2EYLA

Crystal structure of staphylococcal nuclease mutant t82s
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRSDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2eylA00
1SNQA 4HMIA 1IHZA 3TP6A 5KYLA 2EYOA 4IZ8A 2F0SA 2F0IA 5C3WA 4EQPA 3TP5A 1ENCA 4KV6A 5ISRA 3NK9A 4ZUJA 2SNMA 2PW5A 4K14A 1A3UA 1EZ6A 2EYLA 2OXPA 5IGCA 5IGFA 3HZXA 4MIUA 4EVOA 3QB3A 2OF1A 1EY4A 2LKVA 2F0FA 4K5XA 1SNMA 4B9WA 3MZ5A 4QF4A 5IGBA 4J6HA 4RKBA 4DFAA 2F0DA 1SYBA 2PZWA 1EZ8A 1A3TA 2F0JA 5NUCA 1ENAA 1TQOA 1JORA 2F0TA 3D6CA 3T16A 3TMEA 1EYCA 3QOJA 4ZUIA 5I9PA 1SNOA 1EYAA 2F0GA 4N9TA 2RDFA 3SR1A 4K2KA 3D8GA 3TP8A 1JOOA 3T13A 4K8IA 1SNPA 4K6DA 2F0VA 4KD3A 4NKLA 2O4XA 1SYCA 3D4WA 4NP5A 5IGDA 3P1HA 5C6AA 3MEHA 4K5VA 4DU9A 3D4DA 2F3WA 4ODGA 3VA5A 4F8MA 5E3FA 1II3A 3EVQA 5CR3A 4K8JA 2F0NA 5CV9A 4B9XA 4HMJA 5IOCA 1KDAA 4PMBA 4QMGA 5CV5A 4KY5A 2EYFA 4PMCA 4ZQ3A 2HQEA 5JAVA 3S9WA 2RBMA 1SNDA 3MHBA 2ENBA 5C5LA 4OL7A 3RUZA 5IGGA 4H7BA 2EYPA 1TR5A 1EY8A 2EYHA 2PYKA 5J1ZA 5M9OA 3SK6A 5C4ZA 3PMFA 5J39A 1KDCA 1A3VA 1SYEA 3ITPA 3QOLA 4G57A 4EQOA 1NSNS 4LAAA 2EY6A 1EY9A 4DGZA 2F0HA 1AEXA 4K5WA 1KDBA 4KD4A 4KTAA 4N9PA 5CV6A 5EGTA 3SK5A 1JOKA 5IGEA 4E6IA 1JOQA 3LX0A 1EY0A 5KYIA 4RKLA 1U9RA 5IODA 4NMZA 2F0MA 4KJOA 2EY2A 5I6WA 3OMCA 1SYDA 1EY5A 2EY5A 2PZUA 4DF7A 2F0OA 2PW7A 5K5PA 1TT2A 4F7XA 5CV7A 4J1MA 2F0KA 5EKKA 1STAA 1A2TA 4IALA 5C3XA 4PNYA 3DMUA 3HEJA 1A2UA 3E5SA 5E1FA 1F2YA 1NUCA 2F0EA 3NXWA 2SNSA 4KY6A 3NHHA 1STBA 3V2TA 5KIXA 2SOBA 5DEHA 5CGKA 5EKLA 3BDLA 1EY6A 1KAAA 1RKNA 2RKSA 3EJIA 2F0LA 4ID6A 4WORA 3R3OA 5JOBA 3H6MA 2KHSA 3C1EA 3OWFA 1SYGA 5CC4A 5I6YA 5IIFA 3C1FA 4IUNA 3U9OA 1EYDA 4HTHA 4KHVA 3OMGA 4QB4A 5I9OA 4K2LA 1F2ZA 3OSOA 2F3VA 2M00A 5DAUA 5J22A 3MVVA 4S3SA 5KGUA 2EXZA 3DHQA 4ME5A 2PZTA 4NDXA 1KABA 1SNCA 4YIJA 3SHLA 3BDCA 5C5MA 3SK4A 1EQVA 2KQ3A 4KY7A 5KEEA 3NQTA 1STYA 1F2MA 4TRDA 3TP7A 1EY7A 2F0PA 5CV4A 5C4HA 2F0WA 3SK8A 1SYFA 5HGTA 2NUCA 1STNA 2EY1A 2PQEA 3SXHA 5KRUA 3NP8A 3ERQA 4I65A 4WRDA 2F0QA 5CV8A 2EYJA 4EQNA 2EYMA 3P75A 1STHA 2F0UA 2OEOA 1STGA 3EROA 2WACA 4KJNA 4R8NA 5F2DA 3NUCA 3MXPA 5HURA 2QDBA
chains in the Genus database with same CATH superfamily
2WB1E 3JAML 3BDOA 1EU4A 1LACA 2BDNA 2K5NA 5EBDA 3I4MB 4DKAC 4GN3B 3GV6A 3PUXA 4PZ7A 4C3JB 4RAUC 2WKDA 1UAPA 1HPCA 4DR2L 2K28A 2OXPA 5IGFA 1D6EC 4C3HB 1AH9A 3JAMc 3Q23A 3NENA 3HOUG 2KJXA 2IW3A 1QVGA 3QB3A 1VQGA 2X69A 4NB3A 2TSSA 2AQ1B 3GO5A 2PI2E 5NUCA 4X3SA 2HCIA 4FXDA 3GTOH 1S3OA 3HOWH 1BR9A 5M3FB 1K73C 3KF6B 1VMCA 1EYAA 4DK3C 3KDFB 1WTHA 4A3IB 4K8IA 5K36G 2ZTEA 5KNBA 1S5FD 5HY6A 2B63G 4F8MA 4GOPB 1S5CD 1JB7A 4IFDG 3S1NB 2H4OA 4RGNA 4KY5A 2ICEC 4C56C 3HOVH 3CMEA 1EY8A 5C3EH 1Z6HA 4B3ML 4LAAA 4XT3B 3CCLA 4K5WA 1MD2D 1KDBA 2AHOB 4QCLA 4YCUA 1X9NA 1EY0A 2QILA 1XWEA 2K32A 1PRTF 3OMCA 4PMWA 2UUCL 1TT2A 1UE6A 1EIGA 2YU9B 3RZDH 2D5DA 5DEHA 4HIDA 3BDLA 4LK1C 4DV3Q 3S1RB 3PO3G 4M8AA 4R4TA 1HR0Q 1D5ZC 2Q8TA 4DV6L 3FRPB 1EYDA 3KF6A 2B2TC 2FJ2A 4QB4A 5T1IA 3KDFA 4ULLA 5C44B 2F3VA 3FKIH 3F2DA 3QO2A 3BDCA 4GOPA 1SR3A 1B53A 2KHIA 4YCVA 2DY7A 1A63A 2JA5G 2B29A 1STNA 3QIAA 4XYQA 1WTPA 2JA6B 3BS1A 2F0UA 3K8AA 1VQFA 2YTVA 4IPGA 3WWVA 5GAEC 5FLMG 3UDGA 5F2DA 2JK8A 2QDBA 2E2JH 4JI1L 1TWFH 3G6JB 2NVTH 1X3GA 1QCBD 1ENCA 1XNRL 4JYAL 2Q8RE 1CSPA 1VQHA 5FLXc 3QWNA 2Y0SB 4J8QA 4JBJA 3S2HH 1YZ6A 2EYLA 1I5FA 2UXBL 1IKMA 4IO9A 1D2BA 5IP7H 1MKHA 1TVXA 4Q5VA 3K5LA 1QVFA 4A3JB 4C1NK 2NVXH 3HOYG 1R9TH 1FGBD 4GLAC 5KNDA 5IGBA 1UUPA 2L5TA 2OTLA 2MHVA 2L0CA 4XQNA 1EZ8A 1CQFA 3I4OA 3LWUA 3OHXC 1YITA 3QOJA 2Z8LA 3EQLC 5I9PA 1V1OA 1YHBA 2WFWA 4X3TA 4F87A 5A2QL 3RLFA 3T13A 4K6DA 3E9IA 1HUNA 2O4XA 4A75A 3I4NB 4WFN3 4QIWE 5CV9A 3GTGB 5IOCA 3S1QB 4OHJA 1HUMA 4DV5L 3A74A 1DOLA 1NBWA 3RUZA 3PO2G 1TU2B 4APVA 2PYKA 4X64Q 4JG2A 3H3VI 3L3OC 1XYIA 2A8VA 2RQXA 3QR8A 4RMFA 1NSNS 1EY9A 2R3ZA 2F0HA 2KCCA 1X56A 1I4HA 4RKLA 1PH3A 1NAPA 2AMCB 1VF7A 1A15A 2F0OA 1XX8A 2WAQB 2Z4HA 1OXVA 3VR2A 2NYZD 1LM0A 4JI7Q 2RDGA 4A3GG 3NXWA 3DEOA 2ZM6Q 3GTKH 1LTAD 2QEXA 1MGSA 1KRSA 1BXTA 1RKNA 1K3RA 3A0JA 5CC4A 1EFID 2UUAQ 4CHTB 3QG1A 3I4MG 1I3QB 3K80C 4C3JG 3K5MA 1N33Q 2JA7B 1QOHA 3I4LA 5FO9B 4DV4L 4KY7A 2KQ3A 3NQTA 4C3HG 2F4IA 1B3QA 1PMRA 2B2YA 1B4OA 5LMUQ 3PUZA 5FK9C 4OGQC 2DN8A 4A3DH 2AUJD 1HTPA 1SROA 4UP7A 4HJ7A 5M3FG 2EJMA 2ZTDA 4K0KQ 2EIFA 4TVAB 5JVH3 4A3IG 3MFYA 3M4OH 1HNWL 2IJ0A 2SNMA 4GN4B 4LNQA 2GN5A 2K52A 2PNRC 1D1KA 1I4PA 4EVOA 2DNEA 4RH6A 3Q22A 1EQQA 2OWOA 2UXDQ 2N88A 1NE3A 3VR4A 1Y1VB 5AFWA 4K6LA 1LTBD 1PTOF 3J7AV 1YJNA 2PCFB 1FVIA 1W2BA 2KCMA 3BYYB 4WJWA 5C4XB 4NW2A 5M5XB 4JI0L 4K5VA 3D4DA 2NN6H 3KFUA 3A55A 3S2DH 4JBMA 3G7LA 4RCOA 5M5YB 3MEFA 4NXML 1KIXA 4LW1A 4DV1Q 4L8JA 3GP7A 1LTSD 1D5MC 1CK1A 2HUGA 4HJ9A 1WYDA 4BY1H 5EKIA 1KL9A 4LF6L 1RTNA 1HR0W 4ME3A 1A62A 2JQOA 1HXYD 3J80c 2RCFA 3ULJA 5GAHC 3CPFA 4KD4A 1KTKA 3T1YL 2Q2UA 4ZYSA 5KYIA 1U9RA 1VQOA 1I6HB 1PXUA 5DNFA 3BJUA 1SE8A 5IYBH 4OONA 1OTCA 1U4MA 1EFWA 2F0KA 2VS1A 4GNXB 2UUBQ 1C8CA 4BXXG 2JA6G 1DM0B 1D8LA 3NHHA 1CKNB 1NR4A 1EIHA 1MBYA 1NR2A 4QJFA 2RKSA 1JC7A 3HKZB 1NMFA 4GLXA 4L5SA 3M3YH 1SEBD 1F2ZA 3OSOA 3PSIA 3MVVA 1K8AC 3DHQA 3G4SA 2L1BA 1V8QA 2AWNA 2NBFA 2Y0SG 3PCOB 5JEAH 2N49A 3S16H 2KUMA 4QGUA 1YNND 4WJ4A 3GTOB 1S5ED 3HOWB 4LUZA 1CT1D 3ULPA 4A3JG 3SXHA 3FPPA 4J15A 3EROA 1ASYA 5EJWA 3T1HL 2E2DC 3L2PA 1IHZA 1G291 4JI4Q 4IZ8A 2VL6A 1Z47A 3VA7A 2JSOA 3NK9A 3HOVB 1JQYD 3OW7A 2PW5A 3S17H 5C3EB 3I4NG 2R93H 5M3MH 1B2TA 2HIXA 1MIUA 4GNXA 1Y14B 5JEAJ 3H94A 1KD1C 1OXUA 1CZGA 4IUTA 2IY5B 1XMQL 2NZ1D 4ZLTF 1CKNA 1DOKA 4IUVA 4YCWA 1JE5A 4N8X1 2MO1A 4DFAA 3I91A 4RHRA 1RL2A 4V190 1Y8PB 3RZDB 4OIKA 4YWKA 3U4VA 2CHBD 1N34L 1E2ZA 5COYA 2OQKA 3PIOA 1CKMA 3D4WA 1ZXTA 4B3TQ 4YHHL 4ODGA 3OOCA 2EJGC 3S1MH 1WTVA 3EVQA 2CQOA 4Z9CB 4EQ5A 2JE6I 3J81i 2DUDA 4CKBA 2L15A 1U4LA 3FKIB 1YHAA 1V43A 1K0SA 3IRBA 3DWQA 2NWGA 3ZYYX 4P73A 4QIWB 2YTXA 1D5XC 1YNNC 5C0XH 2VQEQ 4DV7Q 1E7ZA 1NCVA 1QZHA 1UWVA 2E2JB 2SEBD 1TWFB 2D9UA 3OPOA 3RNUA 3G6EA 1XPOA 2NVTB 3WOFA 4UPAA 3MFGA 1F2YA 4LF9L 1KNAA 3AFQA 1K0RA 3K5OA 1I50H 1RD9D 1YNJD 3A8IE 4JI5L 2PMZE 4AYBE 3S2HB 3HGBA 2CFMA 2ALYB 2ZXOA 5J22A 2KHSA 1YJ9A 3MXGA 1QVCA 1SBBB 2NVXB 2EXZA 1R9TB 2PZTA 3W3AA 1AE3A 2KEEA 3SHLA 5C5MA 5C0XJ 1MJCA 1STYA 4TRDA 3I55A 2K75A 5GAGC 4AQYQ 5HGTA 5LMNL 5C4JH 1ET6A 1G2TA 4LFBL 4WRDA 1J9OA 1Y1VG 1HQRD 4KJNA 4L63B 3GTPH 5FLXE 1U4PA 4A3CH 1X54A 3GD7A 4IFDI 4GKJL 4HMIA 4HJ5A 5IWAQ 3M4PA 1ILPA 1GJXA 1H9JA 1Q1EA 4ZAIA 1MHWC 2F03A 1VMPA 4EQPA 4GKKL 3K58A 1ZEQX 5I2XA 1A8VA 1E0BA 4L5RC 1JE4A 4GN5A 1HH2P 5G3LD 4H13C 2B2UC 2Y0SE 1P8LA 4ZCKA 1P16A 2PZWA 2ZJPA 5HGQA 4LF5Q 5JPMC 1PH7A 1Y69U 3GTKB 2RDFA 3B6YA 3C46A 4JVZA 4JI8L 1SYCA 4DU9A 4A3FH 3VA5A 5BR8Q 1YNJC 3I90A 1Q86C 4WJ3M 5J3BA 4BBRH 2YV5A 1KDAA 4XIGS 1FL0A 1FYCA 2NTTA 3KF8B 3F2UA 2UXCL 5KNCA 1QJOA 1G51A 1UEAB 4KHPQ 3HKZG 5J39A 1J5EQ 4A4IA 2MJ8A 2NVQH 5IYCH 1WJJA 2OT2A 3I8ZA 1LLRD 3K0YA 4P71A 4U673 2YTYA 3AFPA 1QNUA 1EY5A 4YWMA 4A3DB 1G91A 4IALA 3HOWG 4LFAQ 4G4KA 3OIQA 3GTJH 4A3BH 4DUYQ 1S5DD 3H09A 3M4OB 3HOYB 1W3SA 1HNZQ 2F0LA 3H6MA 4O0AA 1MI2A 4HAEA 1PYBA 2IX0A 3HOVG 4YIJA 4LFCQ 5C3EG 4DR6L 4A93H 2XRQD 3PIP3 2F0WA 2A5HA 3CC2A 3ERQA 5CBAE 3ICEA 3L0OA 3KF8A 1JCKB 1BVSA 2FFKB 5EPLA 4DR2Q 2HQLA 3VYTA 3PO2B 3S2DB 2EYOA 4FF4A 1KHIA 2GVBA 4R4CA 2BH2A 2JN4A 1GKHA 3TP5A 4BY1B 1SDFA 4ZUJA 3AMUA 1OXSC 1O7YA 2KECA 2PO4A 1VQ5A 1B9NA 3AB9A 3KBGA 3TN2A 2O5JC 1WTXA 3FKIG 3PGZA 3M7GA 1D7QA 1PTOB 4J6HA 1E1OA 2G9HD 2PPBC 2F4VL 3D6CA 2VXWA 4ZUIA 2JA9A 3FVQA 1JOOA 3R93A 2J4XA 4B3MQ 4A3MH 1VQ7A 1EU3A 2FXQA 2RHQB 2NZHA 1BBUA 3M3YB 2A74C 3J80E 5CV5A 5JAVA 3DWPA 3E3XA 4DK1A 2CH4A 2PNHA 1O7LA 3FDTA 2UUCQ 4GZYC 3S16B 5IP7G 2A1AA 4DR5L 1ML0D 1XJVA 2HHHL 5EPKA 1O7ZA 1VQMA 3JAMi 4A3EH 1J6QA 3VYRA 4DV6Q 1HZAA 2K7VA 4ZKBB 4BY7H 2BH8A 1H9MA 1LTID 1FNWA 3KK7A 1BBWA 4LF8L 5FKAC 3EJIA 3CCQA 3CRKC 3S17B 3R3OA 2R93B 5M3MB 3C1EA 1K3BC 4HR7B 1PVOA 1I4QA 4XQJA 5E4WC 4IUUA 1JR0D 3MA2B 5IP9H 1Q82C 3PUWA 4JI1Q 2L4NA 3P20A 2PMZB 4POFA 4AYBB 3HKZE 2B2TA 5CORA 1IL2A 1XNRQ 4JYAQ 3N52A 3I2ZA 1PH9A 4HCSA 4R9WA 4LF4L 2UXBQ 3DWAA 3S1MB 3DEPA 5KYLA 3T51B 3I70A 4A76A 2N3SA 1ESFA 3UE1A 5C3WA 4B08A 2AQ3B 4UHVA 1C0AA 4K14A 1A3UA 1B7YB 1TS2A 1EZ6A 1SMXA 3AYHB 3LWEA 3MTSA 4MTKA 2A68D 4JI2L 3R8BA 1WCMH 2LXJA 3VYSA 3RN2A 1CHPD 1O7IA 3GTQH 2KOLA 5A35A 5FLXL 4IOAA 4IN3A 1M1KC 4X65L 4XTCS 3FPUB 1U5KA 3OW2A 5C0XI 1PHJA 3X3NA 3T16A 3K57A 1GOZA 1JJGA 4IURA 4DV5Q 1BF4A 3BVMA 1TWAH 3D8GA 3T56B 3TP8A 4HJAA 4KD3A 3NTKA 1WOCA 2F0VA 2F1MA 4NKLA 5CMDA 1WTOA 1I94L 1S5BD 3VR6A 1XTDA 4A3DG 4PG3A 3UI2A 4DN4M 5CR3A 4R4OA 4NXNL 2K03A 4C1NI 4ZQ3A 3MHBA 1Y1WH 3TZDA 4B3RL 5J1ZA 4B3SL 1Y8NB 3ITPA 2B39A 1Q8IA 2VB3X 1QNKA 1SXTA 2N78A 3TDQA 1IBML 5C4JB 4KTAA 2RF4A 1HFNA 4BWGB 4QQBX 1B3AA 3TZUA 4DV0L 2XWJB 3GTPB 4X62L 4P72A 3CCUA 2G5DA 4J1MA 3TS2A 3KLRA 5EKKA 1A2UA 3GTMH 3PF4A 4KY6A 5JJLA 1IBKL 1BO0A 4A3KH 1CHQD 4DV4Q 1KAAA 2NN6G 1KQSA 4KI0A 1H9RA 3W1BA 2O5IC 1EIFA 4ZK9B 1RIPA 3DLLA 2MP1A 4K2LA 2M00A 4HIKA 1RF2D 1CTMA 2A68C 4S3SA 4ZKCB 4BY1G 3SK4A 3K0XA 1HNXL 4ZRZA 2KHJA 1SMYD 1PFNA 4KLKA 4OIJA 3IL8A 5KRUA 1RJTA 1RODA 2E2IB 3J7AF 4QUCA 5CV8A 4EQNA 2RHSB 3U4ZA 1HNWQ 2BA1A 4JV5L 1LT5D 3NUCA 5IYBG 1VQEA 3O13A 4GLVB 4BBRB 1UE1A 1QG7A 2G9DA 2X6LA 1LYLA 3NWSA 1DOMA 3KJOA 1VQPA 4PV1C 2AQ2B 1VQ4A 2NVQB 4C3IH 1SLJA 1OO9B 2F0FA 2I46A 3QJYA 2E5LL 4JI0Q 5JEAG 2MNAA 4JC0A 2F0DA 3W1GA 1JORA 3OYYA 4NXMQ 2VB2X 4G7ZC 2XSCA 2JP1A 4IOCA 1J8IA 2VQFL 5ELNA 3D31A 4UDUC 4LF6Q 1PV4A 5E3FA 4DV2L 1JWUD 4MHEA 3M4YA 3T1YQ 1ZYRC 3GTLH 1M4VA 1QUQB 1O80A 2KA7A 1Y8OB 3CCEA 3TSSA 2R93G 5M3MG 4Y7NH 4A93B 1PZKD 2D62A 1SE2A 1KAWA 3C3LA 1SYEA 1HA5A 1T9HA 5IT9E 1SMYC 1TWCB 5EGTA 2ES2A 2I0QA 5CV6A 3H3VC 4E6IA 4H0LC 5IODA 1H9KA 4FF1A 3A7AB 4FDBA 4X3KA 4BA2I 1FJGL 1CM9A 4DF7A 2PW7A 4AYBG 1PLFA 4QY7A 3J80L 4BS9A 1STAA 4ILWA 3A5UA 2A19A 4TQUS 3DMUA 2C9OA 5AJ3L 1WTRA 4AH6A 5KIXA 2L55A 2PQAB 1A0IA 2B2WC 4ID6A 3CQZH 2KVMA 3D0FA 4IUNA 1EOVA 2E8GA 3U9OA 2R7FA 4IPCA 5KGUA 1YBYA 3K59A 2ICIA 3T1HQ 1TS5A 4L6TB 2LMCB 2JEBI 2CQAA 1VQKA 2L9HA 4CGYB 1BQQT 1L1OC 4IPHA 5C0XG 4OWWB 1QUQA 3ER0A 3VYUA 3BU2A 4L5TA 3J80i 1I4RA 2P5ZX 4A3MB 1SNQA 3WDNA 1XMQQ 3RZOH 3Q0AA 4BA1I 1UE7A 5I2YA 3I7FA 4JBKA 2I5MX 3CCJA 1N34Q 4UY8C 4DR4L 2LKVA 2PQAA 4B9WA 5EPJA 4YHHQ 2M9VA 1PZJD 1G8ZD 4A3EB 2KCNA 1IL8A 4BY7B 1B50A 1C7YA 1IBLL 2K33A 5IYDH 5IGDA 1ZKOA 1F77A 2QF7A 4NP5A 3NBIA 4A3CG 1ESRA 3MEHA 2CW0C 3NE5B 2L12A 4JOIC 1II3A 1ILQA 1HZ9A 2F0NA 1AZQA 2I5LX 2KCTA 4QMGA 1V1QA 2C35B 4DAMA 4UP9A 4L5QA 1FNUA 1BCPD 2Q8IB 3SK6A 4JK1C 3HFZB 2IWHA 1YEZA 1K8OA 3H0GH 3Q6SA 4N9PA 3EBEA 4LF9Q 2Z6BA 3N6RA 1JOQA 4JI6L 2QW7A 4JI5Q 5E4XA 5I6WA 2K01A 4BBSH 2K14A 5K5PA 2IT1A 3F2CA 5C3XA 1DONA 4O2DA 1Z9FA 1S40A 1QZGA 5CGKA 1G6ZA 1X3PA 5JOBA 4A3FG 2XVSA 4LWCA 2ZJQA 3C2PA 4M1UB 1IYJB 1RDPD 1G2SA 4RG1A 1JB3A 4BBRG 3PF5A 5DM63 5LMNQ 3PIO3 2XNAC 1PFMA 3K7AH 2KBNA 4DNRB 1WCMB 4LFBQ 3TEHB 1XNQL 3GTQB 1B1ZA 1X3QA 4IUPA 3L7ZC 2K5VA 4P2CB 3GQBA 2Z6KA 3URYA 4GKJQ 2R61A 1K28A 1CA5A 1BOSA 5IYCG 2JA8H 4X66L 2UU9L 3SK8A 5EQ0A 4XXEA 1TWAB 2HD3A 2E2HH 4OX9L 1GUSA 4GKKQ 1STHA 2OEOA 3HOZH 3VR5A 1DZ1A 5IY0A 2HIVA 1PRTD 3BG3A 3TQYA 2OQ0A 4A3BG 3M7NA 1E3PA 3V05A 3RLOA 1E2VA 1Y1WB 2Z9HA 1LV9A 3W2DA 3BYTB 1CZWA 4MIUA 1BCPC 3OIPA 2IL8A 3AEVA 4JI8Q 4POGA 4K5XA 3F1ZA 2K50A 4JI3Q 3FEWX 4A93G 3DXJC 1ENAA 4OXPA 2ASBA 3TMEA 1ONLA 3M85A 3TBIB 1VQCA 1DJRD 4EGVA 4DAPA 2B2UA 2UXCQ 4A3KB 1TWHH 1PDQA 1VQDA 3L9AX 1EWCA 1AFPA 1V9PA 1GVPA 5DM73 4DNTB 5DLQE 5JPNC 1N32L 2HQEA 3J81j 1M8AA 1TXYA 3H91A 4OELB 4DR3L 1MSGA 3BVZA 4H7BA 2SDFA 3SE0A 5JVG3 4G57A 1VQJA 4EQOA 1JJCB 3CCVA 5ELCA 3H3VH 1XMOL 3BZKA 5IGEA 3A8KE 3E0EA 3MC0B 5CYUA 4NMZA 1ASZA 2EY2A 4ABNA 1EWIA 3NPPA 2LY7A 2H5XA 1PFBA 2WV6D 1A2TA 4TSSA 3E5SA 2D0OA 2O2LD 1STBA 1PRTC 2WINB 1HHVA 3CPWA 4DA2A 4DR6Q 1F9SA 4A3MG 1KLGD 2I07B 2HT1A 1STEA 3A5ZB 1WTQA 4C3IB 1N36L 4KHVA 1CI3M 1H9SB 2K6AA 2D2CC 5A2QE 3ND8A 5E7NA 4FXKC 3CP0A 4HCEA 1ET9A 2R92H 4RWSC 2EDGA 5CBEE 2A6ED 2Z0SA 1NY4A 3KUPA 1V1PB 2B2VC 1VQBA 2EY1A 2TMPA 2IHFA 5IT9c 4OWXB 2ATWA 2JA7H 4RGMA 3K81C 2EYMA 3P75A 4DR1L 4CKEA 4A3EG 1KRTA 5HURA 3HP3A 4BY7G 3OTOL 1I4GA 2VUMH 1GUNA 3RD4A 3PV0A 4O42A 3LNNA 4KMUC 4DPGA 4HIOA 1M90C 3GTLB 1JJ2A 4HSVA 2CVRA 4Y7NB 3KYHC 2F4VQ 1RCVD 4FYDA 2OF1A 5D3DA 5IP9G 1QILA 1SNMA 3UDFA 4LUVA 4OEMB 1SFOH 1EYGA 2A69D 2XGTA 1LUZA 1XXGA 4CDFC 2JJQA 2K4KA 4X6AH 5ELOA 3I73A 1H9SA 1UE5A 1VQLA 2NN6I 4PQXA 3CQZB 2ZXRA 2R7ZH 3KLWA 3J7ZC 2LS01 4LF7L 4DXGA 4DR7L 4H02A 4YY3L 1J5EL 4DR5Q 3UDIA 1V1PA 1TY0A 2HDMA 4HMJA 4U68A 1LTTD 3GDEA 5BN5A 2HHHQ 3HOXH 2EYFA 4UP8A 3S9WA 3RMHA 5C4XH 4OO1H 3CAMA 2B8GA 5D65A 1KDCA 3QOLA 5LMNW 1WCMG 2A73B 3M4QA 4LF8Q 5I4DA 3LX0A 2A6EC 2F0MA 1B9MA 2BDOA 2DJFC 2BE5D 4KJOA 1PH1A 3X3MA 4P75A 2XN9C 5FOBB 1HNZL 1K83H 4F7XA 1IKLA 3KOJA 1EWHA 3HEJA 3RZOB 2K1BA 1NNXA 1AE2A 1SYGA 4DUZL 1DXMA 3C1FA 3E9HA 2AWOA 2ZT9C 1HZBA 3KLSX 1FNVA 1BCPF 5I9OA 1JWSD 2E76C 2K5HA 5ELFA 4XDXA 1Y1WG 4ME5A 4NDXA 1IYVA 3ULLA 3WOEA 1KABA 1C9OA 2IHEA 2ZJRA 4LF4Q 4TKOB 5CV4A 2A69C 2WIIB 3CRLC 5LL6S 3Q24A 1YJWA 2K5DA 2FHTA 4R8NA 1RTOA 4FF3A 3HG9A 1Q8KA 2NTSA 4LJZC 2Z1CA 3MXPA 1U0LA 1HTLD 5D14A 4JI2Q 3F2BA 1MJEA 1O78A 1EEFD 2R6GA 1VQNA 1X55A 4A3KG 4DAYB 5ISRA 4X65Q 3H15A 4LUOA 3CCRA 1X32A 2E74C 2M2LA 3SEBA 2IPKD 3H0GB 1E1TA 3KLSA 2D0PA 2FMMA 4KKUA 5L37A 1VQ8A 1I94Q 1X65A 1MSHA 1ENFA 3TREA 1VQ9A 1TWGH 4RKBA 4BBSB 2MUYA 1C4QA 2BE5C 4NXNQ 2XRSD 1VQIA 4N9TA 3SR1A 2BA0A 2JXMB 4FF2A 3HS0C 2QCPX 1PTOC 4B3RQ 3P1HA 1D1IA 4B3SQ 1YVCA 2F3WA 2K05A 1KLUD 4DNIA 2WP8J 2B8FA 1WD0A 4B9XA 1IBMQ 3K7AB 3FHWA 3VR3A 3RR5A 2EPBA 3J7YW 1SNDA 4DV0Q 5FJ8G 1TKWB 4X62Q 1DD2A 2JEAI 1TIID 5M9OA 3PMFA 1A3VA 2OCEA 4C3IG 2JA8B 1GUGA 3J7A5 2EXDA 1IBKQ 1JOKA 3J81E 2E2HB 1B70B 2K5WA 4DAYA 3I56A 2K04A 3HOZB 1I50B 1SYDA 2EZVA 1B8AA 1EEID 5JJKA 5CV7A 1PH5A 3IAYA 2F3IA 4IJHA 2CH4W 4CDCC 4G7HC 1R4PB 1VCIA 2F52A 2FMCA 3OWEB 1Q7YC 3BZDB 1HNXQ 1PYWD 3MXUA 4GS3A 5G3LF 5LHY1 1DCZA 4GOPC 1LO5D 5BN4A 3HOUH 3A54A 3K7UC 1KXLA 1GXDC 2LXKA 3PUYA 4IPDA 4JV5Q 2E75C 1ICWA 1L2FA 4DV3L 3CCMA 1EIYB 2GA4B 1HR0L 1EY7A 3ZJYC 4CBVA 5C4HA 3CF5A 1Q81C 3S14H 2NUCA 3U50C 1W6JA 4JBWA 4QL5A 4RCNA 5M5WH 1BDOA 1AW7A 5K36H 1SSOA 1FGUA 1TWHB 2N55A 2ZTCA 5TSSA 1N9WA 3IFTA 2B63H 1Q3LA 3F8TA 3NEMA 3TP6A 1ZYRD 1WI5A 2HDLA 4IFDH 1QB5D 3CC7A 2LFNA 2E5LQ 1PH6A 1WFQA 2DY8A 4X3UA 3D6WA 2KENA 1I4XA 1X3FA 2VNUD 2RVLA 2MQHA 1EY4A 2VQFQ 4KKSA 2MPMA 4Q0FA 1RHPA 4QF4A 1SYBA 3S15H 4DV2Q 4A3FB 3PUVA 1BNZA 3NTIA 3A8JE 2F0GA 5ELEA 1SNPA 3IFDA 4IFDJ 3GV3A 3A7LA 5FJ8H 3PO3H 1AP0A 4RGTA 1OXTA 1Q46A 2NZOA 3RLNA 4QUFA 4I7AA 4PZ8A 5C5LA 2RA4A 1FJGQ 2EYHA 4A3LG 2R92B 5AJ3Q 2Q2IA 4C2MH 2EVBA 1L1OB 1GUOA 3HKSA 2JA5H 1AEXA 1QWYA 4FVMA 3GTJB 4A3BB 1DGSA 2RSOA 4F88A 2XIWA 1C48A 2V4DA 3CU7A 1CA6A 2EY5A 2PZUA 5FLMH 3FMCA 4X64L 1EQRA 1Q12A 2WKCA 2VUMB 2BCOA 4PNYA 4O1NA 3CHBD 4JCVE 1BUVT 5IYDG 3EFXD 1G6PA 3CW2C 1SE4A 4IUQA 4CDEC 3I3CA 4CJ1B 1IXRA 3CXCA 3MWYW 1T5EA 1LTLA 2OTJA 3UE0A 2B2YC 4JI7L 3HRZC 2EJFC 2K5QA 2RSNA 1K8GA 1N8RC 2ZM6L 2B2WA 3HOYH 1T5XD 1GHKA 1A6XA 2I5HA 4DK6C 2DJGC 1SFOB 2ZXPA 1F2MA 2WB1B 4DAVA 2UUAL 2AKWB 2KEDA 4P74A 3H0GG 1F9QA 1L0YB 4IQZA 3TS0A 2EYJA 3DM1A 2CW0D 1N33L 4BBSG 2R7ZB 2VY3A 3CC4A 1L1OA 1SRUA 1DYQA 3HOXB 4DR4Q 5LMUL 4I7ZC 3DM3A 3PO2H 2QA4A 4FP5D 1HZCA 3ND9A 1IBLQ 4OO1I 3SDZA 1CUKA 5H1SE 1JWMD 1YIJA 1VDZA 2CKZB 2ID0A 3LGJA 4K0KL 1R4QB 4KK7A 2NVYH 3MAQA 3JC66 1K83B 2F0TA 3KBXA 2JA8G 5C44G 4CKCA 1EYCA 1SNOA 4A3GH 1FD7D 4K2KA 4KHZA 2UXDL 1W6KA 3HOZG 1PTOH 2QDLA 4CDDC 1WVLA 2HCCA 1CKOA 3CKIB 2LSSA 1U4RA 4DK0A 4HEDA 1GD7A 4K8JA 4HSPA 4A3LH 1WTWA 1CSQA 3I4MH 4JI6Q 4PMBA 3E0JA 3ERSX 4KN7C 4PMCA 5EAYA 4C3JH 1WD1A 4R1JA 1LT6D 2Q2TA 3V96A 4RFBA 1PFSA 3D4RA 4JOIA 2RCNA 4FNFA 5C4ZA 3ONAB 4C3HH 1HQMC 1LT3D 4DV1L 2CWPA 1PYSB 5LL6X 3SK5A 2EOTA 3M9BA 1HRJA 1SN8A 1BBXC 2PI2A 2MGSA 4G7OC 4KKTA 1Q1BA 1KNEA 5FO8B 5M3FH 4XT1B 1YNXA 1XNQQ 5E1FA 1NUCA 3V2TA 2SNSA 4A3IH 2SOBA 3KJPA 4WORA 3G71A 5I6YA 3U9SA 4HJ8A 4X66Q 1HCZA 1BCPB 3JAME 2UU9Q 4HTHA 5EBCA 1VF5C 1NMGA 3S1NH 3J81L 2UUBL 1EQTA 4OX9Q 4PZ6A 3RN5A 2V1CC 1PA6A 1TWGB 2XTIA 2Z4IA 1YHQA 3UDXA 4JW0A 3CCSA 4RGOS 1IZ6A 3J81c 1XPUA 1PH4A 1OXXK 2WACA 3CMAA 1B44D 1E2WA 4MNOA 1AZPA 3AQQA 2C5CA 2YU9H 2J7ZA 4GNXC 1SE3A 1UEBA 2EE1A 3W5OA 1GUWA 1NJIC 3E6ZX 4KV6A 3K5NA 2WAQG 3S1RH 1X6OA 1SJHD 5IGCA 5GADC 4IJLA 2IX1A 2L11A 4CJ0B 3I72A 4JI4L 1PH8A 5ELBA 5C44H 1VS0A 1PZID 3T53B 1GM5A 1GHJA 3MXNB 3MZ5A 1SJED 3SGIA 2F0JA 1A3TA 2R92G 3EIVA 4V0BA 1IYUA 1L0XB 3R2IA 4BXXH 1N32Q 4HIMA 2JA7G 2JA6H 1PRTB 1TS4A 4DR3Q 2BOSA 5FO7B 4ALPA 1PH2A 5C6AA 2A6HD 4RHSA 4RA8A 1F9PA 2VUMG 3HOUB 4FXGC 1XMOQ 4NPSA 4MTNA 1K9MC 1KC8C 2Q2HA 2ENBA 4OL7A 5IGGA 1VQ6A 2VW9A 1TR5A 4B3TL 2Z6KC 3IKJA 1BKBA 2QEJC 3R2TA 4HN7A 3S14B 3CD6A 4A3JH 3GTMB 2EQSA 4N8FA 4XQQA 4CJ2C 5M5WB 5T1GA 1QE6A 4JPBW 4UAIA 2B63B 5JJIA 2WB1G 1N36Q 5BN3A 2IX3A 3NSWA 5IE8A 2F0EA 3MXNA 3TRZA 2VQEL 1JMCA 5EKLA 4DV7L 1UNSA 1EY6A 2R7ZG 1LTGD 3I4NH 3OWFA 2DNCA 2H1EA 2QGQA 3STBD 3GTGH 2X6GA 1F2LA 3PQIA 3HOXG 5DAUA 3S1QH 3Q8DA 3NBHB 4DR1Q 5C4XG 4OO1G 1S4ZA 5D3IB 1VQAA 1SNCA 1EQVA 3OTOQ 3S15B 1E22A 3TP7A 2F0PA 4R4IA 2PQEA 3NP8A 1Q90A 1STGA 3PO3B 2FINB 4AIMA 4EX5A 3EA6A 1IW7D 2B2VA 2A6HC 3NELA 2F0SA 5IT9L 4AQYL 2E2IH 2F0IA 4R8IA 4JI3L 1NTGA 1X3EA 4Y52H 1XPRA 3HZXA 4FO2A 4C2MB 3DUZA 2J0TD 1TS3A 5IWAL 2JA5B 3BZCA 1I3QH 4KN4C 3SVMA 3D3RA 4R4QA 3NQIA 1L0WA 1ICFB 2B3GA 5GROA 1I6VC 3NWTA 1H95A 3VDYA 4LF7Q 4DR7Q 1HJPA 2AUKA 2MFIA 2N8NA 4YY3Q 1TQOA 2QKIC 1S72A 1JICA 1SAPA 1JT8A 1E24A 3NBHA 2MO0A 4MZ9A 1F9RA 3U58A 3A56A 4YWLA 2RDHA 4XYOA 4OWTB 1AN8A 4LF5L 1HA6A 3K6OA 3PIPA 2DGYA 2JYOA 3STBC 2RBMA 1EUJA 2CCZA 3EN2A 2WAQE 2EYPA 5GQOA 1LTRD 2YYZA 5BR8L 1K8MA 2EY6A 5ELDA 4DGZA 1XTCD 4LMQD 2GVAA 1Y1VH 1Z7TA 3AU7A 2VZAA 1GUTA 3G48A 4DUZQ 3T4AC 1LABA 4KHPL 1TWCH 2R7DA 4MN3A 1TY2A 1IW7C 2CWAA 3FP9A 5M5XH 4H44C 2NB0A 5IIFA 5M5YH 1CFMA 2XWBB 3OMGA 4DXFA 1EL0A 4LFAL 1FR3A 3P7JA 5JJZA 4DUYL 2NVYB 5KEEA 1LT4D 1CQVA 3S24A 1YI2A 1SYFA 3BVGA 1PTOD 4I65A 4A3GB 2F0QA 1EOTA 3NTHA 1HFGA 1I6HH 1GO3E 4LFCL
chains in the Genus database with same CATH topology
3JAML 3BDOA 1EU4A 1LACA 2BDNA 5EBDA 3I4MB 3GV6A 3PUXA 4C3JB 4RAUC 2WKDA 1UAPA 1HPCA 2K28A 2OXPA 5IGFA 1D6EC 4C3HB 3Q23A 2KJXA 2IW3A 3QB3A 2X69A 2TSSA 2AQ1B 3GO5A 5NUCA 4X3SA 2HCIA 4FXDA 1BR9A 5M3FB 1VMCA 1EYAA 4A3IB 4K8IA 5K36G 5KNBA 1S5FD 4F8MA 1S5CD 4IFDG 3S1NB 2H4OA 4RGNA 4KY5A 2ICEC 4C56C 1EY8A 1Z6HA 4LAAA 4XT3B 4K5WA 1MD2D 1KDBA 4QCLA 1EY0A 2QILA 1XWEA 2K32A 1PRTF 3OMCA 4PMWA 1TT2A 1EIGA 2YU9B 2D5DA 5DEHA 3BDLA 4LK1C 3S1RB 4M8AA 1D5ZC 2Q8TA 3FRPB 1EYDA 2B2TC 2FJ2A 4QB4A 5T1IA 4ULLA 5C44B 2F3VA 3QO2A 3BDCA 1B53A 2DY7A 1STNA 3QIAA 4XYQA 1WTPA 2JA6B 3BS1A 2F0UA 5F2DA 2QDBA 3G6JB 1QCBD 1ENCA 2Q8RE 3QWNA 2Y0SB 4J8QA 2EYLA 1IKMA 1D2BA 4Q5VA 1TVXA 3K5LA 4A3JB 4C1NK 1FGBD 5KNDA 5IGBA 1UUPA 2L5TA 2MHVA 2L0CA 4XQNA 1EZ8A 1CQFA 3OHXC 3LWUA 3QOJA 2Z8LA 3EQLC 5I9PA 1V1OA 4X3TA 4F87A 5A2QL 3RLFA 3T13A 4K6DA 1HUNA 2O4XA 3I4NB 4WFN3 5CV9A 3GTGB 5IOCA 3S1QB 4OHJA 1HUMA 1DOLA 3RUZA 1TU2B 2PYKA 3L3OC 1XYIA 2RQXA 1NSNS 1EY9A 2R3ZA 2F0HA 2KCCA 4RKLA 1I4HA 1NAPA 1VF7A 1A15A 2F0OA 1XX8A 2WAQB 2Z4HA 1OXVA 3VR2A 2NYZD 2RDGA 3DEOA 3NXWA 1LTAD 1MGSA 1RKNA 1BXTA 5CC4A 1EFID 4CHTB 3QG1A 1I3QB 4C3JG 3K5MA 2JA7B 1QOHA 3I4LA 5FO9B 4KY7A 2KQ3A 3NQTA 4C3HG 2F4IA 1PMRA 2B2YA 1B4OA 3PUZA 5FK9C 4OGQC 2DN8A 2AUJD 1HTPA 2EJMA 5JVH3 3MFYA 2IJ0A 2SNMA 2PNRC 1D1KA 1I4PA 4EVOA 2DNEA 4RH6A 3Q22A 2N88A 3VR4A 1Y1VB 5AFWA 4K6LA 1LTBD 1PTOF 3J7AV 2PCFB 3BYYB 4WJWA 5C4XB 4NW2A 5M5XB 4K5VA 3D4DA 2NN6H 3A55A 5M5YB 3G7LA 4RCOA 4L8JA 3GP7A 1LTSD 1D5MC 1CK1A 2HUGA 5EKIA 1RTNA 1HXYD 4KD4A 1KTKA 4ZYSA 5KYIA 1U9RA 1I6HB 1PXUA 5DNFA 1U4MA 2F0KA 1C8CA 1DM0B 3NHHA 1NR4A 1EIHA 1MBYA 1NR2A 2RKSA 1JC7A 3HKZB 1SEBD 1F2ZA 3OSOA 3MVVA 3DHQA 2L1BA 1V8QA 2AWNA 2NBFA 5JEAH 2KUMA 1YNND 3GTOB 1S5ED 3HOWB 1CT1D 3SXHA 3FPPA 3EROA 5EJWA 2E2DC 1IHZA 1G291 4IZ8A 1Z47A 3VA7A 2JSOA 3NK9A 3HOVB 1JQYD 3OW7A 2PW5A 5C3EB 1B2TA 5JEAJ 3H94A 1OXUA 1CZGA 4IUTA 2NZ1D 4ZLTF 1DOKA 4IUVA 4DFAA 3I91A 4RHRA 4V190 1Y8PB 3RZDB 4OIKA 2CHBD 1E2ZA 5COYA 3D4WA 1ZXTA 4ODGA 3OOCA 2EJGC 1WTVA 3EVQA 4Z9CB 2JE6I 4CKBA 1U4LA 3FKIB 1V43A 3DWQA 2NWGA 3ZYYX 4QIWB 1D5XC 1YNNC 5C0XH 1NCVA 2E2JB 2SEBD 1TWFB 2D9UA 3OPOA 2NVTB 3WOFA 3MFGA 1F2YA 1KNAA 3K5OA 1YNJD 1RD9D 3A8IE 3S2HB 3HGBA 5J22A 2ZXOA 2KHSA 3MXGA 1SBBB 2NVXB 2EXZA 1R9TB 2PZTA 3W3AA 2KEEA 3SHLA 5C5MA 5C0XJ 1STYA 4TRDA 5HGTA 1ET6A 1G2TA 4WRDA 1J9OA 1HQRD 4KJNA 4L63B 5FLXE 1U4PA 3GD7A 4IFDI 4HMIA 1GJXA 1ILPA 1H9JA 1Q1EA 4ZAIA 2F03A 1VMPA 4EQPA 3K58A 1ZEQX 5I2XA 1E0BA 1JE4A 5G3LD 4H13C 2B2UC 2PZWA 5JPMC 1Y69U 3GTKB 2RDFA 3C46A 1SYCA 4DU9A 3VA5A 1YNJC 3I90A 1KDAA 4XIGS 1FYCA 2NTTA 3F2UA 5KNCA 1QJOA 1UEAB 5J39A 2MJ8A 2OT2A 3I8ZA 1LLRD 3K0YA 4U673 1QNUA 1EY5A 4A3DB 1G91A 4IALA 4G4KA 3OIQA 1S5DD 3H09A 3M4OB 3HOYB 2F0LA 3H6MA 1MI2A 4HAEA 2IX0A 4YIJA 2XRQD 3PIP3 2F0WA 2A5HA 3ERQA 5CBAE 3KF8A 1JCKB 5EPLA 2FFKB 3VYTA 3PO2B 3S2DB 2EYOA 4FF4A 3TP5A 4BY1B 1SDFA 4ZUJA 3AMUA 1OXSC 1O7YA 2KECA 2PO4A 1B9NA 3AB9A 3KBGA 3TN2A 2O5JC 1WTXA 3M7GA 1PTOB 4J6HA 2G9HD 2PPBC 3D6CA 2VXWA 4ZUIA 3FVQA 1JOOA 3R93A 2J4XA 1EU3A 3M3YB 2A74C 3J80E 5CV5A 5JAVA 3DWPA 4DK1A 1O7LA 3FDTA 4GZYC 3S16B 1ML0D 5EPKA 1O7ZA 3VYRA 4ZKBB 2K7VA 1H9MA 1LTID 1FNWA 3KK7A 5FKAC 3EJIA 3CRKC 3S17B 3R3OA 2R93B 5M3MB 3C1EA 4HR7B 1I4QA 4XQJA 5E4WC 4IUUA 1JR0D 3MA2B 3PUWA 2L4NA 3P20A 2PMZB 4AYBB 2B2TA 5CORA 3N52A 4HCSA 4R9WA 3DWAA 3S1MB 3DEPA 5KYLA 3T51B 3I70A 1ESFA 5C3WA 4B08A 2AQ3B 4K14A 1A3UA 1TS2A 1EZ6A 3LWEA 3MTSA 2A68D 3R8BA 3VYSA 1CHPD 2KOLA 5A35A 5FLXL 4IN3A 4XTCS 3FPUB 5C0XI 3X3NA 3T16A 3K57A 1GOZA 4IURA 1BF4A 3BVMA 3D8GA 3T56B 3TP8A 4KD3A 3NTKA 2F0VA 2F1MA 4NKLA 5CMDA 1WTOA 1S5BD 3VR6A 3UI2A 4DN4M 5CR3A 2K03A 4C1NI 4ZQ3A 3MHBA 3TZDA 5J1ZA 1Y8NB 3ITPA 2B39A 1Q8IA 2VB3X 1QNKA 1SXTA 3TDQA 5C4JB 4KTAA 1HFNA 4BWGB 1B3AA 3TZUA 2XWJB 3GTPB 4J1MA 3KLRA 5EKKA 1A2UA 4KY6A 1BO0A 1CHQD 1KAAA 2NN6G 4KI0A 1H9RA 2O5IC 4ZK9B 2MP1A 4K2LA 2M00A 1RF2D 1CTMA 2A68C 4S3SA 4ZKCB 3SK4A 4ZRZA 1SMYD 1PFNA 4OIJA 3IL8A 5KRUA 1RJTA 1RODA 2E2IB 3J7AF 4QUCA 5CV8A 4EQNA 2BA1A 1LT5D 3NUCA 3O13A 4BBRB 1QG7A 2G9DA 2X6LA 3NWSA 1DOMA 4PV1C 2AQ2B 2NVQB 1OO9B 2F0FA 2I46A 3QJYA 5JEAG 2F0DA 1JORA 2VB2X 4G7ZC 2XSCA 2JP1A 1J8IA 3D31A 4UDUC 5E3FA 1JWUD 4MHEA 3M4YA 1ZYRC 1M4VA 1O80A 2KA7A 1Y8OB 3TSSA 4A93B 1PZKD 2D62A 1SE2A 3C3LA 1SYEA 1HA5A 5IT9E 1SMYC 1TWCB 5EGTA 3H3VC 5CV6A 4E6IA 4H0LC 5IODA 1H9KA 4FF1A 3A7AB 4X3KA 4BA2I 1CM9A 4DF7A 2PW7A 1PLFA 3J80L 4BS9A 1STAA 4ILWA 1WTRA 4TQUS 3DMUA 2C9OA 5KIXA 2L55A 2B2WC 4ID6A 2KVMA 4IUNA 3U9OA 5KGUA 3K59A 2ICIA 1TS5A 4L6TB 2LMCB 2JEBI 2CQAA 2L9HA 4CGYB 1BQQT 5C0XG 3VYUA 4A3MB 1I4RA 1SNQA 3WDNA 3Q0AA 4BA1I 5I2YA 2LKVA 4B9WA 5EPJA 2M9VA 1PZJD 1G8ZD 4A3EB 2KCNA 1IL8A 4BY7B 1B50A 2K33A 5IGDA 1ZKOA 1F77A 2QF7A 4NP5A 3NBIA 1ESRA 3MEHA 2CW0C 3NE5B 2L12A 1II3A 1ILQA 2F0NA 1AZQA 4QMGA 1FNUA 1BCPD 2Q8IB 3SK6A 4JK1C 2IWHA 1K8OA 3Q6SA 4N9PA 1JOQA 3N6RA 5E4XA 5I6WA 2K01A 5K5PA 2IT1A 5C3XA 1DONA 5CGKA 1G6ZA 1X3PA 5JOBA 2XVSA 3C2PA 4M1UB 1RDPD 1G2SA 1JB3A 5DM63 3PIO3 2XNAC 1PFMA 4DNRB 1WCMB 3GTQB 1B1ZA 1X3QA 4IUPA 3L7ZC 4P2CB 3GQBA 3URYA 2R61A 1CA5A 1BOSA 3SK8A 5EQ0A 4XXEA 1TWAB 1GUSA 1STHA 2OEOA 3VR5A 1DZ1A 1PRTD 3BG3A 3M7NA 3V05A 1E2VA 1Y1WB 1LV9A 3W2DA 3BYTB 1CZWA 4MIUA 1BCPC 3OIPA 2IL8A 4K5XA 3FEWX 3DXJC 1ENAA 3TMEA 1ONLA 3M85A 3TBIB 4EGVA 1DJRD 4DAPA 2B2UA 4A3KB 1PDQA 3L9AX 1EWCA 1AFPA 5DM73 4DNTB 5JPNC 2HQEA 1M8AA 3H91A 1MSGA 3BVZA 4H7BA 2SDFA 3SE0A 5JVG3 4G57A 4EQOA 5ELCA 5IGEA 3A8KE 3MC0B 5CYUA 4NMZA 2EY2A 4ABNA 3NPPA 2LY7A 1PFBA 2WV6D 1A2TA 4TSSA 3E5SA 2O2LD 1STBA 1PRTC 2WINB 1HHVA 4DA2A 1F9SA 1KLGD 2I07B 1STEA 1WTQA 4C3IB 4KHVA 1CI3M 1H9SB 2K6AA 2D2CC 5A2QE 3ND8A 4FXKC 4HCEA 1ET9A 4RWSC 2EDGA 5CBEE 2A6ED 3KUPA 1V1PB 2B2VC 2TMPA 2EY1A 4RGMA 2EYMA 3P75A 4CKEA 5HURA 3HP3A 1I4GA 1GUNA 3RD4A 3PV0A 4O42A 3LNNA 4KMUC 3GTLB 4HSVA 2CVRA 4Y7NB 1RCVD 4FYDA 2OF1A 5D3DA 1QILA 1SNMA 2A69D 1XXGA 3I73A 1H9SA 2NN6I 4PQXA 3CQZB 2ZXRA 2LS01 4DXGA 1V1PA 1TY0A 2HDMA 4HMJA 4U68A 1LTTD 5BN5A 2EYFA 3S9WA 3RMHA 4OO1H 2B8GA 5D65A 1KDCA 3QOLA 2A73B 5I4DA 3LX0A 2A6EC 2F0MA 1B9MA 2BDOA 2BE5D 4KJOA 3X3MA 5FOBB 2XN9C 4F7XA 1IKLA 1EWHA 3HEJA 3RZOB 2K1BA 1SYGA 1DXMA 3C1FA 2AWOA 2ZT9C 3KLSX 1FNVA 1BCPF 5I9OA 1JWSD 2E76C 5ELFA 4XDXA 4ME5A 4NDXA 1IYVA 3WOEA 1KABA 4TKOB 5CV4A 2A69C 2WIIB 3CRLC 5LL6S 3Q24A 2K5DA 2FHTA 4R8NA 1RTOA 4FF3A 3HG9A 2NTSA 4LJZC 2Z1CA 3MXPA 1HTLD 5D14A 1O78A 1EEFD 2R6GA 5ISRA 1X32A 2E74C 2M2LA 3SEBA 2IPKD 3H0GB 3KLSA 2FMMA 4KKUA 1MSHA 1ENFA 4RKBA 4BBSB 2MUYA 1C4QA 2BE5C 2XRSD 4N9TA 3SR1A 2BA0A 2JXMB 4FF2A 3HS0C 2QCPX 1PTOC 3P1HA 1D1IA 2F3WA 2K05A 1KLUD 2WP8J 2B8FA 1WD0A 4B9XA 3K7AB 3VR3A 2EPBA 3J7YW 1SNDA 1TKWB 1DD2A 2JEAI 1TIID 5M9OA 3PMFA 1A3VA 4C3IG 2JA8B 1GUGA 1JOKA 3J81E 2E2HB 2K5WA 4DAYA 2K04A 3HOZB 1I50B 1SYDA 2EZVA 1EEID 5CV7A 3IAYA 4G7HC 1R4PB 1VCIA 2FMCA 3OWEB 3BZDB 1PYWD 3MXUA 5G3LF 5LHY1 1DCZA 1LO5D 5BN4A 3A54A 1GXDC 3PUYA 2E75C 1ICWA 2GA4B 1EY7A 4CBVA 5C4HA 2NUCA 1W6JA 4JBWA 4RCNA 1BDOA 1AW7A 5K36H 1SSOA 1TWHB 2N55A 5TSSA 3IFTA 1Q3LA 3TP6A 1ZYRD 2HDLA 4IFDH 1QB5D 2LFNA 2DY8A 4X3UA 3D6WA 1I4XA 2VNUD 2RVLA 1EY4A 4KKSA 2MPMA 4Q0FA 1RHPA 4QF4A 1SYBA 4A3FB 3PUVA 1BNZA 3NTIA 3A8JE 2F0GA 5ELEA 1SNPA 3IFDA 4IFDJ 3GV3A 3A7LA 1AP0A 4RGTA 1OXTA 4QUFA 5C5LA 2RA4A 2EYHA 2R92B 2EVBA 1GUOA 1AEXA 1QWYA 4FVMA 3GTJB 4A3BB 2RSOA 4F88A 2XIWA 1C48A 2V4DA 3CU7A 1CA6A 2EY5A 2PZUA 3FMCA 1Q12A 2WKCA 2VUMB 2BCOA 4PNYA 4O1NA 3CHBD 1BUVT 3EFXD 1SE4A 4IUQA 3I3CA 4CJ1B 3MWYW 1T5EA 2B2YC 3HRZC 2EJFC 2K5QA 2RSNA 2B2WA 1T5XD 1GHKA 1A6XA 1SFOB 2ZXPA 1F2MA 2WB1B 4DAVA 2KEDA 1F9QA 1L0YB 4IQZA 2EYJA 3DM1A 2CW0D 2R7ZB 1DYQA 3HOXB 4I7ZC 4FP5D 3ND9A 4OO1I 3SDZA 1JWMD 1VDZA 2ID0A 1R4QB 4KK7A 3MAQA 1K83B 2F0TA 3KBXA 4CKCA 1EYCA 1SNOA 1FD7D 4K2KA 4KHZA 1W6KA 1PTOH 1WVLA 2HCCA 3CKIB 1U4RA 4DK0A 4HEDA 4K8JA 4HSPA 1WTWA 4PMBA 3E0JA 4KN7C 4PMCA 1WD1A 1LT6D 3V96A 4RFBA 3D4RA 4FNFA 5C4ZA 3ONAB 1HQMC 1LT3D 5LL6X 3SK5A 2EOTA 1HRJA 1BBXC 2MGSA 4G7OC 4KKTA 1Q1BA 1KNEA 5FO8B 4XT1B 5E1FA 1NUCA 3V2TA 2SNSA 2SOBA 4WORA 5I6YA 3U9SA 1HCZA 1BCPB 3JAME 4HTHA 5EBCA 1VF5C 3J81L 1EQTA 1TWGB 2Z4IA 4RGOS 1OXXK 2WACA 1B44D 1E2WA 1AZPA 2C5CA 2J7ZA 1SE3A 2EE1A 1GUWA 3E6ZX 4KV6A 3K5NA 1SJHD 5IGCA 2IX1A 2L11A 4CJ0B 3I72A 5ELBA 1PZID 3T53B 1GHJA 3MZ5A 1SJED 2F0JA 1A3TA 4V0BA 1IYUA 1L0XB 3R2IA 1PRTB 1TS4A 2BOSA 5FO7B 5C6AA 2A6HD 4RHSA 4RA8A 1F9PA 3HOUB 4FXGC 2ENBA 4OL7A 5IGGA 1TR5A 3IKJA 2QEJC 3R2TA 4HN7A 3S14B 3GTMB 4XQQA 4CJ2C 5M5WB 5T1GA 1QE6A 4UAIA 2B63B 5BN3A 2IX3A 3NSWA 2F0EA 3MXNA 5EKLA 1UNSA 1EY6A 1LTGD 3OWFA 2DNCA 2H1EA 2X6GA 1F2LA 5DAUA 4OO1G 1S4ZA 5D3IB 1SNCA 1EQVA 3S15B 3TP7A 2F0PA 2PQEA 3NP8A 1Q90A 1STGA 3PO3B 2FINB 3EA6A 1IW7D 2B2VA 2A6HC 2F0SA 5IT9L 2F0IA 4R8IA 3HZXA 4FO2A 4C2MB 3DUZA 2J0TD 1TS3A 2JA5B 4KN4C 3SVMA 3D3RA 3NQIA 1I6VC 3NWTA 2AUKA 1TQOA 2QKIC 1JICA 1SAPA 3NBHA 1F9RA 3A56A 2RDHA 4XYOA 1AN8A 1HA6A 3K6OA 2JYOA 2RBMA 2EYPA 1LTRD 2YYZA 1K8MA 2EY6A 4DGZA 5ELDA 1XTCD 4LMQD 1Z7TA 3AU7A 1GUTA 3T4AC 1LABA 4MN3A 1TY2A 1IW7C 4H44C 2NB0A 5IIFA 1CFMA 2XWBB 3OMGA 4DXFA 1EL0A 1FR3A 3P7JA 5JJZA 2NVYB 5KEEA 1LT4D 1CQVA 1SYFA 3BVGA 1PTOD 4I65A 4A3GB 2F0QA 1EOTA 3NTHA 1HFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNQ A;  4HMI A;  1IHZ A;  3TP6 A;  5KYL A;  2EYO A;  4IZ8 A;  2F0S A;  2F0I A;  5C3W A;  4EQP A;  3TP5 A;  1ENC A;  4KV6 A;  5ISR A;  3NK9 A;  4ZUJ A;  2SNM A;  2PW5 A;  4K14 A;  1A3U A;  1EZ6 A;  2EYL A;  2OXP A;  5IGC A;  5IGF A;  3HZX A;  4MIU A;  4EVO A;  3QB3 A;  2OF1 A;  1EY4 A;  2LKV A;  2F0F A;  4K5X A;  1SNM A;  4B9W A;  3MZ5 A;  4QF4 A;  5IGB A;  4J6H A;  4RKB A;  4DFA A;  2F0D A;  1SYB A;  2PZW A;  1EZ8 A;  1A3T A;  2F0J A;  5NUC A;  1ENA A;  1TQO A;  1JOR A;  2F0T A;  3D6C A;  3T16 A;  3TME A;  1EYC A;  3QOJ A;  4ZUI A;  5I9P A;  1SNO A;  1EYA A;  2F0G A;  4N9T A;  2RDF A;  3SR1 A;  4K2K A;  3D8G A;  3TP8 A;  1JOO A;  3T13 A;  4K8I A;  1SNP A;  4K6D A;  2F0V A;  4KD3 A;  4NKL A;  2O4X A;  1SYC A;  3D4W A;  4NP5 A;  5IGD A;  3P1H A;  5C6A A;  3MEH A;  4K5V A;  4DU9 A;  3D4D A;  2F3W A;  4ODG A;  3VA5 A;  4F8M A;  5E3F A;  1II3 A;  3EVQ A;  5CR3 A;  4K8J A;  2F0N A;  5CV9 A;  4B9X A;  4HMJ A;  5IOC A;  1KDA A;  4PMB A;  4QMG A;  5CV5 A;  4KY5 A;  2EYF A;  4PMC A;  4ZQ3 A;  2HQE A;  5JAV A;  3S9W A;  2RBM A;  1SND A;  3MHB A;  2ENB A;  5C5L A;  4OL7 A;  3RUZ A;  5IGG A;  4H7B A;  2EYP A;  1TR5 A;  1EY8 A;  2EYH A;  2PYK A;  5J1Z A;  5M9O A;  3SK6 A;  5C4Z A;  3PMF A;  5J39 A;  1KDC A;  1A3V A;  1SYE A;  3ITP A;  3QOL A;  4G57 A;  4EQO A;  1NSN S;  4LAA A;  2EY6 A;  1EY9 A;  4DGZ A;  2F0H A;  1AEX A;  4K5W A;  1KDB A;  4KD4 A;  4KTA A;  4N9P A;  5CV6 A;  5EGT A;  3SK5 A;  1JOK A;  5IGE A;  4E6I A;  1JOQ A;  3LX0 A;  1EY0 A;  5KYI A;  4RKL A;  1U9R A;  5IOD A;  4NMZ A;  2F0M A;  4KJO A;  2EY2 A;  5I6W A;  3OMC A;  1SYD A;  1EY5 A;  2EY5 A;  2PZU A;  4DF7 A;  2F0O A;  2PW7 A;  5K5P A;  1TT2 A;  4F7X A;  5CV7 A;  4J1M A;  2F0K A;  5EKK A;  1STA A;  1A2T A;  4IAL A;  5C3X A;  4PNY A;  3DMU A;  3HEJ A;  1A2U A;  3E5S A;  5E1F A;  1F2Y A;  1NUC A;  2F0E A;  3NXW A;  2SNS A;  4KY6 A;  3NHH A;  1STB A;  3V2T A;  5KIX A;  2SOB A;  5DEH A;  5CGK A;  5EKL A;  3BDL A;  1EY6 A;  1KAA A;  1RKN A;  2RKS A;  3EJI A;  2F0L A;  4ID6 A;  4WOR A;  3R3O A;  5JOB A;  3H6M A;  2KHS A;  3C1E A;  3OWF A;  1SYG A;  5CC4 A;  5I6Y A;  5IIF A;  3C1F A;  4IUN A;  3U9O A;  1EYD A;  4HTH A;  4KHV A;  3OMG A;  4QB4 A;  5I9O A;  4K2L A;  1F2Z A;  3OSO A;  2F3V A;  2M00 A;  5DAU A;  5J22 A;  3MVV A;  4S3S A;  5KGU A;  2EXZ A;  3DHQ A;  4ME5 A;  2PZT A;  4NDX A;  1KAB A;  1SNC A;  4YIJ A;  3SHL A;  3BDC A;  5C5M A;  3SK4 A;  1EQV A;  2KQ3 A;  4KY7 A;  5KEE A;  3NQT A;  1STY A;  1F2M A;  4TRD A;  3TP7 A;  1EY7 A;  2F0P A;  5CV4 A;  5C4H A;  2F0W A;  3SK8 A;  1SYF A;  5HGT A;  2NUC A;  1STN A;  2EY1 A;  2PQE A;  3SXH A;  5KRU A;  3NP8 A;  3ERQ A;  4I65 A;  4WRD A;  2F0Q A;  5CV8 A;  2EYJ A;  4EQN A;  2EYM A;  3P75 A;  1STH A;  2F0U A;  2OEO A;  1STG A;  3ERO A;  2WAC A;  4KJN A;  4R8N A;  5F2D A;  3NUC A;  3MXP A;  5HUR A;  2QDB A; 
#chains in the Genus database with same CATH topology
 2WB1 E;  3JAM L;  3BDO A;  1EU4 A;  1LAC A;  2BDN A;  2K5N A;  5EBD A;  3I4M B;  4DKA C;  4GN3 B;  3GV6 A;  3PUX A;  4PZ7 A;  4C3J B;  4RAU C;  2WKD A;  1UAP A;  1HPC A;  4DR2 L;  2K28 A;  2OXP A;  5IGF A;  1D6E C;  4C3H B;  1AH9 A;  3JAM c;  3Q23 A;  3NEN A;  3HOU G;  2KJX A;  2IW3 A;  1QVG A;  3QB3 A;  1VQG A;  2X69 A;  4NB3 A;  2TSS A;  2AQ1 B;  3GO5 A;  2PI2 E;  5NUC A;  4X3S A;  2HCI A;  4FXD A;  3GTO H;  1S3O A;  3HOW H;  1BR9 A;  5M3F B;  1K73 C;  3KF6 B;  1VMC A;  1EYA A;  4DK3 C;  3KDF B;  1WTH A;  4A3I B;  4K8I A;  5K36 G;  2ZTE A;  5KNB A;  1S5F D;  5HY6 A;  2B63 G;  4F8M A;  4GOP B;  1S5C D;  1JB7 A;  4IFD G;  3S1N B;  2H4O A;  4RGN A;  4KY5 A;  2ICE C;  4C56 C;  3HOV H;  3CME A;  1EY8 A;  5C3E H;  1Z6H A;  4B3M L;  4LAA A;  4XT3 B;  3CCL A;  4K5W A;  1MD2 D;  1KDB A;  2AHO B;  4QCL A;  4YCU A;  1X9N A;  1EY0 A;  2QIL A;  1XWE A;  2K32 A;  1PRT F;  3OMC A;  4PMW A;  2UUC L;  1TT2 A;  1UE6 A;  1EIG A;  2YU9 B;  3RZD H;  2D5D A;  5DEH A;  4HID A;  3BDL A;  4LK1 C;  4DV3 Q;  3S1R B;  3PO3 G;  4M8A A;  4R4T A;  1HR0 Q;  1D5Z C;  2Q8T A;  4DV6 L;  3FRP B;  1EYD A;  3KF6 A;  2B2T C;  2FJ2 A;  4QB4 A;  5T1I A;  3KDF A;  4ULL A;  5C44 B;  2F3V A;  3FKI H;  3F2D A;  3QO2 A;  3BDC A;  4GOP A;  1SR3 A;  1B53 A;  2KHI A;  4YCV A;  2DY7 A;  1A63 A;  2JA5 G;  2B29 A;  1STN A;  3QIA A;  4XYQ A;  1WTP A;  2JA6 B;  3BS1 A;  2F0U A;  3K8A A;  1VQF A;  2YTV A;  4IPG A;  3WWV A;  5GAE C;  5FLM G;  3UDG A;  5F2D A;  2JK8 A;  2QDB A;  2E2J H;  4JI1 L;  1TWF H;  3G6J B;  2NVT H;  1X3G A;  1QCB D;  1ENC A;  1XNR L;  4JYA L;  2Q8R E;  1CSP A;  1VQH A;  5FLX c;  3QWN A;  2Y0S B;  4J8Q A;  4JBJ A;  3S2H H;  1YZ6 A;  2EYL A;  1I5F A;  2UXB L;  1IKM A;  4IO9 A;  1D2B A;  5IP7 H;  1MKH A;  1TVX A;  4Q5V A;  3K5L A;  1QVF A;  4A3J B;  4C1N K;  2NVX H;  3HOY G;  1R9T H;  1FGB D;  4GLA C;  5KND A;  5IGB A;  1UUP A;  2L5T A;  2OTL A;  2MHV A;  2L0C A;  4XQN A;  1EZ8 A;  1CQF A;  3I4O A;  3LWU A;  3OHX C;  1YIT A;  3QOJ A;  2Z8L A;  3EQL C;  5I9P A;  1V1O A;  1YHB A;  2WFW A;  4X3T A;  4F87 A;  5A2Q L;  3RLF A;  3T13 A;  4K6D A;  3E9I A;  1HUN A;  2O4X A;  4A75 A;  3I4N B;  4WFN 3;  4QIW E;  5CV9 A;  3GTG B;  5IOC A;  3S1Q B;  4OHJ A;  1HUM A;  4DV5 L;  3A74 A;  1DOL A;  1NBW A;  3RUZ A;  3PO2 G;  1TU2 B;  4APV A;  2PYK A;  4X64 Q;  4JG2 A;  3H3V I;  3L3O C;  1XYI A;  2A8V A;  2RQX A;  3QR8 A;  4RMF A;  1NSN S;  1EY9 A;  2R3Z A;  2F0H A;  2KCC A;  1X56 A;  1I4H A;  4RKL A;  1PH3 A;  1NAP A;  2AMC B;  1VF7 A;  1A15 A;  2F0O A;  1XX8 A;  2WAQ B;  2Z4H A;  1OXV A;  3VR2 A;  2NYZ D;  1LM0 A;  4JI7 Q;  2RDG A;  4A3G G;  3NXW A;  3DEO A;  2ZM6 Q;  3GTK H;  1LTA D;  2QEX A;  1MGS A;  1KRS A;  1BXT A;  1RKN A;  1K3R A;  3A0J A;  5CC4 A;  1EFI D;  2UUA Q;  4CHT B;  3QG1 A;  3I4M G;  1I3Q B;  3K80 C;  4C3J G;  3K5M A;  1N33 Q;  2JA7 B;  1QOH A;  3I4L A;  5FO9 B;  4DV4 L;  4KY7 A;  2KQ3 A;  3NQT A;  4C3H G;  2F4I A;  1B3Q A;  1PMR A;  2B2Y A;  1B4O A;  5LMU Q;  3PUZ A;  5FK9 C;  4OGQ C;  2DN8 A;  4A3D H;  2AUJ D;  1HTP A;  1SRO A;  4UP7 A;  4HJ7 A;  5M3F G;  2EJM A;  2ZTD A;  4K0K Q;  2EIF A;  4TVA B;  5JVH 3;  4A3I G;  3MFY A;  3M4O H;  1HNW L;  2IJ0 A;  2SNM A;  4GN4 B;  4LNQ A;  2GN5 A;  2K52 A;  2PNR C;  1D1K A;  1I4P A;  4EVO A;  2DNE A;  4RH6 A;  3Q22 A;  1EQQ A;  2OWO A;  2UXD Q;  2N88 A;  1NE3 A;  3VR4 A;  1Y1V B;  5AFW A;  4K6L A;  1LTB D;  1PTO F;  3J7A V;  1YJN A;  2PCF B;  1FVI A;  1W2B A;  2KCM A;  3BYY B;  4WJW A;  5C4X B;  4NW2 A;  5M5X B;  4JI0 L;  4K5V A;  3D4D A;  2NN6 H;  3KFU A;  3A55 A;  3S2D H;  4JBM A;  3G7L A;  4RCO A;  5M5Y B;  3MEF A;  4NXM L;  1KIX A;  4LW1 A;  4DV1 Q;  4L8J A;  3GP7 A;  1LTS D;  1D5M C;  1CK1 A;  2HUG A;  4HJ9 A;  1WYD A;  4BY1 H;  5EKI A;  1KL9 A;  4LF6 L;  1RTN A;  1HR0 W;  4ME3 A;  1A62 A;  2JQO A;  1HXY D;  3J80 c;  2RCF A;  3ULJ A;  5GAH C;  3CPF A;  4KD4 A;  1KTK A;  3T1Y L;  2Q2U A;  4ZYS A;  5KYI A;  1U9R A;  1VQO A;  1I6H B;  1PXU A;  5DNF A;  3BJU A;  1SE8 A;  5IYB H;  4OON A;  1OTC A;  1U4M A;  1EFW A;  2F0K A;  2VS1 A;  4GNX B;  2UUB Q;  1C8C A;  4BXX G;  2JA6 G;  1DM0 B;  1D8L A;  3NHH A;  1CKN B;  1NR4 A;  1EIH A;  1MBY A;  1NR2 A;  4QJF A;  2RKS A;  1JC7 A;  3HKZ B;  1NMF A;  4GLX A;  4L5S A;  3M3Y H;  1SEB D;  1F2Z A;  3OSO A;  3PSI A;  3MVV A;  1K8A C;  3DHQ A;  3G4S A;  2L1B A;  1V8Q A;  2AWN A;  2NBF A;  2Y0S G;  3PCO B;  5JEA H;  2N49 A;  3S16 H;  2KUM A;  4QGU A;  1YNN D;  4WJ4 A;  3GTO B;  1S5E D;  3HOW B;  4LUZ A;  1CT1 D;  3ULP A;  4A3J G;  3SXH A;  3FPP A;  4J15 A;  3ERO A;  1ASY A;  5EJW A;  3T1H L;  2E2D C;  3L2P A;  1IHZ A;  1G29 1;  4JI4 Q;  4IZ8 A;  2VL6 A;  1Z47 A;  3VA7 A;  2JSO A;  3NK9 A;  3HOV B;  1JQY D;  3OW7 A;  2PW5 A;  3S17 H;  5C3E B;  3I4N G;  2R93 H;  5M3M H;  1B2T A;  2HIX A;  1MIU A;  4GNX A;  1Y14 B;  5JEA J;  3H94 A;  1KD1 C;  1OXU A;  1CZG A;  4IUT A;  2IY5 B;  1XMQ L;  2NZ1 D;  4ZLT F;  1CKN A;  1DOK A;  4IUV A;  4YCW A;  1JE5 A;  4N8X 1;  2MO1 A;  4DFA A;  3I91 A;  4RHR A;  1RL2 A;  4V19 0;  1Y8P B;  3RZD B;  4OIK A;  4YWK A;  3U4V A;  2CHB D;  1N34 L;  1E2Z A;  5COY A;  2OQK A;  3PIO A;  1CKM A;  3D4W A;  1ZXT A;  4B3T Q;  4YHH L;  4ODG A;  3OOC A;  2EJG C;  3S1M H;  1WTV A;  3EVQ A;  2CQO A;  4Z9C B;  4EQ5 A;  2JE6 I;  3J81 i;  2DUD A;  4CKB A;  2L15 A;  1U4L A;  3FKI B;  1YHA A;  1V43 A;  1K0S A;  3IRB A;  3DWQ A;  2NWG A;  3ZYY X;  4P73 A;  4QIW B;  2YTX A;  1D5X C;  1YNN C;  5C0X H;  2VQE Q;  4DV7 Q;  1E7Z A;  1NCV A;  1QZH A;  1UWV A;  2E2J B;  2SEB D;  1TWF B;  2D9U A;  3OPO A;  3RNU A;  3G6E A;  1XPO A;  2NVT B;  3WOF A;  4UPA A;  3MFG A;  1F2Y A;  4LF9 L;  1KNA A;  3AFQ A;  1K0R A;  3K5O A;  1I50 H;  1RD9 D;  1YNJ D;  3A8I E;  4JI5 L;  2PMZ E;  4AYB E;  3S2H B;  3HGB A;  2CFM A;  2ALY B;  2ZXO A;  5J22 A;  2KHS A;  1YJ9 A;  3MXG A;  1QVC A;  1SBB B;  2NVX B;  2EXZ A;  1R9T B;  2PZT A;  3W3A A;  1AE3 A;  2KEE A;  3SHL A;  5C5M A;  5C0X J;  1MJC A;  1STY A;  4TRD A;  3I55 A;  2K75 A;  5GAG C;  4AQY Q;  5HGT A;  5LMN L;  5C4J H;  1ET6 A;  1G2T A;  4LFB L;  4WRD A;  1J9O A;  1Y1V G;  1HQR D;  4KJN A;  4L63 B;  3GTP H;  5FLX E;  1U4P A;  4A3C H;  1X54 A;  3GD7 A;  4IFD I;  4GKJ L;  4HMI A;  4HJ5 A;  5IWA Q;  3M4P A;  1ILP A;  1GJX A;  1H9J A;  1Q1E A;  4ZAI A;  1MHW C;  2F03 A;  1VMP A;  4EQP A;  4GKK L;  3K58 A;  1ZEQ X;  5I2X A;  1A8V A;  1E0B A;  4L5R C;  1JE4 A;  4GN5 A;  1HH2 P;  5G3L D;  4H13 C;  2B2U C;  2Y0S E;  1P8L A;  4ZCK A;  1P16 A;  2PZW A;  2ZJP A;  5HGQ A;  4LF5 Q;  5JPM C;  1PH7 A;  1Y69 U;  3GTK B;  2RDF A;  3B6Y A;  3C46 A;  4JVZ A;  4JI8 L;  1SYC A;  4DU9 A;  4A3F H;  3VA5 A;  5BR8 Q;  1YNJ C;  3I90 A;  1Q86 C;  4WJ3 M;  5J3B A;  4BBR H;  2YV5 A;  1KDA A;  4XIG S;  1FL0 A;  1FYC A;  2NTT A;  3KF8 B;  3F2U A;  2UXC L;  5KNC A;  1QJO A;  1G51 A;  1UEA B;  4KHP Q;  3HKZ G;  5J39 A;  1J5E Q;  4A4I A;  2MJ8 A;  2NVQ H;  5IYC H;  1WJJ A;  2OT2 A;  3I8Z A;  1LLR D;  3K0Y A;  4P71 A;  4U67 3;  2YTY A;  3AFP A;  1QNU A;  1EY5 A;  4YWM A;  4A3D B;  1G91 A;  4IAL A;  3HOW G;  4LFA Q;  4G4K A;  3OIQ A;  3GTJ H;  4A3B H;  4DUY Q;  1S5D D;  3H09 A;  3M4O B;  3HOY B;  1W3S A;  1HNZ Q;  2F0L A;  3H6M A;  4O0A A;  1MI2 A;  4HAE A;  1PYB A;  2IX0 A;  3HOV G;  4YIJ A;  4LFC Q;  5C3E G;  4DR6 L;  4A93 H;  2XRQ D;  3PIP 3;  2F0W A;  2A5H A;  3CC2 A;  3ERQ A;  5CBA E;  3ICE A;  3L0O A;  3KF8 A;  1JCK B;  1BVS A;  2FFK B;  5EPL A;  4DR2 Q;  2HQL A;  3VYT A;  3PO2 B;  3S2D B;  2EYO A;  4FF4 A;  1KHI A;  2GVB A;  4R4C A;  2BH2 A;  2JN4 A;  1GKH A;  3TP5 A;  4BY1 B;  1SDF A;  4ZUJ A;  3AMU A;  1OXS C;  1O7Y A;  2KEC A;  2PO4 A;  1VQ5 A;  1B9N A;  3AB9 A;  3KBG A;  3TN2 A;  2O5J C;  1WTX A;  3FKI G;  3PGZ A;  3M7G A;  1D7Q A;  1PTO B;  4J6H A;  1E1O A;  2G9H D;  2PPB C;  2F4V L;  3D6C A;  2VXW A;  4ZUI A;  2JA9 A;  3FVQ A;  1JOO A;  3R93 A;  2J4X A;  4B3M Q;  4A3M H;  1VQ7 A;  1EU3 A;  2FXQ A;  2RHQ B;  2NZH A;  1BBU A;  3M3Y B;  2A74 C;  3J80 E;  5CV5 A;  5JAV A;  3DWP A;  3E3X A;  4DK1 A;  2CH4 A;  2PNH A;  1O7L A;  3FDT A;  2UUC Q;  4GZY C;  3S16 B;  5IP7 G;  2A1A A;  4DR5 L;  1ML0 D;  1XJV A;  2HHH L;  5EPK A;  1O7Z A;  1VQM A;  3JAM i;  4A3E H;  1J6Q A;  3VYR A;  4DV6 Q;  1HZA A;  2K7V A;  4ZKB B;  4BY7 H;  2BH8 A;  1H9M A;  1LTI D;  1FNW A;  3KK7 A;  1BBW A;  4LF8 L;  5FKA C;  3EJI A;  3CCQ A;  3CRK C;  3S17 B;  3R3O A;  2R93 B;  5M3M B;  3C1E A;  1K3B C;  4HR7 B;  1PVO A;  1I4Q A;  4XQJ A;  5E4W C;  4IUU A;  1JR0 D;  3MA2 B;  5IP9 H;  1Q82 C;  3PUW A;  4JI1 Q;  2L4N A;  3P20 A;  2PMZ B;  4POF A;  4AYB B;  3HKZ E;  2B2T A;  5COR A;  1IL2 A;  1XNR Q;  4JYA Q;  3N52 A;  3I2Z A;  1PH9 A;  4HCS A;  4R9W A;  4LF4 L;  2UXB Q;  3DWA A;  3S1M B;  3DEP A;  5KYL A;  3T51 B;  3I70 A;  4A76 A;  2N3S A;  1ESF A;  3UE1 A;  5C3W A;  4B08 A;  2AQ3 B;  4UHV A;  1C0A A;  4K14 A;  1A3U A;  1B7Y B;  1TS2 A;  1EZ6 A;  1SMX A;  3AYH B;  3LWE A;  3MTS A;  4MTK A;  2A68 D;  4JI2 L;  3R8B A;  1WCM H;  2LXJ A;  3VYS A;  3RN2 A;  1CHP D;  1O7I A;  3GTQ H;  2KOL A;  5A35 A;  5FLX L;  4IOA A;  4IN3 A;  1M1K C;  4X65 L;  4XTC S;  3FPU B;  1U5K A;  3OW2 A;  5C0X I;  1PHJ A;  3X3N A;  3T16 A;  3K57 A;  1GOZ A;  1JJG A;  4IUR A;  4DV5 Q;  1BF4 A;  3BVM A;  1TWA H;  3D8G A;  3T56 B;  3TP8 A;  4HJA A;  4KD3 A;  3NTK A;  1WOC A;  2F0V A;  2F1M A;  4NKL A;  5CMD A;  1WTO A;  1I94 L;  1S5B D;  3VR6 A;  1XTD A;  4A3D G;  4PG3 A;  3UI2 A;  4DN4 M;  5CR3 A;  4R4O A;  4NXN L;  2K03 A;  4C1N I;  4ZQ3 A;  3MHB A;  1Y1W H;  3TZD A;  4B3R L;  5J1Z A;  4B3S L;  1Y8N B;  3ITP A;  2B39 A;  1Q8I A;  2VB3 X;  1QNK A;  1SXT A;  2N78 A;  3TDQ A;  1IBM L;  5C4J B;  4KTA A;  2RF4 A;  1HFN A;  4BWG B;  4QQB X;  1B3A A;  3TZU A;  4DV0 L;  2XWJ B;  3GTP B;  4X62 L;  4P72 A;  3CCU A;  2G5D A;  4J1M A;  3TS2 A;  3KLR A;  5EKK A;  1A2U A;  3GTM H;  3PF4 A;  4KY6 A;  5JJL A;  1IBK L;  1BO0 A;  4A3K H;  1CHQ D;  4DV4 Q;  1KAA A;  2NN6 G;  1KQS A;  4KI0 A;  1H9R A;  3W1B A;  2O5I C;  1EIF A;  4ZK9 B;  1RIP A;  3DLL A;  2MP1 A;  4K2L A;  2M00 A;  4HIK A;  1RF2 D;  1CTM A;  2A68 C;  4S3S A;  4ZKC B;  4BY1 G;  3SK4 A;  3K0X A;  1HNX L;  4ZRZ A;  2KHJ A;  1SMY D;  1PFN A;  4KLK A;  4OIJ A;  3IL8 A;  5KRU A;  1RJT A;  1ROD A;  2E2I B;  3J7A F;  4QUC A;  5CV8 A;  4EQN A;  2RHS B;  3U4Z A;  1HNW Q;  2BA1 A;  4JV5 L;  1LT5 D;  3NUC A;  5IYB G;  1VQE A;  3O13 A;  4GLV B;  4BBR B;  1UE1 A;  1QG7 A;  2G9D A;  2X6L A;  1LYL A;  3NWS A;  1DOM A;  3KJO A;  1VQP A;  4PV1 C;  2AQ2 B;  1VQ4 A;  2NVQ B;  4C3I H;  1SLJ A;  1OO9 B;  2F0F A;  2I46 A;  3QJY A;  2E5L L;  4JI0 Q;  5JEA G;  2MNA A;  4JC0 A;  2F0D A;  3W1G A;  1JOR A;  3OYY A;  4NXM Q;  2VB2 X;  4G7Z C;  2XSC A;  2JP1 A;  4IOC A;  1J8I A;  2VQF L;  5ELN A;  3D31 A;  4UDU C;  4LF6 Q;  1PV4 A;  5E3F A;  4DV2 L;  1JWU D;  4MHE A;  3M4Y A;  3T1Y Q;  1ZYR C;  3GTL H;  1M4V A;  1QUQ B;  1O80 A;  2KA7 A;  1Y8O B;  3CCE A;  3TSS A;  2R93 G;  5M3M G;  4Y7N H;  4A93 B;  1PZK D;  2D62 A;  1SE2 A;  1KAW A;  3C3L A;  1SYE A;  1HA5 A;  1T9H A;  5IT9 E;  1SMY C;  1TWC B;  5EGT A;  2ES2 A;  2I0Q A;  5CV6 A;  3H3V C;  4E6I A;  4H0L C;  5IOD A;  1H9K A;  4FF1 A;  3A7A B;  4FDB A;  4X3K A;  4BA2 I;  1FJG L;  1CM9 A;  4DF7 A;  2PW7 A;  4AYB G;  1PLF A;  4QY7 A;  3J80 L;  4BS9 A;  1STA A;  4ILW A;  3A5U A;  2A19 A;  4TQU S;  3DMU A;  2C9O A;  5AJ3 L;  1WTR A;  4AH6 A;  5KIX A;  2L55 A;  2PQA B;  1A0I A;  2B2W C;  4ID6 A;  3CQZ H;  2KVM A;  3D0F A;  4IUN A;  1EOV A;  2E8G A;  3U9O A;  2R7F A;  4IPC A;  5KGU A;  1YBY A;  3K59 A;  2ICI A;  3T1H Q;  1TS5 A;  4L6T B;  2LMC B;  2JEB I;  2CQA A;  1VQK A;  2L9H A;  4CGY B;  1BQQ T;  1L1O C;  4IPH A;  5C0X G;  4OWW B;  1QUQ A;  3ER0 A;  3VYU A;  3BU2 A;  4L5T A;  3J80 i;  1I4R A;  2P5Z X;  4A3M B;  1SNQ A;  3WDN A;  1XMQ Q;  3RZO H;  3Q0A A;  4BA1 I;  1UE7 A;  5I2Y A;  3I7F A;  4JBK A;  2I5M X;  3CCJ A;  1N34 Q;  4UY8 C;  4DR4 L;  2LKV A;  2PQA A;  4B9W A;  5EPJ A;  4YHH Q;  2M9V A;  1PZJ D;  1G8Z D;  4A3E B;  2KCN A;  1IL8 A;  4BY7 B;  1B50 A;  1C7Y A;  1IBL L;  2K33 A;  5IYD H;  5IGD A;  1ZKO A;  1F77 A;  2QF7 A;  4NP5 A;  3NBI A;  4A3C G;  1ESR A;  3MEH A;  2CW0 C;  3NE5 B;  2L12 A;  4JOI C;  1II3 A;  1ILQ A;  1HZ9 A;  2F0N A;  1AZQ A;  2I5L X;  2KCT A;  4QMG A;  1V1Q A;  2C35 B;  4DAM A;  4UP9 A;  4L5Q A;  1FNU A;  1BCP D;  2Q8I B;  3SK6 A;  4JK1 C;  3HFZ B;  2IWH A;  1YEZ A;  1K8O A;  3H0G H;  3Q6S A;  4N9P A;  3EBE A;  4LF9 Q;  2Z6B A;  3N6R A;  1JOQ A;  4JI6 L;  2QW7 A;  4JI5 Q;  5E4X A;  5I6W A;  2K01 A;  4BBS H;  2K14 A;  5K5P A;  2IT1 A;  3F2C A;  5C3X A;  1DON A;  4O2D A;  1Z9F A;  1S40 A;  1QZG A;  5CGK A;  1G6Z A;  1X3P A;  5JOB A;  4A3F G;  2XVS A;  4LWC A;  2ZJQ A;  3C2P A;  4M1U B;  1IYJ B;  1RDP D;  1G2S A;  4RG1 A;  1JB3 A;  4BBR G;  3PF5 A;  5DM6 3;  5LMN Q;  3PIO 3;  2XNA C;  1PFM A;  3K7A H;  2KBN A;  4DNR B;  1WCM B;  4LFB Q;  3TEH B;  1XNQ L;  3GTQ B;  1B1Z A;  1X3Q A;  4IUP A;  3L7Z C;  2K5V A;  4P2C B;  3GQB A;  2Z6K A;  3URY A;  4GKJ Q;  2R61 A;  1K28 A;  1CA5 A;  1BOS A;  5IYC G;  2JA8 H;  4X66 L;  2UU9 L;  3SK8 A;  5EQ0 A;  4XXE A;  1TWA B;  2HD3 A;  2E2H H;  4OX9 L;  1GUS A;  4GKK Q;  1STH A;  2OEO A;  3HOZ H;  3VR5 A;  1DZ1 A;  5IY0 A;  2HIV A;  1PRT D;  3BG3 A;  3TQY A;  2OQ0 A;  4A3B G;  3M7N A;  1E3P A;  3V05 A;  3RLO A;  1E2V A;  1Y1W B;  2Z9H A;  1LV9 A;  3W2D A;  3BYT B;  1CZW A;  4MIU A;  1BCP C;  3OIP A;  2IL8 A;  3AEV A;  4JI8 Q;  4POG A;  4K5X A;  3F1Z A;  2K50 A;  4JI3 Q;  3FEW X;  4A93 G;  3DXJ C;  1ENA A;  4OXP A;  2ASB A;  3TME A;  1ONL A;  3M85 A;  3TBI B;  1VQC A;  1DJR D;  4EGV A;  4DAP A;  2B2U A;  2UXC Q;  4A3K B;  1TWH H;  1PDQ A;  1VQD A;  3L9A X;  1EWC A;  1AFP A;  1V9P A;  1GVP A;  5DM7 3;  4DNT B;  5DLQ E;  5JPN C;  1N32 L;  2HQE A;  3J81 j;  1M8A A;  1TXY A;  3H91 A;  4OEL B;  4DR3 L;  1MSG A;  3BVZ A;  4H7B A;  2SDF A;  3SE0 A;  5JVG 3;  4G57 A;  1VQJ A;  4EQO A;  1JJC B;  3CCV A;  5ELC A;  3H3V H;  1XMO L;  3BZK A;  5IGE A;  3A8K E;  3E0E A;  3MC0 B;  5CYU A;  4NMZ A;  1ASZ A;  2EY2 A;  4ABN A;  1EWI A;  3NPP A;  2LY7 A;  2H5X A;  1PFB A;  2WV6 D;  1A2T A;  4TSS A;  3E5S A;  2D0O A;  2O2L D;  1STB A;  1PRT C;  2WIN B;  1HHV A;  3CPW A;  4DA2 A;  4DR6 Q;  1F9S A;  4A3M G;  1KLG D;  2I07 B;  2HT1 A;  1STE A;  3A5Z B;  1WTQ A;  4C3I B;  1N36 L;  4KHV A;  1CI3 M;  1H9S B;  2K6A A;  2D2C C;  5A2Q E;  3ND8 A;  5E7N A;  4FXK C;  3CP0 A;  4HCE A;  1ET9 A;  2R92 H;  4RWS C;  2EDG A;  5CBE E;  2A6E D;  2Z0S A;  1NY4 A;  3KUP A;  1V1P B;  2B2V C;  1VQB A;  2EY1 A;  2TMP A;  2IHF A;  5IT9 c;  4OWX B;  2ATW A;  2JA7 H;  4RGM A;  3K81 C;  2EYM A;  3P75 A;  4DR1 L;  4CKE A;  4A3E G;  1KRT A;  5HUR A;  3HP3 A;  4BY7 G;  3OTO L;  1I4G A;  2VUM H;  1GUN A;  3RD4 A;  3PV0 A;  4O42 A;  3LNN A;  4KMU C;  4DPG A;  4HIO A;  1M90 C;  3GTL B;  1JJ2 A;  4HSV A;  2CVR A;  4Y7N B;  3KYH C;  2F4V Q;  1RCV D;  4FYD A;  2OF1 A;  5D3D A;  5IP9 G;  1QIL A;  1SNM A;  3UDF A;  4LUV A;  4OEM B;  1SFO H;  1EYG A;  2A69 D;  2XGT A;  1LUZ A;  1XXG A;  4CDF C;  2JJQ A;  2K4K A;  4X6A H;  5ELO A;  3I73 A;  1H9S A;  1UE5 A;  1VQL A;  2NN6 I;  4PQX A;  3CQZ B;  2ZXR A;  2R7Z H;  3KLW A;  3J7Z C;  2LS0 1;  4LF7 L;  4DXG A;  4DR7 L;  4H02 A;  4YY3 L;  1J5E L;  4DR5 Q;  3UDI A;  1V1P A;  1TY0 A;  2HDM A;  4HMJ A;  4U68 A;  1LTT D;  3GDE A;  5BN5 A;  2HHH Q;  3HOX H;  2EYF A;  4UP8 A;  3S9W A;  3RMH A;  5C4X H;  4OO1 H;  3CAM A;  2B8G A;  5D65 A;  1KDC A;  3QOL A;  5LMN W;  1WCM G;  2A73 B;  3M4Q A;  4LF8 Q;  5I4D A;  3LX0 A;  2A6E C;  2F0M A;  1B9M A;  2BDO A;  2DJF C;  2BE5 D;  4KJO A;  1PH1 A;  3X3M A;  4P75 A;  2XN9 C;  5FOB B;  1HNZ L;  1K83 H;  4F7X A;  1IKL A;  3KOJ A;  1EWH A;  3HEJ A;  3RZO B;  2K1B A;  1NNX A;  1AE2 A;  1SYG A;  4DUZ L;  1DXM A;  3C1F A;  3E9H A;  2AWO A;  2ZT9 C;  1HZB A;  3KLS X;  1FNV A;  1BCP F;  5I9O A;  1JWS D;  2E76 C;  2K5H A;  5ELF A;  4XDX A;  1Y1W G;  4ME5 A;  4NDX A;  1IYV A;  3ULL A;  3WOE A;  1KAB A;  1C9O A;  2IHE A;  2ZJR A;  4LF4 Q;  4TKO B;  5CV4 A;  2A69 C;  2WII B;  3CRL C;  5LL6 S;  3Q24 A;  1YJW A;  2K5D A;  2FHT A;  4R8N A;  1RTO A;  4FF3 A;  3HG9 A;  1Q8K A;  2NTS A;  4LJZ C;  2Z1C A;  3MXP A;  1U0L A;  1HTL D;  5D14 A;  4JI2 Q;  3F2B A;  1MJE A;  1O78 A;  1EEF D;  2R6G A;  1VQN A;  1X55 A;  4A3K G;  4DAY B;  5ISR A;  4X65 Q;  3H15 A;  4LUO A;  3CCR A;  1X32 A;  2E74 C;  2M2L A;  3SEB A;  2IPK D;  3H0G B;  1E1T A;  3KLS A;  2D0P A;  2FMM A;  4KKU A;  5L37 A;  1VQ8 A;  1I94 Q;  1X65 A;  1MSH A;  1ENF A;  3TRE A;  1VQ9 A;  1TWG H;  4RKB A;  4BBS B;  2MUY A;  1C4Q A;  2BE5 C;  4NXN Q;  2XRS D;  1VQI A;  4N9T A;  3SR1 A;  2BA0 A;  2JXM B;  4FF2 A;  3HS0 C;  2QCP X;  1PTO C;  4B3R Q;  3P1H A;  1D1I A;  4B3S Q;  1YVC A;  2F3W A;  2K05 A;  1KLU D;  4DNI A;  2WP8 J;  2B8F A;  1WD0 A;  4B9X A;  1IBM Q;  3K7A B;  3FHW A;  3VR3 A;  3RR5 A;  2EPB A;  3J7Y W;  1SND A;  4DV0 Q;  5FJ8 G;  1TKW B;  4X62 Q;  1DD2 A;  2JEA I;  1TII D;  5M9O A;  3PMF A;  1A3V A;  2OCE A;  4C3I G;  2JA8 B;  1GUG A;  3J7A 5;  2EXD A;  1IBK Q;  1JOK A;  3J81 E;  2E2H B;  1B70 B;  2K5W A;  4DAY A;  3I56 A;  2K04 A;  3HOZ B;  1I50 B;  1SYD A;  2EZV A;  1B8A A;  1EEI D;  5JJK A;  5CV7 A;  1PH5 A;  3IAY A;  2F3I A;  4IJH A;  2CH4 W;  4CDC C;  4G7H C;  1R4P B;  1VCI A;  2F52 A;  2FMC A;  3OWE B;  1Q7Y C;  3BZD B;  1HNX Q;  1PYW D;  3MXU A;  4GS3 A;  5G3L F;  5LHY 1;  1DCZ A;  4GOP C;  1LO5 D;  5BN4 A;  3HOU H;  3A54 A;  3K7U C;  1KXL A;  1GXD C;  2LXK A;  3PUY A;  4IPD A;  4JV5 Q;  2E75 C;  1ICW A;  1L2F A;  4DV3 L;  3CCM A;  1EIY B;  2GA4 B;  1HR0 L;  1EY7 A;  3ZJY C;  4CBV A;  5C4H A;  3CF5 A;  1Q81 C;  3S14 H;  2NUC A;  3U50 C;  1W6J A;  4JBW A;  4QL5 A;  4RCN A;  5M5W H;  1BDO A;  1AW7 A;  5K36 H;  1SSO A;  1FGU A;  1TWH B;  2N55 A;  2ZTC A;  5TSS A;  1N9W A;  3IFT A;  2B63 H;  1Q3L A;  3F8T A;  3NEM A;  3TP6 A;  1ZYR D;  1WI5 A;  2HDL A;  4IFD H;  1QB5 D;  3CC7 A;  2LFN A;  2E5L Q;  1PH6 A;  1WFQ A;  2DY8 A;  4X3U A;  3D6W A;  2KEN A;  1I4X A;  1X3F A;  2VNU D;  2RVL A;  2MQH A;  1EY4 A;  2VQF Q;  4KKS A;  2MPM A;  4Q0F A;  1RHP A;  4QF4 A;  1SYB A;  3S15 H;  4DV2 Q;  4A3F B;  3PUV A;  1BNZ A;  3NTI A;  3A8J E;  2F0G A;  5ELE A;  1SNP A;  3IFD A;  4IFD J;  3GV3 A;  3A7L A;  5FJ8 H;  3PO3 H;  1AP0 A;  4RGT A;  1OXT A;  1Q46 A;  2NZO A;  3RLN A;  4QUF A;  4I7A A;  4PZ8 A;  5C5L A;  2RA4 A;  1FJG Q;  2EYH A;  4A3L G;  2R92 B;  5AJ3 Q;  2Q2I A;  4C2M H;  2EVB A;  1L1O B;  1GUO A;  3HKS A;  2JA5 H;  1AEX A;  1QWY A;  4FVM A;  3GTJ B;  4A3B B;  1DGS A;  2RSO A;  4F88 A;  2XIW A;  1C48 A;  2V4D A;  3CU7 A;  1CA6 A;  2EY5 A;  2PZU A;  5FLM H;  3FMC A;  4X64 L;  1EQR A;  1Q12 A;  2WKC A;  2VUM B;  2BCO A;  4PNY A;  4O1N A;  3CHB D;  4JCV E;  1BUV T;  5IYD G;  3EFX D;  1G6P A;  3CW2 C;  1SE4 A;  4IUQ A;  4CDE C;  3I3C A;  4CJ1 B;  1IXR A;  3CXC A;  3MWY W;  1T5E A;  1LTL A;  2OTJ A;  3UE0 A;  2B2Y C;  4JI7 L;  3HRZ C;  2EJF C;  2K5Q A;  2RSN A;  1K8G A;  1N8R C;  2ZM6 L;  2B2W A;  3HOY H;  1T5X D;  1GHK A;  1A6X A;  2I5H A;  4DK6 C;  2DJG C;  1SFO B;  2ZXP A;  1F2M A;  2WB1 B;  4DAV A;  2UUA L;  2AKW B;  2KED A;  4P74 A;  3H0G G;  1F9Q A;  1L0Y B;  4IQZ A;  3TS0 A;  2EYJ A;  3DM1 A;  2CW0 D;  1N33 L;  4BBS G;  2R7Z B;  2VY3 A;  3CC4 A;  1L1O A;  1SRU A;  1DYQ A;  3HOX B;  4DR4 Q;  5LMU L;  4I7Z C;  3DM3 A;  3PO2 H;  2QA4 A;  4FP5 D;  1HZC A;  3ND9 A;  1IBL Q;  4OO1 I;  3SDZ A;  1CUK A;  5H1S E;  1JWM D;  1YIJ A;  1VDZ A;  2CKZ B;  2ID0 A;  3LGJ A;  4K0K L;  1R4Q B;  4KK7 A;  2NVY H;  3MAQ A;  3JC6 6;  1K83 B;  2F0T A;  3KBX A;  2JA8 G;  5C44 G;  4CKC A;  1EYC A;  1SNO A;  4A3G H;  1FD7 D;  4K2K A;  4KHZ A;  2UXD L;  1W6K A;  3HOZ G;  1PTO H;  2QDL A;  4CDD C;  1WVL A;  2HCC A;  1CKO A;  3CKI B;  2LSS A;  1U4R A;  4DK0 A;  4HED A;  1GD7 A;  4K8J A;  4HSP A;  4A3L H;  1WTW A;  1CSQ A;  3I4M H;  4JI6 Q;  4PMB A;  3E0J A;  3ERS X;  4KN7 C;  4PMC A;  5EAY A;  4C3J H;  1WD1 A;  4R1J A;  1LT6 D;  2Q2T A;  3V96 A;  4RFB A;  1PFS A;  3D4R A;  4JOI A;  2RCN A;  4FNF A;  5C4Z A;  3ONA B;  4C3H H;  1HQM C;  1LT3 D;  4DV1 L;  2CWP A;  1PYS B;  5LL6 X;  3SK5 A;  2EOT A;  3M9B A;  1HRJ A;  1SN8 A;  1BBX C;  2PI2 A;  2MGS A;  4G7O C;  4KKT A;  1Q1B A;  1KNE A;  5FO8 B;  5M3F H;  4XT1 B;  1YNX A;  1XNQ Q;  5E1F A;  1NUC A;  3V2T A;  2SNS A;  4A3I H;  2SOB A;  3KJP A;  4WOR A;  3G71 A;  5I6Y A;  3U9S A;  4HJ8 A;  4X66 Q;  1HCZ A;  1BCP B;  3JAM E;  2UU9 Q;  4HTH A;  5EBC A;  1VF5 C;  1NMG A;  3S1N H;  3J81 L;  2UUB L;  1EQT A;  4OX9 Q;  4PZ6 A;  3RN5 A;  2V1C C;  1PA6 A;  1TWG B;  2XTI A;  2Z4I A;  1YHQ A;  3UDX A;  4JW0 A;  3CCS A;  4RGO S;  1IZ6 A;  3J81 c;  1XPU A;  1PH4 A;  1OXX K;  2WAC A;  3CMA A;  1B44 D;  1E2W A;  4MNO A;  1AZP A;  3AQQ A;  2C5C A;  2YU9 H;  2J7Z A;  4GNX C;  1SE3 A;  1UEB A;  2EE1 A;  3W5O A;  1GUW A;  1NJI C;  3E6Z X;  4KV6 A;  3K5N A;  2WAQ G;  3S1R H;  1X6O A;  1SJH D;  5IGC A;  5GAD C;  4IJL A;  2IX1 A;  2L11 A;  4CJ0 B;  3I72 A;  4JI4 L;  1PH8 A;  5ELB A;  5C44 H;  1VS0 A;  1PZI D;  3T53 B;  1GM5 A;  1GHJ A;  3MXN B;  3MZ5 A;  1SJE D;  3SGI A;  2F0J A;  1A3T A;  2R92 G;  3EIV A;  4V0B A;  1IYU A;  1L0X B;  3R2I A;  4BXX H;  1N32 Q;  4HIM A;  2JA7 G;  2JA6 H;  1PRT B;  1TS4 A;  4DR3 Q;  2BOS A;  5FO7 B;  4ALP A;  1PH2 A;  5C6A A;  2A6H D;  4RHS A;  4RA8 A;  1F9P A;  2VUM G;  3HOU B;  4FXG C;  1XMO Q;  4NPS A;  4MTN A;  1K9M C;  1KC8 C;  2Q2H A;  2ENB A;  4OL7 A;  5IGG A;  1VQ6 A;  2VW9 A;  1TR5 A;  4B3T L;  2Z6K C;  3IKJ A;  1BKB A;  2QEJ C;  3R2T A;  4HN7 A;  3S14 B;  3CD6 A;  4A3J H;  3GTM B;  2EQS A;  4N8F A;  4XQQ A;  4CJ2 C;  5M5W B;  5T1G A;  1QE6 A;  4JPB W;  4UAI A;  2B63 B;  5JJI A;  2WB1 G;  1N36 Q;  5BN3 A;  2IX3 A;  3NSW A;  5IE8 A;  2F0E A;  3MXN A;  3TRZ A;  2VQE L;  1JMC A;  5EKL A;  4DV7 L;  1UNS A;  1EY6 A;  2R7Z G;  1LTG D;  3I4N H;  3OWF A;  2DNC A;  2H1E A;  2QGQ A;  3STB D;  3GTG H;  2X6G A;  1F2L A;  3PQI A;  3HOX G;  5DAU A;  3S1Q H;  3Q8D A;  3NBH B;  4DR1 Q;  5C4X G;  4OO1 G;  1S4Z A;  5D3I B;  1VQA A;  1SNC A;  1EQV A;  3OTO Q;  3S15 B;  1E22 A;  3TP7 A;  2F0P A;  4R4I A;  2PQE A;  3NP8 A;  1Q90 A;  1STG A;  3PO3 B;  2FIN B;  4AIM A;  4EX5 A;  3EA6 A;  1IW7 D;  2B2V A;  2A6H C;  3NEL A;  2F0S A;  5IT9 L;  4AQY L;  2E2I H;  2F0I A;  4R8I A;  4JI3 L;  1NTG A;  1X3E A;  4Y52 H;  1XPR A;  3HZX A;  4FO2 A;  4C2M B;  3DUZ A;  2J0T D;  1TS3 A;  5IWA L;  2JA5 B;  3BZC A;  1I3Q H;  4KN4 C;  3SVM A;  3D3R A;  4R4Q A;  3NQI A;  1L0W A;  1ICF B;  2B3G A;  5GRO A;  1I6V C;  3NWT A;  1H95 A;  3VDY A;  4LF7 Q;  4DR7 Q;  1HJP A;  2AUK A;  2MFI A;  2N8N A;  4YY3 Q;  1TQO A;  2QKI C;  1S72 A;  1JIC A;  1SAP A;  1JT8 A;  1E24 A;  3NBH A;  2MO0 A;  4MZ9 A;  1F9R A;  3U58 A;  3A56 A;  4YWL A;  2RDH A;  4XYO A;  4OWT B;  1AN8 A;  4LF5 L;  1HA6 A;  3K6O A;  3PIP A;  2DGY A;  2JYO A;  3STB C;  2RBM A;  1EUJ A;  2CCZ A;  3EN2 A;  2WAQ E;  2EYP A;  5GQO A;  1LTR D;  2YYZ A;  5BR8 L;  1K8M A;  2EY6 A;  5ELD A;  4DGZ A;  1XTC D;  4LMQ D;  2GVA A;  1Y1V H;  1Z7T A;  3AU7 A;  2VZA A;  1GUT A;  3G48 A;  4DUZ Q;  3T4A C;  1LAB A;  4KHP L;  1TWC H;  2R7D A;  4MN3 A;  1TY2 A;  1IW7 C;  2CWA A;  3FP9 A;  5M5X H;  4H44 C;  2NB0 A;  5IIF A;  5M5Y H;  1CFM A;  2XWB B;  3OMG A;  4DXF A;  1EL0 A;  4LFA L;  1FR3 A;  3P7J A;  5JJZ A;  4DUY L;  2NVY B;  5KEE A;  1LT4 D;  1CQV A;  3S24 A;  1YI2 A;  1SYF A;  3BVG A;  1PTO D;  4I65 A;  4A3G B;  2F0Q A;  1EOT A;  3NTH A;  1HFG A;  1I6H H;  1GO3 E;  4LFC L; 
#chains in the Genus database with same CATH homology
 3JAM L;  3BDO A;  1EU4 A;  1LAC A;  2BDN A;  5EBD A;  3I4M B;  3GV6 A;  3PUX A;  4C3J B;  4RAU C;  2WKD A;  1UAP A;  1HPC A;  2K28 A;  2OXP A;  5IGF A;  1D6E C;  4C3H B;  3Q23 A;  2KJX A;  2IW3 A;  3QB3 A;  2X69 A;  2TSS A;  2AQ1 B;  3GO5 A;  5NUC A;  4X3S A;  2HCI A;  4FXD A;  1BR9 A;  5M3F B;  1VMC A;  1EYA A;  4A3I B;  4K8I A;  5K36 G;  5KNB A;  1S5F D;  4F8M A;  1S5C D;  4IFD G;  3S1N B;  2H4O A;  4RGN A;  4KY5 A;  2ICE C;  4C56 C;  1EY8 A;  1Z6H A;  4LAA A;  4XT3 B;  4K5W A;  1MD2 D;  1KDB A;  4QCL A;  1EY0 A;  2QIL A;  1XWE A;  2K32 A;  1PRT F;  3OMC A;  4PMW A;  1TT2 A;  1EIG A;  2YU9 B;  2D5D A;  5DEH A;  3BDL A;  4LK1 C;  3S1R B;  4M8A A;  1D5Z C;  2Q8T A;  3FRP B;  1EYD A;  2B2T C;  2FJ2 A;  4QB4 A;  5T1I A;  4ULL A;  5C44 B;  2F3V A;  3QO2 A;  3BDC A;  1B53 A;  2DY7 A;  1STN A;  3QIA A;  4XYQ A;  1WTP A;  2JA6 B;  3BS1 A;  2F0U A;  5F2D A;  2QDB A;  3G6J B;  1QCB D;  1ENC A;  2Q8R E;  3QWN A;  2Y0S B;  4J8Q A;  2EYL A;  1IKM A;  1D2B A;  4Q5V A;  1TVX A;  3K5L A;  4A3J B;  4C1N K;  1FGB D;  5KND A;  5IGB A;  1UUP A;  2L5T A;  2MHV A;  2L0C A;  4XQN A;  1EZ8 A;  1CQF A;  3OHX C;  3LWU A;  3QOJ A;  2Z8L A;  3EQL C;  5I9P A;  1V1O A;  4X3T A;  4F87 A;  5A2Q L;  3RLF A;  3T13 A;  4K6D A;  1HUN A;  2O4X A;  3I4N B;  4WFN 3;  5CV9 A;  3GTG B;  5IOC A;  3S1Q B;  4OHJ A;  1HUM A;  1DOL A;  3RUZ A;  1TU2 B;  2PYK A;  3L3O C;  1XYI A;  2RQX A;  1NSN S;  1EY9 A;  2R3Z A;  2F0H A;  2KCC A;  4RKL A;  1I4H A;  1NAP A;  1VF7 A;  1A15 A;  2F0O A;  1XX8 A;  2WAQ B;  2Z4H A;  1OXV A;  3VR2 A;  2NYZ D;  2RDG A;  3DEO A;  3NXW A;  1LTA D;  1MGS A;  1RKN A;  1BXT A;  5CC4 A;  1EFI D;  4CHT B;  3QG1 A;  1I3Q B;  4C3J G;  3K5M A;  2JA7 B;  1QOH A;  3I4L A;  5FO9 B;  4KY7 A;  2KQ3 A;  3NQT A;  4C3H G;  2F4I A;  1PMR A;  2B2Y A;  1B4O A;  3PUZ A;  5FK9 C;  4OGQ C;  2DN8 A;  2AUJ D;  1HTP A;  2EJM A;  5JVH 3;  3MFY A;  2IJ0 A;  2SNM A;  2PNR C;  1D1K A;  1I4P A;  4EVO A;  2DNE A;  4RH6 A;  3Q22 A;  2N88 A;  3VR4 A;  1Y1V B;  5AFW A;  4K6L A;  1LTB D;  1PTO F;  3J7A V;  2PCF B;  3BYY B;  4WJW A;  5C4X B;  4NW2 A;  5M5X B;  4K5V A;  3D4D A;  2NN6 H;  3A55 A;  5M5Y B;  3G7L A;  4RCO A;  4L8J A;  3GP7 A;  1LTS D;  1D5M C;  1CK1 A;  2HUG A;  5EKI A;  1RTN A;  1HXY D;  4KD4 A;  1KTK A;  4ZYS A;  5KYI A;  1U9R A;  1I6H B;  1PXU A;  5DNF A;  1U4M A;  2F0K A;  1C8C A;  1DM0 B;  3NHH A;  1NR4 A;  1EIH A;  1MBY A;  1NR2 A;  2RKS A;  1JC7 A;  3HKZ B;  1SEB D;  1F2Z A;  3OSO A;  3MVV A;  3DHQ A;  2L1B A;  1V8Q A;  2AWN A;  2NBF A;  5JEA H;  2KUM A;  1YNN D;  3GTO B;  1S5E D;  3HOW B;  1CT1 D;  3SXH A;  3FPP A;  3ERO A;  5EJW A;  2E2D C;  1IHZ A;  1G29 1;  4IZ8 A;  1Z47 A;  3VA7 A;  2JSO A;  3NK9 A;  3HOV B;  1JQY D;  3OW7 A;  2PW5 A;  5C3E B;  1B2T A;  5JEA J;  3H94 A;  1OXU A;  1CZG A;  4IUT A;  2NZ1 D;  4ZLT F;  1DOK A;  4IUV A;  4DFA A;  3I91 A;  4RHR A;  4V19 0;  1Y8P B;  3RZD B;  4OIK A;  2CHB D;  1E2Z A;  5COY A;  3D4W A;  1ZXT A;  4ODG A;  3OOC A;  2EJG C;  1WTV A;  3EVQ A;  4Z9C B;  2JE6 I;  4CKB A;  1U4L A;  3FKI B;  1V43 A;  3DWQ A;  2NWG A;  3ZYY X;  4QIW B;  1D5X C;  1YNN C;  5C0X H;  1NCV A;  2E2J B;  2SEB D;  1TWF B;  2D9U A;  3OPO A;  2NVT B;  3WOF A;  3MFG A;  1F2Y A;  1KNA A;  3K5O A;  1YNJ D;  1RD9 D;  3A8I E;  3S2H B;  3HGB A;  5J22 A;  2ZXO A;  2KHS A;  3MXG A;  1SBB B;  2NVX B;  2EXZ A;  1R9T B;  2PZT A;  3W3A A;  2KEE A;  3SHL A;  5C5M A;  5C0X J;  1STY A;  4TRD A;  5HGT A;  1ET6 A;  1G2T A;  4WRD A;  1J9O A;  1HQR D;  4KJN A;  4L63 B;  5FLX E;  1U4P A;  3GD7 A;  4IFD I;  4HMI A;  1GJX A;  1ILP A;  1H9J A;  1Q1E A;  4ZAI A;  2F03 A;  1VMP A;  4EQP A;  3K58 A;  1ZEQ X;  5I2X A;  1E0B A;  1JE4 A;  5G3L D;  4H13 C;  2B2U C;  2PZW A;  5JPM C;  1Y69 U;  3GTK B;  2RDF A;  3C46 A;  1SYC A;  4DU9 A;  3VA5 A;  1YNJ C;  3I90 A;  1KDA A;  4XIG S;  1FYC A;  2NTT A;  3F2U A;  5KNC A;  1QJO A;  1UEA B;  5J39 A;  2MJ8 A;  2OT2 A;  3I8Z A;  1LLR D;  3K0Y A;  4U67 3;  1QNU A;  1EY5 A;  4A3D B;  1G91 A;  4IAL A;  4G4K A;  3OIQ A;  1S5D D;  3H09 A;  3M4O B;  3HOY B;  2F0L A;  3H6M A;  1MI2 A;  4HAE A;  2IX0 A;  4YIJ A;  2XRQ D;  3PIP 3;  2F0W A;  2A5H A;  3ERQ A;  5CBA E;  3KF8 A;  1JCK B;  5EPL A;  2FFK B;  3VYT A;  3PO2 B;  3S2D B;  2EYO A;  4FF4 A;  3TP5 A;  4BY1 B;  1SDF A;  4ZUJ A;  3AMU A;  1OXS C;  1O7Y A;  2KEC A;  2PO4 A;  1B9N A;  3AB9 A;  3KBG A;  3TN2 A;  2O5J C;  1WTX A;  3M7G A;  1PTO B;  4J6H A;  2G9H D;  2PPB C;  3D6C A;  2VXW A;  4ZUI A;  3FVQ A;  1JOO A;  3R93 A;  2J4X A;  1EU3 A;  3M3Y B;  2A74 C;  3J80 E;  5CV5 A;  5JAV A;  3DWP A;  4DK1 A;  1O7L A;  3FDT A;  4GZY C;  3S16 B;  1ML0 D;  5EPK A;  1O7Z A;  3VYR A;  4ZKB B;  2K7V A;  1H9M A;  1LTI D;  1FNW A;  3KK7 A;  5FKA C;  3EJI A;  3CRK C;  3S17 B;  3R3O A;  2R93 B;  5M3M B;  3C1E A;  4HR7 B;  1I4Q A;  4XQJ A;  5E4W C;  4IUU A;  1JR0 D;  3MA2 B;  3PUW A;  2L4N A;  3P20 A;  2PMZ B;  4AYB B;  2B2T A;  5COR A;  3N52 A;  4HCS A;  4R9W A;  3DWA A;  3S1M B;  3DEP A;  5KYL A;  3T51 B;  3I70 A;  1ESF A;  5C3W A;  4B08 A;  2AQ3 B;  4K14 A;  1A3U A;  1TS2 A;  1EZ6 A;  3LWE A;  3MTS A;  2A68 D;  3R8B A;  3VYS A;  1CHP D;  2KOL A;  5A35 A;  5FLX L;  4IN3 A;  4XTC S;  3FPU B;  5C0X I;  3X3N A;  3T16 A;  3K57 A;  1GOZ A;  4IUR A;  1BF4 A;  3BVM A;  3D8G A;  3T56 B;  3TP8 A;  4KD3 A;  3NTK A;  2F0V A;  2F1M A;  4NKL A;  5CMD A;  1WTO A;  1S5B D;  3VR6 A;  3UI2 A;  4DN4 M;  5CR3 A;  2K03 A;  4C1N I;  4ZQ3 A;  3MHB A;  3TZD A;  5J1Z A;  1Y8N B;  3ITP A;  2B39 A;  1Q8I A;  2VB3 X;  1QNK A;  1SXT A;  3TDQ A;  5C4J B;  4KTA A;  1HFN A;  4BWG B;  1B3A A;  3TZU A;  2XWJ B;  3GTP B;  4J1M A;  3KLR A;  5EKK A;  1A2U A;  4KY6 A;  1BO0 A;  1CHQ D;  1KAA A;  2NN6 G;  4KI0 A;  1H9R A;  2O5I C;  4ZK9 B;  2MP1 A;  4K2L A;  2M00 A;  1RF2 D;  1CTM A;  2A68 C;  4S3S A;  4ZKC B;  3SK4 A;  4ZRZ A;  1SMY D;  1PFN A;  4OIJ A;  3IL8 A;  5KRU A;  1RJT A;  1ROD A;  2E2I B;  3J7A F;  4QUC A;  5CV8 A;  4EQN A;  2BA1 A;  1LT5 D;  3NUC A;  3O13 A;  4BBR B;  1QG7 A;  2G9D A;  2X6L A;  3NWS A;  1DOM A;  4PV1 C;  2AQ2 B;  2NVQ B;  1OO9 B;  2F0F A;  2I46 A;  3QJY A;  5JEA G;  2F0D A;  1JOR A;  2VB2 X;  4G7Z C;  2XSC A;  2JP1 A;  1J8I A;  3D31 A;  4UDU C;  5E3F A;  1JWU D;  4MHE A;  3M4Y A;  1ZYR C;  1M4V A;  1O80 A;  2KA7 A;  1Y8O B;  3TSS A;  4A93 B;  1PZK D;  2D62 A;  1SE2 A;  3C3L A;  1SYE A;  1HA5 A;  5IT9 E;  1SMY C;  1TWC B;  5EGT A;  3H3V C;  5CV6 A;  4E6I A;  4H0L C;  5IOD A;  1H9K A;  4FF1 A;  3A7A B;  4X3K A;  4BA2 I;  1CM9 A;  4DF7 A;  2PW7 A;  1PLF A;  3J80 L;  4BS9 A;  1STA A;  4ILW A;  1WTR A;  4TQU S;  3DMU A;  2C9O A;  5KIX A;  2L55 A;  2B2W C;  4ID6 A;  2KVM A;  4IUN A;  3U9O A;  5KGU A;  3K59 A;  2ICI A;  1TS5 A;  4L6T B;  2LMC B;  2JEB I;  2CQA A;  2L9H A;  4CGY B;  1BQQ T;  5C0X G;  3VYU A;  4A3M B;  1I4R A;  1SNQ A;  3WDN A;  3Q0A A;  4BA1 I;  5I2Y A;  2LKV A;  4B9W A;  5EPJ A;  2M9V A;  1PZJ D;  1G8Z D;  4A3E B;  2KCN A;  1IL8 A;  4BY7 B;  1B50 A;  2K33 A;  5IGD A;  1ZKO A;  1F77 A;  2QF7 A;  4NP5 A;  3NBI A;  1ESR A;  3MEH A;  2CW0 C;  3NE5 B;  2L12 A;  1II3 A;  1ILQ A;  2F0N A;  1AZQ A;  4QMG A;  1FNU A;  1BCP D;  2Q8I B;  3SK6 A;  4JK1 C;  2IWH A;  1K8O A;  3Q6S A;  4N9P A;  1JOQ A;  3N6R A;  5E4X A;  5I6W A;  2K01 A;  5K5P A;  2IT1 A;  5C3X A;  1DON A;  5CGK A;  1G6Z A;  1X3P A;  5JOB A;  2XVS A;  3C2P A;  4M1U B;  1RDP D;  1G2S A;  1JB3 A;  5DM6 3;  3PIO 3;  2XNA C;  1PFM A;  4DNR B;  1WCM B;  3GTQ B;  1B1Z A;  1X3Q A;  4IUP A;  3L7Z C;  4P2C B;  3GQB A;  3URY A;  2R61 A;  1CA5 A;  1BOS A;  3SK8 A;  5EQ0 A;  4XXE A;  1TWA B;  1GUS A;  1STH A;  2OEO A;  3VR5 A;  1DZ1 A;  1PRT D;  3BG3 A;  3M7N A;  3V05 A;  1E2V A;  1Y1W B;  1LV9 A;  3W2D A;  3BYT B;  1CZW A;  4MIU A;  1BCP C;  3OIP A;  2IL8 A;  4K5X A;  3FEW X;  3DXJ C;  1ENA A;  3TME A;  1ONL A;  3M85 A;  3TBI B;  4EGV A;  1DJR D;  4DAP A;  2B2U A;  4A3K B;  1PDQ A;  3L9A X;  1EWC A;  1AFP A;  5DM7 3;  4DNT B;  5JPN C;  2HQE A;  1M8A A;  3H91 A;  1MSG A;  3BVZ A;  4H7B A;  2SDF A;  3SE0 A;  5JVG 3;  4G57 A;  4EQO A;  5ELC A;  5IGE A;  3A8K E;  3MC0 B;  5CYU A;  4NMZ A;  2EY2 A;  4ABN A;  3NPP A;  2LY7 A;  1PFB A;  2WV6 D;  1A2T A;  4TSS A;  3E5S A;  2O2L D;  1STB A;  1PRT C;  2WIN B;  1HHV A;  4DA2 A;  1F9S A;  1KLG D;  2I07 B;  1STE A;  1WTQ A;  4C3I B;  4KHV A;  1CI3 M;  1H9S B;  2K6A A;  2D2C C;  5A2Q E;  3ND8 A;  4FXK C;  4HCE A;  1ET9 A;  4RWS C;  2EDG A;  5CBE E;  2A6E D;  3KUP A;  1V1P B;  2B2V C;  2TMP A;  2EY1 A;  4RGM A;  2EYM A;  3P75 A;  4CKE A;  5HUR A;  3HP3 A;  1I4G A;  1GUN A;  3RD4 A;  3PV0 A;  4O42 A;  3LNN A;  4KMU C;  3GTL B;  4HSV A;  2CVR A;  4Y7N B;  1RCV D;  4FYD A;  2OF1 A;  5D3D A;  1QIL A;  1SNM A;  2A69 D;  1XXG A;  3I73 A;  1H9S A;  2NN6 I;  4PQX A;  3CQZ B;  2ZXR A;  2LS0 1;  4DXG A;  1V1P A;  1TY0 A;  2HDM A;  4HMJ A;  4U68 A;  1LTT D;  5BN5 A;  2EYF A;  3S9W A;  3RMH A;  4OO1 H;  2B8G A;  5D65 A;  1KDC A;  3QOL A;  2A73 B;  5I4D A;  3LX0 A;  2A6E C;  2F0M A;  1B9M A;  2BDO A;  2BE5 D;  4KJO A;  3X3M A;  5FOB B;  2XN9 C;  4F7X A;  1IKL A;  1EWH A;  3HEJ A;  3RZO B;  2K1B A;  1SYG A;  1DXM A;  3C1F A;  2AWO A;  2ZT9 C;  3KLS X;  1FNV A;  1BCP F;  5I9O A;  1JWS D;  2E76 C;  5ELF A;  4XDX A;  4ME5 A;  4NDX A;  1IYV A;  3WOE A;  1KAB A;  4TKO B;  5CV4 A;  2A69 C;  2WII B;  3CRL C;  5LL6 S;  3Q24 A;  2K5D A;  2FHT A;  4R8N A;  1RTO A;  4FF3 A;  3HG9 A;  2NTS A;  4LJZ C;  2Z1C A;  3MXP A;  1HTL D;  5D14 A;  1O78 A;  1EEF D;  2R6G A;  5ISR A;  1X32 A;  2E74 C;  2M2L A;  3SEB A;  2IPK D;  3H0G B;  3KLS A;  2FMM A;  4KKU A;  1MSH A;  1ENF A;  4RKB A;  4BBS B;  2MUY A;  1C4Q A;  2BE5 C;  2XRS D;  4N9T A;  3SR1 A;  2BA0 A;  2JXM B;  4FF2 A;  3HS0 C;  2QCP X;  1PTO C;  3P1H A;  1D1I A;  2F3W A;  2K05 A;  1KLU D;  2WP8 J;  2B8F A;  1WD0 A;  4B9X A;  3K7A B;  3VR3 A;  2EPB A;  3J7Y W;  1SND A;  1TKW B;  1DD2 A;  2JEA I;  1TII D;  5M9O A;  3PMF A;  1A3V A;  4C3I G;  2JA8 B;  1GUG A;  1JOK A;  3J81 E;  2E2H B;  2K5W A;  4DAY A;  2K04 A;  3HOZ B;  1I50 B;  1SYD A;  2EZV A;  1EEI D;  5CV7 A;  3IAY A;  4G7H C;  1R4P B;  1VCI A;  2FMC A;  3OWE B;  3BZD B;  1PYW D;  3MXU A;  5G3L F;  5LHY 1;  1DCZ A;  1LO5 D;  5BN4 A;  3A54 A;  1GXD C;  3PUY A;  2E75 C;  1ICW A;  2GA4 B;  1EY7 A;  4CBV A;  5C4H A;  2NUC A;  1W6J A;  4JBW A;  4RCN A;  1BDO A;  1AW7 A;  5K36 H;  1SSO A;  1TWH B;  2N55 A;  5TSS A;  3IFT A;  1Q3L A;  3TP6 A;  1ZYR D;  2HDL A;  4IFD H;  1QB5 D;  2LFN A;  2DY8 A;  4X3U A;  3D6W A;  1I4X A;  2VNU D;  2RVL A;  1EY4 A;  4KKS A;  2MPM A;  4Q0F A;  1RHP A;  4QF4 A;  1SYB A;  4A3F B;  3PUV A;  1BNZ A;  3NTI A;  3A8J E;  2F0G A;  5ELE A;  1SNP A;  3IFD A;  4IFD J;  3GV3 A;  3A7L A;  1AP0 A;  4RGT A;  1OXT A;  4QUF A;  5C5L A;  2RA4 A;  2EYH A;  2R92 B;  2EVB A;  1GUO A;  1AEX A;  1QWY A;  4FVM A;  3GTJ B;  4A3B B;  2RSO A;  4F88 A;  2XIW A;  1C48 A;  2V4D A;  3CU7 A;  1CA6 A;  2EY5 A;  2PZU A;  3FMC A;  1Q12 A;  2WKC A;  2VUM B;  2BCO A;  4PNY A;  4O1N A;  3CHB D;  1BUV T;  3EFX D;  1SE4 A;  4IUQ A;  3I3C A;  4CJ1 B;  3MWY W;  1T5E A;  2B2Y C;  3HRZ C;  2EJF C;  2K5Q A;  2RSN A;  2B2W A;  1T5X D;  1GHK A;  1A6X A;  1SFO B;  2ZXP A;  1F2M A;  2WB1 B;  4DAV A;  2KED A;  1F9Q A;  1L0Y B;  4IQZ A;  2EYJ A;  3DM1 A;  2CW0 D;  2R7Z B;  1DYQ A;  3HOX B;  4I7Z C;  4FP5 D;  3ND9 A;  4OO1 I;  3SDZ A;  1JWM D;  1VDZ A;  2ID0 A;  1R4Q B;  4KK7 A;  3MAQ A;  1K83 B;  2F0T A;  3KBX A;  4CKC A;  1EYC A;  1SNO A;  1FD7 D;  4K2K A;  4KHZ A;  1W6K A;  1PTO H;  1WVL A;  2HCC A;  3CKI B;  1U4R A;  4DK0 A;  4HED A;  4K8J A;  4HSP A;  1WTW A;  4PMB A;  3E0J A;  4KN7 C;  4PMC A;  1WD1 A;  1LT6 D;  3V96 A;  4RFB A;  3D4R A;  4FNF A;  5C4Z A;  3ONA B;  1HQM C;  1LT3 D;  5LL6 X;  3SK5 A;  2EOT A;  1HRJ A;  1BBX C;  2MGS A;  4G7O C;  4KKT A;  1Q1B A;  1KNE A;  5FO8 B;  4XT1 B;  5E1F A;  1NUC A;  3V2T A;  2SNS A;  2SOB A;  4WOR A;  5I6Y A;  3U9S A;  1HCZ A;  1BCP B;  3JAM E;  4HTH A;  5EBC A;  1VF5 C;  3J81 L;  1EQT A;  1TWG B;  2Z4I A;  4RGO S;  1OXX K;  2WAC A;  1B44 D;  1E2W A;  1AZP A;  2C5C A;  2J7Z A;  1SE3 A;  2EE1 A;  1GUW A;  3E6Z X;  4KV6 A;  3K5N A;  1SJH D;  5IGC A;  2IX1 A;  2L11 A;  4CJ0 B;  3I72 A;  5ELB A;  1PZI D;  3T53 B;  1GHJ A;  3MZ5 A;  1SJE D;  2F0J A;  1A3T A;  4V0B A;  1IYU A;  1L0X B;  3R2I A;  1PRT B;  1TS4 A;  2BOS A;  5FO7 B;  5C6A A;  2A6H D;  4RHS A;  4RA8 A;  1F9P A;  3HOU B;  4FXG C;  2ENB A;  4OL7 A;  5IGG A;  1TR5 A;  3IKJ A;  2QEJ C;  3R2T A;  4HN7 A;  3S14 B;  3GTM B;  4XQQ A;  4CJ2 C;  5M5W B;  5T1G A;  1QE6 A;  4UAI A;  2B63 B;  5BN3 A;  2IX3 A;  3NSW A;  2F0E A;  3MXN A;  5EKL A;  1UNS A;  1EY6 A;  1LTG D;  3OWF A;  2DNC A;  2H1E A;  2X6G A;  1F2L A;  5DAU A;  4OO1 G;  1S4Z A;  5D3I B;  1SNC A;  1EQV A;  3S15 B;  3TP7 A;  2F0P A;  2PQE A;  3NP8 A;  1Q90 A;  1STG A;  3PO3 B;  2FIN B;  3EA6 A;  1IW7 D;  2B2V A;  2A6H C;  2F0S A;  5IT9 L;  2F0I A;  4R8I A;  3HZX A;  4FO2 A;  4C2M B;  3DUZ A;  2J0T D;  1TS3 A;  2JA5 B;  4KN4 C;  3SVM A;  3D3R A;  3NQI A;  1I6V C;  3NWT A;  2AUK A;  1TQO A;  2QKI C;  1JIC A;  1SAP A;  3NBH A;  1F9R A;  3A56 A;  2RDH A;  4XYO A;  1AN8 A;  1HA6 A;  3K6O A;  2JYO A;  2RBM A;  2EYP A;  1LTR D;  2YYZ A;  1K8M A;  2EY6 A;  4DGZ A;  5ELD A;  1XTC D;  4LMQ D;  1Z7T A;  3AU7 A;  1GUT A;  3T4A C;  1LAB A;  4MN3 A;  1TY2 A;  1IW7 C;  4H44 C;  2NB0 A;  5IIF A;  1CFM A;  2XWB B;  3OMG A;  4DXF A;  1EL0 A;  1FR3 A;  3P7J A;  5JJZ A;  2NVY B;  5KEE A;  1LT4 D;  1CQV A;  1SYF A;  3BVG A;  1PTO D;  4I65 A;  4A3G B;  2F0Q A;  1EOT A;  3NTH A;  1HFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...