2EYWA

N-terminal sh3 domain of ct10-regulated kinase
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
78
structure length
78
Chain Sequence
b'GAMGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords v-crk sarcoma virus CT10 oncogene homolog isoform a
publication title Structural basis for the transforming activity of human cancer-related signaling adaptor protein CRK.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 3
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2005-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2eywA01
2PZ1A 1SEMA 2MOXA 3PVLA 4RTZA 1KIKA 1GCQA 2VWFA 4F14A 1VYTA 4RTYA 1HJDA 1RI9A 4DEYA 4J9CA 2AKKA 4J9IA 2JT4A 2CH4A 3PE0A 2KNBB 4LN2A 2OI3A 1RLPC 2D8HA 1VYUA 1WI7A 1UJ0A 2K6DA 1M3CA 2GGRA 5L23A 2D8JA 2K3BA 2LJ1A 3H0IA 3M0RA 1GCPA 1AEYA 3VRZA 3R6NA 2HBWA 4LUEA 1X6GA 1QLYA 1ABOA 2KRSA 4AFSC 2YDLA 2HSPA 2O31A 3FJ5A 2KXCA 4OMMA 1YWPA 2D1XA 1WFWA 2ED1A 2A37A 1UDLA 3NMZC 2DL7A 2KXDA 1SHFA 4DEXA 1YP5A 3C0CA 2L2PA 1EFNA 2KT8A 2W0ZA 1V1CA 3EGUA 3H0FA 5I22A 2CSIA 3SEMA 3VS5A 2ABLA 3M0PA 2JXBA 1M3BA 1W6XA 1G83A 1UHCA 1GCQC 2SEMA 2ENMA 1AWWA 1WIEA 2RMOA 2GNCA 2EYYA 2B86A 3GBQA 2LQWA 4CC4B 4J9EA 3QWYA 4JZ4A 4KRTA 1G2BA 3VS1A 4F16A 2KT1A 2L3SA 2RQVA 5ECAA 2LNHB 1OPKA 2JS0A 2CUDA 2FG0A 1UE9A 1UFFA 2KR3A 2M0YA 1SRLA 2DL3A 2O9SA 1KSWA 1SSHA 2EYZA 2YUOA 5FW9A 5GJWB 3VS3A 1K9AA 2AKLA 5IHKA 1E6HA 1ZX6A 2KGTA 2RN8A 2ROLA 2J6KA 2I0NA 3M0TA 2LP5A 2X3WD 1PKTA 2GTOA 2HCKA 4HVVA 1PRLC 1X6BA 1OOTA 3U23A 3RBBB 4JPBW 4RUGA 1UHFA 2EYXA 1GBQA 5HCKA 3O5ZA 1Y57A 2KEAA 2AK5A 4RTUA 2EGEA 2FRWA 1QKXA 2A36A 2G6FX 3I5RA 1A0NB 4RTTA 1H92A 1WX6A 2KYBA 3VS0A 3JV3A 2GQIA 1YN8A 1KFZA 3VS4A 2JM9A 2NWMA 1PNJA 5EC7A 4X1VA 1I0CA 2GBQA 2FEIA 2YT6A 1X2KA 4WCIA 4IIOA 4OMPA 4ESRA 2AZSA 1LCKA 1U06A 4J9BA 5FWCA 1Y0MA 1E6GA 1AWOA 4LUDA 3M0SA 2W10A 1VYVA 2RQWA 1BBZA 3VS6A 2XMFA 2LJ0A 1MV3A 2L0AA 2K79A 4RTWA 1WXBA 1AD5A 2NUZA 2CH4W 4AFQC 1U3OA 4D8DA 4A63B 2RF0A 1GRIA 2J7IA 1HD3A 4JJCA 1JU5C 1K0SA 4AG1C 1SPKA 3UF4A 2KRNA 1T0HA 1AVZC 2K2MA 2J6FA 2KE9A 3UATA 4HVUA 1ARKA 2LMJA 3PVQA 1SHGA 2LJ3A 2BTTA 2CT4A 5IHIA 4CC2A 1X69A 1X27A 3EG0A 3TSWA 2BZYA 1Z9ZA 2DVJA 2A08A 4QT7A 1TUDA 1U5SA 1WXTA 3M0UA 4Y92A 4OMQA 1PWTA 1NEGA 4EIKA 2FPEA 2DILA 1GBRA 1PRMC 4IIMA 1N5ZA 1H3HA 2M51A 2SRCA 2OJ2A 5IXFA 3THKA 1RUWA 3I35A 2YUNA 2DRKA 2LCSA 1UUEA 2F2WA 2JS2A 2HEQA 2HDAA 2YUPA 1UJYA 2F2XA 4LE9A 4AFZC 4JZ3A 3EG1A 2DBKA 4J9DA 2J6OA 2EKHA 2DL5A 2RQRA 1NEBA 1T3LA 5GJVB 1QWFA 1JQQA 4HCKA 4F17A 3EG2A 4GBQA 2DLPA 2KRMA 1OEBA 1JO8A 1OV3A 5FWBA 1PKSA 1WA7A 1WDXA 2PTKA 3REBB 1ABQA 2IIMA 4CC7A 2FO0A 1UECA 2EBPA 1K0XA 1YWOA 2JMAA 2L3PA 1BU1A 2DMOA 1S1NA 2GTJA 3SHWA 3NHNA 2BZ8A 2KBTA 1B07A 1RLQC 4FSSA 1M27C 1AZEA 2O88A 3EHRA 2ED0A 1B3QA 1CSKA 2DL4A 1I07A 1PHTA 2CUBA 2JW4A 1NLPC 1AWJA 1HSQA 2BZXA 1MUZA 1CKAA 4JJDA 1MV0B 2FRYA 4ORZA 1QCFA 3TSZA 3VS7A 3KFVA 3VS2A 2PNIA 2YSQA 2K7AA 2FPDA 1NYFA 2OAWA 2MCNA 2RQUA 1W1FA 2FPFA 1NM7A 2ECZA 2J06A 2LZ6B 3RNJA 1JEGA 1AZGB 2DNUA 1M8MA 1W70A 4J9FA 2KYMA 4OMNA 1ZSGA 3A98A 1E7OA 4ZNXA 1OPLA 1SRMA 3NPFA 2EW3A 1Z9QA 2P4RA 4M4ZA 2EGCA 2KROA 5IXBA 1XOVA 1K76A 1WXUA 4JJBA 2J05A 1UTIA 4AFUC 4E6RA 3CQTA 2EVRA 1VA7A 2H8HA 4RTXA 1AWXA 3LH5A 1FMKA 3ULRB 1YNZA 2V1QA 2DBMA 1QWEA 3H41A 4HXJA 2DYBA 1ZUKA 4RTVA 4HVWA 1H8KA 4LNPA 1ZUUA 2AZVA 2DM1A 2JM8A 1JXOA 1AOJA 2DX1A 4AG2C 1ZUYA 3VRYA 3UA7A 3EHQA 1ZLMA 5IH2A 2EQIA 1M3AA 3I9QA 2RPNA 1WYXA 4D8KA 5I11A 1NLOC 2LQNA 4OMLA 1WLPB 1X2QA 2K9GA 1I1JA 1BB9A 1K4US 3ZL7C 2LX7A 2ROTA 1GL5A 2L3QA 1KJWA 2MIOA 3M0QA 2JTEA 2ESWA 1UG1A 1UGVA 1GFDA 2CSQA 4Z88A 3QWXX 2DRMA 3IQLA 3EG3A 4CC3A 4Z8AA 2EGAA 2QDLA 2DA9A 2RNAA 2O9VA 1J3TA 1FYNA 4OMOA 1NG2A 1QKWA 2O2OA 1M30A 1T3SA 1K1ZA 2E5KA 2EYWA 2C0OA 2D0NA 1ZBJA 2VVKA 2C0TA 3REAB 1TUCA 3NGPA 3I5SA 1IO6A 2A28A 1JXMA 2DJQA 3H0HA 2RQTA 2CREA 4GLMA 1GFCA 2CT3A 1X43A 4J9HA 2CDTA 3UA6A 2F2VA 1TG0A 1NYGA 2DE0X 2YUQA 1YCSB 2X3XD 2C0IA 4R0KA 2EPDA 4J9GA 3TVTA 4K11A 5IHNA 1T0JA 2JMCA 2V1RA 1BK2A 2DF6A 1CKBA 4Z89A 2DL8A 2VKNA
chains in the Genus database with same CATH superfamily
2I2LA 4BE2A 2MOXA 3PVLA 4PJOC 3MPUB 4V2SA 1VYTA 2QG9B 1M2OA 3J7AF 1M5Q1 4ZN3A 1EX4A 4J9CA 1VQ8T 2CYZB 4A4KA 2KNBB 8AT1B 5GAMg 1WI7A 1UJ0A 5L23A 1VQ9A 1YI2Q 1YCYA 3H0IA 4IUPA 4N0AA 2EJFA 2ZPHB 4M75G 4BDYA 1VQKA 1UEBA 3R6NA 2HBWA 2XDBA 3V7CA 4LUEA 3JCMV 3M9QA 4Q5WA 5J39A 5GMKm 3CCQA 1VQPQ 1VQ6A 2C06A 2YDLA 2LVMA 3MKDA 3E19A 4RCBA 2CZ0B 3FJ5A 2KXCA 4KGVB 3CCET 5LJ3g 2A37A 1PSFA 4M77E 3CCMA 1D0ZA 4PFOA 4IUUA 4RG2A 5D6YA 1SHFA 1IHVA 1YP5A 3G6ET 2CZ7B 3RDVA 3NTKA 5DM7R 3CMEA 1ZHIA 3META 2CSIA 3QZ5B 3VYHB 4GY5A 2FHDA 1VQ9T 5KE3A 3ER0A 5C0MA 4EMKC 4M77B 2NYSA 1VQKT 1KC8R 1JBMA 1PC0A 5GAN2 2ZPIB 3CC7A 2EYYA 2B86A 2LQWA 4CC4B 4JZ4A 3CCQT 4OB0B 3VS1A 4F16A 4FYVB 2KT1A 1VQ6T 3JCMQ 3OYFA 2KK4A 3CCLA 3OYAA 4XTWA 5ECAA 2LNHB 4JRKA 2JS0A 1OU8A 1UE9A 1UFFA 1QVFS 5FW9A 2YUOA 3CCMT 1SSHA 2VUBA 1RABB 4BY6B 5GAMd 1ZX6A 4KGXB 2J6KA 2HSEB 3OYMA 2QTVA 5FRMA 1MMGA 2HBPA 3MCAB 3OA6A 1PRLC 1X6BA 3JCMP 2E5QA 4JPBW 4RUGA 4E2FB 4ELYC 1KC8C 1GBQA 2YWWA 3O5ZA 3CC7T 1Y57A 2LNVA 4OMFB 5LJ3d 2AK5A 4PJNA 2EGEA 4A4FA 1D3BB 1YITA 3JCMW 3BW1A 3I5RA 3CCLT 1A0NB 3QUIA 3EFOB 3VS0A 1QVGA 1KFZA 3SDZA 1LPLA 2XICA 3RMQA 2NWMA 4LDYA 4XK8E 3JRZA 4PJOG 3A1PA 4O5VA 3SWNA 1MNDA 4IIOA 1LCKA 2PU9B 5LL6S 2PVDB 1AWOA 3CCVA 1PCXA 3URGA 2W10A 1VYVA 2RQWA 4M7AD 5HKCA 1BBZA 2COYA 4RTWA 2AIRB 3HFNA 2NUZA 2HKNA 2CH4W 2RF0A 2E6NA 1K0SA 4AG1C 2LDMA 3RKXA 1YITT 1D1AA 1O75A 4PLIA 1T0HA 1QVFP 3OSSC 1TOVA 2KE9A 4HVUA 1ARKA 1SHGA 4CC2A 2ZPEB 3JAME 3OW2S 1X27A 3TSWA 2DVJA 4J5YA 3CCVT 1U5SA 2BE7D 2EIFA 4XTVA 1KC8U 1PWTA 3VYGA 1BYMA 3OBYA 1GBRA 4E7LA 1N5ZA 1MMDA 1G3WA 4VUBA 1WQ7A 4UC4A 5IXFA 5A2QE 2M1HA 3CBOA 1RAEB 5GANf 1YIJQ 1UUEA 1N9RA 2JS2A 3VV0A 2HDAA 1KG1A 4X34A 2GCXA 4C0GA 4AFZC 1Y96A 5FLXE 2OX7A 3ME9A 2FB7A 1QCOA 4DOVA 3OYGA 1QWFA 2QA4Q 1VQNQ 4L6V5 1BI1A 2KRMA 3EGXA 4XTUA 1YJNA 2PTKA 2CP3A 3P8DA 1BI2A 3VUZA 1Y07A 4BB7A 1TWBA 4NS5A 1TSFA 3G71Q 3SHWA 2DXBA 2LTOA 1BIAA 4C8QA 1VIFA 2BZ8A 3C4SA 4BY6C 5LJ5f 2PVOB 1B07A 3E2UA 2E3IA 4E7JA 2IVWA 2O88A 1OYXA 1BI3A 2ED0A 3PT9A 1B3QA 4OB1B 1MMNA 1TUGB 2DIGA 4AMCA 1NLPC 3OW2P 1HSQA 2BZXA 1CKAA 2GF7A 3LWIA 3TSZA 4ORZA 1QCFA 4QQDA 5GMKh 2DJZA 4J83A 2PNIA 2YSQA 3EGDA 2LQKA 2MCNA 5GAN3 1YJNT 3I56Q 1NJIU 2J06A 1JB0E 2HL3A 3RNJA 4NOYA 2DNUA 3QXEB 3ZFJA 1M2VA 1XQHA 3NPFA 3R6OA 3LGFA 1QVPA 2P4RA 5AYFA 2PUKB 5A0LA 1K76A 2QASA 3AT1B 3S3MA 1VA7A 2H8HA 2RHZA 1AWXA 2Y4YA 1KQ1A 1BI0A 1YNZA 4FYWB 2V1QA 4HXJA 3H41A 3PGGA 3KXTA 4C92A 4LNPA 1VQOA 2AZVA 2HKQB 1VOMA 1AOJA 3DLLA 5GANj 2R5AA 2RM4A 4JUVA 4AG2C 2WACA 3UA7A 2HD0A 5IH2A 1VQ7Q 1M3AA 3FRNA 1RL2A 3J81E 5KYYB 5I11A 2MF2A 2LQNA 4E47A 1WLPB 1X2QA 3OYKA 2K9GA 3CCRQ 3HHTB 2KDSA 3QYHB 3KUFA 1YBYA 2XI9A 2ROTA 3OYBA 2E10A 1VQ4Q 1GL5A 4M7DD 2JTEA 3G7ZA 1K8AR 2ESWA 3WVDB 2CSQA 1FXXA 3PMTA 3CD6A 3IQLA 2LT4A 1RAAB 2QDLA 2QQ9A 2RNAA 1J3TA 2JJ9A 1VQ5A 4OMOA 1NG2A 4MZPA 2R58A 1Q82R 4E7SA 1K1ZA 2E6ZA 5DLOA 1D1BA 1VQOT 2D0NA 3CCSA 5LJ5j 2DZ9A 3REAB 3I55A 3JCMe 2HMAA 3SFMA 4QVZA 4FT2A 4C0FA 3L1AA 1WHLA 2R57A 5GANh 2CT3A 4J9HA 2CDTA 3UA6A 3JB9D 1YCSB 2NUTA 2K4YA 1S72Q 1K8AC 1T0JA 2V1RA 3OYEA 1CKBA 3CCJA 4OB2B 4ZTJA 1QCNA 3CD6T 2DL8A 2VKNA 2PZ1A 3CBMA 3UPUA 2VASA 4ZTFA 2R5MA 3C12A 1Q82C 3CMAA 3MP6A 1QQJA 1IHWA 4OGEA 3PMIA 3L2WA 4C8QD 4XTYA 4II1A 3CCST 4JJNK 3A5ZB 1ZA1B 3I55T 1RLPC 2D8HA 4BE1A 2K6DA 4RG8A 1M3CA 1Y71A 1VQLA 1IZ6A 5LJ5h 1R77A 2K5IA 1N9SA 4A54A 5LJ3j 3VRZA 4R55A 3QJYA 1QLYA 1QP2A 2OTLA 4IURA 4WTOB 3RKWA 3QO3A 1FMWA 4E7IA 3CCJT 1YJWA 2D1XA 2ED1A 2MPXC 1UDLA 3NMZC 3SWNB 2DL7A 4M7AC 1R8OB 4DEXA 2L2PA 3X24B 2KT8A 2QXFA 4PNOA 4Y91A 2W0ZA 4LDVA 3EGUA 3EFSA 3TQ7P 1UHCA 2SEMA 3T9NA 1VQLT 2ZAEA 5GANg 2RJEA 1YHQA 2GNCA 3MHXA 1K8AU 4DBRA 5KYNA 3GBQA 2JTFA 4J9EA 4KRTA 3RMSA 1G2BA 2WSFE 2L3SA 5LJ3h 4ZGDB 1WPYA 3JCMX 1X01A 4IUQA 1Q95G 2RK1A 5CR2A 1OPKA 2DD4A 1YJWT 4N0AC 1Q82U 4C92D 5CO7A 2DL3A 1KSWA 2EYZA 3SD4A 3L2QA 5GJWB 3VS3A 2NUPA 2AKLA 4F7UA 2QEXA 2KGTA 1JJ2A 3FDRA 4M75A 3OB9A 2RH2A 2ROLA 4QVCA 3HRUA 2JOYA 2LP5A 2O4XA 4XTZA 1PKTA 3CC4Q 1AHJB 1WGSA 2HCKA 1KD1R 4A4GA 4M78A 5LJ5g 2DEQA 3A8HB 1YHQT 5FU7B 2CKKA 3OYIA 4FW1A 3FB9A 4LD6A 4MZTA 2LCLA 4LDWA 3JCMf 2KEAA 3MP8A 4RCCA 3JCMc 3VU3C 1WX6A 4PL6A 2KQWA 2HL5C 2E64A 2QK0A 4NL3A 5KCHA 3PTAA 3G6EA 1WJQA 1WHHA 2X4YA 1KQSA 1VQMQ 3EGXB 1IRXA 2YT6A 1X2KA 4WCIA 2EQKA 2QEXT 4ESRA 2AZSA 4J9BA 3JB9J 2EKOA 3M0SA 1KD1C 1WJSA 5GANd 1D0YA 3V8LA 1N27A 3VS6A 2XMFA 1MV3A 1QW1A 4ELZC 1AD5A 2DEUA 3CMEQ 2OTJQ 4D8DA 2OAUA 3E1SA 2F69A 2J7IA 1TTHB 1UGSB 2IG0A 1TS9A 4EPCA 1JU5C 2BE9B 7AT1B 3OYCA 5J26A 1SPKA 2RJDA 4AT1B 4HT8A 4XU2A 2KRNA 4QQ6A 4XAXB 3O8VA 5CKDA 4X9CA 1WHKA 2K2MA 2WSEE 2LMJA 3CCLQ 1X69A 4M7AG 1X75C 1Z9ZA 1PG5B 1OZ2A 2K3YA 3OMGA 1HK9A 4QT7A 4B9WA 5LJ5d 4BE0A 3M0UA 2X9HA 1BIBA 3CPFA 4HT9A 4EIKA 1M2VB 2IPOB 2DILA 1YI2A 3M56A 4IIMA 1H3HA 3QSUA 2HQXA 3M57A 3SWNC 2SRCA 1RAGB 2MAMA 3I35A 2XHCA 3GLXA 1IREB 1VQPA 1TXQA 2QDYB 3HL8A 1B34A 2Y90A 2AT1B 4PJOA 2DIQA 2F2XA 3JB9H 3OS0A 2DBKA 2RQRA 2DYIA 4LDXA 1NEBA 1T3LA 3NTIA 3LGLA 2RHUA 3A8GB 1KD1U 4F17A 4J6WA 1JO8A 4EMHA 1ZSZA 5FWBA 1FMVA 1PKSA 2K3XA 2CS7A 1R0CB 1YI2T 3QYGB 1UECA 1PD1A 5CKBA 2HQHA 2COWA 4MZMA 1OX8A 3WXMB 2DMOA 2GTJA 3JSCA 3MP1A 5IN1A 2BUDA 3NHNA 3QBYA 2KBTA 2P4TA 1VQPT 2X35A 3J80E 3PNWC 1M27C 4HCZA 4DBHA 1AZEA 2QQBA 2BIVA 2DL4A 2LX9A 4M75D 1PHTA 3EAEA 4JLGA 2K2VA 1TH7A 2CUBA 1FWZA 1M1KR 4N4IA 4DBFA 1WHMA 5FU7C 2CP6A 4M78D 3CPWS 3S3OA 3HRTA 3S6WA 1NYFA 1P92A 4EMKA 2FPFA 3OS1A 4HA8A 3TEEA 4F04B 5GAMe 3HKSA 3CXCS 1AZGB 1M8MA 3A98A 4OVAA 2XG8D 2EW3A 3GIBA 2JZ2A 2XKOC 1Z9QA 3E9GA 1NPRA 4M7AF 2FYKA 1M8VA 4J6XA 5IXBA 1G3SA 4JJBA 3GNFB 1M1KC 4E6RA 3CQTA 3ZBDA 4OP0A 5CQXA 2XIDA 2YXYA 2KI7A 4M7DA 3LH5A 1FMKA 4IUVA 3FC3A 1YJ9Q 2QQRA 1WZOA 1QWEA 3QKJA 3OYYA 2F5KA 4RTVA 2V8IA 2RHXA 4FYYB 2FZCB 2L3RA 1SSFA 2EJ9A 3QZ9B 4FT4A 5D6XA 4JS4A 2DZCA 1R0BG 3MJXA 4HCCA 1NLOC 1UGPB 5CK9A 3X28B 4OMLA 1I1JA 2RI2A 3M4GA 3M4YA 2LX7A 2L3QA 3BFMA 3INZA 1UG1A 4ME7A 3BDLA 2LC4A 4PLLA 1PD0A 4CC3A 4Z8AA 2DA9A 2KAFA 3CPWP 2WSCE 1FYNA 3M53A 2V8KA 1MMAA 2CP0A 2E5KA 2EYWA 4PJJA 3V7SA 4XQ3A 3CXCP 3I5SA 1JXMA 2DJQA 2MK5A 4PJOD 1U8RA 3JCMg 2CREA 4ANJA 1X43A 2F2VA 1YIJA 3A8OB 2M0OA 4C92C 5KCOA 3WVEB 2X3XD 3CCUA 1M1KU 4R0KA 3X25B 1D1CA 4K11A 5IHNA 3LYIA 1BK2A 2DF6A 4M7AE 4IUTA 2DO3A 2GQVA 3LW5E 2NUPB 1XNIA 4FYXB 4A4HA 4KH1B 3EG9A 1KIKA 1GCQA 2VWFA 4F14A 3GF5A 2QA4A 3OSVA 2FL7A 2JVVA 1RI9A 3M5AA 3OW2A 4FCYA 4BUGA 2JT4A 1C1AA 1M90R 4KUIA 3KBGA 4LN2A 4KUDK 4M7AB 1VYUA 5FU6B 5CVIA 1RI0A 1WQWA 2K3BA 3G71A 2LJ1A 3FEOA 2QQAA 1VQOQ 1LNXA 3DLMA 3M0RA 1GCPA 5EG2A 1AEYA 2QQSA 1YIJT 2EFIA 1ABOA 3CCUT 2KRSA 4FM4B 2HSPA 2M16A 2MWPA 4OB3B 2O31A 4M77A 4J7FA 1C6VX 1AT1B 1WFWA 5KYXA 3L42A 2KXDA 1H641 2QA4T 2E4HA 4LD9K 4OGCA 3C0CA 2B8AA 3TU4K 2RJFA 3DKMA 1EFNA 1WHJA 1M90C 4FU6A 4JRQA 1V1CA 3H0FA 5I22A 2CP7A 3JCMd 5GAOm 3UDCA 3SEMA 2XK0A 2Z0WA 2ABLA 1VQ5Q 3L2VA 1G83A 2YRVA 2ENMA 3G71T 1WIEA 2VYTA 2RMOA 3QIIA 2RK2A 3GPLA 2KSSA 2EQUA 3V7RA 5GAOn 2RQVA 5L8RE 4YTLA 2FG0A 4C0ZA 4IKFA 1UGQB 3G4SQ 2M0YA 1D3BA 2QGFB 1K9AA 2JTMA 3FJPA 2CGHA 3EFOA 3QJ6A 3CC2A 2QGGA 2I0NA 3CMAQ 1Q86R 1VQ7A 1OOTA 3RBBB 1M9SA 1W4SA 2EYXA 2YRDA 5D6WA 3HRSA 2QYZA 2RI5A 1B34B 2G3RA 2K57A 3CCRA 4RMOA 2DTHA 5HK3A 1VQLQ 2FRWA 4ZGJB 2A36A 4C92G 5A0DA 2DAQA 1H92A 2KYBA 2P0KA 4WF2A 3JV3A 3Q1JA 1VUBA 2GQIA 1YN8A 3JB9F 3LLRA 3VS4A 2OTLQ 2JM9A 1M90U 1I0CA 2GBQA 4BI4A 5I21A 2DKGA 3CC2T 1U06A 3GNGA 1G3TA 1Y0MA 4D6WA 1Q86C 3RERA 4LUDA 4JDSA 1IB8A 1MGQA 2L0AA 1VQ7T 2K79A 1WXBA 1W2BA 4AFQC 1U3OA 2DPPB 1GRIA 5GAN4 4E7KA 1HD3A 1HYOA 4QW2A 5KH6A 4M75C 3CCRT 2CZ1B 5KYUA 4C8QF 5FRNA 2DVEA 1YHQQ 4M78C 3LWHA 1AVZC 4Y28E 5FU6C 1WHGA 5GAOl 2J6FA 3JCMJ 3RR6A 3MEVA 2LJ3A 2BTTA 2CT4A 2YRCA 1ZA2B 2MWOA 3TCJA 3QG1A 2BZYA 2L8DA 4CRIA 2A08A 1D0XA 2E1HA 1BCMA 2YLCA 2AHJB 1KHCA 2FZKB 1VQ8Q 3QDRB 4M7DE 4Y92A 2GFUA 1F1BB 2FPEA 2XDDA 3OYLA 1PRMC 3TREA 4M77D 3THKA 1RUWA 4L59A 2DETA 2DRKA 3UWNA 2LCSA 2YHTA 2HEQA 2YUPA 4BDZA 3CCEQ 4MMKA 2VV5A 4XU0A 1Q86U 5GMKe 1N6AA 4HCKA 1Q81R 4GBQA 3G6EQ 2DLPA 1OEBA 3CEYA 1ACMB 1OV3A 2O01E 4C92F 4ATOA 1WA7A 5KE2A 3REBB 1SKUB 1ABQA 4CC7A 2CP5A 2LRQA 2EBPA 4KULA 1YWOA 2L3PA 4ZN1A 3OYJA 3S3NA 1VQ9Q 2L5QA 4A53A 1S1NA 3MEAA 1QMCA 4KGZB 1M1FA 2RHYA 4E7ZA 1Y96B 1VQKQ 4FSSA 1I8FA 3VKIA 3GP8A 4C8QE 1I81A 3EFRA 3EHRA 3CCQQ 1CSKA 2EYQA 1VQ6Q 4EDUA 2VGNA 1Q7YR 4L5GA 3QHSA 1Q81C 4JJDA 4KBMB 4C5HA 3CCMQ 1Y7XA 2M9UA 9ATCB 3KFVA 3PFSA 2FPDA 4RKUE 4MDXA 3CC4A 4HKEA 2RQUA 1W1FA 4C8QB 2LZ6B 2F5TX 1I5LA 2GFAA 4J9FA 4X9DA 3M55A 4OMNA 1ZSGA 4B6MA 4ZNXA 1E7OA 1OPLA 1SRMA 3E9FA 4F7UG 1ZSZC 1QP3A 2CZ6B 3CC7Q 1LOJA 2KROA 1QVGS 1Q7YC 3OYNA 4KH0B 1WXUA 5KYYA 2J05A 3EG9B 4M78G 2EVRA 3EGDB 1VQMA 4JS5A 5M9OA 4BI3A 5GAN8 1NBEB 2RD1A 4HVWA 2ZZDA 3CC4T 2DM1A 2H3EB 1JXOA 2JM8A 2DX1A 5KYWA 3C95A 1ZUYA 2OTJA 4C92E 3EHQA 1ZLMA 2D9TA 4C0DB 2A0FB 2H3JA 2EQIA 3AHUA 2QTXA 2VXFA 5GANe 4PJLA 2ZPBB 3H8ZA 4JLIA 3L2RA 2NLUA 1X6OA 1SG5A 1BB9A 1FX7A 3ZL7C 3FIFA 2EQJA 1RACB 1YITQ 2MIOA 3M0QA 5KYXB 1Q81U 4DOWA 3DB4A 2DRMA 1VQMT 4C92B 1LJOA 3EG3A 2ZPFB 2EGAA 5GAOr 2O9VA 3OYHA 2EJGA 4DQ2A 2MYSA 5I2SA 4HCBA 1M30A 1T3SA 2ZPGB 2C0OA 2VVKA 2C0TA 3CCVQ 4C5EA 1O9SA 1IO6A 5CQYA 2A28A 4M7DC 3CMET 2OTJT 3ZEHA 4TVRA 5LJ5e 4GLMA 1GFCA 1BKBA 1C0MA 3M58A 1NE8A 5FROA 1NYGA 1Q7YU 1WJRA 3MO8A 2YUQA 1QVGP 2EPDA 2LCCA 1IXDA 3NFCA 3RKYA 4Z89A 5CKFA 2BKDN 1SEMA 4RTZA 2RB6A 1DJ7B 1K9MR 3L2ZA 2JN0A 4RTYA 4J7IA 4F7UF 1HJDA 2E3HA 4DEYA 1OQKA 4M75F 2AKKA 4J9IA 4O6JA 2CH4A 2LT1A 3PE0A 1ZQ1A 5C6SA 3JCMh 2OI3A 4BI8B 1TU0B 2NUTB 2GGRA 5IT9E 1G5VA 2D8JA 2DXTA 4M78F 5GMKl 2FZGB 6AT1B 1ZBXA 8ATCB 1I4K1 2DXUA 1X6GA 4AFSC 5LJ3e 1NJIR 1U1SA 3PIPA 4LXCA 2HAXA 2V26A 4E7HA 4OMMA 4C8QC 1K9MC 1YWPA 1QVFA 1JRIA 2CP2A 4JRPA 3OYDA 1UGRB 2PUOB 1KQ2A 4OF1A 4C5GA 3HPWA 3BE3A 5HY6A 2PVGB 2QAZA 3QPHA 2X4JA 3NTHA 1NZ9A 1YFNA 2DERA 1NPPA 3VS5A 3M0PA 2JXBA 1M3BA 3EH2A 1YJNQ 2EWNA 1W6XA 3RESA 1GCQC 1AWWA 5KYUB 2KVQG 1NJIC 1RADB 3QWYA 1WNLA 2COZA 4J6YA 3OS5A 2D6FA 2CUDA 3RUXA 3CCUQ 2KR3A 4C0DC 1YJ9A 1SRLA 2O9SA 3RIRA 2P0PA 5GMKi 5GMKj 5IHKA 1MHNA 1VIEA 3MEUA 1E6HA 2RN8A 4M77C 4F7UE 3M0TA 5CCAA 2X3WD 1UB4A 5DLQE 3CPWA 2EAYA 2GTOA 4M75E 4QKUA 4N4GA 4HVVA 2KY9A 3U23A 5AT1B 1UHFA 3C94A 4M7DG 3H9NA 1G3YA 3EH1A 3CXCA 2P0QA 5HCKA 4M78E 2JUFA 2XD0A 4RTUA 3LX7A 1K9MU 1QKXA 2G6FX 4PJOF 4RTTA 4F7UB 2E65A 5IAYA 2M02A 1K73R 1OZ3A 4M75B 4BACA 1VQNA 1YJ9T 2RI3A 1PNJA 2O4XB 4X1VA 5EC7A 1PSEA 2FEIA 4JRIA 4M78B 4OMPA 3M59A 5HK0A 4R56A 4DA4A 5DY9A 2QI2A 5FWCA 1E6GA 1M4ZA 4LDUA 3JB9G 2MI6A 4C5IA 2HNIA 2LJ0A 3OBWA 3PIOA 4A63B 5GAMf 4JJCA 3P8BB 1SF9A 4EMGA 3UF4A 4B9XA 1K73C 3OQ5A 1D09B 1M1GA 2RHIA 3ASKA 4C8QG 4ZGEB 4XU1A 3JB9I 1VQNT 3UATA 3LH0A 3OY9A 3CBPA 4XTXA 3CD6Q 3PVQA 5IHIA 5LJ3f 1OX9A 3I56A 5GAOp 2P84A 5CKHA 3L2UA 3EG0A 2X4WA 3QDFA 1TUDA 1WXTA 4MDWA 3UT1A 4OMQA 1NEGA 3CCSQ 4PK4A 3CC2Q 3G1JA 2K5FA 3I55Q 5GAN6 5CIUA 1W2BS 3DB3A 2M51A 3HTRA 4PFZA 5J3BA 2OJ2A 2DTIA 2V8JA 2YUNA 3F70A 1BCOA 2F2WA 1UJYA 1IGQA 4LE9A 1KK7A 2HQEA 4BD3A 4PJOE 4JZ3A 5CAIA 3EG1A 2HZYA 3CCJQ 4J9DA 2J6OA 4P5NA 2EKHA 2DL5A 4A4EA 4M7DF 5GJVB 3I56T 1N8RR 1JQQA 3V8JA 3EG2A 1XTDA 5KYWB 1V29B 3GOXA 4M77G 1WDXA 1B7TA 2IIMA 2FO0A 1K0XA 2DFUA 2JMAA 1BU1A 1GXIE 4NL2A 4PJOB 2VC8A 1VQ4A 3OS2A 1K73U 2DTOA 1RLQC 2VXEA 4FSXA 4CI0C 3OMCA 1OU9A 2K5LA 2DK3A 2ZCFB 2YLBA 3G4SA 2EQMA 1I07A 2L89A 3FLGA 2JW4A 5D7UA 1YJWQ 1N8RC 1XJWB 3VUBA 1AWJA 1ZSZB 1MUZA 1JJ2S 1MV0B 2FRYA 3JCMb 3VS7A 1V76A 2RO0A 2KMTA 4FW2A 3VS2A 1EZZB 5GAMj 2K7AA 3H6ZA 4DBQA 2OAWA 1VQ5T 4PKCC 1NM7A 2ECZA 1MNEA 1HXDA 4PFPA 1JEGA 1W2BP 4KT0E 3A8LB 2XDPA 1W70A 2KYMA 1S72A 1KHIA 2DXCA 1VQ4T 3V8KA 1IGUA 1PM3A 2RJCA 2ZGWA 5GAN7 5GAOq 4FIBA 1OI1A 4Z02A 2EGCA 4XU3A 4QQGA 3BY7A 2PQWA 1G8XA 1XOVA 4AFUC 1UTIA 4PJMA 3G4ST 1KQSS 1OULA 2A3LA 2FVUA 4N4HA 2JNGA 4RTXA 4EMKB 3SB2A 1I5OB 3ULRB 2VB6A 1EIFA 2DBMA 1LVKA 2DYBA 1ZUKA 5A0GA 3MEWA 5CKEA 2XU8A 3CMAT 2QEXQ 2E41A 1H8KA 1ZUUA 3X26B 1U1TA 4J8OA 3VJPA 5GAMh 3VRYA 2A7YA 3X20B 1S72T 3I9QA 2RA2A 2RPNA 1WYXA 4D8KA 3N5BB 3M54A 3HP9A 2D0QB 4M7DB 1K4US 2DD5A 2X4XA 1N8RU 2Y4XA 1KJWA 4M77F 1UGVA 1RAIB 1GFDA 2OTLT 4Z88A 3QWXX 1JJ2P 4GLKA 5I2MA 2LQ8A 2E70A 1QKWA 2O2OA 1VQ8A 4QVDA 1ZBJA 1H3ZA 1TUCA 2ATCB 3NGPA 3P8HA 3H0HA 2RQTA 4FL6A 2X51A 1TG0A 2DE0X 4M7AA 1RAFB 3A8MB 2C0IA 2MMPA 4J9GA 3TVTA 3HSBA 2JMCA 1KQSP 1RAHB 2E12A 3BDUA 4MMLA 3CCEA 2VGMA 5GAN5 3D7SB 2F1LA 3HFOA 4M4ZA
chains in the Genus database with same CATH topology
2PZ1A 1SEMA 2MOXA 3PVLA 4RTZA 1KIKA 1GCQA 2VWFA 4F14A 1VYTA 4RTYA 1HJDA 1RI9A 4DEYA 4J9CA 2AKKA 4J9IA 2JT4A 2CH4A 3PE0A 2KNBB 4LN2A 2OI3A 1RLPC 2D8HA 1VYUA 1WI7A 1UJ0A 2K6DA 1M3CA 2GGRA 5L23A 2D8JA 2K3BA 2LJ1A 3H0IA 3M0RA 1GCPA 1AEYA 3VRZA 3R6NA 2HBWA 4LUEA 1X6GA 1QLYA 1ABOA 2KRSA 4AFSC 2YDLA 2HSPA 2O31A 3FJ5A 2KXCA 4OMMA 1YWPA 2D1XA 1WFWA 2ED1A 2A37A 1UDLA 3NMZC 2DL7A 2KXDA 1SHFA 4DEXA 1YP5A 3C0CA 2L2PA 1EFNA 2KT8A 2W0ZA 1V1CA 3EGUA 3H0FA 5I22A 2CSIA 3SEMA 3VS5A 2ABLA 3M0PA 2JXBA 1M3BA 1W6XA 1G83A 1UHCA 1GCQC 2SEMA 2ENMA 1AWWA 1WIEA 2RMOA 2GNCA 2EYYA 2B86A 3GBQA 2LQWA 4CC4B 4J9EA 3QWYA 4JZ4A 4KRTA 1G2BA 3VS1A 4F16A 2KT1A 2L3SA 2RQVA 5ECAA 2LNHB 1OPKA 2JS0A 2CUDA 2FG0A 1UE9A 1UFFA 2KR3A 2M0YA 1SRLA 2DL3A 2O9SA 1KSWA 1SSHA 2EYZA 2YUOA 5FW9A 5GJWB 3VS3A 1K9AA 2AKLA 5IHKA 1E6HA 1ZX6A 2KGTA 2RN8A 2ROLA 2J6KA 2I0NA 3M0TA 2LP5A 2X3WD 1PKTA 2GTOA 2HCKA 4HVVA 1PRLC 1X6BA 1OOTA 3U23A 3RBBB 4JPBW 4RUGA 1UHFA 2EYXA 1GBQA 5HCKA 3O5ZA 1Y57A 2KEAA 2AK5A 4RTUA 2EGEA 2FRWA 1QKXA 2A36A 2G6FX 3I5RA 1A0NB 4RTTA 1H92A 1WX6A 2KYBA 3VS0A 3JV3A 2GQIA 1YN8A 1KFZA 3VS4A 2JM9A 2NWMA 1PNJA 5EC7A 4X1VA 1I0CA 2GBQA 2FEIA 2YT6A 1X2KA 4WCIA 4IIOA 4OMPA 4ESRA 2AZSA 1LCKA 1U06A 4J9BA 5FWCA 1Y0MA 1E6GA 1AWOA 4LUDA 3M0SA 2W10A 1VYVA 2RQWA 1BBZA 3VS6A 2XMFA 2LJ0A 1MV3A 2L0AA 2K79A 4RTWA 1WXBA 1AD5A 2NUZA 2CH4W 4AFQC 1U3OA 4D8DA 4A63B 2RF0A 1GRIA 2J7IA 1HD3A 4JJCA 1JU5C 1K0SA 4AG1C 1SPKA 3UF4A 2KRNA 1T0HA 1AVZC 2K2MA 2J6FA 2KE9A 3UATA 4HVUA 1ARKA 2LMJA 3PVQA 1SHGA 2LJ3A 2BTTA 2CT4A 5IHIA 4CC2A 1X69A 1X27A 3EG0A 3TSWA 2BZYA 1Z9ZA 2DVJA 2A08A 4QT7A 1TUDA 1U5SA 1WXTA 3M0UA 4Y92A 4OMQA 1PWTA 1NEGA 4EIKA 2FPEA 2DILA 1GBRA 1PRMC 4IIMA 1N5ZA 1H3HA 2M51A 2SRCA 2OJ2A 5IXFA 3THKA 1RUWA 3I35A 2YUNA 2DRKA 2LCSA 1UUEA 2F2WA 2JS2A 2HEQA 2HDAA 2YUPA 1UJYA 2F2XA 4LE9A 4AFZC 4JZ3A 3EG1A 2DBKA 4J9DA 2J6OA 2EKHA 2DL5A 2RQRA 1NEBA 1T3LA 5GJVB 1QWFA 1JQQA 4HCKA 4F17A 3EG2A 4GBQA 2DLPA 2KRMA 1OEBA 1JO8A 1OV3A 5FWBA 1PKSA 1WA7A 1WDXA 2PTKA 3REBB 1ABQA 2IIMA 4CC7A 2FO0A 1UECA 2EBPA 1K0XA 1YWOA 2JMAA 2L3PA 1BU1A 2DMOA 1S1NA 2GTJA 3SHWA 3NHNA 2BZ8A 2KBTA 1B07A 1RLQC 4FSSA 1M27C 1AZEA 2O88A 3EHRA 2ED0A 1B3QA 1CSKA 2DL4A 1I07A 1PHTA 2CUBA 2JW4A 1NLPC 1AWJA 1HSQA 2BZXA 1MUZA 1CKAA 4JJDA 1MV0B 2FRYA 4ORZA 1QCFA 3TSZA 3VS7A 3KFVA 3VS2A 2PNIA 2YSQA 2K7AA 2FPDA 1NYFA 2OAWA 2MCNA 2RQUA 1W1FA 2FPFA 1NM7A 2ECZA 2J06A 2LZ6B 3RNJA 1JEGA 1AZGB 2DNUA 1M8MA 1W70A 4J9FA 2KYMA 4OMNA 1ZSGA 3A98A 1E7OA 4ZNXA 1OPLA 1SRMA 3NPFA 2EW3A 1Z9QA 2P4RA 4M4ZA 2EGCA 2KROA 5IXBA 1XOVA 1K76A 1WXUA 4JJBA 2J05A 1UTIA 4AFUC 4E6RA 3CQTA 2EVRA 1VA7A 2H8HA 4RTXA 1AWXA 3LH5A 1FMKA 3ULRB 1YNZA 2V1QA 2DBMA 1QWEA 3H41A 4HXJA 2DYBA 1ZUKA 4RTVA 4HVWA 1H8KA 4LNPA 1ZUUA 2AZVA 2DM1A 2JM8A 1JXOA 1AOJA 2DX1A 4AG2C 1ZUYA 3VRYA 3UA7A 3EHQA 1ZLMA 5IH2A 2EQIA 1M3AA 3I9QA 2RPNA 1WYXA 4D8KA 5I11A 1NLOC 2LQNA 4OMLA 1WLPB 1X2QA 2K9GA 1I1JA 1BB9A 1K4US 3ZL7C 2LX7A 2ROTA 1GL5A 2L3QA 1KJWA 2MIOA 3M0QA 2JTEA 2ESWA 1UG1A 1UGVA 1GFDA 2CSQA 4Z88A 3QWXX 2DRMA 3IQLA 3EG3A 4CC3A 4Z8AA 2EGAA 2QDLA 2DA9A 2RNAA 2O9VA 1J3TA 1FYNA 4OMOA 1NG2A 1QKWA 2O2OA 1M30A 1T3SA 1K1ZA 2E5KA 2EYWA 2C0OA 2D0NA 1ZBJA 2VVKA 2C0TA 3REAB 1TUCA 3NGPA 3I5SA 1IO6A 2A28A 1JXMA 2DJQA 3H0HA 2RQTA 2CREA 4GLMA 1GFCA 2CT3A 1X43A 4J9HA 2CDTA 3UA6A 2F2VA 1TG0A 1NYGA 2DE0X 2YUQA 1YCSB 2X3XD 2C0IA 4R0KA 2EPDA 4J9GA 3TVTA 4K11A 5IHNA 1T0JA 2JMCA 2V1RA 1BK2A 2DF6A 1CKBA 4Z89A 2DL8A 2VKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZ1 A;  1SEM A;  2MOX A;  3PVL A;  4RTZ A;  1KIK A;  1GCQ A;  2VWF A;  4F14 A;  1VYT A;  4RTY A;  1HJD A;  1RI9 A;  4DEY A;  4J9C A;  2AKK A;  4J9I A;  2JT4 A;  2CH4 A;  3PE0 A;  2KNB B;  4LN2 A;  2OI3 A;  1RLP C;  2D8H A;  1VYU A;  1WI7 A;  1UJ0 A;  2K6D A;  1M3C A;  2GGR A;  5L23 A;  2D8J A;  2K3B A;  2LJ1 A;  3H0I A;  3M0R A;  1GCP A;  1AEY A;  3VRZ A;  3R6N A;  2HBW A;  4LUE A;  1X6G A;  1QLY A;  1ABO A;  2KRS A;  4AFS C;  2YDL A;  2HSP A;  2O31 A;  3FJ5 A;  2KXC A;  4OMM A;  1YWP A;  2D1X A;  1WFW A;  2ED1 A;  2A37 A;  1UDL A;  3NMZ C;  2DL7 A;  2KXD A;  1SHF A;  4DEX A;  1YP5 A;  3C0C A;  2L2P A;  1EFN A;  2KT8 A;  2W0Z A;  1V1C A;  3EGU A;  3H0F A;  5I22 A;  2CSI A;  3SEM A;  3VS5 A;  2ABL A;  3M0P A;  2JXB A;  1M3B A;  1W6X A;  1G83 A;  1UHC A;  1GCQ C;  2SEM A;  2ENM A;  1AWW A;  1WIE A;  2RMO A;  2GNC A;  2EYY A;  2B86 A;  3GBQ A;  2LQW A;  4CC4 B;  4J9E A;  3QWY A;  4JZ4 A;  4KRT A;  1G2B A;  3VS1 A;  4F16 A;  2KT1 A;  2L3S A;  2RQV A;  5ECA A;  2LNH B;  1OPK A;  2JS0 A;  2CUD A;  2FG0 A;  1UE9 A;  1UFF A;  2KR3 A;  2M0Y A;  1SRL A;  2DL3 A;  2O9S A;  1KSW A;  1SSH A;  2EYZ A;  2YUO A;  5FW9 A;  5GJW B;  3VS3 A;  1K9A A;  2AKL A;  5IHK A;  1E6H A;  1ZX6 A;  2KGT A;  2RN8 A;  2ROL A;  2J6K A;  2I0N A;  3M0T A;  2LP5 A;  2X3W D;  1PKT A;  2GTO A;  2HCK A;  4HVV A;  1PRL C;  1X6B A;  1OOT A;  3U23 A;  3RBB B;  4JPB W;  4RUG A;  1UHF A;  2EYX A;  1GBQ A;  5HCK A;  3O5Z A;  1Y57 A;  2KEA A;  2AK5 A;  4RTU A;  2EGE A;  2FRW A;  1QKX A;  2A36 A;  2G6F X;  3I5R A;  1A0N B;  4RTT A;  1H92 A;  1WX6 A;  2KYB A;  3VS0 A;  3JV3 A;  2GQI A;  1YN8 A;  1KFZ A;  3VS4 A;  2JM9 A;  2NWM A;  1PNJ A;  5EC7 A;  4X1V A;  1I0C A;  2GBQ A;  2FEI A;  2YT6 A;  1X2K A;  4WCI A;  4IIO A;  4OMP A;  4ESR A;  2AZS A;  1LCK A;  1U06 A;  4J9B A;  5FWC A;  1Y0M A;  1E6G A;  1AWO A;  4LUD A;  3M0S A;  2W10 A;  1VYV A;  2RQW A;  1BBZ A;  3VS6 A;  2XMF A;  2LJ0 A;  1MV3 A;  2L0A A;  2K79 A;  4RTW A;  1WXB A;  1AD5 A;  2NUZ A;  2CH4 W;  4AFQ C;  1U3O A;  4D8D A;  4A63 B;  2RF0 A;  1GRI A;  2J7I A;  1HD3 A;  4JJC A;  1JU5 C;  1K0S A;  4AG1 C;  1SPK A;  3UF4 A;  2KRN A;  1T0H A;  1AVZ C;  2K2M A;  2J6F A;  2KE9 A;  3UAT A;  4HVU A;  1ARK A;  2LMJ A;  3PVQ A;  1SHG A;  2LJ3 A;  2BTT A;  2CT4 A;  5IHI A;  4CC2 A;  1X69 A;  1X27 A;  3EG0 A;  3TSW A;  2BZY A;  1Z9Z A;  2DVJ A;  2A08 A;  4QT7 A;  1TUD A;  1U5S A;  1WXT A;  3M0U A;  4Y92 A;  4OMQ A;  1PWT A;  1NEG A;  4EIK A;  2FPE A;  2DIL A;  1GBR A;  1PRM C;  4IIM A;  1N5Z A;  1H3H A;  2M51 A;  2SRC A;  2OJ2 A;  5IXF A;  3THK A;  1RUW A;  3I35 A;  2YUN A;  2DRK A;  2LCS A;  1UUE A;  2F2W A;  2JS2 A;  2HEQ A;  2HDA A;  2YUP A;  1UJY A;  2F2X A;  4LE9 A;  4AFZ C;  4JZ3 A;  3EG1 A;  2DBK A;  4J9D A;  2J6O A;  2EKH A;  2DL5 A;  2RQR A;  1NEB A;  1T3L A;  5GJV B;  1QWF A;  1JQQ A;  4HCK A;  4F17 A;  3EG2 A;  4GBQ A;  2DLP A;  2KRM A;  1OEB A;  1JO8 A;  1OV3 A;  5FWB A;  1PKS A;  1WA7 A;  1WDX A;  2PTK A;  3REB B;  1ABQ A;  2IIM A;  4CC7 A;  2FO0 A;  1UEC A;  2EBP A;  1K0X A;  1YWO A;  2JMA A;  2L3P A;  1BU1 A;  2DMO A;  1S1N A;  2GTJ A;  3SHW A;  3NHN A;  2BZ8 A;  2KBT A;  1B07 A;  1RLQ C;  4FSS A;  1M27 C;  1AZE A;  2O88 A;  3EHR A;  2ED0 A;  1B3Q A;  1CSK A;  2DL4 A;  1I07 A;  1PHT A;  2CUB A;  2JW4 A;  1NLP C;  1AWJ A;  1HSQ A;  2BZX A;  1MUZ A;  1CKA A;  4JJD A;  1MV0 B;  2FRY A;  4ORZ A;  1QCF A;  3TSZ A;  3VS7 A;  3KFV A;  3VS2 A;  2PNI A;  2YSQ A;  2K7A A;  2FPD A;  1NYF A;  2OAW A;  2MCN A;  2RQU A;  1W1F A;  2FPF A;  1NM7 A;  2ECZ A;  2J06 A;  2LZ6 B;  3RNJ A;  1JEG A;  1AZG B;  2DNU A;  1M8M A;  1W70 A;  4J9F A;  2KYM A;  4OMN A;  1ZSG A;  3A98 A;  1E7O A;  4ZNX A;  1OPL A;  1SRM A;  3NPF A;  2EW3 A;  1Z9Q A;  2P4R A;  4M4Z A;  2EGC A;  2KRO A;  5IXB A;  1XOV A;  1K76 A;  1WXU A;  4JJB A;  2J05 A;  1UTI A;  4AFU C;  4E6R A;  3CQT A;  2EVR A;  1VA7 A;  2H8H A;  4RTX A;  1AWX A;  3LH5 A;  1FMK A;  3ULR B;  1YNZ A;  2V1Q A;  2DBM A;  1QWE A;  3H41 A;  4HXJ A;  2DYB A;  1ZUK A;  4RTV A;  4HVW A;  1H8K A;  4LNP A;  1ZUU A;  2AZV A;  2DM1 A;  2JM8 A;  1JXO A;  1AOJ A;  2DX1 A;  4AG2 C;  1ZUY A;  3VRY A;  3UA7 A;  3EHQ A;  1ZLM A;  5IH2 A;  2EQI A;  1M3A A;  3I9Q A;  2RPN A;  1WYX A;  4D8K A;  5I11 A;  1NLO C;  2LQN A;  4OML A;  1WLP B;  1X2Q A;  2K9G A;  1I1J A;  1BB9 A;  1K4U S;  3ZL7 C;  2LX7 A;  2ROT A;  1GL5 A;  2L3Q A;  1KJW A;  2MIO A;  3M0Q A;  2JTE A;  2ESW A;  1UG1 A;  1UGV A;  1GFD A;  2CSQ A;  4Z88 A;  3QWX X;  2DRM A;  3IQL A;  3EG3 A;  4CC3 A;  4Z8A A;  2EGA A;  2QDL A;  2DA9 A;  2RNA A;  2O9V A;  1J3T A;  1FYN A;  4OMO A;  1NG2 A;  1QKW A;  2O2O A;  1M30 A;  1T3S A;  1K1Z A;  2E5K A;  2EYW A;  2C0O A;  2D0N A;  1ZBJ A;  2VVK A;  2C0T A;  3REA B;  1TUC A;  3NGP A;  3I5S A;  1IO6 A;  2A28 A;  1JXM A;  2DJQ A;  3H0H A;  2RQT A;  2CRE A;  4GLM A;  1GFC A;  2CT3 A;  1X43 A;  4J9H A;  2CDT A;  3UA6 A;  2F2V A;  1TG0 A;  1NYG A;  2DE0 X;  2YUQ A;  1YCS B;  2X3X D;  2C0I A;  4R0K A;  2EPD A;  4J9G A;  3TVT A;  4K11 A;  5IHN A;  1T0J A;  2JMC A;  2V1R A;  1BK2 A;  2DF6 A;  1CKB A;  4Z89 A;  2DL8 A;  2VKN A; 
#chains in the Genus database with same CATH topology
 2I2L A;  4BE2 A;  2MOX A;  3PVL A;  4PJO C;  3MPU B;  4V2S A;  1VYT A;  2QG9 B;  1M2O A;  3J7A F;  1M5Q 1;  4ZN3 A;  1EX4 A;  4J9C A;  1VQ8 T;  2CYZ B;  4A4K A;  2KNB B;  8AT1 B;  5GAM g;  1WI7 A;  1UJ0 A;  5L23 A;  1VQ9 A;  1YI2 Q;  1YCY A;  3H0I A;  4IUP A;  4N0A A;  2EJF A;  2ZPH B;  4M75 G;  4BDY A;  1VQK A;  1UEB A;  3R6N A;  2HBW A;  2XDB A;  3V7C A;  4LUE A;  3JCM V;  3M9Q A;  4Q5W A;  5J39 A;  5GMK m;  3CCQ A;  1VQP Q;  1VQ6 A;  2C06 A;  2YDL A;  2LVM A;  3MKD A;  3E19 A;  4RCB A;  2CZ0 B;  3FJ5 A;  2KXC A;  4KGV B;  3CCE T;  5LJ3 g;  2A37 A;  1PSF A;  4M77 E;  3CCM A;  1D0Z A;  4PFO A;  4IUU A;  4RG2 A;  5D6Y A;  1SHF A;  1IHV A;  1YP5 A;  3G6E T;  2CZ7 B;  3RDV A;  3NTK A;  5DM7 R;  3CME A;  1ZHI A;  3MET A;  2CSI A;  3QZ5 B;  3VYH B;  4GY5 A;  2FHD A;  1VQ9 T;  5KE3 A;  3ER0 A;  5C0M A;  4EMK C;  4M77 B;  2NYS A;  1VQK T;  1KC8 R;  1JBM A;  1PC0 A;  5GAN 2;  2ZPI B;  3CC7 A;  2EYY A;  2B86 A;  2LQW A;  4CC4 B;  4JZ4 A;  3CCQ T;  4OB0 B;  3VS1 A;  4F16 A;  4FYV B;  2KT1 A;  1VQ6 T;  3JCM Q;  3OYF A;  2KK4 A;  3CCL A;  3OYA A;  4XTW A;  5ECA A;  2LNH B;  4JRK A;  2JS0 A;  1OU8 A;  1UE9 A;  1UFF A;  1QVF S;  5FW9 A;  2YUO A;  3CCM T;  1SSH A;  2VUB A;  1RAB B;  4BY6 B;  5GAM d;  1ZX6 A;  4KGX B;  2J6K A;  2HSE B;  3OYM A;  2QTV A;  5FRM A;  1MMG A;  2HBP A;  3MCA B;  3OA6 A;  1PRL C;  1X6B A;  3JCM P;  2E5Q A;  4JPB W;  4RUG A;  4E2F B;  4ELY C;  1KC8 C;  1GBQ A;  2YWW A;  3O5Z A;  3CC7 T;  1Y57 A;  2LNV A;  4OMF B;  5LJ3 d;  2AK5 A;  4PJN A;  2EGE A;  4A4F A;  1D3B B;  1YIT A;  3JCM W;  3BW1 A;  3I5R A;  3CCL T;  1A0N B;  3QUI A;  3EFO B;  3VS0 A;  1QVG A;  1KFZ A;  3SDZ A;  1LPL A;  2XIC A;  3RMQ A;  2NWM A;  4LDY A;  4XK8 E;  3JRZ A;  4PJO G;  3A1P A;  4O5V A;  3SWN A;  1MND A;  4IIO A;  1LCK A;  2PU9 B;  5LL6 S;  2PVD B;  1AWO A;  3CCV A;  1PCX A;  3URG A;  2W10 A;  1VYV A;  2RQW A;  4M7A D;  5HKC A;  1BBZ A;  2COY A;  4RTW A;  2AIR B;  3HFN A;  2NUZ A;  2HKN A;  2CH4 W;  2RF0 A;  2E6N A;  1K0S A;  4AG1 C;  2LDM A;  3RKX A;  1YIT T;  1D1A A;  1O75 A;  4PLI A;  1T0H A;  1QVF P;  3OSS C;  1TOV A;  2KE9 A;  4HVU A;  1ARK A;  1SHG A;  4CC2 A;  2ZPE B;  3JAM E;  3OW2 S;  1X27 A;  3TSW A;  2DVJ A;  4J5Y A;  3CCV T;  1U5S A;  2BE7 D;  2EIF A;  4XTV A;  1KC8 U;  1PWT A;  3VYG A;  1BYM A;  3OBY A;  1GBR A;  4E7L A;  1N5Z A;  1MMD A;  1G3W A;  4VUB A;  1WQ7 A;  4UC4 A;  5IXF A;  5A2Q E;  2M1H A;  3CBO A;  1RAE B;  5GAN f;  1YIJ Q;  1UUE A;  1N9R A;  2JS2 A;  3VV0 A;  2HDA A;  1KG1 A;  4X34 A;  2GCX A;  4C0G A;  4AFZ C;  1Y96 A;  5FLX E;  2OX7 A;  3ME9 A;  2FB7 A;  1QCO A;  4DOV A;  3OYG A;  1QWF A;  2QA4 Q;  1VQN Q;  4L6V 5;  1BI1 A;  2KRM A;  3EGX A;  4XTU A;  1YJN A;  2PTK A;  2CP3 A;  3P8D A;  1BI2 A;  3VUZ A;  1Y07 A;  4BB7 A;  1TWB A;  4NS5 A;  1TSF A;  3G71 Q;  3SHW A;  2DXB A;  2LTO A;  1BIA A;  4C8Q A;  1VIF A;  2BZ8 A;  3C4S A;  4BY6 C;  5LJ5 f;  2PVO B;  1B07 A;  3E2U A;  2E3I A;  4E7J A;  2IVW A;  2O88 A;  1OYX A;  1BI3 A;  2ED0 A;  3PT9 A;  1B3Q A;  4OB1 B;  1MMN A;  1TUG B;  2DIG A;  4AMC A;  1NLP C;  3OW2 P;  1HSQ A;  2BZX A;  1CKA A;  2GF7 A;  3LWI A;  3TSZ A;  4ORZ A;  1QCF A;  4QQD A;  5GMK h;  2DJZ A;  4J83 A;  2PNI A;  2YSQ A;  3EGD A;  2LQK A;  2MCN A;  5GAN 3;  1YJN T;  3I56 Q;  1NJI U;  2J06 A;  1JB0 E;  2HL3 A;  3RNJ A;  4NOY A;  2DNU A;  3QXE B;  3ZFJ A;  1M2V A;  1XQH A;  3NPF A;  3R6O A;  3LGF A;  1QVP A;  2P4R A;  5AYF A;  2PUK B;  5A0L A;  1K76 A;  2QAS A;  3AT1 B;  3S3M A;  1VA7 A;  2H8H A;  2RHZ A;  1AWX A;  2Y4Y A;  1KQ1 A;  1BI0 A;  1YNZ A;  4FYW B;  2V1Q A;  4HXJ A;  3H41 A;  3PGG A;  3KXT A;  4C92 A;  4LNP A;  1VQO A;  2AZV A;  2HKQ B;  1VOM A;  1AOJ A;  3DLL A;  5GAN j;  2R5A A;  2RM4 A;  4JUV A;  4AG2 C;  2WAC A;  3UA7 A;  2HD0 A;  5IH2 A;  1VQ7 Q;  1M3A A;  3FRN A;  1RL2 A;  3J81 E;  5KYY B;  5I11 A;  2MF2 A;  2LQN A;  4E47 A;  1WLP B;  1X2Q A;  3OYK A;  2K9G A;  3CCR Q;  3HHT B;  2KDS A;  3QYH B;  3KUF A;  1YBY A;  2XI9 A;  2ROT A;  3OYB A;  2E10 A;  1VQ4 Q;  1GL5 A;  4M7D D;  2JTE A;  3G7Z A;  1K8A R;  2ESW A;  3WVD B;  2CSQ A;  1FXX A;  3PMT A;  3CD6 A;  3IQL A;  2LT4 A;  1RAA B;  2QDL A;  2QQ9 A;  2RNA A;  1J3T A;  2JJ9 A;  1VQ5 A;  4OMO A;  1NG2 A;  4MZP A;  2R58 A;  1Q82 R;  4E7S A;  1K1Z A;  2E6Z A;  5DLO A;  1D1B A;  1VQO T;  2D0N A;  3CCS A;  5LJ5 j;  2DZ9 A;  3REA B;  3I55 A;  3JCM e;  2HMA A;  3SFM A;  4QVZ A;  4FT2 A;  4C0F A;  3L1A A;  1WHL A;  2R57 A;  5GAN h;  2CT3 A;  4J9H A;  2CDT A;  3UA6 A;  3JB9 D;  1YCS B;  2NUT A;  2K4Y A;  1S72 Q;  1K8A C;  1T0J A;  2V1R A;  3OYE A;  1CKB A;  3CCJ A;  4OB2 B;  4ZTJ A;  1QCN A;  3CD6 T;  2DL8 A;  2VKN A;  2PZ1 A;  3CBM A;  3UPU A;  2VAS A;  4ZTF A;  2R5M A;  3C12 A;  1Q82 C;  3CMA A;  3MP6 A;  1QQJ A;  1IHW A;  4OGE A;  3PMI A;  3L2W A;  4C8Q D;  4XTY A;  4II1 A;  3CCS T;  4JJN K;  3A5Z B;  1ZA1 B;  3I55 T;  1RLP C;  2D8H A;  4BE1 A;  2K6D A;  4RG8 A;  1M3C A;  1Y71 A;  1VQL A;  1IZ6 A;  5LJ5 h;  1R77 A;  2K5I A;  1N9S A;  4A54 A;  5LJ3 j;  3VRZ A;  4R55 A;  3QJY A;  1QLY A;  1QP2 A;  2OTL A;  4IUR A;  4WTO B;  3RKW A;  3QO3 A;  1FMW A;  4E7I A;  3CCJ T;  1YJW A;  2D1X A;  2ED1 A;  2MPX C;  1UDL A;  3NMZ C;  3SWN B;  2DL7 A;  4M7A C;  1R8O B;  4DEX A;  2L2P A;  3X24 B;  2KT8 A;  2QXF A;  4PNO A;  4Y91 A;  2W0Z A;  4LDV A;  3EGU A;  3EFS A;  3TQ7 P;  1UHC A;  2SEM A;  3T9N A;  1VQL T;  2ZAE A;  5GAN g;  2RJE A;  1YHQ A;  2GNC A;  3MHX A;  1K8A U;  4DBR A;  5KYN A;  3GBQ A;  2JTF A;  4J9E A;  4KRT A;  3RMS A;  1G2B A;  2WSF E;  2L3S A;  5LJ3 h;  4ZGD B;  1WPY A;  3JCM X;  1X01 A;  4IUQ A;  1Q95 G;  2RK1 A;  5CR2 A;  1OPK A;  2DD4 A;  1YJW T;  4N0A C;  1Q82 U;  4C92 D;  5CO7 A;  2DL3 A;  1KSW A;  2EYZ A;  3SD4 A;  3L2Q A;  5GJW B;  3VS3 A;  2NUP A;  2AKL A;  4F7U A;  2QEX A;  2KGT A;  1JJ2 A;  3FDR A;  4M75 A;  3OB9 A;  2RH2 A;  2ROL A;  4QVC A;  3HRU A;  2JOY A;  2LP5 A;  2O4X A;  4XTZ A;  1PKT A;  3CC4 Q;  1AHJ B;  1WGS A;  2HCK A;  1KD1 R;  4A4G A;  4M78 A;  5LJ5 g;  2DEQ A;  3A8H B;  1YHQ T;  5FU7 B;  2CKK A;  3OYI A;  4FW1 A;  3FB9 A;  4LD6 A;  4MZT A;  2LCL A;  4LDW A;  3JCM f;  2KEA A;  3MP8 A;  4RCC A;  3JCM c;  3VU3 C;  1WX6 A;  4PL6 A;  2KQW A;  2HL5 C;  2E64 A;  2QK0 A;  4NL3 A;  5KCH A;  3PTA A;  3G6E A;  1WJQ A;  1WHH A;  2X4Y A;  1KQS A;  1VQM Q;  3EGX B;  1IRX A;  2YT6 A;  1X2K A;  4WCI A;  2EQK A;  2QEX T;  4ESR A;  2AZS A;  4J9B A;  3JB9 J;  2EKO A;  3M0S A;  1KD1 C;  1WJS A;  5GAN d;  1D0Y A;  3V8L A;  1N27 A;  3VS6 A;  2XMF A;  1MV3 A;  1QW1 A;  4ELZ C;  1AD5 A;  2DEU A;  3CME Q;  2OTJ Q;  4D8D A;  2OAU A;  3E1S A;  2F69 A;  2J7I A;  1TTH B;  1UGS B;  2IG0 A;  1TS9 A;  4EPC A;  1JU5 C;  2BE9 B;  7AT1 B;  3OYC A;  5J26 A;  1SPK A;  2RJD A;  4AT1 B;  4HT8 A;  4XU2 A;  2KRN A;  4QQ6 A;  4XAX B;  3O8V A;  5CKD A;  4X9C A;  1WHK A;  2K2M A;  2WSE E;  2LMJ A;  3CCL Q;  1X69 A;  4M7A G;  1X75 C;  1Z9Z A;  1PG5 B;  1OZ2 A;  2K3Y A;  3OMG A;  1HK9 A;  4QT7 A;  4B9W A;  5LJ5 d;  4BE0 A;  3M0U A;  2X9H A;  1BIB A;  3CPF A;  4HT9 A;  4EIK A;  1M2V B;  2IPO B;  2DIL A;  1YI2 A;  3M56 A;  4IIM A;  1H3H A;  3QSU A;  2HQX A;  3M57 A;  3SWN C;  2SRC A;  1RAG B;  2MAM A;  3I35 A;  2XHC A;  3GLX A;  1IRE B;  1VQP A;  1TXQ A;  2QDY B;  3HL8 A;  1B34 A;  2Y90 A;  2AT1 B;  4PJO A;  2DIQ A;  2F2X A;  3JB9 H;  3OS0 A;  2DBK A;  2RQR A;  2DYI A;  4LDX A;  1NEB A;  1T3L A;  3NTI A;  3LGL A;  2RHU A;  3A8G B;  1KD1 U;  4F17 A;  4J6W A;  1JO8 A;  4EMH A;  1ZSZ A;  5FWB A;  1FMV A;  1PKS A;  2K3X A;  2CS7 A;  1R0C B;  1YI2 T;  3QYG B;  1UEC A;  1PD1 A;  5CKB A;  2HQH A;  2COW A;  4MZM A;  1OX8 A;  3WXM B;  2DMO A;  2GTJ A;  3JSC A;  3MP1 A;  5IN1 A;  2BUD A;  3NHN A;  3QBY A;  2KBT A;  2P4T A;  1VQP T;  2X35 A;  3J80 E;  3PNW C;  1M27 C;  4HCZ A;  4DBH A;  1AZE A;  2QQB A;  2BIV A;  2DL4 A;  2LX9 A;  4M75 D;  1PHT A;  3EAE A;  4JLG A;  2K2V A;  1TH7 A;  2CUB A;  1FWZ A;  1M1K R;  4N4I A;  4DBF A;  1WHM A;  5FU7 C;  2CP6 A;  4M78 D;  3CPW S;  3S3O A;  3HRT A;  3S6W A;  1NYF A;  1P92 A;  4EMK A;  2FPF A;  3OS1 A;  4HA8 A;  3TEE A;  4F04 B;  5GAM e;  3HKS A;  3CXC S;  1AZG B;  1M8M A;  3A98 A;  4OVA A;  2XG8 D;  2EW3 A;  3GIB A;  2JZ2 A;  2XKO C;  1Z9Q A;  3E9G A;  1NPR A;  4M7A F;  2FYK A;  1M8V A;  4J6X A;  5IXB A;  1G3S A;  4JJB A;  3GNF B;  1M1K C;  4E6R A;  3CQT A;  3ZBD A;  4OP0 A;  5CQX A;  2XID A;  2YXY A;  2KI7 A;  4M7D A;  3LH5 A;  1FMK A;  4IUV A;  3FC3 A;  1YJ9 Q;  2QQR A;  1WZO A;  1QWE A;  3QKJ A;  3OYY A;  2F5K A;  4RTV A;  2V8I A;  2RHX A;  4FYY B;  2FZC B;  2L3R A;  1SSF A;  2EJ9 A;  3QZ9 B;  4FT4 A;  5D6X A;  4JS4 A;  2DZC A;  1R0B G;  3MJX A;  4HCC A;  1NLO C;  1UGP B;  5CK9 A;  3X28 B;  4OML A;  1I1J A;  2RI2 A;  3M4G A;  3M4Y A;  2LX7 A;  2L3Q A;  3BFM A;  3INZ A;  1UG1 A;  4ME7 A;  3BDL A;  2LC4 A;  4PLL A;  1PD0 A;  4CC3 A;  4Z8A A;  2DA9 A;  2KAF A;  3CPW P;  2WSC E;  1FYN A;  3M53 A;  2V8K A;  1MMA A;  2CP0 A;  2E5K A;  2EYW A;  4PJJ A;  3V7S A;  4XQ3 A;  3CXC P;  3I5S A;  1JXM A;  2DJQ A;  2MK5 A;  4PJO D;  1U8R A;  3JCM g;  2CRE A;  4ANJ A;  1X43 A;  2F2V A;  1YIJ A;  3A8O B;  2M0O A;  4C92 C;  5KCO A;  3WVE B;  2X3X D;  3CCU A;  1M1K U;  4R0K A;  3X25 B;  1D1C A;  4K11 A;  5IHN A;  3LYI A;  1BK2 A;  2DF6 A;  4M7A E;  4IUT A;  2DO3 A;  2GQV A;  3LW5 E;  2NUP B;  1XNI A;  4FYX B;  4A4H A;  4KH1 B;  3EG9 A;  1KIK A;  1GCQ A;  2VWF A;  4F14 A;  3GF5 A;  2QA4 A;  3OSV A;  2FL7 A;  2JVV A;  1RI9 A;  3M5A A;  3OW2 A;  4FCY A;  4BUG A;  2JT4 A;  1C1A A;  1M90 R;  4KUI A;  3KBG A;  4LN2 A;  4KUD K;  4M7A B;  1VYU A;  5FU6 B;  5CVI A;  1RI0 A;  1WQW A;  2K3B A;  3G71 A;  2LJ1 A;  3FEO A;  2QQA A;  1VQO Q;  1LNX A;  3DLM A;  3M0R A;  1GCP A;  5EG2 A;  1AEY A;  2QQS A;  1YIJ T;  2EFI A;  1ABO A;  3CCU T;  2KRS A;  4FM4 B;  2HSP A;  2M16 A;  2MWP A;  4OB3 B;  2O31 A;  4M77 A;  4J7F A;  1C6V X;  1AT1 B;  1WFW A;  5KYX A;  3L42 A;  2KXD A;  1H64 1;  2QA4 T;  2E4H A;  4LD9 K;  4OGC A;  3C0C A;  2B8A A;  3TU4 K;  2RJF A;  3DKM A;  1EFN A;  1WHJ A;  1M90 C;  4FU6 A;  4JRQ A;  1V1C A;  3H0F A;  5I22 A;  2CP7 A;  3JCM d;  5GAO m;  3UDC A;  3SEM A;  2XK0 A;  2Z0W A;  2ABL A;  1VQ5 Q;  3L2V A;  1G83 A;  2YRV A;  2ENM A;  3G71 T;  1WIE A;  2VYT A;  2RMO A;  3QII A;  2RK2 A;  3GPL A;  2KSS A;  2EQU A;  3V7R A;  5GAO n;  2RQV A;  5L8R E;  4YTL A;  2FG0 A;  4C0Z A;  4IKF A;  1UGQ B;  3G4S Q;  2M0Y A;  1D3B A;  2QGF B;  1K9A A;  2JTM A;  3FJP A;  2CGH A;  3EFO A;  3QJ6 A;  3CC2 A;  2QGG A;  2I0N A;  3CMA Q;  1Q86 R;  1VQ7 A;  1OOT A;  3RBB B;  1M9S A;  1W4S A;  2EYX A;  2YRD A;  5D6W A;  3HRS A;  2QYZ A;  2RI5 A;  1B34 B;  2G3R A;  2K57 A;  3CCR A;  4RMO A;  2DTH A;  5HK3 A;  1VQL Q;  2FRW A;  4ZGJ B;  2A36 A;  4C92 G;  5A0D A;  2DAQ A;  1H92 A;  2KYB A;  2P0K A;  4WF2 A;  3JV3 A;  3Q1J A;  1VUB A;  2GQI A;  1YN8 A;  3JB9 F;  3LLR A;  3VS4 A;  2OTL Q;  2JM9 A;  1M90 U;  1I0C A;  2GBQ A;  4BI4 A;  5I21 A;  2DKG A;  3CC2 T;  1U06 A;  3GNG A;  1G3T A;  1Y0M A;  4D6W A;  1Q86 C;  3RER A;  4LUD A;  4JDS A;  1IB8 A;  1MGQ A;  2L0A A;  1VQ7 T;  2K79 A;  1WXB A;  1W2B A;  4AFQ C;  1U3O A;  2DPP B;  1GRI A;  5GAN 4;  4E7K A;  1HD3 A;  1HYO A;  4QW2 A;  5KH6 A;  4M75 C;  3CCR T;  2CZ1 B;  5KYU A;  4C8Q F;  5FRN A;  2DVE A;  1YHQ Q;  4M78 C;  3LWH A;  1AVZ C;  4Y28 E;  5FU6 C;  1WHG A;  5GAO l;  2J6F A;  3JCM J;  3RR6 A;  3MEV A;  2LJ3 A;  2BTT A;  2CT4 A;  2YRC A;  1ZA2 B;  2MWO A;  3TCJ A;  3QG1 A;  2BZY A;  2L8D A;  4CRI A;  2A08 A;  1D0X A;  2E1H A;  1BCM A;  2YLC A;  2AHJ B;  1KHC A;  2FZK B;  1VQ8 Q;  3QDR B;  4M7D E;  4Y92 A;  2GFU A;  1F1B B;  2FPE A;  2XDD A;  3OYL A;  1PRM C;  3TRE A;  4M77 D;  3THK A;  1RUW A;  4L59 A;  2DET A;  2DRK A;  3UWN A;  2LCS A;  2YHT A;  2HEQ A;  2YUP A;  4BDZ A;  3CCE Q;  4MMK A;  2VV5 A;  4XU0 A;  1Q86 U;  5GMK e;  1N6A A;  4HCK A;  1Q81 R;  4GBQ A;  3G6E Q;  2DLP A;  1OEB A;  3CEY A;  1ACM B;  1OV3 A;  2O01 E;  4C92 F;  4ATO A;  1WA7 A;  5KE2 A;  3REB B;  1SKU B;  1ABQ A;  4CC7 A;  2CP5 A;  2LRQ A;  2EBP A;  4KUL A;  1YWO A;  2L3P A;  4ZN1 A;  3OYJ A;  3S3N A;  1VQ9 Q;  2L5Q A;  4A53 A;  1S1N A;  3MEA A;  1QMC A;  4KGZ B;  1M1F A;  2RHY A;  4E7Z A;  1Y96 B;  1VQK Q;  4FSS A;  1I8F A;  3VKI A;  3GP8 A;  4C8Q E;  1I81 A;  3EFR A;  3EHR A;  3CCQ Q;  1CSK A;  2EYQ A;  1VQ6 Q;  4EDU A;  2VGN A;  1Q7Y R;  4L5G A;  3QHS A;  1Q81 C;  4JJD A;  4KBM B;  4C5H A;  3CCM Q;  1Y7X A;  2M9U A;  9ATC B;  3KFV A;  3PFS A;  2FPD A;  4RKU E;  4MDX A;  3CC4 A;  4HKE A;  2RQU A;  1W1F A;  4C8Q B;  2LZ6 B;  2F5T X;  1I5L A;  2GFA A;  4J9F A;  4X9D A;  3M55 A;  4OMN A;  1ZSG A;  4B6M A;  4ZNX A;  1E7O A;  1OPL A;  1SRM A;  3E9F A;  4F7U G;  1ZSZ C;  1QP3 A;  2CZ6 B;  3CC7 Q;  1LOJ A;  2KRO A;  1QVG S;  1Q7Y C;  3OYN A;  4KH0 B;  1WXU A;  5KYY A;  2J05 A;  3EG9 B;  4M78 G;  2EVR A;  3EGD B;  1VQM A;  4JS5 A;  5M9O A;  4BI3 A;  5GAN 8;  1NBE B;  2RD1 A;  4HVW A;  2ZZD A;  3CC4 T;  2DM1 A;  2H3E B;  1JXO A;  2JM8 A;  2DX1 A;  5KYW A;  3C95 A;  1ZUY A;  2OTJ A;  4C92 E;  3EHQ A;  1ZLM A;  2D9T A;  4C0D B;  2A0F B;  2H3J A;  2EQI A;  3AHU A;  2QTX A;  2VXF A;  5GAN e;  4PJL A;  2ZPB B;  3H8Z A;  4JLI A;  3L2R A;  2NLU A;  1X6O A;  1SG5 A;  1BB9 A;  1FX7 A;  3ZL7 C;  3FIF A;  2EQJ A;  1RAC B;  1YIT Q;  2MIO A;  3M0Q A;  5KYX B;  1Q81 U;  4DOW A;  3DB4 A;  2DRM A;  1VQM T;  4C92 B;  1LJO A;  3EG3 A;  2ZPF B;  2EGA A;  5GAO r;  2O9V A;  3OYH A;  2EJG A;  4DQ2 A;  2MYS A;  5I2S A;  4HCB A;  1M30 A;  1T3S A;  2ZPG B;  2C0O A;  2VVK A;  2C0T A;  3CCV Q;  4C5E A;  1O9S A;  1IO6 A;  5CQY A;  2A28 A;  4M7D C;  3CME T;  2OTJ T;  3ZEH A;  4TVR A;  5LJ5 e;  4GLM A;  1GFC A;  1BKB A;  1C0M A;  3M58 A;  1NE8 A;  5FRO A;  1NYG A;  1Q7Y U;  1WJR A;  3MO8 A;  2YUQ A;  1QVG P;  2EPD A;  2LCC A;  1IXD A;  3NFC A;  3RKY A;  4Z89 A;  5CKF A;  2BKD N;  1SEM A;  4RTZ A;  2RB6 A;  1DJ7 B;  1K9M R;  3L2Z A;  2JN0 A;  4RTY A;  4J7I A;  4F7U F;  1HJD A;  2E3H A;  4DEY A;  1OQK A;  4M75 F;  2AKK A;  4J9I A;  4O6J A;  2CH4 A;  2LT1 A;  3PE0 A;  1ZQ1 A;  5C6S A;  3JCM h;  2OI3 A;  4BI8 B;  1TU0 B;  2NUT B;  2GGR A;  5IT9 E;  1G5V A;  2D8J A;  2DXT A;  4M78 F;  5GMK l;  2FZG B;  6AT1 B;  1ZBX A;  8ATC B;  1I4K 1;  2DXU A;  1X6G A;  4AFS C;  5LJ3 e;  1NJI R;  1U1S A;  3PIP A;  4LXC A;  2HAX A;  2V26 A;  4E7H A;  4OMM A;  4C8Q C;  1K9M C;  1YWP A;  1QVF A;  1JRI A;  2CP2 A;  4JRP A;  3OYD A;  1UGR B;  2PUO B;  1KQ2 A;  4OF1 A;  4C5G A;  3HPW A;  3BE3 A;  5HY6 A;  2PVG B;  2QAZ A;  3QPH A;  2X4J A;  3NTH A;  1NZ9 A;  1YFN A;  2DER A;  1NPP A;  3VS5 A;  3M0P A;  2JXB A;  1M3B A;  3EH2 A;  1YJN Q;  2EWN A;  1W6X A;  3RES A;  1GCQ C;  1AWW A;  5KYU B;  2KVQ G;  1NJI C;  1RAD B;  3QWY A;  1WNL A;  2COZ A;  4J6Y A;  3OS5 A;  2D6F A;  2CUD A;  3RUX A;  3CCU Q;  2KR3 A;  4C0D C;  1YJ9 A;  1SRL A;  2O9S A;  3RIR A;  2P0P A;  5GMK i;  5GMK j;  5IHK A;  1MHN A;  1VIE A;  3MEU A;  1E6H A;  2RN8 A;  4M77 C;  4F7U E;  3M0T A;  5CCA A;  2X3W D;  1UB4 A;  5DLQ E;  3CPW A;  2EAY A;  2GTO A;  4M75 E;  4QKU A;  4N4G A;  4HVV A;  2KY9 A;  3U23 A;  5AT1 B;  1UHF A;  3C94 A;  4M7D G;  3H9N A;  1G3Y A;  3EH1 A;  3CXC A;  2P0Q A;  5HCK A;  4M78 E;  2JUF A;  2XD0 A;  4RTU A;  3LX7 A;  1K9M U;  1QKX A;  2G6F X;  4PJO F;  4RTT A;  4F7U B;  2E65 A;  5IAY A;  2M02 A;  1K73 R;  1OZ3 A;  4M75 B;  4BAC A;  1VQN A;  1YJ9 T;  2RI3 A;  1PNJ A;  2O4X B;  4X1V A;  5EC7 A;  1PSE A;  2FEI A;  4JRI A;  4M78 B;  4OMP A;  3M59 A;  5HK0 A;  4R56 A;  4DA4 A;  5DY9 A;  2QI2 A;  5FWC A;  1E6G A;  1M4Z A;  4LDU A;  3JB9 G;  2MI6 A;  4C5I A;  2HNI A;  2LJ0 A;  3OBW A;  3PIO A;  4A63 B;  5GAM f;  4JJC A;  3P8B B;  1SF9 A;  4EMG A;  3UF4 A;  4B9X A;  1K73 C;  3OQ5 A;  1D09 B;  1M1G A;  2RHI A;  3ASK A;  4C8Q G;  4ZGE B;  4XU1 A;  3JB9 I;  1VQN T;  3UAT A;  3LH0 A;  3OY9 A;  3CBP A;  4XTX A;  3CD6 Q;  3PVQ A;  5IHI A;  5LJ3 f;  1OX9 A;  3I56 A;  5GAO p;  2P84 A;  5CKH A;  3L2U A;  3EG0 A;  2X4W A;  3QDF A;  1TUD A;  1WXT A;  4MDW A;  3UT1 A;  4OMQ A;  1NEG A;  3CCS Q;  4PK4 A;  3CC2 Q;  3G1J A;  2K5F A;  3I55 Q;  5GAN 6;  5CIU A;  1W2B S;  3DB3 A;  2M51 A;  3HTR A;  4PFZ A;  5J3B A;  2OJ2 A;  2DTI A;  2V8J A;  2YUN A;  3F70 A;  1BCO A;  2F2W A;  1UJY A;  1IGQ A;  4LE9 A;  1KK7 A;  2HQE A;  4BD3 A;  4PJO E;  4JZ3 A;  5CAI A;  3EG1 A;  2HZY A;  3CCJ Q;  4J9D A;  2J6O A;  4P5N A;  2EKH A;  2DL5 A;  4A4E A;  4M7D F;  5GJV B;  3I56 T;  1N8R R;  1JQQ A;  3V8J A;  3EG2 A;  1XTD A;  5KYW B;  1V29 B;  3GOX A;  4M77 G;  1WDX A;  1B7T A;  2IIM A;  2FO0 A;  1K0X A;  2DFU A;  2JMA A;  1BU1 A;  1GXI E;  4NL2 A;  4PJO B;  2VC8 A;  1VQ4 A;  3OS2 A;  1K73 U;  2DTO A;  1RLQ C;  2VXE A;  4FSX A;  4CI0 C;  3OMC A;  1OU9 A;  2K5L A;  2DK3 A;  2ZCF B;  2YLB A;  3G4S A;  2EQM A;  1I07 A;  2L89 A;  3FLG A;  2JW4 A;  5D7U A;  1YJW Q;  1N8R C;  1XJW B;  3VUB A;  1AWJ A;  1ZSZ B;  1MUZ A;  1JJ2 S;  1MV0 B;  2FRY A;  3JCM b;  3VS7 A;  1V76 A;  2RO0 A;  2KMT A;  4FW2 A;  3VS2 A;  1EZZ B;  5GAM j;  2K7A A;  3H6Z A;  4DBQ A;  2OAW A;  1VQ5 T;  4PKC C;  1NM7 A;  2ECZ A;  1MNE A;  1HXD A;  4PFP A;  1JEG A;  1W2B P;  4KT0 E;  3A8L B;  2XDP A;  1W70 A;  2KYM A;  1S72 A;  1KHI A;  2DXC A;  1VQ4 T;  3V8K A;  1IGU A;  1PM3 A;  2RJC A;  2ZGW A;  5GAN 7;  5GAO q;  4FIB A;  1OI1 A;  4Z02 A;  2EGC A;  4XU3 A;  4QQG A;  3BY7 A;  2PQW A;  1G8X A;  1XOV A;  4AFU C;  1UTI A;  4PJM A;  3G4S T;  1KQS S;  1OUL A;  2A3L A;  2FVU A;  4N4H A;  2JNG A;  4RTX A;  4EMK B;  3SB2 A;  1I5O B;  3ULR B;  2VB6 A;  1EIF A;  2DBM A;  1LVK A;  2DYB A;  1ZUK A;  5A0G A;  3MEW A;  5CKE A;  2XU8 A;  3CMA T;  2QEX Q;  2E41 A;  1H8K A;  1ZUU A;  3X26 B;  1U1T A;  4J8O A;  3VJP A;  5GAM h;  3VRY A;  2A7Y A;  3X20 B;  1S72 T;  3I9Q A;  2RA2 A;  2RPN A;  1WYX A;  4D8K A;  3N5B B;  3M54 A;  3HP9 A;  2D0Q B;  4M7D B;  1K4U S;  2DD5 A;  2X4X A;  1N8R U;  2Y4X A;  1KJW A;  4M77 F;  1UGV A;  1RAI B;  1GFD A;  2OTL T;  4Z88 A;  3QWX X;  1JJ2 P;  4GLK A;  5I2M A;  2LQ8 A;  2E70 A;  1QKW A;  2O2O A;  1VQ8 A;  4QVD A;  1ZBJ A;  1H3Z A;  1TUC A;  2ATC B;  3NGP A;  3P8H A;  3H0H A;  2RQT A;  4FL6 A;  2X51 A;  1TG0 A;  2DE0 X;  4M7A A;  1RAF B;  3A8M B;  2C0I A;  2MMP A;  4J9G A;  3TVT A;  3HSB A;  2JMC A;  1KQS P;  1RAH B;  2E12 A;  3BDU A;  4MML A;  3CCE A;  2VGM A;  5GAN 5;  3D7S B;  2F1L A;  3HFO A;  4M4Z A; 
#chains in the Genus database with same CATH homology
 2PZ1 A;  1SEM A;  2MOX A;  3PVL A;  4RTZ A;  1KIK A;  1GCQ A;  2VWF A;  4F14 A;  1VYT A;  4RTY A;  1HJD A;  1RI9 A;  4DEY A;  4J9C A;  2AKK A;  4J9I A;  2JT4 A;  2CH4 A;  3PE0 A;  2KNB B;  4LN2 A;  2OI3 A;  1RLP C;  2D8H A;  1VYU A;  1WI7 A;  1UJ0 A;  2K6D A;  1M3C A;  2GGR A;  5L23 A;  2D8J A;  2K3B A;  2LJ1 A;  3H0I A;  3M0R A;  1GCP A;  1AEY A;  3VRZ A;  3R6N A;  2HBW A;  4LUE A;  1X6G A;  1QLY A;  1ABO A;  2KRS A;  4AFS C;  2YDL A;  2HSP A;  2O31 A;  3FJ5 A;  2KXC A;  4OMM A;  1YWP A;  2D1X A;  1WFW A;  2ED1 A;  2A37 A;  1UDL A;  3NMZ C;  2DL7 A;  2KXD A;  1SHF A;  4DEX A;  1YP5 A;  3C0C A;  2L2P A;  1EFN A;  2KT8 A;  2W0Z A;  1V1C A;  3EGU A;  3H0F A;  5I22 A;  2CSI A;  3SEM A;  3VS5 A;  2ABL A;  3M0P A;  2JXB A;  1M3B A;  1W6X A;  1G83 A;  1UHC A;  1GCQ C;  2SEM A;  2ENM A;  1AWW A;  1WIE A;  2RMO A;  2GNC A;  2EYY A;  2B86 A;  3GBQ A;  2LQW A;  4CC4 B;  4J9E A;  3QWY A;  4JZ4 A;  4KRT A;  1G2B A;  3VS1 A;  4F16 A;  2KT1 A;  2L3S A;  2RQV A;  5ECA A;  2LNH B;  1OPK A;  2JS0 A;  2CUD A;  2FG0 A;  1UE9 A;  1UFF A;  2KR3 A;  2M0Y A;  1SRL A;  2DL3 A;  2O9S A;  1KSW A;  1SSH A;  2EYZ A;  2YUO A;  5FW9 A;  5GJW B;  3VS3 A;  1K9A A;  2AKL A;  5IHK A;  1E6H A;  1ZX6 A;  2KGT A;  2RN8 A;  2ROL A;  2J6K A;  2I0N A;  3M0T A;  2LP5 A;  2X3W D;  1PKT A;  2GTO A;  2HCK A;  4HVV A;  1PRL C;  1X6B A;  1OOT A;  3U23 A;  3RBB B;  4JPB W;  4RUG A;  1UHF A;  2EYX A;  1GBQ A;  5HCK A;  3O5Z A;  1Y57 A;  2KEA A;  2AK5 A;  4RTU A;  2EGE A;  2FRW A;  1QKX A;  2A36 A;  2G6F X;  3I5R A;  1A0N B;  4RTT A;  1H92 A;  1WX6 A;  2KYB A;  3VS0 A;  3JV3 A;  2GQI A;  1YN8 A;  1KFZ A;  3VS4 A;  2JM9 A;  2NWM A;  1PNJ A;  5EC7 A;  4X1V A;  1I0C A;  2GBQ A;  2FEI A;  2YT6 A;  1X2K A;  4WCI A;  4IIO A;  4OMP A;  4ESR A;  2AZS A;  1LCK A;  1U06 A;  4J9B A;  5FWC A;  1Y0M A;  1E6G A;  1AWO A;  4LUD A;  3M0S A;  2W10 A;  1VYV A;  2RQW A;  1BBZ A;  3VS6 A;  2XMF A;  2LJ0 A;  1MV3 A;  2L0A A;  2K79 A;  4RTW A;  1WXB A;  1AD5 A;  2NUZ A;  2CH4 W;  4AFQ C;  1U3O A;  4D8D A;  4A63 B;  2RF0 A;  1GRI A;  2J7I A;  1HD3 A;  4JJC A;  1JU5 C;  1K0S A;  4AG1 C;  1SPK A;  3UF4 A;  2KRN A;  1T0H A;  1AVZ C;  2K2M A;  2J6F A;  2KE9 A;  3UAT A;  4HVU A;  1ARK A;  2LMJ A;  3PVQ A;  1SHG A;  2LJ3 A;  2BTT A;  2CT4 A;  5IHI A;  4CC2 A;  1X69 A;  1X27 A;  3EG0 A;  3TSW A;  2BZY A;  1Z9Z A;  2DVJ A;  2A08 A;  4QT7 A;  1TUD A;  1U5S A;  1WXT A;  3M0U A;  4Y92 A;  4OMQ A;  1PWT A;  1NEG A;  4EIK A;  2FPE A;  2DIL A;  1GBR A;  1PRM C;  4IIM A;  1N5Z A;  1H3H A;  2M51 A;  2SRC A;  2OJ2 A;  5IXF A;  3THK A;  1RUW A;  3I35 A;  2YUN A;  2DRK A;  2LCS A;  1UUE A;  2F2W A;  2JS2 A;  2HEQ A;  2HDA A;  2YUP A;  1UJY A;  2F2X A;  4LE9 A;  4AFZ C;  4JZ3 A;  3EG1 A;  2DBK A;  4J9D A;  2J6O A;  2EKH A;  2DL5 A;  2RQR A;  1NEB A;  1T3L A;  5GJV B;  1QWF A;  1JQQ A;  4HCK A;  4F17 A;  3EG2 A;  4GBQ A;  2DLP A;  2KRM A;  1OEB A;  1JO8 A;  1OV3 A;  5FWB A;  1PKS A;  1WA7 A;  1WDX A;  2PTK A;  3REB B;  1ABQ A;  2IIM A;  4CC7 A;  2FO0 A;  1UEC A;  2EBP A;  1K0X A;  1YWO A;  2JMA A;  2L3P A;  1BU1 A;  2DMO A;  1S1N A;  2GTJ A;  3SHW A;  3NHN A;  2BZ8 A;  2KBT A;  1B07 A;  1RLQ C;  4FSS A;  1M27 C;  1AZE A;  2O88 A;  3EHR A;  2ED0 A;  1B3Q A;  1CSK A;  2DL4 A;  1I07 A;  1PHT A;  2CUB A;  2JW4 A;  1NLP C;  1AWJ A;  1HSQ A;  2BZX A;  1MUZ A;  1CKA A;  4JJD A;  1MV0 B;  2FRY A;  4ORZ A;  1QCF A;  3TSZ A;  3VS7 A;  3KFV A;  3VS2 A;  2PNI A;  2YSQ A;  2K7A A;  2FPD A;  1NYF A;  2OAW A;  2MCN A;  2RQU A;  1W1F A;  2FPF A;  1NM7 A;  2ECZ A;  2J06 A;  2LZ6 B;  3RNJ A;  1JEG A;  1AZG B;  2DNU A;  1M8M A;  1W70 A;  4J9F A;  2KYM A;  4OMN A;  1ZSG A;  3A98 A;  1E7O A;  4ZNX A;  1OPL A;  1SRM A;  3NPF A;  2EW3 A;  1Z9Q A;  2P4R A;  4M4Z A;  2EGC A;  2KRO A;  5IXB A;  1XOV A;  1K76 A;  1WXU A;  4JJB A;  2J05 A;  1UTI A;  4AFU C;  4E6R A;  3CQT A;  2EVR A;  1VA7 A;  2H8H A;  4RTX A;  1AWX A;  3LH5 A;  1FMK A;  3ULR B;  1YNZ A;  2V1Q A;  2DBM A;  1QWE A;  3H41 A;  4HXJ A;  2DYB A;  1ZUK A;  4RTV A;  4HVW A;  1H8K A;  4LNP A;  1ZUU A;  2AZV A;  2DM1 A;  2JM8 A;  1JXO A;  1AOJ A;  2DX1 A;  4AG2 C;  1ZUY A;  3VRY A;  3UA7 A;  3EHQ A;  1ZLM A;  5IH2 A;  2EQI A;  1M3A A;  3I9Q A;  2RPN A;  1WYX A;  4D8K A;  5I11 A;  1NLO C;  2LQN A;  4OML A;  1WLP B;  1X2Q A;  2K9G A;  1I1J A;  1BB9 A;  1K4U S;  3ZL7 C;  2LX7 A;  2ROT A;  1GL5 A;  2L3Q A;  1KJW A;  2MIO A;  3M0Q A;  2JTE A;  2ESW A;  1UG1 A;  1UGV A;  1GFD A;  2CSQ A;  4Z88 A;  3QWX X;  2DRM A;  3IQL A;  3EG3 A;  4CC3 A;  4Z8A A;  2EGA A;  2QDL A;  2DA9 A;  2RNA A;  2O9V A;  1J3T A;  1FYN A;  4OMO A;  1NG2 A;  1QKW A;  2O2O A;  1M30 A;  1T3S A;  1K1Z A;  2E5K A;  2EYW A;  2C0O A;  2D0N A;  1ZBJ A;  2VVK A;  2C0T A;  3REA B;  1TUC A;  3NGP A;  3I5S A;  1IO6 A;  2A28 A;  1JXM A;  2DJQ A;  3H0H A;  2RQT A;  2CRE A;  4GLM A;  1GFC A;  2CT3 A;  1X43 A;  4J9H A;  2CDT A;  3UA6 A;  2F2V A;  1TG0 A;  1NYG A;  2DE0 X;  2YUQ A;  1YCS B;  2X3X D;  2C0I A;  4R0K A;  2EPD A;  4J9G A;  3TVT A;  4K11 A;  5IHN A;  1T0J A;  2JMC A;  2V1R A;  1BK2 A;  2DF6 A;  1CKB A;  4Z89 A;  2DL8 A;  2VKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...