2EYLA

Crystal structure of staphylococcal nuclease mutant t82s
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRSDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2eylA00
1IHZA 4KD4A 2EYFA 4B9XA 3TP8A 4PMBA 5HGTA 2NUCA 1NUCA 4EVOA 2F0SA 3D8GA 5IGGA 3QB3A 3NQTA 5IGBA 1EYCA 2PYKA 5IGCA 3BDCA 4NKLA 4QMGA 5KEEA 5JAVA 2M00A 3VA5A 1SYEA 4DF7A 3MHBA 1TR5A 3MEHA 4EQNA 5C3XA 5C4ZA 3NP8A 5CV7A 3TP7A 5I9PA 3NHHA 2F0LA 3NK9A 4KTAA 5F2DA 3SK6A 5KIXA 4QB4A 5J1ZA 2OF1A 2RBMA 5CV8A 4H7BA 2PW5A 5IGDA 2HQEA 4QF4A 1A2UA 2F0EA 2KHSA 1A2TA 4DFAA 4ME5A 2PZTA 4KY5A 1KAAA 2EXZA 4KJOA 1SNDA 5DAUA 1RKNA 3MVVA 4ZUJA 2KQ3A 4ID6A 5I6WA 5J39A 4KJNA 4WRDA 2F0MA 4KY6A 4NP5A 3V2TA 3EVQA 3H6MA 4ODGA 4EQOA 1F2YA 1JOQA 3ITPA 3QOJA 5IIFA 5EGTA 3T13A 1STGA 2LKVA 4ZQ3A 2F0UA 3OSOA 2F0KA 4YIJA 1KABA 3OMCA 3R3OA 4K2LA 2QDBA 4HTHA 2SNMA 1EY8A 2OXPA 2EYOA 2F0HA 5ISRA 3EROA 1STNA 4MIUA 3RUZA 2F0VA 3ERQA 2F0WA 4KY7A 1EYDA 2RKSA 5IOCA 1U9RA 4K14A 3TP5A 5IGEA 5KYLA 1SNMA 5C5MA 3P1HA 4E6IA 1SYCA 1EQVA 5K5PA 2F0TA 2F0OA 3SR1A 4R8NA 2F3VA 3BDLA 2EY5A 2EYLA 2PZUA 5IODA 2EYHA 3SK4A 3P75A 1JOOA 2ENBA 3DHQA 5KYIA 1F2MA 4K5WA 4N9TA 5JOBA 2RDFA 4DU9A 1SYGA 3LX0A 4IZ8A 4N9PA 2F0NA 3NUCA 5C3WA 2EY1A 4F8MA 3D6CA 3C1EA 5CV9A 1EY9A 1KDAA 1II3A 3OMGA 3U9OA 1STHA 4WORA 2F0JA 1EZ8A 2EYPA 1SYDA 1STYA 1SNOA 1EZ6A 1JOKA 3HZXA 1JORA 3MZ5A 4KV6A 4S3SA 3MXPA 5J22A 5CV6A 3T16A 5E1FA 1EY6A 4J6HA 1F2ZA 3SXHA 3TP6A 2F0FA 3HEJA 2F0DA 5EKKA 3SHLA 5EKLA 3DMUA 2PW7A 3TMEA 1A3VA 1STBA 4OL7A 5C6AA 4IUNA 1ENAA 2F0GA 4K8IA 3C1FA 3D4DA 3E5SA 3PMFA 1ENCA 1SYFA 2O4XA 2F3WA 2OEOA 4F7XA 5NUCA 2EY6A 4B9WA 3SK8A 1A3UA 2SNSA 4J1MA 3EJIA 1NSNS 1KDCA 4K2KA 1TQOA 3NXWA 5C4HA 3S9WA 1STAA 4K8JA 3OWFA 1SNQA 4I65A 4IALA 4LAAA 4RKLA 4K5XA 5CR3A 4ZUIA 4DGZA 5I9OA 2F0QA 2SOBA 2WACA 1EY5A 4K6DA 5CV5A 5I6YA 4TRDA 1EYAA 4NMZA 5KRUA 4KD3A 1EY0A 5M9OA 4K5VA 1SYBA 4HMJA 4PNYA 1SNPA 1TT2A 4NDXA 3D4WA 3QOLA 4RKBA 2PQEA 4PMCA 5CV4A 2F0PA 5C5LA 4KHVA 3SK5A 2EYMA 5KGUA 1KDBA 1SNCA 2EY2A 5IGFA 5CGKA 1AEXA 2F0IA 4HMIA 1A3TA 5HURA 5E3FA 2PZWA 1EY4A 2EYJA 5CC4A 4EQPA 1EY7A 5DEHA 4G57A
chains in the Genus database with same CATH superfamily
1VQHA 5FOBB 4XIGS 5EPKA 3VYTA 1DZ1A 2FXQA 3VYSA 2LS01 1QE6A 3C2PA 3HOUB 4JBJA 5LMNW 5C0XG 4UY8C 4R9WA 3S1RB 4B08A 3CMAA 3CAMA 1X65A 4CBVA 1H95A 1S5BD 1PTOD 4JI1L 4XXEA 4IUTA 2FFKB 4JI5L 4ZAIA 2IL8A 4OELB 4WRDA 1HA6A 4KY6A 2A68D 1KNEA 1MIUA 4LFBL 4J8QA 1VQFA 1F77A 5EGTA 1SMXA 3NTIA 2F4IA 4C3HB 1PYSB 1PRTB 1TWAB 2QDLA 4BXXG 1K83B 1LV9A 2EYOA 4IURA 4B3SL 3PUYA 4JI6Q 4MIUA 1TS2A 5CBEE 5GAGC 3A7LA 3WOFA 3MC0B 1BKBA 2F4VL 1XMOQ 2EYLA 3S24A 2DNCA 1HXYD 3NWSA 1N34L 3T1YL 2ENBA 2EOTA 1LT5D 4B3ML 4K5WA 1QZGA 4DR4L 4DU9A 4JG2A 4LF7L 5KNBA 3KLRA 5CV9A 1PTOH 3A54A 3HOVG 2E2HH 4TKOB 1CZGA 1NBWA 5J22A 2FMMA 2EIFA 1OXVA 1WTRA 4JI7Q 1B70B 4EQ5A 2I5MX 2A74C 4OL7A 3PO3G 5FLXE 1WJJA 2O4XA 1OXSC 1PFSA 1FYCA 1K8OA 4A4IA 5LMNQ 1UUPA 2B2UC 2VUMB 4WFN3 2O2LD 5JJKA 4K6DA 3GTQB 3GV3A 1SROA 3VA7A 5GAEC 2DGYA 5IY0A 4G7ZC 3SK5A 2EY2A 1I94Q 3AEVA 2KCMA 4BBRG 2JA5B 4ZLTF 2NN6H 3CQZB 1CA5A 1PDQA 2KEDA 1X3PA 4X64L 1O7IA 4DR2L 3PUWA 4GNXC 3L7ZC 1PLFA 3MEHA 4DV7Q 1ASZA 4DAVA 1OXTA 1SMYD 4P74A 2UUAL 1BR9A 2RBMA 1PH7A 2ZT9C 2KHSA 4ME5A 1H9SB 1RL2A 4LF6Q 3MVVA 3NBHA 2KQ3A 5FJ8H 1YJNA 1DXMA 4C2MH 1CQVA 3S14H 1B1ZA 1VQ5A 4WJWA 1IL8A 2ZM6Q 4L5SA 3S15B 1A62A 2BE5C 4HTHA 2IWHA 5I4DA 1HA5A 3B6YA 3RUZA 2JA8B 4WJ4A 4GN3B 4HJ7A 3FPPA 1TWCB 4UP7A 3QIAA 1V8QA 3SVMA 4HIDA 3HOVB 1FNWA 3S1NH 4IZ8A 1OXUA 2BCOA 1Q12A 2DJGC 4XQNA 4X65L 3DM3A 3JAME 4AQYL 5C0XJ 2WV6D 1G51A 1SJHD 3PO3B 1PYWD 1EZ6A 3HG9A 3M9BA 4POGA 3MXPA 1Y14B 4K0KL 2XVSA 4TQUS 5E4XA 3GTMH 1X54A 1Y1VH 3HEJA 5EKLA 2K7VA 1FGBD 1A3VA 3PIP3 1YNJC 4X66L 1LACA 3CKIB 2QKIC 1KLGD 4RCOA 3D6WA 4K2KA 3G48A 1H9RA 3H3VC 4LAAA 2A6HD 1CHQD 4A93H 4JI8Q 1A63A 4KLKA 2JE6I 1FR3A 3IFTA 2X69A 3NTHA 3RD4A 1YIJA 3I4NG 4QUFA 5ELNA 1Y8OB 5IP7H 1X55A 2EJFC 2K5WA 2E5LL 2NVTB 1AEXA 3F2BA 5E3FA 4CKCA 5M3MH 1XNQL 2B2VC 1WOCA 2EYFA 3K5MA 1EEID 3K5NA 1EU4A 1MBYA 1GHKA 5JJZA 1V9PA 2NZ1D 5IGCA 1GM5A 3AYHB 4XYOA 2SDFA 2KECA 3M4OH 3TP7A 3NK9A 4KTAA 1Z47A 2RCNA 1G6PA 5IWAL 5C44H 1F9PA 1BCPB 2ZTEA 1N32Q 2B63H 3DUZA 4DR5L 1RKNA 3AFQA 4ZUJA 5C0XI 3S2HH 2F1MA 2PPBC 2DNEA 3EA6A 3U4VA 4C1NI 1AN8A 4I7AA 2AWNA 1U4PA 2K28A 3IFDA 3VDYA 1HNZL 3J7AV 3GO5A 3HOYH 2UUBQ 2ICIA 1PH6A 5IGEA 5KYLA 4KK7A 4IPCA 5C5MA 2CKZB 1EQVA 3PUZA 1HNXL 4JI0L 5IP9H 3PF5A 4AH6A 3SK4A 2B8FA 1LABA 1B2TA 1L0YB 3KLWA 2GVAA 2Q8TA 4LFAL 4BY7B 4KKSA 4DV6Q 2IW3A 2I5LX 4LF8L 4GLAC 3PIO3 3G6JB 4R1JA 4DAMA 1KDAA 3OMGA 3FEWX 3SDZA 1MHWC 4HJ5A 4DK0A 3LWUA 4CJ0B 5E1FA 3CCQA 4UAIA 1HRJA 4KHPQ 5FJ8G 3D0FA 1I4PA 1MJEA 1DJRD 3CRKC 4OIKA 3W2DA 3BZKA 1WTHA 2R6GA 3S17B 2F3WA 2AQ1B 2OEOA 3CXCA 5ELBA 2FINB 1TWFH 5C4HA 4HN7A 4DGZA 2RDGA 3HKZB 3LWEA 1EUJA 5KRUA 1F9QA 3HKSA 1TT2A 3IRBA 2NVXB 1PTOB 2C9OA 4JI5Q 4FF2A 3DEPA 1BNZA 3N52A 4IPDA 2CCZA 1SRUA 1XMOL 1YNNC 2Z4IA 2E74C 2NUCA 1QILA 2XSCA 3WDNA 4DR3L 3CCSA 3K57A 5IGBA 5IYDG 2OQ0A 1R4PB 3BDCA 4H13C 2R93B 5EQ0A 1Y1VG 1JJGA 5CV7A 1I4QA 5I9PA 3HOZG 4FP5D 4JOIA 2F4VQ 4OGQC 4CDEC 2KJXA 4B3TQ 2L5TA 2D2CC 4JI7L 5FO9B 4DAYB 2JXMB 4DR4Q 4ID6A 4DR6Q 1LTGD 4C3HH 1YHQA 3KJOA 1TWAH 3ND9A 1JT8A 1S5ED 3F2UA 4ODGA 1BQQT 1ESFA 1WTOA 3QOJA 2L55A 3T13A 3RN2A 5IYBH 3OMCA 1LTID 4OX9L 1PZJD 2F0HA 3Q23A 1BCPC 1EL0A 1O80A 3A5UA 4K14A 5JJIA 2PI2A 2K52A 1ENFA 4E6IA 1DOKA 3D4RA 2ZJPA 4R8NA 4RAUC 2A6ED 2EYHA 1EYGA 5JVH3 3WWVA 2GVBA 2VB2X 1PH5A 4N9TA 2R3ZA 2ALYB 5EAYA 3UE0A 1J6QA 3KLSA 4WORA 2WFWA 2LMCB 5E7NA 4C2MB 3S14B 1EWHA 4JV5Q 2Q2HA 3BS1A 2HUGA 3T16A 2NWGA 1IBMQ 1MSGA 2R7FA 1ICWA 1JE4A 4DV7L 5FLXc 1WTQA 3TMEA 3M7GA 2F0GA 3D4DA 3PMFA 1PVOA 2NVQB 1IKLA 3FHWA 5LL6X 1A3UA 1HCZA 4LF6L 1L0WA 3KDFA 3FKIG 1STAA 5HGQA 2A73B 3VR5A 2KUMA 4AYBB 1ZKOA 4A3DG 1T5XD 2UUAQ 1NNXA 2ZM6L 1EIFA 3S1NB 5T1GA 5DM73 3PO2G 5DM63 2IPKD 4HJAA 4A3CG 1FNVA 1QZHA 4R8IA 1E7ZA 4JYAQ 4A3MB 4EQPA 1Q3LA 4A3JH 3E9HA 1NE3A 2PMZB 2FJ2A 4B9XA 1Y1VB 4LF5Q 1UE7A 4DAPA 2NZOA 1S3OA 1XPUA 3OOCA 5BN5A 3FP9A 1PTOC 2AUKA 1SEBD 3VR4A 3OYYA 2XIWA 4CDFC 3CCLA 2F0LA 2KHIA 2ZJQA 5FKAC 1N9WA 1BO0A 2IJ0A 1ML0D 4A93B 1HFNA 1HNWL 2A68C 2YV5A 3R2TA 4JW0A 4JI3L 4UPAA 2JA7H 2QCPX 2IY5B 2L0CA 2WP8J 3V05A 3J81E 3AQQA 3ICEA 2UXDQ 4BWGB 4XTCS 1K0SA 3UDGA 2PQAA 1DGSA 1TVXA 4AQYQ 2UU9Q 2Q2IA 2WIIB 1K3RA 3IL8A 5IE8A 2JA8H 1UEBA 1O7YA 5M3MB 3E6ZX 1C7YA 1EY8A 3OIQA 5GADC 5ISRA 2C5CA 3MFGA 4X66Q 2F3VA 1PMRA 3HS0C 3K5OA 2EY5A 3J7YW 1RTNA 3M4OB 1HZAA 2ZXPA 3I8ZA 5A2QE 3RZDH 2EVBA 1VMCA 5C44B 3CF5A 1SDFA 3RR5A 2B63B 1Y8NB 3O13A 2DY7A 3E0JA 1Y1WH 3S2HB 3AMUA 3QR8A 1I50H 3VYRA 4DPGA 1PHJA 1EU3A 1WVLA 5CV6A 4DNTB 1LT4D 3GQBA 4C3HG 4RCNA 3JAMi 3CHBD 1XNQQ 4HCEA 3HOYB 3PSIA 5H1SE 5IYBG 5G3LF 2HD3A 3I2ZA 1N32L 1KDCA 4ZRZA 1HJPA 1B44D 4O42A 1E3PA 3OWFA 3RLOA 3I4MH 2C35B 1HZBA 3FRPB 2VW9A 2NBFA 4BA2I 4TRDA 4NMZA 5IT9L 1Z9FA 1U0LA 4X3UA 3D4WA 1VQ8A 2BOSA 4YWMA 4FF1A 1A6XA 1NAPA 3HOWH 1C8CA 4XQQA 1E1OA 4MN3A 1GUOA 1SMYC 4C56C 5FLMG 2B29A 2XN9C 4ZKCB 3NQTA 1X32A 3GV6A 1YZ6A 2AMCB 4QMGA 1HNZQ 3U9SA 4FYDA 3S1MH 2JYOA 2HIXA 2CQAA 1KHIA 1V43A 2BDNA 1M90C 4OONA 2AKWB 1TWFB 4QB4A 4BY1H 2VUMG 4TSSA 1ZXTA 1TU2B 2E2JH 3C46A 4UP8A 4WJ3M 4ALPA 3W1BA 5JJLA 4HJ9A 5C3EB 4FVMA 4HCSA 1I6VC 1PZKD 3K0YA 1FL0A 4NB3A 1O78A 3OSOA 5CORA 3AFPA 2OTJA 5BR8L 5BN3A 2JA5G 4A3BH 1QCBD 1K8AC 1N33L 1QUQA 1RIPA 5HY6A 4YY3Q 4U68A 4XDXA 3AU7A 3ULLA 4A3JG 3K7AH 4BY7H 4DV0Q 1NMFA 2J4XA 2RQXA 3CCVA 4GOPB 1BCPF 1UEAB 3P7JA 4OO1G 5EKIA 1AE2A 4JPBW 1ZYRD 3C1EA 2BA1A 4Z9CB 2L12A 1E2ZA 1P8LA 5D65A 4IOCA 2Y0SB 1JOKA 4RGNA 4J15A 1ILQA 3S17H 1EQRA 2IHFA 4IFDI 1F2ZA 3J80E 2PW7A 3I7FA 1VQBA 2RF4A 2MPMA 5TSSA 4KHZA 4FF3A 4B3TL 2A6HC 5M5WH 1W6JA 2JA8G 4LUOA 1QVGA 4DR3Q 4J1MA 4HIOA 1TQOA 4DR6L 3OW7A 4JBKA 5JVG3 3I72A 3S16H 1I4XA 2NVXH 4G4KA 1HUMA 5BN4A 1GUNA 4LFCQ 3G4SA 1SYBA 4ABNA 1HUNA 2X6GA 2D62A 1CTMA 2KEEA 3DXJC 4PG3A 1K9MC 3NQIA 1GD7A 1L1OB 1U4RA 3EIVA 1AFPA 1RJTA 1Z7TA 1PXUA 3M4PA 2N3SA 5CC4A 4DV2L 1MD2D 2R93H 3G71A 1VDZA 1TWGH 1VQGA 2EJGC 3BVMA 4PMBA 1X9NA 1IKMA 2RSOA 2F0SA 3L0OA 2F3IA 4OX9Q 1IL2A 2I5HA 5KEEA 1QVFA 1QUQB 2CVRA 3G7LA 3T53B 1CM9A 4A75A 2CH4A 2IX0A 1RD9D 4PZ6A 3SK6A 1KRTA 3HOXH 3K5LA 4Y52H 4JV5L 1GXDC 4IUQA 5IGDA 2F0EA 1ET6A 1LT6D 3D3RA 1IBML 1UE5A 2EPBA 1I6HB 2XWBB 4CJ2C 5M3FH 2OCEA 3FMCA 3GTGH 4KJNA 1X3QA 3TBIB 3NWTA 1VQEA 3H6MA 3CMEA 1SLJA 2KENA 1I3QH 3JC66 2F0UA 1RODA 1C0AA 4A3JB 1WD1A 3GTPH 1WCMH 4ZYSA 3KYHC 3Q0AA 2VS1A 1SNMA 4CDDC 1G2SA 3CPFA 1TY0A 3LGJA 5D3IB 1EWCA 2JN4A 4R4CA 1NR4A 2JJQA 5JOBA 4JYAL 2JA7B 1E2WA 4LF5L 1CKMA 5CYUA 4R4TA 1D5XC 1NTGA 1SE3A 4RGTA 3R8BA 3X3NA 1G2TA 4GOPC 2IX1A 2V1CC 2WAQB 4BA1I 2NVQH 1U5KA 1IYUA 4P2CB 3DMUA 1QVCA 2CHBD 1HH2P 4CKBA 3EN2A 5C6AA 4DR1Q 4LF9L 1SYFA 2L11A 4RMFA 2SNSA 4R4OA 3UDIA 1PRTC 1XWEA 3A56A 4A3LH 2UXDL 1OTCA 3J7A5 4YWKA 4MHEA 1LM0A 2JP1A 2SOBA 3RZDB 1I4HA 1EY5A 2WACA 2UU9L 3ONAB 2K75A 4BY7G 4V190 4K5VA 4DK1A 1AZQA 2B2TA 2RHSB 1HNWQ 3NEMA 3K58A 4QIWB 4JI3Q 1K73C 4A3MH 2G9HD 1IBKL 4RFBA 4GKKQ 1HTPA 1Y1WB 1HHVA 1I50B 2NYZD 4LW1A 2B8GA 1IZ6A 1LTBD 1QJOA 1XPOA 4DFAA 4IJHA 2N78A 1D2BA 2EQSA 4PZ8A 4L8JA 2PYKA 1KRSA 3GD7A 1AW7A 1SYEA 1L1OC 3I4LA 3H3VI 1VQ6A 2I46A 1VCIA 2EZVA 3I4MB 1V1PA 3HKZG 3J81c 2OWOA 3KF8A 4KI0A 4NW2A 2N88A 5I6WA 2JA6H 1G6ZA 3F1ZA 3NBHB 1GKHA 3HKZE 2HCCA 1QNUA 3HOWB 1STGA 5M5XB 5D14A 1TY2A 2L15A 3J81i 5IYCH 2NVYH 2QDBA 2TMPA 1IYVA 2A6EC 1TIID 2CH4W 3CRLC 2Z9HA 1B9MA 1VQKA 2L4NA 5K5PA 1J5EL 3S1MB 2R93G 2JSOA 3BDLA 2MO0A 5IODA 3AB9A 2HCIA 1JOOA 2D5DA 1PFNA 3BYTB 1KL9A 1QOHA 4BY1B 3I91A 2RDFA 3MWYW 1AP0A 3NELA 2E2JB 2ZTCA 1GUGA 3D6CA 1FNUA 3U58A 1DYQA 3SE0A 4A3IH 1C48A 3R93A 1SXTA 2E2IB 4OO1I 5AJ3L 1SNOA 3VR2A 1GUWA 2EE1A 4OWXB 5M3FG 4A3BB 3CCUA 2QGQA 2NN6G 2K5DA 2K32A 1YBYA 5EBCA 2EY6A 1DOMA 1PH2A 1EOTA 3K7AB 2PNHA 3MXNA 1C9OA 3TDQA 3BG3A 4DNIA 1CA6A 3BU2A 2BH2A 3VYUA 3E0EA 2WINB 4JI4L 3STBD 1CKNA 1WCMG 1BBXC 1JE5A 2MGSA 3CCJA 4KD3A 4QQBX 3RZOB 3URYA 4HMJA 4PNYA 2Z8LA 1K28A 1YVCA 4HIKA 1X3FA 3MA2B 3TQYA 1A0IA 3PGZA 4YY3L 4G7OC 3M7NA 2IT1A 4C3JH 4L6TB 4EGVA 1IBLL 3A8IE 4DV0L 2K05A 3CPWA 5ELEA 3L3OC 5JEAH 5BR8Q 3E3XA 1DOLA 3M3YH 5M5WB 1N33Q 4L63B 1SE2A 3L9AX 4RGMA 4TVAB 3SEBA 5JAVA 1Q7YC 3J7AF 2VNUD 3Q8DA 1PH1A 1PZID 2IX3A 2HHHQ 1D6EC 1TXYA 3PIOA 1WTWA 1EEFD 3BJUA 5KIXA 1W3SA 5J1ZA 4AYBG 3S16B 1E1TA 5C3EH 5ELDA 2PW5A 2OQKA 1WYDA 1A2UA 1U4MA 3H0GH 2PZTA 4A3LG 2EXZA 1SNDA 1X56A 4AYBE 4CDCC 3T1HL 1F9RA 3HFZB 1F2YA 3E9IA 3UDXA 2CWPA 5I2XA 1Z6HA 3CCRA 2MO1A 2F0KA 4A3MG 1LYLA 1TWGB 1KC8C 3EQLC 1H9MA 4A3KH 2BDOA 3T56B 1EOVA 2MQHA 4LFCL 2CQOA 1XXGA 1S40A 5C4XH 2PMZE 2N8NA 2NB0A 3TZDA 4R4QA 1LTTD 1Q81C 2H1EA 3PQIA 3HOXB 3MXNB 4A93G 1VQ9A 1XNRL 2VZAA 4GLXA 4M1UB 1CKNB 2E2DC 2E75C 4NXMQ 1II3A 2TSSA 5M3FB 3KF6A 1G8ZD 3GTGB 2K04A 3S2DH 1NMGA 1SE8A 5IP7G 1HFGA 3I56A 3J80c 5KNCA 2XWJB 1I3QB 3TP6A 1G91A 3RLNA 5M3MG 3GTPB 4DV2Q 1YITA 4K8IA 4UHVA 4DK3C 1Y69U 1EQQA 1WCMB 4B9WA 2K14A 1VQJA 4ME3A 2M9VA 5IYCG 1EFWA 5EBDA 3J80i 3H94A 5I9OA 3A55A 2WKDA 4R4IA 1BOSA 2O5JC 1PRTF 4B3RL 5C44G 2WB1G 3I90A 2B63G 5KGUA 1SNCA 1CI3M 2F0IA 4Q5VA 3CC4A 5HURA 3H09A 2AUJD 1XTDA 4HIMA 3C3LA 4G57A 4X62L 1S4ZA 2RSNA 1CSPA 1PH4A 4C1NK 1UE6A 2I0QA 2L1BA 1HPCA 3QB3A 3HOYG 1ICFB 3VA5A 3M85A 1WFQA 1TR5A 3TSSA 1YI2A 3NP8A 4DV3Q 4C3IB 1I6HH 4MNOA 1Y8PB 3MEFA 1RF2D 5IP9G 3Q6SA 2UUCQ 4H7BA 2R7ZH 4MTNA 4QL5A 1D5MC 5FK9C 1AZPA 2G9DA 2L9HA 2OTLA 4DV5Q 1OO9B 2UXBQ 4DR1L 5I2YA 4NP5A 3V2TA 4P72A 4APVA 4EQOA 4A3EH 4BBSB 1VQDA 3KF6B 4G7HC 2FHTA 3S1QH 1KABA 1PFBA 1O7ZA 3GTJH 1T9HA 3W5OA 5EPJA 3UE1A 4KKUA 2F0VA 1R9TB 4N8FA 3TP5A 2VXWA 4LF9Q 3P1HA 3SR1A 1NY4A 1ZYRC 2LSSA 4GKKL 4UP9A 2FMCA 2R61A 2JA6B 2F52A 2QILA 1STHA 4FNFA 1CSQA 3ND8A 4QY7A 3T51B 2R92B 1EZ8A 5C3EG 1V1QA 1MI2A 3N6RA 1IBKQ 1M4VA 4BXXH 2HDLA 5C3XA 2B2WA 3GTLH 2D0PA 2NVYB 3E5SA 3K81C 1ENCA 3KLSX 1IW7D 4KN7C 1CQFA 5LMUL 3DLLA 3KDFB 2AQ3B 3DM1A 4LUZA 2WB1B 4ZUIA 1SN8A 2F03A 2NN6I 4QGUA 5ELCA 2Q8RE 1GUTA 2QA4A 3QOLA 4L5TA 4PMCA 5CV4A 4A3IB 4GNXA 1TWHH 1HZ9A 3KFUA 1S72A 1VQCA 2Y0SG 3NENA 3FVQA 1MGSA 4A3FH 5AFWA 4KD4A 2RHQB 1ASYA 1W6KA 1RHPA 5KNDA 3H15A 1AE3A 1QWYA 2SEBD 3T4AC 2Y0SE 4RGOS 4GKJQ 3D8GA 1VMPA 3OWEB 1EYCA 2VQEQ 1D8LA 1CUKA 4DF7A 1LTAD 5COYA 1J5EQ 1JWMD 1F9SA 2I07B 3OTOL 4IO9A 3RN5A 4DXGA 1SAPA 4QF4A 3ULPA 1A2TA 4KJOA 2VY3A 5M5XH 1MSHA 1B9NA 4BBRH 1KLUD 2J0TD 2PQAB 3TS0A 1JOQA 5IIFA 4JOIC 4C3JB 1K8GA 1J9OA 2LKVA 1HQMC 1LT3D 1S5FD 5AJ3Q 2K1BA 2KVMA 4DR7L 1GOZA 3GP7A 3BVGA 5IOCA 3RNUA 1SFOB 4KY7A 3TREA 1IYJB 3M3YB 1K0RA 1SYCA 3K7UC 4P73A 3MAQA 4ZK9B 3IAYA 1F2MA 1JB7A 4JI4Q 3MXGA 2E2IH 1HR0W 3NUCA 3H0GB 2XRSD 1EY9A 1BUVT 1Q8IA 1MJCA 4A3GB 4DUYL 3HRZC 3UDFA 4HSVA 2EYPA 2LY7A 2K5HA 1STYA 1XMQQ 2R7ZG 1JORA 3DWAA 4JI2Q 4YHHQ 1EY6A 4CKEA 2KOLA 5D3DA 2HHHL 3Q24A 2G5DA 1STBA 1TS4A 1IBLQ 2VB3X 1ENAA 3I55A 3NTKA 1ONLA 1WTPA 4A3KB 4DN4M 5FLXL 1NSNS 5C4XB 4LF4Q 3Q22A 3RZOH 2JEAI 3S9WA 5IT9E 4I65A 2K4KA 3A0JA 1YHAA 2B2VA 2P5ZX 2JA7G 3U4ZA 2PQEA 2YYZA 2F0PA 5JEAJ 1KIXA 3S2DB 2BA0A 1ZEQX 3T1HQ 2WAQG 5DEHA 5GAHC 2RVLA 2NZHA 2A69D 2HQLA 1C4QA 1DONA 3KBXA 3I70A 5C4JH 2H4OA 5IGGA 2YTYA 2KCCA 2GN5A 2WAQE 4MTKA 1PV4A 2MFIA 3R2IA 3MHBA 2K5QA 2B3GA 4NXML 3NHHA 2KHJA 5F2DA 2YTVA 1GJXA 2JEBI 2CW0D 3I4NH 4DV4Q 1P16A 1HR0Q 3K59A 3G6EA 1H9SA 5FO7B 1JQYD 3I4OA 1XNRQ 4LJZC 4FO2A 3A7AB 3NBIA 3HGBA 1VS0A 1BF4A 1Y1WG 5ELFA 1HZCA 3R3OA 4QIWE 1D5ZC 1LUZA 3M4YA 2SNMA 4PZ7A 1FD7D 1K8MA 3EROA 1KNAA 1D1KA 2V4DA 1STNA 2XNAC 3ERQA 2F0WA 1PTOF 4A3FG 3I73A 1EIYB 4PMWA 4HR7B 1WTVA 3P75A 1K3BC 3I4MG 5GQOA 4JVZA 2R7ZB 2F0NA 1JWSD 5C3WA 3CCEA 4RWSC 3U9OA 2B2WC 4B3RQ 5CBAE 2F0JA 5JPNC 2QW7A 4DUZL 1YJWA 4FXGC 3JAML 3PUXA 4A3EB 4PQXA 2JK8A 2XTIA 3HOWG 4J6HA 3S1QB 4DV3L 3GTJB 1X3GA 1GHJA 4X3SA 2HIVA 4X62Q 3STBC 2UUCL 2D0OA 5CMDA 3KK7A 1L2FA 3D31A 3I3CA 1MKHA 2VQFL 4DV5L 2UXBL 3F2DA 1E24A 1STEA 2F0QA 1VQLA 5M5YH 1FJGQ 1D1IA 4BY1G 5LL6S 1ET9A 2AHOB 2Z6BA 1Q86C 1LTRD 2MUYA 1LTSD 3IKJA 1JMCA 5C5LA 4KHVA 3CP0A 1W2BA 1BXTA 4EX5A 4CHTB 3PF4A 4DXFA 1WI5A 1H9JA 4HSPA 3J7ZC 3GTLB 2N49A 4A3BG 4C3IH 1B53A 4HEDA 2KCNA 1D7QA 4KN4C 4NKLA 4YCVA 1E2VA 4PV1C 2PNRC 3A8JE 3BYYB 4OIJA 2AWOA 1M8AA 3WOEA 4IUUA 4IUPA 4BBSH 5DAUA 1N36Q 1CT1D 2UXCQ 4GLVB 1RCVD 1TWHB 1VF7A 3EVQA 1VQ4A 2ASBA 2O5IC 1BDOA 1R9TH 2KCTA 4DK6C 1EIHA 3DEOA 4A3FB 5J3BA 1A8VA 2A5HA 1ESRA 5DNFA 4CGYB 3MXUA 2K5NA 5IYDH 4X3TA 4GS3A 1EYDA 4IPGA 4P75A 1PH8A 1GUSA 3BZCA 4F87A 3HOZH 3GTKH 1XYIA 1LO5D 2XRQD 5LMUQ 4IOAA 1VQAA 2ES2A 2H5XA 3DHQA 5KYIA 1UWVA 2R92H 4DV1Q 4N9PA 1JICA 4L5RC 4F8MA 1DM0B 3PIPA 2A1AA 2KA7A 1Q1EA 4GKJL 1U4LA 1SYDA 4BBRB 5E4WC 2VL6A 3DWQA 3HZXA 2VQEL 1GO3E 4KV6A 2MHVA 1Q82C 5GROA 3SXHA 3BZDB 3SHLA 2F0DA 5EKKA 3NSWA 4OWWB 4GZYC 2K33A 1YEZA 4NXNQ 4KKTA 1B50A 2ICEC 5L37A 1S5DD 4K8JA 5CR3A 1M1KC 4IALA 4RKLA 4K5XA 2HT1A 2QF7A 5I6YA 2LXKA 4IFDH 3RMHA 4IN3A 4Y7NH 3HOXG 3PUVA 4O1NA 3OTOQ 4NDXA 3NPPA 2K01A 4RKBA 3OHXC 4YCWA 4Q0FA 2EYMA 3NE5B 1KDBA 2YU9H 1OXXK 1A3TA 3QG1A 1EIGA 3QJYA 1SR3A 2RDHA 2Z6KA 4K6LA 5K36H 4OXPA 4BS9A 5JPMC 1VQIA 2ID0A 1QNKA 4DR7Q 3FKIH 3LNNA 4QJFA 4FXKC 3OW2A 2EJMA 2Q2TA 4A3DH 1JJ2A 1EQTA 3VR3A 2CFMA 4JK1C 1V1PB 1E0BA 1XMQL 2ZXOA 5CV8A 4JI2L 3KF8B 1RDPD 2HQEA 3CW2C 3PO2H 4YHHL 4KY5A 1AH9A 3TRZA 4A3CH 1X6OA 3PV0A 4DAYA 1IXRA 3MTSA 1PH9A 2F0MA 4DNRB 1B8AA 3CU7A 3ITPA 5EJWA 4IUVA 4DUYQ 1GVPA 1B7YB 1QG7A 2RA4A 4ZQ3A 1SFOH 3CD6A 4CJ1B 4LF4L 1PFMA 2OXPA 1B3QA 2A8VA 1UE1A 4RA8A 3FPUB 3ZJYC 5C4JB 1XJVA 1L0XB 1VQ7A 1JB3A 2BE5D 2F0TA 2F0OA 1KXLA 1YJ9A 4ULLA 2B2YA 1BVSA 1VF5C 1I4GA 4C3IG 3F2CA 4A3GH 3K8AA 2MNAA 4HJ8A 3I4NB 3LX0A 3GDEA 1HTLD 1A15A 2EY1A 4RHSA 2E8GA 4JBMA 2K6AA 1KQSA 1QB5D 4RH6A 1PRTD 3GTOH 4LNQA 2M2LA 3MZ5A 4JI1Q 4BBSG 4QCLA 3BDOA 1IW7C 4U673 2HDMA 2F0FA 4JI6L 2E2HB 3KJPA 4IUNA 3C1FA 4QUCA 4F88A 3HOUH 4DV4L 5NUCA 4LFBQ 1HR0L 3SK8A 5IT9c 4I7ZC 3S1RH 1DCZA 1SNQA 1YNJD 1N8RC 1LLRD 1KD1C 4XT3B 4B3SQ 1XTCD 2PI2E 1NR2A 1EYAA 3A74A 5DLQE 1EY0A 2KBNA 3PCOB 2GA4B 1PH3A 1CHPD 1CFMA 4FDBA 2JA6G 1N34Q 1VQNA 2K03A 3T1YQ 4RG1A 3L2PA 2R92G 5IGFA 4B3MQ 4HMIA 2QEXA 1DD2A 4LF7Q 5ELOA 1FGUA 1K83H 1BBUA 5HGTA 4A76A 1SBBB 3FDTA 4IQZA 1ILPA 5EPLA 1VQMA 1NUCA 2B2TC 1Q1BA 4H44C 4EVOA 3U50C 2MJ8A 5LMNL 3V96A 2EXDA 4OEMB 4EQNA 4ZCKA 4MZ9A 4OWTB 3QO2A 2Q8IB 1RTOA 1XPRA 2OF1A 4N8X1 3W1GA 5M5YB 2K50A 4XYQA 1KAAA 5T1IA 1I94L 1VQPA 2WB1E 1CK1A 3SGIA 4A3IG 4IFDG 3J81L 2Q2UA 3H3VH 4OHJA 4HAEA 2ZTDA 4JBWA 3ERSX 3TZUA 2E76C 4DUZQ 2K5VA 2B39A 5FLMH 2D9UA 1I5FA 3DWPA 2DJFC 4M8AA 4X3KA 1SSOA 1FJGL 1S5CD 1FVIA 1U9RA 1O7LA 4NPSA 4JC0A 2PZUA 2BH8A 2VUMH 3BVZA 5K36G 1NCVA 2VQFQ 3GTQH 2PCFB 1LTLA 4X64Q 2DN8A 4DKAC 4DR2Q 4H0LC 5A2QL 3VR6A 4LWCA 1KAWA 3J81j 3OIPA 3TS2A 3KOJA 4IPHA 4LUVA 1Q90A 4S3SA 2N55A 4ILWA 2JA5H 4C3JG 2R7DA 3CQZH 2LXJA 1JR0D 4GN5A 5C0XH 2J7ZA 1JCKB 1NJIC 1TS5A 1B4OA 1EFID 2NTSA 1WD0A 4XQJA 3K0XA 5JEAG 2AQ2B 2NTTA 3GTMB 1G291 2PO4A 5G3LD 2JA9A 1V1OA 2QEJC 3EJIA 3HOZB 1N36L 3X3MA 3GTKB 4OO1H 2DY8A 3KUPA 2UXCL 2ZXRA 4DA2A 4FF4A 1BBWA 3QWNA 1HQRD 3M4QA 3TEHB 3H0GG 2B2UA 4V0BA 3A8KE 2Z6KC 3CCMA 2A69C 4A3GG 3P20A 3MFYA 1SJED 2PZWA 3S15H 1EY4A 1PYBA 2RCFA 1IHZA 1JJCB 3TP8A 2MP1A 1X3EA 4X65Q 4O0AA 2Z4HA 3W3AA 4ZKBB 4AIMA 4X6AH 1E22A 4DV1L 1VQOA 1YNND 2CW0C 4A3KG 2M00A 1TWCH 4K0KQ 3TN2A 4YWLA 5C4ZA 4JI8L 1J8IA 3KBGA 4JCVE 5C4XG 4IJLA 5FO8B 3EFXD 3HOUG 3HOVH 3A5ZB 3K80C 3ER0A 5A35A 4Y7NB 2X6LA 1CKOA 1R4QB 2OT2A 1Q8KA 5J39A 3UI2A 1CZWA 3PO3H 3EBEA 3JAMc 2YU9B 1JWUD 4O2DA 4NXNL 3RLFA 1EWIA 4YIJA 4K2LA 3CC2A 3H91A 2B2YC 4YCUA 4GN4B 1XX8A 2E5LQ 2RKSA 4POFA 4H02A 1H9KA 1PA6A 4FXDA 3FKIB 2A19A 2YTXA 4GOPA 1UNSA 2LFNA 1BCPD 1TS3A 4A3DB 2DUDA 1SYGA 3PO2B 1WTXA 1Q46A 5LHY1 1KTKA 4RHRA 2NVTH 1I4RA 2WKCA 5IWAQ 3CC7A 4UDUC 2UUBL 4DR5Q 2ZJRA 1TKWB 3J80L 4F7XA 4IFDJ 1YHBA 4LMQD 1SE4A 4L5QA 3NXWA 2IHEA 4KMUC 4XT1B 3ZYYX 3K6OA 4DV6L 3ULJA 2JQOA 3OPOA 1B3AA 5CV5A 1JC7A 2Z0SA 2Z1CA 5M9OA 2CWAA 1UAPA 2XGTA 3F8TA 1SNPA 2EDGA 1HNXQ 4JI0Q 2ATWA 3HP3A 4LK1C 4GNXB 1L1OA 1F2LA 1T5EA 1YNXA 5CGKA 4KHPL 4LFAQ 3GTOB 4LF8Q 2EYJA 4A3EG 1EY7A 4P71A
chains in the Genus database with same CATH topology
5FOBB 4XIGS 5EPKA 3VYTA 1DZ1A 3VYSA 2LS01 1QE6A 3C2PA 3HOUB 5C0XG 4R9WA 3S1RB 4B08A 4CBVA 1S5BD 1PTOD 4XXEA 4IUTA 2FFKB 4ZAIA 2IL8A 4WRDA 1HA6A 4KY6A 2A68D 1KNEA 4J8QA 5EGTA 1F77A 3NTIA 2F4IA 4C3HB 1PRTB 1TWAB 1K83B 1LV9A 2EYOA 4IURA 3PUYA 4MIUA 1TS2A 5CBEE 3A7LA 3WOFA 3MC0B 2EYLA 2DNCA 1HXYD 3NWSA 2ENBA 2EOTA 1LT5D 4K5WA 4DU9A 5KNBA 3KLRA 5CV9A 1PTOH 3A54A 4TKOB 1CZGA 5J22A 2FMMA 1OXVA 1WTRA 2A74C 4OL7A 5FLXE 2O4XA 1OXSC 1FYCA 1K8OA 1UUPA 2B2UC 2VUMB 4WFN3 2O2LD 4K6DA 3GTQB 3GV3A 3VA7A 4G7ZC 3SK5A 2EY2A 2JA5B 4ZLTF 2NN6H 3CQZB 1CA5A 1PDQA 2KEDA 1X3PA 3PUWA 3L7ZC 1PLFA 3MEHA 4DAVA 1OXTA 1SMYD 1BR9A 2RBMA 2ZT9C 2KHSA 4ME5A 1H9SB 3MVVA 3NBHA 2KQ3A 1DXMA 1CQVA 1B1ZA 4WJWA 1IL8A 3S15B 2BE5C 4HTHA 2IWHA 5I4DA 1HA5A 3RUZA 2JA8B 3FPPA 1TWCB 3QIAA 1V8QA 3SVMA 3HOVB 1FNWA 4IZ8A 1OXUA 2BCOA 1Q12A 4XQNA 3JAME 5C0XJ 2WV6D 1SJHD 3PO3B 1PYWD 1EZ6A 3HG9A 3MXPA 2XVSA 4TQUS 5E4XA 3HEJA 5EKLA 2K7VA 1FGBD 1A3VA 3PIP3 1YNJC 1LACA 3CKIB 2QKIC 1KLGD 4RCOA 3D6WA 4K2KA 1H9RA 3H3VC 4LAAA 2A6HD 1CHQD 2JE6I 1FR3A 3IFTA 2X69A 3NTHA 3RD4A 4QUFA 1Y8OB 2EJFC 2K5WA 2NVTB 1AEXA 5E3FA 4CKCA 2B2VC 2EYFA 3K5MA 1EEID 3K5NA 1EU4A 1MBYA 1GHKA 5JJZA 2NZ1D 5IGCA 4XYOA 2SDFA 2KECA 3TP7A 3NK9A 4KTAA 1Z47A 1F9PA 1BCPB 3DUZA 1RKNA 4ZUJA 5C0XI 2F1MA 2PPBC 2DNEA 3EA6A 4C1NI 1AN8A 2AWNA 1U4PA 2K28A 3IFDA 3J7AV 3GO5A 2ICIA 5IGEA 5KYLA 4KK7A 5C5MA 1EQVA 3PUZA 3SK4A 2B8FA 1LABA 1B2TA 1L0YB 2Q8TA 4BY7B 4KKSA 2IW3A 3PIO3 3G6JB 1KDAA 3OMGA 3FEWX 3SDZA 4DK0A 3LWUA 4CJ0B 5E1FA 1HRJA 4UAIA 1I4PA 1DJRD 3CRKC 4OIKA 3W2DA 2R6GA 3S17B 2F3WA 2AQ1B 2OEOA 5ELBA 2FINB 5C4HA 4HN7A 4DGZA 2RDGA 3HKZB 3LWEA 5KRUA 1F9QA 1TT2A 2NVXB 1PTOB 2C9OA 4FF2A 3DEPA 1BNZA 3N52A 1YNNC 2Z4IA 2E74C 2NUCA 1QILA 2XSCA 3WDNA 3K57A 5IGBA 1R4PB 3BDCA 4H13C 2R93B 5EQ0A 5CV7A 1I4QA 5I9PA 4FP5D 4OGQC 2KJXA 2L5TA 2D2CC 5FO9B 2JXMB 4ID6A 1LTGD 3ND9A 1S5ED 3F2UA 4ODGA 1BQQT 1ESFA 1WTOA 3QOJA 2L55A 3T13A 3OMCA 1LTID 1PZJD 2F0HA 3Q23A 1BCPC 1EL0A 1O80A 4K14A 1ENFA 4E6IA 1DOKA 3D4RA 4R8NA 4RAUC 2A6ED 2EYHA 5JVH3 2VB2X 4N9TA 2R3ZA 3KLSA 4WORA 2LMCB 4C2MB 3S14B 1EWHA 3BS1A 2HUGA 3T16A 2NWGA 1MSGA 1ICWA 1JE4A 1WTQA 3TMEA 3M7GA 2F0GA 3D4DA 3PMFA 2NVQB 1IKLA 5LL6X 1A3UA 1HCZA 1STAA 2A73B 3VR5A 2KUMA 4AYBB 1ZKOA 1T5XD 3S1NB 5T1GA 5DM73 5DM63 2IPKD 1FNVA 4R8IA 4A3MB 4EQPA 1Q3LA 2PMZB 2FJ2A 4B9XA 1Y1VB 4DAPA 3OOCA 5BN5A 1PTOC 2AUKA 1SEBD 3VR4A 2XIWA 2F0LA 5FKAC 1BO0A 2IJ0A 1ML0D 4A93B 1HFNA 2A68C 3R2TA 2QCPX 2L0CA 2WP8J 3V05A 3J81E 4BWGB 4XTCS 1TVXA 2WIIB 3IL8A 1O7YA 5M3MB 3E6ZX 1EY8A 3OIQA 5ISRA 2C5CA 3MFGA 2F3VA 1PMRA 3HS0C 3K5OA 2EY5A 3J7YW 1RTNA 3M4OB 3I8ZA 2ZXPA 5A2QE 2EVBA 1VMCA 5C44B 1SDFA 2B63B 1Y8NB 3O13A 2DY7A 3E0JA 3S2HB 3AMUA 3VYRA 1EU3A 1WVLA 5CV6A 4DNTB 1LT4D 3GQBA 4C3HG 4RCNA 3CHBD 4HCEA 3HOYB 5G3LF 1KDCA 4ZRZA 1B44D 4O42A 3OWFA 3FRPB 2NBFA 4BA2I 4TRDA 4NMZA 5IT9L 4X3UA 3D4WA 2BOSA 4FF1A 1A6XA 1NAPA 1C8CA 4XQQA 4MN3A 1GUOA 1SMYC 4C56C 2XN9C 4ZKCB 3NQTA 1X32A 3GV6A 4FYDA 4QMGA 3U9SA 2JYOA 2CQAA 1V43A 2BDNA 1TWFB 4QB4A 4TSSA 1ZXTA 1TU2B 3C46A 5C3EB 4FVMA 4HCSA 1I6VC 1PZKD 3K0YA 1O78A 3OSOA 5CORA 5BN3A 1QCBD 4U68A 4XDXA 3AU7A 2J4XA 2RQXA 1BCPF 1UEAB 3P7JA 4OO1G 5EKIA 1ZYRD 3C1EA 2BA1A 4Z9CB 2L12A 1E2ZA 5D65A 2Y0SB 1JOKA 4RGNA 1ILQA 4IFDI 1F2ZA 3J80E 2PW7A 2MPMA 5TSSA 4KHZA 4FF3A 2A6HC 1W6JA 4J1MA 1TQOA 3OW7A 5JVG3 3I72A 1I4XA 4G4KA 1HUMA 5BN4A 1GUNA 1SYBA 4ABNA 1HUNA 2X6GA 2D62A 1CTMA 2KEEA 3DXJC 3NQIA 1U4RA 1AFPA 1RJTA 1Z7TA 1PXUA 5CC4A 1MD2D 1VDZA 2EJGC 3BVMA 1IKMA 4PMBA 2RSOA 2F0SA 5KEEA 2CVRA 3G7LA 3T53B 1CM9A 2IX0A 1RD9D 3SK6A 3K5LA 1GXDC 4IUQA 5IGDA 2F0EA 1ET6A 1LT6D 3D3RA 2EPBA 1I6HB 2XWBB 4CJ2C 3FMCA 4KJNA 1X3QA 3TBIB 3NWTA 3H6MA 2F0UA 1RODA 4A3JB 1WD1A 4ZYSA 3Q0AA 1SNMA 1G2SA 1TY0A 5D3IB 1EWCA 1NR4A 5JOBA 2JA7B 1E2WA 5CYUA 1D5XC 1SE3A 4RGTA 3R8BA 3X3NA 1G2TA 2IX1A 4BA1I 2WAQB 1IYUA 4P2CB 3DMUA 2CHBD 4CKBA 5C6AA 1SYFA 2L11A 2SNSA 1PRTC 1XWEA 3A56A 4MHEA 2JP1A 2SOBA 3RZDB 1I4HA 1EY5A 2WACA 3ONAB 4V190 4K5VA 4DK1A 1AZQA 2B2TA 3K58A 4QIWB 2G9HD 4RFBA 1HTPA 1Y1WB 1HHVA 1I50B 2NYZD 2B8GA 1LTBD 1QJOA 4DFAA 1D2BA 4L8JA 2PYKA 3GD7A 1AW7A 1SYEA 3I4LA 2I46A 1VCIA 2EZVA 3I4MB 1V1PA 3KF8A 4KI0A 4NW2A 2N88A 5I6WA 1G6ZA 2HCCA 1QNUA 3HOWB 1STGA 5M5XB 5D14A 1TY2A 2QDBA 2TMPA 1IYVA 2A6EC 1TIID 3CRLC 1B9MA 2L4NA 5K5PA 3S1MB 2JSOA 3BDLA 5IODA 3AB9A 2HCIA 1JOOA 2D5DA 1PFNA 3BYTB 1QOHA 4BY1B 3I91A 2RDFA 3MWYW 1AP0A 2E2JB 1GUGA 3D6CA 1FNUA 1DYQA 3SE0A 1C48A 3R93A 1SXTA 2E2IB 4OO1I 1SNOA 3VR2A 1GUWA 2EE1A 4A3BB 2NN6G 2K5DA 2K32A 5EBCA 2EY6A 1DOMA 1EOTA 3K7AB 3TDQA 3MXNA 3BG3A 1CA6A 3VYUA 2WINB 1BBXC 2MGSA 4KD3A 3RZOB 3URYA 4HMJA 4PNYA 2Z8LA 3MA2B 4G7OC 3M7NA 2IT1A 4L6TB 4EGVA 3A8IE 2K05A 5ELEA 3L3OC 5JEAH 1DOLA 5M5WB 4L63B 1SE2A 3L9AX 4RGMA 3SEBA 5JAVA 3J7AF 2VNUD 1PZID 2IX3A 1D6EC 1WTWA 1EEFD 5KIXA 5J1ZA 3S16B 5ELDA 2PW5A 1A2UA 1U4MA 2PZTA 2EXZA 1SNDA 1F9RA 1F2YA 5I2XA 1Z6HA 2F0KA 1TWGB 3EQLC 1H9MA 2BDOA 3T56B 1XXGA 2NB0A 3TZDA 1LTTD 2H1EA 3HOXB 4M1UB 2E2DC 2E75C 1II3A 2TSSA 5M3FB 1G8ZD 3GTGB 2K04A 1HFGA 5KNCA 2XWJB 1I3QB 3TP6A 1G91A 3GTPB 4K8IA 1Y69U 1WCMB 4B9WA 2M9VA 5EBDA 3H94A 5I9OA 3A55A 2WKDA 1BOSA 2O5JC 1PRTF 3I90A 5KGUA 1SNCA 1CI3M 2F0IA 4Q5VA 5HURA 3H09A 2AUJD 3C3LA 4G57A 1S4ZA 2RSNA 4C1NK 2L1BA 1HPCA 3QB3A 3VA5A 3M85A 3TSSA 1TR5A 3NP8A 4C3IB 1Y8PB 1RF2D 3Q6SA 4H7BA 1D5MC 5FK9C 1AZPA 2G9DA 2L9HA 1OO9B 5I2YA 4NP5A 3V2TA 4EQOA 4BBSB 4G7HC 2FHTA 1KABA 1PFBA 1O7ZA 5EPJA 4KKUA 2F0VA 1R9TB 3TP5A 2VXWA 3P1HA 3SR1A 1ZYRC 2FMCA 2R61A 2JA6B 2QILA 1STHA 4FNFA 3ND8A 2R92B 3T51B 1EZ8A 1MI2A 3N6RA 1M4VA 2HDLA 5C3XA 2B2WA 2NVYB 3E5SA 1ENCA 3KLSX 1IW7D 4KN7C 1CQFA 2AQ3B 3DM1A 2WB1B 4ZUIA 2F03A 2NN6I 5ELCA 2Q8RE 1GUTA 3QOLA 4PMCA 5CV4A 4A3IB 3FVQA 1MGSA 5AFWA 4KD4A 1W6KA 1RHPA 5KNDA 1QWYA 3T4AC 2SEBD 4RGOS 3D8GA 1VMPA 3OWEB 1EYCA 4DF7A 1LTAD 5COYA 1JWMD 1F9SA 2I07B 4DXGA 1SAPA 4QF4A 1A2TA 4KJOA 1MSHA 1B9NA 1KLUD 2J0TD 1JOQA 5IIFA 4C3JB 1J9OA 2LKVA 1HQMC 1LT3D 1S5FD 2K1BA 2KVMA 1GOZA 3GP7A 3BVGA 5IOCA 1SFOB 4KY7A 3M3YB 1SYCA 3MAQA 4ZK9B 3IAYA 1F2MA 3MXGA 3NUCA 3H0GB 2XRSD 1EY9A 1BUVT 1Q8IA 4A3GB 3HRZC 4HSVA 2EYPA 2LY7A 1STYA 1JORA 3DWAA 1EY6A 4CKEA 2KOLA 5D3DA 3Q24A 1STBA 1TS4A 2VB3X 1ENAA 3NTKA 1ONLA 1WTPA 4A3KB 4DN4M 5FLXL 1NSNS 5C4XB 3Q22A 2JEAI 3S9WA 5IT9E 4I65A 2B2VA 2PQEA 2YYZA 2F0PA 5JEAJ 3S2DB 2BA0A 1ZEQX 5DEHA 2RVLA 2A69D 1DONA 1C4QA 3KBXA 3I70A 2H4OA 5IGGA 2KCCA 3R2IA 3MHBA 2K5QA 3NHHA 5F2DA 1GJXA 2JEBI 2CW0D 3K59A 1H9SA 5FO7B 1JQYD 4LJZC 4FO2A 3A7AB 3NBIA 3HGBA 1BF4A 5ELFA 3R3OA 1D5ZC 3M4YA 2SNMA 1FD7D 1K8MA 3EROA 1KNAA 1D1KA 2V4DA 1STNA 2XNAC 3ERQA 2F0WA 1PTOF 3I73A 4PMWA 4HR7B 1WTVA 3P75A 2R7ZB 2F0NA 1JWSD 5C3WA 4RWSC 3U9OA 2B2WC 5CBAE 2F0JA 5JPNC 4FXGC 3JAML 3PUXA 4A3EB 4PQXA 4J6HA 3S1QB 3GTJB 1GHJA 4X3SA 5CMDA 3KK7A 3D31A 3I3CA 1STEA 2F0QA 1D1IA 5LL6S 1ET9A 1LTRD 2MUYA 1LTSD 3IKJA 5C5LA 4KHVA 1BXTA 4CHTB 4DXFA 1H9JA 4HSPA 3GTLB 1B53A 4HEDA 2KCNA 4KN4C 4NKLA 1E2VA 4PV1C 2PNRC 3A8JE 3BYYB 4OIJA 2AWOA 1M8AA 3WOEA 4IUUA 4IUPA 5DAUA 1CT1D 1RCVD 1TWHB 1VF7A 3EVQA 2O5IC 1BDOA 1EIHA 3DEOA 4A3FB 2A5HA 5DNFA 1ESRA 4CGYB 3MXUA 4X3TA 1EYDA 1GUSA 4F87A 1XYIA 1LO5D 2XRQD 3DHQA 5KYIA 4N9PA 1JICA 4F8MA 1DM0B 2KA7A 1Q1EA 1U4LA 1SYDA 4BBRB 5E4WC 3DWQA 3HZXA 4KV6A 2MHVA 3SXHA 3BZDB 3SHLA 2F0DA 5EKKA 3NSWA 4GZYC 2K33A 4KKTA 1B50A 2ICEC 1S5DD 4K8JA 5CR3A 4IALA 4RKLA 4K5XA 2QF7A 5I6YA 4IFDH 3RMHA 4IN3A 3PUVA 4O1NA 4NDXA 3NPPA 2K01A 4RKBA 3OHXC 4Q0FA 2EYMA 3NE5B 1KDBA 1OXXK 1A3TA 3QG1A 1EIGA 3QJYA 2RDHA 4K6LA 5K36H 4BS9A 5JPMC 2ID0A 1QNKA 3LNNA 4FXKC 2EJMA 1EQTA 3VR3A 4JK1C 1V1PB 1E0BA 2ZXOA 5CV8A 1RDPD 2HQEA 4KY5A 3PV0A 4DAYA 3MTSA 2F0MA 4DNRB 3CU7A 3ITPA 5EJWA 4IUVA 1QG7A 2RA4A 4ZQ3A 4CJ1B 1PFMA 2OXPA 4RA8A 3FPUB 5C4JB 1L0XB 1JB3A 2BE5D 2F0TA 2F0OA 4ULLA 2B2YA 1VF5C 1I4GA 4C3IG 3I4NB 3LX0A 1HTLD 1A15A 2EY1A 4RHSA 2K6AA 1QB5D 4RH6A 1PRTD 2M2LA 3MZ5A 4QCLA 3BDOA 1IW7C 4U673 2HDMA 2F0FA 2E2HB 4IUNA 3C1FA 4QUCA 4F88A 5NUCA 3SK8A 4I7ZC 1DCZA 1SNQA 1YNJD 1LLRD 4XT3B 1XTCD 1NR2A 1EYAA 1EY0A 2GA4B 1CHPD 1CFMA 2K03A 5IGFA 4HMIA 1DD2A 5HGTA 1SBBB 3FDTA 4IQZA 1ILPA 5EPLA 1NUCA 2B2TC 1Q1BA 4H44C 4EVOA 2MJ8A 3V96A 4EQNA 3QO2A 2Q8IB 1RTOA 2OF1A 5M5YB 4XYQA 1KAAA 5T1IA 1CK1A 4IFDG 3J81L 4OHJA 4HAEA 4JBWA 3TZUA 2E76C 2B39A 2D9UA 3DWPA 4M8AA 4X3KA 1SSOA 1S5CD 1U9RA 1O7LA 2PZUA 3BVZA 5K36G 1NCVA 2PCFB 2DN8A 4H0LC 5A2QL 3VR6A 3OIPA 1Q90A 4S3SA 2N55A 4ILWA 4C3JG 1JR0D 5C0XH 2J7ZA 1JCKB 1TS5A 1B4OA 1EFID 2NTSA 1WD0A 4XQJA 5JEAG 2AQ2B 2NTTA 3GTMB 1G291 2PO4A 5G3LD 1V1OA 2QEJC 3EJIA 3HOZB 3X3MA 3GTKB 4OO1H 2DY8A 3KUPA 2ZXRA 4DA2A 4FF4A 3QWNA 1HQRD 2B2UA 4V0BA 3A8KE 2A69C 3P20A 3MFYA 1SJED 2PZWA 1EY4A 1IHZA 3TP8A 2MP1A 2Z4HA 3W3AA 4ZKBB 1YNND 2CW0C 2M00A 3TN2A 5C4ZA 1J8IA 3KBGA 5FO8B 3EFXD 5A35A 4Y7NB 2X6LA 1R4QB 2OT2A 5J39A 3UI2A 1CZWA 2YU9B 1JWUD 3RLFA 4YIJA 4K2LA 3H91A 2B2YC 1XX8A 2RKSA 1H9KA 4FXDA 3FKIB 1UNSA 2LFNA 1BCPD 1TS3A 4A3DB 1SYGA 3PO2B 1WTXA 5LHY1 1KTKA 4RHRA 1I4RA 2WKCA 4UDUC 1TKWB 3J80L 4F7XA 4IFDJ 4LMQD 1SE4A 3NXWA 4KMUC 4XT1B 3ZYYX 3K6OA 3OPOA 1B3AA 5CV5A 1JC7A 2Z1CA 5M9OA 1UAPA 1SNPA 2EDGA 3HP3A 4LK1C 1F2LA 1T5EA 5CGKA 3GTOB 2EYJA 1EY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IHZ A;  4KD4 A;  2EYF A;  4B9X A;  3TP8 A;  4PMB A;  5HGT A;  2NUC A;  1NUC A;  4EVO A;  2F0S A;  3D8G A;  5IGG A;  3QB3 A;  3NQT A;  5IGB A;  1EYC A;  2PYK A;  5IGC A;  3BDC A;  4NKL A;  4QMG A;  5KEE A;  5JAV A;  2M00 A;  3VA5 A;  1SYE A;  4DF7 A;  3MHB A;  1TR5 A;  3MEH A;  4EQN A;  5C3X A;  5C4Z A;  3NP8 A;  5CV7 A;  3TP7 A;  5I9P A;  3NHH A;  2F0L A;  3NK9 A;  4KTA A;  5F2D A;  3SK6 A;  5KIX A;  4QB4 A;  5J1Z A;  2OF1 A;  2RBM A;  5CV8 A;  4H7B A;  2PW5 A;  5IGD A;  2HQE A;  4QF4 A;  1A2U A;  2F0E A;  2KHS A;  1A2T A;  4DFA A;  4ME5 A;  2PZT A;  4KY5 A;  1KAA A;  2EXZ A;  4KJO A;  1SND A;  5DAU A;  1RKN A;  3MVV A;  4ZUJ A;  2KQ3 A;  4ID6 A;  5I6W A;  5J39 A;  4KJN A;  4WRD A;  2F0M A;  4KY6 A;  4NP5 A;  3V2T A;  3EVQ A;  3H6M A;  4ODG A;  4EQO A;  1F2Y A;  1JOQ A;  3ITP A;  3QOJ A;  5IIF A;  5EGT A;  3T13 A;  1STG A;  2LKV A;  4ZQ3 A;  2F0U A;  3OSO A;  2F0K A;  4YIJ A;  1KAB A;  3OMC A;  3R3O A;  4K2L A;  2QDB A;  4HTH A;  2SNM A;  1EY8 A;  2OXP A;  2EYO A;  2F0H A;  5ISR A;  3ERO A;  1STN A;  4MIU A;  3RUZ A;  2F0V A;  3ERQ A;  2F0W A;  4KY7 A;  1EYD A;  2RKS A;  5IOC A;  1U9R A;  4K14 A;  3TP5 A;  5IGE A;  5KYL A;  1SNM A;  5C5M A;  3P1H A;  4E6I A;  1SYC A;  1EQV A;  5K5P A;  2F0T A;  2F0O A;  3SR1 A;  4R8N A;  2F3V A;  3BDL A;  2EY5 A;  2EYL A;  2PZU A;  5IOD A;  2EYH A;  3SK4 A;  3P75 A;  1JOO A;  2ENB A;  3DHQ A;  5KYI A;  1F2M A;  4K5W A;  4N9T A;  5JOB A;  2RDF A;  4DU9 A;  1SYG A;  3LX0 A;  4IZ8 A;  4N9P A;  2F0N A;  3NUC A;  5C3W A;  2EY1 A;  4F8M A;  3D6C A;  3C1E A;  5CV9 A;  1EY9 A;  1KDA A;  1II3 A;  3OMG A;  3U9O A;  1STH A;  4WOR A;  2F0J A;  1EZ8 A;  2EYP A;  1SYD A;  1STY A;  1SNO A;  1EZ6 A;  1JOK A;  3HZX A;  1JOR A;  3MZ5 A;  4KV6 A;  4S3S A;  3MXP A;  5J22 A;  5CV6 A;  3T16 A;  5E1F A;  1EY6 A;  4J6H A;  1F2Z A;  3SXH A;  3TP6 A;  2F0F A;  3HEJ A;  2F0D A;  5EKK A;  3SHL A;  5EKL A;  3DMU A;  2PW7 A;  3TME A;  1A3V A;  1STB A;  4OL7 A;  5C6A A;  4IUN A;  1ENA A;  2F0G A;  4K8I A;  3C1F A;  3D4D A;  3E5S A;  3PMF A;  1ENC A;  1SYF A;  2O4X A;  2F3W A;  2OEO A;  4F7X A;  5NUC A;  2EY6 A;  4B9W A;  3SK8 A;  1A3U A;  2SNS A;  4J1M A;  3EJI A;  1NSN S;  1KDC A;  4K2K A;  1TQO A;  3NXW A;  5C4H A;  3S9W A;  1STA A;  4K8J A;  3OWF A;  1SNQ A;  4I65 A;  4IAL A;  4LAA A;  4RKL A;  4K5X A;  5CR3 A;  4ZUI A;  4DGZ A;  5I9O A;  2F0Q A;  2SOB A;  2WAC A;  1EY5 A;  4K6D A;  5CV5 A;  5I6Y A;  4TRD A;  1EYA A;  4NMZ A;  5KRU A;  4KD3 A;  1EY0 A;  5M9O A;  4K5V A;  1SYB A;  4HMJ A;  4PNY A;  1SNP A;  1TT2 A;  4NDX A;  3D4W A;  3QOL A;  4RKB A;  2PQE A;  4PMC A;  5CV4 A;  2F0P A;  5C5L A;  4KHV A;  3SK5 A;  2EYM A;  5KGU A;  1KDB A;  1SNC A;  2EY2 A;  5IGF A;  5CGK A;  1AEX A;  2F0I A;  4HMI A;  1A3T A;  5HUR A;  5E3F A;  2PZW A;  1EY4 A;  2EYJ A;  5CC4 A;  4EQP A;  1EY7 A;  5DEH A;  4G57 A; 
#chains in the Genus database with same CATH topology
 1VQH A;  5FOB B;  4XIG S;  5EPK A;  3VYT A;  1DZ1 A;  2FXQ A;  3VYS A;  2LS0 1;  1QE6 A;  3C2P A;  3HOU B;  4JBJ A;  5LMN W;  5C0X G;  4UY8 C;  4R9W A;  3S1R B;  4B08 A;  3CMA A;  3CAM A;  1X65 A;  4CBV A;  1H95 A;  1S5B D;  1PTO D;  4JI1 L;  4XXE A;  4IUT A;  2FFK B;  4JI5 L;  4ZAI A;  2IL8 A;  4OEL B;  4WRD A;  1HA6 A;  4KY6 A;  2A68 D;  1KNE A;  1MIU A;  4LFB L;  4J8Q A;  1VQF A;  1F77 A;  5EGT A;  1SMX A;  3NTI A;  2F4I A;  4C3H B;  1PYS B;  1PRT B;  1TWA B;  2QDL A;  4BXX G;  1K83 B;  1LV9 A;  2EYO A;  4IUR A;  4B3S L;  3PUY A;  4JI6 Q;  4MIU A;  1TS2 A;  5CBE E;  5GAG C;  3A7L A;  3WOF A;  3MC0 B;  1BKB A;  2F4V L;  1XMO Q;  2EYL A;  3S24 A;  2DNC A;  1HXY D;  3NWS A;  1N34 L;  3T1Y L;  2ENB A;  2EOT A;  1LT5 D;  4B3M L;  4K5W A;  1QZG A;  4DR4 L;  4DU9 A;  4JG2 A;  4LF7 L;  5KNB A;  3KLR A;  5CV9 A;  1PTO H;  3A54 A;  3HOV G;  2E2H H;  4TKO B;  1CZG A;  1NBW A;  5J22 A;  2FMM A;  2EIF A;  1OXV A;  1WTR A;  4JI7 Q;  1B70 B;  4EQ5 A;  2I5M X;  2A74 C;  4OL7 A;  3PO3 G;  5FLX E;  1WJJ A;  2O4X A;  1OXS C;  1PFS A;  1FYC A;  1K8O A;  4A4I A;  5LMN Q;  1UUP A;  2B2U C;  2VUM B;  4WFN 3;  2O2L D;  5JJK A;  4K6D A;  3GTQ B;  3GV3 A;  1SRO A;  3VA7 A;  5GAE C;  2DGY A;  5IY0 A;  4G7Z C;  3SK5 A;  2EY2 A;  1I94 Q;  3AEV A;  2KCM A;  4BBR G;  2JA5 B;  4ZLT F;  2NN6 H;  3CQZ B;  1CA5 A;  1PDQ A;  2KED A;  1X3P A;  4X64 L;  1O7I A;  4DR2 L;  3PUW A;  4GNX C;  3L7Z C;  1PLF A;  3MEH A;  4DV7 Q;  1ASZ A;  4DAV A;  1OXT A;  1SMY D;  4P74 A;  2UUA L;  1BR9 A;  2RBM A;  1PH7 A;  2ZT9 C;  2KHS A;  4ME5 A;  1H9S B;  1RL2 A;  4LF6 Q;  3MVV A;  3NBH A;  2KQ3 A;  5FJ8 H;  1YJN A;  1DXM A;  4C2M H;  1CQV A;  3S14 H;  1B1Z A;  1VQ5 A;  4WJW A;  1IL8 A;  2ZM6 Q;  4L5S A;  3S15 B;  1A62 A;  2BE5 C;  4HTH A;  2IWH A;  5I4D A;  1HA5 A;  3B6Y A;  3RUZ A;  2JA8 B;  4WJ4 A;  4GN3 B;  4HJ7 A;  3FPP A;  1TWC B;  4UP7 A;  3QIA A;  1V8Q A;  3SVM A;  4HID A;  3HOV B;  1FNW A;  3S1N H;  4IZ8 A;  1OXU A;  2BCO A;  1Q12 A;  2DJG C;  4XQN A;  4X65 L;  3DM3 A;  3JAM E;  4AQY L;  5C0X J;  2WV6 D;  1G51 A;  1SJH D;  3PO3 B;  1PYW D;  1EZ6 A;  3HG9 A;  3M9B A;  4POG A;  3MXP A;  1Y14 B;  4K0K L;  2XVS A;  4TQU S;  5E4X A;  3GTM H;  1X54 A;  1Y1V H;  3HEJ A;  5EKL A;  2K7V A;  1FGB D;  1A3V A;  3PIP 3;  1YNJ C;  4X66 L;  1LAC A;  3CKI B;  2QKI C;  1KLG D;  4RCO A;  3D6W A;  4K2K A;  3G48 A;  1H9R A;  3H3V C;  4LAA A;  2A6H D;  1CHQ D;  4A93 H;  4JI8 Q;  1A63 A;  4KLK A;  2JE6 I;  1FR3 A;  3IFT A;  2X69 A;  3NTH A;  3RD4 A;  1YIJ A;  3I4N G;  4QUF A;  5ELN A;  1Y8O B;  5IP7 H;  1X55 A;  2EJF C;  2K5W A;  2E5L L;  2NVT B;  1AEX A;  3F2B A;  5E3F A;  4CKC A;  5M3M H;  1XNQ L;  2B2V C;  1WOC A;  2EYF A;  3K5M A;  1EEI D;  3K5N A;  1EU4 A;  1MBY A;  1GHK A;  5JJZ A;  1V9P A;  2NZ1 D;  5IGC A;  1GM5 A;  3AYH B;  4XYO A;  2SDF A;  2KEC A;  3M4O H;  3TP7 A;  3NK9 A;  4KTA A;  1Z47 A;  2RCN A;  1G6P A;  5IWA L;  5C44 H;  1F9P A;  1BCP B;  2ZTE A;  1N32 Q;  2B63 H;  3DUZ A;  4DR5 L;  1RKN A;  3AFQ A;  4ZUJ A;  5C0X I;  3S2H H;  2F1M A;  2PPB C;  2DNE A;  3EA6 A;  3U4V A;  4C1N I;  1AN8 A;  4I7A A;  2AWN A;  1U4P A;  2K28 A;  3IFD A;  3VDY A;  1HNZ L;  3J7A V;  3GO5 A;  3HOY H;  2UUB Q;  2ICI A;  1PH6 A;  5IGE A;  5KYL A;  4KK7 A;  4IPC A;  5C5M A;  2CKZ B;  1EQV A;  3PUZ A;  1HNX L;  4JI0 L;  5IP9 H;  3PF5 A;  4AH6 A;  3SK4 A;  2B8F A;  1LAB A;  1B2T A;  1L0Y B;  3KLW A;  2GVA A;  2Q8T A;  4LFA L;  4BY7 B;  4KKS A;  4DV6 Q;  2IW3 A;  2I5L X;  4LF8 L;  4GLA C;  3PIO 3;  3G6J B;  4R1J A;  4DAM A;  1KDA A;  3OMG A;  3FEW X;  3SDZ A;  1MHW C;  4HJ5 A;  4DK0 A;  3LWU A;  4CJ0 B;  5E1F A;  3CCQ A;  4UAI A;  1HRJ A;  4KHP Q;  5FJ8 G;  3D0F A;  1I4P A;  1MJE A;  1DJR D;  3CRK C;  4OIK A;  3W2D A;  3BZK A;  1WTH A;  2R6G A;  3S17 B;  2F3W A;  2AQ1 B;  2OEO A;  3CXC A;  5ELB A;  2FIN B;  1TWF H;  5C4H A;  4HN7 A;  4DGZ A;  2RDG A;  3HKZ B;  3LWE A;  1EUJ A;  5KRU A;  1F9Q A;  3HKS A;  1TT2 A;  3IRB A;  2NVX B;  1PTO B;  2C9O A;  4JI5 Q;  4FF2 A;  3DEP A;  1BNZ A;  3N52 A;  4IPD A;  2CCZ A;  1SRU A;  1XMO L;  1YNN C;  2Z4I A;  2E74 C;  2NUC A;  1QIL A;  2XSC A;  3WDN A;  4DR3 L;  3CCS A;  3K57 A;  5IGB A;  5IYD G;  2OQ0 A;  1R4P B;  3BDC A;  4H13 C;  2R93 B;  5EQ0 A;  1Y1V G;  1JJG A;  5CV7 A;  1I4Q A;  5I9P A;  3HOZ G;  4FP5 D;  4JOI A;  2F4V Q;  4OGQ C;  4CDE C;  2KJX A;  4B3T Q;  2L5T A;  2D2C C;  4JI7 L;  5FO9 B;  4DAY B;  2JXM B;  4DR4 Q;  4ID6 A;  4DR6 Q;  1LTG D;  4C3H H;  1YHQ A;  3KJO A;  1TWA H;  3ND9 A;  1JT8 A;  1S5E D;  3F2U A;  4ODG A;  1BQQ T;  1ESF A;  1WTO A;  3QOJ A;  2L55 A;  3T13 A;  3RN2 A;  5IYB H;  3OMC A;  1LTI D;  4OX9 L;  1PZJ D;  2F0H A;  3Q23 A;  1BCP C;  1EL0 A;  1O80 A;  3A5U A;  4K14 A;  5JJI A;  2PI2 A;  2K52 A;  1ENF A;  4E6I A;  1DOK A;  3D4R A;  2ZJP A;  4R8N A;  4RAU C;  2A6E D;  2EYH A;  1EYG A;  5JVH 3;  3WWV A;  2GVB A;  2VB2 X;  1PH5 A;  4N9T A;  2R3Z A;  2ALY B;  5EAY A;  3UE0 A;  1J6Q A;  3KLS A;  4WOR A;  2WFW A;  2LMC B;  5E7N A;  4C2M B;  3S14 B;  1EWH A;  4JV5 Q;  2Q2H A;  3BS1 A;  2HUG A;  3T16 A;  2NWG A;  1IBM Q;  1MSG A;  2R7F A;  1ICW A;  1JE4 A;  4DV7 L;  5FLX c;  1WTQ A;  3TME A;  3M7G A;  2F0G A;  3D4D A;  3PMF A;  1PVO A;  2NVQ B;  1IKL A;  3FHW A;  5LL6 X;  1A3U A;  1HCZ A;  4LF6 L;  1L0W A;  3KDF A;  3FKI G;  1STA A;  5HGQ A;  2A73 B;  3VR5 A;  2KUM A;  4AYB B;  1ZKO A;  4A3D G;  1T5X D;  2UUA Q;  1NNX A;  2ZM6 L;  1EIF A;  3S1N B;  5T1G A;  5DM7 3;  3PO2 G;  5DM6 3;  2IPK D;  4HJA A;  4A3C G;  1FNV A;  1QZH A;  4R8I A;  1E7Z A;  4JYA Q;  4A3M B;  4EQP A;  1Q3L A;  4A3J H;  3E9H A;  1NE3 A;  2PMZ B;  2FJ2 A;  4B9X A;  1Y1V B;  4LF5 Q;  1UE7 A;  4DAP A;  2NZO A;  1S3O A;  1XPU A;  3OOC A;  5BN5 A;  3FP9 A;  1PTO C;  2AUK A;  1SEB D;  3VR4 A;  3OYY A;  2XIW A;  4CDF C;  3CCL A;  2F0L A;  2KHI A;  2ZJQ A;  5FKA C;  1N9W A;  1BO0 A;  2IJ0 A;  1ML0 D;  4A93 B;  1HFN A;  1HNW L;  2A68 C;  2YV5 A;  3R2T A;  4JW0 A;  4JI3 L;  4UPA A;  2JA7 H;  2QCP X;  2IY5 B;  2L0C A;  2WP8 J;  3V05 A;  3J81 E;  3AQQ A;  3ICE A;  2UXD Q;  4BWG B;  4XTC S;  1K0S A;  3UDG A;  2PQA A;  1DGS A;  1TVX A;  4AQY Q;  2UU9 Q;  2Q2I A;  2WII B;  1K3R A;  3IL8 A;  5IE8 A;  2JA8 H;  1UEB A;  1O7Y A;  5M3M B;  3E6Z X;  1C7Y A;  1EY8 A;  3OIQ A;  5GAD C;  5ISR A;  2C5C A;  3MFG A;  4X66 Q;  2F3V A;  1PMR A;  3HS0 C;  3K5O A;  2EY5 A;  3J7Y W;  1RTN A;  3M4O B;  1HZA A;  2ZXP A;  3I8Z A;  5A2Q E;  3RZD H;  2EVB A;  1VMC A;  5C44 B;  3CF5 A;  1SDF A;  3RR5 A;  2B63 B;  1Y8N B;  3O13 A;  2DY7 A;  3E0J A;  1Y1W H;  3S2H B;  3AMU A;  3QR8 A;  1I50 H;  3VYR A;  4DPG A;  1PHJ A;  1EU3 A;  1WVL A;  5CV6 A;  4DNT B;  1LT4 D;  3GQB A;  4C3H G;  4RCN A;  3JAM i;  3CHB D;  1XNQ Q;  4HCE A;  3HOY B;  3PSI A;  5H1S E;  5IYB G;  5G3L F;  2HD3 A;  3I2Z A;  1N32 L;  1KDC A;  4ZRZ A;  1HJP A;  1B44 D;  4O42 A;  1E3P A;  3OWF A;  3RLO A;  3I4M H;  2C35 B;  1HZB A;  3FRP B;  2VW9 A;  2NBF A;  4BA2 I;  4TRD A;  4NMZ A;  5IT9 L;  1Z9F A;  1U0L A;  4X3U A;  3D4W A;  1VQ8 A;  2BOS A;  4YWM A;  4FF1 A;  1A6X A;  1NAP A;  3HOW H;  1C8C A;  4XQQ A;  1E1O A;  4MN3 A;  1GUO A;  1SMY C;  4C56 C;  5FLM G;  2B29 A;  2XN9 C;  4ZKC B;  3NQT A;  1X32 A;  3GV6 A;  1YZ6 A;  2AMC B;  4QMG A;  1HNZ Q;  3U9S A;  4FYD A;  3S1M H;  2JYO A;  2HIX A;  2CQA A;  1KHI A;  1V43 A;  2BDN A;  1M90 C;  4OON A;  2AKW B;  1TWF B;  4QB4 A;  4BY1 H;  2VUM G;  4TSS A;  1ZXT A;  1TU2 B;  2E2J H;  3C46 A;  4UP8 A;  4WJ3 M;  4ALP A;  3W1B A;  5JJL A;  4HJ9 A;  5C3E B;  4FVM A;  4HCS A;  1I6V C;  1PZK D;  3K0Y A;  1FL0 A;  4NB3 A;  1O78 A;  3OSO A;  5COR A;  3AFP A;  2OTJ A;  5BR8 L;  5BN3 A;  2JA5 G;  4A3B H;  1QCB D;  1K8A C;  1N33 L;  1QUQ A;  1RIP A;  5HY6 A;  4YY3 Q;  4U68 A;  4XDX A;  3AU7 A;  3ULL A;  4A3J G;  3K7A H;  4BY7 H;  4DV0 Q;  1NMF A;  2J4X A;  2RQX A;  3CCV A;  4GOP B;  1BCP F;  1UEA B;  3P7J A;  4OO1 G;  5EKI A;  1AE2 A;  4JPB W;  1ZYR D;  3C1E A;  2BA1 A;  4Z9C B;  2L12 A;  1E2Z A;  1P8L A;  5D65 A;  4IOC A;  2Y0S B;  1JOK A;  4RGN A;  4J15 A;  1ILQ A;  3S17 H;  1EQR A;  2IHF A;  4IFD I;  1F2Z A;  3J80 E;  2PW7 A;  3I7F A;  1VQB A;  2RF4 A;  2MPM A;  5TSS A;  4KHZ A;  4FF3 A;  4B3T L;  2A6H C;  5M5W H;  1W6J A;  2JA8 G;  4LUO A;  1QVG A;  4DR3 Q;  4J1M A;  4HIO A;  1TQO A;  4DR6 L;  3OW7 A;  4JBK A;  5JVG 3;  3I72 A;  3S16 H;  1I4X A;  2NVX H;  4G4K A;  1HUM A;  5BN4 A;  1GUN A;  4LFC Q;  3G4S A;  1SYB A;  4ABN A;  1HUN A;  2X6G A;  2D62 A;  1CTM A;  2KEE A;  3DXJ C;  4PG3 A;  1K9M C;  3NQI A;  1GD7 A;  1L1O B;  1U4R A;  3EIV A;  1AFP A;  1RJT A;  1Z7T A;  1PXU A;  3M4P A;  2N3S A;  5CC4 A;  4DV2 L;  1MD2 D;  2R93 H;  3G71 A;  1VDZ A;  1TWG H;  1VQG A;  2EJG C;  3BVM A;  4PMB A;  1X9N A;  1IKM A;  2RSO A;  2F0S A;  3L0O A;  2F3I A;  4OX9 Q;  1IL2 A;  2I5H A;  5KEE A;  1QVF A;  1QUQ B;  2CVR A;  3G7L A;  3T53 B;  1CM9 A;  4A75 A;  2CH4 A;  2IX0 A;  1RD9 D;  4PZ6 A;  3SK6 A;  1KRT A;  3HOX H;  3K5L A;  4Y52 H;  4JV5 L;  1GXD C;  4IUQ A;  5IGD A;  2F0E A;  1ET6 A;  1LT6 D;  3D3R A;  1IBM L;  1UE5 A;  2EPB A;  1I6H B;  2XWB B;  4CJ2 C;  5M3F H;  2OCE A;  3FMC A;  3GTG H;  4KJN A;  1X3Q A;  3TBI B;  3NWT A;  1VQE A;  3H6M A;  3CME A;  1SLJ A;  2KEN A;  1I3Q H;  3JC6 6;  2F0U A;  1ROD A;  1C0A A;  4A3J B;  1WD1 A;  3GTP H;  1WCM H;  4ZYS A;  3KYH C;  3Q0A A;  2VS1 A;  1SNM A;  4CDD C;  1G2S A;  3CPF A;  1TY0 A;  3LGJ A;  5D3I B;  1EWC A;  2JN4 A;  4R4C A;  1NR4 A;  2JJQ A;  5JOB A;  4JYA L;  2JA7 B;  1E2W A;  4LF5 L;  1CKM A;  5CYU A;  4R4T A;  1D5X C;  1NTG A;  1SE3 A;  4RGT A;  3R8B A;  3X3N A;  1G2T A;  4GOP C;  2IX1 A;  2V1C C;  2WAQ B;  4BA1 I;  2NVQ H;  1U5K A;  1IYU A;  4P2C B;  3DMU A;  1QVC A;  2CHB D;  1HH2 P;  4CKB A;  3EN2 A;  5C6A A;  4DR1 Q;  4LF9 L;  1SYF A;  2L11 A;  4RMF A;  2SNS A;  4R4O A;  3UDI A;  1PRT C;  1XWE A;  3A56 A;  4A3L H;  2UXD L;  1OTC A;  3J7A 5;  4YWK A;  4MHE A;  1LM0 A;  2JP1 A;  2SOB A;  3RZD B;  1I4H A;  1EY5 A;  2WAC A;  2UU9 L;  3ONA B;  2K75 A;  4BY7 G;  4V19 0;  4K5V A;  4DK1 A;  1AZQ A;  2B2T A;  2RHS B;  1HNW Q;  3NEM A;  3K58 A;  4QIW B;  4JI3 Q;  1K73 C;  4A3M H;  2G9H D;  1IBK L;  4RFB A;  4GKK Q;  1HTP A;  1Y1W B;  1HHV A;  1I50 B;  2NYZ D;  4LW1 A;  2B8G A;  1IZ6 A;  1LTB D;  1QJO A;  1XPO A;  4DFA A;  4IJH A;  2N78 A;  1D2B A;  2EQS A;  4PZ8 A;  4L8J A;  2PYK A;  1KRS A;  3GD7 A;  1AW7 A;  1SYE A;  1L1O C;  3I4L A;  3H3V I;  1VQ6 A;  2I46 A;  1VCI A;  2EZV A;  3I4M B;  1V1P A;  3HKZ G;  3J81 c;  2OWO A;  3KF8 A;  4KI0 A;  4NW2 A;  2N88 A;  5I6W A;  2JA6 H;  1G6Z A;  3F1Z A;  3NBH B;  1GKH A;  3HKZ E;  2HCC A;  1QNU A;  3HOW B;  1STG A;  5M5X B;  5D14 A;  1TY2 A;  2L15 A;  3J81 i;  5IYC H;  2NVY H;  2QDB A;  2TMP A;  1IYV A;  2A6E C;  1TII D;  2CH4 W;  3CRL C;  2Z9H A;  1B9M A;  1VQK A;  2L4N A;  5K5P A;  1J5E L;  3S1M B;  2R93 G;  2JSO A;  3BDL A;  2MO0 A;  5IOD A;  3AB9 A;  2HCI A;  1JOO A;  2D5D A;  1PFN A;  3BYT B;  1KL9 A;  1QOH A;  4BY1 B;  3I91 A;  2RDF A;  3MWY W;  1AP0 A;  3NEL A;  2E2J B;  2ZTC A;  1GUG A;  3D6C A;  1FNU A;  3U58 A;  1DYQ A;  3SE0 A;  4A3I H;  1C48 A;  3R93 A;  1SXT A;  2E2I B;  4OO1 I;  5AJ3 L;  1SNO A;  3VR2 A;  1GUW A;  2EE1 A;  4OWX B;  5M3F G;  4A3B B;  3CCU A;  2QGQ A;  2NN6 G;  2K5D A;  2K32 A;  1YBY A;  5EBC A;  2EY6 A;  1DOM A;  1PH2 A;  1EOT A;  3K7A B;  2PNH A;  3MXN A;  1C9O A;  3TDQ A;  3BG3 A;  4DNI A;  1CA6 A;  3BU2 A;  2BH2 A;  3VYU A;  3E0E A;  2WIN B;  4JI4 L;  3STB D;  1CKN A;  1WCM G;  1BBX C;  1JE5 A;  2MGS A;  3CCJ A;  4KD3 A;  4QQB X;  3RZO B;  3URY A;  4HMJ A;  4PNY A;  2Z8L A;  1K28 A;  1YVC A;  4HIK A;  1X3F A;  3MA2 B;  3TQY A;  1A0I A;  3PGZ A;  4YY3 L;  4G7O C;  3M7N A;  2IT1 A;  4C3J H;  4L6T B;  4EGV A;  1IBL L;  3A8I E;  4DV0 L;  2K05 A;  3CPW A;  5ELE A;  3L3O C;  5JEA H;  5BR8 Q;  3E3X A;  1DOL A;  3M3Y H;  5M5W B;  1N33 Q;  4L63 B;  1SE2 A;  3L9A X;  4RGM A;  4TVA B;  3SEB A;  5JAV A;  1Q7Y C;  3J7A F;  2VNU D;  3Q8D A;  1PH1 A;  1PZI D;  2IX3 A;  2HHH Q;  1D6E C;  1TXY A;  3PIO A;  1WTW A;  1EEF D;  3BJU A;  5KIX A;  1W3S A;  5J1Z A;  4AYB G;  3S16 B;  1E1T A;  5C3E H;  5ELD A;  2PW5 A;  2OQK A;  1WYD A;  1A2U A;  1U4M A;  3H0G H;  2PZT A;  4A3L G;  2EXZ A;  1SND A;  1X56 A;  4AYB E;  4CDC C;  3T1H L;  1F9R A;  3HFZ B;  1F2Y A;  3E9I A;  3UDX A;  2CWP A;  5I2X A;  1Z6H A;  3CCR A;  2MO1 A;  2F0K A;  4A3M G;  1LYL A;  1TWG B;  1KC8 C;  3EQL C;  1H9M A;  4A3K H;  2BDO A;  3T56 B;  1EOV A;  2MQH A;  4LFC L;  2CQO A;  1XXG A;  1S40 A;  5C4X H;  2PMZ E;  2N8N A;  2NB0 A;  3TZD A;  4R4Q A;  1LTT D;  1Q81 C;  2H1E A;  3PQI A;  3HOX B;  3MXN B;  4A93 G;  1VQ9 A;  1XNR L;  2VZA A;  4GLX A;  4M1U B;  1CKN B;  2E2D C;  2E75 C;  4NXM Q;  1II3 A;  2TSS A;  5M3F B;  3KF6 A;  1G8Z D;  3GTG B;  2K04 A;  3S2D H;  1NMG A;  1SE8 A;  5IP7 G;  1HFG A;  3I56 A;  3J80 c;  5KNC A;  2XWJ B;  1I3Q B;  3TP6 A;  1G91 A;  3RLN A;  5M3M G;  3GTP B;  4DV2 Q;  1YIT A;  4K8I A;  4UHV A;  4DK3 C;  1Y69 U;  1EQQ A;  1WCM B;  4B9W A;  2K14 A;  1VQJ A;  4ME3 A;  2M9V A;  5IYC G;  1EFW A;  5EBD A;  3J80 i;  3H94 A;  5I9O A;  3A55 A;  2WKD A;  4R4I A;  1BOS A;  2O5J C;  1PRT F;  4B3R L;  5C44 G;  2WB1 G;  3I90 A;  2B63 G;  5KGU A;  1SNC A;  1CI3 M;  2F0I A;  4Q5V A;  3CC4 A;  5HUR A;  3H09 A;  2AUJ D;  1XTD A;  4HIM A;  3C3L A;  4G57 A;  4X62 L;  1S4Z A;  2RSN A;  1CSP A;  1PH4 A;  4C1N K;  1UE6 A;  2I0Q A;  2L1B A;  1HPC A;  3QB3 A;  3HOY G;  1ICF B;  3VA5 A;  3M85 A;  1WFQ A;  1TR5 A;  3TSS A;  1YI2 A;  3NP8 A;  4DV3 Q;  4C3I B;  1I6H H;  4MNO A;  1Y8P B;  3MEF A;  1RF2 D;  5IP9 G;  3Q6S A;  2UUC Q;  4H7B A;  2R7Z H;  4MTN A;  4QL5 A;  1D5M C;  5FK9 C;  1AZP A;  2G9D A;  2L9H A;  2OTL A;  4DV5 Q;  1OO9 B;  2UXB Q;  4DR1 L;  5I2Y A;  4NP5 A;  3V2T A;  4P72 A;  4APV A;  4EQO A;  4A3E H;  4BBS B;  1VQD A;  3KF6 B;  4G7H C;  2FHT A;  3S1Q H;  1KAB A;  1PFB A;  1O7Z A;  3GTJ H;  1T9H A;  3W5O A;  5EPJ A;  3UE1 A;  4KKU A;  2F0V A;  1R9T B;  4N8F A;  3TP5 A;  2VXW A;  4LF9 Q;  3P1H A;  3SR1 A;  1NY4 A;  1ZYR C;  2LSS A;  4GKK L;  4UP9 A;  2FMC A;  2R61 A;  2JA6 B;  2F52 A;  2QIL A;  1STH A;  4FNF A;  1CSQ A;  3ND8 A;  4QY7 A;  3T51 B;  2R92 B;  1EZ8 A;  5C3E G;  1V1Q A;  1MI2 A;  3N6R A;  1IBK Q;  1M4V A;  4BXX H;  2HDL A;  5C3X A;  2B2W A;  3GTL H;  2D0P A;  2NVY B;  3E5S A;  3K81 C;  1ENC A;  3KLS X;  1IW7 D;  4KN7 C;  1CQF A;  5LMU L;  3DLL A;  3KDF B;  2AQ3 B;  3DM1 A;  4LUZ A;  2WB1 B;  4ZUI A;  1SN8 A;  2F03 A;  2NN6 I;  4QGU A;  5ELC A;  2Q8R E;  1GUT A;  2QA4 A;  3QOL A;  4L5T A;  4PMC A;  5CV4 A;  4A3I B;  4GNX A;  1TWH H;  1HZ9 A;  3KFU A;  1S72 A;  1VQC A;  2Y0S G;  3NEN A;  3FVQ A;  1MGS A;  4A3F H;  5AFW A;  4KD4 A;  2RHQ B;  1ASY A;  1W6K A;  1RHP A;  5KND A;  3H15 A;  1AE3 A;  1QWY A;  2SEB D;  3T4A C;  2Y0S E;  4RGO S;  4GKJ Q;  3D8G A;  1VMP A;  3OWE B;  1EYC A;  2VQE Q;  1D8L A;  1CUK A;  4DF7 A;  1LTA D;  5COY A;  1J5E Q;  1JWM D;  1F9S A;  2I07 B;  3OTO L;  4IO9 A;  3RN5 A;  4DXG A;  1SAP A;  4QF4 A;  3ULP A;  1A2T A;  4KJO A;  2VY3 A;  5M5X H;  1MSH A;  1B9N A;  4BBR H;  1KLU D;  2J0T D;  2PQA B;  3TS0 A;  1JOQ A;  5IIF A;  4JOI C;  4C3J B;  1K8G A;  1J9O A;  2LKV A;  1HQM C;  1LT3 D;  1S5F D;  5AJ3 Q;  2K1B A;  2KVM A;  4DR7 L;  1GOZ A;  3GP7 A;  3BVG A;  5IOC A;  3RNU A;  1SFO B;  4KY7 A;  3TRE A;  1IYJ B;  3M3Y B;  1K0R A;  1SYC A;  3K7U C;  4P73 A;  3MAQ A;  4ZK9 B;  3IAY A;  1F2M A;  1JB7 A;  4JI4 Q;  3MXG A;  2E2I H;  1HR0 W;  3NUC A;  3H0G B;  2XRS D;  1EY9 A;  1BUV T;  1Q8I A;  1MJC A;  4A3G B;  4DUY L;  3HRZ C;  3UDF A;  4HSV A;  2EYP A;  2LY7 A;  2K5H A;  1STY A;  1XMQ Q;  2R7Z G;  1JOR A;  3DWA A;  4JI2 Q;  4YHH Q;  1EY6 A;  4CKE A;  2KOL A;  5D3D A;  2HHH L;  3Q24 A;  2G5D A;  1STB A;  1TS4 A;  1IBL Q;  2VB3 X;  1ENA A;  3I55 A;  3NTK A;  1ONL A;  1WTP A;  4A3K B;  4DN4 M;  5FLX L;  1NSN S;  5C4X B;  4LF4 Q;  3Q22 A;  3RZO H;  2JEA I;  3S9W A;  5IT9 E;  4I65 A;  2K4K A;  3A0J A;  1YHA A;  2B2V A;  2P5Z X;  2JA7 G;  3U4Z A;  2PQE A;  2YYZ A;  2F0P A;  5JEA J;  1KIX A;  3S2D B;  2BA0 A;  1ZEQ X;  3T1H Q;  2WAQ G;  5DEH A;  5GAH C;  2RVL A;  2NZH A;  2A69 D;  2HQL A;  1C4Q A;  1DON A;  3KBX A;  3I70 A;  5C4J H;  2H4O A;  5IGG A;  2YTY A;  2KCC A;  2GN5 A;  2WAQ E;  4MTK A;  1PV4 A;  2MFI A;  3R2I A;  3MHB A;  2K5Q A;  2B3G A;  4NXM L;  3NHH A;  2KHJ A;  5F2D A;  2YTV A;  1GJX A;  2JEB I;  2CW0 D;  3I4N H;  4DV4 Q;  1P16 A;  1HR0 Q;  3K59 A;  3G6E A;  1H9S A;  5FO7 B;  1JQY D;  3I4O A;  1XNR Q;  4LJZ C;  4FO2 A;  3A7A B;  3NBI A;  3HGB A;  1VS0 A;  1BF4 A;  1Y1W G;  5ELF A;  1HZC A;  3R3O A;  4QIW E;  1D5Z C;  1LUZ A;  3M4Y A;  2SNM A;  4PZ7 A;  1FD7 D;  1K8M A;  3ERO A;  1KNA A;  1D1K A;  2V4D A;  1STN A;  2XNA C;  3ERQ A;  2F0W A;  1PTO F;  4A3F G;  3I73 A;  1EIY B;  4PMW A;  4HR7 B;  1WTV A;  3P75 A;  1K3B C;  3I4M G;  5GQO A;  4JVZ A;  2R7Z B;  2F0N A;  1JWS D;  5C3W A;  3CCE A;  4RWS C;  3U9O A;  2B2W C;  4B3R Q;  5CBA E;  2F0J A;  5JPN C;  2QW7 A;  4DUZ L;  1YJW A;  4FXG C;  3JAM L;  3PUX A;  4A3E B;  4PQX A;  2JK8 A;  2XTI A;  3HOW G;  4J6H A;  3S1Q B;  4DV3 L;  3GTJ B;  1X3G A;  1GHJ A;  4X3S A;  2HIV A;  4X62 Q;  3STB C;  2UUC L;  2D0O A;  5CMD A;  3KK7 A;  1L2F A;  3D31 A;  3I3C A;  1MKH A;  2VQF L;  4DV5 L;  2UXB L;  3F2D A;  1E24 A;  1STE A;  2F0Q A;  1VQL A;  5M5Y H;  1FJG Q;  1D1I A;  4BY1 G;  5LL6 S;  1ET9 A;  2AHO B;  2Z6B A;  1Q86 C;  1LTR D;  2MUY A;  1LTS D;  3IKJ A;  1JMC A;  5C5L A;  4KHV A;  3CP0 A;  1W2B A;  1BXT A;  4EX5 A;  4CHT B;  3PF4 A;  4DXF A;  1WI5 A;  1H9J A;  4HSP A;  3J7Z C;  3GTL B;  2N49 A;  4A3B G;  4C3I H;  1B53 A;  4HED A;  2KCN A;  1D7Q A;  4KN4 C;  4NKL A;  4YCV A;  1E2V A;  4PV1 C;  2PNR C;  3A8J E;  3BYY B;  4OIJ A;  2AWO A;  1M8A A;  3WOE A;  4IUU A;  4IUP A;  4BBS H;  5DAU A;  1N36 Q;  1CT1 D;  2UXC Q;  4GLV B;  1RCV D;  1TWH B;  1VF7 A;  3EVQ A;  1VQ4 A;  2ASB A;  2O5I C;  1BDO A;  1R9T H;  2KCT A;  4DK6 C;  1EIH A;  3DEO A;  4A3F B;  5J3B A;  1A8V A;  2A5H A;  1ESR A;  5DNF A;  4CGY B;  3MXU A;  2K5N A;  5IYD H;  4X3T A;  4GS3 A;  1EYD A;  4IPG A;  4P75 A;  1PH8 A;  1GUS A;  3BZC A;  4F87 A;  3HOZ H;  3GTK H;  1XYI A;  1LO5 D;  2XRQ D;  5LMU Q;  4IOA A;  1VQA A;  2ES2 A;  2H5X A;  3DHQ A;  5KYI A;  1UWV A;  2R92 H;  4DV1 Q;  4N9P A;  1JIC A;  4L5R C;  4F8M A;  1DM0 B;  3PIP A;  2A1A A;  2KA7 A;  1Q1E A;  4GKJ L;  1U4L A;  1SYD A;  4BBR B;  5E4W C;  2VL6 A;  3DWQ A;  3HZX A;  2VQE L;  1GO3 E;  4KV6 A;  2MHV A;  1Q82 C;  5GRO A;  3SXH A;  3BZD B;  3SHL A;  2F0D A;  5EKK A;  3NSW A;  4OWW B;  4GZY C;  2K33 A;  1YEZ A;  4NXN Q;  4KKT A;  1B50 A;  2ICE C;  5L37 A;  1S5D D;  4K8J A;  5CR3 A;  1M1K C;  4IAL A;  4RKL A;  4K5X A;  2HT1 A;  2QF7 A;  5I6Y A;  2LXK A;  4IFD H;  3RMH A;  4IN3 A;  4Y7N H;  3HOX G;  3PUV A;  4O1N A;  3OTO Q;  4NDX A;  3NPP A;  2K01 A;  4RKB A;  3OHX C;  4YCW A;  4Q0F A;  2EYM A;  3NE5 B;  1KDB A;  2YU9 H;  1OXX K;  1A3T A;  3QG1 A;  1EIG A;  3QJY A;  1SR3 A;  2RDH A;  2Z6K A;  4K6L A;  5K36 H;  4OXP A;  4BS9 A;  5JPM C;  1VQI A;  2ID0 A;  1QNK A;  4DR7 Q;  3FKI H;  3LNN A;  4QJF A;  4FXK C;  3OW2 A;  2EJM A;  2Q2T A;  4A3D H;  1JJ2 A;  1EQT A;  3VR3 A;  2CFM A;  4JK1 C;  1V1P B;  1E0B A;  1XMQ L;  2ZXO A;  5CV8 A;  4JI2 L;  3KF8 B;  1RDP D;  2HQE A;  3CW2 C;  3PO2 H;  4YHH L;  4KY5 A;  1AH9 A;  3TRZ A;  4A3C H;  1X6O A;  3PV0 A;  4DAY A;  1IXR A;  3MTS A;  1PH9 A;  2F0M A;  4DNR B;  1B8A A;  3CU7 A;  3ITP A;  5EJW A;  4IUV A;  4DUY Q;  1GVP A;  1B7Y B;  1QG7 A;  2RA4 A;  4ZQ3 A;  1SFO H;  3CD6 A;  4CJ1 B;  4LF4 L;  1PFM A;  2OXP A;  1B3Q A;  2A8V A;  1UE1 A;  4RA8 A;  3FPU B;  3ZJY C;  5C4J B;  1XJV A;  1L0X B;  1VQ7 A;  1JB3 A;  2BE5 D;  2F0T A;  2F0O A;  1KXL A;  1YJ9 A;  4ULL A;  2B2Y A;  1BVS A;  1VF5 C;  1I4G A;  4C3I G;  3F2C A;  4A3G H;  3K8A A;  2MNA A;  4HJ8 A;  3I4N B;  3LX0 A;  3GDE A;  1HTL D;  1A15 A;  2EY1 A;  4RHS A;  2E8G A;  4JBM A;  2K6A A;  1KQS A;  1QB5 D;  4RH6 A;  1PRT D;  3GTO H;  4LNQ A;  2M2L A;  3MZ5 A;  4JI1 Q;  4BBS G;  4QCL A;  3BDO A;  1IW7 C;  4U67 3;  2HDM A;  2F0F A;  4JI6 L;  2E2H B;  3KJP A;  4IUN A;  3C1F A;  4QUC A;  4F88 A;  3HOU H;  4DV4 L;  5NUC A;  4LFB Q;  1HR0 L;  3SK8 A;  5IT9 c;  4I7Z C;  3S1R H;  1DCZ A;  1SNQ A;  1YNJ D;  1N8R C;  1LLR D;  1KD1 C;  4XT3 B;  4B3S Q;  1XTC D;  2PI2 E;  1NR2 A;  1EYA A;  3A74 A;  5DLQ E;  1EY0 A;  2KBN A;  3PCO B;  2GA4 B;  1PH3 A;  1CHP D;  1CFM A;  4FDB A;  2JA6 G;  1N34 Q;  1VQN A;  2K03 A;  3T1Y Q;  4RG1 A;  3L2P A;  2R92 G;  5IGF A;  4B3M Q;  4HMI A;  2QEX A;  1DD2 A;  4LF7 Q;  5ELO A;  1FGU A;  1K83 H;  1BBU A;  5HGT A;  4A76 A;  1SBB B;  3FDT A;  4IQZ A;  1ILP A;  5EPL A;  1VQM A;  1NUC A;  2B2T C;  1Q1B A;  4H44 C;  4EVO A;  3U50 C;  2MJ8 A;  5LMN L;  3V96 A;  2EXD A;  4OEM B;  4EQN A;  4ZCK A;  4MZ9 A;  4OWT B;  3QO2 A;  2Q8I B;  1RTO A;  1XPR A;  2OF1 A;  4N8X 1;  3W1G A;  5M5Y B;  2K50 A;  4XYQ A;  1KAA A;  5T1I A;  1I94 L;  1VQP A;  2WB1 E;  1CK1 A;  3SGI A;  4A3I G;  4IFD G;  3J81 L;  2Q2U A;  3H3V H;  4OHJ A;  4HAE A;  2ZTD A;  4JBW A;  3ERS X;  3TZU A;  2E76 C;  4DUZ Q;  2K5V A;  2B39 A;  5FLM H;  2D9U A;  1I5F A;  3DWP A;  2DJF C;  4M8A A;  4X3K A;  1SSO A;  1FJG L;  1S5C D;  1FVI A;  1U9R A;  1O7L A;  4NPS A;  4JC0 A;  2PZU A;  2BH8 A;  2VUM H;  3BVZ A;  5K36 G;  1NCV A;  2VQF Q;  3GTQ H;  2PCF B;  1LTL A;  4X64 Q;  2DN8 A;  4DKA C;  4DR2 Q;  4H0L C;  5A2Q L;  3VR6 A;  4LWC A;  1KAW A;  3J81 j;  3OIP A;  3TS2 A;  3KOJ A;  4IPH A;  4LUV A;  1Q90 A;  4S3S A;  2N55 A;  4ILW A;  2JA5 H;  4C3J G;  2R7D A;  3CQZ H;  2LXJ A;  1JR0 D;  4GN5 A;  5C0X H;  2J7Z A;  1JCK B;  1NJI C;  1TS5 A;  1B4O A;  1EFI D;  2NTS A;  1WD0 A;  4XQJ A;  3K0X A;  5JEA G;  2AQ2 B;  2NTT A;  3GTM B;  1G29 1;  2PO4 A;  5G3L D;  2JA9 A;  1V1O A;  2QEJ C;  3EJI A;  3HOZ B;  1N36 L;  3X3M A;  3GTK B;  4OO1 H;  2DY8 A;  3KUP A;  2UXC L;  2ZXR A;  4DA2 A;  4FF4 A;  1BBW A;  3QWN A;  1HQR D;  3M4Q A;  3TEH B;  3H0G G;  2B2U A;  4V0B A;  3A8K E;  2Z6K C;  3CCM A;  2A69 C;  4A3G G;  3P20 A;  3MFY A;  1SJE D;  2PZW A;  3S15 H;  1EY4 A;  1PYB A;  2RCF A;  1IHZ A;  1JJC B;  3TP8 A;  2MP1 A;  1X3E A;  4X65 Q;  4O0A A;  2Z4H A;  3W3A A;  4ZKB B;  4AIM A;  4X6A H;  1E22 A;  4DV1 L;  1VQO A;  1YNN D;  2CW0 C;  4A3K G;  2M00 A;  1TWC H;  4K0K Q;  3TN2 A;  4YWL A;  5C4Z A;  4JI8 L;  1J8I A;  3KBG A;  4JCV E;  5C4X G;  4IJL A;  5FO8 B;  3EFX D;  3HOU G;  3HOV H;  3A5Z B;  3K80 C;  3ER0 A;  5A35 A;  4Y7N B;  2X6L A;  1CKO A;  1R4Q B;  2OT2 A;  1Q8K A;  5J39 A;  3UI2 A;  1CZW A;  3PO3 H;  3EBE A;  3JAM c;  2YU9 B;  1JWU D;  4O2D A;  4NXN L;  3RLF A;  1EWI A;  4YIJ A;  4K2L A;  3CC2 A;  3H91 A;  2B2Y C;  4YCU A;  4GN4 B;  1XX8 A;  2E5L Q;  2RKS A;  4POF A;  4H02 A;  1H9K A;  1PA6 A;  4FXD A;  3FKI B;  2A19 A;  2YTX A;  4GOP A;  1UNS A;  2LFN A;  1BCP D;  1TS3 A;  4A3D B;  2DUD A;  1SYG A;  3PO2 B;  1WTX A;  1Q46 A;  5LHY 1;  1KTK A;  4RHR A;  2NVT H;  1I4R A;  2WKC A;  5IWA Q;  3CC7 A;  4UDU C;  2UUB L;  4DR5 Q;  2ZJR A;  1TKW B;  3J80 L;  4F7X A;  4IFD J;  1YHB A;  4LMQ D;  1SE4 A;  4L5Q A;  3NXW A;  2IHE A;  4KMU C;  4XT1 B;  3ZYY X;  3K6O A;  4DV6 L;  3ULJ A;  2JQO A;  3OPO A;  1B3A A;  5CV5 A;  1JC7 A;  2Z0S A;  2Z1C A;  5M9O A;  2CWA A;  1UAP A;  2XGT A;  3F8T A;  1SNP A;  2EDG A;  1HNX Q;  4JI0 Q;  2ATW A;  3HP3 A;  4LK1 C;  4GNX B;  1L1O A;  1F2L A;  1T5E A;  1YNX A;  5CGK A;  4KHP L;  4LFA Q;  3GTO B;  4LF8 Q;  2EYJ A;  4A3E G;  1EY7 A;  4P71 A; 
#chains in the Genus database with same CATH homology
 5FOB B;  4XIG S;  5EPK A;  3VYT A;  1DZ1 A;  3VYS A;  2LS0 1;  1QE6 A;  3C2P A;  3HOU B;  5C0X G;  4R9W A;  3S1R B;  4B08 A;  4CBV A;  1S5B D;  1PTO D;  4XXE A;  4IUT A;  2FFK B;  4ZAI A;  2IL8 A;  4WRD A;  1HA6 A;  4KY6 A;  2A68 D;  1KNE A;  4J8Q A;  5EGT A;  1F77 A;  3NTI A;  2F4I A;  4C3H B;  1PRT B;  1TWA B;  1K83 B;  1LV9 A;  2EYO A;  4IUR A;  3PUY A;  4MIU A;  1TS2 A;  5CBE E;  3A7L A;  3WOF A;  3MC0 B;  2EYL A;  2DNC A;  1HXY D;  3NWS A;  2ENB A;  2EOT A;  1LT5 D;  4K5W A;  4DU9 A;  5KNB A;  3KLR A;  5CV9 A;  1PTO H;  3A54 A;  4TKO B;  1CZG A;  5J22 A;  2FMM A;  1OXV A;  1WTR A;  2A74 C;  4OL7 A;  5FLX E;  2O4X A;  1OXS C;  1FYC A;  1K8O A;  1UUP A;  2B2U C;  2VUM B;  4WFN 3;  2O2L D;  4K6D A;  3GTQ B;  3GV3 A;  3VA7 A;  4G7Z C;  3SK5 A;  2EY2 A;  2JA5 B;  4ZLT F;  2NN6 H;  3CQZ B;  1CA5 A;  1PDQ A;  2KED A;  1X3P A;  3PUW A;  3L7Z C;  1PLF A;  3MEH A;  4DAV A;  1OXT A;  1SMY D;  1BR9 A;  2RBM A;  2ZT9 C;  2KHS A;  4ME5 A;  1H9S B;  3MVV A;  3NBH A;  2KQ3 A;  1DXM A;  1CQV A;  1B1Z A;  4WJW A;  1IL8 A;  3S15 B;  2BE5 C;  4HTH A;  2IWH A;  5I4D A;  1HA5 A;  3RUZ A;  2JA8 B;  3FPP A;  1TWC B;  3QIA A;  1V8Q A;  3SVM A;  3HOV B;  1FNW A;  4IZ8 A;  1OXU A;  2BCO A;  1Q12 A;  4XQN A;  3JAM E;  5C0X J;  2WV6 D;  1SJH D;  3PO3 B;  1PYW D;  1EZ6 A;  3HG9 A;  3MXP A;  2XVS A;  4TQU S;  5E4X A;  3HEJ A;  5EKL A;  2K7V A;  1FGB D;  1A3V A;  3PIP 3;  1YNJ C;  1LAC A;  3CKI B;  2QKI C;  1KLG D;  4RCO A;  3D6W A;  4K2K A;  1H9R A;  3H3V C;  4LAA A;  2A6H D;  1CHQ D;  2JE6 I;  1FR3 A;  3IFT A;  2X69 A;  3NTH A;  3RD4 A;  4QUF A;  1Y8O B;  2EJF C;  2K5W A;  2NVT B;  1AEX A;  5E3F A;  4CKC A;  2B2V C;  2EYF A;  3K5M A;  1EEI D;  3K5N A;  1EU4 A;  1MBY A;  1GHK A;  5JJZ A;  2NZ1 D;  5IGC A;  4XYO A;  2SDF A;  2KEC A;  3TP7 A;  3NK9 A;  4KTA A;  1Z47 A;  1F9P A;  1BCP B;  3DUZ A;  1RKN A;  4ZUJ A;  5C0X I;  2F1M A;  2PPB C;  2DNE A;  3EA6 A;  4C1N I;  1AN8 A;  2AWN A;  1U4P A;  2K28 A;  3IFD A;  3J7A V;  3GO5 A;  2ICI A;  5IGE A;  5KYL A;  4KK7 A;  5C5M A;  1EQV A;  3PUZ A;  3SK4 A;  2B8F A;  1LAB A;  1B2T A;  1L0Y B;  2Q8T A;  4BY7 B;  4KKS A;  2IW3 A;  3PIO 3;  3G6J B;  1KDA A;  3OMG A;  3FEW X;  3SDZ A;  4DK0 A;  3LWU A;  4CJ0 B;  5E1F A;  1HRJ A;  4UAI A;  1I4P A;  1DJR D;  3CRK C;  4OIK A;  3W2D A;  2R6G A;  3S17 B;  2F3W A;  2AQ1 B;  2OEO A;  5ELB A;  2FIN B;  5C4H A;  4HN7 A;  4DGZ A;  2RDG A;  3HKZ B;  3LWE A;  5KRU A;  1F9Q A;  1TT2 A;  2NVX B;  1PTO B;  2C9O A;  4FF2 A;  3DEP A;  1BNZ A;  3N52 A;  1YNN C;  2Z4I A;  2E74 C;  2NUC A;  1QIL A;  2XSC A;  3WDN A;  3K57 A;  5IGB A;  1R4P B;  3BDC A;  4H13 C;  2R93 B;  5EQ0 A;  5CV7 A;  1I4Q A;  5I9P A;  4FP5 D;  4OGQ C;  2KJX A;  2L5T A;  2D2C C;  5FO9 B;  2JXM B;  4ID6 A;  1LTG D;  3ND9 A;  1S5E D;  3F2U A;  4ODG A;  1BQQ T;  1ESF A;  1WTO A;  3QOJ A;  2L55 A;  3T13 A;  3OMC A;  1LTI D;  1PZJ D;  2F0H A;  3Q23 A;  1BCP C;  1EL0 A;  1O80 A;  4K14 A;  1ENF A;  4E6I A;  1DOK A;  3D4R A;  4R8N A;  4RAU C;  2A6E D;  2EYH A;  5JVH 3;  2VB2 X;  4N9T A;  2R3Z A;  3KLS A;  4WOR A;  2LMC B;  4C2M B;  3S14 B;  1EWH A;  3BS1 A;  2HUG A;  3T16 A;  2NWG A;  1MSG A;  1ICW A;  1JE4 A;  1WTQ A;  3TME A;  3M7G A;  2F0G A;  3D4D A;  3PMF A;  2NVQ B;  1IKL A;  5LL6 X;  1A3U A;  1HCZ A;  1STA A;  2A73 B;  3VR5 A;  2KUM A;  4AYB B;  1ZKO A;  1T5X D;  3S1N B;  5T1G A;  5DM7 3;  5DM6 3;  2IPK D;  1FNV A;  4R8I A;  4A3M B;  4EQP A;  1Q3L A;  2PMZ B;  2FJ2 A;  4B9X A;  1Y1V B;  4DAP A;  3OOC A;  5BN5 A;  1PTO C;  2AUK A;  1SEB D;  3VR4 A;  2XIW A;  2F0L A;  5FKA C;  1BO0 A;  2IJ0 A;  1ML0 D;  4A93 B;  1HFN A;  2A68 C;  3R2T A;  2QCP X;  2L0C A;  2WP8 J;  3V05 A;  3J81 E;  4BWG B;  4XTC S;  1TVX A;  2WII B;  3IL8 A;  1O7Y A;  5M3M B;  3E6Z X;  1EY8 A;  3OIQ A;  5ISR A;  2C5C A;  3MFG A;  2F3V A;  1PMR A;  3HS0 C;  3K5O A;  2EY5 A;  3J7Y W;  1RTN A;  3M4O B;  3I8Z A;  2ZXP A;  5A2Q E;  2EVB A;  1VMC A;  5C44 B;  1SDF A;  2B63 B;  1Y8N B;  3O13 A;  2DY7 A;  3E0J A;  3S2H B;  3AMU A;  3VYR A;  1EU3 A;  1WVL A;  5CV6 A;  4DNT B;  1LT4 D;  3GQB A;  4C3H G;  4RCN A;  3CHB D;  4HCE A;  3HOY B;  5G3L F;  1KDC A;  4ZRZ A;  1B44 D;  4O42 A;  3OWF A;  3FRP B;  2NBF A;  4BA2 I;  4TRD A;  4NMZ A;  5IT9 L;  4X3U A;  3D4W A;  2BOS A;  4FF1 A;  1A6X A;  1NAP A;  1C8C A;  4XQQ A;  4MN3 A;  1GUO A;  1SMY C;  4C56 C;  2XN9 C;  4ZKC B;  3NQT A;  1X32 A;  3GV6 A;  4FYD A;  4QMG A;  3U9S A;  2JYO A;  2CQA A;  1V43 A;  2BDN A;  1TWF B;  4QB4 A;  4TSS A;  1ZXT A;  1TU2 B;  3C46 A;  5C3E B;  4FVM A;  4HCS A;  1I6V C;  1PZK D;  3K0Y A;  1O78 A;  3OSO A;  5COR A;  5BN3 A;  1QCB D;  4U68 A;  4XDX A;  3AU7 A;  2J4X A;  2RQX A;  1BCP F;  1UEA B;  3P7J A;  4OO1 G;  5EKI A;  1ZYR D;  3C1E A;  2BA1 A;  4Z9C B;  2L12 A;  1E2Z A;  5D65 A;  2Y0S B;  1JOK A;  4RGN A;  1ILQ A;  4IFD I;  1F2Z A;  3J80 E;  2PW7 A;  2MPM A;  5TSS A;  4KHZ A;  4FF3 A;  2A6H C;  1W6J A;  4J1M A;  1TQO A;  3OW7 A;  5JVG 3;  3I72 A;  1I4X A;  4G4K A;  1HUM A;  5BN4 A;  1GUN A;  1SYB A;  4ABN A;  1HUN A;  2X6G A;  2D62 A;  1CTM A;  2KEE A;  3DXJ C;  3NQI A;  1U4R A;  1AFP A;  1RJT A;  1Z7T A;  1PXU A;  5CC4 A;  1MD2 D;  1VDZ A;  2EJG C;  3BVM A;  1IKM A;  4PMB A;  2RSO A;  2F0S A;  5KEE A;  2CVR A;  3G7L A;  3T53 B;  1CM9 A;  2IX0 A;  1RD9 D;  3SK6 A;  3K5L A;  1GXD C;  4IUQ A;  5IGD A;  2F0E A;  1ET6 A;  1LT6 D;  3D3R A;  2EPB A;  1I6H B;  2XWB B;  4CJ2 C;  3FMC A;  4KJN A;  1X3Q A;  3TBI B;  3NWT A;  3H6M A;  2F0U A;  1ROD A;  4A3J B;  1WD1 A;  4ZYS A;  3Q0A A;  1SNM A;  1G2S A;  1TY0 A;  5D3I B;  1EWC A;  1NR4 A;  5JOB A;  2JA7 B;  1E2W A;  5CYU A;  1D5X C;  1SE3 A;  4RGT A;  3R8B A;  3X3N A;  1G2T A;  2IX1 A;  4BA1 I;  2WAQ B;  1IYU A;  4P2C B;  3DMU A;  2CHB D;  4CKB A;  5C6A A;  1SYF A;  2L11 A;  2SNS A;  1PRT C;  1XWE A;  3A56 A;  4MHE A;  2JP1 A;  2SOB A;  3RZD B;  1I4H A;  1EY5 A;  2WAC A;  3ONA B;  4V19 0;  4K5V A;  4DK1 A;  1AZQ A;  2B2T A;  3K58 A;  4QIW B;  2G9H D;  4RFB A;  1HTP A;  1Y1W B;  1HHV A;  1I50 B;  2NYZ D;  2B8G A;  1LTB D;  1QJO A;  4DFA A;  1D2B A;  4L8J A;  2PYK A;  3GD7 A;  1AW7 A;  1SYE A;  3I4L A;  2I46 A;  1VCI A;  2EZV A;  3I4M B;  1V1P A;  3KF8 A;  4KI0 A;  4NW2 A;  2N88 A;  5I6W A;  1G6Z A;  2HCC A;  1QNU A;  3HOW B;  1STG A;  5M5X B;  5D14 A;  1TY2 A;  2QDB A;  2TMP A;  1IYV A;  2A6E C;  1TII D;  3CRL C;  1B9M A;  2L4N A;  5K5P A;  3S1M B;  2JSO A;  3BDL A;  5IOD A;  3AB9 A;  2HCI A;  1JOO A;  2D5D A;  1PFN A;  3BYT B;  1QOH A;  4BY1 B;  3I91 A;  2RDF A;  3MWY W;  1AP0 A;  2E2J B;  1GUG A;  3D6C A;  1FNU A;  1DYQ A;  3SE0 A;  1C48 A;  3R93 A;  1SXT A;  2E2I B;  4OO1 I;  1SNO A;  3VR2 A;  1GUW A;  2EE1 A;  4A3B B;  2NN6 G;  2K5D A;  2K32 A;  5EBC A;  2EY6 A;  1DOM A;  1EOT A;  3K7A B;  3TDQ A;  3MXN A;  3BG3 A;  1CA6 A;  3VYU A;  2WIN B;  1BBX C;  2MGS A;  4KD3 A;  3RZO B;  3URY A;  4HMJ A;  4PNY A;  2Z8L A;  3MA2 B;  4G7O C;  3M7N A;  2IT1 A;  4L6T B;  4EGV A;  3A8I E;  2K05 A;  5ELE A;  3L3O C;  5JEA H;  1DOL A;  5M5W B;  4L63 B;  1SE2 A;  3L9A X;  4RGM A;  3SEB A;  5JAV A;  3J7A F;  2VNU D;  1PZI D;  2IX3 A;  1D6E C;  1WTW A;  1EEF D;  5KIX A;  5J1Z A;  3S16 B;  5ELD A;  2PW5 A;  1A2U A;  1U4M A;  2PZT A;  2EXZ A;  1SND A;  1F9R A;  1F2Y A;  5I2X A;  1Z6H A;  2F0K A;  1TWG B;  3EQL C;  1H9M A;  2BDO A;  3T56 B;  1XXG A;  2NB0 A;  3TZD A;  1LTT D;  2H1E A;  3HOX B;  4M1U B;  2E2D C;  2E75 C;  1II3 A;  2TSS A;  5M3F B;  1G8Z D;  3GTG B;  2K04 A;  1HFG A;  5KNC A;  2XWJ B;  1I3Q B;  3TP6 A;  1G91 A;  3GTP B;  4K8I A;  1Y69 U;  1WCM B;  4B9W A;  2M9V A;  5EBD A;  3H94 A;  5I9O A;  3A55 A;  2WKD A;  1BOS A;  2O5J C;  1PRT F;  3I90 A;  5KGU A;  1SNC A;  1CI3 M;  2F0I A;  4Q5V A;  5HUR A;  3H09 A;  2AUJ D;  3C3L A;  4G57 A;  1S4Z A;  2RSN A;  4C1N K;  2L1B A;  1HPC A;  3QB3 A;  3VA5 A;  3M85 A;  3TSS A;  1TR5 A;  3NP8 A;  4C3I B;  1Y8P B;  1RF2 D;  3Q6S A;  4H7B A;  1D5M C;  5FK9 C;  1AZP A;  2G9D A;  2L9H A;  1OO9 B;  5I2Y A;  4NP5 A;  3V2T A;  4EQO A;  4BBS B;  4G7H C;  2FHT A;  1KAB A;  1PFB A;  1O7Z A;  5EPJ A;  4KKU A;  2F0V A;  1R9T B;  3TP5 A;  2VXW A;  3P1H A;  3SR1 A;  1ZYR C;  2FMC A;  2R61 A;  2JA6 B;  2QIL A;  1STH A;  4FNF A;  3ND8 A;  2R92 B;  3T51 B;  1EZ8 A;  1MI2 A;  3N6R A;  1M4V A;  2HDL A;  5C3X A;  2B2W A;  2NVY B;  3E5S A;  1ENC A;  3KLS X;  1IW7 D;  4KN7 C;  1CQF A;  2AQ3 B;  3DM1 A;  2WB1 B;  4ZUI A;  2F03 A;  2NN6 I;  5ELC A;  2Q8R E;  1GUT A;  3QOL A;  4PMC A;  5CV4 A;  4A3I B;  3FVQ A;  1MGS A;  5AFW A;  4KD4 A;  1W6K A;  1RHP A;  5KND A;  1QWY A;  3T4A C;  2SEB D;  4RGO S;  3D8G A;  1VMP A;  3OWE B;  1EYC A;  4DF7 A;  1LTA D;  5COY A;  1JWM D;  1F9S A;  2I07 B;  4DXG A;  1SAP A;  4QF4 A;  1A2T A;  4KJO A;  1MSH A;  1B9N A;  1KLU D;  2J0T D;  1JOQ A;  5IIF A;  4C3J B;  1J9O A;  2LKV A;  1HQM C;  1LT3 D;  1S5F D;  2K1B A;  2KVM A;  1GOZ A;  3GP7 A;  3BVG A;  5IOC A;  1SFO B;  4KY7 A;  3M3Y B;  1SYC A;  3MAQ A;  4ZK9 B;  3IAY A;  1F2M A;  3MXG A;  3NUC A;  3H0G B;  2XRS D;  1EY9 A;  1BUV T;  1Q8I A;  4A3G B;  3HRZ C;  4HSV A;  2EYP A;  2LY7 A;  1STY A;  1JOR A;  3DWA A;  1EY6 A;  4CKE A;  2KOL A;  5D3D A;  3Q24 A;  1STB A;  1TS4 A;  2VB3 X;  1ENA A;  3NTK A;  1ONL A;  1WTP A;  4A3K B;  4DN4 M;  5FLX L;  1NSN S;  5C4X B;  3Q22 A;  2JEA I;  3S9W A;  5IT9 E;  4I65 A;  2B2V A;  2PQE A;  2YYZ A;  2F0P A;  5JEA J;  3S2D B;  2BA0 A;  1ZEQ X;  5DEH A;  2RVL A;  2A69 D;  1DON A;  1C4Q A;  3KBX A;  3I70 A;  2H4O A;  5IGG A;  2KCC A;  3R2I A;  3MHB A;  2K5Q A;  3NHH A;  5F2D A;  1GJX A;  2JEB I;  2CW0 D;  3K59 A;  1H9S A;  5FO7 B;  1JQY D;  4LJZ C;  4FO2 A;  3A7A B;  3NBI A;  3HGB A;  1BF4 A;  5ELF A;  3R3O A;  1D5Z C;  3M4Y A;  2SNM A;  1FD7 D;  1K8M A;  3ERO A;  1KNA A;  1D1K A;  2V4D A;  1STN A;  2XNA C;  3ERQ A;  2F0W A;  1PTO F;  3I73 A;  4PMW A;  4HR7 B;  1WTV A;  3P75 A;  2R7Z B;  2F0N A;  1JWS D;  5C3W A;  4RWS C;  3U9O A;  2B2W C;  5CBA E;  2F0J A;  5JPN C;  4FXG C;  3JAM L;  3PUX A;  4A3E B;  4PQX A;  4J6H A;  3S1Q B;  3GTJ B;  1GHJ A;  4X3S A;  5CMD A;  3KK7 A;  3D31 A;  3I3C A;  1STE A;  2F0Q A;  1D1I A;  5LL6 S;  1ET9 A;  1LTR D;  2MUY A;  1LTS D;  3IKJ A;  5C5L A;  4KHV A;  1BXT A;  4CHT B;  4DXF A;  1H9J A;  4HSP A;  3GTL B;  1B53 A;  4HED A;  2KCN A;  4KN4 C;  4NKL A;  1E2V A;  4PV1 C;  2PNR C;  3A8J E;  3BYY B;  4OIJ A;  2AWO A;  1M8A A;  3WOE A;  4IUU A;  4IUP A;  5DAU A;  1CT1 D;  1RCV D;  1TWH B;  1VF7 A;  3EVQ A;  2O5I C;  1BDO A;  1EIH A;  3DEO A;  4A3F B;  2A5H A;  5DNF A;  1ESR A;  4CGY B;  3MXU A;  4X3T A;  1EYD A;  1GUS A;  4F87 A;  1XYI A;  1LO5 D;  2XRQ D;  3DHQ A;  5KYI A;  4N9P A;  1JIC A;  4F8M A;  1DM0 B;  2KA7 A;  1Q1E A;  1U4L A;  1SYD A;  4BBR B;  5E4W C;  3DWQ A;  3HZX A;  4KV6 A;  2MHV A;  3SXH A;  3BZD B;  3SHL A;  2F0D A;  5EKK A;  3NSW A;  4GZY C;  2K33 A;  4KKT A;  1B50 A;  2ICE C;  1S5D D;  4K8J A;  5CR3 A;  4IAL A;  4RKL A;  4K5X A;  2QF7 A;  5I6Y A;  4IFD H;  3RMH A;  4IN3 A;  3PUV A;  4O1N A;  4NDX A;  3NPP A;  2K01 A;  4RKB A;  3OHX C;  4Q0F A;  2EYM A;  3NE5 B;  1KDB A;  1OXX K;  1A3T A;  3QG1 A;  1EIG A;  3QJY A;  2RDH A;  4K6L A;  5K36 H;  4BS9 A;  5JPM C;  2ID0 A;  1QNK A;  3LNN A;  4FXK C;  2EJM A;  1EQT A;  3VR3 A;  4JK1 C;  1V1P B;  1E0B A;  2ZXO A;  5CV8 A;  1RDP D;  2HQE A;  4KY5 A;  3PV0 A;  4DAY A;  3MTS A;  2F0M A;  4DNR B;  3CU7 A;  3ITP A;  5EJW A;  4IUV A;  1QG7 A;  2RA4 A;  4ZQ3 A;  4CJ1 B;  1PFM A;  2OXP A;  4RA8 A;  3FPU B;  5C4J B;  1L0X B;  1JB3 A;  2BE5 D;  2F0T A;  2F0O A;  4ULL A;  2B2Y A;  1VF5 C;  1I4G A;  4C3I G;  3I4N B;  3LX0 A;  1HTL D;  1A15 A;  2EY1 A;  4RHS A;  2K6A A;  1QB5 D;  4RH6 A;  1PRT D;  2M2L A;  3MZ5 A;  4QCL A;  3BDO A;  1IW7 C;  4U67 3;  2HDM A;  2F0F A;  2E2H B;  4IUN A;  3C1F A;  4QUC A;  4F88 A;  5NUC A;  3SK8 A;  4I7Z C;  1DCZ A;  1SNQ A;  1YNJ D;  1LLR D;  4XT3 B;  1XTC D;  1NR2 A;  1EYA A;  1EY0 A;  2GA4 B;  1CHP D;  1CFM A;  2K03 A;  5IGF A;  4HMI A;  1DD2 A;  5HGT A;  1SBB B;  3FDT A;  4IQZ A;  1ILP A;  5EPL A;  1NUC A;  2B2T C;  1Q1B A;  4H44 C;  4EVO A;  2MJ8 A;  3V96 A;  4EQN A;  3QO2 A;  2Q8I B;  1RTO A;  2OF1 A;  5M5Y B;  4XYQ A;  1KAA A;  5T1I A;  1CK1 A;  4IFD G;  3J81 L;  4OHJ A;  4HAE A;  4JBW A;  3TZU A;  2E76 C;  2B39 A;  2D9U A;  3DWP A;  4M8A A;  4X3K A;  1SSO A;  1S5C D;  1U9R A;  1O7L A;  2PZU A;  3BVZ A;  5K36 G;  1NCV A;  2PCF B;  2DN8 A;  4H0L C;  5A2Q L;  3VR6 A;  3OIP A;  1Q90 A;  4S3S A;  2N55 A;  4ILW A;  4C3J G;  1JR0 D;  5C0X H;  2J7Z A;  1JCK B;  1TS5 A;  1B4O A;  1EFI D;  2NTS A;  1WD0 A;  4XQJ A;  5JEA G;  2AQ2 B;  2NTT A;  3GTM B;  1G29 1;  2PO4 A;  5G3L D;  1V1O A;  2QEJ C;  3EJI A;  3HOZ B;  3X3M A;  3GTK B;  4OO1 H;  2DY8 A;  3KUP A;  2ZXR A;  4DA2 A;  4FF4 A;  3QWN A;  1HQR D;  2B2U A;  4V0B A;  3A8K E;  2A69 C;  3P20 A;  3MFY A;  1SJE D;  2PZW A;  1EY4 A;  1IHZ A;  3TP8 A;  2MP1 A;  2Z4H A;  3W3A A;  4ZKB B;  1YNN D;  2CW0 C;  2M00 A;  3TN2 A;  5C4Z A;  1J8I A;  3KBG A;  5FO8 B;  3EFX D;  5A35 A;  4Y7N B;  2X6L A;  1R4Q B;  2OT2 A;  5J39 A;  3UI2 A;  1CZW A;  2YU9 B;  1JWU D;  3RLF A;  4YIJ A;  4K2L A;  3H91 A;  2B2Y C;  1XX8 A;  2RKS A;  1H9K A;  4FXD A;  3FKI B;  1UNS A;  2LFN A;  1BCP D;  1TS3 A;  4A3D B;  1SYG A;  3PO2 B;  1WTX A;  5LHY 1;  1KTK A;  4RHR A;  1I4R A;  2WKC A;  4UDU C;  1TKW B;  3J80 L;  4F7X A;  4IFD J;  4LMQ D;  1SE4 A;  3NXW A;  4KMU C;  4XT1 B;  3ZYY X;  3K6O A;  3OPO A;  1B3A A;  5CV5 A;  1JC7 A;  2Z1C A;  5M9O A;  1UAP A;  1SNP A;  2EDG A;  3HP3 A;  4LK1 C;  1F2L A;  1T5E A;  5CGK A;  3GTO B;  2EYJ A;  1EY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...