2EYLA

Crystal structure of staphylococcal nuclease mutant t82s
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRSDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2eylA00
5IGBA 1TQOA 5EKKA 4ZUIA 1STBA 5I9PA 4PMCA 3HEJA 5KYIA 4K2KA 2EYHA 3R3OA 2F0JA 5CV7A 1EY9A 3NQTA 3EJIA 2EY1A 2F0MA 2EY2A 4K5XA 1EYAA 1SNPA 4KD3A 1SYCA 2F0VA 1STNA 4TRDA 3OMCA 4B9XA 5KEEA 5CV5A 4K5VA 2KHSA 1NUCA 1SNMA 3NK9A 2M00A 3OWFA 3TP6A 5HURA 1F2YA 5IGEA 3MHBA 5E3FA 2QDBA 2PZTA 5CGKA 4ZUJA 4ID6A 4HTHA 3E5SA 3DHQA 3EROA 3S9WA 2PW5A 1JORA 5J39A 1JOQA 3NP8A 3QOLA 2RBMA 3D4DA 4QB4A 2PW7A 3H6MA 1II3A 4YIJA 5KRUA 2F0IA 5EKLA 3EVQA 1A3VA 4QF4A 1KAAA 5EGTA 3HZXA 3NHHA 1F2MA 4K8IA 5I9OA 5CV6A 2RDFA 3DMUA 4EQNA 2EYJA 2EXZA 4R8NA 3TMEA 1SYGA 4QMGA 1SYEA 3P75A 4KJOA 4KV6A 1RKNA 4WORA 3RUZA 2F0HA 3TP5A 4N9TA 4PMBA 4KHVA 4MIUA 2PQEA 4K14A 1A2UA 3MZ5A 5C4HA 1KDCA 4EQOA 5CC4A 2RKSA 2SOBA 5J22A 5C4ZA 4KJNA 1EY6A 1U9RA 1EYDA 5ISRA 2EYPA 2LKVA 3MXPA 4DU9A 3OSOA 3ERQA 5IIFA 3MEHA 3C1EA 3NUCA 2HQEA 2F0GA 2F0WA 4NMZA 5DAUA 2F0PA 4ZQ3A 4OL7A 2F0EA 4J1MA 1JOKA 3SHLA 1SNOA 1A2TA 4KY6A 2F0OA 1TR5A 5E1FA 5KGUA 4DFAA 3SK6A 5C5LA 2F0DA 1SYDA 3C1FA 2EYOA 5I6YA 1A3UA 1JOOA 3SK4A 5HGTA 3TP7A 3SXHA 5NUCA 4I65A 2F0TA 5JOBA 1F2ZA 4PNYA 4EQPA 1SNQA 3D4WA 1EY5A 4NP5A 2PZUA 2OF1A 3ITPA 5IGGA 2F0FA 2OEOA 4H7BA 5C5MA 2NUCA 1A3TA 4F8MA 1KABA 1ENAA 4E6IA 5K5PA 5C3XA 2PYKA 1STGA 4IALA 4N9PA 3SR1A 1TT2A 4HMIA 4RKLA 1SYBA 5CR3A 1EY4A 2EY5A 3P1HA 2F0SA 3BDCA 5C3WA 2F0UA 1SNCA 4F7XA 5M9OA 1STYA 2F3VA 3SK5A 1NSNS 1ENCA 4WRDA 4ME5A 4DGZA 4NKLA 4KD4A 3T16A 1EZ6A 1EY8A 2EY6A 3NXWA 5CV4A 3VA5A 5IGDA 1STAA 2WACA 1SNDA 4HMJA 3D6CA 1EQVA 2EYLA 4KY7A 1EY0A 2EYFA 4DF7A 2F0QA 2ENBA 4NDXA 2PZWA 4K6DA 2F0LA 5CV9A 5J1ZA 4B9WA 5C6AA 5IGFA 5IOCA 5KYLA 5IODA 3SK8A 3BDLA 5DEHA 5KIXA 2F0KA 3LX0A 1IHZA 4G57A 4K8JA 4ODGA 4EVOA 1EYCA 3OMGA 1STHA 2OXPA 2F0NA 1AEXA 2SNSA 1KDBA 3V2TA 5JAVA 2EYMA 4KTAA 3QOJA 5CV8A 3MVVA 3T13A 1KDAA 4J6HA 4RKBA 4KY5A 4S3SA 3D8GA 1EZ8A 2F3WA 2KQ3A 3U9OA 4K5WA 5IGCA 1EY7A 3QB3A 3PMFA 5F2DA 4IUNA 1SYFA 5I6WA 2SNMA 2O4XA 4LAAA 3TP8A 4K2LA 4IZ8A
chains in the Genus database with same CATH superfamily
2AUKA 4ME3A 1X3GA 4CBVA 1H9SB 1K83B 3RMHA 1VQMA 3T1HL 5CV7A 2QW7A 3SEBA 2A73B 2EY1A 4TRDA 2HQLA 1NUCA 2R93B 4YCVA 2JA6B 3S1NB 1E2VA 3KLWA 4A3GH 1Y14B 1DZ1A 2JA7H 2WB1G 1R4QB 5J39A 4OELB 1YITA 3QOLA 2C9OA 1Y1VG 2SDFA 1JWUD 4YWMA 4POGA 4DUYQ 2IL8A 1SN8A 2C35B 1C9OA 4FXKC 1IYJB 5C4XH 1EIYB 4KV6A 5A2QL 4PMBA 4XYOA 3EA6A 1N8RC 1K0SA 3S2HH 5FJ8G 2G5DA 1JCKB 3S14H 2JA6H 5EBCA 1I4QA 1SLJA 3H09A 3CC7A 2VXWA 1EUJA 1CTMA 1YJNA 1YHQA 1B50A 2R93H 4AIMA 2NVTB 1LACA 1GUOA 1PMRA 5C5MA 2NUCA 1HZCA 2EJFC 1SDFA 2FINB 2VQEQ 3MTSA 3GTPH 5I2YA 1MD2D 1WOCA 1LTLA 4U68A 3E3XA 2L9HA 4A3KG 2M2LA 4C3JG 5LL6X 2H1EA 3PCOB 3M4OH 4KD4A 1EZ6A 2NVYH 4IPGA 3CCSA 2E5LQ 3HP3A 1KTKA 1EU4A 2F0QA 4EVOA 1G2SA 2K5HA 1EWCA 1NAPA 1QJOA 4BXXG 1ZEQX 1HNZL 1PZID 4LFAQ 4H44C 4JI1L 1I4HA 3RZDH 2ZJPA 1TS2A 4CGYB 4P71A 5IYBG 4FYDA 2PQAA 4UAIA 2RDHA 2JEBI 5EKKA 4A3IH 4BY1H 1SROA 4CKBA 1HXYD 4FNFA 3R3OA 3L9AX 3NBHA 3NQTA 4CKEA 3AFQA 2E2DC 3Q0AA 3H15A 4HJ8A 2DNEA 4JI0Q 4B9XA 3GTKH 3PUXA 1Y8OB 3I3CA 4O1NA 4DV1L 1DD2A 2QDBA 1BNZA 1VS0A 4HCEA 4B3SQ 1PFSA 1SJHD 4UP8A 4QY7A 2K6AA 3NP8A 2OTLA 4AH6A 5KRUA 1V1PA 1RTNA 2AWNA 1CZGA 2VS1A 4OXPA 4B3RL 4J8QA 2F4IA 2EXZA 4P74A 1CHQD 3VR4A 1CSPA 1M4VA 3G7LA 4A3DB 2JA5G 2KUMA 2IX0A 2UU9L 1DXMA 1I6HH 2UXCL 5DAUA 3ZYYX 4FF4A 4DV5L 1Q86C 3NPPA 4YY3Q 5C5LA 2Y0SB 3A7AB 1C7YA 3PO2B 1JE4A 1Q90A 3GDEA 2RHQB 3S2DB 4KN4C 4JYAQ 1HQMC 2SEBD 3JAMi 2Q8RE 3NTHA 3S1MH 1A3TA 1D8LA 3M85A 1JICA 4Z9CB 3CD6A 3PUWA 3EN2A 5CR3A 1EY4A 1VQ8A 3SK5A 4ALPA 1TWAB 4RWSC 1YJWA 1I3QH 4OEMB 4AQYQ 1JJCB 2JE6I 3I55A 1U4RA 3J81j 5M3MB 1E24A 2ZM6Q 1G8ZD 2F0LA 3BVZA 4A3FB 3Q22A 4JV5Q 1STHA 4QL5A 3CRLC 2ASBA 3E0EA 3DUZA 1VQPA 1MSGA 2KQ3A 3HKZG 1JC7A 1TWAH 5IGCA 3TS0A 4IUNA 2NVQB 2A19A 3FVQA 1K8AC 3UE0A 4R4QA 3K7AH 1TQOA 3PQIA 5T1IA 3A55A 4DV4Q 2BH2A 1DOMA 2IPKD 2IW3A 4JI2Q 4K0KQ 3I91A 4X64Q 1V1QA 4MNOA 4FDBA 4K6LA 3RN5A 2K52A 4DV7L 2EPBA 1BUVT 3NK9A 1BBWA 3I8ZA 4BWGB 3MAQA 1F9PA 2OQ0A 3K0XA 3M4QA 1SMYC 3SGIA 5C0XJ 2YU9B 2JP1A 5FO7B 1WVLA 1RDPD 4RAUC 1KAAA 2KCTA 4DAYA 3U9SA 3DMUA 1BCPF 1YZ6A 1L1OA 1MSHA 3PUVA 4WORA 3RUZA 1E2ZA 3TP5A 3WWVA 4JOIC 3BVMA 3KLSX 3R2IA 4XDXA 1JJGA 1I4PA 1YHAA 3RLNA 1D5ZC 1Q46A 2B2TA 1LV9A 4DK3C 4JI4L 4IFDG 4LF5L 2EYPA 4DU9A 3HOXH 3JAME 2AQ2B 3CHBD 3RLOA 4QCLA 4JI8L 4LF6Q 2F0PA 1UEAB 3J80L 1I6VC 4QGUA 5E1FA 5ELBA 4QUFA 2F0DA 4C3IG 3RZOH 1PFMA 5AFWA 1Y8PB 3SK4A 4OONA 2E75C 4DAPA 4DXFA 2ALYB 1VF7A 2BA0A 4R4TA 3D4WA 1SFOB 4WFN3 2RQXA 5M5XH 2TMPA 1QVCA 2XWJB 4F8MA 4LMQD 1IBKQ 3H3VI 4DAVA 4A3DG 3L0OA 4RCNA 1T5EA 2BOSA 3MA2B 2B3GA 3W1BA 1HJPA 2F3IA 4R1JA 1DM0B 4FXDA 4A3DH 1EY8A 5C44H 1HA5A 1D2BA 2PPBC 2HD3A 3VA5A 4XQQA 3PF5A 2NTSA 5FK9C 4A3BH 3GTMB 1X3QA 4B3SL 3S17H 2N88A 5C4XG 4X3UA 2EIFA 2JJQA 1FNUA 3U50C 2I5MX 1TWCB 4ODGA 2Z0SA 3RLFA 4GN5A 2OWOA 1MJEA 3PO2H 2PCFB 4IURA 3WOFA 4RG1A 1KIXA 2XRSD 4U673 4LF7Q 1SXTA 3W3AA 1YHBA 2AKWB 3MXUA 5IGBA 2R92G 2R7ZH 1EY9A 3IRBA 2B2TC 2CWAA 4LF4L 3ER0A 4K5XA 2F0VA 4DR6Q 4DR7Q 1AE2A 5CV5A 2Q2HA 5ELCA 2JYOA 3L3OC 2UUBL 4Y7NB 1S5ED 4RGOS 2PW5A 1PH5A 2MQHA 2RBMA 2LXJA 1P16A 4YHHQ 4YIJA 2VUMB 1XTCD 1VQOA 3NHHA 3S2HB 1F2MA 1W2BA 1QUQB 4EQNA 2UU9Q 1ASYA 4A76A 4R8NA 2K7VA 3UE1A 3GD7A 1D7QA 3D6WA 4N9TA 3J81L 4NW2A 2L15A 5IYBH 3CCUA 1HR0L 2K5NA 5CC4A 3I56A 2Z6BA 1EY6A 2B2UC 2NVTH 1N32Q 4A3KH 5BR8Q 5ELNA 2ZTEA 4JK1C 1A2TA 2QA4A 1TY0A 1I5FA 1S5CD 4P73A 2RA4A 5KNBA 4ZLTF 1O78A 4OIKA 2QEXA 3D4RA 1YJ9A 1GUTA 4CJ1B 2UXDQ 2K1BA 4BBRH 5CBEE 1ONLA 1FNWA 3P1HA 2B63B 3BDCA 2M9VA 2XVSA 2RSOA 3A7LA 2G9DA 5I2XA 1NNXA 1U5KA 1WTXA 1SFOH 1HR0Q 2ZXRA 3GTPB 3D6CA 4ZRZA 1P8LA 1KAWA 4HJ9A 4NDXA 3QWNA 4CKCA 1N32L 3VYSA 3RZDB 1A63A 4MZ9A 2Z6KA 3J80c 4K8JA 1EYCA 3OMGA 4X65Q 4RGTA 2EQSA 3KBGA 3MVVA 2P5ZX 1PRTF 1IYUA 5AJ3L 2B2WA 3RR5A 3PIO3 4LUZA 2KA7A 5DNFA 2QCPX 2LS01 5JPNC 2JA5H 5EPJA 1A6XA 2FMCA 1CKNA 5LMUQ 4DV3L 4M8AA 2Z9HA 2K33A 1PV4A 1BF4A 2Z1CA 2MUYA 1SJED 4HCSA 3F2BA 3H91A 2CHBD 1B4OA 1PFBA 4IJLA 4LF9Q 5CGKA 2KENA 1JB7A 1K9MC 1QCBD 1YNJC 1NMFA 3JAML 4DA2A 5IT9L 2PW7A 4X66Q 2NYZD 1M8AA 1BXTA 3F2DA 5KNCA 1GXDC 3TEHB 1A0IA 1K8OA 1RL2A 1BKBA 3BS1A 3FKIB 4IUVA 4KJOA 1Q12A 2B29A 4CJ0B 4G7ZC 1W6KA 1HZBA 1A2UA 2MFIA 2VY3A 5J22A 1GHJA 4KKTA 3J7A5 3HOWB 2NN6I 3M4YA 3CQZB 4NMZA 1V8QA 1UWVA 2KECA 3H0GB 1BO0A 1EQTA 1D5XC 3K81C 5IE8A 2E2HH 3TP7A 1W6JA 2UXBQ 5JOBA 4PNYA 3PGZA 1K28A 1QZGA 2K5WA 4UHVA 2QKIC 5T1GA 5IGGA 3T4AC 1OXTA 4B3ML 1MGSA 1SEBD 2D0PA 4A3EB 4G4KA 4C3JH 4N9PA 1VF5C 3HOYG 3P20A 4L63B 1BVSA 1WCMB 1MJCA 1PLFA 2IWHA 2F0UA 1PHJA 4HIMA 3S15B 1K8MA 1L0XB 5C0XH 4KHPQ 4WRDA 1EOTA 4KMUC 2AMCB 4ME5A 4GKJQ 4C1NI 4DR4Q 1I4GA 3X3NA 1Q8KA 4I7ZC 4MTNA 1AZPA 3I90A 5ELFA 3I7FA 1EQVA 5M5YB 1EY0A 2KEEA 3GTQB 1E1OA 3I4NB 3B6YA 3K5LA 2K75A 1D1IA 2BH8A 4CDEC 4IOCA 1VQDA 1PTOD 5IT9c 2KHIA 4LF4Q 4ILWA 5JEAH 2B63H 2CW0C 2D9UA 2NN6G 2YU9H 4EQ5A 3MEFA 3HOWH 1TKWB 4GN4B 5LMNQ 1RD9D 2IHEA 5GQOA 4NXMQ 3CCQA 1D6EC 3U4ZA 4GOPA 3S15H 3KF8B 4LK1C 3U58A 5CYUA 1N34L 2E76C 4O2DA 3HEJA 1M1KC 1QE6A 1PXUA 2V1CC 3KDFB 4X62Q 4KKUA 5I4DA 2NZOA 1HZAA 4K5VA 1R4PB 3CRKC 4DV4L 5IWAL 4IQZA 1AE3A 1GO3E 1KNEA 3FDTA 5EPKA 3HKSA 4ZUJA 3S9WA 3DHQA 4GNXB 3CCJA 3UI2A 3R8BA 4HIKA 1TIID 1EFWA 3K57A 2F0IA 2QF7A 2KBNA 5FLXc 2HCCA 4GOPB 1G6ZA 5M3MH 4NPSA 1SSOA 3HZXA 1IKMA 2RDFA 5C0XI 2HDMA 4QMGA 1E7ZA 1X3FA 3DWAA 1RKNA 1V9PA 2ZJRA 1PYWD 3OIPA 1ILQA 5JJZA 4EQOA 1XPRA 3FKIH 4PV1C 1QG7A 4RH6A 5EQ0A 3ERQA 4A93B 3MEHA 2Y0SG 3M3YH 2F0WA 3FPPA 2FFKB 3PO2G 3DM3A 1LABA 1QUQA 2H4OA 1Q1EA 2LXKA 4G7HC 1IW7D 4DUZQ 1JOOA 1PTOB 2EXDA 5BN4A 2F0TA 2XNAC 3ITPA 1L2FA 3MXNA 1B3AA 4X3KA 2AQ1B 2VQFQ 2MP1A 3VYRA 1CM9A 3IAYA 2RSNA 2D5DA 1HTLD 1O7YA 4F7XA 2F3VA 1FD7D 1LTGD 4DGZA 3PIPA 3AYHB 3X3MA 1GM5A 3M9BA 5C3EG 1LT6D 3CP0A 2GN5A 1O7IA 5JVG3 1B1ZA 4OHJA 1S40A 5J1ZA 4N8FA 5ELOA 3A5UA 3S1RB 1WTWA 5DEHA 1UNSA 4X66L 2F0KA 1XNRL 1VQ7A 1HPCA 2OXPA 2F0NA 2JXMB 2WAQG 3EQLC 4DR3Q 4KTAA 4A3BB 3QOJA 1AFPA 4J6HA 3F1ZA 1VQKA 2WFWA 1B70B 2XWBB 2F3WA 4JI1Q 4IFDH 1AW7A 1HH2P 1MIUA 2CH4A 3BZKA 5C3XA 1Y1WB 4DV1Q 2BE5D 1HQRD 1STBA 1K3BC 4DR1L 1Z6HA 1G51A 3NQIA 3TQYA 5K36G 4A93G 4IOAA 4DNIA 1EOVA 2Z8LA 2B2VA 1VQAA 3NTKA 1ZXTA 4TSSA 3O13A 1XTDA 1A3VA 2LSSA 1VQGA 3GTOH 2ICIA 2F52A 2I5LX 1N33Q 5A35A 3Q24A 3P75A 1XPOA 2WKDA 4HJ7A 3HRZC 3RNUA 3HOZB 4O42A 2RKSA 4Y52H 1N33L 4P75A 4HJ5A 3V05A 1Y1WH 5EBDA 1L1OB 3C1EA 1N36L 1IBLQ 1QNKA 2ZT9C 2K03A 4DN4M 1JQYD 3KOJA 4BY7H 2K28A 4H0LC 2F0OA 4YY3L 3SK6A 3M3YB 1QVGA 3MFYA 3SXHA 4ZKBB 1WTOA 3H94A 4EQPA 2E8GA 2MO1A 4NP5A 4A3BG 2HIXA 4LNQA 2NVQH 4KHPL 4LJZC 3M7NA 1B2TA 4JCVE 1ENAA 4ZCKA 4F88A 4CDFC 2BDNA 1SYBA 1CT1D 4RMFA 3GTKB 3DWPA 3J80E 3ERSX 1STYA 3F2CA 1N9WA 2A68D 3A8IE 4JBJA 1BCPC 3UDFA 1XMQL 5LMUL 5C4XB 3KF6B 2XRQD 5CV4A 2GVBA 4R9WA 1STAA 2WACA 4HMJA 3NWTA 1I94Q 2EYLA 3A56A 5G3LF 5LHY1 5CV9A 2PZWA 1J6QA 1PH8A 3KJOA 3S1QH 5IODA 5KIXA 1JE5A 1EU3A 3TZDA 3E9IA 4X3TA 2I46A 1CKOA 4RKBA 4S3SA 1BBXC 4LFBL 3TZUA 3HOXG 1EZ8A 3TBIB 1EWIA 3QB3A 5F2DA 1RTOA 2R92B 3G6JB 2O4XA 3I70A 1AN8A 2YTXA 4PZ8A 3CCEA 3Q23A 5M3FH 5BN5A 3M4OB 3K7UC 1U4MA 1YVCA 3OMCA 3IL8A 1EEID 5KNDA 4GN3B 1XMQQ 2GVAA 1B7YB 4LF9L 1LYLA 2YTVA 4LF7L 1WFQA 3HOZH 1FJGL 4BXXH 2O5IC 4JBMA 2A6HD 4LF5Q 1Q81C 1SYGA 4XQNA 4BBSB 3PV0A 3QIAA 1IL2A 4GLXA 4HR7B 1SMXA 5C4HA 1CI3M 4HSVA 1PH3A 2A69D 4IUPA 2XIWA 3J81E 4XIGS 3OYYA 1TWFH 1EYDA 3QJYA 2CH4W 2F4VL 3G48A 2QEJC 4OWXB 5IP9G 2YYZA 2NN6H 1JOKA 1XNRQ 2AQ3B 3K5OA 1GD7A 1DGSA 4L6TB 3N52A 5NUCA 3J80i 4A3IB 1PH9A 1SNQA 1NTGA 1LM0A 2UUCL 4JI5Q 3KF8A 4C56C 3FKIG 1HNWQ 1TWFB 1SBBB 3W1GA 5EKIA 1VQ4A 1IBML 1XMOL 3K7AB 4YWLA 4RGMA 3NXWA 1RJTA 2ZXOA 2PQAB 4A3EH 1HNZQ 4B08A 1HA6A 1PYSB 3MWYW 3STBD 4DR1Q 1CA5A 1S72A 2JEAI 3LX0A 5HGQA 4XYQA 5JAVA 2Q8IB 1T5XD 1Y1VH 3CC2A 4DV0L 4KY5A 3D8GA 3H0GG 1SE2A 4R4OA 4AQYL 1GUSA 5GAGC 2SNMA 4DV2Q 2L55A 2K04A 2N55A 1HTPA 4X6AH 4APVA 5GROA 1MKHA 2R92H 2R7ZG 2EY2A 4XQJA 1PZJD 3OIQA 4A3MG 2JA8H 1ESFA 2CWPA 2M00A 4I7AA 4LF8Q 2ZXPA 2PZTA 4C3JB 5IP7H 4GKKQ 3EBEA 1NMGA 4FF3A 1JORA 2A74C 3D4DA 2R6GA 5EKLA 1S5FD 1FL0A 3PUZA 1TWGB 1JR0D 3KLSA 3CQZH 5D65A 3QR8A 1AP0A 1W3SA 3TMEA 3CPWA 2QGQA 1ML0D 2ZM6L 5FO9B 2E5LL 2K01A 3C2PA 3E9HA 1X32A 3G6EA 1F2LA 3MZ5A 3HG9A 4DUYL 3HFZB 5ISRA 1EIGA 5FLXL 2I0QA 1XPUA 1WTVA 3AEVA 3K6OA 1AZQA 2JA8B 5KGUA 5JJKA 1SYDA 5M5WH 4DR2Q 2RDGA 1O7LA 1TWHB 2D62A 1I4XA 1KNAA 1VQNA 3ND8A 2K05A 2KVMA 4QQBX 2NVYB 1U4PA 3S16B 1SMYD 1IKLA 4J15A 4A3KB 4DUZL 5K5PA 1U4LA 1I50B 1TT2A 1X56A 2F03A 2C5CA 1B44D 2FXQA 1CZWA 1PRTC 2K4KA 3DEPA 3GTGH 5IGDA 3GTLH 1LTTD 3HOUG 1K3RA 3WOEA 1TXYA 2XGTA 4KY7A 2LMCB 3A54A 3VR6A 1DJRD 3PO3G 1BR9A 5C6AA 2JA5B 4DNTB 1EL0A 5IGFA 2DJFC 3SK8A 5DM63 4FF1A 3CKIB 2J0TD 4HIOA 3EFXD 1EEFD 1F9RA 3NTIA 4GZYC 2DGYA 2NVXB 3G71A 3GTGB 1F9QA 1LTRD 1SYFA 3S1QB 4TVAB 3TP8A 3T51B 1IZ6A 1E2WA 1TS5A 2KJXA 2OT2A 2Q8TA 2L4NA 4DV5Q 2F0MA 2ID0A 4JI5L 2LY7A 4DXGA 3H0GH 2NZ1D 2MPMA 1X54A 3DEOA 3MFGA 3DM1A 1PH7A 4JVZA 3AFPA 4KN7C 5E3FA 2O5JC 1XJVA 1B53A 3E5SA 4NXML 3QO2A 5M5WB 4DR7L 1II3A 1Z9FA 2BCOA 1B9MA 2HDLA 2R61A 2CQAA 2KCNA 4BBSH 5I9OA 1T9HA 2QILA 4JI4Q 3ULJA 4IFDI 1O80A 1E0BA 2UXCQ 4TQUS 3T53B 3I4MG 2RVLA 1BDOA 1VQFA 2R7ZB 2UUCQ 5JEAG 1L1OC 4JI7Q 4DK1A 5IIFA 1M90C 4A3JB 4OIJA 1VQLA 1BQQT 2R7FA 1SNOA 3SHLA 4OO1H 1NY4A 2A8VA 2EJMA 2EYOA 3KF6A 5I6YA 2K5VA 1CKMA 3GV6A 2B2WC 4V0BA 3SVMA 3KLRA 4I65A 5IYDH 1EY5A 3OOCA 2IT1A 3H3VH 3GTJH 4AYBB 3D31A 2R7DA 3RD4A 2BE5C 2PMZE 1SE4A 3LNNA 2WV6D 1FGBD 3KDFA 1WD0A 5JVH3 1BBUA 4DAMA 3VR2A 2L11A 1RCVD 3GV3A 4LF8L 4LW1A 1WD1A 1JT8A 1QOHA 5C4JH 3I4OA 1A62A 1EFID 1VQCA 3ULLA 3BVGA 4X62L 2UUAL 1H9RA 4JI3L 2Q2TA 4K6DA 2JA9A 5IYCH 3HOZG 1HNXQ 1FVIA 1VQJA 1RHPA 5M3MG 1WTHA 3NSWA 3V2TA 3G4SA 2EYMA 2KOLA 2L0CA 5IP9H 3T13A 4A3FG 4O0AA 1WTQA 5K36H 4XT3B 1Y1WG 1PRTD 4CDCC 3HOYB 5GAEC 3NELA 4DR6L 1NR4A 4OGQC 3HKZB 1J9OA 3KBXA 1BOSA 1HFGA 2Q2UA 3K5NA 4KI0A 1LUZA 3EJIA 4IPHA 4QJFA 1H95A 3VYTA 4YHHL 4IO9A 4RFBA 4N8X1 1JB3A 1NE3A 2UXDL 1GUNA 4ZK9B 2IY5B 4A3MH 4IUTA 4DV7Q 4OX9Q 1H9SA 4QB4A 1NR2A 4CDDC 4DR5Q 1I6HB 2WAQE 3CMAA 4X65L 2K32A 2IX1A 3J7AV 2EOTA 2WINB 3M7GA 4JOIA 4IPDA 2VUMH 4KHVA 4DAYB 1CFMA 1WCMH 3HOXB 4HJAA 3DXJC 1VCIA 1TS4A 2JSOA 2E74C 2K14A 4WJWA 3OSOA 2F4VQ 3JC66 4CHTB 2N3SA 1HRJA 4KY6A 3SE0A 3J7AF 5ELDA 3K58A 4ZKCB 1H9MA 2PNHA 3C3LA 1OO9B 1B9NA 3N6RA 4OO1G 2N78A 3OHXC 1B8AA 2Y0SE 4OWWB 1G91A 2F0FA 5A2QE 1RF2D 4A3JH 1R9TB 3UDXA 2ICEC 3CPFA 5FKAC 2VUMG 1FGUA 1HHVA 5C3WA 2F0SA 3T1YQ 4UP9A 4EX5A 4NKLA 2PMZB 4A3JG 1CKNB 4MN3A 2UXBL 4BBSG 4RHSA 4DNRB 2PO4A 2EYFA 4A3LH 3S1RH 2R3ZA 1LTAD 3VDYA 1YNND 1IHZA 2K5QA 2NB0A 5EPLA 1ET6A 2OQKA 2SNSA 1KDBA 4P72A 1LT4D 1YI2A 5DM73 4F87A 1IXRA 2PI2A 2VB2X 3CU7A 1VQIA 5D3IB 2H5XA 1SAPA 1RIPA 4POFA 3FRPB 1I94L 3EIVA 4HSPA 2IHFA 1QILA 5GAHC 4A3IG 1X9NA 5H1SE 2MNAA 2ES2A 2E2JH 4K2KA 1DOLA 2F0JA 1WTPA 1PH1A 4RA8A 3HS0C 3GTOB 3HKZE 5LL6S 1VMPA 1KD1C 3H3VC 4KD3A 1STNA 2NVXH 3UDIA 1S3OA 3BYYB 3TP6A 4C2MB 4JC0A 1F2YA 4A3CG 1X6OA 5FO8B 2B63G 1PVOA 1KHIA 3NBIA 5FOBB 3QG1A 4HTHA 2YV5A 2D2CC 1IBMQ 2G9HD 4B3TL 3A8JE 3H6MA 3P7JA 4LWCA 1D5MC 5D14A 5EGTA 3HOUH 4K8IA 1WI5A 3AMUA 4LFCL 2L5TA 3TRZA 2FJ2A 3J7ZC 4B3TQ 5CMDA 1IBLL 3I73A 1I50H 3HOVB 1EIFA 2CCZA 4H02A 3NEMA 5JJIA 1V1PB 1UE6A 5C4ZA 1TU2B 1N34Q 4A3MB 1N36Q 3NUCA 1Z47A 1TWHH 2F0GA 3PIOA 1CA6A 1MBYA 2DN8A 2B39A 3S16H 4J1MA 3JAMc 4JV5L 1TWCH 1XXGA 4DFAA 1S5DD 4JW0A 5IYCG 1DYQA 1FR3A 4BA2I 1ENFA 1H9KA 2TSSA 2D0OA 2PZUA 1LT3D 3BDOA 1KABA 3KJPA 4JBKA 1JJ2A 1S5BD 2NTTA 2CKZB 5JJLA 3SR1A 5GADC 1IW7C 1UE7A 3IFDA 1ESRA 1SNCA 4DV0Q 1YIJA 1TWGH 1GUWA 3VYUA 4FF2A 3HOVH 2B8FA 1SR3A 4C3HG 1PFNA 1KC8C 1Y8NB 3LGJA 4LUOA 5M5YH 1ICWA 1KRTA 4DF7A 3A8KE 2Z6KC 1PZKD 1U0LA 3AU7A 5IOCA 3CCMA 3BDLA 3OWEB 1ICFB 5KEEA 4UY8C 1IL8A 3VR5A 4M1UB 1GVPA 3GTQH 1FNVA 4Y7NH 2B8GA 4WJ4A 5E4WC 3SDZA 4XT1B 1PH4A 1VMCA 2JA8G 2EJGC 4C2MH 3U9OA 2N49A 2OCEA 2K50A 3PMFA 3R93A 3PF4A 3ND9A 3PSIA 4DR3L 1AH9A 1PYBA 4B9WA 3BJUA 3KYHC 4BY1G 2HT1A 1KXLA 1Q7YC 4PMCA 2A5HA 3GTLB 2QDLA 2EYHA 1XNQQ 4FXGC 4JI8Q 4LF6L 1ZYRC 1WYDA 1SNPA 1JWMD 4QIWB 1SYCA 2VB3X 2JQOA 1VQEA 3OWFA 3K59A 3PO3B 4IFDJ 1V1OA 1HZ9A 4LUVA 4IUQA 3T1YL 2OTJA 1MI2A 1UUPA 5FLXE 3CMEA 4A3GG 1Q3LA 1JOQA 1YNXA 3LWUA 4L5QA 2B2YC 2EZVA 1QNUA 3EVQA 1IBKL 3R2TA 2B2YA 1NCVA 3C46A 4QF4A 3CCLA 1G2TA 4GS3A 3GTMH 2CQOA 4HIDA 2PNRC 2Q2IA 5C44B 1SYEA 3ICEA 2RF4A 4HAEA 4KHZA 1YBYA 2A6ED 1TS3A 3HOWG 4PMWA 4GLAC 2PQEA 1V43A 4K14A 4RHRA 3S14B 4XTCS 1G6PA 2CVRA 2DJGC 5EJWA 4DV3Q 2Z4HA 4LFCQ 2VNUD 1U9RA 4MTKA 1DONA 2XN9C 4C3HB 4GOPC 3BZCA 1Q82C 5D3DA 1K73C 3UDGA 4Q5VA 3DWQA 1KLUD 4DK0A 3L2PA 4OO1I 2JA7B 3PO3H 5E7NA 2ATWA 4MHEA 1UE1A 1LTSD 5C4JB 5L37A 5FLMG 4JI0L 3CCVA 3KUPA 1EQQA 1F77A 3FP9A 4A4IA 3HOVG 4BA1I 5IY0A 4IALA 4PG3A 1NBWA 3I4MB 4HMIA 1PTOF 3F8TA 4JYAL 3AB9A 4PZ6A 1NSNS 4B3MQ 1G291 2J7ZA 3T16A 4KK7A 3IKJA 4JPBW 2FMMA 3K8AA 5J3BA 3S24A 5IWAQ 1WCMG 1MHWC 1K83H 2RCFA 5FLMH 1YEZA 2A69C 3FMCA 2KEDA 3KK7A 4X64L 4JI6L 2R93G 2ENBA 4XXEA 1E3PA 3OW2A 4JI3Q 2JA6G 3WDNA 5LMNL 3FHWA 1VDZA 1DOKA 5FJ8H 1ASZA 5IP7G 2CW0D 1VQ5A 2O2LD 1Y1VB 4JI6Q 1Q1BA 3W2DA 4AYBG 1XX8A 1BCPD 1RODA 2MJ8A 4K5WA 1KRSA 1QVFA 1YNJD 1XMOQ 1VQHA 4LAAA 4IZ8A 1GOZA 3S17B 4UP7A 4LFBQ 4R4IA 1D1KA 1ZYRD 3FEWX 4X3SA 2X69A 5M3FG 1IYVA 4ULLA 2UUAQ 1J5EL 4L5RC 1CSQA 3OTOQ 4NXNQ 2V4DA 1PH2A 4L5SA 2HIVA 4DR4L 4GKJL 5IGEA 2FHTA 4QIWE 4ID6A 1EYGA 2AUJD 1UE5A 5C3EB 3J81i 2DY7A 1OXVA 1EQRA 5EAYA 4C3HH 2K5DA 3TS2A 1C4QA 1STEA 4JBWA 1HUNA 3I4NG 4MIUA 3I4LA 1KDCA 4BBRG 2WIIB 3NE5B 1WTRA 4KJNA 3MC0B 1CUKA 1FYCA 1FJGQ 2GA4B 2N8NA 3GTJB 1C48A 2IX3A 3C1FA 3S2DH 4NXNL 3OTOL 1SE3A 3I2ZA 3L7ZC 3Q6SA 1K0RA 2LFNA 4BY7B 4KLKA 5C44G 2VQEL 3PUYA 3GO5A 3ONAB 5E4XA 2PYKA 1DCZA 1XNQL 5HY6A 5M9OA 4OWTB 4DV6Q 3U4VA 4DR5L 2NWGA 3A5ZB 5M3FB 4ZYSA 3CAMA 2KCMA 1SNDA 1I4RA 2WP8J 2BDOA 4LFAL 2WB1E 3T56B 5AJ3Q 4JI2L 3GP7A 1CQVA 3LWEA 3IFTA 1HNWL 4GLVB 1PTOC 1J8IA 2F1MA 1AEXA 1CQFA 1WJJA 3OPOA 4A3CH 3TREA 3W5OA 2EE1A 2X6LA 2I07B 3TDQA 4YWKA 1LLRD 1QZHA 1R9TH 1PDQA 5I6WA 2VQFL 4K2LA 4ZUIA 5KYIA 1L0YB 4RGNA 2VL6A 2RHSB 3ULPA 5ELEA 4BBRB 3HOUB 2I5HA 3F2UA 4DV2L 1VQ9A 5CORA 2XTIA 3CXCA 4IUUA 3D0FA 5HURA 3E6ZX 1O7ZA 1PTOH 2RCNA 4H13C 4PZ7A 3S1NH 4KKSA 1J5EQ 2BA1A 1TY2A 4L8JA 4A3LG 4NB3A 4A93H 1GUGA 3CCRA 1HCZA 1K8GA 1EWHA 1YNNC 4K0KL 2UUBQ 4JI7L 5CV6A 2EYJA 3V96A 4HN7A 1KQSA 2VW9A 1S4ZA 1SE8A 1HR0W 2F0HA 3J81c 3PIP3 2L12A 2EVBA 1KLGD 2AWOA 2SOBA 1A8VA 1QWYA 1E1TA 5C0XG 4JG2A 2LKVA 3MXPA 2WAQB 5BR8L 2XSCA 2YTYA 1H9JA 3T1HQ 2ZTDA 2A68C 2A1AA 2F0EA 3RZOB 1TR5A 2B2UA 1A3UA 1CHPD 5HGTA 2ZJQA 1UEBA 1Q8IA 1QB5D 1F2ZA 1L0WA 1JMCA 1KL9A 5IYDG 4C3IB 2VZAA 2E2IB 2OF1A 2MGSA 2OEOA 4Q0FA 2AHOB 1EIHA 1SRUA 3CF5A 4DR2L 4UPAA 3DLLA 1X3PA 1GJXA 1OXUA 1STGA 3TN2A 5BN3A 1VQBA 1ZKOA 3D3RA 2E2JB 1X55A 4QUCA 4A75A 5JEAJ 3M4PA 2KHJA 3BYTB 2IJ0A 2B2VC 5M5XB 3E0JA 1OXSC 4DPGA 4FO2A 2J4XA 1F9SA 2DUDA 4ZAIA 2EDGA 5KYLA 1B3QA 1PH6A 2DNCA 2A6HC 1HNXL 3STBC 4CJ2C 1Z7TA 2HHHL 4BY7G 2WB1B 4HEDA 2CFMA 1KDAA 3CW2C 4TKOB 5DLQE 1I3QB 1LT5D 4DK6C 1EY7A 4GNXC 2ZTCA 2HUGA 2NBFA 3NWSA 4R8IA 3I4MH 5I9PA 1E22A 3Q8DA 1LTID 3BU2A 2KCCA 3AQQA 1HFNA 1EYAA 3I72A 2WKCA 1UAPA 4A3FH 2KHSA 1SNMA 1JWSD 5COYA 3MHBA 3CC4A 2E2HB 3VR3A 3URYA 3A74A 5TSSA 1GKHA 3EROA 5JPMC 1C8CA 3NBHB 4P2CB 5G3LD 1LO5D 3MXGA 4YCUA 4BS9A 1A15A 1PRTB 3K0YA 2HHHQ 1VQ6A 1ET9A 2JN4A 5LMNW 1CK1A 4IPCA 4A3EG 1LTBD 1C0AA 2MHVA 3K80C 3VA7A 3OW7A 3NENA 1GHKA 1TVXA 2X6GA 1HUMA 4EGVA 1OTCA 2Z4IA 4G7OC 4FP5D 5IT9E 2HQEA 4PQXA 4ZQ3A 4OL7A 1XYIA 3HOYH 3FPUB 4OX9L 4RCOA 1ILPA 2JK8A 3KFUA 4YCWA 1XWEA 3MXNB 4WJ3M 5C3EH 4H7BA 5CBAE 4DV6L 4E6IA 3BZDB 3GQBA 4A3GB 1X65A 3HGBA 3TSSA 4RKLA 4DKAC 2EY5A 2HCIA 1ENCA 3BG3A 3S1MB 2EY6A 4FVMA 4C1NK 3K5MA 4C3IH 4UDUC 1X3EA 2E2IH 1OXXK 4GKKL 3RN2A 4B3RQ 4IJHA 4L5TA 4AYBE 1Y69U 2DY8A 4IN3A 3ZJYC 2JA7G 4G57A 1PA6A 2NZHA 2L1BA 2PI2E 1BCPB 4V190 5CV8A 2MO0A 2A6EC 4GNXA 4ABNA 4BY1B 3J7YW 4R4CA 1NJIC 3A0JA 3I4NH
chains in the Genus database with same CATH topology
2AUKA 4CBVA 1H9SB 1K83B 3RMHA 5CV7A 3SEBA 2A73B 2EY1A 4TRDA 1NUCA 2R93B 2JA6B 3S1NB 1E2VA 1DZ1A 1R4QB 5J39A 3QOLA 2C9OA 2SDFA 1JWUD 2IL8A 4FXKC 4KV6A 5A2QL 4PMBA 4XYOA 3EA6A 1JCKB 5EBCA 1I4QA 3H09A 2VXWA 1CTMA 1B50A 2NVTB 1LACA 1GUOA 1PMRA 5C5MA 2NUCA 2EJFC 1SDFA 2FINB 3MTSA 5I2YA 1MD2D 4U68A 2L9HA 2M2LA 4C3JG 5LL6X 2H1EA 4KD4A 1EZ6A 3HP3A 1KTKA 1EU4A 2F0QA 4EVOA 1G2SA 1EWCA 1NAPA 1QJOA 1ZEQX 1PZID 4H44C 1I4HA 1TS2A 4CGYB 4FYDA 4UAIA 2RDHA 2JEBI 5EKKA 4CKBA 1HXYD 4FNFA 3R3OA 3L9AX 3NBHA 3NQTA 4CKEA 2E2DC 3Q0AA 2DNEA 4B9XA 3PUXA 1Y8OB 3I3CA 4O1NA 1DD2A 2QDBA 1BNZA 4HCEA 1SJHD 2K6AA 3NP8A 5KRUA 1V1PA 1RTNA 2AWNA 1CZGA 4J8QA 2F4IA 2EXZA 1CHQD 3VR4A 1M4VA 3G7LA 4A3DB 2KUMA 2IX0A 1DXMA 5DAUA 3ZYYX 4FF4A 3NPPA 5C5LA 2Y0SB 3A7AB 3PO2B 1JE4A 1Q90A 3S2DB 4KN4C 1HQMC 2SEBD 2Q8RE 3NTHA 1A3TA 3M85A 1JICA 4Z9CB 3PUWA 5CR3A 1EY4A 3SK5A 1TWAB 4RWSC 2JE6I 1U4RA 5M3MB 1G8ZD 2F0LA 3BVZA 4A3FB 3Q22A 1STHA 3CRLC 3DUZA 1MSGA 2KQ3A 1JC7A 5IGCA 4IUNA 2NVQB 3FVQA 5T1IA 1TQOA 3A55A 1DOMA 2IPKD 2IW3A 3I91A 4K6LA 2EPBA 1BUVT 3NK9A 3I8ZA 4BWGB 3MAQA 1F9PA 5C0XJ 1SMYC 2YU9B 2JP1A 5FO7B 1WVLA 1RDPD 4RAUC 1KAAA 4DAYA 3U9SA 3DMUA 1BCPF 1MSHA 3PUVA 4WORA 3RUZA 1E2ZA 3TP5A 3BVMA 3KLSX 3R2IA 4XDXA 1I4PA 1D5ZC 2B2TA 4IFDG 1LV9A 4DU9A 2EYPA 4QCLA 3JAME 2AQ2B 3CHBD 2F0PA 3J80L 1UEAB 1I6VC 5E1FA 5ELBA 4QUFA 2F0DA 4C3IG 1PFMA 5AFWA 1Y8PB 3SK4A 2E75C 4DAPA 4DXFA 1VF7A 2BA0A 3D4WA 1SFOB 4WFN3 2RQXA 2TMPA 2XWJB 4F8MA 4LMQD 4DAVA 4RCNA 1T5EA 2BOSA 3MA2B 4FXDA 1DM0B 1EY8A 1HA5A 1D2BA 2PPBC 3VA5A 4XQQA 2NTSA 5FK9C 3GTMB 1X3QA 2N88A 4X3UA 1FNUA 1TWCB 4ODGA 3RLFA 2PCFB 4IURA 3WOFA 2XRSD 4U673 1SXTA 3W3AA 3MXUA 5IGBA 1EY9A 2B2TC 4K5XA 2F0VA 5CV5A 5ELCA 2JYOA 3L3OC 4Y7NB 1S5ED 4RGOS 2PW5A 2RBMA 2VUMB 4YIJA 1XTCD 3NHHA 3S2HB 1F2MA 4EQNA 4R8NA 2K7VA 3GD7A 3D6WA 4N9TA 3J81L 4NW2A 5CC4A 1EY6A 2B2UC 4JK1C 1A2TA 1TY0A 1S5CD 2RA4A 5KNBA 4ZLTF 1O78A 4OIKA 3D4RA 1GUTA 4CJ1B 2K1BA 5CBEE 1ONLA 1FNWA 3P1HA 2B63B 3BDCA 2M9VA 2XVSA 2RSOA 3A7LA 2G9DA 5I2XA 1WTXA 2ZXRA 3GTPB 3D6CA 4ZRZA 4NDXA 3QWNA 4CKCA 3VYSA 3RZDB 4K8JA 1EYCA 3OMGA 4RGTA 3KBGA 3MVVA 1PRTF 1IYUA 2B2WA 3PIO3 2KA7A 5DNFA 2QCPX 2LS01 5JPNC 5EPJA 1A6XA 2FMCA 4M8AA 2K33A 1BF4A 2Z1CA 2MUYA 1SJED 4HCSA 3H91A 2CHBD 1B4OA 1PFBA 5CGKA 1QCBD 1YNJC 3JAML 4DA2A 5IT9L 2PW7A 2NYZD 1M8AA 1BXTA 5KNCA 1GXDC 1K8OA 3BS1A 3FKIB 4IUVA 4KJOA 1Q12A 4CJ0B 4G7ZC 1W6KA 1A2UA 5J22A 1GHJA 4KKTA 3HOWB 2NN6I 3M4YA 3CQZB 4NMZA 1V8QA 2KECA 3H0GB 1BO0A 1EQTA 1D5XC 3TP7A 1W6JA 5JOBA 4PNYA 2K5WA 2QKIC 5T1GA 5IGGA 3T4AC 1OXTA 1MGSA 1SEBD 4A3EB 4G4KA 4N9PA 1VF5C 3P20A 4L63B 1WCMB 1PLFA 2IWHA 2F0UA 3S15B 1K8MA 1L0XB 5C0XH 4WRDA 1EOTA 4KMUC 4ME5A 4C1NI 1I4GA 3X3NA 4I7ZC 1AZPA 3I90A 5ELFA 1EQVA 5M5YB 1EY0A 2KEEA 3GTQB 3I4NB 3K5LA 1D1IA 1PTOD 4ILWA 5JEAH 2CW0C 2D9UA 2NN6G 1TKWB 1RD9D 1D6EC 4LK1C 5CYUA 2E76C 3HEJA 1QE6A 1PXUA 4KKUA 5I4DA 4K5VA 1R4PB 3CRKC 4IQZA 1KNEA 3FDTA 5EPKA 4ZUJA 3S9WA 3DHQA 3UI2A 3R8BA 1TIID 3K57A 2F0IA 2QF7A 2HCCA 1G6ZA 1SSOA 3HZXA 1IKMA 2RDFA 5C0XI 2HDMA 4QMGA 3DWAA 1RKNA 1PYWD 3OIPA 1ILQA 5JJZA 4EQOA 4PV1C 1QG7A 4RH6A 5EQ0A 3ERQA 4A93B 3MEHA 2F0WA 3FPPA 2FFKB 1LABA 2H4OA 1Q1EA 4G7HC 1IW7D 1JOOA 1PTOB 5BN4A 2F0TA 2XNAC 3ITPA 3MXNA 1B3AA 4X3KA 2AQ1B 2MP1A 3VYRA 1CM9A 3IAYA 2RSNA 2D5DA 1HTLD 1O7YA 4F7XA 2F3VA 1FD7D 1LTGD 4DGZA 3X3MA 1LT6D 5JVG3 1B1ZA 4OHJA 5J1ZA 3S1RB 1WTWA 5DEHA 1UNSA 2F0KA 1HPCA 2OXPA 2F0NA 2JXMB 3EQLC 4KTAA 4A3BB 3QOJA 1AFPA 4J6HA 2XWBB 2F3WA 4IFDH 1AW7A 5C3XA 1Y1WB 2BE5D 1HQRD 1STBA 1Z6HA 3NQIA 5K36G 2Z8LA 2B2VA 3NTKA 1ZXTA 4TSSA 3O13A 1A3VA 2ICIA 5A35A 3Q24A 3P75A 2WKDA 3HRZC 3HOZB 2RKSA 4O42A 3V05A 5EBDA 3C1EA 1QNKA 2ZT9C 2K03A 4DN4M 1JQYD 2K28A 4H0LC 2F0OA 3SK6A 3M3YB 3MFYA 3SXHA 4ZKBB 1WTOA 3H94A 4EQPA 4NP5A 4LJZC 3M7NA 1B2TA 1ENAA 4F88A 2BDNA 1SYBA 1CT1D 3GTKB 3DWPA 3J80E 1STYA 2A68D 3A8IE 1BCPC 5C4XB 2XRQD 5CV4A 4R9WA 1STAA 2WACA 4HMJA 3NWTA 2EYLA 3A56A 5G3LF 5LHY1 5CV9A 2PZWA 5IODA 5KIXA 1EU3A 3TZDA 4X3TA 2I46A 4RKBA 4S3SA 1BBXC 3TZUA 1EZ8A 3TBIB 3QB3A 5F2DA 1RTOA 2R92B 3G6JB 2O4XA 3I70A 1AN8A 3Q23A 5BN5A 3M4OB 1U4MA 3OMCA 3IL8A 1EEID 5KNDA 2O5IC 2A6HD 1SYGA 4XQNA 4BBSB 3PV0A 3QIAA 4HR7B 5C4HA 1CI3M 4HSVA 2A69D 4IUPA 2XIWA 3J81E 4XIGS 1EYDA 3QJYA 2QEJC 2YYZA 2NN6H 1JOKA 2AQ3B 3K5OA 4L6TB 3N52A 5NUCA 4A3IB 1SNQA 3KF8A 4C56C 1TWFB 1SBBB 5EKIA 3K7AB 4RGMA 3NXWA 1RJTA 2ZXOA 4B08A 1HA6A 3MWYW 1CA5A 2JEAI 3LX0A 4XYQA 5JAVA 2Q8IB 1T5XD 4KY5A 3D8GA 1SE2A 1GUSA 2SNMA 2L55A 2K04A 2N55A 1HTPA 2EY2A 4XQJA 1PZJD 3OIQA 1ESFA 2M00A 2ZXPA 2PZTA 4C3JB 1JORA 4FF3A 2A74C 3D4DA 2R6GA 5EKLA 1S5FD 3PUZA 1TWGB 1JR0D 3KLSA 5D65A 1AP0A 3TMEA 1ML0D 5FO9B 2K01A 3C2PA 1X32A 1F2LA 3MZ5A 3HG9A 5ISRA 1EIGA 5FLXL 1WTVA 3K6OA 1AZQA 2JA8B 5KGUA 1SYDA 2RDGA 1TWHB 1O7LA 2D62A 1I4XA 1KNAA 3ND8A 2K05A 2KVMA 2NVYB 1U4PA 3S16B 1SMYD 1IKLA 4A3KB 5K5PA 1U4LA 1I50B 1TT2A 2F03A 2C5CA 1B44D 1CZWA 1PRTC 3DEPA 5IGDA 1LTTD 3WOEA 4KY7A 2LMCB 3A54A 3VR6A 1DJRD 1BR9A 5C6AA 2JA5B 4DNTB 1EL0A 5IGFA 3SK8A 5DM63 4FF1A 3CKIB 2J0TD 3EFXD 1EEFD 1F9RA 3NTIA 4GZYC 2NVXB 3GTGB 1F9QA 1LTRD 1SYFA 3S1QB 3TP8A 3T51B 1TS5A 1E2WA 2OT2A 2KJXA 2Q8TA 2L4NA 2F0MA 2ID0A 2LY7A 4DXGA 2NZ1D 2MPMA 3DEOA 3MFGA 3DM1A 4KN7C 5E3FA 2O5JC 1B53A 3E5SA 3QO2A 5M5WB 1II3A 2BCOA 1B9MA 2HDLA 2R61A 2CQAA 2KCNA 5I9OA 2QILA 4IFDI 1O80A 1E0BA 4TQUS 3T53B 2RVLA 1BDOA 2R7ZB 5JEAG 4DK1A 5IIFA 4A3JB 4OIJA 1BQQT 3SHLA 1SNOA 4OO1H 2EJMA 2EYOA 5I6YA 3GV6A 2B2WC 4V0BA 3SVMA 3KLRA 4I65A 1EY5A 3OOCA 2IT1A 4AYBB 3D31A 3RD4A 2BE5C 1SE4A 3LNNA 2WV6D 1FGBD 1WD0A 5JVH3 3VR2A 2L11A 1RCVD 3GV3A 1WD1A 1QOHA 1EFID 3BVGA 1H9RA 4K6DA 1RHPA 3NSWA 3V2TA 2EYMA 2KOLA 2L0CA 3T13A 1WTQA 5K36H 4XT3B 1PRTD 3HOYB 1NR4A 4OGQC 3HKZB 1J9OA 3KBXA 1BOSA 1HFGA 3K5NA 4KI0A 3EJIA 3VYTA 4RFBA 1JB3A 1GUNA 4ZK9B 4IUTA 1H9SA 4QB4A 1NR2A 1I6HB 2K32A 2IX1A 3J7AV 2EOTA 2WINB 3M7GA 4KHVA 1CFMA 3HOXB 3DXJC 1VCIA 1TS4A 2JSOA 2E74C 4WJWA 3OSOA 4CHTB 1HRJA 4KY6A 3SE0A 3J7AF 5ELDA 3K58A 4ZKCB 1H9MA 3C3LA 1OO9B 1B9NA 3N6RA 4OO1G 3OHXC 1G91A 2F0FA 5A2QE 1RF2D 1R9TB 2ICEC 5FKAC 1HHVA 5C3WA 2F0SA 4NKLA 2PMZB 4MN3A 4RHSA 4DNRB 2PO4A 2EYFA 2R3ZA 1LTAD 1YNND 1IHZA 2K5QA 2NB0A 5EPLA 1ET6A 2SNSA 1KDBA 1LT4D 5DM73 4F87A 3CU7A 2VB2X 5D3IB 1SAPA 3FRPB 4HSPA 1QILA 4K2KA 1DOLA 2F0JA 1WTPA 4RA8A 3HS0C 3GTOB 5LL6S 1VMPA 3H3VC 4KD3A 1STNA 4C2MB 3BYYB 3TP6A 1F2YA 5FO8B 5FOBB 3NBIA 3QG1A 4HTHA 2D2CC 2G9HD 3A8JE 3H6MA 3P7JA 1D5MC 5D14A 5EGTA 4K8IA 3AMUA 2L5TA 2FJ2A 5CMDA 3HOVB 3I73A 1V1PB 5C4ZA 1TU2B 4A3MB 3NUCA 1Z47A 2F0GA 1CA6A 1MBYA 2DN8A 2B39A 4J1MA 1XXGA 4DFAA 1S5DD 1DYQA 1FR3A 4BA2I 1ENFA 1H9KA 2TSSA 2PZUA 1LT3D 3BDOA 1KABA 1S5BD 2NTTA 3SR1A 1IW7C 3IFDA 1ESRA 1SNCA 1GUWA 3VYUA 4FF2A 2B8FA 4C3HG 1PFNA 1Y8NB 1ICWA 4DF7A 3A8KE 1PZKD 3AU7A 5IOCA 3BDLA 3OWEB 5KEEA 1IL8A 3VR5A 4M1UB 1FNVA 2B8GA 5E4WC 3SDZA 4XT1B 1VMCA 2EJGC 3U9OA 3PMFA 3R93A 3ND9A 4B9WA 4PMCA 2A5HA 3GTLB 2EYHA 4FXGC 1ZYRC 1SNPA 1JWMD 4QIWB 1SYCA 2VB3X 3OWFA 3K59A 3PO3B 4IFDJ 1V1OA 4IUQA 1MI2A 1UUPA 5FLXE 1JOQA 1Q3LA 3LWUA 2B2YC 2EZVA 1QNUA 3EVQA 3R2TA 2B2YA 1NCVA 3C46A 4QF4A 1G2TA 2PNRC 5C44B 1SYEA 4HAEA 4KHZA 2A6ED 1TS3A 4PMWA 2PQEA 1V43A 4K14A 4RHRA 3S14B 4XTCS 2CVRA 2VNUD 5EJWA 2Z4HA 1U9RA 1DONA 2XN9C 4C3HB 5D3DA 4Q5VA 3DWQA 1KLUD 4DK0A 4OO1I 2JA7B 4MHEA 1LTSD 5C4JB 3KUPA 1F77A 4BA1I 4IALA 3I4MB 4HMIA 1PTOF 3AB9A 1NSNS 1G291 2J7ZA 3T16A 3IKJA 4KK7A 2FMMA 2A69C 3FMCA 2KEDA 3KK7A 2ENBA 4XXEA 3WDNA 1VDZA 1DOKA 2CW0D 2O2LD 1Y1VB 1Q1BA 3W2DA 1XX8A 1BCPD 1RODA 2MJ8A 4K5WA 1YNJD 4LAAA 4IZ8A 1GOZA 3S17B 1D1KA 1ZYRD 3FEWX 4X3SA 2X69A 1IYVA 4ULLA 2V4DA 5IGEA 2FHTA 4ID6A 2AUJD 5C3EB 2DY7A 1OXVA 2K5DA 1C4QA 1STEA 4JBWA 1HUNA 4MIUA 3I4LA 1KDCA 2WIIB 3NE5B 1WTRA 4KJNA 3MC0B 1FYCA 2GA4B 3GTJB 1C48A 2IX3A 3C1FA 1SE3A 3L7ZC 3Q6SA 2LFNA 4BY7B 3PUYA 3GO5A 3ONAB 5E4XA 2PYKA 1DCZA 5M9OA 2NWGA 5M3FB 4ZYSA 1SNDA 1I4RA 2WP8J 2BDOA 3T56B 3GP7A 1CQVA 3LWEA 3IFTA 1PTOC 1J8IA 2F1MA 1AEXA 1CQFA 3OPOA 2EE1A 2X6LA 2I07B 3TDQA 1LLRD 1PDQA 5I6WA 4K2LA 4ZUIA 5KYIA 1L0YB 4RGNA 5ELEA 4BBRB 3HOUB 3F2UA 5CORA 4IUUA 5HURA 3E6ZX 1O7ZA 1PTOH 4H13C 4KKSA 2BA1A 1TY2A 4L8JA 1GUGA 1HCZA 1EWHA 1YNNC 5CV6A 2EYJA 3V96A 4HN7A 1S4ZA 2F0HA 3PIP3 2L12A 2EVBA 1KLGD 2AWOA 2SOBA 1QWYA 5C0XG 2LKVA 3MXPA 2WAQB 2XSCA 1H9JA 2A68C 2F0EA 3RZOB 1TR5A 2B2UA 1A3UA 1CHPD 5HGTA 1Q8IA 1QB5D 1F2ZA 2E2IB 4C3IB 2OF1A 2MGSA 2OEOA 4Q0FA 1EIHA 1X3PA 1GJXA 1OXUA 1STGA 3TN2A 5BN3A 1ZKOA 3D3RA 2E2JB 4QUCA 5JEAJ 3BYTB 2IJ0A 2B2VC 5M5XB 3E0JA 1OXSC 4FO2A 2J4XA 1F9SA 4ZAIA 2EDGA 5KYLA 2DNCA 2A6HC 4CJ2C 1Z7TA 2WB1B 4HEDA 1KDAA 4TKOB 1I3QB 1LT5D 1EY7A 2HUGA 2NBFA 3NWSA 4R8IA 5I9PA 1LTID 2KCCA 1HFNA 1EYAA 3I72A 2WKCA 1UAPA 2KHSA 1SNMA 1JWSD 5COYA 3MHBA 2E2HB 3VR3A 3URYA 5TSSA 3EROA 5JPMC 1C8CA 4P2CB 5G3LD 1LO5D 3MXGA 4BS9A 1A15A 1PRTB 3K0YA 1ET9A 1CK1A 1LTBD 2MHVA 3VA7A 3OW7A 1GHKA 1TVXA 2X6GA 1HUMA 4EGVA 2Z4IA 4G7OC 4FP5D 5IT9E 2HQEA 4PQXA 4ZQ3A 4OL7A 1XYIA 3FPUB 4RCOA 1ILPA 1XWEA 4H7BA 5CBAE 4E6IA 3BZDB 3GQBA 4A3GB 3HGBA 3TSSA 4RKLA 2EY5A 2HCIA 1ENCA 3BG3A 3S1MB 2EY6A 4FVMA 4C1NK 3K5MA 4UDUC 1OXXK 1Y69U 2DY8A 4IN3A 4G57A 2L1BA 1BCPB 4V190 5CV8A 2A6EC 4BY1B 4ABNA 3J7YW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGB A;  1TQO A;  5EKK A;  4ZUI A;  1STB A;  5I9P A;  4PMC A;  3HEJ A;  5KYI A;  4K2K A;  2EYH A;  3R3O A;  2F0J A;  5CV7 A;  1EY9 A;  3NQT A;  3EJI A;  2EY1 A;  2F0M A;  2EY2 A;  4K5X A;  1EYA A;  1SNP A;  4KD3 A;  1SYC A;  2F0V A;  1STN A;  4TRD A;  3OMC A;  4B9X A;  5KEE A;  5CV5 A;  4K5V A;  2KHS A;  1NUC A;  1SNM A;  3NK9 A;  2M00 A;  3OWF A;  3TP6 A;  5HUR A;  1F2Y A;  5IGE A;  3MHB A;  5E3F A;  2QDB A;  2PZT A;  5CGK A;  4ZUJ A;  4ID6 A;  4HTH A;  3E5S A;  3DHQ A;  3ERO A;  3S9W A;  2PW5 A;  1JOR A;  5J39 A;  1JOQ A;  3NP8 A;  3QOL A;  2RBM A;  3D4D A;  4QB4 A;  2PW7 A;  3H6M A;  1II3 A;  4YIJ A;  5KRU A;  2F0I A;  5EKL A;  3EVQ A;  1A3V A;  4QF4 A;  1KAA A;  5EGT A;  3HZX A;  3NHH A;  1F2M A;  4K8I A;  5I9O A;  5CV6 A;  2RDF A;  3DMU A;  4EQN A;  2EYJ A;  2EXZ A;  4R8N A;  3TME A;  1SYG A;  4QMG A;  1SYE A;  3P75 A;  4KJO A;  4KV6 A;  1RKN A;  4WOR A;  3RUZ A;  2F0H A;  3TP5 A;  4N9T A;  4PMB A;  4KHV A;  4MIU A;  2PQE A;  4K14 A;  1A2U A;  3MZ5 A;  5C4H A;  1KDC A;  4EQO A;  5CC4 A;  2RKS A;  2SOB A;  5J22 A;  5C4Z A;  4KJN A;  1EY6 A;  1U9R A;  1EYD A;  5ISR A;  2EYP A;  2LKV A;  3MXP A;  4DU9 A;  3OSO A;  3ERQ A;  5IIF A;  3MEH A;  3C1E A;  3NUC A;  2HQE A;  2F0G A;  2F0W A;  4NMZ A;  5DAU A;  2F0P A;  4ZQ3 A;  4OL7 A;  2F0E A;  4J1M A;  1JOK A;  3SHL A;  1SNO A;  1A2T A;  4KY6 A;  2F0O A;  1TR5 A;  5E1F A;  5KGU A;  4DFA A;  3SK6 A;  5C5L A;  2F0D A;  1SYD A;  3C1F A;  2EYO A;  5I6Y A;  1A3U A;  1JOO A;  3SK4 A;  5HGT A;  3TP7 A;  3SXH A;  5NUC A;  4I65 A;  2F0T A;  5JOB A;  1F2Z A;  4PNY A;  4EQP A;  1SNQ A;  3D4W A;  1EY5 A;  4NP5 A;  2PZU A;  2OF1 A;  3ITP A;  5IGG A;  2F0F A;  2OEO A;  4H7B A;  5C5M A;  2NUC A;  1A3T A;  4F8M A;  1KAB A;  1ENA A;  4E6I A;  5K5P A;  5C3X A;  2PYK A;  1STG A;  4IAL A;  4N9P A;  3SR1 A;  1TT2 A;  4HMI A;  4RKL A;  1SYB A;  5CR3 A;  1EY4 A;  2EY5 A;  3P1H A;  2F0S A;  3BDC A;  5C3W A;  2F0U A;  1SNC A;  4F7X A;  5M9O A;  1STY A;  2F3V A;  3SK5 A;  1NSN S;  1ENC A;  4WRD A;  4ME5 A;  4DGZ A;  4NKL A;  4KD4 A;  3T16 A;  1EZ6 A;  1EY8 A;  2EY6 A;  3NXW A;  5CV4 A;  3VA5 A;  5IGD A;  1STA A;  2WAC A;  1SND A;  4HMJ A;  3D6C A;  1EQV A;  2EYL A;  4KY7 A;  1EY0 A;  2EYF A;  4DF7 A;  2F0Q A;  2ENB A;  4NDX A;  2PZW A;  4K6D A;  2F0L A;  5CV9 A;  5J1Z A;  4B9W A;  5C6A A;  5IGF A;  5IOC A;  5KYL A;  5IOD A;  3SK8 A;  3BDL A;  5DEH A;  5KIX A;  2F0K A;  3LX0 A;  1IHZ A;  4G57 A;  4K8J A;  4ODG A;  4EVO A;  1EYC A;  3OMG A;  1STH A;  2OXP A;  2F0N A;  1AEX A;  2SNS A;  1KDB A;  3V2T A;  5JAV A;  2EYM A;  4KTA A;  3QOJ A;  5CV8 A;  3MVV A;  3T13 A;  1KDA A;  4J6H A;  4RKB A;  4KY5 A;  4S3S A;  3D8G A;  1EZ8 A;  2F3W A;  2KQ3 A;  3U9O A;  4K5W A;  5IGC A;  1EY7 A;  3QB3 A;  3PMF A;  5F2D A;  4IUN A;  1SYF A;  5I6W A;  2SNM A;  2O4X A;  4LAA A;  3TP8 A;  4K2L A;  4IZ8 A; 
#chains in the Genus database with same CATH topology
 2AUK A;  4ME3 A;  1X3G A;  4CBV A;  1H9S B;  1K83 B;  3RMH A;  1VQM A;  3T1H L;  5CV7 A;  2QW7 A;  3SEB A;  2A73 B;  2EY1 A;  4TRD A;  2HQL A;  1NUC A;  2R93 B;  4YCV A;  2JA6 B;  3S1N B;  1E2V A;  3KLW A;  4A3G H;  1Y14 B;  1DZ1 A;  2JA7 H;  2WB1 G;  1R4Q B;  5J39 A;  4OEL B;  1YIT A;  3QOL A;  2C9O A;  1Y1V G;  2SDF A;  1JWU D;  4YWM A;  4POG A;  4DUY Q;  2IL8 A;  1SN8 A;  2C35 B;  1C9O A;  4FXK C;  1IYJ B;  5C4X H;  1EIY B;  4KV6 A;  5A2Q L;  4PMB A;  4XYO A;  3EA6 A;  1N8R C;  1K0S A;  3S2H H;  5FJ8 G;  2G5D A;  1JCK B;  3S14 H;  2JA6 H;  5EBC A;  1I4Q A;  1SLJ A;  3H09 A;  3CC7 A;  2VXW A;  1EUJ A;  1CTM A;  1YJN A;  1YHQ A;  1B50 A;  2R93 H;  4AIM A;  2NVT B;  1LAC A;  1GUO A;  1PMR A;  5C5M A;  2NUC A;  1HZC A;  2EJF C;  1SDF A;  2FIN B;  2VQE Q;  3MTS A;  3GTP H;  5I2Y A;  1MD2 D;  1WOC A;  1LTL A;  4U68 A;  3E3X A;  2L9H A;  4A3K G;  2M2L A;  4C3J G;  5LL6 X;  2H1E A;  3PCO B;  3M4O H;  4KD4 A;  1EZ6 A;  2NVY H;  4IPG A;  3CCS A;  2E5L Q;  3HP3 A;  1KTK A;  1EU4 A;  2F0Q A;  4EVO A;  1G2S A;  2K5H A;  1EWC A;  1NAP A;  1QJO A;  4BXX G;  1ZEQ X;  1HNZ L;  1PZI D;  4LFA Q;  4H44 C;  4JI1 L;  1I4H A;  3RZD H;  2ZJP A;  1TS2 A;  4CGY B;  4P71 A;  5IYB G;  4FYD A;  2PQA A;  4UAI A;  2RDH A;  2JEB I;  5EKK A;  4A3I H;  4BY1 H;  1SRO A;  4CKB A;  1HXY D;  4FNF A;  3R3O A;  3L9A X;  3NBH A;  3NQT A;  4CKE A;  3AFQ A;  2E2D C;  3Q0A A;  3H15 A;  4HJ8 A;  2DNE A;  4JI0 Q;  4B9X A;  3GTK H;  3PUX A;  1Y8O B;  3I3C A;  4O1N A;  4DV1 L;  1DD2 A;  2QDB A;  1BNZ A;  1VS0 A;  4HCE A;  4B3S Q;  1PFS A;  1SJH D;  4UP8 A;  4QY7 A;  2K6A A;  3NP8 A;  2OTL A;  4AH6 A;  5KRU A;  1V1P A;  1RTN A;  2AWN A;  1CZG A;  2VS1 A;  4OXP A;  4B3R L;  4J8Q A;  2F4I A;  2EXZ A;  4P74 A;  1CHQ D;  3VR4 A;  1CSP A;  1M4V A;  3G7L A;  4A3D B;  2JA5 G;  2KUM A;  2IX0 A;  2UU9 L;  1DXM A;  1I6H H;  2UXC L;  5DAU A;  3ZYY X;  4FF4 A;  4DV5 L;  1Q86 C;  3NPP A;  4YY3 Q;  5C5L A;  2Y0S B;  3A7A B;  1C7Y A;  3PO2 B;  1JE4 A;  1Q90 A;  3GDE A;  2RHQ B;  3S2D B;  4KN4 C;  4JYA Q;  1HQM C;  2SEB D;  3JAM i;  2Q8R E;  3NTH A;  3S1M H;  1A3T A;  1D8L A;  3M85 A;  1JIC A;  4Z9C B;  3CD6 A;  3PUW A;  3EN2 A;  5CR3 A;  1EY4 A;  1VQ8 A;  3SK5 A;  4ALP A;  1TWA B;  4RWS C;  1YJW A;  1I3Q H;  4OEM B;  4AQY Q;  1JJC B;  2JE6 I;  3I55 A;  1U4R A;  3J81 j;  5M3M B;  1E24 A;  2ZM6 Q;  1G8Z D;  2F0L A;  3BVZ A;  4A3F B;  3Q22 A;  4JV5 Q;  1STH A;  4QL5 A;  3CRL C;  2ASB A;  3E0E A;  3DUZ A;  1VQP A;  1MSG A;  2KQ3 A;  3HKZ G;  1JC7 A;  1TWA H;  5IGC A;  3TS0 A;  4IUN A;  2NVQ B;  2A19 A;  3FVQ A;  1K8A C;  3UE0 A;  4R4Q A;  3K7A H;  1TQO A;  3PQI A;  5T1I A;  3A55 A;  4DV4 Q;  2BH2 A;  1DOM A;  2IPK D;  2IW3 A;  4JI2 Q;  4K0K Q;  3I91 A;  4X64 Q;  1V1Q A;  4MNO A;  4FDB A;  4K6L A;  3RN5 A;  2K52 A;  4DV7 L;  2EPB A;  1BUV T;  3NK9 A;  1BBW A;  3I8Z A;  4BWG B;  3MAQ A;  1F9P A;  2OQ0 A;  3K0X A;  3M4Q A;  1SMY C;  3SGI A;  5C0X J;  2YU9 B;  2JP1 A;  5FO7 B;  1WVL A;  1RDP D;  4RAU C;  1KAA A;  2KCT A;  4DAY A;  3U9S A;  3DMU A;  1BCP F;  1YZ6 A;  1L1O A;  1MSH A;  3PUV A;  4WOR A;  3RUZ A;  1E2Z A;  3TP5 A;  3WWV A;  4JOI C;  3BVM A;  3KLS X;  3R2I A;  4XDX A;  1JJG A;  1I4P A;  1YHA A;  3RLN A;  1D5Z C;  1Q46 A;  2B2T A;  1LV9 A;  4DK3 C;  4JI4 L;  4IFD G;  4LF5 L;  2EYP A;  4DU9 A;  3HOX H;  3JAM E;  2AQ2 B;  3CHB D;  3RLO A;  4QCL A;  4JI8 L;  4LF6 Q;  2F0P A;  1UEA B;  3J80 L;  1I6V C;  4QGU A;  5E1F A;  5ELB A;  4QUF A;  2F0D A;  4C3I G;  3RZO H;  1PFM A;  5AFW A;  1Y8P B;  3SK4 A;  4OON A;  2E75 C;  4DAP A;  4DXF A;  2ALY B;  1VF7 A;  2BA0 A;  4R4T A;  3D4W A;  1SFO B;  4WFN 3;  2RQX A;  5M5X H;  2TMP A;  1QVC A;  2XWJ B;  4F8M A;  4LMQ D;  1IBK Q;  3H3V I;  4DAV A;  4A3D G;  3L0O A;  4RCN A;  1T5E A;  2BOS A;  3MA2 B;  2B3G A;  3W1B A;  1HJP A;  2F3I A;  4R1J A;  1DM0 B;  4FXD A;  4A3D H;  1EY8 A;  5C44 H;  1HA5 A;  1D2B A;  2PPB C;  2HD3 A;  3VA5 A;  4XQQ A;  3PF5 A;  2NTS A;  5FK9 C;  4A3B H;  3GTM B;  1X3Q A;  4B3S L;  3S17 H;  2N88 A;  5C4X G;  4X3U A;  2EIF A;  2JJQ A;  1FNU A;  3U50 C;  2I5M X;  1TWC B;  4ODG A;  2Z0S A;  3RLF A;  4GN5 A;  2OWO A;  1MJE A;  3PO2 H;  2PCF B;  4IUR A;  3WOF A;  4RG1 A;  1KIX A;  2XRS D;  4U67 3;  4LF7 Q;  1SXT A;  3W3A A;  1YHB A;  2AKW B;  3MXU A;  5IGB A;  2R92 G;  2R7Z H;  1EY9 A;  3IRB A;  2B2T C;  2CWA A;  4LF4 L;  3ER0 A;  4K5X A;  2F0V A;  4DR6 Q;  4DR7 Q;  1AE2 A;  5CV5 A;  2Q2H A;  5ELC A;  2JYO A;  3L3O C;  2UUB L;  4Y7N B;  1S5E D;  4RGO S;  2PW5 A;  1PH5 A;  2MQH A;  2RBM A;  2LXJ A;  1P16 A;  4YHH Q;  4YIJ A;  2VUM B;  1XTC D;  1VQO A;  3NHH A;  3S2H B;  1F2M A;  1W2B A;  1QUQ B;  4EQN A;  2UU9 Q;  1ASY A;  4A76 A;  4R8N A;  2K7V A;  3UE1 A;  3GD7 A;  1D7Q A;  3D6W A;  4N9T A;  3J81 L;  4NW2 A;  2L15 A;  5IYB H;  3CCU A;  1HR0 L;  2K5N A;  5CC4 A;  3I56 A;  2Z6B A;  1EY6 A;  2B2U C;  2NVT H;  1N32 Q;  4A3K H;  5BR8 Q;  5ELN A;  2ZTE A;  4JK1 C;  1A2T A;  2QA4 A;  1TY0 A;  1I5F A;  1S5C D;  4P73 A;  2RA4 A;  5KNB A;  4ZLT F;  1O78 A;  4OIK A;  2QEX A;  3D4R A;  1YJ9 A;  1GUT A;  4CJ1 B;  2UXD Q;  2K1B A;  4BBR H;  5CBE E;  1ONL A;  1FNW A;  3P1H A;  2B63 B;  3BDC A;  2M9V A;  2XVS A;  2RSO A;  3A7L A;  2G9D A;  5I2X A;  1NNX A;  1U5K A;  1WTX A;  1SFO H;  1HR0 Q;  2ZXR A;  3GTP B;  3D6C A;  4ZRZ A;  1P8L A;  1KAW A;  4HJ9 A;  4NDX A;  3QWN A;  4CKC A;  1N32 L;  3VYS A;  3RZD B;  1A63 A;  4MZ9 A;  2Z6K A;  3J80 c;  4K8J A;  1EYC A;  3OMG A;  4X65 Q;  4RGT A;  2EQS A;  3KBG A;  3MVV A;  2P5Z X;  1PRT F;  1IYU A;  5AJ3 L;  2B2W A;  3RR5 A;  3PIO 3;  4LUZ A;  2KA7 A;  5DNF A;  2QCP X;  2LS0 1;  5JPN C;  2JA5 H;  5EPJ A;  1A6X A;  2FMC A;  1CKN A;  5LMU Q;  4DV3 L;  4M8A A;  2Z9H A;  2K33 A;  1PV4 A;  1BF4 A;  2Z1C A;  2MUY A;  1SJE D;  4HCS A;  3F2B A;  3H91 A;  2CHB D;  1B4O A;  1PFB A;  4IJL A;  4LF9 Q;  5CGK A;  2KEN A;  1JB7 A;  1K9M C;  1QCB D;  1YNJ C;  1NMF A;  3JAM L;  4DA2 A;  5IT9 L;  2PW7 A;  4X66 Q;  2NYZ D;  1M8A A;  1BXT A;  3F2D A;  5KNC A;  1GXD C;  3TEH B;  1A0I A;  1K8O A;  1RL2 A;  1BKB A;  3BS1 A;  3FKI B;  4IUV A;  4KJO A;  1Q12 A;  2B29 A;  4CJ0 B;  4G7Z C;  1W6K A;  1HZB A;  1A2U A;  2MFI A;  2VY3 A;  5J22 A;  1GHJ A;  4KKT A;  3J7A 5;  3HOW B;  2NN6 I;  3M4Y A;  3CQZ B;  4NMZ A;  1V8Q A;  1UWV A;  2KEC A;  3H0G B;  1BO0 A;  1EQT A;  1D5X C;  3K81 C;  5IE8 A;  2E2H H;  3TP7 A;  1W6J A;  2UXB Q;  5JOB A;  4PNY A;  3PGZ A;  1K28 A;  1QZG A;  2K5W A;  4UHV A;  2QKI C;  5T1G A;  5IGG A;  3T4A C;  1OXT A;  4B3M L;  1MGS A;  1SEB D;  2D0P A;  4A3E B;  4G4K A;  4C3J H;  4N9P A;  1VF5 C;  3HOY G;  3P20 A;  4L63 B;  1BVS A;  1WCM B;  1MJC A;  1PLF A;  2IWH A;  2F0U A;  1PHJ A;  4HIM A;  3S15 B;  1K8M A;  1L0X B;  5C0X H;  4KHP Q;  4WRD A;  1EOT A;  4KMU C;  2AMC B;  4ME5 A;  4GKJ Q;  4C1N I;  4DR4 Q;  1I4G A;  3X3N A;  1Q8K A;  4I7Z C;  4MTN A;  1AZP A;  3I90 A;  5ELF A;  3I7F A;  1EQV A;  5M5Y B;  1EY0 A;  2KEE A;  3GTQ B;  1E1O A;  3I4N B;  3B6Y A;  3K5L A;  2K75 A;  1D1I A;  2BH8 A;  4CDE C;  4IOC A;  1VQD A;  1PTO D;  5IT9 c;  2KHI A;  4LF4 Q;  4ILW A;  5JEA H;  2B63 H;  2CW0 C;  2D9U A;  2NN6 G;  2YU9 H;  4EQ5 A;  3MEF A;  3HOW H;  1TKW B;  4GN4 B;  5LMN Q;  1RD9 D;  2IHE A;  5GQO A;  4NXM Q;  3CCQ A;  1D6E C;  3U4Z A;  4GOP A;  3S15 H;  3KF8 B;  4LK1 C;  3U58 A;  5CYU A;  1N34 L;  2E76 C;  4O2D A;  3HEJ A;  1M1K C;  1QE6 A;  1PXU A;  2V1C C;  3KDF B;  4X62 Q;  4KKU A;  5I4D A;  2NZO A;  1HZA A;  4K5V A;  1R4P B;  3CRK C;  4DV4 L;  5IWA L;  4IQZ A;  1AE3 A;  1GO3 E;  1KNE A;  3FDT A;  5EPK A;  3HKS A;  4ZUJ A;  3S9W A;  3DHQ A;  4GNX B;  3CCJ A;  3UI2 A;  3R8B A;  4HIK A;  1TII D;  1EFW A;  3K57 A;  2F0I A;  2QF7 A;  2KBN A;  5FLX c;  2HCC A;  4GOP B;  1G6Z A;  5M3M H;  4NPS A;  1SSO A;  3HZX A;  1IKM A;  2RDF A;  5C0X I;  2HDM A;  4QMG A;  1E7Z A;  1X3F A;  3DWA A;  1RKN A;  1V9P A;  2ZJR A;  1PYW D;  3OIP A;  1ILQ A;  5JJZ A;  4EQO A;  1XPR A;  3FKI H;  4PV1 C;  1QG7 A;  4RH6 A;  5EQ0 A;  3ERQ A;  4A93 B;  3MEH A;  2Y0S G;  3M3Y H;  2F0W A;  3FPP A;  2FFK B;  3PO2 G;  3DM3 A;  1LAB A;  1QUQ A;  2H4O A;  1Q1E A;  2LXK A;  4G7H C;  1IW7 D;  4DUZ Q;  1JOO A;  1PTO B;  2EXD A;  5BN4 A;  2F0T A;  2XNA C;  3ITP A;  1L2F A;  3MXN A;  1B3A A;  4X3K A;  2AQ1 B;  2VQF Q;  2MP1 A;  3VYR A;  1CM9 A;  3IAY A;  2RSN A;  2D5D A;  1HTL D;  1O7Y A;  4F7X A;  2F3V A;  1FD7 D;  1LTG D;  4DGZ A;  3PIP A;  3AYH B;  3X3M A;  1GM5 A;  3M9B A;  5C3E G;  1LT6 D;  3CP0 A;  2GN5 A;  1O7I A;  5JVG 3;  1B1Z A;  4OHJ A;  1S40 A;  5J1Z A;  4N8F A;  5ELO A;  3A5U A;  3S1R B;  1WTW A;  5DEH A;  1UNS A;  4X66 L;  2F0K A;  1XNR L;  1VQ7 A;  1HPC A;  2OXP A;  2F0N A;  2JXM B;  2WAQ G;  3EQL C;  4DR3 Q;  4KTA A;  4A3B B;  3QOJ A;  1AFP A;  4J6H A;  3F1Z A;  1VQK A;  2WFW A;  1B70 B;  2XWB B;  2F3W A;  4JI1 Q;  4IFD H;  1AW7 A;  1HH2 P;  1MIU A;  2CH4 A;  3BZK A;  5C3X A;  1Y1W B;  4DV1 Q;  2BE5 D;  1HQR D;  1STB A;  1K3B C;  4DR1 L;  1Z6H A;  1G51 A;  3NQI A;  3TQY A;  5K36 G;  4A93 G;  4IOA A;  4DNI A;  1EOV A;  2Z8L A;  2B2V A;  1VQA A;  3NTK A;  1ZXT A;  4TSS A;  3O13 A;  1XTD A;  1A3V A;  2LSS A;  1VQG A;  3GTO H;  2ICI A;  2F52 A;  2I5L X;  1N33 Q;  5A35 A;  3Q24 A;  3P75 A;  1XPO A;  2WKD A;  4HJ7 A;  3HRZ C;  3RNU A;  3HOZ B;  4O42 A;  2RKS A;  4Y52 H;  1N33 L;  4P75 A;  4HJ5 A;  3V05 A;  1Y1W H;  5EBD A;  1L1O B;  3C1E A;  1N36 L;  1IBL Q;  1QNK A;  2ZT9 C;  2K03 A;  4DN4 M;  1JQY D;  3KOJ A;  4BY7 H;  2K28 A;  4H0L C;  2F0O A;  4YY3 L;  3SK6 A;  3M3Y B;  1QVG A;  3MFY A;  3SXH A;  4ZKB B;  1WTO A;  3H94 A;  4EQP A;  2E8G A;  2MO1 A;  4NP5 A;  4A3B G;  2HIX A;  4LNQ A;  2NVQ H;  4KHP L;  4LJZ C;  3M7N A;  1B2T A;  4JCV E;  1ENA A;  4ZCK A;  4F88 A;  4CDF C;  2BDN A;  1SYB A;  1CT1 D;  4RMF A;  3GTK B;  3DWP A;  3J80 E;  3ERS X;  1STY A;  3F2C A;  1N9W A;  2A68 D;  3A8I E;  4JBJ A;  1BCP C;  3UDF A;  1XMQ L;  5LMU L;  5C4X B;  3KF6 B;  2XRQ D;  5CV4 A;  2GVB A;  4R9W A;  1STA A;  2WAC A;  4HMJ A;  3NWT A;  1I94 Q;  2EYL A;  3A56 A;  5G3L F;  5LHY 1;  5CV9 A;  2PZW A;  1J6Q A;  1PH8 A;  3KJO A;  3S1Q H;  5IOD A;  5KIX A;  1JE5 A;  1EU3 A;  3TZD A;  3E9I A;  4X3T A;  2I46 A;  1CKO A;  4RKB A;  4S3S A;  1BBX C;  4LFB L;  3TZU A;  3HOX G;  1EZ8 A;  3TBI B;  1EWI A;  3QB3 A;  5F2D A;  1RTO A;  2R92 B;  3G6J B;  2O4X A;  3I70 A;  1AN8 A;  2YTX A;  4PZ8 A;  3CCE A;  3Q23 A;  5M3F H;  5BN5 A;  3M4O B;  3K7U C;  1U4M A;  1YVC A;  3OMC A;  3IL8 A;  1EEI D;  5KND A;  4GN3 B;  1XMQ Q;  2GVA A;  1B7Y B;  4LF9 L;  1LYL A;  2YTV A;  4LF7 L;  1WFQ A;  3HOZ H;  1FJG L;  4BXX H;  2O5I C;  4JBM A;  2A6H D;  4LF5 Q;  1Q81 C;  1SYG A;  4XQN A;  4BBS B;  3PV0 A;  3QIA A;  1IL2 A;  4GLX A;  4HR7 B;  1SMX A;  5C4H A;  1CI3 M;  4HSV A;  1PH3 A;  2A69 D;  4IUP A;  2XIW A;  3J81 E;  4XIG S;  3OYY A;  1TWF H;  1EYD A;  3QJY A;  2CH4 W;  2F4V L;  3G48 A;  2QEJ C;  4OWX B;  5IP9 G;  2YYZ A;  2NN6 H;  1JOK A;  1XNR Q;  2AQ3 B;  3K5O A;  1GD7 A;  1DGS A;  4L6T B;  3N52 A;  5NUC A;  3J80 i;  4A3I B;  1PH9 A;  1SNQ A;  1NTG A;  1LM0 A;  2UUC L;  4JI5 Q;  3KF8 A;  4C56 C;  3FKI G;  1HNW Q;  1TWF B;  1SBB B;  3W1G A;  5EKI A;  1VQ4 A;  1IBM L;  1XMO L;  3K7A B;  4YWL A;  4RGM A;  3NXW A;  1RJT A;  2ZXO A;  2PQA B;  4A3E H;  1HNZ Q;  4B08 A;  1HA6 A;  1PYS B;  3MWY W;  3STB D;  4DR1 Q;  1CA5 A;  1S72 A;  2JEA I;  3LX0 A;  5HGQ A;  4XYQ A;  5JAV A;  2Q8I B;  1T5X D;  1Y1V H;  3CC2 A;  4DV0 L;  4KY5 A;  3D8G A;  3H0G G;  1SE2 A;  4R4O A;  4AQY L;  1GUS A;  5GAG C;  2SNM A;  4DV2 Q;  2L55 A;  2K04 A;  2N55 A;  1HTP A;  4X6A H;  4APV A;  5GRO A;  1MKH A;  2R92 H;  2R7Z G;  2EY2 A;  4XQJ A;  1PZJ D;  3OIQ A;  4A3M G;  2JA8 H;  1ESF A;  2CWP A;  2M00 A;  4I7A A;  4LF8 Q;  2ZXP A;  2PZT A;  4C3J B;  5IP7 H;  4GKK Q;  3EBE A;  1NMG A;  4FF3 A;  1JOR A;  2A74 C;  3D4D A;  2R6G A;  5EKL A;  1S5F D;  1FL0 A;  3PUZ A;  1TWG B;  1JR0 D;  3KLS A;  3CQZ H;  5D65 A;  3QR8 A;  1AP0 A;  1W3S A;  3TME A;  3CPW A;  2QGQ A;  1ML0 D;  2ZM6 L;  5FO9 B;  2E5L L;  2K01 A;  3C2P A;  3E9H A;  1X32 A;  3G6E A;  1F2L A;  3MZ5 A;  3HG9 A;  4DUY L;  3HFZ B;  5ISR A;  1EIG A;  5FLX L;  2I0Q A;  1XPU A;  1WTV A;  3AEV A;  3K6O A;  1AZQ A;  2JA8 B;  5KGU A;  5JJK A;  1SYD A;  5M5W H;  4DR2 Q;  2RDG A;  1O7L A;  1TWH B;  2D62 A;  1I4X A;  1KNA A;  1VQN A;  3ND8 A;  2K05 A;  2KVM A;  4QQB X;  2NVY B;  1U4P A;  3S16 B;  1SMY D;  1IKL A;  4J15 A;  4A3K B;  4DUZ L;  5K5P A;  1U4L A;  1I50 B;  1TT2 A;  1X56 A;  2F03 A;  2C5C A;  1B44 D;  2FXQ A;  1CZW A;  1PRT C;  2K4K A;  3DEP A;  3GTG H;  5IGD A;  3GTL H;  1LTT D;  3HOU G;  1K3R A;  3WOE A;  1TXY A;  2XGT A;  4KY7 A;  2LMC B;  3A54 A;  3VR6 A;  1DJR D;  3PO3 G;  1BR9 A;  5C6A A;  2JA5 B;  4DNT B;  1EL0 A;  5IGF A;  2DJF C;  3SK8 A;  5DM6 3;  4FF1 A;  3CKI B;  2J0T D;  4HIO A;  3EFX D;  1EEF D;  1F9R A;  3NTI A;  4GZY C;  2DGY A;  2NVX B;  3G71 A;  3GTG B;  1F9Q A;  1LTR D;  1SYF A;  3S1Q B;  4TVA B;  3TP8 A;  3T51 B;  1IZ6 A;  1E2W A;  1TS5 A;  2KJX A;  2OT2 A;  2Q8T A;  2L4N A;  4DV5 Q;  2F0M A;  2ID0 A;  4JI5 L;  2LY7 A;  4DXG A;  3H0G H;  2NZ1 D;  2MPM A;  1X54 A;  3DEO A;  3MFG A;  3DM1 A;  1PH7 A;  4JVZ A;  3AFP A;  4KN7 C;  5E3F A;  2O5J C;  1XJV A;  1B53 A;  3E5S A;  4NXM L;  3QO2 A;  5M5W B;  4DR7 L;  1II3 A;  1Z9F A;  2BCO A;  1B9M A;  2HDL A;  2R61 A;  2CQA A;  2KCN A;  4BBS H;  5I9O A;  1T9H A;  2QIL A;  4JI4 Q;  3ULJ A;  4IFD I;  1O80 A;  1E0B A;  2UXC Q;  4TQU S;  3T53 B;  3I4M G;  2RVL A;  1BDO A;  1VQF A;  2R7Z B;  2UUC Q;  5JEA G;  1L1O C;  4JI7 Q;  4DK1 A;  5IIF A;  1M90 C;  4A3J B;  4OIJ A;  1VQL A;  1BQQ T;  2R7F A;  1SNO A;  3SHL A;  4OO1 H;  1NY4 A;  2A8V A;  2EJM A;  2EYO A;  3KF6 A;  5I6Y A;  2K5V A;  1CKM A;  3GV6 A;  2B2W C;  4V0B A;  3SVM A;  3KLR A;  4I65 A;  5IYD H;  1EY5 A;  3OOC A;  2IT1 A;  3H3V H;  3GTJ H;  4AYB B;  3D31 A;  2R7D A;  3RD4 A;  2BE5 C;  2PMZ E;  1SE4 A;  3LNN A;  2WV6 D;  1FGB D;  3KDF A;  1WD0 A;  5JVH 3;  1BBU A;  4DAM A;  3VR2 A;  2L11 A;  1RCV D;  3GV3 A;  4LF8 L;  4LW1 A;  1WD1 A;  1JT8 A;  1QOH A;  5C4J H;  3I4O A;  1A62 A;  1EFI D;  1VQC A;  3ULL A;  3BVG A;  4X62 L;  2UUA L;  1H9R A;  4JI3 L;  2Q2T A;  4K6D A;  2JA9 A;  5IYC H;  3HOZ G;  1HNX Q;  1FVI A;  1VQJ A;  1RHP A;  5M3M G;  1WTH A;  3NSW A;  3V2T A;  3G4S A;  2EYM A;  2KOL A;  2L0C A;  5IP9 H;  3T13 A;  4A3F G;  4O0A A;  1WTQ A;  5K36 H;  4XT3 B;  1Y1W G;  1PRT D;  4CDC C;  3HOY B;  5GAE C;  3NEL A;  4DR6 L;  1NR4 A;  4OGQ C;  3HKZ B;  1J9O A;  3KBX A;  1BOS A;  1HFG A;  2Q2U A;  3K5N A;  4KI0 A;  1LUZ A;  3EJI A;  4IPH A;  4QJF A;  1H95 A;  3VYT A;  4YHH L;  4IO9 A;  4RFB A;  4N8X 1;  1JB3 A;  1NE3 A;  2UXD L;  1GUN A;  4ZK9 B;  2IY5 B;  4A3M H;  4IUT A;  4DV7 Q;  4OX9 Q;  1H9S A;  4QB4 A;  1NR2 A;  4CDD C;  4DR5 Q;  1I6H B;  2WAQ E;  3CMA A;  4X65 L;  2K32 A;  2IX1 A;  3J7A V;  2EOT A;  2WIN B;  3M7G A;  4JOI A;  4IPD A;  2VUM H;  4KHV A;  4DAY B;  1CFM A;  1WCM H;  3HOX B;  4HJA A;  3DXJ C;  1VCI A;  1TS4 A;  2JSO A;  2E74 C;  2K14 A;  4WJW A;  3OSO A;  2F4V Q;  3JC6 6;  4CHT B;  2N3S A;  1HRJ A;  4KY6 A;  3SE0 A;  3J7A F;  5ELD A;  3K58 A;  4ZKC B;  1H9M A;  2PNH A;  3C3L A;  1OO9 B;  1B9N A;  3N6R A;  4OO1 G;  2N78 A;  3OHX C;  1B8A A;  2Y0S E;  4OWW B;  1G91 A;  2F0F A;  5A2Q E;  1RF2 D;  4A3J H;  1R9T B;  3UDX A;  2ICE C;  3CPF A;  5FKA C;  2VUM G;  1FGU A;  1HHV A;  5C3W A;  2F0S A;  3T1Y Q;  4UP9 A;  4EX5 A;  4NKL A;  2PMZ B;  4A3J G;  1CKN B;  4MN3 A;  2UXB L;  4BBS G;  4RHS A;  4DNR B;  2PO4 A;  2EYF A;  4A3L H;  3S1R H;  2R3Z A;  1LTA D;  3VDY A;  1YNN D;  1IHZ A;  2K5Q A;  2NB0 A;  5EPL A;  1ET6 A;  2OQK A;  2SNS A;  1KDB A;  4P72 A;  1LT4 D;  1YI2 A;  5DM7 3;  4F87 A;  1IXR A;  2PI2 A;  2VB2 X;  3CU7 A;  1VQI A;  5D3I B;  2H5X A;  1SAP A;  1RIP A;  4POF A;  3FRP B;  1I94 L;  3EIV A;  4HSP A;  2IHF A;  1QIL A;  5GAH C;  4A3I G;  1X9N A;  5H1S E;  2MNA A;  2ES2 A;  2E2J H;  4K2K A;  1DOL A;  2F0J A;  1WTP A;  1PH1 A;  4RA8 A;  3HS0 C;  3GTO B;  3HKZ E;  5LL6 S;  1VMP A;  1KD1 C;  3H3V C;  4KD3 A;  1STN A;  2NVX H;  3UDI A;  1S3O A;  3BYY B;  3TP6 A;  4C2M B;  4JC0 A;  1F2Y A;  4A3C G;  1X6O A;  5FO8 B;  2B63 G;  1PVO A;  1KHI A;  3NBI A;  5FOB B;  3QG1 A;  4HTH A;  2YV5 A;  2D2C C;  1IBM Q;  2G9H D;  4B3T L;  3A8J E;  3H6M A;  3P7J A;  4LWC A;  1D5M C;  5D14 A;  5EGT A;  3HOU H;  4K8I A;  1WI5 A;  3AMU A;  4LFC L;  2L5T A;  3TRZ A;  2FJ2 A;  3J7Z C;  4B3T Q;  5CMD A;  1IBL L;  3I73 A;  1I50 H;  3HOV B;  1EIF A;  2CCZ A;  4H02 A;  3NEM A;  5JJI A;  1V1P B;  1UE6 A;  5C4Z A;  1TU2 B;  1N34 Q;  4A3M B;  1N36 Q;  3NUC A;  1Z47 A;  1TWH H;  2F0G A;  3PIO A;  1CA6 A;  1MBY A;  2DN8 A;  2B39 A;  3S16 H;  4J1M A;  3JAM c;  4JV5 L;  1TWC H;  1XXG A;  4DFA A;  1S5D D;  4JW0 A;  5IYC G;  1DYQ A;  1FR3 A;  4BA2 I;  1ENF A;  1H9K A;  2TSS A;  2D0O A;  2PZU A;  1LT3 D;  3BDO A;  1KAB A;  3KJP A;  4JBK A;  1JJ2 A;  1S5B D;  2NTT A;  2CKZ B;  5JJL A;  3SR1 A;  5GAD C;  1IW7 C;  1UE7 A;  3IFD A;  1ESR A;  1SNC A;  4DV0 Q;  1YIJ A;  1TWG H;  1GUW A;  3VYU A;  4FF2 A;  3HOV H;  2B8F A;  1SR3 A;  4C3H G;  1PFN A;  1KC8 C;  1Y8N B;  3LGJ A;  4LUO A;  5M5Y H;  1ICW A;  1KRT A;  4DF7 A;  3A8K E;  2Z6K C;  1PZK D;  1U0L A;  3AU7 A;  5IOC A;  3CCM A;  3BDL A;  3OWE B;  1ICF B;  5KEE A;  4UY8 C;  1IL8 A;  3VR5 A;  4M1U B;  1GVP A;  3GTQ H;  1FNV A;  4Y7N H;  2B8G A;  4WJ4 A;  5E4W C;  3SDZ A;  4XT1 B;  1PH4 A;  1VMC A;  2JA8 G;  2EJG C;  4C2M H;  3U9O A;  2N49 A;  2OCE A;  2K50 A;  3PMF A;  3R93 A;  3PF4 A;  3ND9 A;  3PSI A;  4DR3 L;  1AH9 A;  1PYB A;  4B9W A;  3BJU A;  3KYH C;  4BY1 G;  2HT1 A;  1KXL A;  1Q7Y C;  4PMC A;  2A5H A;  3GTL B;  2QDL A;  2EYH A;  1XNQ Q;  4FXG C;  4JI8 Q;  4LF6 L;  1ZYR C;  1WYD A;  1SNP A;  1JWM D;  4QIW B;  1SYC A;  2VB3 X;  2JQO A;  1VQE A;  3OWF A;  3K59 A;  3PO3 B;  4IFD J;  1V1O A;  1HZ9 A;  4LUV A;  4IUQ A;  3T1Y L;  2OTJ A;  1MI2 A;  1UUP A;  5FLX E;  3CME A;  4A3G G;  1Q3L A;  1JOQ A;  1YNX A;  3LWU A;  4L5Q A;  2B2Y C;  2EZV A;  1QNU A;  3EVQ A;  1IBK L;  3R2T A;  2B2Y A;  1NCV A;  3C46 A;  4QF4 A;  3CCL A;  1G2T A;  4GS3 A;  3GTM H;  2CQO A;  4HID A;  2PNR C;  2Q2I A;  5C44 B;  1SYE A;  3ICE A;  2RF4 A;  4HAE A;  4KHZ A;  1YBY A;  2A6E D;  1TS3 A;  3HOW G;  4PMW A;  4GLA C;  2PQE A;  1V43 A;  4K14 A;  4RHR A;  3S14 B;  4XTC S;  1G6P A;  2CVR A;  2DJG C;  5EJW A;  4DV3 Q;  2Z4H A;  4LFC Q;  2VNU D;  1U9R A;  4MTK A;  1DON A;  2XN9 C;  4C3H B;  4GOP C;  3BZC A;  1Q82 C;  5D3D A;  1K73 C;  3UDG A;  4Q5V A;  3DWQ A;  1KLU D;  4DK0 A;  3L2P A;  4OO1 I;  2JA7 B;  3PO3 H;  5E7N A;  2ATW A;  4MHE A;  1UE1 A;  1LTS D;  5C4J B;  5L37 A;  5FLM G;  4JI0 L;  3CCV A;  3KUP A;  1EQQ A;  1F77 A;  3FP9 A;  4A4I A;  3HOV G;  4BA1 I;  5IY0 A;  4IAL A;  4PG3 A;  1NBW A;  3I4M B;  4HMI A;  1PTO F;  3F8T A;  4JYA L;  3AB9 A;  4PZ6 A;  1NSN S;  4B3M Q;  1G29 1;  2J7Z A;  3T16 A;  4KK7 A;  3IKJ A;  4JPB W;  2FMM A;  3K8A A;  5J3B A;  3S24 A;  5IWA Q;  1WCM G;  1MHW C;  1K83 H;  2RCF A;  5FLM H;  1YEZ A;  2A69 C;  3FMC A;  2KED A;  3KK7 A;  4X64 L;  4JI6 L;  2R93 G;  2ENB A;  4XXE A;  1E3P A;  3OW2 A;  4JI3 Q;  2JA6 G;  3WDN A;  5LMN L;  3FHW A;  1VDZ A;  1DOK A;  5FJ8 H;  1ASZ A;  5IP7 G;  2CW0 D;  1VQ5 A;  2O2L D;  1Y1V B;  4JI6 Q;  1Q1B A;  3W2D A;  4AYB G;  1XX8 A;  1BCP D;  1ROD A;  2MJ8 A;  4K5W A;  1KRS A;  1QVF A;  1YNJ D;  1XMO Q;  1VQH A;  4LAA A;  4IZ8 A;  1GOZ A;  3S17 B;  4UP7 A;  4LFB Q;  4R4I A;  1D1K A;  1ZYR D;  3FEW X;  4X3S A;  2X69 A;  5M3F G;  1IYV A;  4ULL A;  2UUA Q;  1J5E L;  4L5R C;  1CSQ A;  3OTO Q;  4NXN Q;  2V4D A;  1PH2 A;  4L5S A;  2HIV A;  4DR4 L;  4GKJ L;  5IGE A;  2FHT A;  4QIW E;  4ID6 A;  1EYG A;  2AUJ D;  1UE5 A;  5C3E B;  3J81 i;  2DY7 A;  1OXV A;  1EQR A;  5EAY A;  4C3H H;  2K5D A;  3TS2 A;  1C4Q A;  1STE A;  4JBW A;  1HUN A;  3I4N G;  4MIU A;  3I4L A;  1KDC A;  4BBR G;  2WII B;  3NE5 B;  1WTR A;  4KJN A;  3MC0 B;  1CUK A;  1FYC A;  1FJG Q;  2GA4 B;  2N8N A;  3GTJ B;  1C48 A;  2IX3 A;  3C1F A;  3S2D H;  4NXN L;  3OTO L;  1SE3 A;  3I2Z A;  3L7Z C;  3Q6S A;  1K0R A;  2LFN A;  4BY7 B;  4KLK A;  5C44 G;  2VQE L;  3PUY A;  3GO5 A;  3ONA B;  5E4X A;  2PYK A;  1DCZ A;  1XNQ L;  5HY6 A;  5M9O A;  4OWT B;  4DV6 Q;  3U4V A;  4DR5 L;  2NWG A;  3A5Z B;  5M3F B;  4ZYS A;  3CAM A;  2KCM A;  1SND A;  1I4R A;  2WP8 J;  2BDO A;  4LFA L;  2WB1 E;  3T56 B;  5AJ3 Q;  4JI2 L;  3GP7 A;  1CQV A;  3LWE A;  3IFT A;  1HNW L;  4GLV B;  1PTO C;  1J8I A;  2F1M A;  1AEX A;  1CQF A;  1WJJ A;  3OPO A;  4A3C H;  3TRE A;  3W5O A;  2EE1 A;  2X6L A;  2I07 B;  3TDQ A;  4YWK A;  1LLR D;  1QZH A;  1R9T H;  1PDQ A;  5I6W A;  2VQF L;  4K2L A;  4ZUI A;  5KYI A;  1L0Y B;  4RGN A;  2VL6 A;  2RHS B;  3ULP A;  5ELE A;  4BBR B;  3HOU B;  2I5H A;  3F2U A;  4DV2 L;  1VQ9 A;  5COR A;  2XTI A;  3CXC A;  4IUU A;  3D0F A;  5HUR A;  3E6Z X;  1O7Z A;  1PTO H;  2RCN A;  4H13 C;  4PZ7 A;  3S1N H;  4KKS A;  1J5E Q;  2BA1 A;  1TY2 A;  4L8J A;  4A3L G;  4NB3 A;  4A93 H;  1GUG A;  3CCR A;  1HCZ A;  1K8G A;  1EWH A;  1YNN C;  4K0K L;  2UUB Q;  4JI7 L;  5CV6 A;  2EYJ A;  3V96 A;  4HN7 A;  1KQS A;  2VW9 A;  1S4Z A;  1SE8 A;  1HR0 W;  2F0H A;  3J81 c;  3PIP 3;  2L12 A;  2EVB A;  1KLG D;  2AWO A;  2SOB A;  1A8V A;  1QWY A;  1E1T A;  5C0X G;  4JG2 A;  2LKV A;  3MXP A;  2WAQ B;  5BR8 L;  2XSC A;  2YTY A;  1H9J A;  3T1H Q;  2ZTD A;  2A68 C;  2A1A A;  2F0E A;  3RZO B;  1TR5 A;  2B2U A;  1A3U A;  1CHP D;  5HGT A;  2ZJQ A;  1UEB A;  1Q8I A;  1QB5 D;  1F2Z A;  1L0W A;  1JMC A;  1KL9 A;  5IYD G;  4C3I B;  2VZA A;  2E2I B;  2OF1 A;  2MGS A;  2OEO A;  4Q0F A;  2AHO B;  1EIH A;  1SRU A;  3CF5 A;  4DR2 L;  4UPA A;  3DLL A;  1X3P A;  1GJX A;  1OXU A;  1STG A;  3TN2 A;  5BN3 A;  1VQB A;  1ZKO A;  3D3R A;  2E2J B;  1X55 A;  4QUC A;  4A75 A;  5JEA J;  3M4P A;  2KHJ A;  3BYT B;  2IJ0 A;  2B2V C;  5M5X B;  3E0J A;  1OXS C;  4DPG A;  4FO2 A;  2J4X A;  1F9S A;  2DUD A;  4ZAI A;  2EDG A;  5KYL A;  1B3Q A;  1PH6 A;  2DNC A;  2A6H C;  1HNX L;  3STB C;  4CJ2 C;  1Z7T A;  2HHH L;  4BY7 G;  2WB1 B;  4HED A;  2CFM A;  1KDA A;  3CW2 C;  4TKO B;  5DLQ E;  1I3Q B;  1LT5 D;  4DK6 C;  1EY7 A;  4GNX C;  2ZTC A;  2HUG A;  2NBF A;  3NWS A;  4R8I A;  3I4M H;  5I9P A;  1E22 A;  3Q8D A;  1LTI D;  3BU2 A;  2KCC A;  3AQQ A;  1HFN A;  1EYA A;  3I72 A;  2WKC A;  1UAP A;  4A3F H;  2KHS A;  1SNM A;  1JWS D;  5COY A;  3MHB A;  3CC4 A;  2E2H B;  3VR3 A;  3URY A;  3A74 A;  5TSS A;  1GKH A;  3ERO A;  5JPM C;  1C8C A;  3NBH B;  4P2C B;  5G3L D;  1LO5 D;  3MXG A;  4YCU A;  4BS9 A;  1A15 A;  1PRT B;  3K0Y A;  2HHH Q;  1VQ6 A;  1ET9 A;  2JN4 A;  5LMN W;  1CK1 A;  4IPC A;  4A3E G;  1LTB D;  1C0A A;  2MHV A;  3K80 C;  3VA7 A;  3OW7 A;  3NEN A;  1GHK A;  1TVX A;  2X6G A;  1HUM A;  4EGV A;  1OTC A;  2Z4I A;  4G7O C;  4FP5 D;  5IT9 E;  2HQE A;  4PQX A;  4ZQ3 A;  4OL7 A;  1XYI A;  3HOY H;  3FPU B;  4OX9 L;  4RCO A;  1ILP A;  2JK8 A;  3KFU A;  4YCW A;  1XWE A;  3MXN B;  4WJ3 M;  5C3E H;  4H7B A;  5CBA E;  4DV6 L;  4E6I A;  3BZD B;  3GQB A;  4A3G B;  1X65 A;  3HGB A;  3TSS A;  4RKL A;  4DKA C;  2EY5 A;  2HCI A;  1ENC A;  3BG3 A;  3S1M B;  2EY6 A;  4FVM A;  4C1N K;  3K5M A;  4C3I H;  4UDU C;  1X3E A;  2E2I H;  1OXX K;  4GKK L;  3RN2 A;  4B3R Q;  4IJH A;  4L5T A;  4AYB E;  1Y69 U;  2DY8 A;  4IN3 A;  3ZJY C;  2JA7 G;  4G57 A;  1PA6 A;  2NZH A;  2L1B A;  2PI2 E;  1BCP B;  4V19 0;  5CV8 A;  2MO0 A;  2A6E C;  4GNX A;  4ABN A;  4BY1 B;  3J7Y W;  4R4C A;  1NJI C;  3A0J A;  3I4N H; 
#chains in the Genus database with same CATH homology
 2AUK A;  4CBV A;  1H9S B;  1K83 B;  3RMH A;  5CV7 A;  3SEB A;  2A73 B;  2EY1 A;  4TRD A;  1NUC A;  2R93 B;  2JA6 B;  3S1N B;  1E2V A;  1DZ1 A;  1R4Q B;  5J39 A;  3QOL A;  2C9O A;  2SDF A;  1JWU D;  2IL8 A;  4FXK C;  4KV6 A;  5A2Q L;  4PMB A;  4XYO A;  3EA6 A;  1JCK B;  5EBC A;  1I4Q A;  3H09 A;  2VXW A;  1CTM A;  1B50 A;  2NVT B;  1LAC A;  1GUO A;  1PMR A;  5C5M A;  2NUC A;  2EJF C;  1SDF A;  2FIN B;  3MTS A;  5I2Y A;  1MD2 D;  4U68 A;  2L9H A;  2M2L A;  4C3J G;  5LL6 X;  2H1E A;  4KD4 A;  1EZ6 A;  3HP3 A;  1KTK A;  1EU4 A;  2F0Q A;  4EVO A;  1G2S A;  1EWC A;  1NAP A;  1QJO A;  1ZEQ X;  1PZI D;  4H44 C;  1I4H A;  1TS2 A;  4CGY B;  4FYD A;  4UAI A;  2RDH A;  2JEB I;  5EKK A;  4CKB A;  1HXY D;  4FNF A;  3R3O A;  3L9A X;  3NBH A;  3NQT A;  4CKE A;  2E2D C;  3Q0A A;  2DNE A;  4B9X A;  3PUX A;  1Y8O B;  3I3C A;  4O1N A;  1DD2 A;  2QDB A;  1BNZ A;  4HCE A;  1SJH D;  2K6A A;  3NP8 A;  5KRU A;  1V1P A;  1RTN A;  2AWN A;  1CZG A;  4J8Q A;  2F4I A;  2EXZ A;  1CHQ D;  3VR4 A;  1M4V A;  3G7L A;  4A3D B;  2KUM A;  2IX0 A;  1DXM A;  5DAU A;  3ZYY X;  4FF4 A;  3NPP A;  5C5L A;  2Y0S B;  3A7A B;  3PO2 B;  1JE4 A;  1Q90 A;  3S2D B;  4KN4 C;  1HQM C;  2SEB D;  2Q8R E;  3NTH A;  1A3T A;  3M85 A;  1JIC A;  4Z9C B;  3PUW A;  5CR3 A;  1EY4 A;  3SK5 A;  1TWA B;  4RWS C;  2JE6 I;  1U4R A;  5M3M B;  1G8Z D;  2F0L A;  3BVZ A;  4A3F B;  3Q22 A;  1STH A;  3CRL C;  3DUZ A;  1MSG A;  2KQ3 A;  1JC7 A;  5IGC A;  4IUN A;  2NVQ B;  3FVQ A;  5T1I A;  1TQO A;  3A55 A;  1DOM A;  2IPK D;  2IW3 A;  3I91 A;  4K6L A;  2EPB A;  1BUV T;  3NK9 A;  3I8Z A;  4BWG B;  3MAQ A;  1F9P A;  5C0X J;  1SMY C;  2YU9 B;  2JP1 A;  5FO7 B;  1WVL A;  1RDP D;  4RAU C;  1KAA A;  4DAY A;  3U9S A;  3DMU A;  1BCP F;  1MSH A;  3PUV A;  4WOR A;  3RUZ A;  1E2Z A;  3TP5 A;  3BVM A;  3KLS X;  3R2I A;  4XDX A;  1I4P A;  1D5Z C;  2B2T A;  4IFD G;  1LV9 A;  4DU9 A;  2EYP A;  4QCL A;  3JAM E;  2AQ2 B;  3CHB D;  2F0P A;  3J80 L;  1UEA B;  1I6V C;  5E1F A;  5ELB A;  4QUF A;  2F0D A;  4C3I G;  1PFM A;  5AFW A;  1Y8P B;  3SK4 A;  2E75 C;  4DAP A;  4DXF A;  1VF7 A;  2BA0 A;  3D4W A;  1SFO B;  4WFN 3;  2RQX A;  2TMP A;  2XWJ B;  4F8M A;  4LMQ D;  4DAV A;  4RCN A;  1T5E A;  2BOS A;  3MA2 B;  4FXD A;  1DM0 B;  1EY8 A;  1HA5 A;  1D2B A;  2PPB C;  3VA5 A;  4XQQ A;  2NTS A;  5FK9 C;  3GTM B;  1X3Q A;  2N88 A;  4X3U A;  1FNU A;  1TWC B;  4ODG A;  3RLF A;  2PCF B;  4IUR A;  3WOF A;  2XRS D;  4U67 3;  1SXT A;  3W3A A;  3MXU A;  5IGB A;  1EY9 A;  2B2T C;  4K5X A;  2F0V A;  5CV5 A;  5ELC A;  2JYO A;  3L3O C;  4Y7N B;  1S5E D;  4RGO S;  2PW5 A;  2RBM A;  2VUM B;  4YIJ A;  1XTC D;  3NHH A;  3S2H B;  1F2M A;  4EQN A;  4R8N A;  2K7V A;  3GD7 A;  3D6W A;  4N9T A;  3J81 L;  4NW2 A;  5CC4 A;  1EY6 A;  2B2U C;  4JK1 C;  1A2T A;  1TY0 A;  1S5C D;  2RA4 A;  5KNB A;  4ZLT F;  1O78 A;  4OIK A;  3D4R A;  1GUT A;  4CJ1 B;  2K1B A;  5CBE E;  1ONL A;  1FNW A;  3P1H A;  2B63 B;  3BDC A;  2M9V A;  2XVS A;  2RSO A;  3A7L A;  2G9D A;  5I2X A;  1WTX A;  2ZXR A;  3GTP B;  3D6C A;  4ZRZ A;  4NDX A;  3QWN A;  4CKC A;  3VYS A;  3RZD B;  4K8J A;  1EYC A;  3OMG A;  4RGT A;  3KBG A;  3MVV A;  1PRT F;  1IYU A;  2B2W A;  3PIO 3;  2KA7 A;  5DNF A;  2QCP X;  2LS0 1;  5JPN C;  5EPJ A;  1A6X A;  2FMC A;  4M8A A;  2K33 A;  1BF4 A;  2Z1C A;  2MUY A;  1SJE D;  4HCS A;  3H91 A;  2CHB D;  1B4O A;  1PFB A;  5CGK A;  1QCB D;  1YNJ C;  3JAM L;  4DA2 A;  5IT9 L;  2PW7 A;  2NYZ D;  1M8A A;  1BXT A;  5KNC A;  1GXD C;  1K8O A;  3BS1 A;  3FKI B;  4IUV A;  4KJO A;  1Q12 A;  4CJ0 B;  4G7Z C;  1W6K A;  1A2U A;  5J22 A;  1GHJ A;  4KKT A;  3HOW B;  2NN6 I;  3M4Y A;  3CQZ B;  4NMZ A;  1V8Q A;  2KEC A;  3H0G B;  1BO0 A;  1EQT A;  1D5X C;  3TP7 A;  1W6J A;  5JOB A;  4PNY A;  2K5W A;  2QKI C;  5T1G A;  5IGG A;  3T4A C;  1OXT A;  1MGS A;  1SEB D;  4A3E B;  4G4K A;  4N9P A;  1VF5 C;  3P20 A;  4L63 B;  1WCM B;  1PLF A;  2IWH A;  2F0U A;  3S15 B;  1K8M A;  1L0X B;  5C0X H;  4WRD A;  1EOT A;  4KMU C;  4ME5 A;  4C1N I;  1I4G A;  3X3N A;  4I7Z C;  1AZP A;  3I90 A;  5ELF A;  1EQV A;  5M5Y B;  1EY0 A;  2KEE A;  3GTQ B;  3I4N B;  3K5L A;  1D1I A;  1PTO D;  4ILW A;  5JEA H;  2CW0 C;  2D9U A;  2NN6 G;  1TKW B;  1RD9 D;  1D6E C;  4LK1 C;  5CYU A;  2E76 C;  3HEJ A;  1QE6 A;  1PXU A;  4KKU A;  5I4D A;  4K5V A;  1R4P B;  3CRK C;  4IQZ A;  1KNE A;  3FDT A;  5EPK A;  4ZUJ A;  3S9W A;  3DHQ A;  3UI2 A;  3R8B A;  1TII D;  3K57 A;  2F0I A;  2QF7 A;  2HCC A;  1G6Z A;  1SSO A;  3HZX A;  1IKM A;  2RDF A;  5C0X I;  2HDM A;  4QMG A;  3DWA A;  1RKN A;  1PYW D;  3OIP A;  1ILQ A;  5JJZ A;  4EQO A;  4PV1 C;  1QG7 A;  4RH6 A;  5EQ0 A;  3ERQ A;  4A93 B;  3MEH A;  2F0W A;  3FPP A;  2FFK B;  1LAB A;  2H4O A;  1Q1E A;  4G7H C;  1IW7 D;  1JOO A;  1PTO B;  5BN4 A;  2F0T A;  2XNA C;  3ITP A;  3MXN A;  1B3A A;  4X3K A;  2AQ1 B;  2MP1 A;  3VYR A;  1CM9 A;  3IAY A;  2RSN A;  2D5D A;  1HTL D;  1O7Y A;  4F7X A;  2F3V A;  1FD7 D;  1LTG D;  4DGZ A;  3X3M A;  1LT6 D;  5JVG 3;  1B1Z A;  4OHJ A;  5J1Z A;  3S1R B;  1WTW A;  5DEH A;  1UNS A;  2F0K A;  1HPC A;  2OXP A;  2F0N A;  2JXM B;  3EQL C;  4KTA A;  4A3B B;  3QOJ A;  1AFP A;  4J6H A;  2XWB B;  2F3W A;  4IFD H;  1AW7 A;  5C3X A;  1Y1W B;  2BE5 D;  1HQR D;  1STB A;  1Z6H A;  3NQI A;  5K36 G;  2Z8L A;  2B2V A;  3NTK A;  1ZXT A;  4TSS A;  3O13 A;  1A3V A;  2ICI A;  5A35 A;  3Q24 A;  3P75 A;  2WKD A;  3HRZ C;  3HOZ B;  2RKS A;  4O42 A;  3V05 A;  5EBD A;  3C1E A;  1QNK A;  2ZT9 C;  2K03 A;  4DN4 M;  1JQY D;  2K28 A;  4H0L C;  2F0O A;  3SK6 A;  3M3Y B;  3MFY A;  3SXH A;  4ZKB B;  1WTO A;  3H94 A;  4EQP A;  4NP5 A;  4LJZ C;  3M7N A;  1B2T A;  1ENA A;  4F88 A;  2BDN A;  1SYB A;  1CT1 D;  3GTK B;  3DWP A;  3J80 E;  1STY A;  2A68 D;  3A8I E;  1BCP C;  5C4X B;  2XRQ D;  5CV4 A;  4R9W A;  1STA A;  2WAC A;  4HMJ A;  3NWT A;  2EYL A;  3A56 A;  5G3L F;  5LHY 1;  5CV9 A;  2PZW A;  5IOD A;  5KIX A;  1EU3 A;  3TZD A;  4X3T A;  2I46 A;  4RKB A;  4S3S A;  1BBX C;  3TZU A;  1EZ8 A;  3TBI B;  3QB3 A;  5F2D A;  1RTO A;  2R92 B;  3G6J B;  2O4X A;  3I70 A;  1AN8 A;  3Q23 A;  5BN5 A;  3M4O B;  1U4M A;  3OMC A;  3IL8 A;  1EEI D;  5KND A;  2O5I C;  2A6H D;  1SYG A;  4XQN A;  4BBS B;  3PV0 A;  3QIA A;  4HR7 B;  5C4H A;  1CI3 M;  4HSV A;  2A69 D;  4IUP A;  2XIW A;  3J81 E;  4XIG S;  1EYD A;  3QJY A;  2QEJ C;  2YYZ A;  2NN6 H;  1JOK A;  2AQ3 B;  3K5O A;  4L6T B;  3N52 A;  5NUC A;  4A3I B;  1SNQ A;  3KF8 A;  4C56 C;  1TWF B;  1SBB B;  5EKI A;  3K7A B;  4RGM A;  3NXW A;  1RJT A;  2ZXO A;  4B08 A;  1HA6 A;  3MWY W;  1CA5 A;  2JEA I;  3LX0 A;  4XYQ A;  5JAV A;  2Q8I B;  1T5X D;  4KY5 A;  3D8G A;  1SE2 A;  1GUS A;  2SNM A;  2L55 A;  2K04 A;  2N55 A;  1HTP A;  2EY2 A;  4XQJ A;  1PZJ D;  3OIQ A;  1ESF A;  2M00 A;  2ZXP A;  2PZT A;  4C3J B;  1JOR A;  4FF3 A;  2A74 C;  3D4D A;  2R6G A;  5EKL A;  1S5F D;  3PUZ A;  1TWG B;  1JR0 D;  3KLS A;  5D65 A;  1AP0 A;  3TME A;  1ML0 D;  5FO9 B;  2K01 A;  3C2P A;  1X32 A;  1F2L A;  3MZ5 A;  3HG9 A;  5ISR A;  1EIG A;  5FLX L;  1WTV A;  3K6O A;  1AZQ A;  2JA8 B;  5KGU A;  1SYD A;  2RDG A;  1TWH B;  1O7L A;  2D62 A;  1I4X A;  1KNA A;  3ND8 A;  2K05 A;  2KVM A;  2NVY B;  1U4P A;  3S16 B;  1SMY D;  1IKL A;  4A3K B;  5K5P A;  1U4L A;  1I50 B;  1TT2 A;  2F03 A;  2C5C A;  1B44 D;  1CZW A;  1PRT C;  3DEP A;  5IGD A;  1LTT D;  3WOE A;  4KY7 A;  2LMC B;  3A54 A;  3VR6 A;  1DJR D;  1BR9 A;  5C6A A;  2JA5 B;  4DNT B;  1EL0 A;  5IGF A;  3SK8 A;  5DM6 3;  4FF1 A;  3CKI B;  2J0T D;  3EFX D;  1EEF D;  1F9R A;  3NTI A;  4GZY C;  2NVX B;  3GTG B;  1F9Q A;  1LTR D;  1SYF A;  3S1Q B;  3TP8 A;  3T51 B;  1TS5 A;  1E2W A;  2OT2 A;  2KJX A;  2Q8T A;  2L4N A;  2F0M A;  2ID0 A;  2LY7 A;  4DXG A;  2NZ1 D;  2MPM A;  3DEO A;  3MFG A;  3DM1 A;  4KN7 C;  5E3F A;  2O5J C;  1B53 A;  3E5S A;  3QO2 A;  5M5W B;  1II3 A;  2BCO A;  1B9M A;  2HDL A;  2R61 A;  2CQA A;  2KCN A;  5I9O A;  2QIL A;  4IFD I;  1O80 A;  1E0B A;  4TQU S;  3T53 B;  2RVL A;  1BDO A;  2R7Z B;  5JEA G;  4DK1 A;  5IIF A;  4A3J B;  4OIJ A;  1BQQ T;  3SHL A;  1SNO A;  4OO1 H;  2EJM A;  2EYO A;  5I6Y A;  3GV6 A;  2B2W C;  4V0B A;  3SVM A;  3KLR A;  4I65 A;  1EY5 A;  3OOC A;  2IT1 A;  4AYB B;  3D31 A;  3RD4 A;  2BE5 C;  1SE4 A;  3LNN A;  2WV6 D;  1FGB D;  1WD0 A;  5JVH 3;  3VR2 A;  2L11 A;  1RCV D;  3GV3 A;  1WD1 A;  1QOH A;  1EFI D;  3BVG A;  1H9R A;  4K6D A;  1RHP A;  3NSW A;  3V2T A;  2EYM A;  2KOL A;  2L0C A;  3T13 A;  1WTQ A;  5K36 H;  4XT3 B;  1PRT D;  3HOY B;  1NR4 A;  4OGQ C;  3HKZ B;  1J9O A;  3KBX A;  1BOS A;  1HFG A;  3K5N A;  4KI0 A;  3EJI A;  3VYT A;  4RFB A;  1JB3 A;  1GUN A;  4ZK9 B;  4IUT A;  1H9S A;  4QB4 A;  1NR2 A;  1I6H B;  2K32 A;  2IX1 A;  3J7A V;  2EOT A;  2WIN B;  3M7G A;  4KHV A;  1CFM A;  3HOX B;  3DXJ C;  1VCI A;  1TS4 A;  2JSO A;  2E74 C;  4WJW A;  3OSO A;  4CHT B;  1HRJ A;  4KY6 A;  3SE0 A;  3J7A F;  5ELD A;  3K58 A;  4ZKC B;  1H9M A;  3C3L A;  1OO9 B;  1B9N A;  3N6R A;  4OO1 G;  3OHX C;  1G91 A;  2F0F A;  5A2Q E;  1RF2 D;  1R9T B;  2ICE C;  5FKA C;  1HHV A;  5C3W A;  2F0S A;  4NKL A;  2PMZ B;  4MN3 A;  4RHS A;  4DNR B;  2PO4 A;  2EYF A;  2R3Z A;  1LTA D;  1YNN D;  1IHZ A;  2K5Q A;  2NB0 A;  5EPL A;  1ET6 A;  2SNS A;  1KDB A;  1LT4 D;  5DM7 3;  4F87 A;  3CU7 A;  2VB2 X;  5D3I B;  1SAP A;  3FRP B;  4HSP A;  1QIL A;  4K2K A;  1DOL A;  2F0J A;  1WTP A;  4RA8 A;  3HS0 C;  3GTO B;  5LL6 S;  1VMP A;  3H3V C;  4KD3 A;  1STN A;  4C2M B;  3BYY B;  3TP6 A;  1F2Y A;  5FO8 B;  5FOB B;  3NBI A;  3QG1 A;  4HTH A;  2D2C C;  2G9H D;  3A8J E;  3H6M A;  3P7J A;  1D5M C;  5D14 A;  5EGT A;  4K8I A;  3AMU A;  2L5T A;  2FJ2 A;  5CMD A;  3HOV B;  3I73 A;  1V1P B;  5C4Z A;  1TU2 B;  4A3M B;  3NUC A;  1Z47 A;  2F0G A;  1CA6 A;  1MBY A;  2DN8 A;  2B39 A;  4J1M A;  1XXG A;  4DFA A;  1S5D D;  1DYQ A;  1FR3 A;  4BA2 I;  1ENF A;  1H9K A;  2TSS A;  2PZU A;  1LT3 D;  3BDO A;  1KAB A;  1S5B D;  2NTT A;  3SR1 A;  1IW7 C;  3IFD A;  1ESR A;  1SNC A;  1GUW A;  3VYU A;  4FF2 A;  2B8F A;  4C3H G;  1PFN A;  1Y8N B;  1ICW A;  4DF7 A;  3A8K E;  1PZK D;  3AU7 A;  5IOC A;  3BDL A;  3OWE B;  5KEE A;  1IL8 A;  3VR5 A;  4M1U B;  1FNV A;  2B8G A;  5E4W C;  3SDZ A;  4XT1 B;  1VMC A;  2EJG C;  3U9O A;  3PMF A;  3R93 A;  3ND9 A;  4B9W A;  4PMC A;  2A5H A;  3GTL B;  2EYH A;  4FXG C;  1ZYR C;  1SNP A;  1JWM D;  4QIW B;  1SYC A;  2VB3 X;  3OWF A;  3K59 A;  3PO3 B;  4IFD J;  1V1O A;  4IUQ A;  1MI2 A;  1UUP A;  5FLX E;  1JOQ A;  1Q3L A;  3LWU A;  2B2Y C;  2EZV A;  1QNU A;  3EVQ A;  3R2T A;  2B2Y A;  1NCV A;  3C46 A;  4QF4 A;  1G2T A;  2PNR C;  5C44 B;  1SYE A;  4HAE A;  4KHZ A;  2A6E D;  1TS3 A;  4PMW A;  2PQE A;  1V43 A;  4K14 A;  4RHR A;  3S14 B;  4XTC S;  2CVR A;  2VNU D;  5EJW A;  2Z4H A;  1U9R A;  1DON A;  2XN9 C;  4C3H B;  5D3D A;  4Q5V A;  3DWQ A;  1KLU D;  4DK0 A;  4OO1 I;  2JA7 B;  4MHE A;  1LTS D;  5C4J B;  3KUP A;  1F77 A;  4BA1 I;  4IAL A;  3I4M B;  4HMI A;  1PTO F;  3AB9 A;  1NSN S;  1G29 1;  2J7Z A;  3T16 A;  3IKJ A;  4KK7 A;  2FMM A;  2A69 C;  3FMC A;  2KED A;  3KK7 A;  2ENB A;  4XXE A;  3WDN A;  1VDZ A;  1DOK A;  2CW0 D;  2O2L D;  1Y1V B;  1Q1B A;  3W2D A;  1XX8 A;  1BCP D;  1ROD A;  2MJ8 A;  4K5W A;  1YNJ D;  4LAA A;  4IZ8 A;  1GOZ A;  3S17 B;  1D1K A;  1ZYR D;  3FEW X;  4X3S A;  2X69 A;  1IYV A;  4ULL A;  2V4D A;  5IGE A;  2FHT A;  4ID6 A;  2AUJ D;  5C3E B;  2DY7 A;  1OXV A;  2K5D A;  1C4Q A;  1STE A;  4JBW A;  1HUN A;  4MIU A;  3I4L A;  1KDC A;  2WII B;  3NE5 B;  1WTR A;  4KJN A;  3MC0 B;  1FYC A;  2GA4 B;  3GTJ B;  1C48 A;  2IX3 A;  3C1F A;  1SE3 A;  3L7Z C;  3Q6S A;  2LFN A;  4BY7 B;  3PUY A;  3GO5 A;  3ONA B;  5E4X A;  2PYK A;  1DCZ A;  5M9O A;  2NWG A;  5M3F B;  4ZYS A;  1SND A;  1I4R A;  2WP8 J;  2BDO A;  3T56 B;  3GP7 A;  1CQV A;  3LWE A;  3IFT A;  1PTO C;  1J8I A;  2F1M A;  1AEX A;  1CQF A;  3OPO A;  2EE1 A;  2X6L A;  2I07 B;  3TDQ A;  1LLR D;  1PDQ A;  5I6W A;  4K2L A;  4ZUI A;  5KYI A;  1L0Y B;  4RGN A;  5ELE A;  4BBR B;  3HOU B;  3F2U A;  5COR A;  4IUU A;  5HUR A;  3E6Z X;  1O7Z A;  1PTO H;  4H13 C;  4KKS A;  2BA1 A;  1TY2 A;  4L8J A;  1GUG A;  1HCZ A;  1EWH A;  1YNN C;  5CV6 A;  2EYJ A;  3V96 A;  4HN7 A;  1S4Z A;  2F0H A;  3PIP 3;  2L12 A;  2EVB A;  1KLG D;  2AWO A;  2SOB A;  1QWY A;  5C0X G;  2LKV A;  3MXP A;  2WAQ B;  2XSC A;  1H9J A;  2A68 C;  2F0E A;  3RZO B;  1TR5 A;  2B2U A;  1A3U A;  1CHP D;  5HGT A;  1Q8I A;  1QB5 D;  1F2Z A;  2E2I B;  4C3I B;  2OF1 A;  2MGS A;  2OEO A;  4Q0F A;  1EIH A;  1X3P A;  1GJX A;  1OXU A;  1STG A;  3TN2 A;  5BN3 A;  1ZKO A;  3D3R A;  2E2J B;  4QUC A;  5JEA J;  3BYT B;  2IJ0 A;  2B2V C;  5M5X B;  3E0J A;  1OXS C;  4FO2 A;  2J4X A;  1F9S A;  4ZAI A;  2EDG A;  5KYL A;  2DNC A;  2A6H C;  4CJ2 C;  1Z7T A;  2WB1 B;  4HED A;  1KDA A;  4TKO B;  1I3Q B;  1LT5 D;  1EY7 A;  2HUG A;  2NBF A;  3NWS A;  4R8I A;  5I9P A;  1LTI D;  2KCC A;  1HFN A;  1EYA A;  3I72 A;  2WKC A;  1UAP A;  2KHS A;  1SNM A;  1JWS D;  5COY A;  3MHB A;  2E2H B;  3VR3 A;  3URY A;  5TSS A;  3ERO A;  5JPM C;  1C8C A;  4P2C B;  5G3L D;  1LO5 D;  3MXG A;  4BS9 A;  1A15 A;  1PRT B;  3K0Y A;  1ET9 A;  1CK1 A;  1LTB D;  2MHV A;  3VA7 A;  3OW7 A;  1GHK A;  1TVX A;  2X6G A;  1HUM A;  4EGV A;  2Z4I A;  4G7O C;  4FP5 D;  5IT9 E;  2HQE A;  4PQX A;  4ZQ3 A;  4OL7 A;  1XYI A;  3FPU B;  4RCO A;  1ILP A;  1XWE A;  4H7B A;  5CBA E;  4E6I A;  3BZD B;  3GQB A;  4A3G B;  3HGB A;  3TSS A;  4RKL A;  2EY5 A;  2HCI A;  1ENC A;  3BG3 A;  3S1M B;  2EY6 A;  4FVM A;  4C1N K;  3K5M A;  4UDU C;  1OXX K;  1Y69 U;  2DY8 A;  4IN3 A;  4G57 A;  2L1B A;  1BCP B;  4V19 0;  5CV8 A;  2A6E C;  4BY1 B;  4ABN A;  3J7Y W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...