A;  1U4P A;  1I4H A;  1QVG A;  4CJ1 B;  5C44 B;  1EZ6 A;  1PLF A;  4LF8 L;  2Z8L A;  2F0T A;  2VUM B;  1PRT D;  3CC4 A;  2F52 A;  4LJZ C;  2Q8R E;  3HOW G;  4DR5 Q;  1YJW A;  2UXB L;  2KQ3 A;  4LUO A;  1UWV A;  2DY8 A;  1U5K A;  2EJM A;  5J39 A;  4A3G H;  1KLU D;  2K32 A;  1KC8 C;  2L9H A;  1PTO B;  3PO3 G;  4QL5 A;  4DV2 Q;  2DGY A;  3IFT A;  4Q5V A;  1EY9 A;  2Q8I B;  3AB9 A;  1B44 D;  5M3M H;  1I3Q H;  1VQI A;  3R2I A;  4FO2 A;  2Z4I A;  4MTN A;  1FD7 D;  4S3S A;  1TWH H;  2F0W A;  1LV9 A;  3NBH A;  3SE0 A;  2PMZ B;  4TQU S;  2E2J H;  5CBA E;  2VQF L;  1YJ9 A;  2ID0 A;  4BBS B;  5IOC A;  4C3I B;  1TS4 A;  3PMF A;  4JI2 L;  1HFG A;  3CCQ A;  1XMO Q;  1VMC A;  4MHE A;  5JPN C;  1G2S A;  3W2D A;  4A3C H;  2EPB A;  1H9S B;  1EQV A;  3CW2 C;  1WOC A;  4P71 A;  3OIQ A;  3BG3 A;  1X32 A;  1SEB D;  3DEP A;  2L4N A;  4B3T L;  3I4N H;  2BCO A;  3V05 A;  1MJE A;  1GJX A;  3U50 C;  4F88 A;  4RWS C;  1HZC A;  4H7B A;  1GOZ A;  5C4X B;  3MXN A;  3PUX A;  4LW1 A;  4FF2 A;  1D5Z C;  2B63 H;  1E1T A;  4C1N K;  4A3M G;  1X56 A;  1C4Q A;  1K9M C;  3T1H Q;  1RL2 A;  1BXT A;  3H6M A;  3PUW A;  3PUY A;  1VQL A;  4TSS A;  1WYD A;  4LF4 L;  4A75 A;  4ILW A;  1STG A;  3WOF A;  1HRJ A;  1TWG H;  1LYL A;  4IFD G;  2LXK A;  2CW0 D;  1X3E A;  4NXN L;  3BZC A;  4BY7 G;  1PFB A;  3H3V H;  1EY0 A;  3VYS A;  2IX1 A;  1WVL A;  2ZTE A;  1LM0 A;  1S5E D;  4A3I H;  1Y8P B;  2KHI A;  1VQC A;  3I4M H;  4MIU A;  3EFX D;  3UDX A;  4ID6 A;  4QB4 A;  4LF5 L;  4JI7 L;  1IBM L;  4R9W A;  4JI6 L;  5KNC A;  1YBY A;  1O78 A;  2K5N A;  1STN A;  1AW7 A;  3FRP B;  1ZYR C;  4DV1 Q;  4OO1 I;  3B6Y A;  5IYC G;  2R93 H;  1S5F D;  3CME A;  2XGT A;  3A8I E;  4UP9 A;  4DNR B;  5ISR A;  1Z6H A;  1A63 A;  3U4V A;  3P20 A;  5C44 H;  1K73 C;  5ELC A;  3AFQ A;  4A3F B;  2JYO A;  2VUM H;  3T1Y Q;  3R8B A;  4C56 C;  2F0S A;  4OIK A;  4X65 Q;  3WDN A;  3TSS A;  4LF6 Q;  1CKN A;  4CGY B;  5JAV A;  1VQ8 A;  1GUS A;  4GOP B;  4JPB W;  1H9J A;  1STY A;  1TWA B;  3E6Z X;  1U4M A;  1PTO H;  2H1E A;  4IAL A;  5EBC A;  2B2Y C;  2ZTD A;  3F2B A;  3HOU G;  3E3X A;  2I07 B;  1CSP A;  4AYB E;  1E7Z A;  3TME A;  3E0J A;  4H13 C;  2RVL A;  3UI2 A;  3T16 A;  1K0R A;  1VQ7 A;  2KHS A;  1JJC B;  2XRS D;  5FLX L;  1SJH D;  2A6E C;  2E76 C;  4DV3 Q;  4OON A;  2DUD A;  5J3B A;  1YIJ A;  2IY5 B;  3A8K E;  3M4P A;  1XXG A;  4R4C A;  4OIJ A;  4CKE A;  2PCF B;  1WTH A;  4DR3 Q;  5FO9 B;  4C3I H;  1UEA B;  3M7G A;  4DV6 Q;  2PPB C;  1D5M C;  4X3U A;  3K5O A;  3K5N A;  3MHB A;  3NXW A;  4JW0 A;  3D4R A;  3HKZ G;  1JWU D;  4NXM Q;  5ELB A;  3RNU A;  2N78 A;  3HOX H;  3GTJ B;  4YCW A;  1WD0 A;  5FJ8 H;  2RDH A;  4C3J B;  1VQN A;  3A74 A;  1RKN A;  4HED A;  1EYD A;  1XPU A;  4QUF A;  3W5O A;  1KLG D;  2K5V A;  4ZK9 B;  2B2W C;  3GTO H;  2JK8 A;  1U4L A;  3S17 B;  2K5Q A;  1WCM B;  1PH3 A;  5C4X H;  1J8I A;  2CVR A;  3ERQ A;  4L5R C;  5LMU L;  1KAB A;  3I8Z A;  1CM9 A;  3KF6 A;  3NWT A;  4WJ3 M;  4B3S L;  1A62 A;  4DR7 L;  1HUN A;  4GKK Q;  3HOV G;  1PVO A;  2N55 A;  3SEB A;  3AYH B;  4R4T A;  1AH9 A;  1QOH A;  2X6L A;  2ZTC A;  4PZ8 A;  1X9N A;  4BA2 I;  3SK6 A;  2HCI A;  5E1F A;  1LTA D;  2ZM6 L;  4JI0 L;  3MVV A;  4HCS A;  2Z1C A;  2WAC A;  1L1O A;  1G51 A;  1AE2 A;  4DUY L;  2Z6K A;  1K3R A;  1HTL D;  3A0J A;  5J22 A;  4JOI C;  1VCI A;  1VQG A;  2F3W A;  3HZX A;  1LLR D;  1CT1 D;  2EOT A;  2YTY A;  4RH6 A;  5FK9 C;  4QGU A;  4A3F H;  5J1Z A;  2KCT A;  5FLX c;  3HOY B;  2O2L D;  1J5E Q;  4DR1 Q;  1VQF A;  4OWT B;  2JA7 B;  2JA6 B;  1EIY B;  1SMX A;  2NVT B;  2B8G A;  2EDG A;  1I4P A;  4MTK A;  2DY7 A;  4ZKB B;  4BBR G;  3K7A B;  3RN2 A;  1IBK L;  1B7Y B;  1TWA H;  5C3W A;  3H15 A;  2K5W A;  3K7U C;  1VQA A;  1S72 A;  3CQZ B;  3FEW X;  2RQX A;  2YYZ A;  1PMR A;  5GQO A;  2Q2H A;  1NY4 A;  1PH1 A;  2F0E A;  2VNU D;  4RKL A;  1SSO A;  4X66 L;  5GAG C;  4QQB X;  1YNX A;  1STB A;  3FKI B;  2NVQ B;  1NTG A;  3Q8D A;  3FVQ A;  4B3R Q;  2K01 A;  1XWE A;  2K28 A;  2F0D A;  1XTC D;  1UNS A;  2A69 D;  4EQO A;  2XVS A;  3I90 A;  5A35 A;  5M5W H;  2O5I C;  1P16 A;  2L15 A;  3H0G G;  3HS0 C;  5M3F G;  1EIF A;  1MD2 D;  3BZD B;  5M5X B;  5E4W C;  5CBE E;  1JE5 A;  1STE A;  1BF4 A;  4ZLT F;  1BCP D;  1ENF A;  3GTJ H;  3OW7 A;  3UDG A;  1B4O A;  4C3J H;  4ZYS A;  4FYD A;  1FL0 A;  4DAM A;  1EFI D;  3DUZ A;  1F77 A;  1KNE A;  3TQY A;  1QJO A;  1U4R A;  2K50 A;  3S17 H;  5G3L D;  1WCM H;  2K03 A;  2B29 A;  1N8R C;  4DR6 Q;  2AHO B;  5DLQ E;  4XYO A;  1VQJ A;  1SNP A;  1EYG A;  3CCJ A;  1N36 Q;  2F0G A;  3OW2 A;  3CD6 A;  3UE1 A;  2Y0S E;  2YTV A;  4GLV B;  2CFM A;  1CK1 A;  5C3E B;  1VQO A;  2UUB Q;  2UUA Q;  1TS3 A;  1PH8 A;  1LTI D;  2ALY B;  2G9D A;  4KHZ A;  2NZO A;  3TS2 A;  3J7Y W;  2BH2 A;  2LS0 1;  1YNN D;  1Y69 U;  1DOM A;  4R4Q A;  3PSI A;  4JK1 C;  1E2V A;  2A6H C;  2E74 C;  5C0X G;  2F03 A;  3PUV A;  4O1N A;  1K3B C;  2AUJ D;  4RHR A;  2KED A;  2A19 A;  4RG1 A;  4DXF A;  1N34 L;  1IW7 D;  5H1S E;  4GZY C;  2VW9 A;  2NUC A;  1PTO C;  5HUR A;  4X62 Q;  1GXD C;  1Q12 A;  2Z0S A;  3DWP A;  3SHL A;  2UU9 L;  3FPP A;  3F2U A;  4M8A A;  3K0X A;  1L2F A;  2NN6 G;  4LF5 Q;  2B2T C;  5I2Y A;  1Y1V G;  1Y1W B;  4BXX G;  2EYF A;  3RUZ A;  2HIX A;  3IKJ A;  4LFB L;  4HJ9 A;  1PFN A;  2BOS A;  2KBN A;  3HOY H;  1N9W A;  4HMI A;  2F4V Q;  1ENC A;  1VQ6 A;  2AWN A;  5IP7 G;  2JA7 H;  2JA6 H;  2NVY B;  5IGC A;  1PYB A;  2NVT H;  1PH5 A;  2WIN B;  1KDC A;  1CHQ D;  1Q1B A;  1DZ1 A;  1S4Z A;  1W6J A;  2JA8 G;  2OCE A;  3Q6S A;  3KDF A;  5IIF A;  4DNT B;  1CZG A;  4TVA B;  4JI5 Q;  1BBW A;  1FYC A;  1YHB A;  2E75 C;  3F2D A;  2CCZ A;  3CQZ H;  1SNQ A;  5K5P A;  4HN7 A;  3S24 A;  1HCZ A;  2I5H A;  1ENA A;  3NSW A;  2AUK A;  1VQ9 A;  1D5X C;  1B53 A;  1ET9 A;  2CWP A;  1V1P A;  4DUZ Q;  4K0K L;  2M9V A;  3TP7 A;  1HNZ L;  1CA5 A;  1EY4 A;  3ND9 A;  1I4R A;  5DNF A;  2BH8 A;  3X3M A;  1QUQ B;  5LMN Q;  4GN5 A;  5HY6 A;  3ULP A;  4DK0 A;  1HZA A;  3ONA B;  4DA2 A;  3Q0A A;  3A5Z B;  2DJF C;  4E6I A;  3F2C A;  1HZB A;  2X69 A;  1XNR L;  5LHY 1;  5LL6 X;  2OQK A;  1FR3 A;  4ZUJ A;  1LT4 D;  3QIA A;  1SE3 A;  1R9T B;  4ZQ3 A;  2IT1 A;  1K83 B;  1HH2 P;  2RF4 A;  4YY3 L;  5BN4 A;  4PG3 A;  2BE5 D;  1EOV A;  1NR2 A;  1HFN A;  1N32 L;  4LFA L;  4A3G G;  1KIX A;  4GKJ L;  1AP0 A;  2NBF A;  3LNN A;  3CCV A;  4DV7 L;  2AWO A;  5AJ3 L;  1F9S A;  2E2H B;  3C1F A;  4OWW B;  3ZYY X;  2KCN A;  1PV4 A;  5IWA L;  3EN2 A;  2FIN B;  3MXP A;  1RCV D;  1EZ8 A;  3G4S A;  2WP8 J;  5C3E H;  3S2D B;  5M3M G;  2HHH L;  3QO2 A;  4KK7 A;  4KY5 A;  5FOB B;  3HKZ E;  5T1G A;  3F8T A;  4RFB A;  1HZ9 A;  1LAB A;  4CDF C;  2RDG A;  2R3Z A;  2C5C A;  3DWA A;  5EJW A;  4G7H C;  4O0A A;  4DV0 L;  3ITP A;  3BVZ A;  1BKB A;  4DFA A;  1W2B A;  2OXP A;  1JT8 A;  1PXU A;  1Y8N B;  1L0X B;  4GOP C;  2PZT A;  3SK5 A;  3A7A B;  1A3T A;  4BWG B;  4A3C G;  2V4D A;  4APV A;  5GAE C;  3KLS X;  4BY1 B;  1JCK B;  1Q8K A;  3K0Y A;  3JAM E;  3OTO L;  1PH9 A;  1EY8 A;  2KUM A;  3TP6 A;  1MJC A;  2K5D A;  3GQB A;  4HR7 B;  3Q22 A;  1HNX L;  1P8L A;  1QZH A;  3I4N G;  4C3H B;  1D8L A;  3H94 A;  3RN5 A;  3NQT A;  2FFK B;  1I4Q A;  1TQO A;  1QNU A;  1EL0 A;  2B63 G;  1PZI D;  1ZXT A;  3DM3 A;  2JJQ A;  2NVY H;  3CC2 A;  4PMW A;  1CQF A;  3S15 B;  4DV5 L;  5C4Z A;  3NP8 A;  2IJ0 A;  2K6A A;  4KJO A;  4A3B H;  5E4X A;  2Q2T A;  1HA6 A;  1VQE A;  1JB7 A;  3GTG B;  4HJ7 A;  1SYB A;  1A6X A;  1ZYR D;  1NSN S;  2L11 A;  2R7D A;  4KTA A;  1X3Q A;  4I7Z C;  4NKL A;  4IUR A;  4A3I G;  3KF8 B;  3EA6 A;  3I4M G;  3TP8 A;  1Y14 B;  3NEM A;  1ET6 A;  1F2L A;  3BYT B;  1H9K A;  2MNA A;  3VR4 A;  5FKA C;  4AQY L;  1RTN A;  4JI3 Q;  3GTQ B;  2XNA C;  4ME5 A;  2R93 G;  1JJG A;  2LY7 A;  4L5S A;  1K8M A;  2PZU A;  3AEV A;  3PO3 B;  4N8F A;  3J81 E; 
#chains in the Genus database with same CATH homology
 1AFP A;  3NTH A;  2TSS A;  4R8I A;  4YIJ A;  4ZKC B;  2BE5 C;  3J7A F;  2OEO A;  2C9O A;  2NTS A;  2M2L A;  4H44 C;  3BVM A;  3VR2 A;  1V1O A;  5I9P A;  2VXW A;  1MI2 A;  2A6E D;  5C5M A;  1IYV A;  3OIP A;  2F3V A;  1T5E A;  2A74 C;  4FF4 A;  2FJ2 A;  4KV6 A;  4DXG A;  5COR A;  5I6W A;  1LT3 D;  4DAY A;  3HRZ C;  3DXJ C;  1E0B A;  1BUV T;  4L63 B;  3C2P A;  1DON A;  1ESR A;  3MWY W;  3KBG A;  2B2V A;  3CHB D;  4C3I G;  3S1Q B;  5CYU A;  1HA5 A;  1SYD A;  4A3M B;  2ENB A;  1X3P A;  3VA5 A;  1IL8 A;  4A3K B;  4K2L A;  2D5D A;  3P7J A;  4NMZ A;  2WB1 B;  1SJE D;  3LWU A;  4CKB A;  5JOB A;  5IGG A;  4DAV A;  1JC7 A;  1EWC A;  4WFN 3;  4B9W A;  2PYK A;  2JSO A;  4TKO B;  1SFO B;  2ZT9 C;  2KEE A;  3M4Y A;  1KDA A;  2J4X A;  1EIH A;  2XRQ D;  1F9P A;  4FVM A;  2A73 B;  1SDF A;  4O42 A;  1DOK A;  3IAY A;  1I6H B;  2MHV A;  1OXU A;  2F0L A;  3L3O C;  1SMY D;  3N6R A;  1WTV A;  3P1H A;  5BN5 A;  4OO1 H;  1TS2 A;  1TWF B;  2EYJ A;  3G7L A;  1TY2 A;  4EQN A;  1WD1 A;  1EEF D;  5K36 H;  3EQL C;  2F0N A;  1AZP A;  1BCP F;  5C6A A;  4KKU A;  2B2U C;  4C1N I;  1NAP A;  3HEJ A;  1Q1E A;  1LAC A;  4KD4 A;  2J7Z A;  3KLS A;  2NWG A;  5CGK A;  3D4W A;  4UDU C;  3QJY A;  1YNJ C;  3I4L A;  2B2Y A;  4FXK C;  1OXS C;  4A3J B;  1VF5 C;  2R6G A;  3NK9 A;  2OT2 A;  3QG1 A;  5D65 A;  1Z47 A;  4XYQ A;  1R4P B;  5HGT A;  4H0L C;  3URY A;  4KMU C;  2RSO A;  1EYC A;  5KNB A;  4U68 A;  4BS9 A;  2KCC A;  3HKZ B;  1JR0 D;  4PMB A;  1GUT A;  1TS5 A;  5IT9 E;  3VR3 A;  1BR9 A;  1ZEQ X;  3M85 A;  1EWH A;  3S2H B;  4C2M B;  1DYQ A;  1VF7 A;  3D6W A;  4XTC S;  1JWM D;  2PNR C;  2ICI A;  1JOO A;  3VR5 A;  5D3I B;  5BN3 A;  1EU4 A;  1UAP A;  2WV6 D;  2EE1 A;  4OHJ A;  3D3R A;  1O7Z A;  1PFM A;  1E2Z A;  4C3J G;  2DNC A;  3PO2 B;  4IFD I;  2HCC A;  3BDO A;  4J6H A;  3BDL A;  3K6O A;  5KEE A;  1GUG A;  3TN2 A;  3HG9 A;  4HCE A;  2A6H D;  2ICE C;  3GV3 A;  5IGE A;  4IUQ A;  1SMY C;  4FXD A;  2QCP X;  3L7Z C;  2CQA A;  4LMQ D;  1IYU A;  1PTO D;  2E2I B;  3A56 A;  1D2B A;  4FF1 A;  4KJN A;  3PIP 3;  1BO0 A;  4WOR A;  3Q23 A;  3CKI B;  5CMD A;  1SNC A;  3GP7 A;  3FDT A;  1QE6 A;  5CV4 A;  2B39 A;  5CV8 A;  4X3T A;  4NW2 A;  5CV7 A;  4K8J A;  1R4Q B;  2DN8 A;  4BBR B;  3OHX C;  2KOL A;  1OXV A;  1ONL A;  1KAA A;  1G91 A;  2K1B A;  2RBM A;  4IUU A;  2EYM A;  2TMP A;  4KI0 A;  1ML0 D;  1LTS D;  4RAU C;  2F0K A;  1F9Q A;  3J80 E;  3GTK B;  4RGN A;  3M4O B;  4EQP A;  2HUG A;  1H9R A;  1F2Z A;  1BBX C;  5M3F B;  3S1M B;  2R92 B;  1B9N A;  2LMC B;  3MXU A;  3S1N B;  2F1M A;  4KN4 C;  1HTP A;  1B50 A;  2D2C C;  3MFY A;  4FNF A;  4P2C B;  1STA A;  1AEX A;  4JBW A;  2H4O A;  4Y7N B;  1XYI A;  1O80 A;  1IHZ A;  1AN8 A;  1O7Y A;  5IGB A;  1PRT B;  5EKK A;  1LO5 D;  2O4X A;  1BDO A;  2L0C A;  4A3E B;  3HGB A;  4XIG S;  1WTR A;  3NUC A;  3NWS A;  4V19 0;  3X3N A;  4V0B A;  1W6K A;  3A54 A;  4ZUI A;  3NHH A;  5IGD A;  4XDX A;  1KNA A;  2JA5 B;  3D4D A;  4PV1 C;  4U67 3;  1RF2 D;  4KN7 C;  1PRT F;  1MBY A;  4ZRZ A;  3QB3 A;  3BVG A;  2EVB A;  3NTK A;  4RA8 A;  1PDQ A;  4M1U B;  1EYA A;  5FO7 B;  1J9O A;  2EYP A;  2JA8 B;  1WTW A;  2VB3 X;  5C4J B;  4QCL A;  1BNZ A;  4AYB B;  2AQ1 B;  1G6Z A;  5ELF A;  1A2T A;  2KA7 A;  5A2Q E;  3K5L A;  1WTX A;  5ELE A;  1G29 1;  1RHP A;  1H9S A;  4N9P A;  1TII D;  1B3A A;  3V2T A;  3E5S A;  4K2K A;  2A68 C;  2L55 A;  1DXM A;  1EEI D;  1JWS D;  1WTO A;  3AU7 A;  2NYZ D;  4ABN A;  2XWJ B;  1LT5 D;  3HOZ B;  4A93 B;  3OSO A;  3I3C A;  5EGT A;  1EY6 A;  4G7O C;  4DAP A;  1I50 B;  4CJ2 C;  5LL6 S;  2RKS A;  3OPO A;  4KY7 A;  3ND8 A;  3WOE A;  3K57 A;  2EY1 A;  3S1R B;  3OOC A;  4OL7 A;  5JVH 3;  2EYH A;  1G2T A;  4RCO A;  4X3K A;  1I3Q B;  2JP1 A;  1S5D D;  1UUP A;  4ULL A;  1SYF A;  4KKS A;  5C0X I;  4QMG A;  3C46 A;  2NVX B;  1TWH B;  2E2J B;  1GUN A;  2DNE A;  4QF4 A;  4R8N A;  3S9W A;  4FP5 D;  2PO4 A;  5CV5 A;  3EVQ A;  1Z7T A;  4G7Z C;  1EY5 A;  2NN6 I;  4A3D B;  1TR5 A;  5ELD A;  1M4V A;  1D1I A;  1C48 A;  3DM1 A;  2PZW A;  3I91 A;  1F9R A;  3P75 A;  2NB0 A;  1Q90 A;  5E3F A;  3JAM L;  1CA6 A;  2ZXP A;  2EYL A;  1FNW A;  1NCV A;  2EJF C;  4KHV A;  1CZW A;  3GTM B;  2B63 B;  2K05 A;  1ILQ A;  5JPM C;  2YU9 B;  1I4X A;  3FPU B;  1SNM A;  1IKM A;  4CBV A;  4EVO A;  1SYG A;  1CHP D;  1Y8O B;  3SXH A;  2F0U A;  2F0J A;  3D6C A;  4K5X A;  3RZO B;  1E2W A;  2EY5 A;  1OO9 B;  1TWC B;  4XT1 B;  5JJZ A;  2L12 A;  5CV9 A;  1CFM A;  3MEH A;  2O5J C;  3HOW B;  4HSV A;  2SEB D;  4BA1 I;  2HDL A;  5T1I A;  1CTM A;  4KY6 A;  2K04 A;  1SAP A;  3BDC A;  4TRD A;  1SXT A;  4OO1 G;  1DOL A;  3TDQ A;  1ROD A;  4NP5 A;  1C8C A;  2KJX A;  1ESF A;  2I46 A;  5COY A;  3J81 L;  2FMC A;  2FHT A;  3RLF A;  5K36 G;  2XSC A;  5M5Y B;  2LKV A;  1LTB D;  1YNJ D;  1TU2 B;  3GTL B;  1B1Z A;  4HMJ A;  2IX3 A;  4K14 A;  1FGB D;  2Y0S B;  1TKW B;  1STH A;  1L0Y B;  5M9O A;  1JQY D;  5IOD A;  1B9M A;  4FXG C;  2EYO A;  1BQQ T;  2IX0 A;  3K58 A;  5JEA J;  2SOB A;  4ZAI A;  2R7Z B;  3MFG A;  4LAA A;  4XQJ A;  1PTO F;  3KLR A;  1EU3 A;  3KBX A;  1HXY D;  3MZ5 A;  3FMC A;  1V1P B;  3HP3 A;  3HOX B;  4XXE A;  2RA4 A;  1BOS A;  2B2V C;  3A55 A;  4Q0F A;  1GUO A;  4CHT B;  1TVX A;  3GTO B;  2XIW A;  1HPC A;  3H91 A;  3T56 B;  4BY7 B;  1K8O A;  4J1M A;  3T53 B;  2G9H D;  1ILP A;  3KK7 A;  5FO8 B;  3ERO A;  2IPK D;  3CU7 A;  5KYL A;  4UAI A;  3TZD A;  2RSN A;  5C3X A;  2AQ2 B;  1BCP B;  1DCZ A;  5JEA H;  2L1B A;  4I65 A;  4F8M A;  1SBB B;  1LTT D;  3AMU A;  2L5T A;  5D3D A;  2D62 A;  1F2M A;  3DHQ A;  3TP5 A;  4DU9 A;  5C4H A;  2JEA I;  5KGU A;  1JOK A;  1MGS A;  1A3U A;  3U9O A;  2MJ8 A;  2EY2 A;  2D9U A;  3T13 A;  3GD7 A;  5DAU A;  2QF7 A;  1PRT C;  2F0M A;  1A15 A;  2PQE A;  3HOU B;  3S16 B;  2PW5 A;  2B2U A;  5G3L F;  2M00 A;  3GTP B;  5I4D A;  4KKT A;  4WJW A;  3SK8 A;  3GO5 A;  2SNM A;  2QDB A;  5CR3 A;  3VYU A;  5CV6 A;  1PZK D;  3C3L A;  4IFD J;  2WII B;  3MXG A;  4DGZ A;  5FLX E;  4L8J A;  1EQT A;  5EPK A;  2OF1 A;  1F2Y A;  2J0T D;  4RGM A;  5EQ0 A;  2WKD A;  5IT9 L;  1QB5 D;  5F2D A;  5M5W B;  1OXT A;  3S14 B;  1RJT A;  2EJG C;  2AQ3 B;  4XQQ A;  4WRD A;  2BDN A;  2F0V A;  3DWQ A;  5EBD A;  2B2W A;  5EPL A;  1RD9 D;  4RGT A;  1DJR D;  2F0Q A;  2NZ1 D;  3HOV B;  2A5H A;  2XWB B;  4K5V A;  3QOL A;  3MC0 B;  2EZV A;  4IFD H;  1QNK A;  3J7A V;  3PIO 3;  3IL8 A;  3D31 A;  4J8Q A;  2BDO A;  2IL8 A;  1PZJ D;  3G6J B;  1GUW A;  1G8Z D;  4EGV A;  1VDZ A;  1RTO A;  2Z4H A;  1A2U A;  2CW0 C;  4IUP A;  2JXM B;  2X6G A;  3R93 A;  2MGS A;  3RZD B;  3SDZ A;  5KND A;  1V8Q A;  1HHV A;  1I4G A;  2VB2 X;  3QWN A;  1QWY A;  1DD2 A;  2F0I A;  1MSH A;  3SK4 A;  4Z9C B;  1EY7 A;  4XQN A;  4ODG A;  1S5B D;  3RMH A;  4IUV A;  5C5L A;  1T5X D;  4K6D A;  3R3O A;  4CKC A;  5EKL A;  1SND A;  5JVG 3;  3N52 A;  4RGO S;  2GA4 B;  1CI3 M;  4PQX A;  2QEJ C;  2EXZ A;  3H09 A;  1Q3L A;  1JOQ A;  5DEH A;  1EIG A;  2A68 D;  3PUZ A;  3K59 A;  4RHS A;  3J80 L;  3H0G B;  2ZXR A;  2LFN A;  1GHK A;  3W3A A;  1FNU A;  2SNS A;  4HSP A;  3CRK C;  4KD3 A;  1FNV A;  1H9M A;  4CJ0 B;  1M8A A;  1GHJ A;  5I6Y A;  1ICW A;  1OXX K;  3CRL C;  1KTK A;  3DEO A;  3NTI A;  1O7L A;  2JE6 I;  2QKI C;  2XN9 C;  3OWE B;  1I6V C;  3LWE A;  4IUT A;  5I2X A;  1JOR A;  3H3V C;  2F0F A;  1S5C D;  5EPJ A;  4G57 A;  5KRU A;  2BA0 A;  5KYI A;  3TZU A;  3OWF A;  4IZ8 A;  3LX0 A;  3KF8 A;  4DK1 A;  4IUN A;  3MTS A;  4N9T A;  1A3V A;  3NE5 B;  2EY6 A;  1SYE A;  3M3Y B;  2K7V A;  1DM0 B;  3NBI A;  1Y1V B;  2E2D C;  3PV0 A;  1QG7 A;  3A7L A;  1SNO A;  4X3S A;  4FF3 A;  1LTR D;  3BYY B;  4QUC A;  1PYW D;  2MP1 A;  5KIX A;  2B2T A;  3KUP A;  1HQR D;  5DM6 3;  3QOJ A;  3DMU A;  1SE2 A;  3MAQ A;  1NUC A;  1TY0 A;  4K6L A;  4IQZ A;  4HTH A;  1SE4 A;  1AZQ A;  1V43 A;  2IWH A;  1NR4 A;  3V96 A;  2N88 A;  3R2T A;  2IW3 A;  1CQV A;  4XT3 B;  1KDB A;  2MPM A;  4IN3 A;  3NQI A;  5AFW A;  5A2Q L;  2MUY A;  1SYC A;  1HQM C;  1XX8 A;  5I9O A;  2BA1 A;  2F0O A;  5IGF A;  4A3B B;  4QIW B;  2NTT A;  2KVM A;  2R61 A;  1TT2 A;  5C0X J;  1EOT A;  3VR6 A;  1WTQ A;  3SR1 A;  2KEC A;  2A69 C;  3GV6 A;  3I72 A;  2JEB I;  3I73 A;  1VMP A;  2WAQ B;  1HUM A;  3OMG A;  4RCN A;  4A3G B;  1JIC A;  4DN4 M;  1BCP C;  3A8J E;  2HDM A;  4K8I A;  4F7X A;  4F87 A;  4HAE A;  3L9A X;  3T51 B;  1D6E C;  4G4K A;  3MA2 B;  5NUC A;  4K5W A;  5TSS A;  5M3M B;  4MN3 A;  3EJI A;  1B2T A;  3Q24 A;  1JE4 A;  1Q8I A;  5C0X H;  1II3 A;  3RD4 A;  2F0P A;  3VYR A;  4L6T B;  4OGQ C;  3BS1 A;  2B8F A;  4B08 A;  2FMM A;  3OMC A;  3T4A C;  1IKL A;  1YNN C;  5CC4 A;  2F0H A;  3D8G A;  2NN6 H;  4RKB A;  2WKC A;  3I4N B;  1U9R A;  5DM7 3;  2SDF A;  4PMC A;  1IW7 C;  2CHB D;  4B9X A;  1QIL A;  1D1K A;  2K33 A;  1RDP D;  5D14 A;  3SVM A;  1JB3 A;  1LTG D;  5EKI A;  3NPP A;  3IFD A;  3TBI B;  3M7N A;  3C1E A;  1TWG B;  4C3H G;  4NDX A;  1LT6 D;  4PNY A;  3U9S A;  2HQE A;  1WTP A;  3VA7 A;  4A3I B;  3VYT A;  2PW7 A;  2ZXO A;  3I4M B;  2Q8T A;  5JEA G;  2QIL A;  2RDF A;  3I70 A;  4DF7 A;  3K5M A;  1QCB D;  2R93 B;  1ZKO A;  4LK1 C;  1MSG A;  2F4I A;  3O13 A;  1U4P A;  1I4H A;  4CJ1 B;  5C44 B;  1EZ6 A;  1PLF A;  2Z8L A;  2F0T A;  2VUM B;  1PRT D;  4LJZ C;  2Q8R E;  2KQ3 A;  2DY8 A;  2EJM A;  5J39 A;  1KLU D;  2K32 A;  2L9H A;  1PTO B;  3IFT A;  4Q5V A;  1EY9 A;  2Q8I B;  3AB9 A;  1B44 D;  3R2I A;  4FO2 A;  2Z4I A;  1FD7 D;  4S3S A;  2F0W A;  3NBH A;  1LV9 A;  3SE0 A;  2PMZ B;  4TQU S;  5CBA E;  2ID0 A;  4BBS B;  5IOC A;  4C3I B;  1TS4 A;  3PMF A;  1HFG A;  1VMC A;  4MHE A;  5JPN C;  1G2S A;  3W2D A;  2EPB A;  1H9S B;  1EQV A;  3OIQ A;  3BG3 A;  1X32 A;  1SEB D;  3DEP A;  2L4N A;  2BCO A;  3V05 A;  1GJX A;  4F88 A;  4RWS C;  4H7B A;  1GOZ A;  5C4X B;  3MXN A;  3PUX A;  4FF2 A;  1D5Z C;  4C1N K;  1C4Q A;  1BXT A;  3H6M A;  3PUW A;  3PUY A;  4TSS A;  4ILW A;  1STG A;  3WOF A;  1HRJ A;  4IFD G;  2CW0 D;  1PFB A;  1EY0 A;  3VYS A;  2IX1 A;  1WVL A;  1S5E D;  1Y8P B;  4MIU A;  3EFX D;  4ID6 A;  4QB4 A;  4R9W A;  5KNC A;  1O78 A;  1STN A;  1AW7 A;  3FRP B;  1ZYR C;  4OO1 I;  1S5F D;  3A8I E;  4DNR B;  5ISR A;  1Z6H A;  3P20 A;  5ELC A;  4A3F B;  2JYO A;  3R8B A;  4C56 C;  2F0S A;  4OIK A;  3WDN A;  3TSS A;  4CGY B;  5JAV A;  1GUS A;  1H9J A;  1STY A;  1TWA B;  3E6Z X;  1U4M A;  1PTO H;  2H1E A;  5EBC A;  4IAL A;  2B2Y C;  2I07 B;  3TME A;  3E0J A;  4H13 C;  2RVL A;  3UI2 A;  3T16 A;  2KHS A;  2XRS D;  5FLX L;  1SJH D;  2A6E C;  2E76 C;  3A8K E;  1XXG A;  4CKE A;  4OIJ A;  2PCF B;  5FO9 B;  1UEA B;  3M7G A;  2PPB C;  1D5M C;  4X3U A;  3K5O A;  3K5N A;  3MHB A;  3NXW A;  3D4R A;  1JWU D;  5ELB A;  3GTJ B;  1WD0 A;  2RDH A;  4C3J B;  1RKN A;  4HED A;  1EYD A;  4QUF A;  1KLG D;  4ZK9 B;  2B2W C;  1U4L A;  3S17 B;  2K5Q A;  1WCM B;  1J8I A;  2CVR A;  3ERQ A;  1KAB A;  3I8Z A;  1CM9 A;  3NWT A;  1HUN A;  2N55 A;  3SEB A;  1QOH A;  2X6L A;  4BA2 I;  3SK6 A;  2HCI A;  5E1F A;  1LTA D;  3MVV A;  4HCS A;  2Z1C A;  2WAC A;  1HTL D;  5J22 A;  1VCI A;  2F3W A;  3HZX A;  1LLR D;  1CT1 D;  2EOT A;  4RH6 A;  5FK9 C;  5J1Z A;  3HOY B;  2O2L D;  2JA7 B;  2JA6 B;  2NVT B;  2B8G A;  2EDG A;  1I4P A;  2DY7 A;  4ZKB B;  3K7A B;  5C3W A;  2K5W A;  3CQZ B;  3FEW X;  2RQX A;  2YYZ A;  1PMR A;  2F0E A;  2VNU D;  4RKL A;  1SSO A;  1STB A;  3FKI B;  2NVQ B;  3FVQ A;  2K01 A;  1XWE A;  2K28 A;  2F0D A;  1XTC D;  1UNS A;  2A69 D;  4EQO A;  2XVS A;  3I90 A;  5A35 A;  2O5I C;  3HS0 C;  1MD2 D;  3BZD B;  5M5X B;  5E4W C;  5CBE E;  1STE A;  1BF4 A;  4ZLT F;  1BCP D;  1ENF A;  3OW7 A;  1B4O A;  4ZYS A;  4FYD A;  1EFI D;  3DUZ A;  1F77 A;  1KNE A;  1QJO A;  1U4R A;  5G3L D;  2K03 A;  4XYO A;  1SNP A;  2F0G A;  1CK1 A;  5C3E B;  1TS3 A;  1LTI D;  4KHZ A;  2G9D A;  3J7Y W;  2LS0 1;  1YNN D;  1Y69 U;  1DOM A;  4JK1 C;  1E2V A;  2A6H C;  2E74 C;  5C0X G;  2F03 A;  3PUV A;  4O1N A;  2AUJ D;  4RHR A;  2KED A;  4DXF A;  1IW7 D;  4GZY C;  2NUC A;  1PTO C;  5HUR A;  1GXD C;  1Q12 A;  3DWP A;  3SHL A;  3FPP A;  3F2U A;  4M8A A;  2NN6 G;  2B2T C;  5I2Y A;  1Y1W B;  2EYF A;  3RUZ A;  3IKJ A;  1PFN A;  2BOS A;  4HMI A;  1ENC A;  2AWN A;  2NVY B;  5IGC A;  2WIN B;  1KDC A;  1CHQ D;  1Q1B A;  1DZ1 A;  1S4Z A;  1W6J A;  3Q6S A;  5IIF A;  4DNT B;  1CZG A;  1FYC A;  2E75 C;  1SNQ A;  5K5P A;  4HN7 A;  1HCZ A;  1ENA A;  3NSW A;  2AUK A;  1D5X C;  1B53 A;  1ET9 A;  1V1P A;  2M9V A;  3TP7 A;  1CA5 A;  1EY4 A;  3ND9 A;  1I4R A;  5DNF A;  3X3M A;  4DK0 A;  3ONA B;  4DA2 A;  3Q0A A;  4E6I A;  2X69 A;  5LHY 1;  5LL6 X;  1FR3 A;  4ZUJ A;  1LT4 D;  3QIA A;  1SE3 A;  1R9T B;  4ZQ3 A;  2IT1 A;  1K83 B;  5BN4 A;  2BE5 D;  1NR2 A;  1HFN A;  1AP0 A;  2NBF A;  3LNN A;  2AWO A;  1F9S A;  2E2H B;  3C1F A;  3ZYY X;  2KCN A;  2FIN B;  3MXP A;  1RCV D;  1EZ8 A;  2WP8 J;  3S2D B;  3QO2 A;  4KK7 A;  4KY5 A;  5FOB B;  5T1G A;  4RFB A;  1LAB A;  2RDG A;  2R3Z A;  2C5C A;  3DWA A;  5EJW A;  4G7H C;  3ITP A;  3BVZ A;  4DFA A;  2OXP A;  1PXU A;  1Y8N B;  1L0X B;  2PZT A;  3SK5 A;  4BWG B;  1A3T A;  3A7A B;  2V4D A;  3KLS X;  4BY1 B;  1JCK B;  3K0Y A;  3JAM E;  1EY8 A;  2KUM A;  3TP6 A;  3GQB A;  2K5D A;  4HR7 B;  3Q22 A;  4C3H B;  3H94 A;  3NQT A;  2FFK B;  1I4Q A;  1TQO A;  1QNU A;  1EL0 A;  1PZI D;  1ZXT A;  4PMW A;  1CQF A;  3S15 B;  5C4Z A;  3NP8 A;  2IJ0 A;  2K6A A;  4KJO A;  5E4X A;  1HA6 A;  3GTG B;  1SYB A;  1A6X A;  1ZYR D;  1NSN S;  2L11 A;  4KTA A;  1X3Q A;  4I7Z C;  4NKL A;  4IUR A;  3EA6 A;  3TP8 A;  1ET6 A;  1F2L A;  3BYT B;  1H9K A;  3VR4 A;  5FKA C;  1RTN A;  3GTQ B;  2XNA C;  4ME5 A;  2LY7 A;  1K8M A;  2PZU A;  3PO3 B;  3J81 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...