2EYLA

Crystal structure of staphylococcal nuclease mutant t82s
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRSDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2eylA00
3HEJA 1SYEA 1KAAA 1EY8A 1EYDA 4EVOA 1JOKA 2F0DA 1JORA 4K8IA 4I65A 4WORA 5IGGA 5CR3A 4PMCA 5C6AA 1KDCA 4EQPA 1JOQA 4N9TA 5K5PA 4F7XA 3D6CA 5I6WA 2F3WA 1A3TA 1NUCA 2SNSA 4HMIA 4KV6A 2SOBA 3TMEA 4YIJA 2PW5A 1EQVA 4ZUIA 2F0VA 3PMFA 1EYAA 1U9RA 4H7BA 2EYJA 4ZQ3A 3MHBA 4KTAA 5J22A 1JOOA 1KDAA 2RBMA 4KY6A 5IGCA 2EYMA 1EYCA 3QB3A 3SK4A 2EYLA 2PW7A 5C4HA 1EY6A 3BDLA 4NP5A 3SR1A 5CV6A 3D4WA 3RUZA 3EROA 4IUNA 4KD4A 4KY7A 1EY0A 2F0FA 3OMCA 5J1ZA 3SK8A 4EQOA 3VA5A 3TP5A 5I9OA 4KHVA 5E3FA 1TT2A 4ID6A 4DFAA 1A2TA 2F0JA 5JOBA 3MEHA 2EY6A 2OF1A 2F0OA 5JAVA 4K14A 4KD3A 1NSNS 1TR5A 2F0GA 5F2DA 1A3UA 4ME5A 1F2MA 3QOJA 4RKLA 5IGEA 3SK5A 4RKBA 2F0PA 3ERQA 2F0EA 4K2LA 4EQNA 5C3WA 4PMBA 2F0NA 2PQEA 4R8NA 3C1FA 5IIFA 5I9PA 3P1HA 5M9OA 5IGDA 3HZXA 4KJNA 5CGKA 2EY5A 4ODGA 1RKNA 1SNDA 1AEXA 3BDCA 2F0IA 3T13A 2PYKA 4K5VA 4TRDA 2F0SA 1SYFA 1STGA 5CV8A 4IZ8A 3OMGA 2M00A 3MVVA 3MZ5A 5ISRA 5CV5A 1SYGA 3EJIA 1STBA 5J39A 5CV7A 5KYLA 4KY5A 3LX0A 4QB4A 4DGZA 3P75A 5KYIA 2F0TA 1SNMA 4NMZA 4NKLA 3U9OA 1STHA 4KJOA 3T16A 4F8MA 5KIXA 3S9WA 1EY9A 2EYHA 2KHSA 1STAA 3QOLA 4N9PA 4K5WA 1A2UA 4HTHA 3H6MA 4OL7A 5HURA 5IODA 4DU9A 4J1MA 4S3SA 5NUCA 1EY4A 2EXZA 3OWFA 3NQTA 1EZ8A 5IGBA 4QMGA 1SYBA 2EYFA 3EVQA 3NHHA 2PZWA 1EZ6A 2OXPA 3TP6A 2RDFA 4MIUA 5IOCA 5CC4A 1SNOA 5CV4A 5C4ZA 2ENBA 1KDBA 4J6HA 5EKKA 4E6IA 2RKSA 4K5XA 4K2KA 5E1FA 5EGTA 1STYA 2LKVA 4IALA 1ENAA 1EY5A 3TP7A 2EY1A 4NDXA 1IHZA 1ENCA 2F0MA 2EYPA 3NUCA 4DF7A 5DAUA 2QDBA 2EYOA 5DEHA 1A3VA 2EY2A 3ITPA 3MXPA 4PNYA 3C1EA 1KABA 2PZUA 3DMUA 4G57A 5C5LA 1SYCA 3SK6A 1TQOA 4K6DA 4ZUJA 2F0UA 3SHLA 5I6YA 2NUCA 5C5MA 1EY7A 2HQEA 3OSOA 5KEEA 4QF4A 5KGUA 2F0LA 2KQ3A 3NP8A 1II3A 1SYDA 3NXWA 3NK9A 1F2YA 2F0WA 2SNMA 1SNQA 1F2ZA 3D8GA 4K8JA 4WRDA 4B9WA 1STNA 2F0HA 3D4DA 3E5SA 5IGFA 2O4XA 5KRUA 3TP8A 3R3OA 4LAAA 4B9XA 5HGTA 5C3XA 2WACA 1SNCA 2F0KA 2F0QA 2F3VA 2OEOA 2PZTA 3DHQA 5CV9A 3SXHA 1SNPA 5EKLA 4HMJA 3V2TA
chains in the Genus database with same CATH superfamily
2LMCB 1EY8A 4UP7A 4L5QA 5M5XB 3FKIG 1Z7TA 2QDLA 1BCPC 5C6AA 2L55A 4A3EH 1MSHA 3CQZB 3QWNA 3F8TA 2C35B 4NXNL 4AQYQ 1I4XA 1QWYA 3QO2A 5DM73 3I4NH 4LF6Q 4HJ5A 1EYAA 4H7BA 5BN3A 2UUAL 3VR4A 4OIKA 1Y1WB 1O7IA 3J81L 4ZLTF 5FJ8H 2BE5D 4JG2A 3VR6A 3RZOB 3NPPA 2ASBA 1G291 2CWAA 1WTOA 3TP5A 4OWXB 2Z9HA 2EY6A 4RG1A 1Q8KA 1TR5A 4IJLA 3I4OA 4L6TB 2M9VA 2F0PA 3JAML 4PMBA 4R8NA 1YEZA 1DOLA 4X66L 5JPNC 2Z8LA 3HZXA 1S5CD 5EKIA 3BYTB 2HHHL 1PDQA 5M5YH 1KIXA 1VQ6A 3CMAA 1JC7A 4M1UB 3HOXG 1STGA 4LFAQ 5CV8A 3T1YL 4JI3L 4LF4Q 5GADC 1X3PA 1STBA 2O5IC 2OWOA 4QB4A 3HKZG 4QUCA 1HFNA 2N55A 4Y7NB 3S9WA 2CQOA 1PH1A 1BR9A 1L0YB 4YWLA 1Q86C 1PH7A 3J80L 4GKKL 1IL8A 2WP8J 2B2YA 3NQTA 1ET6A 3GTGH 3TEHB 2UXDQ 3BS1A 3GTPB 1R9TB 1F77A 2A8VA 3C46A 2NTTA 1GHJA 3CC2A 4V0BA 3CMEA 2VS1A 3TZDA 1IHZA 3CCQA 4BBSH 2P5ZX 3I3CA 5IP7G 1CK1A 4GOPB 4LFBQ 4IOAA 1I50H 2BDOA 2DUDA 4OO1G 3QJYA 1II3A 4U68A 3AU7A 4B9WA 5C4XG 3E5SA 4JI0Q 5KRUA 3ER0A 2JJQA 2NVQB 2F0KA 1YNJD 4HJAA 4QY7A 2NVXH 3V2TA 4CHTB 3K7UC 2VQEQ 1PZKD 2K5HA 1T9HA 2TSSA 3MA2B 2XN9C 1PTOH 4JI5Q 1PTOC 1WD1A 2X69A 1K8MA 3NTHA 1IYUA 4QIWE 3S16B 1ZYRC 1A3TA 1GD7A 5EAYA 2SOBA 2K6AA 4IFDI 2Z4IA 5ELFA 1U9RA 2D5DA 1RCVD 5H1SE 3VR5A 3M4OB 3GTMB 4HN7A 3ERSX 4K0KQ 3BDLA 1E1OA 5CBAE 3GTKB 1Y1VB 2SDFA 1UE6A 4KKUA 1L0XB 1SDFA 3K7AH 4CDCC 4A75A 2F0FA 4XQNA 1TWFB 4DFAA 3CC4A 5LL6X 3VA7A 4GLAC 3X3MA 4IPGA 4JOIC 1NR4A 5K36H 4QL5A 4DR5L 2JE6I 3CPFA 2ZTCA 2E74C 4KI0A 1BKBA 4NB3A 3KJPA 1L2FA 3Q23A 2UU9Q 2K5QA 4YWKA 1D7QA 2R7DA 4CBVA 3MVVA 2D62A 2MFIA 5J39A 4B3ML 4XDXA 2IWHA 1SNMA 4G4KA 4DUZL 1Q1BA 2JYOA 1YHQA 2XTIA 4IOCA 3H6MA 1F2LA 1TWAB 1MIUA 3IFTA 1D1IA 1EU4A 1EEFD 2XWBB 1ILQA 2RA4A 4GN5A 2RHSB 3HOZH 5C4ZA 1C4QA 3S1RB 1MJEA 3W1GA 4DV4Q 4K2KA 1AE3A 2BA0A 2C5CA 3FRPB 1IBMQ 1N32L 3CRLC 5C3EG 1XPUA 3SK6A 1FNUA 3K59A 4ZUJA 2F0UA 2IHEA 2JA7H 1QG7A 3S2HB 1G6PA 1AZQA 5EKLA 3HOUH 1JQYD 2DJFC 2K03A 3D8GA 3PUVA 2QF7A 5M3MG 4IO9A 3HOVG 1XNRQ 2MHVA 3M3YH 1CQVA 1G2SA 4HJ7A 1ILPA 2Z6BA 3M85A 3B6YA 1BCPB 3G71A 4DR4Q 3JAME 4LFCL 5M5WH 1LTID 1EU3A 4A3EB 3S1NB 4LWCA 3OWEB 1MD2D 5IGGA 1C0AA 4PMCA 2N8NA 1JOQA 3I4NB 2EOTA 1FGUA 1FJGL 1Q90A 4KLKA 3RN5A 1OXVA 4JBWA 3MHBA 5BN5A 1CA6A 2CHBD 2IPKD 2EYLA 1CKNA 3H94A 5LMUQ 5IT9c 3J80E 4ZCKA 3NBHA 1PFSA 4IUVA 3CC7A 4P71A 1VCIA 3FHWA 1HZBA 1WTPA 2R92H 1BO0A 4A3LG 4QIWB 2BH2A 1RD9D 3T1YQ 2F0GA 4ZK9B 4JI3Q 3F2CA 2TMPA 3AQQA 1HNWL 5AJ3L 1SE4A 1HQRD 4OIJA 1PH6A 5M5YB 1GOZA 3E0JA 1WFQA 4I7ZC 4A3MG 1M8AA 2UXCQ 1KLUD 1VQAA 4MNOA 4TRDA 1B9NA 2F0SA 2OT2A 1L1OA 4C3HG 4ZAIA 2MJ8A 2VUMG 4NMZA 4KJOA 3KBGA 4KKTA 4B3SQ 2WFWA 3WDNA 1ASZA 1B9MA 5IODA 3GTGB 1VQOA 3G4SA 2A69C 2DNEA 3I4LA 4X3SA 1EZ8A 1Z9FA 1YJWA 1SYBA 1JCKB 3TP6A 1VMPA 1PH3A 1HTPA 4JBMA 2KHIA 3C3LA 4K5XA 5EGTA 1HR0W 4OX9L 4BBSB 3GO5A 4A3DH 3TP7A 4DK0A 4NDXA 1LYLA 2L15A 5C0XI 1Q12A 1SE2A 1HNZQ 2BH8A 1I50B 3MXPA 1YHBA 2A6HD 4JI2Q 2VXWA 2NUCA 1D5XC 1EWCA 2MNAA 1JT8A 4RCNA 1NY4A 1A62A 1VQEA 2EVBA 2IX3A 5DM63 4DAYA 2JA6B 1DYQA 2NVXB 1QOHA 4BY7H 1QILA 4JYAQ 3PO2G 4A93H 1WTQA 1PTOB 4PZ7A 4GZYC 2RSNA 2UUCL 3H0GG 1O7ZA 2JA8H 1X3QA 3WOEA 1IYVA 1Q7YC 1A0IA 1J5EQ 1C48A 4GLXA 3TMEA 3EQLC 5IT9L 2JA9A 3PMFA 2O5JC 1UAPA 4LF9L 4ZKBB 1NBWA 2AHOB 4BA2I 1TXYA 3E3XA 1XJVA 3K7AB 4B3RQ 4A3KH 5LL6S 4LW1A 2FHTA 1DOMA 1CKOA 2WV6D 2JQOA 4EQOA 4IFDH 5E3FA 2WKCA 1YHAA 2RDGA 2L4NA 3OOCA 3GQBA 4DV0Q 3HKSA 1NSNS 3HP3A 1ESRA 3OHXC 4R4OA 2F0NA 2PQEA 1CI3M 2E75C 3QG1A 2Q8IB 2UXBQ 3O13A 2ICEC 1IW7C 4FDBA 2AWNA 3KUPA 2QEJC 4POFA 1C7YA 3MZ5A 4A3JH 5BR8Q 1Y1WG 4AQYL 4DGZA 2KCNA 3U9OA 4LF6L 1J8IA 1X56A 1N32Q 2FINB 4H44C 4LJZC 2EXZA 2A68D 3CP0A 3HOZB 2FXQA 4JI8Q 2OXPA 1GKHA 2ZTEA 3FDTA 2LFNA 1H9KA 2ZXOA 1K9MC 3WOFA 4AYBE 2EY1A 4DNTB 1BNZA 4X62Q 3ITPA 2JA7B 3KYHC 2IT1A 2VQFQ 3HOUB 3BVZA 1RL2A 5G3LF 4C2MH 4A3FH 4LFCQ 1VQ4A 5IP9H 3NXWA 2F0WA 5M3MB 1N33Q 1SNQA 4LFAL 1MHWC 4LF4L 3M3YB 1QVFA 1QE6A 2L9HA 4DK1A 2AQ3B 4PZ8A 4HJ9A 1SNCA 2GVAA 2OEOA 4CKCA 3KF6B 1PMRA 2HIXA 1KQSA 1SYEA 1KAAA 4BXXH 1F9RA 4HJ8A 2HQLA 2K52A 3IRBA 2XVSA 4JI1L 3SVMA 3AFQA 1LTTD 2UXDL 2DY8A 4L8JA 4KN7C 4N9TA 1XPOA 2F3WA 1KRTA 1Q82C 2R7FA 2F4VQ 4TKOB 4KTAA 1RDPD 3DWAA 4HEDA 5JJIA 5HGQA 5EBDA 3DLLA 5AJ3Q 2ZJQA 4DUYQ 2V4DA 4LFBL 2VL6A 3S15H 3RZDB 1X65A 2R92B 3D4WA 4ALPA 3SK8A 4JW0A 3HOYH 4OONA 3KF8B 2E2HB 1HHVA 1CHQD 5A2QL 3K0YA 1V1PA 2IHFA 4JI0L 1GXDC 3F2UA 4A3MB 1VF7A 4KJNA 5IYDG 5C44H 3CCRA 4KMUC 1RKNA 1DGSA 4JI5L 3W5OA 2PI2E 2B63G 2K5VA 4IZ8A 2CW0D 3A5ZB 1BF4A 1PH4A 2F0TA 3KOJA 4LMQD 5KIXA 1Y1VG 1EY9A 2KHSA 1Y8OB 1HR0Q 4O1NA 4V190 4A3CG 1EY4A 1K3BC 4QMGA 1YITA 1FYCA 3TN2A 4K0KL 4KKSA 1TY0A 4X3KA 1FD7D 2B29A 4J6HA 1NCVA 1XMQQ 4XTCS 2KCMA 4DR6Q 1SROA 4P73A 1QVGA 1JJGA 5FKAC 4JI4Q 4DN4M 2F0MA 3PO3H 2ES2A 5IT9E 1HXYD 1RHPA 1A3VA 1S4ZA 3H15A 3IFDA 3PQIA 3SHLA 1B4OA 3DXJC 2QGQA 4HCSA 1GUSA 5KGUA 1OTCA 2UU9L 1PHJA 3K8AA 1QZGA 4K8JA 1F2YA 2SNMA 1CQFA 2YTYA 3GP7A 3ZYYX 5EQ0A 4O2DA 1N8RC 1NE3A 4BY7B 2GVBA 2K05A 3P7JA 1PRTC 4A93B 5C0XH 5C4JH 4DV7Q 1QVCA 4AYBB 3J7AF 4A3BH 3DHQA 3G6EA 1SNPA 3KBXA 5FLMH 3PIPA 2JA8B 5COYA 1JOKA 1EIGA 2PPBC 2HCIA 2O2LD 4C3JH 1GUTA 4L5SA 3OPOA 2LXKA 1WOCA 3W2DA 4DV4L 1VQHA 4ZUIA 2YTXA 4DK6C 1IBML 4CDFC 2KEDA 3HRZC 3SK4A 4WJ4A 2ZT9C 3RLFA 1TS2A 4UP9A 1PH8A 1E24A 4RHSA 2JN4A 1EY0A 2ZJPA 1LM0A 1SMYC 1X55A 3TZUA 4A3EG 5D14A 4DXFA 1XPRA 2R7ZH 1KXLA 1B2TA 1XNRL 2KCTA 3STBD 4K2LA 2NN6I 1JJCB 3I4NG 4FF2A 4DR4L 2F0IA 1QNUA 4BWGB 2R93H 2Z6KC 3UDIA 5ISRA 5FJ8G 2K01A 1PH5A 3T53B 2AWOA 3GTLH 1V1QA 4R4IA 2D9UA 5KNCA 2F1MA 5DNFA 4HTHA 1OO9B 5D3DA 4UHVA 4S3SA 2G5DA 3NSWA 4C1NK 5LMUL 3NTIA 1STEA 2IY5B 4GNXC 2CH4A 2K33A 2ALYB 4EX5A 1LT3D 2RCFA 1ENAA 3NWSA 1BOSA 1EQQA 2WB1E 3NUCA 1SBBB 2K04A 1NAPA 3PF5A 4DA2A 2D2CC 3DM3A 1WCMH 4C2MB 2LY7A 5I6YA 3J7AV 3HG9A 2QKIC 4DV5Q 2H5XA 2UXCL 2EXDA 4MTKA 1U4RA 3K5NA 4JI1Q 5E7NA 3U4ZA 2YYZA 5IGFA 4LF7L 3MEFA 4FNFA 4B3SL 1PFNA 5A2QE 1LTRD 5FO7B 2NZHA 4IPDA 2CCZA 2F0DA 4LUVA 4BBSG 4U673 4K8IA 3I72A 1SE3A 5EPJA 3CXCA 2PQAA 4JBJA 1WTVA 3D6CA 1QZHA 1O80A 2R61A 1Y69U 4IPHA 5JJLA 2ICIA 1HNZL 3NELA 3QB3A 5CORA 4L5RC 4JI2L 2JA6G 3SR1A 3HOYB 1WTRA 1IKMA 4KY7A 3VA5A 1VMCA 1KTKA 1S72A 1TWGH 4CJ2C 3QOJA 1CTMA 5C44B 4JYAL 3CKIB 1IZ6A 4K6LA 2E5LQ 3M4QA 2K75A 2I5LX 5IYBH 2B63B 1VQBA 5D65A 3KFUA 4HIDA 3H3VI 2J7ZA 1J5EL 1CKNB 1SXTA 5CV7A 1E1TA 1J6QA 2B2WC 3P75A 4OEMB 1LTSD 1TWHB 1PYSB 4Q5VA 4HIKA 1STHA 1MSGA 2MUYA 4DR1Q 3NBHB 1AN8A 3QOLA 4OL7A 2Q2TA 2CVRA 1YIJA 4CJ0B 2I46A 3E9IA 1LV9A 3ICEA 3R93A 3CCMA 5K36G 1TS4A 5T1GA 4B3RL 2B2VC 3BYYB 1Q8IA 4DKAC 3MXUA 1E22A 2HDLA 1RF2D 4FO2A 4RAUC 4FXKC 3CF5A 2QW7A 4H0LC 3PO3B 1C9OA 1X6OA 2AQ2B 4DV0L 1CSPA 5ELDA 5DAUA 1U4PA 2QDBA 1L1OB 4UAIA 1V8QA 1WD0A 4PQXA 2EJGC 4YY3L 5C5LA 2UXBL 1B3AA 4BBRH 3Q22A 1TQOA 5IYCH 2KA7A 1HRJA 5T1IA 4XT1B 3VYSA 1K28A 3R8BA 2F0LA 1PRTB 1SSOA 1X3EA 3NK9A 1JR0D 2IJ0A 2NYZD 4FYDA 3S1QH 2B39A 5C4JB 2CFMA 3V96A 4A3BB 2PNRC 5BR8L 3HOZG 3AB9A 3ULLA 1Z47A 4I7AA 4LAAA 3BJUA 2ZM6Q 1YZ6A 1TU2B 2LXJA 2JK8A 1B1ZA 2WB1B 1HQMC 4WJ3M 1VQJA 3CCSA 1H95A 3RN2A 2EDGA 3KLWA 2RSOA 4C3JB 3F1ZA 2KJXA 1VQ9A 3W3AA 3Q8DA 5CR3A 4JI8L 1GHKA 3R2IA 2JA7G 1XNQL 1NUCA 1I4GA 3OYYA 2X6LA 2JA5H 3HOUG 2B2TC 2EYJA 1G8ZD 3N52A 3MAQA 1Y8PB 1KDAA 1TIID 2EYMA 4X62L 2A74C 2NVTH 1BCPD 1V1OA 5I4DA 2VQFL 1QB5D 4GOPA 2KHJA 3OMCA 1SJHD 2R7ZB 1EUJA 3AYHB 1HTLD 1N33L 5JOBA 4F88A 2FJ2A 5F2DA 1W2BA 3S2DH 1WTWA 4RFBA 5IGEA 1JE5A 3FPUB 1EEID 2XWJB 4OXPA 2JEAI 3P1HA 2WINB 4A4IA 2IL8A 1VQFA 3MTSA 3AMUA 5CGKA 4IFDJ 1KRSA 2R93B 1OXSC 2C9OA 4PZ6A 3BDCA 1R4PB 3QIAA 2A6EC 2A1AA 3GTLB 1SYGA 1X32A 1XTDA 1PXUA 5KYLA 4OGQC 3M7GA 2KECA 2EQSA 2NN6H 2F4VL 2R92G 3T51B 4NXMQ 1DONA 5JEAH 1LO5D 3BZKA 5JPMC 3GTJH 1Q1EA 3BU2A 3OWFA 2UUBQ 1PYBA 4GNXB 1HFGA 5L37A 3Q6SA 4DUYL 3EIVA 2DJGC 1LTLA 2XRQD 4IALA 1EY5A 1PLFA 1N36Q 1WCMB 1U4MA 4ILWA 2YTVA 1K83H 4O0AA 4IN3A 4LF7Q 4IUPA 5TSSA 2I5HA 4KN4C 4C3IH 1SR3A 3A8JE 4AIMA 1B70B 1EYGA 1YNNC 5G3LD 4RH6A 1P16A 3GDEA 3SE0A 1GUNA 1ML0D 5GAGC 1OXTA 1LTGD 3GV6A 1VS0A 4B9XA 1HZ9A 1YI2A 2HT1A 3DEPA 4A3DG 1HR0L 2N3SA 2IW3A 5E4XA 4JBKA 4R1JA 1G6ZA 2L5TA 4NPSA 4I65A 1PRTF 2E2JH 1JMCA 3FMCA 2WIIB 4LUOA 3RLNA 4MTNA 4YIJA 1XMQL 1I4QA 1KC8C 1M1KC 3DWQA 4DR6L 4FVMA 2Q2UA 2BOSA 4JI4L 2A19A 3IL8A 4KHPQ 4Q0FA 3U58A 2PW7A 1PTOD 4BY7G 2B2YC 4A93G 1JJ2A 2BA1A 1ZYRD 4HCEA 4AYBG 2XGTA 2JA8G 1TT2A 1HH2P 1JWUD 3F2DA 2JEBI 4YHHQ 3ULPA 5ELOA 4DK3C 1QNKA 2AUKA 2NWGA 4DV7L 1I6HH 5IIFA 5I9PA 1VQKA 4JV5Q 4JPBW 1KD1C 2KVMA 3S24A 3G7LA 1BCPF 1SFOH 3U4VA 3S17H 2YU9H 2RVLA 3VYUA 1SYFA 3MXGA 3M7NA 4A3KG 3LX0A 2VNUD 4IFDG 1VQ8A 2NZOA 3A54A 3GD7A 4QJFA 1FL0A 4LF8Q 1CUKA 2G9DA 3N6RA 5GAEC 3H3VH 4CDEC 2I5MX 4YY3Q 3RLOA 2RDFA 3MXNB 1JB7A 2WAQE 4N8FA 2K50A 5CC4A 1W3SA 5J3BA 1ZXTA 5E1FA 2DNCA 5IY0A 3I2ZA 3DEOA 1YJ9A 3WWVA 4A3JG 1JWMD 1EIYB 4XXEA 4WFN3 3DMUA 3LWUA 2HQEA 3S1QB 4QF4A 3K81C 3NP8A 1EFID 3OTOQ 1SYDA 1MGSA 1F2ZA 5E4WC 2E2DC 1T5XD 2MGSA 1E2VA 1E3PA 3RR5A 1EWIA 4DAMA 3D3RA 1XNQQ 1S5BD 1NJIC 1AZPA 1FNVA 4RGTA 1JWSD 5EPLA 1AP0A 5FLXc 4EVOA 1Y1WH 2SEBD 1RTNA 2BCOA 2Q2IA 1S5ED 3PF4A 3FEWX 4HIMA 3TS2A 3KLSX 5GQOA 2XIWA 1KDCA 5C0XJ 2BE5C 3A7LA 1W6KA 5I6WA 1UEAB 4A3FG 3RMHA 5IP9G 3DWPA 2F0VA 5ELBA 3PUXA 2MO0A 1Q3LA 3K57A 1QUQB 3HFZB 4KY6A 5J22A 2NVTB 2CWPA 5IGCA 4LNQA 4LF5Q 2JXMB 1JB3A 1BDOA 5M5WB 2A5HA 3R2TA 2H4OA 4BXXG 5J1ZA 4IURA 4DV5L 3UE1A 1H9SB 1CSQA 2Z1CA 4X64Q 1A2TA 3CCLA 1KAWA 1HCZA 4CKEA 1BVSA 3BG3A 1D2BA 1DM0B 1WTHA 4IUTA 4ME5A 2VW9A 4EQNA 5C3WA 4DV2L 1H9JA 1DZ1A 4H02A 3G48A 4OO1I 4UY8C 3KDFB 4B3TQ 1H9MA 1PTOF 2B8FA 1IBKL 4POGA 2PYKA 2HIVA 3NEMA 1OXUA 2J4XA 3MFYA 2XRSD 5ELNA 2Q8TA 4NKLA 2G9HD 3HOYG 1DCZA 1I5FA 4DV3Q 1A2UA 4RCOA 1SAPA 2KENA 5CBEE 1Q81C 5NUCA 1NR2A 1BUVT 1X3FA 1EIHA 5IGBA 2D0PA 1FGBD 4IUUA 2PZWA 5C44G 2M2LA 3EBEA 4A3GH 4F87A 4ULLA 1T5EA 3ND8A 3DM1A 4JOIA 2NVQH 4OELB 1K83B 4UP8A 2CQAA 2A69D 2NB0A 1KNAA 1DJRD 1YNJC 4C3IB 5LMNQ 1AFPA 1SYCA 1HNXQ 2HD3A 2E5LL 1EY7A 4DAPA 3QR8A 3J81i 5FLXL 1U4LA 2WAQB 1O78A 1LABA 3TSSA 1IL2A 2O4XA 4A3IH 4NW2A 5HGTA 4A3DB 1UNSA 5C3XA 3UI2A 2VY3A 4DR1L 1D5MC 3M4OH 3EA6A 2K1BA 1VQ5A 3PO3G 3SDZA 2E2JB 3PGZA 1JORA 2NVYH 3T56B 4DV6Q 3OIPA 3J81c 1X9NA 1VQLA 3UDXA 3OW7A 1QCBD 1L1OC 2V1CC 4JC0A 3I4MH 3UE0A 1G91A 1I94Q 5JVH3 1EQVA 2H1EA 3A56A 3HOWH 2L0CA 4YCVA 1E2ZA 3FP9A 5M3FH 5C0XG 3MC0B 4KHZA 1DXMA 4DNRB 4A3BG 3HS0C 1M90C 2AKWB 3BVGA 3BZDB 4N8X1 1HA6A 3NENA 5FLMG 1IBLQ 3EROA 4IUNA 4Z9CB 2WB1G 1QJOA 2Y0SE 3MEHA 3PIO3 5JAVA 2F0OA 3NWTA 3ULJA 4C3JG 4TQUS 1XWEA 5FO8B 1I6HB 3H91A 2PQAB 2FMCA 3SK5A 2F0EA 2ZM6L 4J15A 2RF4A 4P72A 4YCWA 2K5DA 5IGDA 5JJZA 3J7ZC 1PV4A 2YU9B 3S17B 3KF6A 4GN3B 2OQKA 1NNXA 2NZ1D 2JSOA 4CGYB 4A3KB 1TY2A 4BY1H 5GROA 4C56C 3OMGA 2M00A 4DR3Q 5CV5A 3CD6A 1CKMA 2FFKB 3EJIA 5I2XA 5JJKA 3JC66 1ZKOA 1PZJD 4XIGS 1ICWA 1X3GA 4L5TA 4HSPA 2R7ZG 1VF5C 1IW7D 1KNEA 4R4TA 3U9SA 2EYFA 2PNHA 2OQ0A 5KNDA 3CCVA 1A6XA 4A3JB 1B3QA 1PFBA 2R93G 4ABNA 4JVZA 1ENCA 3KF8A 1W6JA 1HA5A 3FKIH 2EYOA 2ZTDA 5DEHA 3S1NH 4PNYA 2LSSA 1CA5A 3D0FA 3TDQA 4JI7Q 3SEBA 1Z6HA 4P74A 4CDDC 5GAHC 2RQXA 1VQGA 2KCCA 4BA1I 5KNBA 3CHBD 3D6WA 3CCEA 1WI5A 1D5ZC 3SXHA 4MHEA 4NXML 1NMGA 1I4PA 2DGYA 3BDOA 4IPCA 2UUBL 4RGNA 4OWWB 2HUGA 1TWCH 1WCMG 1MI2A 4A3FB 1NTGA 3K5LA 4LK1C 2FMMA 1EQTA 1K0RA 1N34Q 4AH6A 4GN4B 1N36L 1XMOQ 1U0LA 1SN8A 1EYCA 3RNUA 4X6AH 1CHPD 1EY6A 3HOXH 4DV2Q 4DR2Q 4H13C 5EPKA 1B44D 2EJFC 4KD4A 3FVQA 3D4RA 1S5DD 1P8LA 1IBKQ 2K5NA 1UE1A 1RTOA 1TS5A 1A3UA 5ELEA 1SJED 3ERQA 4DPGA 1WJJA 5AFWA 1IYJB 1CM9A 1SRUA 1Q46A 4GLVB 3T13A 3S15B 3Q24A 3NQIA 4PV1C 1D6EC 4JCVE 4ZKCB 4LUZA 5FLXE 4DV1Q 4G7OC 3CCJA 2Y0SB 5IP7H 1FNWA 1FR3A 3I55A 1B53A 1VQIA 1IXRA 4OO1H 2OTJA 1MBYA 3ONAB 4KHPL 3I70A 2E2IH 2YV5A 4A3GB 4QUFA 2A6HC 5IWAQ 2QCPX 5C4XH 4JI6Q 4MZ9A 5CV4A 3URYA 4M8AA 1G51A 5IYBG 4IJHA 5JEAJ 2JA6H 2LKVA 1A63A 3M9BA 4YHHL 3K0XA 1F9SA 5LHY1 1ICFB 3I56A 3A55A 1RJTA 2F4IA 4QQBX 3TQYA 4FXDA 2N78A 4JV5L 3T1HQ 2MP1A 1PVOA 1D1KA 5I2YA 3F2BA 1PZID 1IKLA 2L12A 1LTBD 4MN3A 3VYRA 1VQ7A 4A3IB 4DR7Q 1STNA 2F0HA 2N88A 1I4HA 3AFPA 1GVPA 2GN5A 2NTSA 3R3OA 3RD4A 5FOBB 1ZEQX 3CRKC 2R3ZA 2NVYB 3HKZE 3E6ZX 1S3OA 2F03A 1LT4D 3BZCA 4LF8L 2KBNA 3I8ZA 1GM5A 3I4MB 1LT5D 3TBIB 4BBRG 1YJNA 5IYCG 2JP1A 4CJ1B 1PRTD 1B7YB 2K4KA 4HMIA 3HOWB 3HGBA 1XYIA 5M3FB 1LTAD 1ESFA 2PI2A 1G2TA 4XT3B 1TVXA 1YVCA 1EIFA 3FPPA 1A8VA 4C1NI 1HZCA 3MWYW 4HIOA 1LLRD 2PO4A 4X65Q 5I9OA 3OTOL 2F0JA 3MFGA 1KHIA 2B2UA 2CH4W 2JA5G 5M9OA 4GKJL 1EQRA 2EY5A 4BY1B 1SLJA 2A68C 1SMYD 4FP5D 1VQNA 4DAYB 3KLRA 2PMZE 5EBCA 1X54A 3E0EA 4O42A 4F8MA 3PV0A 5C3EH 3CCUA 2EPBA 4APVA 4UDUC 5ELCA 3J81E 4LF5L 2K32A 4KK7A 4QCLA 4Y52H 3NHHA 1EZ6A 3PUYA 4RWSC 5M3MH 1UUPA 3HOVH 4NXNQ 1WTXA 4RA8A 1TKWB 1KDBA 2ENBA 1JICA 3X3NA 3UDGA 3H09A 4ZRZA 4X64L 3FKIB 2L1BA 2UUAQ 3P20A 1AH9A 1EL0A 2EY2A 2NN6G 3C1EA 1KABA 1LUZA 3L0OA 1JE4A 1D8LA 5JEAG 4B3TL 1O7LA 1B8AA 1GUWA 3LWEA 1UE5A 2AUJD 3D4DA 2ZXPA 5FO9B 5CV9A 4X66Q 4DV3L 2IX1A 4HMJA 3EN2A 4TVAB 1TWCB 2HHHQ 2AMCB 1VQCA 3RZDH 5FK9C 2KOLA 4WORA 4P2CB 4A3LH 3TREA 3G6JB 4C3IG 4EQ5A 2SNSA 5JVG3 2E2HH 1I6VC 1WYDA 5DLQE 2Z0SA 3L2PA 4ZQ3A 1E7ZA 3CAMA 4A3MH 2MO1A 3HOXB 1F9QA 4GKKQ 1F9PA 4RHRA 3K80C 5LMNW 2WAQG 4JK1C 4P75A 4R4QA 5C4HA 5LMNL 1HJPA 1I4RA 3HKZB 4C3HH 3K5MA 2J0TD 2I07B 4PMWA 3IKJA 3W1BA 3RUZA 1HNXL 3K6OA 2VUMH 1VDZA 2DN8A 1PFMA 3L9AX 2CW0C 4K14A 4KD3A 3OW2A 4R4CA 2R6GA 1VQPA 3S1MH 2WKDA 1R4QB 3C1FA 2AQ1B 1GO3E 2IX0A 2BDNA 2EJMA 4ODGA 2QEXA 2EZVA 1SNDA 2RCNA 1XTCD 3PUWA 1K8GA 2PCFB 1E2WA 4DV6L 1ENFA 4ME3A 1BXTA 1J9OA 2D0OA 1VQMA 1TWGB 1AW7A 2KUMA 3T16A 1I94L 1A15A 4N9PA 2E2IB 5HURA 4DU9A 1DD2A 5C4XB 1KLGD 2OCEA 1GUGA 1DOKA 5IOCA 1IBLL 1AE2A 1LT6D 4DAVA 4FF1A 3KK7A 1HZAA 1STYA 3PO2H 3C2PA 1KL9A 2PMZB 2B3GA 3H0GH 4DNIA 3BVMA 4L63B 2PZUA 1EFWA 3GTOH 3NBIA 5D3IB 3OSOA 1VQDA 2ID0A 5KEEA 1K8OA 2Z6KA 3GTQH 4XYOA 2Q2HA 1I3QH 3S14H 1V1PB 2KEEA 1EWHA 4DR3L 3H3VC 1MJCA 1C8CA 3ND9A 4IUQA 4DXGA 3J7A5 2F3VA 1L0WA 4DR5Q 3TRZA 2E76C 2NBFA 3OIQA 4A76A 3M4YA 4BBRB 3I91A 2EIFA 1YBYA 2HDMA 4EQPA 4GNXA 5M5XH 1NMFA 3T4AC 4BS9A 1CT1D 4F7XA 5K5PA 1RIPA 1V43A 1SMXA 2Q8RE 3I90A 1K8AC 4B3MQ 3GV3A 3L7ZC 2I0QA 4KV6A 3CQZH 4DUZQ 1CZGA 1K73C 1M4VA 4YCUA 2X6GA 3STBC 3J7YW 4FXGC 3LGJA 5CV6A 4GKJQ 2MQHA 1E0BA 1LACA 2LS01 3AEVA 4JI7L 1FVIA 4KHVA 4J8QA 1Y8NB 4ID6A 3RZOH 3J81j 3CPWA 2OF1A 3D31A 1PYWD 4OWTB 4CKBA 4GS3A 2JA5B 4RKLA 3K58A 4RKBA 1CZWA 3TS0A 1PH2A 4TSSA 1UEBA 2E8GA 2XSCA 2VB2X 2K5WA 2GA4B 2OTLA 1GJXA 4K5VA 2F3IA 2ATWA 4XQQA 5C3EB 5KYIA 1BBUA 4RGMA 2EYHA 2A73B 1N34L 1STAA 3S2DB 2N49A 4K5WA 4Y7NH 1XMOL 1XX8A 4J1MA 3A5UA 3A0JA 3HOVB 4DR2L 2A6ED 3LNNA 1SNOA 1OXXK 5A35A 2B2UC 1WVLA 1FJGQ 2RKSA 4UPAA 5BN4A 1BBWA 3GTPH 2EE1A 1BQQT 1R9TH 4FF3A 4IQZA 4G7ZC 4DF7A 3ZJYC 1ET9A 2CKZB 2L11A 3CW2C 2VB3X 1B50A 4G57A 1YNXA 3GTJB 1BBXC 3U50C 1GUOA 2Y0SG 5C5MA 1HUMA 5EJWA 1S40A 2KQ3A 1K3RA 4GOPC 3I73A 2Z4HA 3EFXD 3I7FA 2B2WA 3A74A 4ZYSA 1TS3A 4A3GG 4FF4A 1K0SA 4WJWA 4DV1L 3TP8A 1UE7A 3KJOA 1HNWQ 4RGOS 2F0QA 2PZTA 4B08A 3HEJA 3IAYA 1EYDA 2K7VA 1UWVA 1YNND 2B2VA 3CU7A 4R9WA 4R8IA 5IWAL 4JI6L 4EGVA 2ZJRA 3MXNA 3Q0AA 2PW5A 3A8KE 4HR7B 2QILA 4G7HC 3S16H 5CMDA 2VQEL 5IYDH 1HUNA 1JOOA 2RBMA 2QA4A 4OHJA 4C3HB 4A3IG 3VR3A 2HCCA 1EOVA 2B63H 2VUMB 4NP5A 3GTMH 4X3UA 3T1HL 3VYTA 1RODA 3JAMi 1PH9A 3GTKH 1Y1VH 4XYQA 4OX9Q 4PG3A 1TWHH 3PUZA 4DR7L 3S1MB 3M4PA 3VDYA 1H9RA 1TWFH 1V9PA 1F2MA 4A3CH 3I4MG 1CFMA 3A8IE 3HOWG 3DUZA 5M3FG 1AEXA 2RHQB 1PA6A 3JAMc 3NE5B 2F52A 3PIP3 1SEBD 2ZXRA 3J80i 4KY5A 2XNAC 2B2TA 2B8GA 3VR2A 2RDHA 3SGIA 4HSVA 2UUCQ 1QUQA 2K28A 1HPCA 4XQJA 3V05A 1ONLA 1TWAH 3EVQA 1EOTA 4HAEA 1XXGA 1Y14B 1SFOB 4MIUA 1ASYA 3PO2B 4X3TA 1S5FD 4X65L 5EKKA 4E6IA 3J80c 3K5OA 3H0GB 1H9SA 4BY1G 3S1RH 1N9WA 1SE8A 2EYPA 4LF9Q 5CYUA 4RMFA 1MKHA 3GTOB 3L3OC 4QGUA 3PIOA 3GTQB 5HY6A 3UDFA 4K6DA 3NTKA 2DY7A 1I3QB 3S14B 3PSIA 3KLSA 3KDFA 4WRDA 3PCOB 2K14A 3S2HH 3A7AB 2VZAA 4YWMA 1U5KA 2MPMA 5IE8A 2WACA 3E9HA 1O7YA
chains in the Genus database with same CATH topology
2LMCB 1EY8A 5M5XB 1Z7TA 1BCPC 5C6AA 2L55A 1MSHA 3CQZB 3QWNA 1I4XA 1QWYA 3QO2A 5DM73 1EYAA 4H7BA 5BN3A 3VR4A 4OIKA 1Y1WB 3J81L 4ZLTF 2BE5D 3VR6A 3RZOB 3NPPA 1G291 1WTOA 3TP5A 2EY6A 1TR5A 4L6TB 2M9VA 2F0PA 3JAML 4PMBA 4R8NA 5JPNC 1DOLA 2Z8LA 3HZXA 1S5CD 5EKIA 3BYTB 1PDQA 1JC7A 4M1UB 1STGA 5CV8A 1X3PA 1STBA 2O5IC 4QB4A 4QUCA 1HFNA 2N55A 4Y7NB 3S9WA 1BR9A 1L0YB 3J80L 1IL8A 2WP8J 2B2YA 3NQTA 1ET6A 3BS1A 3GTPB 1R9TB 1F77A 3C46A 2NTTA 1GHJA 4V0BA 3TZDA 1IHZA 3I3CA 1CK1A 2BDOA 4OO1G 3QJYA 1II3A 4U68A 3AU7A 4B9WA 3E5SA 5KRUA 2NVQB 2F0KA 1YNJD 3V2TA 4CHTB 1PZKD 3MA2B 2TSSA 2XN9C 1PTOH 1PTOC 1WD1A 2X69A 1K8MA 3NTHA 1IYUA 3S16B 1ZYRC 1A3TA 2SOBA 2K6AA 4IFDI 2Z4IA 5ELFA 1U9RA 2D5DA 1RCVD 3VR5A 3M4OB 3GTMB 4HN7A 3BDLA 5CBAE 3GTKB 1Y1VB 2SDFA 4KKUA 1L0XB 1SDFA 2F0FA 4XQNA 1TWFB 4DFAA 5LL6X 3VA7A 3X3MA 1NR4A 5K36H 2JE6I 2E74C 4KI0A 3Q23A 2K5QA 4CBVA 3MVVA 2D62A 5J39A 4XDXA 2IWHA 1SNMA 4G4KA 1Q1BA 2JYOA 3H6MA 1F2LA 1TWAB 3IFTA 1D1IA 1EU4A 1EEFD 2XWBB 1ILQA 2RA4A 5C4ZA 1C4QA 3S1RB 4K2KA 2BA0A 2C5CA 3FRPB 3CRLC 3SK6A 1FNUA 3K59A 4ZUJA 2F0UA 1QG7A 3S2HB 1AZQA 5EKLA 1JQYD 2K03A 3D8GA 3PUVA 2QF7A 2MHVA 1CQVA 1G2SA 1ILPA 3M85A 1BCPB 3JAME 3S1NB 1LTID 1EU3A 4A3EB 3OWEB 1MD2D 5IGGA 4PMCA 1JOQA 3I4NB 2EOTA 1Q90A 1OXVA 4JBWA 3MHBA 5BN5A 1CA6A 2CHBD 2IPKD 2EYLA 3H94A 3J80E 3NBHA 4IUVA 1VCIA 1WTPA 1BO0A 4QIWB 1RD9D 2F0GA 4ZK9B 2TMPA 1SE4A 1HQRD 4OIJA 5M5YB 1GOZA 3E0JA 4I7ZC 1M8AA 1KLUD 4TRDA 1B9NA 2F0SA 2OT2A 4C3HG 4ZAIA 2MJ8A 4NMZA 4KJOA 3KBGA 4KKTA 3WDNA 1B9MA 5IODA 3GTGB 2A69C 2DNEA 3I4LA 4X3SA 1EZ8A 1SYBA 1JCKB 3TP6A 1VMPA 1HTPA 3C3LA 4K5XA 5EGTA 4BBSB 3GO5A 3TP7A 4DK0A 4NDXA 5C0XI 1Q12A 1SE2A 1I50B 3MXPA 2A6HD 2VXWA 2NUCA 1D5XC 1EWCA 4RCNA 2EVBA 2IX3A 5DM63 4DAYA 2JA6B 1DYQA 2NVXB 1QOHA 1QILA 1WTQA 1PTOB 4GZYC 2RSNA 1O7ZA 1X3QA 3WOEA 1IYVA 1C48A 3TMEA 3EQLC 5IT9L 3PMFA 2O5JC 1UAPA 4ZKBB 4BA2I 3K7AB 5LL6S 2FHTA 1DOMA 2WV6D 4EQOA 4IFDH 5E3FA 2WKCA 2RDGA 2L4NA 3OOCA 3GQBA 1NSNS 3HP3A 1ESRA 3OHXC 2F0NA 2PQEA 2Q8IB 1CI3M 2E75C 3QG1A 3O13A 2ICEC 1IW7C 2AWNA 3KUPA 2QEJC 3MZ5A 4DGZA 2KCNA 3U9OA 1J8IA 2FINB 4H44C 4LJZC 2EXZA 2A68D 3HOZB 2OXPA 3FDTA 2LFNA 1H9KA 2ZXOA 3WOFA 2EY1A 4DNTB 1BNZA 3ITPA 2JA7B 2IT1A 3HOUB 3BVZA 5G3LF 3NXWA 2F0WA 5M3MB 1SNQA 3M3YB 1QE6A 2L9HA 4DK1A 2AQ3B 1SNCA 2OEOA 4CKCA 1PMRA 1SYEA 1KAAA 1F9RA 2XVSA 3SVMA 1LTTD 2DY8A 4L8JA 4KN7C 4N9TA 2F3WA 4TKOB 4KTAA 1RDPD 3DWAA 4HEDA 5EBDA 2V4DA 3RZDB 2R92B 3D4WA 3SK8A 2E2HB 1HHVA 1CHQD 5A2QL 3K0YA 1V1PA 1GXDC 3F2UA 4A3MB 1VF7A 4KJNA 4KMUC 1RKNA 4IZ8A 2CW0D 1BF4A 2F0TA 4LMQD 5KIXA 1EY9A 2KHSA 1Y8OB 4O1NA 4V190 1EY4A 4QMGA 1FYCA 3TN2A 4KKSA 1TY0A 4X3KA 1FD7D 4J6HA 1NCVA 4XTCS 5FKAC 4DN4M 2F0MA 5IT9E 1HXYD 1RHPA 1A3VA 1S4ZA 3IFDA 3SHLA 1B4OA 3DXJC 4HCSA 1GUSA 5KGUA 4K8JA 1F2YA 2SNMA 1CQFA 3GP7A 3ZYYX 5EQ0A 4BY7B 2K05A 3P7JA 1PRTC 4A93B 5C0XH 3J7AF 4AYBB 3DHQA 1SNPA 3KBXA 2JA8B 5COYA 1JOKA 1EIGA 2PPBC 2HCIA 2O2LD 1GUTA 3OPOA 3W2DA 4ZUIA 2KEDA 3HRZC 3SK4A 2ZT9C 3RLFA 1TS2A 4RHSA 1EY0A 1SMYC 3TZUA 5D14A 4DXFA 1B2TA 4K2LA 2NN6I 4FF2A 2F0IA 1QNUA 4BWGB 5ISRA 2K01A 3T53B 2AWOA 2D9UA 5KNCA 2F1MA 5DNFA 4HTHA 1OO9B 5D3DA 4S3SA 3NSWA 4C1NK 3NTIA 1STEA 2K33A 1LT3D 1ENAA 3NWSA 1BOSA 3NUCA 1SBBB 2K04A 1NAPA 4DA2A 2D2CC 4C2MB 2LY7A 5I6YA 3J7AV 3HG9A 2QKIC 1U4RA 3K5NA 2YYZA 5IGFA 4FNFA 1PFNA 5A2QE 1LTRD 5FO7B 2F0DA 4U673 4K8IA 3I72A 1SE3A 5EPJA 1WTVA 3D6CA 1O80A 2R61A 1Y69U 2ICIA 3QB3A 5CORA 3SR1A 3HOYB 1WTRA 1IKMA 4KY7A 3VA5A 1VMCA 1KTKA 4CJ2C 3QOJA 1CTMA 5C44B 3CKIB 4K6LA 2B63B 5D65A 2J7ZA 1SXTA 5CV7A 2B2WC 3P75A 1LTSD 1TWHB 4Q5VA 1STHA 1MSGA 2MUYA 1AN8A 3QOLA 4OL7A 2CVRA 4CJ0B 2I46A 1LV9A 3R93A 5K36G 1TS4A 5T1GA 2B2VC 3BYYB 1Q8IA 3MXUA 2HDLA 4FO2A 1RF2D 4RAUC 3PO3B 4FXKC 4H0LC 2AQ2B 5ELDA 5DAUA 1U4PA 2QDBA 4UAIA 1V8QA 1WD0A 4PQXA 2EJGC 5C5LA 1B3AA 3Q22A 1TQOA 2KA7A 1HRJA 5T1IA 4XT1B 3VYSA 3R8BA 2F0LA 1PRTB 1SSOA 2IJ0A 1JR0D 3NK9A 2NYZD 4FYDA 2B39A 5C4JB 3V96A 4A3BB 2PNRC 3AB9A 1Z47A 4LAAA 1TU2B 1B1ZA 2WB1B 1HQMC 2EDGA 2RSOA 4C3JB 2KJXA 3W3AA 5CR3A 1GHKA 3R2IA 1NUCA 1I4GA 2X6LA 2B2TC 2EYJA 1G8ZD 3N52A 3MAQA 1Y8PB 1KDAA 1TIID 2EYMA 2A74C 1BCPD 1V1OA 5I4DA 1QB5D 3OMCA 1SJHD 2R7ZB 1HTLD 5JOBA 4F88A 2FJ2A 5F2DA 1WTWA 4RFBA 5IGEA 3FPUB 1EEID 2XWJB 2JEAI 3P1HA 2WINB 2IL8A 3MTSA 3AMUA 5CGKA 4IFDJ 2R93B 1OXSC 2C9OA 3BDCA 1R4PB 3QIAA 2A6EC 3GTLB 1SYGA 1X32A 1PXUA 5KYLA 4OGQC 3M7GA 2KECA 2NN6H 3T51B 1DONA 5JEAH 1LO5D 5JPMC 1Q1EA 3OWFA 1HFGA 3Q6SA 2XRQD 4IALA 1EY5A 1PLFA 1WCMB 1U4MA 4ILWA 4IN3A 4IUPA 5TSSA 4KN4C 3A8JE 1YNNC 5G3LD 4RH6A 3SE0A 1GUNA 1ML0D 1OXTA 1LTGD 3GV6A 4B9XA 3DEPA 2IW3A 5E4XA 1G6ZA 2L5TA 4I65A 1PRTF 3FMCA 2WIIB 4YIJA 1I4QA 3DWQA 4FVMA 2BOSA 3IL8A 4Q0FA 2PW7A 1PTOD 2B2YC 2BA1A 1ZYRD 4HCEA 1TT2A 1JWUD 2JEBI 1QNKA 2AUKA 2NWGA 5IIFA 5I9PA 2KVMA 3G7LA 1BCPF 2RVLA 3VYUA 1SYFA 3MXGA 3M7NA 3LX0A 2VNUD 4IFDG 3A54A 3GD7A 2G9DA 3N6RA 2RDFA 5CC4A 1ZXTA 5E1FA 2DNCA 3DEOA 1JWMD 4XXEA 4WFN3 3DMUA 3LWUA 2HQEA 3S1QB 4QF4A 3NP8A 1EFID 1SYDA 1MGSA 1F2ZA 5E4WC 2E2DC 1T5XD 2MGSA 1E2VA 3D3RA 1S5BD 1AZPA 1FNVA 4RGTA 1JWSD 5EPLA 1AP0A 4EVOA 2SEBD 1RTNA 2BCOA 1S5ED 3FEWX 3KLSX 2XIWA 1KDCA 5C0XJ 2BE5C 3A7LA 1W6KA 5I6WA 1UEAB 3RMHA 3DWPA 2F0VA 5ELBA 3PUXA 1Q3LA 3K57A 5J22A 4KY6A 2NVTB 5IGCA 2JXMB 1JB3A 1BDOA 5M5WB 2A5HA 3R2TA 2H4OA 5J1ZA 4IURA 1H9SB 2Z1CA 1A2TA 1HCZA 4CKEA 3BG3A 1D2BA 1DM0B 4ME5A 4IUTA 4EQNA 5C3WA 1H9JA 1DZ1A 4OO1I 1H9MA 1PTOF 2B8FA 2PYKA 1OXUA 2J4XA 3MFYA 2XRSD 2Q8TA 4NKLA 2G9HD 1DCZA 1A2UA 4RCOA 1SAPA 5CBEE 5NUCA 1NR2A 1BUVT 1EIHA 5IGBA 4IUUA 1FGBD 2PZWA 2M2LA 4F87A 4ULLA 1T5EA 3ND8A 3DM1A 1K83B 2CQAA 2A69D 2NB0A 1KNAA 1DJRD 1YNJC 4C3IB 1AFPA 1SYCA 1EY7A 4DAPA 5FLXL 1U4LA 2WAQB 1O78A 1LABA 3TSSA 2O4XA 4NW2A 5HGTA 4A3DB 1UNSA 5C3XA 3UI2A 1D5MC 3EA6A 2K1BA 3SDZA 2E2JB 1JORA 3T56B 3OIPA 1QCBD 3OW7A 1G91A 5JVH3 1EQVA 2H1EA 3A56A 2L0CA 1E2ZA 5C0XG 3MC0B 4KHZA 1DXMA 4DNRB 3HS0C 3BVGA 3BZDB 1HA6A 3EROA 4IUNA 4Z9CB 1QJOA 3MEHA 3PIO3 5JAVA 2F0OA 3NWTA 4C3JG 4TQUS 1XWEA 5FO8B 1I6HB 3H91A 2FMCA 3SK5A 2F0EA 5IGDA 2K5DA 2YU9B 5JJZA 3S17B 2NZ1D 2JSOA 4CGYB 4A3KB 1TY2A 4C56C 3OMGA 2M00A 5CV5A 3EJIA 2FFKB 5I2XA 1ZKOA 1PZJD 4XIGS 1ICWA 4HSPA 1VF5C 1IW7D 1KNEA 3U9SA 2EYFA 5KNDA 1A6XA 4A3JB 1PFBA 4ABNA 1ENCA 3KF8A 1W6JA 1HA5A 2EYOA 5DEHA 4PNYA 1CA5A 3TDQA 3SEBA 1Z6HA 2RQXA 4BA1I 2KCCA 5KNBA 3CHBD 3D6WA 1D5ZC 3SXHA 4MHEA 1I4PA 3BDOA 4RGNA 2HUGA 1MI2A 4A3FB 3K5LA 4LK1C 2FMMA 1EQTA 1EYCA 1CHPD 1EY6A 4H13C 5EPKA 1B44D 2EJFC 4KD4A 3FVQA 3D4RA 1S5DD 1RTOA 1TS5A 1A3UA 5ELEA 1SJED 3ERQA 5AFWA 1CM9A 3T13A 3S15B 3Q24A 3NQIA 4PV1C 1D6EC 4ZKCB 5FLXE 4G7OC 2Y0SB 1FNWA 1FR3A 1B53A 4OO1H 1MBYA 3ONAB 3I70A 4A3GB 4QUFA 2A6HC 2QCPX 5CV4A 3URYA 4M8AA 5JEAJ 2LKVA 1F9SA 5LHY1 3A55A 1RJTA 2F4IA 4FXDA 2MP1A 1D1KA 5I2YA 1PZID 1IKLA 2L12A 1LTBD 4MN3A 3VYRA 4A3IB 1STNA 2F0HA 2N88A 1I4HA 2NTSA 3R3OA 3RD4A 5FOBB 1ZEQX 3CRKC 2R3ZA 2NVYB 3E6ZX 2F03A 1LT4D 3I8ZA 3I4MB 1LT5D 3TBIB 2JP1A 4CJ1B 1PRTD 4HMIA 3HOWB 3HGBA 1XYIA 5M3FB 1LTAD 1ESFA 1G2TA 4XT3B 1TVXA 3FPPA 4C1NI 3MWYW 1LLRD 2PO4A 5I9OA 2F0JA 3MFGA 2B2UA 5M9OA 2EY5A 4BY1B 2A68C 1SMYD 4FP5D 3KLRA 5EBCA 4O42A 4F8MA 3PV0A 2EPBA 4UDUC 5ELCA 3J81E 2K32A 4KK7A 4QCLA 3NHHA 1EZ6A 3PUYA 4RWSC 1UUPA 1WTXA 4RA8A 1TKWB 1KDBA 2ENBA 1JICA 3X3NA 3H09A 4ZRZA 3FKIB 2L1BA 3P20A 1EL0A 2EY2A 2NN6G 3C1EA 1KABA 1JE4A 5JEAG 1O7LA 1GUWA 3LWEA 2AUJD 3D4DA 2ZXPA 5FO9B 5CV9A 2IX1A 4HMJA 1TWCB 5FK9C 2KOLA 4WORA 4P2CB 3G6JB 4C3IG 2SNSA 5JVG3 1I6VC 4ZQ3A 3HOXB 1F9QA 1F9PA 4RHRA 4JK1C 5C4HA 1I4RA 3HKZB 3K5MA 2J0TD 2I07B 4PMWA 3IKJA 3RUZA 3K6OA 1VDZA 2DN8A 1PFMA 3L9AX 2CW0C 4K14A 4KD3A 2R6GA 2WKDA 1R4QB 3C1FA 2AQ1B 2IX0A 2BDNA 2EJMA 4ODGA 2EZVA 1SNDA 1XTCD 3PUWA 2PCFB 1E2WA 1ENFA 1BXTA 1J9OA 1TWGB 1AW7A 2KUMA 3T16A 1A15A 4N9PA 2E2IB 5HURA 4DU9A 1DD2A 5C4XB 1KLGD 1GUGA 1DOKA 5IOCA 1LT6D 4DAVA 4FF1A 3KK7A 1STYA 3C2PA 2PMZB 3BVMA 4L63B 2PZUA 3NBIA 5D3IB 3OSOA 1K8OA 2ID0A 5KEEA 4XYOA 1V1PB 2KEEA 1EWHA 3H3VC 1C8CA 3ND9A 4IUQA 4DXGA 2F3VA 2E76C 2NBFA 3OIQA 3M4YA 4BBRB 3I91A 2HDMA 4EQPA 3T4AC 4BS9A 1CT1D 4F7XA 5K5PA 1V43A 2Q8RE 3I90A 3GV3A 3L7ZC 4KV6A 1CZGA 1M4VA 2X6GA 3J7YW 4FXGC 5CV6A 1E0BA 1LACA 2LS01 4KHVA 4J8QA 1Y8NB 4ID6A 2OF1A 3D31A 1PYWD 4CKBA 2JA5B 4RKLA 3K58A 4RKBA 1CZWA 4TSSA 2XSCA 2VB2X 2K5WA 2GA4B 1GJXA 4K5VA 4XQQA 5C3EB 5KYIA 4RGMA 2EYHA 2A73B 1STAA 3S2DB 4K5WA 1XX8A 4J1MA 3HOVB 2A6ED 3LNNA 1SNOA 1OXXK 5A35A 2B2UC 1WVLA 2RKSA 5BN4A 2EE1A 1BQQT 4FF3A 4IQZA 4G7ZC 4DF7A 1ET9A 2L11A 2VB3X 1B50A 4G57A 3GTJB 1BBXC 1GUOA 5C5MA 1HUMA 5EJWA 2KQ3A 3I73A 2Z4HA 3EFXD 2B2WA 4ZYSA 1TS3A 4FF4A 4WJWA 3TP8A 4RGOS 2F0QA 2PZTA 4B08A 3HEJA 3IAYA 1EYDA 2K7VA 1YNND 2B2VA 3CU7A 4R9WA 4R8IA 4EGVA 3MXNA 3Q0AA 2PW5A 3A8KE 4HR7B 2QILA 4G7HC 5CMDA 1HUNA 1JOOA 2RBMA 4OHJA 4C3HB 3VR3A 2HCCA 2VUMB 4NP5A 4X3UA 3VYTA 1RODA 4XYQA 3PUZA 3S1MB 1H9RA 1F2MA 1CFMA 3A8IE 3DUZA 1AEXA 3NE5B 3PIP3 1SEBD 2ZXRA 4KY5A 2XNAC 2B2TA 2B8GA 3VR2A 2RDHA 4HSVA 2K28A 1HPCA 4XQJA 3V05A 1ONLA 3EVQA 1EOTA 4HAEA 1XXGA 1SFOB 4MIUA 3PO2B 4X3TA 1S5FD 5EKKA 4E6IA 3K5OA 3H0GB 1H9SA 2EYPA 5CYUA 3GTOB 3L3OC 3GTQB 4K6DA 3NTKA 2DY7A 1I3QB 3S14B 3KLSA 4WRDA 3A7AB 2MPMA 2WACA 1O7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HEJ A;  1SYE A;  1KAA A;  1EY8 A;  1EYD A;  4EVO A;  1JOK A;  2F0D A;  1JOR A;  4K8I A;  4I65 A;  4WOR A;  5IGG A;  5CR3 A;  4PMC A;  5C6A A;  1KDC A;  4EQP A;  1JOQ A;  4N9T A;  5K5P A;  4F7X A;  3D6C A;  5I6W A;  2F3W A;  1A3T A;  1NUC A;  2SNS A;  4HMI A;  4KV6 A;  2SOB A;  3TME A;  4YIJ A;  2PW5 A;  1EQV A;  4ZUI A;  2F0V A;  3PMF A;  1EYA A;  1U9R A;  4H7B A;  2EYJ A;  4ZQ3 A;  3MHB A;  4KTA A;  5J22 A;  1JOO A;  1KDA A;  2RBM A;  4KY6 A;  5IGC A;  2EYM A;  1EYC A;  3QB3 A;  3SK4 A;  2EYL A;  2PW7 A;  5C4H A;  1EY6 A;  3BDL A;  4NP5 A;  3SR1 A;  5CV6 A;  3D4W A;  3RUZ A;  3ERO A;  4IUN A;  4KD4 A;  4KY7 A;  1EY0 A;  2F0F A;  3OMC A;  5J1Z A;  3SK8 A;  4EQO A;  3VA5 A;  3TP5 A;  5I9O A;  4KHV A;  5E3F A;  1TT2 A;  4ID6 A;  4DFA A;  1A2T A;  2F0J A;  5JOB A;  3MEH A;  2EY6 A;  2OF1 A;  2F0O A;  5JAV A;  4K14 A;  4KD3 A;  1NSN S;  1TR5 A;  2F0G A;  5F2D A;  1A3U A;  4ME5 A;  1F2M A;  3QOJ A;  4RKL A;  5IGE A;  3SK5 A;  4RKB A;  2F0P A;  3ERQ A;  2F0E A;  4K2L A;  4EQN A;  5C3W A;  4PMB A;  2F0N A;  2PQE A;  4R8N A;  3C1F A;  5IIF A;  5I9P A;  3P1H A;  5M9O A;  5IGD A;  3HZX A;  4KJN A;  5CGK A;  2EY5 A;  4ODG A;  1RKN A;  1SND A;  1AEX A;  3BDC A;  2F0I A;  3T13 A;  2PYK A;  4K5V A;  4TRD A;  2F0S A;  1SYF A;  1STG A;  5CV8 A;  4IZ8 A;  3OMG A;  2M00 A;  3MVV A;  3MZ5 A;  5ISR A;  5CV5 A;  1SYG A;  3EJI A;  1STB A;  5J39 A;  5CV7 A;  5KYL A;  4KY5 A;  3LX0 A;  4QB4 A;  4DGZ A;  3P75 A;  5KYI A;  2F0T A;  1SNM A;  4NMZ A;  4NKL A;  3U9O A;  1STH A;  4KJO A;  3T16 A;  4F8M A;  5KIX A;  3S9W A;  1EY9 A;  2EYH A;  2KHS A;  1STA A;  3QOL A;  4N9P A;  4K5W A;  1A2U A;  4HTH A;  3H6M A;  4OL7 A;  5HUR A;  5IOD A;  4DU9 A;  4J1M A;  4S3S A;  5NUC A;  1EY4 A;  2EXZ A;  3OWF A;  3NQT A;  1EZ8 A;  5IGB A;  4QMG A;  1SYB A;  2EYF A;  3EVQ A;  3NHH A;  2PZW A;  1EZ6 A;  2OXP A;  3TP6 A;  2RDF A;  4MIU A;  5IOC A;  5CC4 A;  1SNO A;  5CV4 A;  5C4Z A;  2ENB A;  1KDB A;  4J6H A;  5EKK A;  4E6I A;  2RKS A;  4K5X A;  4K2K A;  5E1F A;  5EGT A;  1STY A;  2LKV A;  4IAL A;  1ENA A;  1EY5 A;  3TP7 A;  2EY1 A;  4NDX A;  1IHZ A;  1ENC A;  2F0M A;  2EYP A;  3NUC A;  4DF7 A;  5DAU A;  2QDB A;  2EYO A;  5DEH A;  1A3V A;  2EY2 A;  3ITP A;  3MXP A;  4PNY A;  3C1E A;  1KAB A;  2PZU A;  3DMU A;  4G57 A;  5C5L A;  1SYC A;  3SK6 A;  1TQO A;  4K6D A;  4ZUJ A;  2F0U A;  3SHL A;  5I6Y A;  2NUC A;  5C5M A;  1EY7 A;  2HQE A;  3OSO A;  5KEE A;  4QF4 A;  5KGU A;  2F0L A;  2KQ3 A;  3NP8 A;  1II3 A;  1SYD A;  3NXW A;  3NK9 A;  1F2Y A;  2F0W A;  2SNM A;  1SNQ A;  1F2Z A;  3D8G A;  4K8J A;  4WRD A;  4B9W A;  1STN A;  2F0H A;  3D4D A;  3E5S A;  5IGF A;  2O4X A;  5KRU A;  3TP8 A;  3R3O A;  4LAA A;  4B9X A;  5HGT A;  5C3X A;  2WAC A;  1SNC A;  2F0K A;  2F0Q A;  2F3V A;  2OEO A;  2PZT A;  3DHQ A;  5CV9 A;  3SXH A;  1SNP A;  5EKL A;  4HMJ A;  3V2T A; 
#chains in the Genus database with same CATH topology
 2LMC B;  1EY8 A;  4UP7 A;  4L5Q A;  5M5X B;  3FKI G;  1Z7T A;  2QDL A;  1BCP C;  5C6A A;  2L55 A;  4A3E H;  1MSH A;  3CQZ B;  3QWN A;  3F8T A;  2C35 B;  4NXN L;  4AQY Q;  1I4X A;  1QWY A;  3QO2 A;  5DM7 3;  3I4N H;  4LF6 Q;  4HJ5 A;  1EYA A;  4H7B A;  5BN3 A;  2UUA L;  3VR4 A;  4OIK A;  1Y1W B;  1O7I A;  3J81 L;  4ZLT F;  5FJ8 H;  2BE5 D;  4JG2 A;  3VR6 A;  3RZO B;  3NPP A;  2ASB A;  1G29 1;  2CWA A;  1WTO A;  3TP5 A;  4OWX B;  2Z9H A;  2EY6 A;  4RG1 A;  1Q8K A;  1TR5 A;  4IJL A;  3I4O A;  4L6T B;  2M9V A;  2F0P A;  3JAM L;  4PMB A;  4R8N A;  1YEZ A;  1DOL A;  4X66 L;  5JPN C;  2Z8L A;  3HZX A;  1S5C D;  5EKI A;  3BYT B;  2HHH L;  1PDQ A;  5M5Y H;  1KIX A;  1VQ6 A;  3CMA A;  1JC7 A;  4M1U B;  3HOX G;  1STG A;  4LFA Q;  5CV8 A;  3T1Y L;  4JI3 L;  4LF4 Q;  5GAD C;  1X3P A;  1STB A;  2O5I C;  2OWO A;  4QB4 A;  3HKZ G;  4QUC A;  1HFN A;  2N55 A;  4Y7N B;  3S9W A;  2CQO A;  1PH1 A;  1BR9 A;  1L0Y B;  4YWL A;  1Q86 C;  1PH7 A;  3J80 L;  4GKK L;  1IL8 A;  2WP8 J;  2B2Y A;  3NQT A;  1ET6 A;  3GTG H;  3TEH B;  2UXD Q;  3BS1 A;  3GTP B;  1R9T B;  1F77 A;  2A8V A;  3C46 A;  2NTT A;  1GHJ A;  3CC2 A;  4V0B A;  3CME A;  2VS1 A;  3TZD A;  1IHZ A;  3CCQ A;  4BBS H;  2P5Z X;  3I3C A;  5IP7 G;  1CK1 A;  4GOP B;  4LFB Q;  4IOA A;  1I50 H;  2BDO A;  2DUD A;  4OO1 G;  3QJY A;  1II3 A;  4U68 A;  3AU7 A;  4B9W A;  5C4X G;  3E5S A;  4JI0 Q;  5KRU A;  3ER0 A;  2JJQ A;  2NVQ B;  2F0K A;  1YNJ D;  4HJA A;  4QY7 A;  2NVX H;  3V2T A;  4CHT B;  3K7U C;  2VQE Q;  1PZK D;  2K5H A;  1T9H A;  2TSS A;  3MA2 B;  2XN9 C;  1PTO H;  4JI5 Q;  1PTO C;  1WD1 A;  2X69 A;  1K8M A;  3NTH A;  1IYU A;  4QIW E;  3S16 B;  1ZYR C;  1A3T A;  1GD7 A;  5EAY A;  2SOB A;  2K6A A;  4IFD I;  2Z4I A;  5ELF A;  1U9R A;  2D5D A;  1RCV D;  5H1S E;  3VR5 A;  3M4O B;  3GTM B;  4HN7 A;  3ERS X;  4K0K Q;  3BDL A;  1E1O A;  5CBA E;  3GTK B;  1Y1V B;  2SDF A;  1UE6 A;  4KKU A;  1L0X B;  1SDF A;  3K7A H;  4CDC C;  4A75 A;  2F0F A;  4XQN A;  1TWF B;  4DFA A;  3CC4 A;  5LL6 X;  3VA7 A;  4GLA C;  3X3M A;  4IPG A;  4JOI C;  1NR4 A;  5K36 H;  4QL5 A;  4DR5 L;  2JE6 I;  3CPF A;  2ZTC A;  2E74 C;  4KI0 A;  1BKB A;  4NB3 A;  3KJP A;  1L2F A;  3Q23 A;  2UU9 Q;  2K5Q A;  4YWK A;  1D7Q A;  2R7D A;  4CBV A;  3MVV A;  2D62 A;  2MFI A;  5J39 A;  4B3M L;  4XDX A;  2IWH A;  1SNM A;  4G4K A;  4DUZ L;  1Q1B A;  2JYO A;  1YHQ A;  2XTI A;  4IOC A;  3H6M A;  1F2L A;  1TWA B;  1MIU A;  3IFT A;  1D1I A;  1EU4 A;  1EEF D;  2XWB B;  1ILQ A;  2RA4 A;  4GN5 A;  2RHS B;  3HOZ H;  5C4Z A;  1C4Q A;  3S1R B;  1MJE A;  3W1G A;  4DV4 Q;  4K2K A;  1AE3 A;  2BA0 A;  2C5C A;  3FRP B;  1IBM Q;  1N32 L;  3CRL C;  5C3E G;  1XPU A;  3SK6 A;  1FNU A;  3K59 A;  4ZUJ A;  2F0U A;  2IHE A;  2JA7 H;  1QG7 A;  3S2H B;  1G6P A;  1AZQ A;  5EKL A;  3HOU H;  1JQY D;  2DJF C;  2K03 A;  3D8G A;  3PUV A;  2QF7 A;  5M3M G;  4IO9 A;  3HOV G;  1XNR Q;  2MHV A;  3M3Y H;  1CQV A;  1G2S A;  4HJ7 A;  1ILP A;  2Z6B A;  3M85 A;  3B6Y A;  1BCP B;  3G71 A;  4DR4 Q;  3JAM E;  4LFC L;  5M5W H;  1LTI D;  1EU3 A;  4A3E B;  3S1N B;  4LWC A;  3OWE B;  1MD2 D;  5IGG A;  1C0A A;  4PMC A;  2N8N A;  1JOQ A;  3I4N B;  2EOT A;  1FGU A;  1FJG L;  1Q90 A;  4KLK A;  3RN5 A;  1OXV A;  4JBW A;  3MHB A;  5BN5 A;  1CA6 A;  2CHB D;  2IPK D;  2EYL A;  1CKN A;  3H94 A;  5LMU Q;  5IT9 c;  3J80 E;  4ZCK A;  3NBH A;  1PFS A;  4IUV A;  3CC7 A;  4P71 A;  1VCI A;  3FHW A;  1HZB A;  1WTP A;  2R92 H;  1BO0 A;  4A3L G;  4QIW B;  2BH2 A;  1RD9 D;  3T1Y Q;  2F0G A;  4ZK9 B;  4JI3 Q;  3F2C A;  2TMP A;  3AQQ A;  1HNW L;  5AJ3 L;  1SE4 A;  1HQR D;  4OIJ A;  1PH6 A;  5M5Y B;  1GOZ A;  3E0J A;  1WFQ A;  4I7Z C;  4A3M G;  1M8A A;  2UXC Q;  1KLU D;  1VQA A;  4MNO A;  4TRD A;  1B9N A;  2F0S A;  2OT2 A;  1L1O A;  4C3H G;  4ZAI A;  2MJ8 A;  2VUM G;  4NMZ A;  4KJO A;  3KBG A;  4KKT A;  4B3S Q;  2WFW A;  3WDN A;  1ASZ A;  1B9M A;  5IOD A;  3GTG B;  1VQO A;  3G4S A;  2A69 C;  2DNE A;  3I4L A;  4X3S A;  1EZ8 A;  1Z9F A;  1YJW A;  1SYB A;  1JCK B;  3TP6 A;  1VMP A;  1PH3 A;  1HTP A;  4JBM A;  2KHI A;  3C3L A;  4K5X A;  5EGT A;  1HR0 W;  4OX9 L;  4BBS B;  3GO5 A;  4A3D H;  3TP7 A;  4DK0 A;  4NDX A;  1LYL A;  2L15 A;  5C0X I;  1Q12 A;  1SE2 A;  1HNZ Q;  2BH8 A;  1I50 B;  3MXP A;  1YHB A;  2A6H D;  4JI2 Q;  2VXW A;  2NUC A;  1D5X C;  1EWC A;  2MNA A;  1JT8 A;  4RCN A;  1NY4 A;  1A62 A;  1VQE A;  2EVB A;  2IX3 A;  5DM6 3;  4DAY A;  2JA6 B;  1DYQ A;  2NVX B;  1QOH A;  4BY7 H;  1QIL A;  4JYA Q;  3PO2 G;  4A93 H;  1WTQ A;  1PTO B;  4PZ7 A;  4GZY C;  2RSN A;  2UUC L;  3H0G G;  1O7Z A;  2JA8 H;  1X3Q A;  3WOE A;  1IYV A;  1Q7Y C;  1A0I A;  1J5E Q;  1C48 A;  4GLX A;  3TME A;  3EQL C;  5IT9 L;  2JA9 A;  3PMF A;  2O5J C;  1UAP A;  4LF9 L;  4ZKB B;  1NBW A;  2AHO B;  4BA2 I;  1TXY A;  3E3X A;  1XJV A;  3K7A B;  4B3R Q;  4A3K H;  5LL6 S;  4LW1 A;  2FHT A;  1DOM A;  1CKO A;  2WV6 D;  2JQO A;  4EQO A;  4IFD H;  5E3F A;  2WKC A;  1YHA A;  2RDG A;  2L4N A;  3OOC A;  3GQB A;  4DV0 Q;  3HKS A;  1NSN S;  3HP3 A;  1ESR A;  3OHX C;  4R4O A;  2F0N A;  2PQE A;  1CI3 M;  2E75 C;  3QG1 A;  2Q8I B;  2UXB Q;  3O13 A;  2ICE C;  1IW7 C;  4FDB A;  2AWN A;  3KUP A;  2QEJ C;  4POF A;  1C7Y A;  3MZ5 A;  4A3J H;  5BR8 Q;  1Y1W G;  4AQY L;  4DGZ A;  2KCN A;  3U9O A;  4LF6 L;  1J8I A;  1X56 A;  1N32 Q;  2FIN B;  4H44 C;  4LJZ C;  2EXZ A;  2A68 D;  3CP0 A;  3HOZ B;  2FXQ A;  4JI8 Q;  2OXP A;  1GKH A;  2ZTE A;  3FDT A;  2LFN A;  1H9K A;  2ZXO A;  1K9M C;  3WOF A;  4AYB E;  2EY1 A;  4DNT B;  1BNZ A;  4X62 Q;  3ITP A;  2JA7 B;  3KYH C;  2IT1 A;  2VQF Q;  3HOU B;  3BVZ A;  1RL2 A;  5G3L F;  4C2M H;  4A3F H;  4LFC Q;  1VQ4 A;  5IP9 H;  3NXW A;  2F0W A;  5M3M B;  1N33 Q;  1SNQ A;  4LFA L;  1MHW C;  4LF4 L;  3M3Y B;  1QVF A;  1QE6 A;  2L9H A;  4DK1 A;  2AQ3 B;  4PZ8 A;  4HJ9 A;  1SNC A;  2GVA A;  2OEO A;  4CKC A;  3KF6 B;  1PMR A;  2HIX A;  1KQS A;  1SYE A;  1KAA A;  4BXX H;  1F9R A;  4HJ8 A;  2HQL A;  2K52 A;  3IRB A;  2XVS A;  4JI1 L;  3SVM A;  3AFQ A;  1LTT D;  2UXD L;  2DY8 A;  4L8J A;  4KN7 C;  4N9T A;  1XPO A;  2F3W A;  1KRT A;  1Q82 C;  2R7F A;  2F4V Q;  4TKO B;  4KTA A;  1RDP D;  3DWA A;  4HED A;  5JJI A;  5HGQ A;  5EBD A;  3DLL A;  5AJ3 Q;  2ZJQ A;  4DUY Q;  2V4D A;  4LFB L;  2VL6 A;  3S15 H;  3RZD B;  1X65 A;  2R92 B;  3D4W A;  4ALP A;  3SK8 A;  4JW0 A;  3HOY H;  4OON A;  3KF8 B;  2E2H B;  1HHV A;  1CHQ D;  5A2Q L;  3K0Y A;  1V1P A;  2IHF A;  4JI0 L;  1GXD C;  3F2U A;  4A3M B;  1VF7 A;  4KJN A;  5IYD G;  5C44 H;  3CCR A;  4KMU C;  1RKN A;  1DGS A;  4JI5 L;  3W5O A;  2PI2 E;  2B63 G;  2K5V A;  4IZ8 A;  2CW0 D;  3A5Z B;  1BF4 A;  1PH4 A;  2F0T A;  3KOJ A;  4LMQ D;  5KIX A;  1Y1V G;  1EY9 A;  2KHS A;  1Y8O B;  1HR0 Q;  4O1N A;  4V19 0;  4A3C G;  1EY4 A;  1K3B C;  4QMG A;  1YIT A;  1FYC A;  3TN2 A;  4K0K L;  4KKS A;  1TY0 A;  4X3K A;  1FD7 D;  2B29 A;  4J6H A;  1NCV A;  1XMQ Q;  4XTC S;  2KCM A;  4DR6 Q;  1SRO A;  4P73 A;  1QVG A;  1JJG A;  5FKA C;  4JI4 Q;  4DN4 M;  2F0M A;  3PO3 H;  2ES2 A;  5IT9 E;  1HXY D;  1RHP A;  1A3V A;  1S4Z A;  3H15 A;  3IFD A;  3PQI A;  3SHL A;  1B4O A;  3DXJ C;  2QGQ A;  4HCS A;  1GUS A;  5KGU A;  1OTC A;  2UU9 L;  1PHJ A;  3K8A A;  1QZG A;  4K8J A;  1F2Y A;  2SNM A;  1CQF A;  2YTY A;  3GP7 A;  3ZYY X;  5EQ0 A;  4O2D A;  1N8R C;  1NE3 A;  4BY7 B;  2GVB A;  2K05 A;  3P7J A;  1PRT C;  4A93 B;  5C0X H;  5C4J H;  4DV7 Q;  1QVC A;  4AYB B;  3J7A F;  4A3B H;  3DHQ A;  3G6E A;  1SNP A;  3KBX A;  5FLM H;  3PIP A;  2JA8 B;  5COY A;  1JOK A;  1EIG A;  2PPB C;  2HCI A;  2O2L D;  4C3J H;  1GUT A;  4L5S A;  3OPO A;  2LXK A;  1WOC A;  3W2D A;  4DV4 L;  1VQH A;  4ZUI A;  2YTX A;  4DK6 C;  1IBM L;  4CDF C;  2KED A;  3HRZ C;  3SK4 A;  4WJ4 A;  2ZT9 C;  3RLF A;  1TS2 A;  4UP9 A;  1PH8 A;  1E24 A;  4RHS A;  2JN4 A;  1EY0 A;  2ZJP A;  1LM0 A;  1SMY C;  1X55 A;  3TZU A;  4A3E G;  5D14 A;  4DXF A;  1XPR A;  2R7Z H;  1KXL A;  1B2T A;  1XNR L;  2KCT A;  3STB D;  4K2L A;  2NN6 I;  1JJC B;  3I4N G;  4FF2 A;  4DR4 L;  2F0I A;  1QNU A;  4BWG B;  2R93 H;  2Z6K C;  3UDI A;  5ISR A;  5FJ8 G;  2K01 A;  1PH5 A;  3T53 B;  2AWO A;  3GTL H;  1V1Q A;  4R4I A;  2D9U A;  5KNC A;  2F1M A;  5DNF A;  4HTH A;  1OO9 B;  5D3D A;  4UHV A;  4S3S A;  2G5D A;  3NSW A;  4C1N K;  5LMU L;  3NTI A;  1STE A;  2IY5 B;  4GNX C;  2CH4 A;  2K33 A;  2ALY B;  4EX5 A;  1LT3 D;  2RCF A;  1ENA A;  3NWS A;  1BOS A;  1EQQ A;  2WB1 E;  3NUC A;  1SBB B;  2K04 A;  1NAP A;  3PF5 A;  4DA2 A;  2D2C C;  3DM3 A;  1WCM H;  4C2M B;  2LY7 A;  5I6Y A;  3J7A V;  3HG9 A;  2QKI C;  4DV5 Q;  2H5X A;  2UXC L;  2EXD A;  4MTK A;  1U4R A;  3K5N A;  4JI1 Q;  5E7N A;  3U4Z A;  2YYZ A;  5IGF A;  4LF7 L;  3MEF A;  4FNF A;  4B3S L;  1PFN A;  5A2Q E;  1LTR D;  5FO7 B;  2NZH A;  4IPD A;  2CCZ A;  2F0D A;  4LUV A;  4BBS G;  4U67 3;  4K8I A;  3I72 A;  1SE3 A;  5EPJ A;  3CXC A;  2PQA A;  4JBJ A;  1WTV A;  3D6C A;  1QZH A;  1O80 A;  2R61 A;  1Y69 U;  4IPH A;  5JJL A;  2ICI A;  1HNZ L;  3NEL A;  3QB3 A;  5COR A;  4L5R C;  4JI2 L;  2JA6 G;  3SR1 A;  3HOY B;  1WTR A;  1IKM A;  4KY7 A;  3VA5 A;  1VMC A;  1KTK A;  1S72 A;  1TWG H;  4CJ2 C;  3QOJ A;  1CTM A;  5C44 B;  4JYA L;  3CKI B;  1IZ6 A;  4K6L A;  2E5L Q;  3M4Q A;  2K75 A;  2I5L X;  5IYB H;  2B63 B;  1VQB A;  5D65 A;  3KFU A;  4HID A;  3H3V I;  2J7Z A;  1J5E L;  1CKN B;  1SXT A;  5CV7 A;  1E1T A;  1J6Q A;  2B2W C;  3P75 A;  4OEM B;  1LTS D;  1TWH B;  1PYS B;  4Q5V A;  4HIK A;  1STH A;  1MSG A;  2MUY A;  4DR1 Q;  3NBH B;  1AN8 A;  3QOL A;  4OL7 A;  2Q2T A;  2CVR A;  1YIJ A;  4CJ0 B;  2I46 A;  3E9I A;  1LV9 A;  3ICE A;  3R93 A;  3CCM A;  5K36 G;  1TS4 A;  5T1G A;  4B3R L;  2B2V C;  3BYY B;  1Q8I A;  4DKA C;  3MXU A;  1E22 A;  2HDL A;  1RF2 D;  4FO2 A;  4RAU C;  4FXK C;  3CF5 A;  2QW7 A;  4H0L C;  3PO3 B;  1C9O A;  1X6O A;  2AQ2 B;  4DV0 L;  1CSP A;  5ELD A;  5DAU A;  1U4P A;  2QDB A;  1L1O B;  4UAI A;  1V8Q A;  1WD0 A;  4PQX A;  2EJG C;  4YY3 L;  5C5L A;  2UXB L;  1B3A A;  4BBR H;  3Q22 A;  1TQO A;  5IYC H;  2KA7 A;  1HRJ A;  5T1I A;  4XT1 B;  3VYS A;  1K28 A;  3R8B A;  2F0L A;  1PRT B;  1SSO A;  1X3E A;  3NK9 A;  1JR0 D;  2IJ0 A;  2NYZ D;  4FYD A;  3S1Q H;  2B39 A;  5C4J B;  2CFM A;  3V96 A;  4A3B B;  2PNR C;  5BR8 L;  3HOZ G;  3AB9 A;  3ULL A;  1Z47 A;  4I7A A;  4LAA A;  3BJU A;  2ZM6 Q;  1YZ6 A;  1TU2 B;  2LXJ A;  2JK8 A;  1B1Z A;  2WB1 B;  1HQM C;  4WJ3 M;  1VQJ A;  3CCS A;  1H95 A;  3RN2 A;  2EDG A;  3KLW A;  2RSO A;  4C3J B;  3F1Z A;  2KJX A;  1VQ9 A;  3W3A A;  3Q8D A;  5CR3 A;  4JI8 L;  1GHK A;  3R2I A;  2JA7 G;  1XNQ L;  1NUC A;  1I4G A;  3OYY A;  2X6L A;  2JA5 H;  3HOU G;  2B2T C;  2EYJ A;  1G8Z D;  3N52 A;  3MAQ A;  1Y8P B;  1KDA A;  1TII D;  2EYM A;  4X62 L;  2A74 C;  2NVT H;  1BCP D;  1V1O A;  5I4D A;  2VQF L;  1QB5 D;  4GOP A;  2KHJ A;  3OMC A;  1SJH D;  2R7Z B;  1EUJ A;  3AYH B;  1HTL D;  1N33 L;  5JOB A;  4F88 A;  2FJ2 A;  5F2D A;  1W2B A;  3S2D H;  1WTW A;  4RFB A;  5IGE A;  1JE5 A;  3FPU B;  1EEI D;  2XWJ B;  4OXP A;  2JEA I;  3P1H A;  2WIN B;  4A4I A;  2IL8 A;  1VQF A;  3MTS A;  3AMU A;  5CGK A;  4IFD J;  1KRS A;  2R93 B;  1OXS C;  2C9O A;  4PZ6 A;  3BDC A;  1R4P B;  3QIA A;  2A6E C;  2A1A A;  3GTL B;  1SYG A;  1X32 A;  1XTD A;  1PXU A;  5KYL A;  4OGQ C;  3M7G A;  2KEC A;  2EQS A;  2NN6 H;  2F4V L;  2R92 G;  3T51 B;  4NXM Q;  1DON A;  5JEA H;  1LO5 D;  3BZK A;  5JPM C;  3GTJ H;  1Q1E A;  3BU2 A;  3OWF A;  2UUB Q;  1PYB A;  4GNX B;  1HFG A;  5L37 A;  3Q6S A;  4DUY L;  3EIV A;  2DJG C;  1LTL A;  2XRQ D;  4IAL A;  1EY5 A;  1PLF A;  1N36 Q;  1WCM B;  1U4M A;  4ILW A;  2YTV A;  1K83 H;  4O0A A;  4IN3 A;  4LF7 Q;  4IUP A;  5TSS A;  2I5H A;  4KN4 C;  4C3I H;  1SR3 A;  3A8J E;  4AIM A;  1B70 B;  1EYG A;  1YNN C;  5G3L D;  4RH6 A;  1P16 A;  3GDE A;  3SE0 A;  1GUN A;  1ML0 D;  5GAG C;  1OXT A;  1LTG D;  3GV6 A;  1VS0 A;  4B9X A;  1HZ9 A;  1YI2 A;  2HT1 A;  3DEP A;  4A3D G;  1HR0 L;  2N3S A;  2IW3 A;  5E4X A;  4JBK A;  4R1J A;  1G6Z A;  2L5T A;  4NPS A;  4I65 A;  1PRT F;  2E2J H;  1JMC A;  3FMC A;  2WII B;  4LUO A;  3RLN A;  4MTN A;  4YIJ A;  1XMQ L;  1I4Q A;  1KC8 C;  1M1K C;  3DWQ A;  4DR6 L;  4FVM A;  2Q2U A;  2BOS A;  4JI4 L;  2A19 A;  3IL8 A;  4KHP Q;  4Q0F A;  3U58 A;  2PW7 A;  1PTO D;  4BY7 G;  2B2Y C;  4A93 G;  1JJ2 A;  2BA1 A;  1ZYR D;  4HCE A;  4AYB G;  2XGT A;  2JA8 G;  1TT2 A;  1HH2 P;  1JWU D;  3F2D A;  2JEB I;  4YHH Q;  3ULP A;  5ELO A;  4DK3 C;  1QNK A;  2AUK A;  2NWG A;  4DV7 L;  1I6H H;  5IIF A;  5I9P A;  1VQK A;  4JV5 Q;  4JPB W;  1KD1 C;  2KVM A;  3S24 A;  3G7L A;  1BCP F;  1SFO H;  3U4V A;  3S17 H;  2YU9 H;  2RVL A;  3VYU A;  1SYF A;  3MXG A;  3M7N A;  4A3K G;  3LX0 A;  2VNU D;  4IFD G;  1VQ8 A;  2NZO A;  3A54 A;  3GD7 A;  4QJF A;  1FL0 A;  4LF8 Q;  1CUK A;  2G9D A;  3N6R A;  5GAE C;  3H3V H;  4CDE C;  2I5M X;  4YY3 Q;  3RLO A;  2RDF A;  3MXN B;  1JB7 A;  2WAQ E;  4N8F A;  2K50 A;  5CC4 A;  1W3S A;  5J3B A;  1ZXT A;  5E1F A;  2DNC A;  5IY0 A;  3I2Z A;  3DEO A;  1YJ9 A;  3WWV A;  4A3J G;  1JWM D;  1EIY B;  4XXE A;  4WFN 3;  3DMU A;  3LWU A;  2HQE A;  3S1Q B;  4QF4 A;  3K81 C;  3NP8 A;  1EFI D;  3OTO Q;  1SYD A;  1MGS A;  1F2Z A;  5E4W C;  2E2D C;  1T5X D;  2MGS A;  1E2V A;  1E3P A;  3RR5 A;  1EWI A;  4DAM A;  3D3R A;  1XNQ Q;  1S5B D;  1NJI C;  1AZP A;  1FNV A;  4RGT A;  1JWS D;  5EPL A;  1AP0 A;  5FLX c;  4EVO A;  1Y1W H;  2SEB D;  1RTN A;  2BCO A;  2Q2I A;  1S5E D;  3PF4 A;  3FEW X;  4HIM A;  3TS2 A;  3KLS X;  5GQO A;  2XIW A;  1KDC A;  5C0X J;  2BE5 C;  3A7L A;  1W6K A;  5I6W A;  1UEA B;  4A3F G;  3RMH A;  5IP9 G;  3DWP A;  2F0V A;  5ELB A;  3PUX A;  2MO0 A;  1Q3L A;  3K57 A;  1QUQ B;  3HFZ B;  4KY6 A;  5J22 A;  2NVT B;  2CWP A;  5IGC A;  4LNQ A;  4LF5 Q;  2JXM B;  1JB3 A;  1BDO A;  5M5W B;  2A5H A;  3R2T A;  2H4O A;  4BXX G;  5J1Z A;  4IUR A;  4DV5 L;  3UE1 A;  1H9S B;  1CSQ A;  2Z1C A;  4X64 Q;  1A2T A;  3CCL A;  1KAW A;  1HCZ A;  4CKE A;  1BVS A;  3BG3 A;  1D2B A;  1DM0 B;  1WTH A;  4IUT A;  4ME5 A;  2VW9 A;  4EQN A;  5C3W A;  4DV2 L;  1H9J A;  1DZ1 A;  4H02 A;  3G48 A;  4OO1 I;  4UY8 C;  3KDF B;  4B3T Q;  1H9M A;  1PTO F;  2B8F A;  1IBK L;  4POG A;  2PYK A;  2HIV A;  3NEM A;  1OXU A;  2J4X A;  3MFY A;  2XRS D;  5ELN A;  2Q8T A;  4NKL A;  2G9H D;  3HOY G;  1DCZ A;  1I5F A;  4DV3 Q;  1A2U A;  4RCO A;  1SAP A;  2KEN A;  5CBE E;  1Q81 C;  5NUC A;  1NR2 A;  1BUV T;  1X3F A;  1EIH A;  5IGB A;  2D0P A;  1FGB D;  4IUU A;  2PZW A;  5C44 G;  2M2L A;  3EBE A;  4A3G H;  4F87 A;  4ULL A;  1T5E A;  3ND8 A;  3DM1 A;  4JOI A;  2NVQ H;  4OEL B;  1K83 B;  4UP8 A;  2CQA A;  2A69 D;  2NB0 A;  1KNA A;  1DJR D;  1YNJ C;  4C3I B;  5LMN Q;  1AFP A;  1SYC A;  1HNX Q;  2HD3 A;  2E5L L;  1EY7 A;  4DAP A;  3QR8 A;  3J81 i;  5FLX L;  1U4L A;  2WAQ B;  1O78 A;  1LAB A;  3TSS A;  1IL2 A;  2O4X A;  4A3I H;  4NW2 A;  5HGT A;  4A3D B;  1UNS A;  5C3X A;  3UI2 A;  2VY3 A;  4DR1 L;  1D5M C;  3M4O H;  3EA6 A;  2K1B A;  1VQ5 A;  3PO3 G;  3SDZ A;  2E2J B;  3PGZ A;  1JOR A;  2NVY H;  3T56 B;  4DV6 Q;  3OIP A;  3J81 c;  1X9N A;  1VQL A;  3UDX A;  3OW7 A;  1QCB D;  1L1O C;  2V1C C;  4JC0 A;  3I4M H;  3UE0 A;  1G91 A;  1I94 Q;  5JVH 3;  1EQV A;  2H1E A;  3A56 A;  3HOW H;  2L0C A;  4YCV A;  1E2Z A;  3FP9 A;  5M3F H;  5C0X G;  3MC0 B;  4KHZ A;  1DXM A;  4DNR B;  4A3B G;  3HS0 C;  1M90 C;  2AKW B;  3BVG A;  3BZD B;  4N8X 1;  1HA6 A;  3NEN A;  5FLM G;  1IBL Q;  3ERO A;  4IUN A;  4Z9C B;  2WB1 G;  1QJO A;  2Y0S E;  3MEH A;  3PIO 3;  5JAV A;  2F0O A;  3NWT A;  3ULJ A;  4C3J G;  4TQU S;  1XWE A;  5FO8 B;  1I6H B;  3H91 A;  2PQA B;  2FMC A;  3SK5 A;  2F0E A;  2ZM6 L;  4J15 A;  2RF4 A;  4P72 A;  4YCW A;  2K5D A;  5IGD A;  5JJZ A;  3J7Z C;  1PV4 A;  2YU9 B;  3S17 B;  3KF6 A;  4GN3 B;  2OQK A;  1NNX A;  2NZ1 D;  2JSO A;  4CGY B;  4A3K B;  1TY2 A;  4BY1 H;  5GRO A;  4C56 C;  3OMG A;  2M00 A;  4DR3 Q;  5CV5 A;  3CD6 A;  1CKM A;  2FFK B;  3EJI A;  5I2X A;  5JJK A;  3JC6 6;  1ZKO A;  1PZJ D;  4XIG S;  1ICW A;  1X3G A;  4L5T A;  4HSP A;  2R7Z G;  1VF5 C;  1IW7 D;  1KNE A;  4R4T A;  3U9S A;  2EYF A;  2PNH A;  2OQ0 A;  5KND A;  3CCV A;  1A6X A;  4A3J B;  1B3Q A;  1PFB A;  2R93 G;  4ABN A;  4JVZ A;  1ENC A;  3KF8 A;  1W6J A;  1HA5 A;  3FKI H;  2EYO A;  2ZTD A;  5DEH A;  3S1N H;  4PNY A;  2LSS A;  1CA5 A;  3D0F A;  3TDQ A;  4JI7 Q;  3SEB A;  1Z6H A;  4P74 A;  4CDD C;  5GAH C;  2RQX A;  1VQG A;  2KCC A;  4BA1 I;  5KNB A;  3CHB D;  3D6W A;  3CCE A;  1WI5 A;  1D5Z C;  3SXH A;  4MHE A;  4NXM L;  1NMG A;  1I4P A;  2DGY A;  3BDO A;  4IPC A;  2UUB L;  4RGN A;  4OWW B;  2HUG A;  1TWC H;  1WCM G;  1MI2 A;  4A3F B;  1NTG A;  3K5L A;  4LK1 C;  2FMM A;  1EQT A;  1K0R A;  1N34 Q;  4AH6 A;  4GN4 B;  1N36 L;  1XMO Q;  1U0L A;  1SN8 A;  1EYC A;  3RNU A;  4X6A H;  1CHP D;  1EY6 A;  3HOX H;  4DV2 Q;  4DR2 Q;  4H13 C;  5EPK A;  1B44 D;  2EJF C;  4KD4 A;  3FVQ A;  3D4R A;  1S5D D;  1P8L A;  1IBK Q;  2K5N A;  1UE1 A;  1RTO A;  1TS5 A;  1A3U A;  5ELE A;  1SJE D;  3ERQ A;  4DPG A;  1WJJ A;  5AFW A;  1IYJ B;  1CM9 A;  1SRU A;  1Q46 A;  4GLV B;  3T13 A;  3S15 B;  3Q24 A;  3NQI A;  4PV1 C;  1D6E C;  4JCV E;  4ZKC B;  4LUZ A;  5FLX E;  4DV1 Q;  4G7O C;  3CCJ A;  2Y0S B;  5IP7 H;  1FNW A;  1FR3 A;  3I55 A;  1B53 A;  1VQI A;  1IXR A;  4OO1 H;  2OTJ A;  1MBY A;  3ONA B;  4KHP L;  3I70 A;  2E2I H;  2YV5 A;  4A3G B;  4QUF A;  2A6H C;  5IWA Q;  2QCP X;  5C4X H;  4JI6 Q;  4MZ9 A;  5CV4 A;  3URY A;  4M8A A;  1G51 A;  5IYB G;  4IJH A;  5JEA J;  2JA6 H;  2LKV A;  1A63 A;  3M9B A;  4YHH L;  3K0X A;  1F9S A;  5LHY 1;  1ICF B;  3I56 A;  3A55 A;  1RJT A;  2F4I A;  4QQB X;  3TQY A;  4FXD A;  2N78 A;  4JV5 L;  3T1H Q;  2MP1 A;  1PVO A;  1D1K A;  5I2Y A;  3F2B A;  1PZI D;  1IKL A;  2L12 A;  1LTB D;  4MN3 A;  3VYR A;  1VQ7 A;  4A3I B;  4DR7 Q;  1STN A;  2F0H A;  2N88 A;  1I4H A;  3AFP A;  1GVP A;  2GN5 A;  2NTS A;  3R3O A;  3RD4 A;  5FOB B;  1ZEQ X;  3CRK C;  2R3Z A;  2NVY B;  3HKZ E;  3E6Z X;  1S3O A;  2F03 A;  1LT4 D;  3BZC A;  4LF8 L;  2KBN A;  3I8Z A;  1GM5 A;  3I4M B;  1LT5 D;  3TBI B;  4BBR G;  1YJN A;  5IYC G;  2JP1 A;  4CJ1 B;  1PRT D;  1B7Y B;  2K4K A;  4HMI A;  3HOW B;  3HGB A;  1XYI A;  5M3F B;  1LTA D;  1ESF A;  2PI2 A;  1G2T A;  4XT3 B;  1TVX A;  1YVC A;  1EIF A;  3FPP A;  1A8V A;  4C1N I;  1HZC A;  3MWY W;  4HIO A;  1LLR D;  2PO4 A;  4X65 Q;  5I9O A;  3OTO L;  2F0J A;  3MFG A;  1KHI A;  2B2U A;  2CH4 W;  2JA5 G;  5M9O A;  4GKJ L;  1EQR A;  2EY5 A;  4BY1 B;  1SLJ A;  2A68 C;  1SMY D;  4FP5 D;  1VQN A;  4DAY B;  3KLR A;  2PMZ E;  5EBC A;  1X54 A;  3E0E A;  4O42 A;  4F8M A;  3PV0 A;  5C3E H;  3CCU A;  2EPB A;  4APV A;  4UDU C;  5ELC A;  3J81 E;  4LF5 L;  2K32 A;  4KK7 A;  4QCL A;  4Y52 H;  3NHH A;  1EZ6 A;  3PUY A;  4RWS C;  5M3M H;  1UUP A;  3HOV H;  4NXN Q;  1WTX A;  4RA8 A;  1TKW B;  1KDB A;  2ENB A;  1JIC A;  3X3N A;  3UDG A;  3H09 A;  4ZRZ A;  4X64 L;  3FKI B;  2L1B A;  2UUA Q;  3P20 A;  1AH9 A;  1EL0 A;  2EY2 A;  2NN6 G;  3C1E A;  1KAB A;  1LUZ A;  3L0O A;  1JE4 A;  1D8L A;  5JEA G;  4B3T L;  1O7L A;  1B8A A;  1GUW A;  3LWE A;  1UE5 A;  2AUJ D;  3D4D A;  2ZXP A;  5FO9 B;  5CV9 A;  4X66 Q;  4DV3 L;  2IX1 A;  4HMJ A;  3EN2 A;  4TVA B;  1TWC B;  2HHH Q;  2AMC B;  1VQC A;  3RZD H;  5FK9 C;  2KOL A;  4WOR A;  4P2C B;  4A3L H;  3TRE A;  3G6J B;  4C3I G;  4EQ5 A;  2SNS A;  5JVG 3;  2E2H H;  1I6V C;  1WYD A;  5DLQ E;  2Z0S A;  3L2P A;  4ZQ3 A;  1E7Z A;  3CAM A;  4A3M H;  2MO1 A;  3HOX B;  1F9Q A;  4GKK Q;  1F9P A;  4RHR A;  3K80 C;  5LMN W;  2WAQ G;  4JK1 C;  4P75 A;  4R4Q A;  5C4H A;  5LMN L;  1HJP A;  1I4R A;  3HKZ B;  4C3H H;  3K5M A;  2J0T D;  2I07 B;  4PMW A;  3IKJ A;  3W1B A;  3RUZ A;  1HNX L;  3K6O A;  2VUM H;  1VDZ A;  2DN8 A;  1PFM A;  3L9A X;  2CW0 C;  4K14 A;  4KD3 A;  3OW2 A;  4R4C A;  2R6G A;  1VQP A;  3S1M H;  2WKD A;  1R4Q B;  3C1F A;  2AQ1 B;  1GO3 E;  2IX0 A;  2BDN A;  2EJM A;  4ODG A;  2QEX A;  2EZV A;  1SND A;  2RCN A;  1XTC D;  3PUW A;  1K8G A;  2PCF B;  1E2W A;  4DV6 L;  1ENF A;  4ME3 A;  1BXT A;  1J9O A;  2D0O A;  1VQM A;  1TWG B;  1AW7 A;  2KUM A;  3T16 A;  1I94 L;  1A15 A;  4N9P A;  2E2I B;  5HUR A;  4DU9 A;  1DD2 A;  5C4X B;  1KLG D;  2OCE A;  1GUG A;  1DOK A;  5IOC A;  1IBL L;  1AE2 A;  1LT6 D;  4DAV A;  4FF1 A;  3KK7 A;  1HZA A;  1STY A;  3PO2 H;  3C2P A;  1KL9 A;  2PMZ B;  2B3G A;  3H0G H;  4DNI A;  3BVM A;  4L63 B;  2PZU A;  1EFW A;  3GTO H;  3NBI A;  5D3I B;  3OSO A;  1VQD A;  2ID0 A;  5KEE A;  1K8O A;  2Z6K A;  3GTQ H;  4XYO A;  2Q2H A;  1I3Q H;  3S14 H;  1V1P B;  2KEE A;  1EWH A;  4DR3 L;  3H3V C;  1MJC A;  1C8C A;  3ND9 A;  4IUQ A;  4DXG A;  3J7A 5;  2F3V A;  1L0W A;  4DR5 Q;  3TRZ A;  2E76 C;  2NBF A;  3OIQ A;  4A76 A;  3M4Y A;  4BBR B;  3I91 A;  2EIF A;  1YBY A;  2HDM A;  4EQP A;  4GNX A;  5M5X H;  1NMF A;  3T4A C;  4BS9 A;  1CT1 D;  4F7X A;  5K5P A;  1RIP A;  1V43 A;  1SMX A;  2Q8R E;  3I90 A;  1K8A C;  4B3M Q;  3GV3 A;  3L7Z C;  2I0Q A;  4KV6 A;  3CQZ H;  4DUZ Q;  1CZG A;  1K73 C;  1M4V A;  4YCU A;  2X6G A;  3STB C;  3J7Y W;  4FXG C;  3LGJ A;  5CV6 A;  4GKJ Q;  2MQH A;  1E0B A;  1LAC A;  2LS0 1;  3AEV A;  4JI7 L;  1FVI A;  4KHV A;  4J8Q A;  1Y8N B;  4ID6 A;  3RZO H;  3J81 j;  3CPW A;  2OF1 A;  3D31 A;  1PYW D;  4OWT B;  4CKB A;  4GS3 A;  2JA5 B;  4RKL A;  3K58 A;  4RKB A;  1CZW A;  3TS0 A;  1PH2 A;  4TSS A;  1UEB A;  2E8G A;  2XSC A;  2VB2 X;  2K5W A;  2GA4 B;  2OTL A;  1GJX A;  4K5V A;  2F3I A;  2ATW A;  4XQQ A;  5C3E B;  5KYI A;  1BBU A;  4RGM A;  2EYH A;  2A73 B;  1N34 L;  1STA A;  3S2D B;  2N49 A;  4K5W A;  4Y7N H;  1XMO L;  1XX8 A;  4J1M A;  3A5U A;  3A0J A;  3HOV B;  4DR2 L;  2A6E D;  3LNN A;  1SNO A;  1OXX K;  5A35 A;  2B2U C;  1WVL A;  1FJG Q;  2RKS A;  4UPA A;  5BN4 A;  1BBW A;  3GTP H;  2EE1 A;  1BQQ T;  1R9T H;  4FF3 A;  4IQZ A;  4G7Z C;  4DF7 A;  3ZJY C;  1ET9 A;  2CKZ B;  2L11 A;  3CW2 C;  2VB3 X;  1B50 A;  4G57 A;  1YNX A;  3GTJ B;  1BBX C;  3U50 C;  1GUO A;  2Y0S G;  5C5M A;  1HUM A;  5EJW A;  1S40 A;  2KQ3 A;  1K3R A;  4GOP C;  3I73 A;  2Z4H A;  3EFX D;  3I7F A;  2B2W A;  3A74 A;  4ZYS A;  1TS3 A;  4A3G G;  4FF4 A;  1K0S A;  4WJW A;  4DV1 L;  3TP8 A;  1UE7 A;  3KJO A;  1HNW Q;  4RGO S;  2F0Q A;  2PZT A;  4B08 A;  3HEJ A;  3IAY A;  1EYD A;  2K7V A;  1UWV A;  1YNN D;  2B2V A;  3CU7 A;  4R9W A;  4R8I A;  5IWA L;  4JI6 L;  4EGV A;  2ZJR A;  3MXN A;  3Q0A A;  2PW5 A;  3A8K E;  4HR7 B;  2QIL A;  4G7H C;  3S16 H;  5CMD A;  2VQE L;  5IYD H;  1HUN A;  1JOO A;  2RBM A;  2QA4 A;  4OHJ A;  4C3H B;  4A3I G;  3VR3 A;  2HCC A;  1EOV A;  2B63 H;  2VUM B;  4NP5 A;  3GTM H;  4X3U A;  3T1H L;  3VYT A;  1ROD A;  3JAM i;  1PH9 A;  3GTK H;  1Y1V H;  4XYQ A;  4OX9 Q;  4PG3 A;  1TWH H;  3PUZ A;  4DR7 L;  3S1M B;  3M4P A;  3VDY A;  1H9R A;  1TWF H;  1V9P A;  1F2M A;  4A3C H;  3I4M G;  1CFM A;  3A8I E;  3HOW G;  3DUZ A;  5M3F G;  1AEX A;  2RHQ B;  1PA6 A;  3JAM c;  3NE5 B;  2F52 A;  3PIP 3;  1SEB D;  2ZXR A;  3J80 i;  4KY5 A;  2XNA C;  2B2T A;  2B8G A;  3VR2 A;  2RDH A;  3SGI A;  4HSV A;  2UUC Q;  1QUQ A;  2K28 A;  1HPC A;  4XQJ A;  3V05 A;  1ONL A;  1TWA H;  3EVQ A;  1EOT A;  4HAE A;  1XXG A;  1Y14 B;  1SFO B;  4MIU A;  1ASY A;  3PO2 B;  4X3T A;  1S5F D;  4X65 L;  5EKK A;  4E6I A;  3J80 c;  3K5O A;  3H0G B;  1H9S A;  4BY1 G;  3S1R H;  1N9W A;  1SE8 A;  2EYP A;  4LF9 Q;  5CYU A;  4RMF A;  1MKH A;  3GTO B;  3L3O C;  4QGU A;  3PIO A;  3GTQ B;  5HY6 A;  3UDF A;  4K6D A;  3NTK A;  2DY7 A;  1I3Q B;  3S14 B;  3PSI A;  3KLS A;  3KDF A;  4WRD A;  3PCO B;  2K14 A;  3S2H H;  3A7A B;  2VZA A;  4YWM A;  1U5K A;  2MPM A;  5IE8 A;  2WAC A;  3E9H A;  1O7Y A; 
#chains in the Genus database with same CATH homology
 2LMC B;  1EY8 A;  5M5X B;  1Z7T A;  1BCP C;  5C6A A;  2L55 A;  1MSH A;  3CQZ B;  3QWN A;  1I4X A;  1QWY A;  3QO2 A;  5DM7 3;  1EYA A;  4H7B A;  5BN3 A;  3VR4 A;  4OIK A;  1Y1W B;  3J81 L;  4ZLT F;  2BE5 D;  3VR6 A;  3RZO B;  3NPP A;  1G29 1;  1WTO A;  3TP5 A;  2EY6 A;  1TR5 A;  4L6T B;  2M9V A;  2F0P A;  3JAM L;  4PMB A;  4R8N A;  5JPN C;  1DOL A;  2Z8L A;  3HZX A;  1S5C D;  5EKI A;  3BYT B;  1PDQ A;  1JC7 A;  4M1U B;  1STG A;  5CV8 A;  1X3P A;  1STB A;  2O5I C;  4QB4 A;  4QUC A;  1HFN A;  2N55 A;  4Y7N B;  3S9W A;  1BR9 A;  1L0Y B;  3J80 L;  1IL8 A;  2WP8 J;  2B2Y A;  3NQT A;  1ET6 A;  3BS1 A;  3GTP B;  1R9T B;  1F77 A;  3C46 A;  2NTT A;  1GHJ A;  4V0B A;  3TZD A;  1IHZ A;  3I3C A;  1CK1 A;  2BDO A;  4OO1 G;  3QJY A;  1II3 A;  4U68 A;  3AU7 A;  4B9W A;  3E5S A;  5KRU A;  2NVQ B;  2F0K A;  1YNJ D;  3V2T A;  4CHT B;  1PZK D;  3MA2 B;  2TSS A;  2XN9 C;  1PTO H;  1PTO C;  1WD1 A;  2X69 A;  1K8M A;  3NTH A;  1IYU A;  3S16 B;  1ZYR C;  1A3T A;  2SOB A;  2K6A A;  4IFD I;  2Z4I A;  5ELF A;  1U9R A;  2D5D A;  1RCV D;  3VR5 A;  3M4O B;  3GTM B;  4HN7 A;  3BDL A;  5CBA E;  3GTK B;  1Y1V B;  2SDF A;  4KKU A;  1L0X B;  1SDF A;  2F0F A;  4XQN A;  1TWF B;  4DFA A;  5LL6 X;  3VA7 A;  3X3M A;  1NR4 A;  5K36 H;  2JE6 I;  2E74 C;  4KI0 A;  3Q23 A;  2K5Q A;  4CBV A;  3MVV A;  2D62 A;  5J39 A;  4XDX A;  2IWH A;  1SNM A;  4G4K A;  1Q1B A;  2JYO A;  3H6M A;  1F2L A;  1TWA B;  3IFT A;  1D1I A;  1EU4 A;  1EEF D;  2XWB B;  1ILQ A;  2RA4 A;  5C4Z A;  1C4Q A;  3S1R B;  4K2K A;  2BA0 A;  2C5C A;  3FRP B;  3CRL C;  3SK6 A;  1FNU A;  3K59 A;  4ZUJ A;  2F0U A;  1QG7 A;  3S2H B;  1AZQ A;  5EKL A;  1JQY D;  2K03 A;  3D8G A;  3PUV A;  2QF7 A;  2MHV A;  1CQV A;  1G2S A;  1ILP A;  3M85 A;  1BCP B;  3JAM E;  3S1N B;  1LTI D;  1EU3 A;  4A3E B;  3OWE B;  1MD2 D;  5IGG A;  4PMC A;  1JOQ A;  3I4N B;  2EOT A;  1Q90 A;  1OXV A;  4JBW A;  3MHB A;  5BN5 A;  1CA6 A;  2CHB D;  2IPK D;  2EYL A;  3H94 A;  3J80 E;  3NBH A;  4IUV A;  1VCI A;  1WTP A;  1BO0 A;  4QIW B;  1RD9 D;  2F0G A;  4ZK9 B;  2TMP A;  1SE4 A;  1HQR D;  4OIJ A;  5M5Y B;  1GOZ A;  3E0J A;  4I7Z C;  1M8A A;  1KLU D;  4TRD A;  1B9N A;  2F0S A;  2OT2 A;  4C3H G;  4ZAI A;  2MJ8 A;  4NMZ A;  4KJO A;  3KBG A;  4KKT A;  3WDN A;  1B9M A;  5IOD A;  3GTG B;  2A69 C;  2DNE A;  3I4L A;  4X3S A;  1EZ8 A;  1SYB A;  1JCK B;  3TP6 A;  1VMP A;  1HTP A;  3C3L A;  4K5X A;  5EGT A;  4BBS B;  3GO5 A;  3TP7 A;  4DK0 A;  4NDX A;  5C0X I;  1Q12 A;  1SE2 A;  1I50 B;  3MXP A;  2A6H D;  2VXW A;  2NUC A;  1D5X C;  1EWC A;  4RCN A;  2EVB A;  2IX3 A;  5DM6 3;  4DAY A;  2JA6 B;  1DYQ A;  2NVX B;  1QOH A;  1QIL A;  1WTQ A;  1PTO B;  4GZY C;  2RSN A;  1O7Z A;  1X3Q A;  3WOE A;  1IYV A;  1C48 A;  3TME A;  3EQL C;  5IT9 L;  3PMF A;  2O5J C;  1UAP A;  4ZKB B;  4BA2 I;  3K7A B;  5LL6 S;  2FHT A;  1DOM A;  2WV6 D;  4EQO A;  4IFD H;  5E3F A;  2WKC A;  2RDG A;  2L4N A;  3OOC A;  3GQB A;  1NSN S;  3HP3 A;  1ESR A;  3OHX C;  2F0N A;  2PQE A;  2Q8I B;  1CI3 M;  2E75 C;  3QG1 A;  3O13 A;  2ICE C;  1IW7 C;  2AWN A;  3KUP A;  2QEJ C;  3MZ5 A;  4DGZ A;  2KCN A;  3U9O A;  1J8I A;  2FIN B;  4H44 C;  4LJZ C;  2EXZ A;  2A68 D;  3HOZ B;  2OXP A;  3FDT A;  2LFN A;  1H9K A;  2ZXO A;  3WOF A;  2EY1 A;  4DNT B;  1BNZ A;  3ITP A;  2JA7 B;  2IT1 A;  3HOU B;  3BVZ A;  5G3L F;  3NXW A;  2F0W A;  5M3M B;  1SNQ A;  3M3Y B;  1QE6 A;  2L9H A;  4DK1 A;  2AQ3 B;  1SNC A;  2OEO A;  4CKC A;  1PMR A;  1SYE A;  1KAA A;  1F9R A;  2XVS A;  3SVM A;  1LTT D;  2DY8 A;  4L8J A;  4KN7 C;  4N9T A;  2F3W A;  4TKO B;  4KTA A;  1RDP D;  3DWA A;  4HED A;  5EBD A;  2V4D A;  3RZD B;  2R92 B;  3D4W A;  3SK8 A;  2E2H B;  1HHV A;  1CHQ D;  5A2Q L;  3K0Y A;  1V1P A;  1GXD C;  3F2U A;  4A3M B;  1VF7 A;  4KJN A;  4KMU C;  1RKN A;  4IZ8 A;  2CW0 D;  1BF4 A;  2F0T A;  4LMQ D;  5KIX A;  1EY9 A;  2KHS A;  1Y8O B;  4O1N A;  4V19 0;  1EY4 A;  4QMG A;  1FYC A;  3TN2 A;  4KKS A;  1TY0 A;  4X3K A;  1FD7 D;  4J6H A;  1NCV A;  4XTC S;  5FKA C;  4DN4 M;  2F0M A;  5IT9 E;  1HXY D;  1RHP A;  1A3V A;  1S4Z A;  3IFD A;  3SHL A;  1B4O A;  3DXJ C;  4HCS A;  1GUS A;  5KGU A;  4K8J A;  1F2Y A;  2SNM A;  1CQF A;  3GP7 A;  3ZYY X;  5EQ0 A;  4BY7 B;  2K05 A;  3P7J A;  1PRT C;  4A93 B;  5C0X H;  3J7A F;  4AYB B;  3DHQ A;  1SNP A;  3KBX A;  2JA8 B;  5COY A;  1JOK A;  1EIG A;  2PPB C;  2HCI A;  2O2L D;  1GUT A;  3OPO A;  3W2D A;  4ZUI A;  2KED A;  3HRZ C;  3SK4 A;  2ZT9 C;  3RLF A;  1TS2 A;  4RHS A;  1EY0 A;  1SMY C;  3TZU A;  5D14 A;  4DXF A;  1B2T A;  4K2L A;  2NN6 I;  4FF2 A;  2F0I A;  1QNU A;  4BWG B;  5ISR A;  2K01 A;  3T53 B;  2AWO A;  2D9U A;  5KNC A;  2F1M A;  5DNF A;  4HTH A;  1OO9 B;  5D3D A;  4S3S A;  3NSW A;  4C1N K;  3NTI A;  1STE A;  2K33 A;  1LT3 D;  1ENA A;  3NWS A;  1BOS A;  3NUC A;  1SBB B;  2K04 A;  1NAP A;  4DA2 A;  2D2C C;  4C2M B;  2LY7 A;  5I6Y A;  3J7A V;  3HG9 A;  2QKI C;  1U4R A;  3K5N A;  2YYZ A;  5IGF A;  4FNF A;  1PFN A;  5A2Q E;  1LTR D;  5FO7 B;  2F0D A;  4U67 3;  4K8I A;  3I72 A;  1SE3 A;  5EPJ A;  1WTV A;  3D6C A;  1O80 A;  2R61 A;  1Y69 U;  2ICI A;  3QB3 A;  5COR A;  3SR1 A;  3HOY B;  1WTR A;  1IKM A;  4KY7 A;  3VA5 A;  1VMC A;  1KTK A;  4CJ2 C;  3QOJ A;  1CTM A;  5C44 B;  3CKI B;  4K6L A;  2B63 B;  5D65 A;  2J7Z A;  1SXT A;  5CV7 A;  2B2W C;  3P75 A;  1LTS D;  1TWH B;  4Q5V A;  1STH A;  1MSG A;  2MUY A;  1AN8 A;  3QOL A;  4OL7 A;  2CVR A;  4CJ0 B;  2I46 A;  1LV9 A;  3R93 A;  5K36 G;  1TS4 A;  5T1G A;  2B2V C;  3BYY B;  1Q8I A;  3MXU A;  2HDL A;  4FO2 A;  1RF2 D;  4RAU C;  3PO3 B;  4FXK C;  4H0L C;  2AQ2 B;  5ELD A;  5DAU A;  1U4P A;  2QDB A;  4UAI A;  1V8Q A;  1WD0 A;  4PQX A;  2EJG C;  5C5L A;  1B3A A;  3Q22 A;  1TQO A;  2KA7 A;  1HRJ A;  5T1I A;  4XT1 B;  3VYS A;  3R8B A;  2F0L A;  1PRT B;  1SSO A;  2IJ0 A;  1JR0 D;  3NK9 A;  2NYZ D;  4FYD A;  2B39 A;  5C4J B;  3V96 A;  4A3B B;  2PNR C;  3AB9 A;  1Z47 A;  4LAA A;  1TU2 B;  1B1Z A;  2WB1 B;  1HQM C;  2EDG A;  2RSO A;  4C3J B;  2KJX A;  3W3A A;  5CR3 A;  1GHK A;  3R2I A;  1NUC A;  1I4G A;  2X6L A;  2B2T C;  2EYJ A;  1G8Z D;  3N52 A;  3MAQ A;  1Y8P B;  1KDA A;  1TII D;  2EYM A;  2A74 C;  1BCP D;  1V1O A;  5I4D A;  1QB5 D;  3OMC A;  1SJH D;  2R7Z B;  1HTL D;  5JOB A;  4F88 A;  2FJ2 A;  5F2D A;  1WTW A;  4RFB A;  5IGE A;  3FPU B;  1EEI D;  2XWJ B;  2JEA I;  3P1H A;  2WIN B;  2IL8 A;  3MTS A;  3AMU A;  5CGK A;  4IFD J;  2R93 B;  1OXS C;  2C9O A;  3BDC A;  1R4P B;  3QIA A;  2A6E C;  3GTL B;  1SYG A;  1X32 A;  1PXU A;  5KYL A;  4OGQ C;  3M7G A;  2KEC A;  2NN6 H;  3T51 B;  1DON A;  5JEA H;  1LO5 D;  5JPM C;  1Q1E A;  3OWF A;  1HFG A;  3Q6S A;  2XRQ D;  4IAL A;  1EY5 A;  1PLF A;  1WCM B;  1U4M A;  4ILW A;  4IN3 A;  4IUP A;  5TSS A;  4KN4 C;  3A8J E;  1YNN C;  5G3L D;  4RH6 A;  3SE0 A;  1GUN A;  1ML0 D;  1OXT A;  1LTG D;  3GV6 A;  4B9X A;  3DEP A;  2IW3 A;  5E4X A;  1G6Z A;  2L5T A;  4I65 A;  1PRT F;  3FMC A;  2WII B;  4YIJ A;  1I4Q A;  3DWQ A;  4FVM A;  2BOS A;  3IL8 A;  4Q0F A;  2PW7 A;  1PTO D;  2B2Y C;  2BA1 A;  1ZYR D;  4HCE A;  1TT2 A;  1JWU D;  2JEB I;  1QNK A;  2AUK A;  2NWG A;  5IIF A;  5I9P A;  2KVM A;  3G7L A;  1BCP F;  2RVL A;  3VYU A;  1SYF A;  3MXG A;  3M7N A;  3LX0 A;  2VNU D;  4IFD G;  3A54 A;  3GD7 A;  2G9D A;  3N6R A;  2RDF A;  5CC4 A;  1ZXT A;  5E1F A;  2DNC A;  3DEO A;  1JWM D;  4XXE A;  4WFN 3;  3DMU A;  3LWU A;  2HQE A;  3S1Q B;  4QF4 A;  3NP8 A;  1EFI D;  1SYD A;  1MGS A;  1F2Z A;  5E4W C;  2E2D C;  1T5X D;  2MGS A;  1E2V A;  3D3R A;  1S5B D;  1AZP A;  1FNV A;  4RGT A;  1JWS D;  5EPL A;  1AP0 A;  4EVO A;  2SEB D;  1RTN A;  2BCO A;  1S5E D;  3FEW X;  3KLS X;  2XIW A;  1KDC A;  5C0X J;  2BE5 C;  3A7L A;  1W6K A;  5I6W A;  1UEA B;  3RMH A;  3DWP A;  2F0V A;  5ELB A;  3PUX A;  1Q3L A;  3K57 A;  5J22 A;  4KY6 A;  2NVT B;  5IGC A;  2JXM B;  1JB3 A;  1BDO A;  5M5W B;  2A5H A;  3R2T A;  2H4O A;  5J1Z A;  4IUR A;  1H9S B;  2Z1C A;  1A2T A;  1HCZ A;  4CKE A;  3BG3 A;  1D2B A;  1DM0 B;  4ME5 A;  4IUT A;  4EQN A;  5C3W A;  1H9J A;  1DZ1 A;  4OO1 I;  1H9M A;  1PTO F;  2B8F A;  2PYK A;  1OXU A;  2J4X A;  3MFY A;  2XRS D;  2Q8T A;  4NKL A;  2G9H D;  1DCZ A;  1A2U A;  4RCO A;  1SAP A;  5CBE E;  5NUC A;  1NR2 A;  1BUV T;  1EIH A;  5IGB A;  4IUU A;  1FGB D;  2PZW A;  2M2L A;  4F87 A;  4ULL A;  1T5E A;  3ND8 A;  3DM1 A;  1K83 B;  2CQA A;  2A69 D;  2NB0 A;  1KNA A;  1DJR D;  1YNJ C;  4C3I B;  1AFP A;  1SYC A;  1EY7 A;  4DAP A;  5FLX L;  1U4L A;  2WAQ B;  1O78 A;  1LAB A;  3TSS A;  2O4X A;  4NW2 A;  5HGT A;  4A3D B;  1UNS A;  5C3X A;  3UI2 A;  1D5M C;  3EA6 A;  2K1B A;  3SDZ A;  2E2J B;  1JOR A;  3T56 B;  3OIP A;  1QCB D;  3OW7 A;  1G91 A;  5JVH 3;  1EQV A;  2H1E A;  3A56 A;  2L0C A;  1E2Z A;  5C0X G;  3MC0 B;  4KHZ A;  1DXM A;  4DNR B;  3HS0 C;  3BVG A;  3BZD B;  1HA6 A;  3ERO A;  4IUN A;  4Z9C B;  1QJO A;  3MEH A;  3PIO 3;  5JAV A;  2F0O A;  3NWT A;  4C3J G;  4TQU S;  1XWE A;  5FO8 B;  1I6H B;  3H91 A;  2FMC A;  3SK5 A;  2F0E A;  5IGD A;  2K5D A;  2YU9 B;  5JJZ A;  3S17 B;  2NZ1 D;  2JSO A;  4CGY B;  4A3K B;  1TY2 A;  4C56 C;  3OMG A;  2M00 A;  5CV5 A;  3EJI A;  2FFK B;  5I2X A;  1ZKO A;  1PZJ D;  4XIG S;  1ICW A;  4HSP A;  1VF5 C;  1IW7 D;  1KNE A;  3U9S A;  2EYF A;  5KND A;  1A6X A;  4A3J B;  1PFB A;  4ABN A;  1ENC A;  3KF8 A;  1W6J A;  1HA5 A;  2EYO A;  5DEH A;  4PNY A;  1CA5 A;  3TDQ A;  3SEB A;  1Z6H A;  2RQX A;  4BA1 I;  2KCC A;  5KNB A;  3CHB D;  3D6W A;  1D5Z C;  3SXH A;  4MHE A;  1I4P A;  3BDO A;  4RGN A;  2HUG A;  1MI2 A;  4A3F B;  3K5L A;  4LK1 C;  2FMM A;  1EQT A;  1EYC A;  1CHP D;  1EY6 A;  4H13 C;  5EPK A;  1B44 D;  2EJF C;  4KD4 A;  3FVQ A;  3D4R A;  1S5D D;  1RTO A;  1TS5 A;  1A3U A;  5ELE A;  1SJE D;  3ERQ A;  5AFW A;  1CM9 A;  3T13 A;  3S15 B;  3Q24 A;  3NQI A;  4PV1 C;  1D6E C;  4ZKC B;  5FLX E;  4G7O C;  2Y0S B;  1FNW A;  1FR3 A;  1B53 A;  4OO1 H;  1MBY A;  3ONA B;  3I70 A;  4A3G B;  4QUF A;  2A6H C;  2QCP X;  5CV4 A;  3URY A;  4M8A A;  5JEA J;  2LKV A;  1F9S A;  5LHY 1;  3A55 A;  1RJT A;  2F4I A;  4FXD A;  2MP1 A;  1D1K A;  5I2Y A;  1PZI D;  1IKL A;  2L12 A;  1LTB D;  4MN3 A;  3VYR A;  4A3I B;  1STN A;  2F0H A;  2N88 A;  1I4H A;  2NTS A;  3R3O A;  3RD4 A;  5FOB B;  1ZEQ X;  3CRK C;  2R3Z A;  2NVY B;  3E6Z X;  2F03 A;  1LT4 D;  3I8Z A;  3I4M B;  1LT5 D;  3TBI B;  2JP1 A;  4CJ1 B;  1PRT D;  4HMI A;  3HOW B;  3HGB A;  1XYI A;  5M3F B;  1LTA D;  1ESF A;  1G2T A;  4XT3 B;  1TVX A;  3FPP A;  4C1N I;  3MWY W;  1LLR D;  2PO4 A;  5I9O A;  2F0J A;  3MFG A;  2B2U A;  5M9O A;  2EY5 A;  4BY1 B;  2A68 C;  1SMY D;  4FP5 D;  3KLR A;  5EBC A;  4O42 A;  4F8M A;  3PV0 A;  2EPB A;  4UDU C;  5ELC A;  3J81 E;  2K32 A;  4KK7 A;  4QCL A;  3NHH A;  1EZ6 A;  3PUY A;  4RWS C;  1UUP A;  1WTX A;  4RA8 A;  1TKW B;  1KDB A;  2ENB A;  1JIC A;  3X3N A;  3H09 A;  4ZRZ A;  3FKI B;  2L1B A;  3P20 A;  1EL0 A;  2EY2 A;  2NN6 G;  3C1E A;  1KAB A;  1JE4 A;  5JEA G;  1O7L A;  1GUW A;  3LWE A;  2AUJ D;  3D4D A;  2ZXP A;  5FO9 B;  5CV9 A;  2IX1 A;  4HMJ A;  1TWC B;  5FK9 C;  2KOL A;  4WOR A;  4P2C B;  3G6J B;  4C3I G;  2SNS A;  5JVG 3;  1I6V C;  4ZQ3 A;  3HOX B;  1F9Q A;  1F9P A;  4RHR A;  4JK1 C;  5C4H A;  1I4R A;  3HKZ B;  3K5M A;  2J0T D;  2I07 B;  4PMW A;  3IKJ A;  3RUZ A;  3K6O A;  1VDZ A;  2DN8 A;  1PFM A;  3L9A X;  2CW0 C;  4K14 A;  4KD3 A;  2R6G A;  2WKD A;  1R4Q B;  3C1F A;  2AQ1 B;  2IX0 A;  2BDN A;  2EJM A;  4ODG A;  2EZV A;  1SND A;  1XTC D;  3PUW A;  2PCF B;  1E2W A;  1ENF A;  1BXT A;  1J9O A;  1TWG B;  1AW7 A;  2KUM A;  3T16 A;  1A15 A;  4N9P A;  2E2I B;  5HUR A;  4DU9 A;  1DD2 A;  5C4X B;  1KLG D;  1GUG A;  1DOK A;  5IOC A;  1LT6 D;  4DAV A;  4FF1 A;  3KK7 A;  1STY A;  3C2P A;  2PMZ B;  3BVM A;  4L63 B;  2PZU A;  3NBI A;  5D3I B;  3OSO A;  1K8O A;  2ID0 A;  5KEE A;  4XYO A;  1V1P B;  2KEE A;  1EWH A;  3H3V C;  1C8C A;  3ND9 A;  4IUQ A;  4DXG A;  2F3V A;  2E76 C;  2NBF A;  3OIQ A;  3M4Y A;  4BBR B;  3I91 A;  2HDM A;  4EQP A;  3T4A C;  4BS9 A;  1CT1 D;  4F7X A;  5K5P A;  1V43 A;  2Q8R E;  3I90 A;  3GV3 A;  3L7Z C;  4KV6 A;  1CZG A;  1M4V A;  2X6G A;  3J7Y W;  4FXG C;  5CV6 A;  1E0B A;  1LAC A;  2LS0 1;  4KHV A;  4J8Q A;  1Y8N B;  4ID6 A;  2OF1 A;  3D31 A;  1PYW D;  4CKB A;  2JA5 B;  4RKL A;  3K58 A;  4RKB A;  1CZW A;  4TSS A;  2XSC A;  2VB2 X;  2K5W A;  2GA4 B;  1GJX A;  4K5V A;  4XQQ A;  5C3E B;  5KYI A;  4RGM A;  2EYH A;  2A73 B;  1STA A;  3S2D B;  4K5W A;  1XX8 A;  4J1M A;  3HOV B;  2A6E D;  3LNN A;  1SNO A;  1OXX K;  5A35 A;  2B2U C;  1WVL A;  2RKS A;  5BN4 A;  2EE1 A;  1BQQ T;  4FF3 A;  4IQZ A;  4G7Z C;  4DF7 A;  1ET9 A;  2L11 A;  2VB3 X;  1B50 A;  4G57 A;  3GTJ B;  1BBX C;  1GUO A;  5C5M A;  1HUM A;  5EJW A;  2KQ3 A;  3I73 A;  2Z4H A;  3EFX D;  2B2W A;  4ZYS A;  1TS3 A;  4FF4 A;  4WJW A;  3TP8 A;  4RGO S;  2F0Q A;  2PZT A;  4B08 A;  3HEJ A;  3IAY A;  1EYD A;  2K7V A;  1YNN D;  2B2V A;  3CU7 A;  4R9W A;  4R8I A;  4EGV A;  3MXN A;  3Q0A A;  2PW5 A;  3A8K E;  4HR7 B;  2QIL A;  4G7H C;  5CMD A;  1HUN A;  1JOO A;  2RBM A;  4OHJ A;  4C3H B;  3VR3 A;  2HCC A;  2VUM B;  4NP5 A;  4X3U A;  3VYT A;  1ROD A;  4XYQ A;  3PUZ A;  3S1M B;  1H9R A;  1F2M A;  1CFM A;  3A8I E;  3DUZ A;  1AEX A;  3NE5 B;  3PIP 3;  1SEB D;  2ZXR A;  4KY5 A;  2XNA C;  2B2T A;  2B8G A;  3VR2 A;  2RDH A;  4HSV A;  2K28 A;  1HPC A;  4XQJ A;  3V05 A;  1ONL A;  3EVQ A;  1EOT A;  4HAE A;  1XXG A;  1SFO B;  4MIU A;  3PO2 B;  4X3T A;  1S5F D;  5EKK A;  4E6I A;  3K5O A;  3H0G B;  1H9S A;  2EYP A;  5CYU A;  3GTO B;  3L3O C;  3GTQ B;  4K6D A;  3NTK A;  2DY7 A;  1I3Q B;  3S14 B;  3KLS A;  4WRD A;  3A7A B;  2MPM A;  2WAC A;  1O7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...