2EYLA

Crystal structure of staphylococcal nuclease mutant t82s
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRSDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2eylA00
3PMFA 5CGKA 1EYCA 4EQNA 4H7BA 2OEOA 1EYDA 2F0DA 2SNMA 3NHHA 4PMBA 1A3TA 5IOCA 3SK6A 5IGFA 1SNOA 4KV6A 5J39A 1II3A 1EY0A 3NUCA 1STNA 4KY6A 2RDFA 4KJNA 3H6MA 5JOBA 2LKVA 3ITPA 4DFAA 5DEHA 3NXWA 2F0UA 1TT2A 4TRDA 4B9XA 2RKSA 3OMGA 4IALA 5HGTA 4KY7A 4QB4A 1TR5A 5F2DA 3TP5A 4K8IA 3MEHA 1SNMA 1AEXA 4K5VA 1SNQA 4I65A 5ISRA 5C4ZA 2WACA 2EYLA 3P75A 1A3VA 2PZWA 1EQVA 4K2KA 5CV5A 5J1ZA 3U9OA 5I9OA 2F3WA 1SYBA 3D6CA 3D4WA 1SNPA 5CV7A 5EKKA 5IGGA 4QMGA 1F2YA 4EQOA 1NUCA 3HZXA 3OMCA 5IIFA 5IODA 2F0QA 2PQEA 4RKLA 3SK8A 1JOQA 1KDBA 2PZTA 1EZ8A 2OXPA 2PYKA 4K2LA 3RUZA 4DGZA 1A3UA 5C4HA 2F0HA 3D8GA 3TP8A 2O4XA 2EY2A 3D4DA 3SK5A 5KGUA 1SNCA 2F0WA 2EYOA 3R3OA 5E1FA 2NUCA 5E3FA 1EY6A 3NQTA 4K6DA 3T13A 5IGEA 4KTAA 1EY4A 4PMCA 4N9TA 5KYIA 5CR3A 1RKNA 4ZUIA 5CV4A 4NP5A 2F3VA 2PW7A 4ME5A 4KJOA 4ZQ3A 4HTHA 4K5XA 1STBA 5IGDA 3TP6A 4DU9A 5IGBA 5JAVA 1TQOA 3EJIA 4G57A 3EVQA 4WRDA 5CC4A 3NK9A 4PNYA 1KDCA 2F0FA 2EYJA 2F0OA 5EKLA 1SYDA 2QDBA 3QOJA 1EY9A 3SR1A 1JOOA 5K5PA 4B9WA 1U9RA 1SYFA 4NKLA 5DAUA 2EY6A 4DF7A 2F0NA 1SYEA 5C3XA 5NUCA 1KABA 1A2UA 3ERQA 4YIJA 5KIXA 4J1MA 2EY1A 2F0EA 3EROA 1STYA 2EYPA 2EXZA 2F0VA 2F0PA 4NDXA 3TP7A 5J22A 3NP8A 1KAAA 5I9PA 5C5LA 3S9WA 4KHVA 5C3WA 1EY7A 3VA5A 3BDLA 3E5SA 3DHQA 3SHLA 1EY8A 1KDAA 2KHSA 4NMZA 2PZUA 5C5MA 5I6WA 2EYMA 1EZ6A 4K14A 1ENAA 1F2MA 3MZ5A 2F0KA 4OL7A 5IGCA 5I6YA 3MVVA 4EVOA 1JORA 2HQEA 1A2TA 4KD4A 4LAAA 3QB3A 1EY5A 2F0LA 4WORA 3LX0A 3SXHA 2SNSA 4ODGA 1SNDA 2F0TA 5M9OA 3HEJA 5CV8A 5C6AA 2EYFA 3BDCA 1JOKA 3SK4A 2F0SA 4HMIA 1STGA 4N9PA 4S3SA 5CV6A 1STAA 4QF4A 4ZUJA 4E6IA 3MXPA 3OSOA 2ENBA 4KD3A 1IHZA 2M00A 4HMJA 1SYGA 1EYAA 1F2ZA 4IZ8A 3T16A 4R8NA 4EQPA 2F0JA 2KQ3A 3C1EA 2F0MA 5KEEA 3QOLA 1SYCA 5KYLA 4KY5A 2F0IA 2SOBA 3C1FA 2OF1A 4J6HA 4F7XA 5KRUA 2EY5A 1NSNS 1STHA 1ENCA 2RBMA 4K5WA 4F8MA 3V2TA 3MHBA 2F0GA 3P1HA 4IUNA 5CV9A 5EGTA 5HURA 3OWFA 3DMUA 4K8JA 2PW5A 4RKBA 4ID6A 3TMEA 4MIUA 2EYHA
chains in the Genus database with same CATH superfamily
1HFGA 5FLXc 2SEBD 1ZYRD 3AU7A 1SNOA 2B2YA 2B63B 2HDMA 5C0XI 2EXDA 3J80E 2ZJPA 2JA8B 4RG1A 1TT2A 1HH2P 2JXMB 3NQIA 3H09A 4QCLA 4DXFA 1B44D 4K5VA 4YCVA 2LY7A 3U4ZA 3K6OA 1N9WA 1SMYD 3TDQA 3SK8A 2MHVA 4RKLA 4RCNA 3K5NA 2PZTA 1KNAA 2A68D 2YTYA 4KKUA 4JI5L 1PH1A 5K36G 1YBYA 3GQBA 3TN2A 2BH8A 3PIOA 3HOXH 4JI6Q 4RCOA 4KHZA 3GTOH 4N9TA 1VQEA 1I4GA 3T53B 2NVQH 3GTGH 1ESRA 4A3GB 3RZOH 1DCZA 2QDBA 2BH2A 1FYCA 4RAUC 1EWHA 5C3EH 2B2VA 2HCIA 2HIXA 1WFQA 3C46A 3NWTA 3H0GB 1Z7TA 4KLKA 1ET6A 1L1OA 2WAQG 3S15B 1K3RA 1FGUA 1NBWA 5C3WA 4G7OC 1A63A 1B53A 2E76C 3M85A 2D2CC 1S5ED 3N52A 2B2YC 1Q8IA 2XN9C 4OWWB 4BXXG 3HOXB 1KIXA 2QA4A 2QDLA 4EVOA 5IWAQ 3A5UA 2E2DC 2NN6H 3AQQA 4A3JB 5K36H 2B2UC 2F0TA 3UE1A 2E2HB 2B63H 3S24A 2BA1A 1X6OA 4BY1H 1EIGA 1PH5A 3TS2A 4A3MH 1OO9B 3I4MB 3RLOA 4WJ4A 4DR2Q 3T16A 1H9MA 2A69D 1K73C 2KQ3A 2NVTB 1A0IA 5ELDA 2EY5A 4K0KL 2IJ0A 2KCNA 1EL0A 1KHIA 3V2TA 1WTRA 1JJGA 2QEJC 3ND9A 2BDOA 3PO3G 2VL6A 3F8TA 4RKBA 1CT1D 4A3KH 2Q2UA 3J81j 3VYUA 1WD0A 1SEBD 4X3SA 2K5NA 1QB5D 4A3KG 5KNDA 3PGZA 2EPBA 1RTNA 4B9XA 3OYYA 2F03A 1BO0A 2RKSA 2DUDA 4KY7A 4DV1L 3N6RA 4GZYC 2WACA 2EYLA 2QKIC 4X65Q 1CK1A 4FDBA 4MN3A 3AEVA 2IW3A 1UWVA 5JPMC 2JA5B 1K0RA 1ASZA 1GUOA 2D62A 4R9WA 4POGA 2WKCA 1I4HA 1Q1EA 4K6DA 3NQTA 3W1GA 1I4PA 3BDOA 3IAYA 4A3FH 4DV2Q 2XTIA 4JI1Q 1BCPF 1TWAH 4BY7B 3ZJYC 3HOXG 1HA5A 2EYJA 1JOOA 1Y1WB 4CJ2C 1HNZL 2BE5D 4NXNL 1QWYA 3BZKA 4OO1G 4YIJA 3TEHB 4RGMA 2N8NA 1WD1A 2EXZA 2KECA 2UXBQ 4DR3L 1RD9D 2Y0SE 4I7ZC 4F87A 5C3EB 3X3NA 4OO1H 2NZHA 5IP7G 4JI4Q 3T1HQ 1VQ4A 4K14A 3KLRA 4HJ5A 2UUBL 1NY4A 2DY7A 2K04A 4OXPA 1XPRA 1R4PB 4IFDH 5IP7H 5G3LD 3M3YH 2F0LA 1L1OB 2MNAA 3MAQA 4JI7L 4QUCA 4IJHA 2JA7H 3PUXA 4BY7H 3BDCA 1NE3A 5BN4A 2MGSA 1H9RA 3DM1A 2K01A 2F4VL 3PQIA 5FOBB 4CJ1B 1BBWA 4FP5D 4LF7Q 5C4XB 3CC4A 3T1HL 5KEEA 5KNCA 4DK6C 1SYCA 3CCRA 3RZOB 3BG3A 5KRUA 1S72A 5EKIA 1E3PA 1EUJA 1STHA 1VDZA 1VQGA 5EAYA 1KRTA 3W1BA 4ZYSA 3T51B 2VW9A 3ULPA 4A3EH 4LF4Q 3A8IE 4NXMQ 1EYCA 1Y1VG 5IGFA 4KV6A 2EJFC 1II3A 3NUCA 4B3MQ 2UXCL 1Y8OB 2BOSA 1GHKA 1JJCB 5D3DA 1UE7A 3JAME 1EOVA 2KHJA 2XSCA 1PH2A 1CUKA 2N3SA 3LWUA 4NW2A 1SLJA 4C3IG 4GOPA 2ID0A 4PMWA 3QWNA 4H13C 1BBUA 3U9OA 5I9OA 2FHTA 5EPKA 4KKSA 2F0QA 1XPUA 1D5ZC 3SEBA 5TSSA 2UUCQ 2F0HA 5M3MG 3D8GA 2ZXRA 3K57A 2M2LA 3HKZG 2CHBD 3HOUH 5E1FA 2JK8A 2WP8J 4GKJL 1EY4A 2PQAA 5IT9E 3GTJH 3H3VI 3G6JB 1N36L 4KI0A 5ELCA 1DOKA 4A3EG 4JI6L 1E2WA 1XNQQ 1PZJD 5C44H 2HUGA 3J81c 4DV3L 3S2DH 4LFBL 1LTSD 1TWFH 2F0OA 3AFPA 1HZBA 4HIOA 2WKDA 3RZDB 1SE2A 1AZPA 1N34L 3CPFA 2L15A 1GM5A 2JA8G 1QVCA 4M8AA 3KOJA 2E2JH 3TP7A 2K05A 4EGVA 5J22A 4LUZA 2N78A 2DGYA 5LL6X 5C4XG 2MUYA 1PRTD 4C3HH 2CKZB 2JA8H 1CZGA 2CW0C 4AQYL 4DUZL 5FJ8G 3CCSA 1SBBB 3GP7A 3J80i 4R4CA 2HQEA 4FO2A 1WCMB 1MIUA 4N8FA 1I6VC 3FRPB 2K33A 2GVAA 2YV5A 2IHFA 1VQLA 3FEWX 1VMPA 3GTPH 2B2WA 1EU3A 2Y0SB 1Y14B 2KUMA 4JC0A 2QGQA 2JA6B 1HUMA 3RZDH 2HHHL 4BBSH 4B08A 1EYAA 4R8NA 2I46A 1TWHH 4JK1C 3IRBA 2MFIA 1L2FA 5LMNL 1MBYA 1JB3A 3BYTB 5BR8Q 1CZWA 4ZAIA 4DUYQ 1D2BA 3TMEA 3A5ZB 4O1NA 3VR4A 2CH4W 1J8IA 2E74C 5IODA 2OT2A 4JI8L 4Q0FA 3D6WA 1D5XC 2R93B 1IW7D 1SJHD 1ZKOA 4L6TB 4XYOA 4JI8Q 2UUAQ 1C48A 1FJGQ 4IALA 1UEAB 4BWGB 4QB4A 2Z6BA 1BCPB 2A19A 4Y7NH 1HQMC 2K5DA 4G7HC 4BA2I 2DN8A 1LT6D 3BS1A 1IKMA 3B6YA 4PQXA 4EQOA 4A3LG 2D0PA 1Q90A 3L7ZC 4K2LA 4DGZA 2E2JB 2PNHA 2NVXB 4YWLA 2F0WA 1FGBD 4BY1G 3I91A 1O7IA 4A3MB 3WOEA 1O7YA 2E75C 2G5DA 3BJUA 5C0XG 2R61A 2R6GA 2WB1E 4CDDC 3ICEA 1PH8A 3EJIA 4MNOA 1B9NA 1EY9A 1HXYD 1VS0A 1ILPA 1H9SB 4DF7A 2G9DA 3CRLC 1VQMA 5H1SE 5M3FH 4CKEA 3MWYW 2F0EA 1L0WA 2EYPA 2K6AA 1BUVT 4LFCL 1Q3LA 3S1NH 5I9PA 3S9WA 2RHQB 4A4IA 4GS3A 1U4PA 1OXTA 1G91A 2JEBI 1I50B 3DEOA 1CA5A 1Q8KA 2NVXH 2NN6G 2AQ1B 1PH6A 1X3EA 4A3DG 4DR4Q 3D31A 3OIPA 1VQFA 3NSWA 3SXHA 2SNSA 5FJ8H 4JYAQ 3PUVA 4J15A 3TZDA 2XRSD 2R7ZG 2F4VQ 1U4RA 3K7AB 3K0XA 3I3CA 2IT1A 5CMDA 4R8IA 1DD2A 3S2HH 1P8LA 2IPKD 2K5WA 1IHZA 3TREA 3S15H 5IE8A 4RFBA 2SDFA 1N32L 3X3MA 2KCTA 2OF1A 1NSNS 1KC8C 4F8MA 3P1HA 3STBC 5HURA 4RGOS 1B3QA 2VB2X 4B3TQ 3E0EA 5M3FG 3WDNA 1HNZQ 3GTOB 1PV4A 4JYAL 1HR0Q 2L11A 5FO7B 3NHHA 5C3EG 1LT4D 2L55A 1SROA 3CW2C 1TWCH 1VMCA 3QG1A 5GROA 2PCFB 4ZK9B 1VQAA 1IBML 3H6MA 5JOBA 3ITPA 3HRZC 5FLMH 1E1OA 4KKTA 5DEHA 1HR0W 4FF3A 1EIFA 4X6AH 4X3TA 4DK0A 4V190 4R4TA 3I4OA 4K2KA 5FLMG 2XRQD 2N88A 1HJPA 4QMGA 1F2YA 3CC2A 1XNRQ 4QL5A 2RSOA 1A3UA 4YHHQ 4DR7L 2I0QA 4M1UB 1SFOB 2D5DA 2B3GA 3S1RB 5E4XA 1GXDC 1RTOA 5ELNA 3V05A 1GUWA 4L5QA 2Q8RE 1JE5A 5I4DA 3W2DA 3BVGA 4ZKCB 4ZQ3A 2HDLA 2JSOA 2Q2IA 4WJ3M 1SSOA 5JAVA 1AE2A 1CSQA 4QGUA 2L12A 3HOWB 1SYDA 5K5PA 3VA7A 1ICWA 2YTVA 3A74A 5C3XA 3KDFA 1QZHA 3BVMA 3I90A 1JT8A 2RF4A 1Y1VB 4HJ7A 3UDFA 5JJKA 5AJ3Q 1GOZA 4DR6L 3T56B 4JVZA 1GKHA 3SDZA 2XWJB 5DNFA 4JI0L 3KF6B 3EBEA 4PZ6A 5JVH3 2R3ZA 4N8X1 1E2VA 1RHPA 4AQYQ 1PRTB 3UI2A 3Q23A 1PXUA 4LK1C 3M4PA 5C6AA 1PH7A 3HOVH 1H9SA 4XQNA 4N9PA 3VR5A 3CHBD 3CQZB 5CV6A 1QOHA 4IOCA 2I07B 2ENBA 1YNJD 1I94L 1L0XB 2KEDA 2B2UA 2Z4HA 2KBNA 2UUAL 3HOYB 4DR6Q 5M5YB 3C1EA 3E6ZX 2XVSA 1HUNA 4F7XA 1Y8PB 1GUTA 1IL2A 1F9PA 3TQYA 3FKIB 3DMUA 1HTLD 2OWOA 1VQHA 2ASBA 5IOCA 3NWSA 2R7DA 1N33Q 2L5TA 3I4NG 1STNA 2EQSA 1N8RC 3D4RA 1E2ZA 1PTOF 4DFAA 2JN4A 1VQ7A 3OMGA 3Q8DA 3CQZH 1MSHA 4K8IA 1AFPA 4H44C 4C3HG 3CF5A 3GTLB 3I8ZA 1EQTA 1K9MC 4A3BB 3M4YA 5IGGA 3D4WA 3OMCA 4JV5Q 1S5DD 2K5QA 4B3RQ 4B3TL 5C4HA 1KAWA 1H9JA 1I4RA 1XWEA 3HKZB 2UU9Q 2A6EC 3R3OA 5IGEA 5C44G 1CKMA 3KLWA 1SMYC 1Q12A 2I5LX 3VR2A 3A8KE 4TQUS 5CR3A 4JOIA 4JI4L 1B50A 1O78A 1YEZA 4ME5A 4ME3A 4BBSG 4K5XA 4HJAA 2FFKB 4P75A 1HFNA 4LFAQ 4DNTB 3KFUA 2WFWA 4YWMA 4B9WA 1HRJA 4JCVE 4YY3Q 1WTVA 4DR5L 2CW0D 4J1MA 2KEEA 4A3EB 2JA9A 1T5EA 4OX9L 1DJRD 2PZUA 2ZJQA 4GKJQ 3KUPA 3MFYA 1F2MA 1SE3A 4JI3Q 1GUNA 3F2BA 1R4QB 3CAMA 4X66L 2XNAC 2AWOA 3OPOA 2MJ8A 1YNJC 1K83B 2QW7A 4ZRZA 5LMUQ 1UE5A 2K03A 4A3JG 1TWGB 1HR0L 3G7LA 3PIP3 1DYQA 5A35A 1CHQD 4A3LH 1CKOA 4QF4A 1WTPA 1UAPA 3AFQA 4A3JH 1WTWA 1KRSA 3ER0A 2O5JC 1RIPA 2SOBA 2EJMA 1NCVA 1YJ9A 1ENCA 4K5WA 1TXYA 1FNUA 1GD7A 1DONA 1F9SA 4IUNA 2Y0SG 4ZLTF 4X62Q 4AYBE 2FINB 3NTIA 1MHWC 1IBMQ 1H9KA 4FF4A 5JEAJ 5IP9H 3QJYA 1IBLL 5J39A 2B8GA 3K5MA 1Q7YC 2A6HC 2RDFA 3FP9A 2PPBC 2UXBL 3PCOB 2LKVA 1YZ6A 2F0UA 1JWUD 4BBSB 2DJGC 4CJ0B 3VR6A 3VR3A 1TR5A 1PZKD 1SNMA 2V1CC 3EIVA 4I65A 5ISRA 5J1ZA 1KL9A 2L4NA 1QNUA 5EQ0A 3D3RA 2KJXA 3BZDB 1LTAD 2ZM6Q 3OIQA 1OXVA 5DM73 1JB7A 1A6XA 1BCPD 2Z6KC 3A8JE 1EZ8A 4AYBB 1L1OC 4B3SQ 1X3QA 2ICIA 1IXRA 4IPHA 1EQQA 2R7ZH 1YHQA 2R92B 1N33L 1V9PA 3BYYB 4R4QA 3I55A 3J7AF 5M3MH 4FVMA 3RN5A 1WTHA 3CMAA 2NTTA 1PA6A 1PTOD 3PO3B 4OWTB 2IL8A 1ONLA 4Q5VA 3GTKH 1C7YA 4LF8L 4IUUA 2YU9H 2F0NA 4LF4L 3CCQA 3RLFA 4DV7L 3I56A 3R93A 4FXDA 2GVBA 5G3LF 1A8VA 4H0LC 4DUZQ 3VA5A 2KHSA 2J0TD 4C56C 1KTKA 3PV0A 5C5MA 3KJOA 1EZ6A 4DR1L 3U50C 1I4XA 2RQXA 1PFSA 4A3BH 4OGQC 1TY2A 2X6GA 5I6YA 4BBRG 3PSIA 4C3JB 1HCZA 4WFN3 3QR8A 1UNSA 4HIMA 3K5OA 1XPOA 4DV0L 4RHSA 4DK1A 5CV8A 1I3QB 1RDPD 2L9HA 2VQFQ 3M7GA 3OSOA 1DM0B 3HG9A 1AW7A 1QUQA 4A3DB 2NBFA 2NVYH 1WI5A 1BR9A 2K28A 3MC0B 4XYQA 1YHBA 1IBKL 2NVQB 1PYBA 3AB9A 1LYLA 1V1PA 5FKAC 3PO2B 3KF6A 2UXDL 2K5VA 1NMGA 4OIKA 4H7BA 3A0JA 5DLQE 2F0DA 1AH9A 4EX5A 3CCEA 3E9HA 1XTDA 3FMCA 4KY6A 1F77A 5M3MB 2MO0A 1VQKA 3NXWA 3I70A 5F2DA 4C2MB 1I4QA 3G4SA 2M9VA 2Z9HA 3P75A 3QIAA 5CV5A 2RVLA 4HR7B 1TS5A 5EKKA 1HTPA 1Q82C 4CHTB 2JP1A 2O5IC 1ILQA 3RUZA 4OWXB 2I5HA 1U0LA 1C8CA 1V1PB 3HS0C 3S1MB 2B63G 1HA6A 1SNCA 2EYOA 4OONA 3Q22A 4PMCA 5FK9C 4RGTA 5HGQA 1N32Q 5CV4A 1FR3A 1PH9A 4JBMA 4G57A 4IUVA 4PNYA 1JWSD 2A1AA 1WCMH 4G4KA 5C0XH 2ZXOA 3H15A 4L8JA 2XGTA 1KNEA 2FMMA 4NKLA 1MJCA 2Z1CA 3SVMA 1D5MC 4KN7C 2YYZA 5JVG3 3CMEA 4XXEA 1VQOA 4MTNA 3S17B 2UU9L 4QJFA 4C3IB 4PV1C 4P71A 4LF7L 4DNIA 1S5BD 1XMOQ 5M5WH 3BVZA 1VQBA 3F2UA 3JAMi 3ULLA 4LF5Q 1BOSA 4C3HB 5IYDH 1IL8A 1FD7D 3F2CA 4XT3B 4OHJA 1B4OA 4MZ9A 3HOZB 3MFGA 3HOYH 1LLRD 3BU2A 1Q81C 1JOKA 2MO1A 4LFCQ 1LTRD 2WAQB 4CKBA 3I4LA 1A15A 4IFDI 3HOYG 1F2ZA 1TVXA 2EJGC 3GV3A 3P7JA 4QQBX 4DV2L 4A3FG 2ICEC 1F9QA 2DJFC 2FXQA 1CM9A 4JI2Q 1NTGA 2H4OA 5T1GA 4X64Q 3MHBA 3S14H 2F0GA 4FNFA 2K4KA 4FXGC 1TS4A 5LMUL 1X3GA 2CFMA 1TWHB 1AN8A 1Q46A 1WTXA 2PQAB 1YNXA 4R4IA 1LTBD 3OW7A 3NPPA 1EY0A 4TVAB 1QUQB 3S16B 3STBD 2ZTEA 2ALYB 1VF5C 1HZCA 4PG3A 2HHHQ 4U68A 4QIWE 4F88A 2R92G 4KHPQ 2ZM6L 2IWHA 3FPUB 4LFBQ 2A6HD 3LWEA 2L0CA 1V1QA 3CCMA 2J7ZA 1SYBA 3FVQA 1EEID 1ML0D 5IIFA 5CORA 1ET9A 2EVBA 3DWAA 3M3YB 5C0XJ 1M90C 1SR3A 1S4ZA 4DAVA 2PYKA 1B7YB 1L0YB 1BVSA 3M4QA 2JE6I 1YNND 3D4DA 1JMCA 3T13A 4R4OA 1HZ9A 5KYIA 3MXNA 3NBHA 1O7LA 5D14A 4CDEC 4JBJA 2HD3A 4NPSA 3TP6A 4DU9A 2K14A 5BR8L 5AFWA 1Z47A 5EKLA 4GLXA 4IO9A 3SR1A 1LTID 5ELFA 5I2YA 1QJOA 1GO3E 2B8FA 1X32A 4C3JG 2JEAI 4DAYA 3VYTA 4LF8Q 4Y52H 2F0VA 2MP1A 1IBLQ 1SE8A 1DOLA 5C5LA 1VQJA 4KMUC 4NMZA 2V4DA 5JEAH 3RLNA 4XT1B 3CP0A 1VCIA 4C3IH 4ABNA 4WORA 1DGSA 4LNQA 3KBXA 3V96A 1N34Q 1TWCB 2E8GA 3MA2B 5IWAL 1KQSA 4DV4L 1RJTA 4IJLA 4ULLA 4BS9A 4IPCA 4YWKA 5IYDG 3LGJA 3IFDA 4JBKA 2G9HD 4HMJA 3IFTA 3HOVG 1E24A 1N36Q 2UXDQ 4J6HA 2KOLA 3PUYA 1IW7C 5CV9A 3OWFA 5EBCA 1TWFB 5JJLA 1ZEQX 3JAMc 5M3FB 1DZ1A 1ENFA 3S17H 1EYDA 1PFBA 1TWGH 4IUPA 4DR3Q 4P74A 2KA7A 4KJNA 2O2LD 4A3IB 4HIKA 2YTXA 5CBEE 1BCPC 3VYRA 5C4XH 1QZGA 4IN3A 2AMCB 4K0KQ 2H1EA 5JJIA 3JC66 3FPPA 1SNPA 4CKCA 4DV1Q 1GVPA 3RMHA 2K1BA 2RDGA 1EFID 3WOFA 3L9AX 2JYOA 3SK5A 5KGUA 1WJJA 2NUCA 1AE3A 1VQPA 2CQAA 4ZUIA 1LM0A 4K6LA 2BDNA 4NP5A 4HTHA 4HCEA 1W6KA 4A93G 5FO8B 1Y8NB 1ESFA 1BQQT 1LT3D 1TQOA 3CPWA 3EVQA 1UE1A 4X65L 4LF6Q 4H02A 4CBVA 4GNXB 3QOJA 1JJ2A 2AKWB 1U9RA 2E2HH 1SMXA 3A56A 1NAPA 4A93H 3GTMH 2EY6A 3PO2H 1J9OA 3G71A 3ERQA 3CCJA 4PZ8A 3VDYA 2UXCQ 1I94Q 5M5XH 3GD7A 1WYDA 3K5LA 5IP9G 1MJEA 1KAAA 1FNWA 4FF2A 5GAEC 1D8LA 2LS01 4RA8A 4GNXC 4YCWA 2JQOA 4JI7Q 2F0KA 3CRKC 2WV6D 1FL0A 1LACA 2P5ZX 4ZKBB 5JEAG 1PRTC 4BA1I 4ODGA 2A69C 3H3VH 3ULJA 1NNXA 2K75A 1HHVA 3S1RH 1YHAA 3R8BA 3MXPA 4L63B 3D0FA 1E7ZA 2CQOA 5JPNC 2ES2A 2F0MA 3CCLA 4QUFA 1WOCA 2DY8A 1R9TH 1EFWA 1OXUA 2RCNA 5EGTA 1K8GA 3ERSX 4DK3C 2R7ZB 2PW5A 1WCMG 3J7ZC 1XNRL 2Q2TA 4DAPA 4MIUA 3H0GH 5D3IB 2ATWA 4AH6A 4PMBA 3I7FA 2IHEA 4GN3B 3CCVA 2CCZA 3GTQH 4DR2L 3PIO3 2F3WA 2PI2A 5CV7A 2KHIA 4OIJA 1UEBA 2K32A 1S3OA 3GDEA 4DR5Q 1I6HB 1X56A 1SDFA 1PTOC 2O4XA 2LFNA 1EY6A 5LHY1 2F3IA 2NTSA 5GAHC 1LABA 4JI0Q 3HFZB 3PUZA 1CQFA 5IGBA 3FKIG 3CKIB 1H95A 4HSVA 1PH4A 3OOCA 2A6ED 4IPDA 1KDCA 1K83H 1I3QH 3L3OC 4JG2A 1XNQL 3J7A5 2GA4B 3LNNA 1SYEA 4GOPC 1B1ZA 1EIYB 3DM3A 1K28A 4UDUC 1I6HH 1TKWB 2NN6I 1NMFA 3S1MH 4RHRA 3J80c 3G6EA 4G7ZC 1QVGA 3GTLH 1C9OA 3HOWG 2VUMH 2CH4A 3HP3A 3U9SA 1OTCA 3HKSA 5LMNQ 2R92H 1V8QA 3MVVA 3GTJB 4XQQA 4DV4Q 1IYJB 3S2HB 4GNXA 3NENA 3IKJA 1SNDA 1DOMA 4HJ8A 1X9NA 1STAA 2E5LQ 2CWPA 1YI2A 2YU9B 2OTJA 1VQ5A 5IYBH 1W6JA 3HKZE 5COYA 3H91A 1E22A 2HQLA 3A54A 5I2XA 4IUTA 3SE0A 4X3UA 4LF6L 3T4AC 1PFNA 1ZYRC 2RBMA 1Y1WH 1SXTA 5C4JB 3CXCA 3S16H 4ID6A 4JI5Q 2IX1A 2OEOA 4DUYL 4ZCKA 4C3JH 3M9BA 1G6ZA 1UE6A 3H0GG 1A62A 5EPLA 2VUMG 1YJNA 1XMOL 1STEA 5ELBA 1MI2A 3KBGA 4IFDG 1AEXA 5CYUA 2QCPX 4LUVA 4XIGS 4GKKL 4O42A 1EQVA 3PF5A 4DR4L 1PMRA 3NEMA 1PH3A 2RDHA 3L0OA 1SFOH 3S14B 4HSPA 4LF9L 2PQEA 4YY3L 3OWEB 1LT5D 3K80C 2AUJD 2LSSA 2NYZD 4FXKC 2WB1G 2RCFA 1XX8A 3NTKA 2K5HA 1ZXTA 5HY6A 3ND8A 2J4XA 4HJ9A 2E5LL 4JOIC 3UE0A 4B3ML 1TY0A 3T1YQ 3QO2A 5D65A 1M4VA 2XIWA 1EIHA 3TS0A 2WIIB 1EWCA 1D1IA 1QG7A 1STBA 5FLXL 1CTMA 4GN4B 3T1YL 1CSPA 4X64L 1JC7A 2VY3A 5CC4A 1U5KA 4OO1I 5E4WC 4LF5L 3KF8B 4DV0Q 5IT9c 1S5CD 5DAUA 3FKIH 4POFA 5EBDA 2PNRC 1QCBD 1SN8A 2F0PA 3I73A 2D0OA 1GUSA 4DA2A 2B2VC 3U58A 1EY7A 5BN3A 2VS1A 2A8VA 1IKLA 4RH6A 3R2TA 2HT1A 4WJWA 3SGIA 3MZ5A 1B8AA 1NJIC 2VQEL 3TSSA 3Q24A 2D9UA 3HOWH 2UUBQ 1HZAA 1PFMA 4DAMA 1LTGD 4L5RC 4E6IA 3DWQA 2R93G 4LUOA 3TZUA 4U673 4AYBG 1BKBA 4KD3A 4O0AA 1S40A 2M00A 1SYGA 4EQPA 3S1QH 3P20A 5KYLA 3C1FA 4HCSA 2Q8TA 5IY0A 4C1NK 5ELOA 2BCOA 1K0SA 2PMZB 1YIJA 2OQ0A 4B3RL 1JE4A 1XYIA 4L5TA 3DEPA 2NVYB 5CGKA 4EQNA 3HOZG 2VZAA 1Y1WG 3EN2A 4TSSA 1X55A 4X3KA 1KD1C 2HCCA 3W3AA 3CD6A 1GJXA 3CU7A 4A3GH 4IQZA 3NTHA 2Q2HA 2C9OA 3MXUA 2CWAA 3K7AH 1D1KA 2C35B 1G51A 2WAQE 4UP7A 2I5MX 2DNEA 3A55A 2FJ2A 2NVTH 4DV3Q 4A3GG 5LMNW 1K8MA 1JWMD 4UAIA 1WVLA 3J7AV 5IGDA 4YHHL 4DR7Q 4LMQD 4DV6L 4X62L 4C2MH 1VQIA 4P73A 1CA6A 1WTQA 1DXMA 1IYVA 2A74C 1Z6HA 4B3SL 3E3XA 2F3VA 2K7VA 2ZXPA 1YVCA 2BA0A 3FDTA 2L1BA 3PO2G 1PYWD 1IBKQ 1MD2D 2FMCA 5EPJA 2Z4IA 5A2QL 3HOZH 4GOPB 1J5EL 1EQRA 5NUCA 1A2UA 1VQ9A 1YITA 1RCVD 2EY1A 4RGNA 2MQHA 4UPAA 2VQFL 4JBWA 1LV9A 4IOAA 2MPMA 4LJZC 2A73B 4RWSC 3SHLA 1FJGL 3M7NA 1EY8A 2X6LA 1PYSB 1YJWA 3AYHB 3DUZA 1HPCA 2IY5B 2CVRA 5IGCA 3K58A 1JICA 1JORA 1A2TA 4KD4A 2LXJA 1B3AA 5GAGC 2PO4A 4DR1Q 2VNUD 1MGSA 1NR4A 1CKNB 4TKOB 2TMPA 4A3IH 1J5EQ 1CFMA 3U4VA 2QEXA 4ILWA 1HNXQ 3Q6SA 4XQJA 1B9MA 1CHPD 1RODA 2C5CA 1EEFD 2N49A 3M4OH 1BBXC 2KCMA 3QOLA 1KLGD 3R2IA 2ZTCA 3NELA 2JJQA 4DKAC 1OXXK 2KENA 4JI3L 1LTLA 3I72A 4K8JA 5KNBA 3S1QB 1F2LA 4OEMB 1EU4A 1LUZA 2EYHA 4KJOA 2QILA 1U4MA 4YCUA 3J7YW 3J81L 3I4NB 4IUQA 3NBHB 4P2CB 2E2IH 4A76A 1B70B 1VQ6A 3HOVB 5M5WB 5HGTA 3TP5A 3MXNB 1XXGA 3WWVA 3NE5B 1A3VA 2DNCA 4A3BG 2B39A 1K3BC 1E0BA 1G2TA 3HZXA 4JPBW 2AQ2B 2NWGA 4BBRH 2OXPA 1P16A 3TP8A 1HNWL 3O13A 1T9HA 1X65A 5C44B 4A3KB 3PF4A 5E3FA 3KDFB 4KN4C 2AQ3B 2A68C 4RMFA 5IYBG 4I7AA 2GN5A 2VQEQ 3NK9A 4X66Q 2X69A 3EQLC 1SYFA 4FF1A 3J81i 4JV5L 1IYUA 4CGYB 2JA5G 1TU2B 4PZ7A 2VUMB 1STYA 1W3SA 2VXWA 3A7AB 5GADC 3NP8A 1KXLA 5M5YH 5IYCG 3W5OA 2JA5H 2BE5C 3JAML 4UY8C 4IPGA 4MHEA 3MEFA 4BY7G 5T1IA 5IYCH 1PHJA 1XMQL 1BNZA 2KCCA 1BF4A 3QB3A 1Z9FA 1EY5A 1O80A 3LX0A 4J8QA 3RD4A 2B29A 2KVMA 4DAYB 1PRTF 1PTOH 3DLLA 1QVFA 3C2PA 4R1JA 4ZUJA 4Z9CB 2WB1B 5J3BA 2IX0A 3HGBA 4DV5L 4A3MG 4BY1B 1Y69U 3GTGB 1E1TA 3J81E 1M1KC 2Z8LA 1WTOA 1C4QA 5EJWA 4BBRB 4QIWB 1TS3A 3HOUB 1CI3M 1SE4A 1X3FA 1RF2D 1UUPA 1MKHA 4OELB 4L5SA 4NXNQ 3OW2A 1A3TA 3SK6A 3GTPB 1V43A 2JA7B 4XDXA 4QY7A 2RSNA 1PTOB 5IT9L 1BDOA 1TWAB 3OHXC 2VB3X 3MEHA 1I50H 1SNQA 4HEDA 5C4ZA 1W2BA 4CDCC 5LL6S 1XMQQ 4O2DA 2K50A 1NUCA 4IURA 2RHSB 1JOQA 2OCEA 1SJED 3I4MG 2K52A 1O7ZA 1J6QA 2EY2A 4ALPA 3M4OB 2RA4A 2B2TA 1EYGA 1VQNA 4DV5Q 1PZID 1LTTD 2WINB 1I5FA 2Z6KA 3KLSA 4WRDA 1M8AA 4JI2L 2OQKA 3GTQB 2EIFA 2HIVA 2PI2E 4LWCA 5L37A 3E9IA 3FHWA 2B2WC 1G291 4A3CH 4HN7A 4UHVA 3I4NH 5AJ3L 1MSGA 1S5FD 3GTMB 4A3CG 1OXSC 3DHQA 2AHOB 1KDAA 1D6EC 2H5XA 4HIDA 3K0YA 5I6WA 2EYMA 2F4IA 4A75A 1ENAA 3KF8A 1KLUD 4OL7A 1D7QA 3K81C 1G6PA 4NXML 2NB0A 2R93H 3PUWA 1Q1BA 1EWIA 4DV6Q 5M9OA 4UP8A 3HEJA 2EYFA 1JCKB 2F52A 4C1NI 2JA7G 2IX3A 2EE1A 3UDXA 4GN5A 3Q0AA 2XWBB 4IZ8A 4APVA 3S1NB 3URYA 1G8ZD 4KY5A 2R7FA 4LFAL 3MTSA 4GKKQ 3CCUA 3RNUA 3BZCA 2Z0SA 5ELEA 1IZ6A 4GLAC 4A93B 3I2ZA 4MTKA 3C3LA 1Q86C 2OTLA 1U4LA 3PMFA 1LO5D 2A5HA 5M5XB 4LW1A 1RL2A 1JQYD 4FYDA 2SNMA 1R9TB 5JJZA 1G2SA 1XJVA 2NZOA 1QE6A 2PMZE 1EOTA 4IFDJ 1XTCD 1PDQA 1T5XD 3GV6A 1VQCA 3DWPA 1VQ8A 2EOTA 4DXGA 4TRDA 4JI1L 4XTCS 5FLXE 3OTOQ 4LF9Q 3EFXD 3GTKB 2PZWA 2ZJRA 4DN4M 3E0JA 4KK7A 3D6CA 2EDGA 1SRUA 3OTOL 3J80L 1FNVA 1KDBA 3UDGA 5E7NA 2B2TC 3RN2A 4V0BA 5C4JH 1TIID 4A3IG 1QILA 1BXTA 3RR5A 2TSSA 4GLVB 3KYHC 4KTAA 3I4MH 4P72A 1RKNA 2QF7A 3KK7A 2PW7A 2LMCB 3ZYYX 3A7LA 1V1OA 1YNNC 2NZ1D 1CQVA 1AZQA 3DXJC 2F0FA 1PLFA 3H94A 2ZTDA 2AWNA 1ASYA 1HNXL 1VQDA 1Y1VH 1QNKA 5BN5A 3AMUA 1KABA 1B2TA 1K8OA 5KIXA 3F2DA 1CKNA 3EROA 3IL8A 3GO5A 4DPGA 4NDXA 1HNWQ 1K8AC 2UUCL 1TS2A 4BXXH 3MXGA 5CBAE 4KHVA 3PIPA 3K7UC 1FVIA 3BDLA 3E5SA 1SAPA 1HQRD 2E2IB 4A3DH 3G48A 4KHPL 1GUGA 2F1MA 1NR2A 3K59A 5FO9B 1X54A 4JW0A 2AUKA 3H3VC 3EA6A 1X3PA 4LAAA 1VF7A 4UP9A 4NB3A 3F1ZA 3NBIA 3VYSA 3KLSX 3K8AA 5GQOA 3HOUG 1AP0A 4DNRB 3SK4A 2F0SA 4HMIA 1STGA 4S3SA 1ICFB 2EZVA 4DV7Q 3CC7A 2JA6G 1C0AA 3UDIA 2Q8IB 3L2PA 4OX9Q 2F0JA 4Y7NB 3PO3H 3ONAB 4A3FB 1PVOA 3TRZA 3S2DB 2F0IA 2LXKA 2JA6H 4HAEA 1JR0D 1F9RA 3KJPA 2N55A 1GHJA 3TBIB 5DM63 4EQ5A 4CDFC 5A2QE 4AIMA 2ZT9C
chains in the Genus database with same CATH topology
1HFGA 2SEBD 1ZYRD 3AU7A 1SNOA 2B2YA 2B63B 2HDMA 5C0XI 3J80E 2JA8B 1TT2A 2JXMB 3NQIA 3H09A 4QCLA 4DXFA 1B44D 4K5VA 2LY7A 3K6OA 1SMYD 3TDQA 3SK8A 2MHVA 4RKLA 4RCNA 3K5NA 2PZTA 1KNAA 2A68D 4KKUA 5K36G 3GQBA 3TN2A 4RCOA 4KHZA 4N9TA 1I4GA 3T53B 1ESRA 4A3GB 1DCZA 2QDBA 1FYCA 4RAUC 1EWHA 2B2VA 2HCIA 3C46A 3NWTA 3H0GB 1Z7TA 1ET6A 3S15B 5C3WA 4G7OC 1B53A 2E76C 3M85A 2D2CC 1S5ED 3N52A 2B2YC 1Q8IA 2XN9C 3HOXB 4EVOA 2E2DC 2NN6H 4A3JB 5K36H 2B2UC 2F0TA 2E2HB 2BA1A 1EIGA 1OO9B 3I4MB 3T16A 1H9MA 2A69D 2KQ3A 2NVTB 5ELDA 2EY5A 2IJ0A 2KCNA 1EL0A 3V2TA 1WTRA 2QEJC 3ND9A 2BDOA 4RKBA 1CT1D 3VYUA 1WD0A 1SEBD 4X3SA 1QB5D 5KNDA 2EPBA 1RTNA 4B9XA 2F03A 1BO0A 2RKSA 4KY7A 3N6RA 4GZYC 2WACA 2EYLA 2QKIC 1CK1A 4MN3A 2IW3A 5JPMC 2JA5B 1GUOA 2D62A 4R9WA 2WKCA 1I4HA 1Q1EA 3NQTA 4K6DA 3IAYA 1I4PA 3BDOA 1BCPF 4BY7B 1HA5A 2EYJA 1JOOA 1Y1WB 4CJ2C 2BE5D 1QWYA 4OO1G 4YIJA 4RGMA 1WD1A 2EXZA 2KECA 1RD9D 4I7ZC 4F87A 5C3EB 3X3NA 4OO1H 4K14A 3KLRA 2DY7A 2K04A 1R4PB 4IFDH 5G3LD 2F0LA 3MAQA 4QUCA 3PUXA 3BDCA 5BN4A 2MGSA 1H9RA 3DM1A 2K01A 5FOBB 4CJ1B 4FP5D 5C4XB 5KEEA 5KNCA 1SYCA 3RZOB 3BG3A 5KRUA 5EKIA 1STHA 1VDZA 4ZYSA 3T51B 3A8IE 1EYCA 5IGFA 4KV6A 2EJFC 1II3A 3NUCA 1Y8OB 2BOSA 1GHKA 5D3DA 3JAME 2XSCA 3LWUA 4C3IG 4NW2A 2ID0A 4PMWA 3QWNA 4H13C 3U9OA 5I9OA 2FHTA 5EPKA 4KKSA 2F0QA 1D5ZC 3SEBA 5TSSA 2F0HA 3D8GA 2ZXRA 3K57A 2M2LA 2CHBD 5E1FA 2WP8J 1EY4A 5IT9E 3G6JB 4KI0A 5ELCA 1DOKA 1E2WA 1PZJD 2HUGA 1LTSD 2F0OA 2WKDA 3RZDB 1SE2A 1AZPA 4M8AA 3TP7A 2K05A 4EGVA 5J22A 5LL6X 2MUYA 1PRTD 1CZGA 2CW0C 1SBBB 3GP7A 2HQEA 4FO2A 1WCMB 1I6VC 3FRPB 2K33A 3FEWX 1VMPA 2B2WA 1EU3A 2Y0SB 2KUMA 2JA6B 1HUMA 4B08A 1EYAA 4R8NA 2I46A 4JK1C 1MBYA 1JB3A 3BYTB 1CZWA 4ZAIA 1D2BA 3TMEA 4O1NA 3VR4A 1J8IA 2E74C 5IODA 2OT2A 4Q0FA 3D6WA 1D5XC 2R93B 1IW7D 1SJHD 1ZKOA 4L6TB 4XYOA 1C48A 4IALA 1UEAB 4BWGB 4QB4A 1BCPB 1HQMC 2K5DA 4G7HC 4BA2I 2DN8A 1LT6D 3BS1A 1IKMA 4PQXA 4EQOA 1Q90A 3L7ZC 4K2LA 4DGZA 2E2JB 2NVXB 2F0WA 1FGBD 4A3MB 3I91A 3WOEA 1O7YA 2E75C 5C0XG 2R61A 2R6GA 3EJIA 1B9NA 1EY9A 1HXYD 1ILPA 1H9SB 4DF7A 2G9DA 3CRLC 4CKEA 3MWYW 2F0EA 2EYPA 2K6AA 1BUVT 1Q3LA 5I9PA 3S9WA 1U4PA 1OXTA 1G91A 2JEBI 1I50B 3DEOA 1CA5A 2NN6G 2AQ1B 3D31A 3OIPA 3NSWA 3SXHA 2SNSA 3PUVA 3TZDA 2XRSD 1U4RA 3K7AB 3I3CA 2IT1A 5CMDA 4R8IA 1DD2A 2IPKD 2K5WA 1IHZA 4RFBA 2SDFA 3X3MA 2OF1A 1NSNS 4F8MA 3P1HA 5HURA 4RGOS 2VB2X 3WDNA 3GTOB 2L11A 5FO7B 3NHHA 1LT4D 2L55A 1VMCA 3QG1A 2PCFB 4ZK9B 3H6MA 5JOBA 3ITPA 3HRZC 5DEHA 4KKTA 4FF3A 4X3TA 4DK0A 4V190 4K2KA 2XRQD 2N88A 4QMGA 1F2YA 2RSOA 1A3UA 4M1UB 1SFOB 2D5DA 3S1RB 5E4XA 1GXDC 1RTOA 3V05A 1GUWA 2Q8RE 5I4DA 3W2DA 3BVGA 4ZKCB 4ZQ3A 2HDLA 2JSOA 1SSOA 5JAVA 2L12A 3HOWB 1SYDA 5K5PA 3VA7A 1ICWA 5C3XA 3BVMA 3I90A 1Y1VB 1GOZA 3T56B 3SDZA 2XWJB 5DNFA 5JVH3 2R3ZA 1E2VA 1RHPA 1PRTB 3UI2A 3Q23A 1PXUA 4LK1C 5C6AA 1H9SA 4XQNA 4N9PA 3VR5A 3CHBD 3CQZB 5CV6A 1QOHA 2I07B 2ENBA 1YNJD 1L0XB 2KEDA 2B2UA 2Z4HA 3HOYB 5M5YB 3C1EA 3E6ZX 2XVSA 1HUNA 4F7XA 1Y8PB 1GUTA 1F9PA 3FKIB 3DMUA 1HTLD 5IOCA 3NWSA 2L5TA 1STNA 3D4RA 1E2ZA 1PTOF 4DFAA 3OMGA 1MSHA 4K8IA 1AFPA 4H44C 3GTLB 4C3HG 3I8ZA 1EQTA 4A3BB 3M4YA 5IGGA 3D4WA 3OMCA 1S5DD 2K5QA 5C4HA 1H9JA 1I4RA 1XWEA 3HKZB 2A6EC 3R3OA 5IGEA 3VR2A 1SMYC 1Q12A 3A8KE 4TQUS 5CR3A 1B50A 1O78A 4ME5A 4K5XA 2FFKB 1HFNA 4DNTB 4B9WA 1HRJA 1WTVA 2CW0D 4J1MA 2KEEA 4A3EB 1T5EA 1DJRD 2PZUA 3KUPA 3MFYA 1F2MA 1SE3A 1GUNA 1R4QB 2XNAC 2AWOA 3OPOA 2MJ8A 1YNJC 1K83B 4ZRZA 2K03A 1TWGB 3G7LA 3PIP3 1DYQA 5A35A 1CHQD 4QF4A 1WTPA 1UAPA 1WTWA 2O5JC 2SOBA 2EJMA 1NCVA 1ENCA 4K5WA 1FNUA 1DONA 1F9SA 4IUNA 4ZLTF 2FINB 3NTIA 4FF4A 1H9KA 5JEAJ 3QJYA 5J39A 2B8GA 3K5MA 2A6HC 2RDFA 2PPBC 2LKVA 2F0UA 1JWUD 4BBSB 4CJ0B 3VR6A 3VR3A 1TR5A 1PZKD 1SNMA 4I65A 5ISRA 5J1ZA 2L4NA 1QNUA 5EQ0A 3D3RA 2KJXA 3BZDB 1LTAD 3OIQA 1OXVA 5DM73 1A6XA 1BCPD 3A8JE 1EZ8A 4AYBB 1X3QA 2ICIA 2R92B 3BYYB 3J7AF 4FVMA 2NTTA 1PTOD 3PO3B 2IL8A 1ONLA 4Q5VA 4IUUA 2F0NA 3RLFA 3R93A 4FXDA 5G3LF 4H0LC 3VA5A 2KHSA 2J0TD 4C56C 1KTKA 3PV0A 5C5MA 1EZ6A 1I4XA 2RQXA 4OGQC 1TY2A 2X6GA 5I6YA 4C3JB 1HCZA 4WFN3 1UNSA 3K5OA 4DK1A 4RHSA 5CV8A 1I3QB 1RDPD 2L9HA 3M7GA 3OSOA 1DM0B 3HG9A 1AW7A 4A3DB 2NBFA 1BR9A 2K28A 3MC0B 4XYQA 2NVQB 3AB9A 1V1PA 5FKAC 3PO2B 4OIKA 4H7BA 2F0DA 3FMCA 4KY6A 1F77A 5M3MB 3NXWA 3I70A 5F2DA 4C2MB 1I4QA 2M9VA 3P75A 3QIAA 5CV5A 2RVLA 4HR7B 1TS5A 5EKKA 1HTPA 4CHTB 2JP1A 2O5IC 1ILQA 3RUZA 1C8CA 1V1PB 3HS0C 3S1MB 1HA6A 1SNCA 2EYOA 3Q22A 4PMCA 5FK9C 4RGTA 5CV4A 1FR3A 4G57A 4IUVA 4PNYA 1JWSD 4G4KA 5C0XH 2ZXOA 4L8JA 1KNEA 2FMMA 4NKLA 2Z1CA 3SVMA 1D5MC 4KN7C 2YYZA 5JVG3 4XXEA 3S17B 4C3IB 4PV1C 1S5BD 3BVZA 3F2UA 1BOSA 4C3HB 1IL8A 1FD7D 4XT3B 4OHJA 1B4OA 3HOZB 3MFGA 1LLRD 1JOKA 1LTRD 2WAQB 4CKBA 3I4LA 1A15A 4IFDI 1F2ZA 1TVXA 2EJGC 3GV3A 3P7JA 2ICEC 1F9QA 1CM9A 2H4OA 5T1GA 3MHBA 2F0GA 4FNFA 4FXGC 1TS4A 1TWHB 1AN8A 1WTXA 1LTBD 3OW7A 3NPPA 1EY0A 3S16B 1VF5C 4U68A 4F88A 2IWHA 3FPUB 2A6HD 3LWEA 2L0CA 2J7ZA 1SYBA 3FVQA 1EEID 1ML0D 5IIFA 5CORA 1ET9A 2EVBA 3DWAA 3M3YB 5C0XJ 1S4ZA 4DAVA 2PYKA 1L0YB 2JE6I 1YNND 3D4DA 3T13A 5KYIA 3MXNA 3NBHA 1O7LA 5D14A 3TP6A 4DU9A 5AFWA 1Z47A 5EKLA 3SR1A 1LTID 5ELFA 5I2YA 1QJOA 2B8FA 1X32A 4C3JG 2JEAI 4DAYA 3VYTA 2F0VA 2MP1A 1DOLA 5C5LA 4KMUC 4NMZA 2V4DA 5JEAH 4XT1B 1VCIA 4ABNA 4WORA 3KBXA 3V96A 1TWCB 3MA2B 1RJTA 4ULLA 4BS9A 3IFDA 2G9HD 4HMJA 3IFTA 4J6HA 2KOLA 3PUYA 1IW7C 5CV9A 3OWFA 5EBCA 1TWFB 1ZEQX 5M3FB 1DZ1A 1ENFA 1EYDA 1PFBA 4IUPA 2KA7A 4KJNA 2O2LD 4A3IB 5CBEE 1BCPC 3VYRA 4IN3A 2H1EA 3FPPA 1SNPA 4CKCA 3RMHA 2K1BA 2RDGA 1EFID 3WOFA 3L9AX 2JYOA 3SK5A 5KGUA 2NUCA 2CQAA 4ZUIA 4K6LA 2BDNA 4NP5A 4HTHA 4HCEA 1W6KA 5FO8B 1Y8NB 1ESFA 1BQQT 1LT3D 1TQOA 3EVQA 4CBVA 3QOJA 1U9RA 3A56A 1NAPA 2EY6A 1J9OA 3ERQA 3GD7A 3K5LA 1KAAA 1FNWA 4FF2A 2LS01 4RA8A 2F0KA 3CRKC 2WV6D 1LACA 4ZKBB 5JEAG 1PRTC 4BA1I 4ODGA 2A69C 1HHVA 3R8BA 3MXPA 4L63B 5JPNC 2F0MA 4QUFA 2DY8A 1OXUA 5EGTA 2R7ZB 2PW5A 4DAPA 4MIUA 5D3IB 4PMBA 3PIO3 2F3WA 5CV7A 1I6HB 4OIJA 2K32A 1SDFA 1PTOC 2O4XA 2LFNA 1EY6A 5LHY1 2NTSA 1LABA 1CQFA 3PUZA 5IGBA 3CKIB 4HSVA 3OOCA 2A6ED 1KDCA 3L3OC 2GA4B 3LNNA 1SYEA 1B1ZA 4UDUC 1TKWB 2NN6I 4RHRA 4G7ZC 3HP3A 3U9SA 1V8QA 3MVVA 3GTJB 4XQQA 3S2HB 3IKJA 1SNDA 1DOMA 1STAA 2YU9B 1W6JA 5COYA 3H91A 3A54A 5I2XA 4IUTA 3SE0A 4X3UA 3T4AC 1PFNA 1ZYRC 2RBMA 1SXTA 5C4JB 4ID6A 2IX1A 2OEOA 1G6ZA 5EPLA 1STEA 5ELBA 1MI2A 3KBGA 4IFDG 1AEXA 5CYUA 2QCPX 4XIGS 4O42A 1EQVA 1PMRA 2RDHA 3S14B 4HSPA 2PQEA 3OWEB 1LT5D 2AUJD 2NYZD 4FXKC 1XX8A 3NTKA 1ZXTA 3ND8A 2J4XA 1TY0A 3QO2A 5D65A 1M4VA 2XIWA 1EIHA 2WIIB 1EWCA 1D1IA 1QG7A 1STBA 5FLXL 1CTMA 1JC7A 5CC4A 4OO1I 5E4WC 1S5CD 5DAUA 5EBDA 2PNRC 1QCBD 2F0PA 3I73A 1GUSA 4DA2A 2B2VC 1EY7A 5BN3A 1IKLA 4RH6A 3R2TA 4WJWA 3MZ5A 3TSSA 3Q24A 2D9UA 1PFMA 1LTGD 4E6IA 3DWQA 3TZUA 4U673 4KD3A 2M00A 1SYGA 4EQPA 3P20A 5KYLA 3C1FA 4HCSA 2Q8TA 4C1NK 2BCOA 2PMZB 1JE4A 1XYIA 3DEPA 2NVYB 5CGKA 4EQNA 4TSSA 4X3KA 2HCCA 3W3AA 1GJXA 3CU7A 4IQZA 3NTHA 2C9OA 3MXUA 1D1KA 3A55A 2DNEA 2FJ2A 1K8MA 1JWMD 4UAIA 1WVLA 3J7AV 5IGDA 4LMQD 1CA6A 1WTQA 1DXMA 1IYVA 2A74C 1Z6HA 2F3VA 2K7VA 2ZXPA 2BA0A 3FDTA 2L1BA 1PYWD 1MD2D 2FMCA 5EPJA 2Z4IA 5A2QL 5NUCA 1A2UA 1RCVD 2EY1A 4RGNA 4JBWA 1LV9A 2MPMA 4LJZC 2A73B 4RWSC 3SHLA 3M7NA 1EY8A 2X6LA 3DUZA 1HPCA 2CVRA 5IGCA 3K58A 1JICA 1JORA 1A2TA 4KD4A 1B3AA 2VNUD 2PO4A 1MGSA 1NR4A 4TKOB 2TMPA 1CFMA 4ILWA 3Q6SA 4XQJA 1B9MA 1CHPD 1RODA 2C5CA 1EEFD 1BBXC 3QOLA 1KLGD 3R2IA 1OXXK 3I72A 4K8JA 5KNBA 3S1QB 1F2LA 1EU4A 2EYHA 4KJOA 2QILA 1U4MA 3J7YW 3J81L 3I4NB 4IUQA 4P2CB 3HOVB 5M5WB 5HGTA 3TP5A 1XXGA 3NE5B 1A3VA 2DNCA 2B39A 1E0BA 1G2TA 3HZXA 2AQ2B 2NWGA 2OXPA 3TP8A 3O13A 5C44B 4A3KB 5E3FA 4KN4C 2AQ3B 2A68C 3NK9A 2X69A 3EQLC 1SYFA 4FF1A 1IYUA 4CGYB 1TU2B 2VUMB 1STYA 2VXWA 3A7AB 3NP8A 2BE5C 3JAML 4MHEA 5T1IA 1BNZA 2KCCA 1BF4A 3QB3A 1EY5A 1O80A 3LX0A 4J8QA 3RD4A 2KVMA 1PRTF 1PTOH 3C2PA 4ZUJA 4Z9CB 2WB1B 2IX0A 3HGBA 4BY1B 1Y69U 3GTGB 3J81E 2Z8LA 1WTOA 1C4QA 5EJWA 4BBRB 4QIWB 1TS3A 3HOUB 1CI3M 1SE4A 1RF2D 1UUPA 1A3TA 3SK6A 3GTPB 1V43A 2JA7B 4XDXA 2RSNA 1PTOB 5IT9L 1BDOA 1TWAB 3OHXC 2VB3X 3MEHA 1SNQA 4HEDA 5C4ZA 5LL6S 1NUCA 4IURA 1JOQA 1SJED 1O7ZA 2EY2A 3M4OB 2RA4A 2B2TA 1PZID 1LTTD 2WINB 3KLSA 4WRDA 1M8AA 3GTQB 2B2WC 1G291 4HN7A 1MSGA 1S5FD 3GTMB 1OXSC 3DHQA 1KDAA 1D6EC 3K0YA 5I6WA 2EYMA 2F4IA 1ENAA 3KF8A 1KLUD 4OL7A 2NB0A 3PUWA 1Q1BA 5M9OA 3HEJA 2EYFA 1JCKB 4C1NI 2IX3A 2EE1A 3Q0AA 2XWBB 4IZ8A 3S1NB 3URYA 1G8ZD 4KY5A 3MTSA 5ELEA 4A93B 3C3LA 1U4LA 3PMFA 1LO5D 2A5HA 5M5XB 4FYDA 1JQYD 2SNMA 1R9TB 5JJZA 1G2SA 1QE6A 1EOTA 4IFDJ 1XTCD 1PDQA 1T5XD 3GV6A 3DWPA 2EOTA 4DXGA 4TRDA 4XTCS 5FLXE 3EFXD 3GTKB 2PZWA 4DN4M 3E0JA 4KK7A 3D6CA 2EDGA 3J80L 1FNVA 1KDBA 2B2TC 4V0BA 1TIID 1QILA 1BXTA 2TSSA 4KTAA 1RKNA 2QF7A 3KK7A 2PW7A 2LMCB 3ZYYX 3A7LA 1V1OA 1YNNC 2NZ1D 1CQVA 1AZQA 3DXJC 2F0FA 1PLFA 3H94A 2AWNA 1QNKA 5BN5A 3AMUA 1KABA 1B2TA 1K8OA 5KIXA 3EROA 3IL8A 3GO5A 4NDXA 1TS2A 3MXGA 5CBAE 4KHVA 3BDLA 3E5SA 1SAPA 1HQRD 2E2IB 1GUGA 2F1MA 1NR2A 3K59A 5FO9B 2AUKA 3H3VC 3EA6A 1X3PA 4LAAA 1VF7A 3VYSA 3NBIA 3KLSX 1AP0A 4DNRB 3SK4A 2F0SA 4HMIA 1STGA 4S3SA 2EZVA 2Q8IB 2F0JA 4Y7NB 3ONAB 4A3FB 3S2DB 2F0IA 4HAEA 1JR0D 1F9RA 2N55A 1GHJA 3TBIB 5DM63 5A2QE 2ZT9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PMF A;  5CGK A;  1EYC A;  4EQN A;  4H7B A;  2OEO A;  1EYD A;  2F0D A;  2SNM A;  3NHH A;  4PMB A;  1A3T A;  5IOC A;  3SK6 A;  5IGF A;  1SNO A;  4KV6 A;  5J39 A;  1II3 A;  1EY0 A;  3NUC A;  1STN A;  4KY6 A;  2RDF A;  4KJN A;  3H6M A;  5JOB A;  2LKV A;  3ITP A;  4DFA A;  5DEH A;  3NXW A;  2F0U A;  1TT2 A;  4TRD A;  4B9X A;  2RKS A;  3OMG A;  4IAL A;  5HGT A;  4KY7 A;  4QB4 A;  1TR5 A;  5F2D A;  3TP5 A;  4K8I A;  3MEH A;  1SNM A;  1AEX A;  4K5V A;  1SNQ A;  4I65 A;  5ISR A;  5C4Z A;  2WAC A;  2EYL A;  3P75 A;  1A3V A;  2PZW A;  1EQV A;  4K2K A;  5CV5 A;  5J1Z A;  3U9O A;  5I9O A;  2F3W A;  1SYB A;  3D6C A;  3D4W A;  1SNP A;  5CV7 A;  5EKK A;  5IGG A;  4QMG A;  1F2Y A;  4EQO A;  1NUC A;  3HZX A;  3OMC A;  5IIF A;  5IOD A;  2F0Q A;  2PQE A;  4RKL A;  3SK8 A;  1JOQ A;  1KDB A;  2PZT A;  1EZ8 A;  2OXP A;  2PYK A;  4K2L A;  3RUZ A;  4DGZ A;  1A3U A;  5C4H A;  2F0H A;  3D8G A;  3TP8 A;  2O4X A;  2EY2 A;  3D4D A;  3SK5 A;  5KGU A;  1SNC A;  2F0W A;  2EYO A;  3R3O A;  5E1F A;  2NUC A;  5E3F A;  1EY6 A;  3NQT A;  4K6D A;  3T13 A;  5IGE A;  4KTA A;  1EY4 A;  4PMC A;  4N9T A;  5KYI A;  5CR3 A;  1RKN A;  4ZUI A;  5CV4 A;  4NP5 A;  2F3V A;  2PW7 A;  4ME5 A;  4KJO A;  4ZQ3 A;  4HTH A;  4K5X A;  1STB A;  5IGD A;  3TP6 A;  4DU9 A;  5IGB A;  5JAV A;  1TQO A;  3EJI A;  4G57 A;  3EVQ A;  4WRD A;  5CC4 A;  3NK9 A;  4PNY A;  1KDC A;  2F0F A;  2EYJ A;  2F0O A;  5EKL A;  1SYD A;  2QDB A;  3QOJ A;  1EY9 A;  3SR1 A;  1JOO A;  5K5P A;  4B9W A;  1U9R A;  1SYF A;  4NKL A;  5DAU A;  2EY6 A;  4DF7 A;  2F0N A;  1SYE A;  5C3X A;  5NUC A;  1KAB A;  1A2U A;  3ERQ A;  4YIJ A;  5KIX A;  4J1M A;  2EY1 A;  2F0E A;  3ERO A;  1STY A;  2EYP A;  2EXZ A;  2F0V A;  2F0P A;  4NDX A;  3TP7 A;  5J22 A;  3NP8 A;  1KAA A;  5I9P A;  5C5L A;  3S9W A;  4KHV A;  5C3W A;  1EY7 A;  3VA5 A;  3BDL A;  3E5S A;  3DHQ A;  3SHL A;  1EY8 A;  1KDA A;  2KHS A;  4NMZ A;  2PZU A;  5C5M A;  5I6W A;  2EYM A;  1EZ6 A;  4K14 A;  1ENA A;  1F2M A;  3MZ5 A;  2F0K A;  4OL7 A;  5IGC A;  5I6Y A;  3MVV A;  4EVO A;  1JOR A;  2HQE A;  1A2T A;  4KD4 A;  4LAA A;  3QB3 A;  1EY5 A;  2F0L A;  4WOR A;  3LX0 A;  3SXH A;  2SNS A;  4ODG A;  1SND A;  2F0T A;  5M9O A;  3HEJ A;  5CV8 A;  5C6A A;  2EYF A;  3BDC A;  1JOK A;  3SK4 A;  2F0S A;  4HMI A;  1STG A;  4N9P A;  4S3S A;  5CV6 A;  1STA A;  4QF4 A;  4ZUJ A;  4E6I A;  3MXP A;  3OSO A;  2ENB A;  4KD3 A;  1IHZ A;  2M00 A;  4HMJ A;  1SYG A;  1EYA A;  1F2Z A;  4IZ8 A;  3T16 A;  4R8N A;  4EQP A;  2F0J A;  2KQ3 A;  3C1E A;  2F0M A;  5KEE A;  3QOL A;  1SYC A;  5KYL A;  4KY5 A;  2F0I A;  2SOB A;  3C1F A;  2OF1 A;  4J6H A;  4F7X A;  5KRU A;  2EY5 A;  1NSN S;  1STH A;  1ENC A;  2RBM A;  4K5W A;  4F8M A;  3V2T A;  3MHB A;  2F0G A;  3P1H A;  4IUN A;  5CV9 A;  5EGT A;  5HUR A;  3OWF A;  3DMU A;  4K8J A;  2PW5 A;  4RKB A;  4ID6 A;  3TME A;  4MIU A;  2EYH A; 
#chains in the Genus database with same CATH topology
 1HFG A;  5FLX c;  2SEB D;  1ZYR D;  3AU7 A;  1SNO A;  2B2Y A;  2B63 B;  2HDM A;  5C0X I;  2EXD A;  3J80 E;  2ZJP A;  2JA8 B;  4RG1 A;  1TT2 A;  1HH2 P;  2JXM B;  3NQI A;  3H09 A;  4QCL A;  4DXF A;  1B44 D;  4K5V A;  4YCV A;  2LY7 A;  3U4Z A;  3K6O A;  1N9W A;  1SMY D;  3TDQ A;  3SK8 A;  2MHV A;  4RKL A;  4RCN A;  3K5N A;  2PZT A;  1KNA A;  2A68 D;  2YTY A;  4KKU A;  4JI5 L;  1PH1 A;  5K36 G;  1YBY A;  3GQB A;  3TN2 A;  2BH8 A;  3PIO A;  3HOX H;  4JI6 Q;  4RCO A;  4KHZ A;  3GTO H;  4N9T A;  1VQE A;  1I4G A;  3T53 B;  2NVQ H;  3GTG H;  1ESR A;  4A3G B;  3RZO H;  1DCZ A;  2QDB A;  2BH2 A;  1FYC A;  4RAU C;  1EWH A;  5C3E H;  2B2V A;  2HCI A;  2HIX A;  1WFQ A;  3C46 A;  3NWT A;  3H0G B;  1Z7T A;  4KLK A;  1ET6 A;  1L1O A;  2WAQ G;  3S15 B;  1K3R A;  1FGU A;  1NBW A;  5C3W A;  4G7O C;  1A63 A;  1B53 A;  2E76 C;  3M85 A;  2D2C C;  1S5E D;  3N52 A;  2B2Y C;  1Q8I A;  2XN9 C;  4OWW B;  4BXX G;  3HOX B;  1KIX A;  2QA4 A;  2QDL A;  4EVO A;  5IWA Q;  3A5U A;  2E2D C;  2NN6 H;  3AQQ A;  4A3J B;  5K36 H;  2B2U C;  2F0T A;  3UE1 A;  2E2H B;  2B63 H;  3S24 A;  2BA1 A;  1X6O A;  4BY1 H;  1EIG A;  1PH5 A;  3TS2 A;  4A3M H;  1OO9 B;  3I4M B;  3RLO A;  4WJ4 A;  4DR2 Q;  3T16 A;  1H9M A;  2A69 D;  1K73 C;  2KQ3 A;  2NVT B;  1A0I A;  5ELD A;  2EY5 A;  4K0K L;  2IJ0 A;  2KCN A;  1EL0 A;  1KHI A;  3V2T A;  1WTR A;  1JJG A;  2QEJ C;  3ND9 A;  2BDO A;  3PO3 G;  2VL6 A;  3F8T A;  4RKB A;  1CT1 D;  4A3K H;  2Q2U A;  3J81 j;  3VYU A;  1WD0 A;  1SEB D;  4X3S A;  2K5N A;  1QB5 D;  4A3K G;  5KND A;  3PGZ A;  2EPB A;  1RTN A;  4B9X A;  3OYY A;  2F03 A;  1BO0 A;  2RKS A;  2DUD A;  4KY7 A;  4DV1 L;  3N6R A;  4GZY C;  2WAC A;  2EYL A;  2QKI C;  4X65 Q;  1CK1 A;  4FDB A;  4MN3 A;  3AEV A;  2IW3 A;  1UWV A;  5JPM C;  2JA5 B;  1K0R A;  1ASZ A;  1GUO A;  2D62 A;  4R9W A;  4POG A;  2WKC A;  1I4H A;  1Q1E A;  4K6D A;  3NQT A;  3W1G A;  1I4P A;  3BDO A;  3IAY A;  4A3F H;  4DV2 Q;  2XTI A;  4JI1 Q;  1BCP F;  1TWA H;  4BY7 B;  3ZJY C;  3HOX G;  1HA5 A;  2EYJ A;  1JOO A;  1Y1W B;  4CJ2 C;  1HNZ L;  2BE5 D;  4NXN L;  1QWY A;  3BZK A;  4OO1 G;  4YIJ A;  3TEH B;  4RGM A;  2N8N A;  1WD1 A;  2EXZ A;  2KEC A;  2UXB Q;  4DR3 L;  1RD9 D;  2Y0S E;  4I7Z C;  4F87 A;  5C3E B;  3X3N A;  4OO1 H;  2NZH A;  5IP7 G;  4JI4 Q;  3T1H Q;  1VQ4 A;  4K14 A;  3KLR A;  4HJ5 A;  2UUB L;  1NY4 A;  2DY7 A;  2K04 A;  4OXP A;  1XPR A;  1R4P B;  4IFD H;  5IP7 H;  5G3L D;  3M3Y H;  2F0L A;  1L1O B;  2MNA A;  3MAQ A;  4JI7 L;  4QUC A;  4IJH A;  2JA7 H;  3PUX A;  4BY7 H;  3BDC A;  1NE3 A;  5BN4 A;  2MGS A;  1H9R A;  3DM1 A;  2K01 A;  2F4V L;  3PQI A;  5FOB B;  4CJ1 B;  1BBW A;  4FP5 D;  4LF7 Q;  5C4X B;  3CC4 A;  3T1H L;  5KEE A;  5KNC A;  4DK6 C;  1SYC A;  3CCR A;  3RZO B;  3BG3 A;  5KRU A;  1S72 A;  5EKI A;  1E3P A;  1EUJ A;  1STH A;  1VDZ A;  1VQG A;  5EAY A;  1KRT A;  3W1B A;  4ZYS A;  3T51 B;  2VW9 A;  3ULP A;  4A3E H;  4LF4 Q;  3A8I E;  4NXM Q;  1EYC A;  1Y1V G;  5IGF A;  4KV6 A;  2EJF C;  1II3 A;  3NUC A;  4B3M Q;  2UXC L;  1Y8O B;  2BOS A;  1GHK A;  1JJC B;  5D3D A;  1UE7 A;  3JAM E;  1EOV A;  2KHJ A;  2XSC A;  1PH2 A;  1CUK A;  2N3S A;  3LWU A;  4NW2 A;  1SLJ A;  4C3I G;  4GOP A;  2ID0 A;  4PMW A;  3QWN A;  4H13 C;  1BBU A;  3U9O A;  5I9O A;  2FHT A;  5EPK A;  4KKS A;  2F0Q A;  1XPU A;  1D5Z C;  3SEB A;  5TSS A;  2UUC Q;  2F0H A;  5M3M G;  3D8G A;  2ZXR A;  3K57 A;  2M2L A;  3HKZ G;  2CHB D;  3HOU H;  5E1F A;  2JK8 A;  2WP8 J;  4GKJ L;  1EY4 A;  2PQA A;  5IT9 E;  3GTJ H;  3H3V I;  3G6J B;  1N36 L;  4KI0 A;  5ELC A;  1DOK A;  4A3E G;  4JI6 L;  1E2W A;  1XNQ Q;  1PZJ D;  5C44 H;  2HUG A;  3J81 c;  4DV3 L;  3S2D H;  4LFB L;  1LTS D;  1TWF H;  2F0O A;  3AFP A;  1HZB A;  4HIO A;  2WKD A;  3RZD B;  1SE2 A;  1AZP A;  1N34 L;  3CPF A;  2L15 A;  1GM5 A;  2JA8 G;  1QVC A;  4M8A A;  3KOJ A;  2E2J H;  3TP7 A;  2K05 A;  4EGV A;  5J22 A;  4LUZ A;  2N78 A;  2DGY A;  5LL6 X;  5C4X G;  2MUY A;  1PRT D;  4C3H H;  2CKZ B;  2JA8 H;  1CZG A;  2CW0 C;  4AQY L;  4DUZ L;  5FJ8 G;  3CCS A;  1SBB B;  3GP7 A;  3J80 i;  4R4C A;  2HQE A;  4FO2 A;  1WCM B;  1MIU A;  4N8F A;  1I6V C;  3FRP B;  2K33 A;  2GVA A;  2YV5 A;  2IHF A;  1VQL A;  3FEW X;  1VMP A;  3GTP H;  2B2W A;  1EU3 A;  2Y0S B;  1Y14 B;  2KUM A;  4JC0 A;  2QGQ A;  2JA6 B;  1HUM A;  3RZD H;  2HHH L;  4BBS H;  4B08 A;  1EYA A;  4R8N A;  2I46 A;  1TWH H;  4JK1 C;  3IRB A;  2MFI A;  1L2F A;  5LMN L;  1MBY A;  1JB3 A;  3BYT B;  5BR8 Q;  1CZW A;  4ZAI A;  4DUY Q;  1D2B A;  3TME A;  3A5Z B;  4O1N A;  3VR4 A;  2CH4 W;  1J8I A;  2E74 C;  5IOD A;  2OT2 A;  4JI8 L;  4Q0F A;  3D6W A;  1D5X C;  2R93 B;  1IW7 D;  1SJH D;  1ZKO A;  4L6T B;  4XYO A;  4JI8 Q;  2UUA Q;  1C48 A;  1FJG Q;  4IAL A;  1UEA B;  4BWG B;  4QB4 A;  2Z6B A;  1BCP B;  2A19 A;  4Y7N H;  1HQM C;  2K5D A;  4G7H C;  4BA2 I;  2DN8 A;  1LT6 D;  3BS1 A;  1IKM A;  3B6Y A;  4PQX A;  4EQO A;  4A3L G;  2D0P A;  1Q90 A;  3L7Z C;  4K2L A;  4DGZ A;  2E2J B;  2PNH A;  2NVX B;  4YWL A;  2F0W A;  1FGB D;  4BY1 G;  3I91 A;  1O7I A;  4A3M B;  3WOE A;  1O7Y A;  2E75 C;  2G5D A;  3BJU A;  5C0X G;  2R61 A;  2R6G A;  2WB1 E;  4CDD C;  3ICE A;  1PH8 A;  3EJI A;  4MNO A;  1B9N A;  1EY9 A;  1HXY D;  1VS0 A;  1ILP A;  1H9S B;  4DF7 A;  2G9D A;  3CRL C;  1VQM A;  5H1S E;  5M3F H;  4CKE A;  3MWY W;  2F0E A;  1L0W A;  2EYP A;  2K6A A;  1BUV T;  4LFC L;  1Q3L A;  3S1N H;  5I9P A;  3S9W A;  2RHQ B;  4A4I A;  4GS3 A;  1U4P A;  1OXT A;  1G91 A;  2JEB I;  1I50 B;  3DEO A;  1CA5 A;  1Q8K A;  2NVX H;  2NN6 G;  2AQ1 B;  1PH6 A;  1X3E A;  4A3D G;  4DR4 Q;  3D31 A;  3OIP A;  1VQF A;  3NSW A;  3SXH A;  2SNS A;  5FJ8 H;  4JYA Q;  3PUV A;  4J15 A;  3TZD A;  2XRS D;  2R7Z G;  2F4V Q;  1U4R A;  3K7A B;  3K0X A;  3I3C A;  2IT1 A;  5CMD A;  4R8I A;  1DD2 A;  3S2H H;  1P8L A;  2IPK D;  2K5W A;  1IHZ A;  3TRE A;  3S15 H;  5IE8 A;  4RFB A;  2SDF A;  1N32 L;  3X3M A;  2KCT A;  2OF1 A;  1NSN S;  1KC8 C;  4F8M A;  3P1H A;  3STB C;  5HUR A;  4RGO S;  1B3Q A;  2VB2 X;  4B3T Q;  3E0E A;  5M3F G;  3WDN A;  1HNZ Q;  3GTO B;  1PV4 A;  4JYA L;  1HR0 Q;  2L11 A;  5FO7 B;  3NHH A;  5C3E G;  1LT4 D;  2L55 A;  1SRO A;  3CW2 C;  1TWC H;  1VMC A;  3QG1 A;  5GRO A;  2PCF B;  4ZK9 B;  1VQA A;  1IBM L;  3H6M A;  5JOB A;  3ITP A;  3HRZ C;  5FLM H;  1E1O A;  4KKT A;  5DEH A;  1HR0 W;  4FF3 A;  1EIF A;  4X6A H;  4X3T A;  4DK0 A;  4V19 0;  4R4T A;  3I4O A;  4K2K A;  5FLM G;  2XRQ D;  2N88 A;  1HJP A;  4QMG A;  1F2Y A;  3CC2 A;  1XNR Q;  4QL5 A;  2RSO A;  1A3U A;  4YHH Q;  4DR7 L;  2I0Q A;  4M1U B;  1SFO B;  2D5D A;  2B3G A;  3S1R B;  5E4X A;  1GXD C;  1RTO A;  5ELN A;  3V05 A;  1GUW A;  4L5Q A;  2Q8R E;  1JE5 A;  5I4D A;  3W2D A;  3BVG A;  4ZKC B;  4ZQ3 A;  2HDL A;  2JSO A;  2Q2I A;  4WJ3 M;  1SSO A;  5JAV A;  1AE2 A;  1CSQ A;  4QGU A;  2L12 A;  3HOW B;  1SYD A;  5K5P A;  3VA7 A;  1ICW A;  2YTV A;  3A74 A;  5C3X A;  3KDF A;  1QZH A;  3BVM A;  3I90 A;  1JT8 A;  2RF4 A;  1Y1V B;  4HJ7 A;  3UDF A;  5JJK A;  5AJ3 Q;  1GOZ A;  4DR6 L;  3T56 B;  4JVZ A;  1GKH A;  3SDZ A;  2XWJ B;  5DNF A;  4JI0 L;  3KF6 B;  3EBE A;  4PZ6 A;  5JVH 3;  2R3Z A;  4N8X 1;  1E2V A;  1RHP A;  4AQY Q;  1PRT B;  3UI2 A;  3Q23 A;  1PXU A;  4LK1 C;  3M4P A;  5C6A A;  1PH7 A;  3HOV H;  1H9S A;  4XQN A;  4N9P A;  3VR5 A;  3CHB D;  3CQZ B;  5CV6 A;  1QOH A;  4IOC A;  2I07 B;  2ENB A;  1YNJ D;  1I94 L;  1L0X B;  2KED A;  2B2U A;  2Z4H A;  2KBN A;  2UUA L;  3HOY B;  4DR6 Q;  5M5Y B;  3C1E A;  3E6Z X;  2XVS A;  1HUN A;  4F7X A;  1Y8P B;  1GUT A;  1IL2 A;  1F9P A;  3TQY A;  3FKI B;  3DMU A;  1HTL D;  2OWO A;  1VQH A;  2ASB A;  5IOC A;  3NWS A;  2R7D A;  1N33 Q;  2L5T A;  3I4N G;  1STN A;  2EQS A;  1N8R C;  3D4R A;  1E2Z A;  1PTO F;  4DFA A;  2JN4 A;  1VQ7 A;  3OMG A;  3Q8D A;  3CQZ H;  1MSH A;  4K8I A;  1AFP A;  4H44 C;  4C3H G;  3CF5 A;  3GTL B;  3I8Z A;  1EQT A;  1K9M C;  4A3B B;  3M4Y A;  5IGG A;  3D4W A;  3OMC A;  4JV5 Q;  1S5D D;  2K5Q A;  4B3R Q;  4B3T L;  5C4H A;  1KAW A;  1H9J A;  1I4R A;  1XWE A;  3HKZ B;  2UU9 Q;  2A6E C;  3R3O A;  5IGE A;  5C44 G;  1CKM A;  3KLW A;  1SMY C;  1Q12 A;  2I5L X;  3VR2 A;  3A8K E;  4TQU S;  5CR3 A;  4JOI A;  4JI4 L;  1B50 A;  1O78 A;  1YEZ A;  4ME5 A;  4ME3 A;  4BBS G;  4K5X A;  4HJA A;  2FFK B;  4P75 A;  1HFN A;  4LFA Q;  4DNT B;  3KFU A;  2WFW A;  4YWM A;  4B9W A;  1HRJ A;  4JCV E;  4YY3 Q;  1WTV A;  4DR5 L;  2CW0 D;  4J1M A;  2KEE A;  4A3E B;  2JA9 A;  1T5E A;  4OX9 L;  1DJR D;  2PZU A;  2ZJQ A;  4GKJ Q;  3KUP A;  3MFY A;  1F2M A;  1SE3 A;  4JI3 Q;  1GUN A;  3F2B A;  1R4Q B;  3CAM A;  4X66 L;  2XNA C;  2AWO A;  3OPO A;  2MJ8 A;  1YNJ C;  1K83 B;  2QW7 A;  4ZRZ A;  5LMU Q;  1UE5 A;  2K03 A;  4A3J G;  1TWG B;  1HR0 L;  3G7L A;  3PIP 3;  1DYQ A;  5A35 A;  1CHQ D;  4A3L H;  1CKO A;  4QF4 A;  1WTP A;  1UAP A;  3AFQ A;  4A3J H;  1WTW A;  1KRS A;  3ER0 A;  2O5J C;  1RIP A;  2SOB A;  2EJM A;  1NCV A;  1YJ9 A;  1ENC A;  4K5W A;  1TXY A;  1FNU A;  1GD7 A;  1DON A;  1F9S A;  4IUN A;  2Y0S G;  4ZLT F;  4X62 Q;  4AYB E;  2FIN B;  3NTI A;  1MHW C;  1IBM Q;  1H9K A;  4FF4 A;  5JEA J;  5IP9 H;  3QJY A;  1IBL L;  5J39 A;  2B8G A;  3K5M A;  1Q7Y C;  2A6H C;  2RDF A;  3FP9 A;  2PPB C;  2UXB L;  3PCO B;  2LKV A;  1YZ6 A;  2F0U A;  1JWU D;  4BBS B;  2DJG C;  4CJ0 B;  3VR6 A;  3VR3 A;  1TR5 A;  1PZK D;  1SNM A;  2V1C C;  3EIV A;  4I65 A;  5ISR A;  5J1Z A;  1KL9 A;  2L4N A;  1QNU A;  5EQ0 A;  3D3R A;  2KJX A;  3BZD B;  1LTA D;  2ZM6 Q;  3OIQ A;  1OXV A;  5DM7 3;  1JB7 A;  1A6X A;  1BCP D;  2Z6K C;  3A8J E;  1EZ8 A;  4AYB B;  1L1O C;  4B3S Q;  1X3Q A;  2ICI A;  1IXR A;  4IPH A;  1EQQ A;  2R7Z H;  1YHQ A;  2R92 B;  1N33 L;  1V9P A;  3BYY B;  4R4Q A;  3I55 A;  3J7A F;  5M3M H;  4FVM A;  3RN5 A;  1WTH A;  3CMA A;  2NTT A;  1PA6 A;  1PTO D;  3PO3 B;  4OWT B;  2IL8 A;  1ONL A;  4Q5V A;  3GTK H;  1C7Y A;  4LF8 L;  4IUU A;  2YU9 H;  2F0N A;  4LF4 L;  3CCQ A;  3RLF A;  4DV7 L;  3I56 A;  3R93 A;  4FXD A;  2GVB A;  5G3L F;  1A8V A;  4H0L C;  4DUZ Q;  3VA5 A;  2KHS A;  2J0T D;  4C56 C;  1KTK A;  3PV0 A;  5C5M A;  3KJO A;  1EZ6 A;  4DR1 L;  3U50 C;  1I4X A;  2RQX A;  1PFS A;  4A3B H;  4OGQ C;  1TY2 A;  2X6G A;  5I6Y A;  4BBR G;  3PSI A;  4C3J B;  1HCZ A;  4WFN 3;  3QR8 A;  1UNS A;  4HIM A;  3K5O A;  1XPO A;  4DV0 L;  4RHS A;  4DK1 A;  5CV8 A;  1I3Q B;  1RDP D;  2L9H A;  2VQF Q;  3M7G A;  3OSO A;  1DM0 B;  3HG9 A;  1AW7 A;  1QUQ A;  4A3D B;  2NBF A;  2NVY H;  1WI5 A;  1BR9 A;  2K28 A;  3MC0 B;  4XYQ A;  1YHB A;  1IBK L;  2NVQ B;  1PYB A;  3AB9 A;  1LYL A;  1V1P A;  5FKA C;  3PO2 B;  3KF6 A;  2UXD L;  2K5V A;  1NMG A;  4OIK A;  4H7B A;  3A0J A;  5DLQ E;  2F0D A;  1AH9 A;  4EX5 A;  3CCE A;  3E9H A;  1XTD A;  3FMC A;  4KY6 A;  1F77 A;  5M3M B;  2MO0 A;  1VQK A;  3NXW A;  3I70 A;  5F2D A;  4C2M B;  1I4Q A;  3G4S A;  2M9V A;  2Z9H A;  3P75 A;  3QIA A;  5CV5 A;  2RVL A;  4HR7 B;  1TS5 A;  5EKK A;  1HTP A;  1Q82 C;  4CHT B;  2JP1 A;  2O5I C;  1ILQ A;  3RUZ A;  4OWX B;  2I5H A;  1U0L A;  1C8C A;  1V1P B;  3HS0 C;  3S1M B;  2B63 G;  1HA6 A;  1SNC A;  2EYO A;  4OON A;  3Q22 A;  4PMC A;  5FK9 C;  4RGT A;  5HGQ A;  1N32 Q;  5CV4 A;  1FR3 A;  1PH9 A;  4JBM A;  4G57 A;  4IUV A;  4PNY A;  1JWS D;  2A1A A;  1WCM H;  4G4K A;  5C0X H;  2ZXO A;  3H15 A;  4L8J A;  2XGT A;  1KNE A;  2FMM A;  4NKL A;  1MJC A;  2Z1C A;  3SVM A;  1D5M C;  4KN7 C;  2YYZ A;  5JVG 3;  3CME A;  4XXE A;  1VQO A;  4MTN A;  3S17 B;  2UU9 L;  4QJF A;  4C3I B;  4PV1 C;  4P71 A;  4LF7 L;  4DNI A;  1S5B D;  1XMO Q;  5M5W H;  3BVZ A;  1VQB A;  3F2U A;  3JAM i;  3ULL A;  4LF5 Q;  1BOS A;  4C3H B;  5IYD H;  1IL8 A;  1FD7 D;  3F2C A;  4XT3 B;  4OHJ A;  1B4O A;  4MZ9 A;  3HOZ B;  3MFG A;  3HOY H;  1LLR D;  3BU2 A;  1Q81 C;  1JOK A;  2MO1 A;  4LFC Q;  1LTR D;  2WAQ B;  4CKB A;  3I4L A;  1A15 A;  4IFD I;  3HOY G;  1F2Z A;  1TVX A;  2EJG C;  3GV3 A;  3P7J A;  4QQB X;  4DV2 L;  4A3F G;  2ICE C;  1F9Q A;  2DJF C;  2FXQ A;  1CM9 A;  4JI2 Q;  1NTG A;  2H4O A;  5T1G A;  4X64 Q;  3MHB A;  3S14 H;  2F0G A;  4FNF A;  2K4K A;  4FXG C;  1TS4 A;  5LMU L;  1X3G A;  2CFM A;  1TWH B;  1AN8 A;  1Q46 A;  1WTX A;  2PQA B;  1YNX A;  4R4I A;  1LTB D;  3OW7 A;  3NPP A;  1EY0 A;  4TVA B;  1QUQ B;  3S16 B;  3STB D;  2ZTE A;  2ALY B;  1VF5 C;  1HZC A;  4PG3 A;  2HHH Q;  4U68 A;  4QIW E;  4F88 A;  2R92 G;  4KHP Q;  2ZM6 L;  2IWH A;  3FPU B;  4LFB Q;  2A6H D;  3LWE A;  2L0C A;  1V1Q A;  3CCM A;  2J7Z A;  1SYB A;  3FVQ A;  1EEI D;  1ML0 D;  5IIF A;  5COR A;  1ET9 A;  2EVB A;  3DWA A;  3M3Y B;  5C0X J;  1M90 C;  1SR3 A;  1S4Z A;  4DAV A;  2PYK A;  1B7Y B;  1L0Y B;  1BVS A;  3M4Q A;  2JE6 I;  1YNN D;  3D4D A;  1JMC A;  3T13 A;  4R4O A;  1HZ9 A;  5KYI A;  3MXN A;  3NBH A;  1O7L A;  5D14 A;  4CDE C;  4JBJ A;  2HD3 A;  4NPS A;  3TP6 A;  4DU9 A;  2K14 A;  5BR8 L;  5AFW A;  1Z47 A;  5EKL A;  4GLX A;  4IO9 A;  3SR1 A;  1LTI D;  5ELF A;  5I2Y A;  1QJO A;  1GO3 E;  2B8F A;  1X32 A;  4C3J G;  2JEA I;  4DAY A;  3VYT A;  4LF8 Q;  4Y52 H;  2F0V A;  2MP1 A;  1IBL Q;  1SE8 A;  1DOL A;  5C5L A;  1VQJ A;  4KMU C;  4NMZ A;  2V4D A;  5JEA H;  3RLN A;  4XT1 B;  3CP0 A;  1VCI A;  4C3I H;  4ABN A;  4WOR A;  1DGS A;  4LNQ A;  3KBX A;  3V96 A;  1N34 Q;  1TWC B;  2E8G A;  3MA2 B;  5IWA L;  1KQS A;  4DV4 L;  1RJT A;  4IJL A;  4ULL A;  4BS9 A;  4IPC A;  4YWK A;  5IYD G;  3LGJ A;  3IFD A;  4JBK A;  2G9H D;  4HMJ A;  3IFT A;  3HOV G;  1E24 A;  1N36 Q;  2UXD Q;  4J6H A;  2KOL A;  3PUY A;  1IW7 C;  5CV9 A;  3OWF A;  5EBC A;  1TWF B;  5JJL A;  1ZEQ X;  3JAM c;  5M3F B;  1DZ1 A;  1ENF A;  3S17 H;  1EYD A;  1PFB A;  1TWG H;  4IUP A;  4DR3 Q;  4P74 A;  2KA7 A;  4KJN A;  2O2L D;  4A3I B;  4HIK A;  2YTX A;  5CBE E;  1BCP C;  3VYR A;  5C4X H;  1QZG A;  4IN3 A;  2AMC B;  4K0K Q;  2H1E A;  5JJI A;  3JC6 6;  3FPP A;  1SNP A;  4CKC A;  4DV1 Q;  1GVP A;  3RMH A;  2K1B A;  2RDG A;  1EFI D;  3WOF A;  3L9A X;  2JYO A;  3SK5 A;  5KGU A;  1WJJ A;  2NUC A;  1AE3 A;  1VQP A;  2CQA A;  4ZUI A;  1LM0 A;  4K6L A;  2BDN A;  4NP5 A;  4HTH A;  4HCE A;  1W6K A;  4A93 G;  5FO8 B;  1Y8N B;  1ESF A;  1BQQ T;  1LT3 D;  1TQO A;  3CPW A;  3EVQ A;  1UE1 A;  4X65 L;  4LF6 Q;  4H02 A;  4CBV A;  4GNX B;  3QOJ A;  1JJ2 A;  2AKW B;  1U9R A;  2E2H H;  1SMX A;  3A56 A;  1NAP A;  4A93 H;  3GTM H;  2EY6 A;  3PO2 H;  1J9O A;  3G71 A;  3ERQ A;  3CCJ A;  4PZ8 A;  3VDY A;  2UXC Q;  1I94 Q;  5M5X H;  3GD7 A;  1WYD A;  3K5L A;  5IP9 G;  1MJE A;  1KAA A;  1FNW A;  4FF2 A;  5GAE C;  1D8L A;  2LS0 1;  4RA8 A;  4GNX C;  4YCW A;  2JQO A;  4JI7 Q;  2F0K A;  3CRK C;  2WV6 D;  1FL0 A;  1LAC A;  2P5Z X;  4ZKB B;  5JEA G;  1PRT C;  4BA1 I;  4ODG A;  2A69 C;  3H3V H;  3ULJ A;  1NNX A;  2K75 A;  1HHV A;  3S1R H;  1YHA A;  3R8B A;  3MXP A;  4L63 B;  3D0F A;  1E7Z A;  2CQO A;  5JPN C;  2ES2 A;  2F0M A;  3CCL A;  4QUF A;  1WOC A;  2DY8 A;  1R9T H;  1EFW A;  1OXU A;  2RCN A;  5EGT A;  1K8G A;  3ERS X;  4DK3 C;  2R7Z B;  2PW5 A;  1WCM G;  3J7Z C;  1XNR L;  2Q2T A;  4DAP A;  4MIU A;  3H0G H;  5D3I B;  2ATW A;  4AH6 A;  4PMB A;  3I7F A;  2IHE A;  4GN3 B;  3CCV A;  2CCZ A;  3GTQ H;  4DR2 L;  3PIO 3;  2F3W A;  2PI2 A;  5CV7 A;  2KHI A;  4OIJ A;  1UEB A;  2K32 A;  1S3O A;  3GDE A;  4DR5 Q;  1I6H B;  1X56 A;  1SDF A;  1PTO C;  2O4X A;  2LFN A;  1EY6 A;  5LHY 1;  2F3I A;  2NTS A;  5GAH C;  1LAB A;  4JI0 Q;  3HFZ B;  3PUZ A;  1CQF A;  5IGB A;  3FKI G;  3CKI B;  1H95 A;  4HSV A;  1PH4 A;  3OOC A;  2A6E D;  4IPD A;  1KDC A;  1K83 H;  1I3Q H;  3L3O C;  4JG2 A;  1XNQ L;  3J7A 5;  2GA4 B;  3LNN A;  1SYE A;  4GOP C;  1B1Z A;  1EIY B;  3DM3 A;  1K28 A;  4UDU C;  1I6H H;  1TKW B;  2NN6 I;  1NMF A;  3S1M H;  4RHR A;  3J80 c;  3G6E A;  4G7Z C;  1QVG A;  3GTL H;  1C9O A;  3HOW G;  2VUM H;  2CH4 A;  3HP3 A;  3U9S A;  1OTC A;  3HKS A;  5LMN Q;  2R92 H;  1V8Q A;  3MVV A;  3GTJ B;  4XQQ A;  4DV4 Q;  1IYJ B;  3S2H B;  4GNX A;  3NEN A;  3IKJ A;  1SND A;  1DOM A;  4HJ8 A;  1X9N A;  1STA A;  2E5L Q;  2CWP A;  1YI2 A;  2YU9 B;  2OTJ A;  1VQ5 A;  5IYB H;  1W6J A;  3HKZ E;  5COY A;  3H91 A;  1E22 A;  2HQL A;  3A54 A;  5I2X A;  4IUT A;  3SE0 A;  4X3U A;  4LF6 L;  3T4A C;  1PFN A;  1ZYR C;  2RBM A;  1Y1W H;  1SXT A;  5C4J B;  3CXC A;  3S16 H;  4ID6 A;  4JI5 Q;  2IX1 A;  2OEO A;  4DUY L;  4ZCK A;  4C3J H;  3M9B A;  1G6Z A;  1UE6 A;  3H0G G;  1A62 A;  5EPL A;  2VUM G;  1YJN A;  1XMO L;  1STE A;  5ELB A;  1MI2 A;  3KBG A;  4IFD G;  1AEX A;  5CYU A;  2QCP X;  4LUV A;  4XIG S;  4GKK L;  4O42 A;  1EQV A;  3PF5 A;  4DR4 L;  1PMR A;  3NEM A;  1PH3 A;  2RDH A;  3L0O A;  1SFO H;  3S14 B;  4HSP A;  4LF9 L;  2PQE A;  4YY3 L;  3OWE B;  1LT5 D;  3K80 C;  2AUJ D;  2LSS A;  2NYZ D;  4FXK C;  2WB1 G;  2RCF A;  1XX8 A;  3NTK A;  2K5H A;  1ZXT A;  5HY6 A;  3ND8 A;  2J4X A;  4HJ9 A;  2E5L L;  4JOI C;  3UE0 A;  4B3M L;  1TY0 A;  3T1Y Q;  3QO2 A;  5D65 A;  1M4V A;  2XIW A;  1EIH A;  3TS0 A;  2WII B;  1EWC A;  1D1I A;  1QG7 A;  1STB A;  5FLX L;  1CTM A;  4GN4 B;  3T1Y L;  1CSP A;  4X64 L;  1JC7 A;  2VY3 A;  5CC4 A;  1U5K A;  4OO1 I;  5E4W C;  4LF5 L;  3KF8 B;  4DV0 Q;  5IT9 c;  1S5C D;  5DAU A;  3FKI H;  4POF A;  5EBD A;  2PNR C;  1QCB D;  1SN8 A;  2F0P A;  3I73 A;  2D0O A;  1GUS A;  4DA2 A;  2B2V C;  3U58 A;  1EY7 A;  5BN3 A;  2VS1 A;  2A8V A;  1IKL A;  4RH6 A;  3R2T A;  2HT1 A;  4WJW A;  3SGI A;  3MZ5 A;  1B8A A;  1NJI C;  2VQE L;  3TSS A;  3Q24 A;  2D9U A;  3HOW H;  2UUB Q;  1HZA A;  1PFM A;  4DAM A;  1LTG D;  4L5R C;  4E6I A;  3DWQ A;  2R93 G;  4LUO A;  3TZU A;  4U67 3;  4AYB G;  1BKB A;  4KD3 A;  4O0A A;  1S40 A;  2M00 A;  1SYG A;  4EQP A;  3S1Q H;  3P20 A;  5KYL A;  3C1F A;  4HCS A;  2Q8T A;  5IY0 A;  4C1N K;  5ELO A;  2BCO A;  1K0S A;  2PMZ B;  1YIJ A;  2OQ0 A;  4B3R L;  1JE4 A;  1XYI A;  4L5T A;  3DEP A;  2NVY B;  5CGK A;  4EQN A;  3HOZ G;  2VZA A;  1Y1W G;  3EN2 A;  4TSS A;  1X55 A;  4X3K A;  1KD1 C;  2HCC A;  3W3A A;  3CD6 A;  1GJX A;  3CU7 A;  4A3G H;  4IQZ A;  3NTH A;  2Q2H A;  2C9O A;  3MXU A;  2CWA A;  3K7A H;  1D1K A;  2C35 B;  1G51 A;  2WAQ E;  4UP7 A;  2I5M X;  2DNE A;  3A55 A;  2FJ2 A;  2NVT H;  4DV3 Q;  4A3G G;  5LMN W;  1K8M A;  1JWM D;  4UAI A;  1WVL A;  3J7A V;  5IGD A;  4YHH L;  4DR7 Q;  4LMQ D;  4DV6 L;  4X62 L;  4C2M H;  1VQI A;  4P73 A;  1CA6 A;  1WTQ A;  1DXM A;  1IYV A;  2A74 C;  1Z6H A;  4B3S L;  3E3X A;  2F3V A;  2K7V A;  2ZXP A;  1YVC A;  2BA0 A;  3FDT A;  2L1B A;  3PO2 G;  1PYW D;  1IBK Q;  1MD2 D;  2FMC A;  5EPJ A;  2Z4I A;  5A2Q L;  3HOZ H;  4GOP B;  1J5E L;  1EQR A;  5NUC A;  1A2U A;  1VQ9 A;  1YIT A;  1RCV D;  2EY1 A;  4RGN A;  2MQH A;  4UPA A;  2VQF L;  4JBW A;  1LV9 A;  4IOA A;  2MPM A;  4LJZ C;  2A73 B;  4RWS C;  3SHL A;  1FJG L;  3M7N A;  1EY8 A;  2X6L A;  1PYS B;  1YJW A;  3AYH B;  3DUZ A;  1HPC A;  2IY5 B;  2CVR A;  5IGC A;  3K58 A;  1JIC A;  1JOR A;  1A2T A;  4KD4 A;  2LXJ A;  1B3A A;  5GAG C;  2PO4 A;  4DR1 Q;  2VNU D;  1MGS A;  1NR4 A;  1CKN B;  4TKO B;  2TMP A;  4A3I H;  1J5E Q;  1CFM A;  3U4V A;  2QEX A;  4ILW A;  1HNX Q;  3Q6S A;  4XQJ A;  1B9M A;  1CHP D;  1ROD A;  2C5C A;  1EEF D;  2N49 A;  3M4O H;  1BBX C;  2KCM A;  3QOL A;  1KLG D;  3R2I A;  2ZTC A;  3NEL A;  2JJQ A;  4DKA C;  1OXX K;  2KEN A;  4JI3 L;  1LTL A;  3I72 A;  4K8J A;  5KNB A;  3S1Q B;  1F2L A;  4OEM B;  1EU4 A;  1LUZ A;  2EYH A;  4KJO A;  2QIL A;  1U4M A;  4YCU A;  3J7Y W;  3J81 L;  3I4N B;  4IUQ A;  3NBH B;  4P2C B;  2E2I H;  4A76 A;  1B70 B;  1VQ6 A;  3HOV B;  5M5W B;  5HGT A;  3TP5 A;  3MXN B;  1XXG A;  3WWV A;  3NE5 B;  1A3V A;  2DNC A;  4A3B G;  2B39 A;  1K3B C;  1E0B A;  1G2T A;  3HZX A;  4JPB W;  2AQ2 B;  2NWG A;  4BBR H;  2OXP A;  1P16 A;  3TP8 A;  1HNW L;  3O13 A;  1T9H A;  1X65 A;  5C44 B;  4A3K B;  3PF4 A;  5E3F A;  3KDF B;  4KN4 C;  2AQ3 B;  2A68 C;  4RMF A;  5IYB G;  4I7A A;  2GN5 A;  2VQE Q;  3NK9 A;  4X66 Q;  2X69 A;  3EQL C;  1SYF A;  4FF1 A;  3J81 i;  4JV5 L;  1IYU A;  4CGY B;  2JA5 G;  1TU2 B;  4PZ7 A;  2VUM B;  1STY A;  1W3S A;  2VXW A;  3A7A B;  5GAD C;  3NP8 A;  1KXL A;  5M5Y H;  5IYC G;  3W5O A;  2JA5 H;  2BE5 C;  3JAM L;  4UY8 C;  4IPG A;  4MHE A;  3MEF A;  4BY7 G;  5T1I A;  5IYC H;  1PHJ A;  1XMQ L;  1BNZ A;  2KCC A;  1BF4 A;  3QB3 A;  1Z9F A;  1EY5 A;  1O80 A;  3LX0 A;  4J8Q A;  3RD4 A;  2B29 A;  2KVM A;  4DAY B;  1PRT F;  1PTO H;  3DLL A;  1QVF A;  3C2P A;  4R1J A;  4ZUJ A;  4Z9C B;  2WB1 B;  5J3B A;  2IX0 A;  3HGB A;  4DV5 L;  4A3M G;  4BY1 B;  1Y69 U;  3GTG B;  1E1T A;  3J81 E;  1M1K C;  2Z8L A;  1WTO A;  1C4Q A;  5EJW A;  4BBR B;  4QIW B;  1TS3 A;  3HOU B;  1CI3 M;  1SE4 A;  1X3F A;  1RF2 D;  1UUP A;  1MKH A;  4OEL B;  4L5S A;  4NXN Q;  3OW2 A;  1A3T A;  3SK6 A;  3GTP B;  1V43 A;  2JA7 B;  4XDX A;  4QY7 A;  2RSN A;  1PTO B;  5IT9 L;  1BDO A;  1TWA B;  3OHX C;  2VB3 X;  3MEH A;  1I50 H;  1SNQ A;  4HED A;  5C4Z A;  1W2B A;  4CDC C;  5LL6 S;  1XMQ Q;  4O2D A;  2K50 A;  1NUC A;  4IUR A;  2RHS B;  1JOQ A;  2OCE A;  1SJE D;  3I4M G;  2K52 A;  1O7Z A;  1J6Q A;  2EY2 A;  4ALP A;  3M4O B;  2RA4 A;  2B2T A;  1EYG A;  1VQN A;  4DV5 Q;  1PZI D;  1LTT D;  2WIN B;  1I5F A;  2Z6K A;  3KLS A;  4WRD A;  1M8A A;  4JI2 L;  2OQK A;  3GTQ B;  2EIF A;  2HIV A;  2PI2 E;  4LWC A;  5L37 A;  3E9I A;  3FHW A;  2B2W C;  1G29 1;  4A3C H;  4HN7 A;  4UHV A;  3I4N H;  5AJ3 L;  1MSG A;  1S5F D;  3GTM B;  4A3C G;  1OXS C;  3DHQ A;  2AHO B;  1KDA A;  1D6E C;  2H5X A;  4HID A;  3K0Y A;  5I6W A;  2EYM A;  2F4I A;  4A75 A;  1ENA A;  3KF8 A;  1KLU D;  4OL7 A;  1D7Q A;  3K81 C;  1G6P A;  4NXM L;  2NB0 A;  2R93 H;  3PUW A;  1Q1B A;  1EWI A;  4DV6 Q;  5M9O A;  4UP8 A;  3HEJ A;  2EYF A;  1JCK B;  2F52 A;  4C1N I;  2JA7 G;  2IX3 A;  2EE1 A;  3UDX A;  4GN5 A;  3Q0A A;  2XWB B;  4IZ8 A;  4APV A;  3S1N B;  3URY A;  1G8Z D;  4KY5 A;  2R7F A;  4LFA L;  3MTS A;  4GKK Q;  3CCU A;  3RNU A;  3BZC A;  2Z0S A;  5ELE A;  1IZ6 A;  4GLA C;  4A93 B;  3I2Z A;  4MTK A;  3C3L A;  1Q86 C;  2OTL A;  1U4L A;  3PMF A;  1LO5 D;  2A5H A;  5M5X B;  4LW1 A;  1RL2 A;  1JQY D;  4FYD A;  2SNM A;  1R9T B;  5JJZ A;  1G2S A;  1XJV A;  2NZO A;  1QE6 A;  2PMZ E;  1EOT A;  4IFD J;  1XTC D;  1PDQ A;  1T5X D;  3GV6 A;  1VQC A;  3DWP A;  1VQ8 A;  2EOT A;  4DXG A;  4TRD A;  4JI1 L;  4XTC S;  5FLX E;  3OTO Q;  4LF9 Q;  3EFX D;  3GTK B;  2PZW A;  2ZJR A;  4DN4 M;  3E0J A;  4KK7 A;  3D6C A;  2EDG A;  1SRU A;  3OTO L;  3J80 L;  1FNV A;  1KDB A;  3UDG A;  5E7N A;  2B2T C;  3RN2 A;  4V0B A;  5C4J H;  1TII D;  4A3I G;  1QIL A;  1BXT A;  3RR5 A;  2TSS A;  4GLV B;  3KYH C;  4KTA A;  3I4M H;  4P72 A;  1RKN A;  2QF7 A;  3KK7 A;  2PW7 A;  2LMC B;  3ZYY X;  3A7L A;  1V1O A;  1YNN C;  2NZ1 D;  1CQV A;  1AZQ A;  3DXJ C;  2F0F A;  1PLF A;  3H94 A;  2ZTD A;  2AWN A;  1ASY A;  1HNX L;  1VQD A;  1Y1V H;  1QNK A;  5BN5 A;  3AMU A;  1KAB A;  1B2T A;  1K8O A;  5KIX A;  3F2D A;  1CKN A;  3ERO A;  3IL8 A;  3GO5 A;  4DPG A;  4NDX A;  1HNW Q;  1K8A C;  2UUC L;  1TS2 A;  4BXX H;  3MXG A;  5CBA E;  4KHV A;  3PIP A;  3K7U C;  1FVI A;  3BDL A;  3E5S A;  1SAP A;  1HQR D;  2E2I B;  4A3D H;  3G48 A;  4KHP L;  1GUG A;  2F1M A;  1NR2 A;  3K59 A;  5FO9 B;  1X54 A;  4JW0 A;  2AUK A;  3H3V C;  3EA6 A;  1X3P A;  4LAA A;  1VF7 A;  4UP9 A;  4NB3 A;  3F1Z A;  3NBI A;  3VYS A;  3KLS X;  3K8A A;  5GQO A;  3HOU G;  1AP0 A;  4DNR B;  3SK4 A;  2F0S A;  4HMI A;  1STG A;  4S3S A;  1ICF B;  2EZV A;  4DV7 Q;  3CC7 A;  2JA6 G;  1C0A A;  3UDI A;  2Q8I B;  3L2P A;  4OX9 Q;  2F0J A;  4Y7N B;  3PO3 H;  3ONA B;  4A3F B;  1PVO A;  3TRZ A;  3S2D B;  2F0I A;  2LXK A;  2JA6 H;  4HAE A;  1JR0 D;  1F9R A;  3KJP A;  2N55 A;  1GHJ A;  3TBI B;  5DM6 3;  4EQ5 A;  4CDF C;  5A2Q E;  4AIM A;  2ZT9 C; 
#chains in the Genus database with same CATH homology
 1HFG A;  2SEB D;  1ZYR D;  3AU7 A;  1SNO A;  2B2Y A;  2B63 B;  2HDM A;  5C0X I;  3J80 E;  2JA8 B;  1TT2 A;  2JXM B;  3NQI A;  3H09 A;  4QCL A;  4DXF A;  1B44 D;  4K5V A;  2LY7 A;  3K6O A;  1SMY D;  3TDQ A;  3SK8 A;  2MHV A;  4RKL A;  4RCN A;  3K5N A;  2PZT A;  1KNA A;  2A68 D;  4KKU A;  5K36 G;  3GQB A;  3TN2 A;  4RCO A;  4KHZ A;  4N9T A;  1I4G A;  3T53 B;  1ESR A;  4A3G B;  1DCZ A;  2QDB A;  1FYC A;  4RAU C;  1EWH A;  2B2V A;  2HCI A;  3C46 A;  3NWT A;  3H0G B;  1Z7T A;  1ET6 A;  3S15 B;  5C3W A;  4G7O C;  1B53 A;  2E76 C;  3M85 A;  2D2C C;  1S5E D;  3N52 A;  2B2Y C;  1Q8I A;  2XN9 C;  3HOX B;  4EVO A;  2E2D C;  2NN6 H;  4A3J B;  5K36 H;  2B2U C;  2F0T A;  2E2H B;  2BA1 A;  1EIG A;  1OO9 B;  3I4M B;  3T16 A;  1H9M A;  2A69 D;  2KQ3 A;  2NVT B;  5ELD A;  2EY5 A;  2IJ0 A;  2KCN A;  1EL0 A;  3V2T A;  1WTR A;  2QEJ C;  3ND9 A;  2BDO A;  4RKB A;  1CT1 D;  3VYU A;  1WD0 A;  1SEB D;  4X3S A;  1QB5 D;  5KND A;  2EPB A;  1RTN A;  4B9X A;  2F03 A;  1BO0 A;  2RKS A;  4KY7 A;  3N6R A;  4GZY C;  2WAC A;  2EYL A;  2QKI C;  1CK1 A;  4MN3 A;  2IW3 A;  5JPM C;  2JA5 B;  1GUO A;  2D62 A;  4R9W A;  2WKC A;  1I4H A;  1Q1E A;  3NQT A;  4K6D A;  3IAY A;  1I4P A;  3BDO A;  1BCP F;  4BY7 B;  1HA5 A;  2EYJ A;  1JOO A;  1Y1W B;  4CJ2 C;  2BE5 D;  1QWY A;  4OO1 G;  4YIJ A;  4RGM A;  1WD1 A;  2EXZ A;  2KEC A;  1RD9 D;  4I7Z C;  4F87 A;  5C3E B;  3X3N A;  4OO1 H;  4K14 A;  3KLR A;  2DY7 A;  2K04 A;  1R4P B;  4IFD H;  5G3L D;  2F0L A;  3MAQ A;  4QUC A;  3PUX A;  3BDC A;  5BN4 A;  2MGS A;  1H9R A;  3DM1 A;  2K01 A;  5FOB B;  4CJ1 B;  4FP5 D;  5C4X B;  5KEE A;  5KNC A;  1SYC A;  3RZO B;  3BG3 A;  5KRU A;  5EKI A;  1STH A;  1VDZ A;  4ZYS A;  3T51 B;  3A8I E;  1EYC A;  5IGF A;  4KV6 A;  2EJF C;  1II3 A;  3NUC A;  1Y8O B;  2BOS A;  1GHK A;  5D3D A;  3JAM E;  2XSC A;  3LWU A;  4C3I G;  4NW2 A;  2ID0 A;  4PMW A;  3QWN A;  4H13 C;  3U9O A;  5I9O A;  2FHT A;  5EPK A;  4KKS A;  2F0Q A;  1D5Z C;  3SEB A;  5TSS A;  2F0H A;  3D8G A;  2ZXR A;  3K57 A;  2M2L A;  2CHB D;  5E1F A;  2WP8 J;  1EY4 A;  5IT9 E;  3G6J B;  4KI0 A;  5ELC A;  1DOK A;  1E2W A;  1PZJ D;  2HUG A;  1LTS D;  2F0O A;  2WKD A;  3RZD B;  1SE2 A;  1AZP A;  4M8A A;  3TP7 A;  2K05 A;  4EGV A;  5J22 A;  5LL6 X;  2MUY A;  1PRT D;  1CZG A;  2CW0 C;  1SBB B;  3GP7 A;  2HQE A;  4FO2 A;  1WCM B;  1I6V C;  3FRP B;  2K33 A;  3FEW X;  1VMP A;  2B2W A;  1EU3 A;  2Y0S B;  2KUM A;  2JA6 B;  1HUM A;  4B08 A;  1EYA A;  4R8N A;  2I46 A;  4JK1 C;  1MBY A;  1JB3 A;  3BYT B;  1CZW A;  4ZAI A;  1D2B A;  3TME A;  4O1N A;  3VR4 A;  1J8I A;  2E74 C;  5IOD A;  2OT2 A;  4Q0F A;  3D6W A;  1D5X C;  2R93 B;  1IW7 D;  1SJH D;  1ZKO A;  4L6T B;  4XYO A;  1C48 A;  4IAL A;  1UEA B;  4BWG B;  4QB4 A;  1BCP B;  1HQM C;  2K5D A;  4G7H C;  4BA2 I;  2DN8 A;  1LT6 D;  3BS1 A;  1IKM A;  4PQX A;  4EQO A;  1Q90 A;  3L7Z C;  4K2L A;  4DGZ A;  2E2J B;  2NVX B;  2F0W A;  1FGB D;  4A3M B;  3I91 A;  3WOE A;  1O7Y A;  2E75 C;  5C0X G;  2R61 A;  2R6G A;  3EJI A;  1B9N A;  1EY9 A;  1HXY D;  1ILP A;  1H9S B;  4DF7 A;  2G9D A;  3CRL C;  4CKE A;  3MWY W;  2F0E A;  2EYP A;  2K6A A;  1BUV T;  1Q3L A;  5I9P A;  3S9W A;  1U4P A;  1OXT A;  1G91 A;  2JEB I;  1I50 B;  3DEO A;  1CA5 A;  2NN6 G;  2AQ1 B;  3D31 A;  3OIP A;  3NSW A;  3SXH A;  2SNS A;  3PUV A;  3TZD A;  2XRS D;  1U4R A;  3K7A B;  3I3C A;  2IT1 A;  5CMD A;  4R8I A;  1DD2 A;  2IPK D;  2K5W A;  1IHZ A;  4RFB A;  2SDF A;  3X3M A;  2OF1 A;  1NSN S;  4F8M A;  3P1H A;  5HUR A;  4RGO S;  2VB2 X;  3WDN A;  3GTO B;  2L11 A;  5FO7 B;  3NHH A;  1LT4 D;  2L55 A;  1VMC A;  3QG1 A;  2PCF B;  4ZK9 B;  3H6M A;  5JOB A;  3ITP A;  3HRZ C;  5DEH A;  4KKT A;  4FF3 A;  4X3T A;  4DK0 A;  4V19 0;  4K2K A;  2XRQ D;  2N88 A;  4QMG A;  1F2Y A;  2RSO A;  1A3U A;  4M1U B;  1SFO B;  2D5D A;  3S1R B;  5E4X A;  1GXD C;  1RTO A;  3V05 A;  1GUW A;  2Q8R E;  5I4D A;  3W2D A;  3BVG A;  4ZKC B;  4ZQ3 A;  2HDL A;  2JSO A;  1SSO A;  5JAV A;  2L12 A;  3HOW B;  1SYD A;  5K5P A;  3VA7 A;  1ICW A;  5C3X A;  3BVM A;  3I90 A;  1Y1V B;  1GOZ A;  3T56 B;  3SDZ A;  2XWJ B;  5DNF A;  5JVH 3;  2R3Z A;  1E2V A;  1RHP A;  1PRT B;  3UI2 A;  3Q23 A;  1PXU A;  4LK1 C;  5C6A A;  1H9S A;  4XQN A;  4N9P A;  3VR5 A;  3CHB D;  3CQZ B;  5CV6 A;  1QOH A;  2I07 B;  2ENB A;  1YNJ D;  1L0X B;  2KED A;  2B2U A;  2Z4H A;  3HOY B;  5M5Y B;  3C1E A;  3E6Z X;  2XVS A;  1HUN A;  4F7X A;  1Y8P B;  1GUT A;  1F9P A;  3FKI B;  3DMU A;  1HTL D;  5IOC A;  3NWS A;  2L5T A;  1STN A;  3D4R A;  1E2Z A;  1PTO F;  4DFA A;  3OMG A;  1MSH A;  4K8I A;  1AFP A;  4H44 C;  3GTL B;  4C3H G;  3I8Z A;  1EQT A;  4A3B B;  3M4Y A;  5IGG A;  3D4W A;  3OMC A;  1S5D D;  2K5Q A;  5C4H A;  1H9J A;  1I4R A;  1XWE A;  3HKZ B;  2A6E C;  3R3O A;  5IGE A;  3VR2 A;  1SMY C;  1Q12 A;  3A8K E;  4TQU S;  5CR3 A;  1B50 A;  1O78 A;  4ME5 A;  4K5X A;  2FFK B;  1HFN A;  4DNT B;  4B9W A;  1HRJ A;  1WTV A;  2CW0 D;  4J1M A;  2KEE A;  4A3E B;  1T5E A;  1DJR D;  2PZU A;  3KUP A;  3MFY A;  1F2M A;  1SE3 A;  1GUN A;  1R4Q B;  2XNA C;  2AWO A;  3OPO A;  2MJ8 A;  1YNJ C;  1K83 B;  4ZRZ A;  2K03 A;  1TWG B;  3G7L A;  3PIP 3;  1DYQ A;  5A35 A;  1CHQ D;  4QF4 A;  1WTP A;  1UAP A;  1WTW A;  2O5J C;  2SOB A;  2EJM A;  1NCV A;  1ENC A;  4K5W A;  1FNU A;  1DON A;  1F9S A;  4IUN A;  4ZLT F;  2FIN B;  3NTI A;  4FF4 A;  1H9K A;  5JEA J;  3QJY A;  5J39 A;  2B8G A;  3K5M A;  2A6H C;  2RDF A;  2PPB C;  2LKV A;  2F0U A;  1JWU D;  4BBS B;  4CJ0 B;  3VR6 A;  3VR3 A;  1TR5 A;  1PZK D;  1SNM A;  4I65 A;  5ISR A;  5J1Z A;  2L4N A;  1QNU A;  5EQ0 A;  3D3R A;  2KJX A;  3BZD B;  1LTA D;  3OIQ A;  1OXV A;  5DM7 3;  1A6X A;  1BCP D;  3A8J E;  1EZ8 A;  4AYB B;  1X3Q A;  2ICI A;  2R92 B;  3BYY B;  3J7A F;  4FVM A;  2NTT A;  1PTO D;  3PO3 B;  2IL8 A;  1ONL A;  4Q5V A;  4IUU A;  2F0N A;  3RLF A;  3R93 A;  4FXD A;  5G3L F;  4H0L C;  3VA5 A;  2KHS A;  2J0T D;  4C56 C;  1KTK A;  3PV0 A;  5C5M A;  1EZ6 A;  1I4X A;  2RQX A;  4OGQ C;  1TY2 A;  2X6G A;  5I6Y A;  4C3J B;  1HCZ A;  4WFN 3;  1UNS A;  3K5O A;  4DK1 A;  4RHS A;  5CV8 A;  1I3Q B;  1RDP D;  2L9H A;  3M7G A;  3OSO A;  1DM0 B;  3HG9 A;  1AW7 A;  4A3D B;  2NBF A;  1BR9 A;  2K28 A;  3MC0 B;  4XYQ A;  2NVQ B;  3AB9 A;  1V1P A;  5FKA C;  3PO2 B;  4OIK A;  4H7B A;  2F0D A;  3FMC A;  4KY6 A;  1F77 A;  5M3M B;  3NXW A;  3I70 A;  5F2D A;  4C2M B;  1I4Q A;  2M9V A;  3P75 A;  3QIA A;  5CV5 A;  2RVL A;  4HR7 B;  1TS5 A;  5EKK A;  1HTP A;  4CHT B;  2JP1 A;  2O5I C;  1ILQ A;  3RUZ A;  1C8C A;  1V1P B;  3HS0 C;  3S1M B;  1HA6 A;  1SNC A;  2EYO A;  3Q22 A;  4PMC A;  5FK9 C;  4RGT A;  5CV4 A;  1FR3 A;  4G57 A;  4IUV A;  4PNY A;  1JWS D;  4G4K A;  5C0X H;  2ZXO A;  4L8J A;  1KNE A;  2FMM A;  4NKL A;  2Z1C A;  3SVM A;  1D5M C;  4KN7 C;  2YYZ A;  5JVG 3;  4XXE A;  3S17 B;  4C3I B;  4PV1 C;  1S5B D;  3BVZ A;  3F2U A;  1BOS A;  4C3H B;  1IL8 A;  1FD7 D;  4XT3 B;  4OHJ A;  1B4O A;  3HOZ B;  3MFG A;  1LLR D;  1JOK A;  1LTR D;  2WAQ B;  4CKB A;  3I4L A;  1A15 A;  4IFD I;  1F2Z A;  1TVX A;  2EJG C;  3GV3 A;  3P7J A;  2ICE C;  1F9Q A;  1CM9 A;  2H4O A;  5T1G A;  3MHB A;  2F0G A;  4FNF A;  4FXG C;  1TS4 A;  1TWH B;  1AN8 A;  1WTX A;  1LTB D;  3OW7 A;  3NPP A;  1EY0 A;  3S16 B;  1VF5 C;  4U68 A;  4F88 A;  2IWH A;  3FPU B;  2A6H D;  3LWE A;  2L0C A;  2J7Z A;  1SYB A;  3FVQ A;  1EEI D;  1ML0 D;  5IIF A;  5COR A;  1ET9 A;  2EVB A;  3DWA A;  3M3Y B;  5C0X J;  1S4Z A;  4DAV A;  2PYK A;  1L0Y B;  2JE6 I;  1YNN D;  3D4D A;  3T13 A;  5KYI A;  3MXN A;  3NBH A;  1O7L A;  5D14 A;  3TP6 A;  4DU9 A;  5AFW A;  1Z47 A;  5EKL A;  3SR1 A;  1LTI D;  5ELF A;  5I2Y A;  1QJO A;  2B8F A;  1X32 A;  4C3J G;  2JEA I;  4DAY A;  3VYT A;  2F0V A;  2MP1 A;  1DOL A;  5C5L A;  4KMU C;  4NMZ A;  2V4D A;  5JEA H;  4XT1 B;  1VCI A;  4ABN A;  4WOR A;  3KBX A;  3V96 A;  1TWC B;  3MA2 B;  1RJT A;  4ULL A;  4BS9 A;  3IFD A;  2G9H D;  4HMJ A;  3IFT A;  4J6H A;  2KOL A;  3PUY A;  1IW7 C;  5CV9 A;  3OWF A;  5EBC A;  1TWF B;  1ZEQ X;  5M3F B;  1DZ1 A;  1ENF A;  1EYD A;  1PFB A;  4IUP A;  2KA7 A;  4KJN A;  2O2L D;  4A3I B;  5CBE E;  1BCP C;  3VYR A;  4IN3 A;  2H1E A;  3FPP A;  1SNP A;  4CKC A;  3RMH A;  2K1B A;  2RDG A;  1EFI D;  3WOF A;  3L9A X;  2JYO A;  3SK5 A;  5KGU A;  2NUC A;  2CQA A;  4ZUI A;  4K6L A;  2BDN A;  4NP5 A;  4HTH A;  4HCE A;  1W6K A;  5FO8 B;  1Y8N B;  1ESF A;  1BQQ T;  1LT3 D;  1TQO A;  3EVQ A;  4CBV A;  3QOJ A;  1U9R A;  3A56 A;  1NAP A;  2EY6 A;  1J9O A;  3ERQ A;  3GD7 A;  3K5L A;  1KAA A;  1FNW A;  4FF2 A;  2LS0 1;  4RA8 A;  2F0K A;  3CRK C;  2WV6 D;  1LAC A;  4ZKB B;  5JEA G;  1PRT C;  4BA1 I;  4ODG A;  2A69 C;  1HHV A;  3R8B A;  3MXP A;  4L63 B;  5JPN C;  2F0M A;  4QUF A;  2DY8 A;  1OXU A;  5EGT A;  2R7Z B;  2PW5 A;  4DAP A;  4MIU A;  5D3I B;  4PMB A;  3PIO 3;  2F3W A;  5CV7 A;  1I6H B;  4OIJ A;  2K32 A;  1SDF A;  1PTO C;  2O4X A;  2LFN A;  1EY6 A;  5LHY 1;  2NTS A;  1LAB A;  1CQF A;  3PUZ A;  5IGB A;  3CKI B;  4HSV A;  3OOC A;  2A6E D;  1KDC A;  3L3O C;  2GA4 B;  3LNN A;  1SYE A;  1B1Z A;  4UDU C;  1TKW B;  2NN6 I;  4RHR A;  4G7Z C;  3HP3 A;  3U9S A;  1V8Q A;  3MVV A;  3GTJ B;  4XQQ A;  3S2H B;  3IKJ A;  1SND A;  1DOM A;  1STA A;  2YU9 B;  1W6J A;  5COY A;  3H91 A;  3A54 A;  5I2X A;  4IUT A;  3SE0 A;  4X3U A;  3T4A C;  1PFN A;  1ZYR C;  2RBM A;  1SXT A;  5C4J B;  4ID6 A;  2IX1 A;  2OEO A;  1G6Z A;  5EPL A;  1STE A;  5ELB A;  1MI2 A;  3KBG A;  4IFD G;  1AEX A;  5CYU A;  2QCP X;  4XIG S;  4O42 A;  1EQV A;  1PMR A;  2RDH A;  3S14 B;  4HSP A;  2PQE A;  3OWE B;  1LT5 D;  2AUJ D;  2NYZ D;  4FXK C;  1XX8 A;  3NTK A;  1ZXT A;  3ND8 A;  2J4X A;  1TY0 A;  3QO2 A;  5D65 A;  1M4V A;  2XIW A;  1EIH A;  2WII B;  1EWC A;  1D1I A;  1QG7 A;  1STB A;  5FLX L;  1CTM A;  1JC7 A;  5CC4 A;  4OO1 I;  5E4W C;  1S5C D;  5DAU A;  5EBD A;  2PNR C;  1QCB D;  2F0P A;  3I73 A;  1GUS A;  4DA2 A;  2B2V C;  1EY7 A;  5BN3 A;  1IKL A;  4RH6 A;  3R2T A;  4WJW A;  3MZ5 A;  3TSS A;  3Q24 A;  2D9U A;  1PFM A;  1LTG D;  4E6I A;  3DWQ A;  3TZU A;  4U67 3;  4KD3 A;  2M00 A;  1SYG A;  4EQP A;  3P20 A;  5KYL A;  3C1F A;  4HCS A;  2Q8T A;  4C1N K;  2BCO A;  2PMZ B;  1JE4 A;  1XYI A;  3DEP A;  2NVY B;  5CGK A;  4EQN A;  4TSS A;  4X3K A;  2HCC A;  3W3A A;  1GJX A;  3CU7 A;  4IQZ A;  3NTH A;  2C9O A;  3MXU A;  1D1K A;  3A55 A;  2DNE A;  2FJ2 A;  1K8M A;  1JWM D;  4UAI A;  1WVL A;  3J7A V;  5IGD A;  4LMQ D;  1CA6 A;  1WTQ A;  1DXM A;  1IYV A;  2A74 C;  1Z6H A;  2F3V A;  2K7V A;  2ZXP A;  2BA0 A;  3FDT A;  2L1B A;  1PYW D;  1MD2 D;  2FMC A;  5EPJ A;  2Z4I A;  5A2Q L;  5NUC A;  1A2U A;  1RCV D;  2EY1 A;  4RGN A;  4JBW A;  1LV9 A;  2MPM A;  4LJZ C;  2A73 B;  4RWS C;  3SHL A;  3M7N A;  1EY8 A;  2X6L A;  3DUZ A;  1HPC A;  2CVR A;  5IGC A;  3K58 A;  1JIC A;  1JOR A;  1A2T A;  4KD4 A;  1B3A A;  2VNU D;  2PO4 A;  1MGS A;  1NR4 A;  4TKO B;  2TMP A;  1CFM A;  4ILW A;  3Q6S A;  4XQJ A;  1B9M A;  1CHP D;  1ROD A;  2C5C A;  1EEF D;  1BBX C;  3QOL A;  1KLG D;  3R2I A;  1OXX K;  3I72 A;  4K8J A;  5KNB A;  3S1Q B;  1F2L A;  1EU4 A;  2EYH A;  4KJO A;  2QIL A;  1U4M A;  3J7Y W;  3J81 L;  3I4N B;  4IUQ A;  4P2C B;  3HOV B;  5M5W B;  5HGT A;  3TP5 A;  1XXG A;  3NE5 B;  1A3V A;  2DNC A;  2B39 A;  1E0B A;  1G2T A;  3HZX A;  2AQ2 B;  2NWG A;  2OXP A;  3TP8 A;  3O13 A;  5C44 B;  4A3K B;  5E3F A;  4KN4 C;  2AQ3 B;  2A68 C;  3NK9 A;  2X69 A;  3EQL C;  1SYF A;  4FF1 A;  1IYU A;  4CGY B;  1TU2 B;  2VUM B;  1STY A;  2VXW A;  3A7A B;  3NP8 A;  2BE5 C;  3JAM L;  4MHE A;  5T1I A;  1BNZ A;  2KCC A;  1BF4 A;  3QB3 A;  1EY5 A;  1O80 A;  3LX0 A;  4J8Q A;  3RD4 A;  2KVM A;  1PRT F;  1PTO H;  3C2P A;  4ZUJ A;  4Z9C B;  2WB1 B;  2IX0 A;  3HGB A;  4BY1 B;  1Y69 U;  3GTG B;  3J81 E;  2Z8L A;  1WTO A;  1C4Q A;  5EJW A;  4BBR B;  4QIW B;  1TS3 A;  3HOU B;  1CI3 M;  1SE4 A;  1RF2 D;  1UUP A;  1A3T A;  3SK6 A;  3GTP B;  1V43 A;  2JA7 B;  4XDX A;  2RSN A;  1PTO B;  5IT9 L;  1BDO A;  1TWA B;  3OHX C;  2VB3 X;  3MEH A;  1SNQ A;  4HED A;  5C4Z A;  5LL6 S;  1NUC A;  4IUR A;  1JOQ A;  1SJE D;  1O7Z A;  2EY2 A;  3M4O B;  2RA4 A;  2B2T A;  1PZI D;  1LTT D;  2WIN B;  3KLS A;  4WRD A;  1M8A A;  3GTQ B;  2B2W C;  1G29 1;  4HN7 A;  1MSG A;  1S5F D;  3GTM B;  1OXS C;  3DHQ A;  1KDA A;  1D6E C;  3K0Y A;  5I6W A;  2EYM A;  2F4I A;  1ENA A;  3KF8 A;  1KLU D;  4OL7 A;  2NB0 A;  3PUW A;  1Q1B A;  5M9O A;  3HEJ A;  2EYF A;  1JCK B;  4C1N I;  2IX3 A;  2EE1 A;  3Q0A A;  2XWB B;  4IZ8 A;  3S1N B;  3URY A;  1G8Z D;  4KY5 A;  3MTS A;  5ELE A;  4A93 B;  3C3L A;  1U4L A;  3PMF A;  1LO5 D;  2A5H A;  5M5X B;  4FYD A;  1JQY D;  2SNM A;  1R9T B;  5JJZ A;  1G2S A;  1QE6 A;  1EOT A;  4IFD J;  1XTC D;  1PDQ A;  1T5X D;  3GV6 A;  3DWP A;  2EOT A;  4DXG A;  4TRD A;  4XTC S;  5FLX E;  3EFX D;  3GTK B;  2PZW A;  4DN4 M;  3E0J A;  4KK7 A;  3D6C A;  2EDG A;  3J80 L;  1FNV A;  1KDB A;  2B2T C;  4V0B A;  1TII D;  1QIL A;  1BXT A;  2TSS A;  4KTA A;  1RKN A;  2QF7 A;  3KK7 A;  2PW7 A;  2LMC B;  3ZYY X;  3A7L A;  1V1O A;  1YNN C;  2NZ1 D;  1CQV A;  1AZQ A;  3DXJ C;  2F0F A;  1PLF A;  3H94 A;  2AWN A;  1QNK A;  5BN5 A;  3AMU A;  1KAB A;  1B2T A;  1K8O A;  5KIX A;  3ERO A;  3IL8 A;  3GO5 A;  4NDX A;  1TS2 A;  3MXG A;  5CBA E;  4KHV A;  3BDL A;  3E5S A;  1SAP A;  1HQR D;  2E2I B;  1GUG A;  2F1M A;  1NR2 A;  3K59 A;  5FO9 B;  2AUK A;  3H3V C;  3EA6 A;  1X3P A;  4LAA A;  1VF7 A;  3VYS A;  3NBI A;  3KLS X;  1AP0 A;  4DNR B;  3SK4 A;  2F0S A;  4HMI A;  1STG A;  4S3S A;  2EZV A;  2Q8I B;  2F0J A;  4Y7N B;  3ONA B;  4A3F B;  3S2D B;  2F0I A;  4HAE A;  1JR0 D;  1F9R A;  2N55 A;  1GHJ A;  3TBI B;  5DM6 3;  5A2Q E;  2ZT9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...