2EZ0D

Crystal structure of the s107a/e148q/y445a mutant of ecclc, in complex with a fab fragment
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Ion-binding properties of the ClC chloride selectivity filter.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 48
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ez0D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ez0D01
1VGEL 1KB9K 3LAFA 4FFYH 4M7LL 3LMJL 2YRZA 4TVPE 1ZHLA 1F00I 3C5SA 3M8OL 3BD3A 1S7QA 5MERB 5HGHB 3WIHA 3KDMA 3U30B 5FA4A 1W0YT 5HYJE 3RAJH 4FFYL 4IRJD 1L6XA 4XT1C 4Y2DB 4EQ2A 4ZFOB 5E2JA 2X89A 3OX8A 5I1LA 1HSAB 1IQWH 2V7HB 3RAJL 4QRPE 5I16B 1RZKC 1SM3L 3DJ9A 1CFQA 5JIHA 3U7WH 2DYPD 2QSVA 5KOMC 4HK0A 4BH8B 3MRHA 3ZL4H 4KV5E 1BD2E 1IQWL 1JNNH 1T3FB 2VOTA 3PXJA 5M94B 3FT2A 1P84J 3U7WL 4HKXA 4PJDF 1B3JA 5AAWA 3ZL4L 1JNNL 5EBMA 4KROC 2VXTH 4WW2A 5DJ8B 2YD7A 1OP5H 3INUH 3QXDB 4F37K 5MENA 2YRLA 3X14A 4HS3A 4WW1B 3ILQC 2VXTL 4WWKA 3L3DA 3KYMB 4YPJA 3RX5A 1T22A 4FS0A 3INUL 5B21A 2OL3H 1F3RB 2Q6WA 4OKVB 1QR1B 1ZANL 5IB1A 1UWXH 2BNQE 3EDKA 3T65A 3MJ9A 4NQSA 4I18C 1OGAB 5ITBH 4XRCA 4XZUB 5BRZE 5E5UB 2OL3L 1E4KA 4J4PD 3WIFA 3QCTH 3QDMB 3Q6GH 1EFXD 2W60B 2YRPA 4XHJC 3SOBH 5CLWA 3TA3A 3BYTA 1YEKL 1U6AH 1ZT7B 5EO9B 5ITBL 4LGRB 5JZ7C 1VESA 3QH3A 1UKTA 3QCTL 2IMMA 2VZSA 3B2UC 3Q6GL 3SOBL 4EUPH 1U6AL 1AKJA 4HEME 4IDLA 4JFEE 3BXNA 5ADOH 5DQ9B 3FT4A 3N85H 1GSMA 1N64H 1IGJB 5ADOL 2GTWA 3N85L 5D1QA 3ALXA 1RZIA 2NLJB 3ISWA 1N64L 3MBEB 2H3NB 3QG6A 4V2CB 4NIKB 1AO7B 2C3XA 4ZUSA 4AIZA 3P4OA 4BSJA 3GJFH 5FB8A 1W0WA 2IANE 4AH2A 4JGUA 4NQCB 1XGPA 3OMZA 5DQDH 1T0MA 4JFPA 1P2CB 2D0GA 4Y2OA 3B8YA 3MRRA 4X6DF 3OXRA 3NGBC 4YBQD 5DQDL 1WWCA 3QEQE 3SJVA 3L7EB 5C0EA 2BOCB 3T0VA 3MACH 3PL6D 4Z0XA 1YN6A 3WXVH 3VRIB 5J11B 3O0RH 5IBUB 4DZ8B 1U41A 1J05A 3MACL 1Y6MR 3ZKND 4HIIB 1HZHH 4HXAH 4FXKB 4GRWH 3L5HA 3FJTA 1WFOA 1EV2E 3O0RL 1UENA 2PYEA 1BZ9A 2VDLH 2J5LB 4HXAL 1HZHL 2VDRH 3I02B 4QF1B 2R4RH 2HKFH 1H3UA 1DSFH 2QEJA 1MJ7H 3C6LD 1N59A 1H3PH 2VDLL 4NPYA 1CL7H 3VRJB 3EZJB 3T1FA 5C0FB 2R4RL 2HKFL 3EYOA 1NFKA 1DSFL 1MJ7L 3RDTC 1H3PL 3Q1SH 1CL7L 4U6VH 1HKFA 3JTSB 2V7NB 3FCTA 1QPPA 3O6FB 3PWPE 1S9VA 3QDGE 3C6SA 4OLWH 3Q1SL 4X9GA 1T7ZA 4PTUB 4U6VL 1A6TA 3AXLA 2VDQH 2XYCA 2Y23A 4X6CE 4Y19B 4WI5A 3S97C 4NUGH 3J8F7 4YK4C 3SKOA 1NCBH 1AGCB 2I9TA 2VDQL 1JUFB 4P46A 4MD0B 3NN8A 3QYCA 4ODVH 2V17H 5H37H 4NUGL 32C2B 4PJCA 4R4BA 5EZOH 1NCBL 1E4XH 5EULV 1FZKB 4P4KD 1XF5B 2V17L 5EZOL 3QQ9D 1E4XL 2UVEA 3UPRB 2HT3D 2X44D 8CGTA 4MJ2A 3ZYOA 1U0QA 3MRMB 4DN4H 3IDMA 1LE9B 4GXVL 3SY0A 4JM4H 5D2LA 5H35A 2WBJD 3WN5A 4P2OC 4C55A 1JNLH 2X4NB 4JM4L 4PFEA 4KXZI 4E42B 1EZVY 4WFED 3ECBA 3BWAB 4PJ8C 1JNLL 1R5IB 4H25B 3LKSA 5C0GB 1KF9B 1JPGB 5KZCD 1WBYB 3TO4C 2XA8H 1OCWH 3GMOB 3DVIA 4LPWA 5EU3B 2X4OB 5E4IA 2ESVD 3W9DA 2X41A 3D0VA 4N8CH 5SWSB 3U36A 5EZJA 2XA8L 2ZCKH 5H2BB 1OCWL 3X13A 5K9JH 4OZHB 1MWAH 4TSAH 4N8CL 4NO5A 2X1WL 3IGAB 4PRHA 1HH6A 1MWAL 5HD8D 1QVOB 4TSAL 3DUUB 3ZKMD 5DJZA 1T1WB 3V6OE 2YD6A 1A02N 3RZCB 4EIGB 1U93B 4KJYB 2YKLH 1YEHH 3KR3H 3PQYB 1VGKA 3K8LA 4OF3A 2YKLL 4X5LA 5I8EA 5EORH 5JOFA 4P99A 1YEHL 2P5EA 3KR3L 3QUYB 4CVXB 5J13B 1I7RA 3QWQB 1WGOA 1Z6JT 1QFWH 2ARJB 3E0GA 4UQ2A 3V9FA 1T0PB 3HC4H 2HVJA 5EORL 5D1XD 3EUUA 4E41D 1QFWL 5K59F 2JJSC 2H26B 3HC4L 3UMTA 4HHAB 4NN5B 1EO7A 4WTZG 3PNWB 4N0FA 5DFVD 1KBGH 3VWJB 3HG1B 4DKAA 2FSEA 2K7QA 3BQUB 5FF6B 1Y18B 2YSSB 3QWRD 2X2YA 1KBGL 5HDQH 3SEPA 1S9WA 2W91A 4KHXH 4P2CG 4EI6A 3GRWH 3MRJB 1Q0XH 3C08H 4EEEA 5HI4C 3NFNB 4ODUB 2YPLA 4LHQB 4QXUH 4OGXL 2XNAB 5HDQL 4KHXL 3GRWL 1X5XA 4FFWD 1Q0XL 1U8KB 3C08L 3FQWA 1T2JA 3BOVA 4QXUL 5CD5C 4HZAA 1WAAF 3EO1B 5FYLH 4MX7A 3KPRE 1VEMA 2BNUB 3OTTA 5FYLL 1R5VA 4G9FD 4N8VB 2APVA 1NBYB 1B4JH 4NCC1 4NQVB 2EEBA 1PYWA 3D69A 4XVUD 4J1UB 2JK5A 2DLEA 3IJSA 1B4JL 1YN7B 4HMCA 1NBQA 2B7DT 5ICZA 1BZ7A 4X4XA 2IQ9H 5E9DD 3RGVA 3UTOA 2VZ3A 1WUNT 3GSWA 4LSUH 4ZPVB 4JN2A 1NAMH 2PXYA 2NZ9C 3U6RB 2IQ9L 1D9KD 4FFZH 1A6PA 5E5RB 1UJTA 3EDDA 3L3IA 4LSUL 2PO6C 5GGTH 1NAML 4KDTA 3QUKB 4FFZL 3WBDA 4P2RA 3IFPA 3SE3A 5GGTL 5E24E 5DD6A 1FE8H 4OLXH 4YPGB 3G6AB 1HYRC 3QFDA 3O3BA 3TH4T 3MRGB 4XXDB 4IRJB 4IIQB 1CK0H 1FE8L 4OLXL 5IMKB 3CUPB 2VQUA 1KN2H 4P5KB 1BP3B 1AR2A 3GSNH 1CK0L 3EIFA 2ZJSH 1DP0A 3RIFK 1KN2L 3I6LE 3QJHB 4LSSH 3JWOC 2AQ2A 3GSNL 3T0ED 5ABDE 3ARYA 3CFJA 1S9XB 3LQAH 4MNHA 3ULVH 2ZJSL 5HDLA 3MUGA 1TPXB 3SDXF 1U8QA 4IRZH 4LSSL 2YUXA 4K3JH 5HPMB 4PJFA 3BZFA 4IOIB 4OLEA 1F45A 3ULVL 2FDBP 4K7PY 4IRZL 3W11D 4K3JL 3IAQA 3Q5OA 1HINH 1WC7B 4HMEA 4D9LH 2ZZUT 1NEZA 2XKNA 3FB6B 1HINL 3WJJA 4TNWK 4OCWH 3LN4A 1EFXB 5CEYB 1EH9A 4D9LL 4PR5B 1Q9WB 4O4YH 2BY0A 5F9JB 3STZA 3BH8B 2VERN 2AJUH 3JXAA 4OCWL 5AUMA 4O4YL 2R2HA 1OTSD 2AJUL 5JDSA 3U46A 3SJVE 1WIUA 5DUMH 2K9UA 4Y5XB 4KKAC 5ALBH 5TDNA 5D71H 3D18B 1FFPB 4F7MA 4U1IA 4WO4A 5DUML 4IMKC 5ALBL 2WBKA 2UUDH 3DRTB 5E7BA 1LK2A 5D71L 4GH7B 1CFBA 5C6PB 2ZUTA 4XGZB 1F4AA 3MRCA 2LE9A 4KPHH 4B53A 1MY5A 2PYEE 1S7UB 1RK1B 1D5MA 4ZOBA 2AEWA 4HULB 3EYVA 4G8GA 4I2XB 4U1KB 3RBSA 3VMPA 3RX7A 1JGUL 4KPHL 4S2SA 5HHOA 1VADB 1QLFA 4BYHA 2ZNXA 2ZSWA 4F7CB 3K8KA 3IFOB 5IBLD 1QNZH 3MA7B 3HUJA 4B7IA 4XNZB 3PL6B 3D87B 1IEHA 4KGJA 3C5JA 1TJIH 4ZOCA 2VO5A 3HZVA 4RNRA 3LKRB 5DI8B 4PLJD 4WEUD 3T08A 1OQXA 1TJIL 4ONGH 5I9QB 3JWDL 5HYQB 2X1PA 4D3CH 1CZ8H 4Z7UF 1GHFH 1UB6A 3WFDH 5J1TC 2ERJC 1J7VR 2AV7A 4ONGL 4PJCE 1T1XA 4OZ4B 1CZ8L 1GHFL 3K3QA 2XI9A 3HHRB 3WFDL 1NL0H 4EDXA 2LQRA 3GMRB 3F62A 3CH8A 2CK0H 3L3KA 5F3HB 1UXSA 1NL0L 3GSRA 5E1HB 1QSFA 5HYSA 5DD0H 2CK0L 4IRSD 4OUUB 2CDGA 4LAJH 3MJ7A 3OJVC 3KLSA 5D2LE 3BVNB 5DD0L 4ZFGH 3FB5B 2AJXH 4PG9A 3SE4C 3D3VA 5C9KA 3MREB 2F58L 3MRIB 1L7TH 1RK0B 4L3CA 4ZFGL 1XR9A 2AJXL 1B2WH 1L7TL 5T1MA 3ZDYE 2P8MB 3NMEA 4FQJH 2NW2B 4IBLT 3WS3A 1B2WL 1MJJA 4XCEA 5D7SH 4DZBB 5GZOC 1CD1A 1FZMA 2QQLH 2VZTA 3MBEC 3UPCA 2DIAA 1KCVL 2X9XA 4FQJL 4UUJB 4WDIB 1CDYA 1QR4A 2N1KA 3VFTA 5D7SL 4JZJB 5IMOB 2QQLL 1K9TA 2Y36H 3QIWA 5FKPA 2DTML 2AEPH 5GXBB 3QUZA 4LSDA 5H8DA 2BC4B 1DBJH 2MQ3A 4PRHE 1CFNA 1HK6A 2Y36L 4PJ5A 2YD2A 3W2DH 4AJ0A 2AEPL 4Z7WB 1DBJL 5JW4R 3FFDA 3DROB 3IRZA 2A2QT 3W2DL 1Q9KB 1SY6H 5KZCB 3LY6A 4L4JA 5EBWA 1HILA 3TM6A 2P5EE 4ZS7H 2MQ0A 4BQBA 2BRRH 1J1XH 1SY6L 3QXVA 4HJJH 4AENA 2VRAA 4ZS7L 5FOJA 2BRRL 1MNUH 1J1XL 3IJHB 5JW4N 4HJJL 4QRPD 1S7VA 1S8DA 1M7IB 1CU4H 5I30H 1MNUL 4MS8C 1MLBB 1NCCH 2CRZA 4R7NB 5D7JC 2EZ0D 1I7ZB 1JWSB 2R1YA 5J56B 3SQOL 1S5HA 3EO0A 1CU4L 4NRYA 5I30L 1P4BH 4FQPA 5F72S 4HFWB 4NRXB 3TYFA 1NCCL 5F7EH 4N0UB 1A4JA 4LQ1A 1P4BL 1RZ8B 4PJHF 5F7EL 3BP6B 4MDJB 2YPLE 4YLQT 1MUJB 1KG0B 4YHIB 5D1XB 1XMWA 3SGJA 5B38A 3O6LH 4DVBB 4PGZA 1OAKH 2BNQD 4LEOB 2GY5A 3O3DB 1ETZB 1UM5H 4Z78B 3MROA 2EKJA 5BRZD 4IEFB 3O6LL 4OT1H 3T2PA 4XTRC 1OAKL 5JIPA 3Q6FA 2VDNH 1UM5L 3A67L 4H26A 1F2XK 2CKBL 4OT1L 2HG5B 3IDYB 4P23B 1EEZA 4YR6B 4GRWF 3VA2C 2VSCA 3DYPA 4U4BA 2H41A 2VDNL 4K71C 3GMLA 1MCIA 1T21B 4JFED 3LQMA 1YUHA 4OI7A 1WWAX 3WS6C 1T5WA 4JGJA 5EO1A 4WV1B 1RFDH 3FB7A 4CNIA 3NVQA 3HMXA 1RFDL 4WCYH 3QBTB 4MLSA 1BEYH 4O9HH 1ONQA 4TOYH 4NKDB 5EO0A 4R0LA 3U9UB 5EOCH 3B9KD 5DGRA 4DFHA 3NZ8A 2P46B 4WCYL 2IAND 1BEYL 4O9HL 2X1QA 1T4KB 4AM0A 1C5BH 4TOYL 1DQLH 1MCWW 5EOCL 3QQ3A 5DA4A 4P2RE 1E4WL 1A1MB 2AAVA 2VLJA 3H7BB 1C5BL 1NBZA 1J0YA 1DQLL 1MJ8H 1FFOA 4O51B 5GGRY 4EVNB 3JV5A 3EYFA 2DLFH 2EC9T 1QP1A 1E6JH 1MJ8L 1JF5A 1CGTA 2A0LC 1EGJA 3IVKA 2DLFL 2EDOA 2UWEB 1E6JL 3DETD 1P4LA 3DV4B 5AZEH 3UO1H 3QUYC 1NCUA 3S34H 2ATPB 1DANT 2QJDA 2CMRH 3ES6A 4EQ3A 3QI9D 4HDIA 4FQ1H 2X4UA 5AZEL 3BI9X 2H1PH 3Q0HA 3RL1B 4PJFE 3UO1L 5LGKA 4R96A 1R5WB 3S34L 2MCPH 2CMRL 4MNGA 4FQ1L 4L1HA 1L0XA 2NY1C 2H1PL 4LSQH 2VTFA 1Z5LA 2X7LA 3DLQR 4NN5C 4QWWC 2MCPL 3PWPD 3ZTNH 2AXJA 4LRNH 3QDGD 4LSQL 1ZV5A 3WUWA 5FECA 3ZTNL 4HD9A 4LRNL 1VFUA 3TIDB 3DX7B 5T1KA 3BO8B 1M7DB 3HE7D 3T0EB 3ULUH 5EOTB 1AXSA 1JN6B 1NGPH 4OF0A 4N5EC 2OTUB 3ULUL 4U7MA 1NGPL 4HJ0D 1FGVH 2VR5A 3VDCA 3ULVC 1X5AA 3OR7A 2GW5A 4DGYH 3BKYH 5DHXB 5D5MB 4LCCB 4MA8H 1O5DT 7FABH 3S36X 4U1SA 1LO5A 3THMH 1FGVL 2OCFD 1N8ZB 5ID1B 3R0NA 4RZCB 1T03H 1OTTD 4DGYL 5E00B 4ZUVB 3H9SB 5FCSH 1I4FB 3QT2A 7FABL 4MA8L 3TF7C 1BQLH 1FNGA 2XQYK 3NCYS 3E1F1 4C56A 3OXSB 1Z9SA 3THML 3MRNB 4NHCH 2GITB 2P5WB 4NUJA 1T03L 4ZFFB 4CKVX 5F44A 1BQLL 2NY6B 3BIBX 4ZTOL 1YQVH 4G8GE 1A6ZA 3BPLC 3SDYH 4NHCL 5HHOE 1FCCA 1PKOA 1VDGA 3MO1A 1LEIA 1YQVL 3SDYL 1I1RA 4AG4H 5GRVL 3HUJE 3KYOB 1N7MH 5D1ZB 1J5OH 3MSPA 3N1MC 1E27A 2VDPH 5C08A 4QY8B 4AG4L 3EOYG 3ZDZF 5DTFA 2QQNH 4ZO9A 5GS3A 1N7ML 3G5XB 4ZMAT 2VDPL 4RMVA 4Y5VA 5DD3H 1MHHA 5BMFH 5D9SB 2QQNL 3L5WB 3VI3F 3VXSA 3H3PH 4V2BA 3VXPB 1VACA 3L3GB 3ARDC 2YOCA 2F9BT 4GKSB 5DD3L 5BMFL 4QCIB 3HE6A 4YQXH 1JCKA 2FLBT 3VFPA 3AM8A 3D85A 3H3PL 3IDGB 4O5LH 4IRJC 1U8MA 4Z77A 1KFAH 3AROA 2VAAB 4HUWA 1RZFH 5C3TA 4O5LL 4LNRA 3PHOA 4Z7VF 1KFAL 3T0DA 4X6BB 1YY8A 1QSFE 5I1KL 1LD9A 1RZFL 1SYVA 1PGRB 2BSRA 1DBMH 3QXUA 5F1OB 4HSQA 1MREH 4NM4H 2RFXB 2L7JA 4IS6A 5EU5A 3V0VB 3Q2CA 1DBML 3JWDC 3D3VE 4XP9H 5BZDB 1ZLUH 2A73A 1MREL 1UCTA 1UKQA 4K3HA 4NM4L 2KH2B 4I48A 4LCWA 2AJ3A 4XP9L 1GXEA 1B0GB 1NGZA 2HVKB 3ARGD 3GI8H 1NFDB 4KKCD 2IPTH 4ZXBB 3MRPA 4ETQA 1Y0LA 1BOYA 4LOUD 2J6EH 1NFIA 3GI8L 4ORGB 4Y4HA 4EXPX 3F7YA 3OKNA 4C83A 3FB8A 2IPTL 3QRFM 43C9B 4PJDA 2J6EL 3OJMB 1JPST 3V8OA 1D6EA 1BFOA 5JXAH 5HHQA 3PHQB 2YA2A 2XT1B 4PTTB 3W0WB 4JRWA 4PJ5E 5BCAA 4X9BA 4PJGB 4BK5A 5AYUH 5I8CB 5C0AD 5JXAL 1P1ZA 1U8LA 1I85C 1XGRB 4F33B 5AYUL 3TBYB 1B90A 5TJWK 5GQBA 1KJMA 3MR9A 4JVWA 4S1SH 3IT8D 4PGCB 5IR1B 1TZIA 1SJVA 4RDQF 3VXOA 2CDEA 5HGDA 3WFBH 4J7RA 5I2IA 4GLRI 4TSCH 4S1SL 1Q8MA 2X89D 3KG5A 1HOCB 5HSFA 3RUGB 3U0PA 3WFBL 4MXQD 1P7KA 4MQTB 1JTTA 5DR5L 4FTVA 4TSCL 3AC0A 2HJKA 3B5TA 4FG6C 4YBQC 4C4KT 4APQA 3O2VH 1GZPA 4JHAH 4M4RA 3FRUB 4H8WH 2DLIA 5GHWH 5ESVB 2R69H 1FNSH 4JZOB 2GFBA 3O2VL 5DJYA 5FEBA 4JHAL 4H8WL 1UZ6E 5MEND 5GHWL 3ZKNC 2DJSA 2R69L 4XI5D 1FNSL 3QUMA 5D6CB 3UROR 5HYJB 2AJZA 4WWKD 2N4IA 5FUCE 5CFHA 1OSZA 4GRMB 1CIUA 4KTYA 3KPLB 4YAQB 4R6UA 3UPAA 3C6LC 2I27N 5IESH 1BD2B 3IU3B 3I6LD 2JELH 4JLRA 4LHUA 3PJSA 3TA3D 2A74A 5HVHB 1FO0H 2WQRA 2BSTA 3VD9A 3P77A 2JELL 4R97B 1WTGT 4G8FA 1FO0L 2VLRA 1AKJD 4I0KA 3SGKC 8FABA 4S0TD 3RPIA 2CD0A 1KTDB 2WP3T 5C0DA 1H0DB 4LSTH 2BNQB 5CJBA 5D1QD 1F13A 1EUTA 5J7CC 4G8EA 3V6FB 4LSTL 1FGNH 3DYMA 3CVHH 5AZ2H 5J6GB 4O02H 4P4KC 4X6FA 3QQNA 4PREA 2CQVA 3QQ9C 4HS8H 4TUOA 3G08B 3HNVH 4NJ9H 4Y0GA 1FGNL 5AZ2L 3CVHL 4O02L 1V3MA 2AKRB 3C5ZC 4G7VH 1HXYB 2I9LA 4HS8L 5D2NC 3HNVL 4NJ9L 4OAWB 5IB2B 3SJVD 4G7VL 4FFVD 4MNQA 3QEGH 3CK0H 2WBJC 4BZ1H 4X6EB 1XGQB 5T3XE 2PYFB 4YHNA 1W72H 3LSOA 5CGMA 2YPKB 3CK0L 4BZ1L 3L5JA 2VWEE 5FOBA 5DHVA 3VFRB 4LIQH 1W72L 3B9KB 2PYED 1JI2A 2IANB 5EFIB 2DS4A 3B4NA 2R23A 5IK3B 1RJCA 4LIQL 1GGUA 1S9YA 4PV9B 1TTUA 1P6FA 5EIIA 3FQRA 5DF0A 3BKCH 3QEQB 3WLWD 4MNGE 4BFEA 3CZJA 5DDHA 5L2KE 1XGUB 4X4ZA 3BKCL 5HD8C 1PDKA 4X7DC 5E70A 3ZKMC 5EN2A 1RJZB 1Z3GH 4KI5E 1CYGA 5B3JE 1S7SB 2W0KA 5DRNB 1WIPA 4ODBD 2EDKA 1JF1A 2OMNA 4U3XA 3OWEA 5A1AA 1Z3GL 4WU5A 2IBGA 4P46D 4X4YA 1NDGB 1BZQK 1K4CB 1RUKH 2FCBA 3QWOA 5E8OB 5DFTA 4HUUB 2ADIB 1P84K 1AP2A 3LQZB 4HZLB 4M6MH 4NSKB 1TXKA 1RUKL 3RNKA 4X8XA 2XWTB 3BAEH 1U8PB 5DSCA 1JHTA 3MNWA 5LG1A 4M6ML 3IDNB 2FJGA 3QDGB 3HPLB 5IQ9A 5DFVC 4KK5D 3BAEL 2LTQC 3RI5K 4X6CB 4C56E 3NZHH 2Z8WC 3IDYC 1UEMA 2YN5A 5C0RH 5IEKB 1IGYB 2HMID 2QBWA 3HE7B 1WEJH 3AGVA 4UBDC 3NZHL 5DEGA 4HIHB 3MZGB 1G1CA 5KSAB 5C0RL 1WEJL 3DVFA 4WV1C 4FFWC 2H2SD 4F9LA 3ULUC 5DJ0A 2VL5B 3G5ZB 3T3MF 1VKXA 3LIZH 3NPSB 5EC1B 5E6ZA 3RWFA 2ID5A 4YXKH 5EU6A 1DE4A 3F6IA 4F57H 4X5WA 4JFOB 2GJ6A 2VYRE 3VXTA 3LIZL 3PWLB 3MPCA 2ED7A 3HAEG 1NCTA 4L4TA 5C09A 4YXKL 1AY1H 4F9PC 4F57L 2BHUA 1TQBB 4LAQH 4MD4A 4PRHD 3MGOA 1AGEB 3HZYB 1ZHBB 1U3YA 2E9BA 1AY1L 5CJ8A 4XVUC 4PJBF 4LAQL 3MYJB 4NKMA 4J2XA 1BVZA 4MCZB 2RGSA 5KVEH 1IEAB 4NYLB 4PGJA 4I3RH 1RU9H 1WAAA 2P5ED 3V4UH 3WD5H 2J3SA 4YUEH 1JNHB 3MUY1 4RGNE 1E6OH 4RMUA 5KVEL 1KUMA 4I3RL 1RU9L 1D9KC 4QRTA 3WFHB 2JJVA 3V4UL 4YUEL 3WD5L 4OM1H 2OR7A 1E6OL 1HHGB 5JPNA 3CLFH 2JB5H 3DRQA 4BZ2H 5GSRA 4I3SH 4JFHE 4Z5RB 4KJWD 5MEPB 1Z0NA 1JPTH 4DKEH 3U2SA 4OM1L 1UYWH 3DURB 4OQTH 3CLFL 2JB5L 4BZ2L 1NANH 4CDHA 4I3SL 3SKNB 4LCWE 1XCQB 1TDQA 1JPTL 2UV3A 4DKEL 4GKZA 1UYWL 4OQTL 1HHIA 5DEFA 2Y9RT 1A7PH 3P9LA 4I4WA 2H2PD 3S96B 4N9OB 3UTSA 1H9VA 1KEMH 3EFFB 4M5ZH 5CJ5A 3S5LA 5JA9A 5I1CH 1NMBH 1GC1H 5TE4H 2YPLD 5HHVL 1A7PL 5MEQA 3RRQA 5C2UB 2X4PA 2AEQL 4P2OA 4XXCA 1N3NA 1KEML 4PJDE 1P7QB 5I1CL 1NMBL 1GC1L 5TE4L 4OFDA 4FQCH 1BVLA 2Z92A 2HTKD 3DTXA 4LCUA 3TO4A 2IH1A 3QPQD 2C3GA 1G9MH 1QTYT 1H15B 4FQCL 3L3JA 5CJXA 1UFUA 4ONOA 1ACZA 3ARGB 4ZNEA 2CXGA 3TIEB 3ARUA 1OT2A 1ZWIA 1G9ML 1KXQE 4G9DA 4LARH 3VXQA 2VDKH 3QULB 3TJEH 5EUKB 4I0PB 5B3NA 1TQCB 4J12A 1YECH 2YXFA 4LARL 2X42A 2VDKL 4O2EB 3TV3H 1S7RA 3TJEL 4JPIA 3V5KA 3F8UB 4L9LB 3RGVD 3SDXA 1YECL 1G7PA 3TV3L 1S7WA 5L8KB 3EOAB 4OGAD 4FTVE 2DQJH 4RA0C 4YZFF 1L0QA 3FQTA 3AY4A 2EIZA 5EOCJ 3KPRB 3MNVA 3NOIA 1U3HB 2DQJL 4KKBD 5J8OA 1NUNB 4P2RD 3PP3H 4PP2A 4ODSH 3X11A 2V9QA 3C5SB 3F12B 2JJSA 1S7QB 4RRPG 3KDMB 5FA4B 3W39A 4ODSL 3DX6A 2DM2A 4JKKA 1ORSB 4JKPL 5I1LB 3OX8B 5J3HD 3UX9B 2J4WH 1CFQB 1X5GA 2HFEA 1CDUA 4HK0B 5I75B 4HIJB 5F7LB 4FXGA 5CEZH 5KANI 1IGTA 1MIEH 4KKLD 5IBLC 2J4WL 1BBJA 3FT2B 3LHPH 3AS3A 1PEWA 4QRSB 2Q86A 1T20B 4KAQH 5CEZL 1MIEL 3F7PC 5GGSB 3LHPL 2VLRE 1I3UA 1PLGH 3BRDA 2CRYA 5FA3A 4KAQL 4Z6AT 4WWKB 4U33A 2YD9A 1PLGL 1H5BA 1T22B 1G9NH 4J3WA 1ZEAH 4M03A 4UAOC 5IB1B 2F53A 4FQLH 4QRRA 4DUVA 4NQSB 5FO7B 1G9NL 3RKDD 1ZEAL 2R9HD 1EBPA 1K2DA 1UACL 4FQLL 3GO1H 2XPGB 3QH3B 5BO1H 4HAGA 3GO1L 4HH9B 2VLKA 4IRSC 4J8RA 3T4YA 4AYFA 3FT4B 3ZT5A 5BO1L 4Z7UA 4ZOAA 1FQ9C 4GXUN 4MNQE 2EDRA 2J2ZA 3TWCH 2FHFA 4WO4D 1JZ7A 2GTWB 4G6JH 1PY4A 1RZIB 4KGLA 3E6HB 3TWCL 4DJMA 1KNOB 1B4RA 1LP9F 4ZUSB 4G6JL 1FG2A 1G7JB 1NUFA 5BZWA 4Y1AA 5JW5A 1Q94A 4ZUWB 3U82B 5FB8B 1W0WB 4G8GD 3WIHL 1I9EA 1AGDA 5A3IC 3QIUC 4RIRB 2GUOB 5HHOD 1J0JA 1A7NH 3MRRB 3OXRB 5BS0B 3WLBA 5KVGH 5CD3B 5C0EB 1A7NL 3FO2A 3IAPA 5HDBE 2BZDA 1U8NB 1YN6B 4W4OC 4P5MA 2HRPH 5KVGL 4RMWA 5L2JA 4AMKH 3PGCB 1J05B 4LLMB 1JVKA 2KL6A 2B2XH 2HRPL 5KN5B 4W4NA 4AMKL 1CTNA 2JKXA 4H1LH 1EUUA 4OM0H 1MHCA 2IH3A 2B2XL 4GRLB 3OGCA 4UOW0 2J8UF 1N59B 4PGBB 4NPYB 3RWEA 4OM0L 3C87A 1FIGH 1XIWB 1NMCC 2FJHA 4RGMC 1XFPA 4KVCH 1FN4A 1V5JA 2G5BA 4WENB 2OL3A 1DBAH 1QSFD 3BP5A 2E7LA 1S9VB 2EZ0C 3EDFA 1A6TB 3AXLB 4KVCL 5HVHC 1U3JA 1A6AB 3MFGB 4LLWA 1DBAL 1J9CT 5K93A 1YPZB 2F5AH 4PRAA 3D3VD 4OZFG 3B83A 4PJ7E 2BXZA 4P46B 2FLRT 3NN8B 2F5AL 4PJCB 1BOGB 4NHUA 4EUPA 3HMWH 1PJ9A 3IXTA 2DQFA 3OKEA 3QDJA 1F90H 5CP3H 1BM3H 5EBGA 5CSZB 4M61A 1IVLA 4NRZA 4LPTA 3HMWL 3BKJH 2ADJA 4YHZH 1F90L 1BM3L 4OD3H 4QHLA 1T89A 5EU6E 5HVGB 3H7LA 1XH3A 4PV8A 3BKJL 4YHZL 3IDMB 4PGEA 1NC4A 3QIWD 4RAVA 3SY0B 5I1JH 4L4TE 4OD3L 3QUZD 2IG2H 5C09E 5D2LB 1FCGA 3WN5B 1A14H 2VDOL 3GJFA 4PJ5D 5I1JL 4L8SA 2IG2L 2XZCH 1UKSA 3ECBB 3LKSB 4BKLA 1CDCA 2XZCL 5EUOF 2XN9A 2HJFB 43CAA 1WAAE 1AD0B 3FRPA 1VFOA 1QRNA 4YXHH 2DWEA 3W9DB 3D0VB 4OI8A 5EZJB 1XGTB 1JPSH 1KTRL 2GK2A 2AERT 4ZSOB 3B9KC 4YXHL 2IALB 2QSTA 3CFDA 1JPSL 2UZYB 4HIEA 4PRHB 5EBLA 1HH6B 4RAUA 3BJ91 5DJDA 3HRZA 1G7MA 5JIKA 4ZG1A 4OCRH 3RP1A 2FATL 5B39B 4WFGE 4Q7DA 4W68A 1VGKB 4HLZH 4OCRL 1T6VN 1WF5A 4CRPA 5JOFB 3CSYA 4OCYH 3ROOA 1I7RB 3UTSE 4HLJA 5D7LE 2ZUWA 3OPZH 4XP4H 2HVJB 2PTTA 3DETC 4OCYL 5DYOA 3PWNA 4M93C 5HI3D 2WINB 2V9TA 1NUGA 3OPZL 2XWJA 3ZO0A 4XB7A 4XP4L 3TNNA 4RMQA 1FVDA 1WZMA 3QI9C 3VFOA 3D48R 4YE4H 4YDKH 1M6OA 2HJLB 5E8NA 2APWA 1B0WA 1HH9A 2ZNWA 4MB4A 2BX5A 1GYAA 4ZNEE 4YE4L 3ZTJH 4YDKL 1S9WB 3HB3D 4EI6B 3MXWH 4P3DA 3BPOB 1RJLA 1ZT4A 3SQBA 2ZWLT 2BVOA 1IAIH 4KRPD 1A7OH 3MXWL 1I7TB 3SDXE 2ZSVA 1IAIL 3X3FH 1A7OL 3OAZK 1WCQA 4XNUH 3X3FL 4I8DA 3G04A 4HJ0C 4U1HA 3W5MA 2VH5H 1J0KA 3TCLB 2PCPB 1BVKA 1DQQB 1ND0A 3ABZA 5TH2A 4RRPA 3CD4A 1M4KA 4XNUL 1QBBA 2VH5L 5D7KD 2VLJD 3D69B 5T33H 4ONFH 5IW1A 3CIQA 3IJSB 2ZUXA 3ZE0E 1TQBC 3QXAA 5T33L 4ONFL 1BZ7B 4W6WB 4X4XB 5T3XD 4M5YH 3GSWB 3O3UN 3LV3B 4JRYE 2PXYB 3P0GB 4M5YL 2D3VA 2A6KA 3UP1A 3L3IB 4UTBH 1JYWA 4PLOB 4F2MB 1HXMA 1CGSH 1FYTB 4W70A 4P57B 3UXFA 4ZTPH 2DM4A 4UTBL 3VH8G 1JE6A 3BFOA 4MQ7A 5DD6B 5FHAL 1CF8H 1CGSL 3R06A 4XAWH 4ZTPL 5F7FA 3O3BB 3WHXB 4GG8B 3ROLA 3LEVH 3OZ9H 1CF8L 4XAWL 2F53E 2EIDA 3V6OC 3PV6A 4KI5D 4Q0XH 3LEVL 3OZ9L 4MJ4A 1FV1A 1QSEA 2HLFD 4JRXA 2EXYD 3PIQA 4WI2A 4PYHA 2NMSA 5T1KD 4Q0XL 3CFJB 4MNHB 5ESQB 2GJZA 3P0YH 1U8QB 3MFFB 4MCYA 5IKCA 3BZFB 2VLKE 3GRWA 1IT9H 3IXAA 3MV9A 3P0YL 4Z7UE 3ARXA 1IT9L 5HGBB 1R3KA 2OTWB 1J87A 1GAFH 1CDJA 3BHBA 3ZKXC 4ODXA 1NEZB 4G80A 3KPSA 3NABH 1MFNA 1JTPA 4C56D 4R3SA 1GAFL 3ARGC 1D6VH 3HZMA 1R0AH 1ZHKB 4KKCC 3NABL 4Y1AE 3ETBF 3STZB 3L5XH 3MLXH 1CDGA 3I50L 4LLVB 4LOUC 1D6VL 1R0AL 2OBGA 4CN6A 2R2HB 3RWIB 2UY6A 2G75A 3NFPA 4NBZB 3L5XL 3SDAA 2GK0A 3RVTD 3MLXL 3RJQB 4L9LC 3OKLA 4ZAKA 1MHPH 5C0JB 1R3JA 5C08D 5TFSH 3TFKD 1ZSDA 3QDAA 1LK2B 1MHPL 1UH2A 1NAMA 5TFSL 2MOVA 5DVOA 1LDSA 3MRCB 4X7CC 3VXSD 4LU5H 5DURD 5GGTA 4JJHA 4G8GB 1UZ8B 3HE6D 1F6AB 3RU8H 4LU5L 3D85D 1QLFB 4NO3B 3O4LA 3OAYH 4D0CB 3GJFK 3UTTB 1LMKA 1ZMYA 4JHWH 3PGDB 5D96B 3KNBB 3RU8L 3RWDA 1MAKA 4MXQC 4RGND 4GBXB 3FO0L 4JHWL 4N90E 1LEGB 1E28B 3GEWB 3HZVB 3GSNA 4BSVA 2FJFB 3DX9A 2Y06H 1LDPH 2NX5E 4HKJA 4X0KB 3MRBA 3VXRA 4JFHD 4WNQA 4WW2C 1PKQA 3BEWA 2Y06L 2AV7B 3GSVA 1T1XB 5K9OA 4LCWD 4KMTH 1HQ4B 1PG7X 4KKNA 3QDJE 2E7HA 1NKOA 1QD0A 1A5FH 3TYGH 4EDXB 3DO7A 2FECL 1YY9D 3GSQB 2CUIA 4KMTL 5BV7B 2NY4D 2X9WA 3L3KB 4WWID 1UXSB 5KS9E 3KGRA 4OF8A 1A5FL 4Y4HD 3TYGL 3MRDA 1QSFB 5F88A 5ADPH 4RBPH 2N56A 3ZDXE 3DIFA 3B5HA 3TA3C 5DMJB 3MNZB 1WBXA 1RJYA 5ADPL 4HUVA 2E9JA 1ZVSA 2LFGA 3D3VB 4WY7H 5EB9A 4BSWB 3TZVA 1G0DA 2W59A 4CMHC 2A6IA 3S3SA 2YBRB 1AFVH 1UEYA 3CPLA 3MQIA 4NKOA 3UAJD 4MQSB 4L3CB 2E7BA 4AEHH 4MA3B 4WY7L 1Z0MA 5T1MB 1AFVL 3SDDC 1KJVA 3WS3B 4AEHL 5JW4M 4XCEB 5D1QC 4S1QH 1FZMB 2P24A 4U6YA 3ZHDA 5IGXH 3L9RB 5JO5B 3VFTB 4S1QL 3ARDA 3M17A 3O11A 4GRWE 5FKPB 1NQBA 1BBDH 3QUZB 4HKBA 4K2UH 5LJYH 5IGXL 1MELA 4PRDB 2AV1B 1CFNB 2DB8A 5FFLA 4XCCH 4FTVD 4PJ5B 1BBDL 5F9WC 4K2UL 1IL1A 4APQD 2OJEA 5LBSH 5GJTH 4XCCL 3U1SH 4FFVC 4KRNA 4HS6B 1RIHH 3N1FC 3R4DA 5JOEA 5HHNA 5LBSL 5GJTL 5I1DB 3U1SL 3FQXA 2Q76B 4NWTH 5LAXB 4V1DA 4ONHA 3NFSH 4HWEH 1RIHL 1VEOA 4M8QB 4PJ9A 4AENB 1A7BA 3VD3A 4MQXD 3T0WA 3EAKA 3TH2T 3MRLA 3NFSL 4HWEL 1GGCH 1BQHG 5DD5H 5ILTH 4PJEE 1X5ZA 2E7MA 5AYQA 4NC2B 5DD5L 2R1YB 2A77H 3LS5H 4LHUD 4LPUA 5ILTL 1S5HB 3S8WA 1CLYL 3S98A 3ALWA 4M3JA 5K9KB 5GS0D 4Q6YA 3LS5L 2A77L 2D7PA 2VLRD 1NDMB 1U8IB 3RWGA 1SBSH 3MOQA 4OIAA 6CGTA 3V79C 1AD9B 3DVGA 2FO4A 1V3KA 1TTGA 1MFDH 4B0MM 1QUNA 4WUUA 1SBSL 1JZ6A 4P46C 3BESR 3OB8A 4YFDB 3MROB 3VFSA 1MFDL 2A6DA 3DARA 4WEBH 3PWVA 2PNDA 3LVEA 1WZKA 3S4SG 2Z93A 4H26B 4PIRF 5E94B 2W9EH 4WEBL 2W0LA 4ODTH 2ZUQB 3GMLB 5T3ZH 3SBWA 2W9EL 4KK5C 1PFCA 1YUHB 1CWVA 4ODTL 4FN0A 1T5WB 3ARBA 1L0YA 4QHUB 5EO1B 5T3ZL 4MNQD 4JO1L 2HMIC 3I75A 1K3IA 3VD4A 1X5FA 3FB7B 4CNIB 1MQKH 3KJ4C 2CO7B 5DUBB 3RL2A 4RQQB 5EO0B 4R0LB 2H2SC 1G7QA 3KYNA 2VR9A 4QHMA 2BNRA 1SY6A 3G9AB 3ILQD 3WDJA 2FIRT 3QQ3B 4JHZA 1LK3H 1OHQA 3N0PB 5HHXH 2NTSP 1E0OB 2Z4QA 3KPQB 3KPOA 2HT2C 3DPBA 1FFOB 5MI0C 1CLOH 3EYFB 1LK3L 4LVEA 3OJ2C 5HHXL 4JREB 1BJ1J 1OWWA 4OFKA 4DEPC 4KUCF 5DEZA 1CLOL 1C8PA 1QSEE 4JRXE 1P4LB 2O5XH 3C8KA 1AHWC 1F97A 2NY0B 2DWDA 5INCA 2CRIA 1I9JH 1JPFA 2RAMA 4YFLF 3AREA 3ES6B 3ZDZE 2O5XL 5FYJH 4HDIB 2X4UB 2CKNA 1F3DH 4U1JB 3QHZH 4R96B 1A47A 4QXTB 1CVSC 3MV9E 4MNGB 5FYJL 4YDLB 3ZE2F 5L2KB 3VI3E 1IAOB 3QHZL 3I6KA 4KJWC 1L9NA 4LVNB 4PJBA 2Y6SD 4U3HA 1AGFB 4PPTA 1F6FB 3WUWB 3SKMB 2PW1B 5FYLE 5FECB 5IMLB 3DSNA 1MCKA 3C5ZA 3VWKC 3O8XA 1Q9LB 1TNNA 2FBJH 1O0VA 1EEYB 3P9MA 1X44A 3LN5A 2KQMA 3MXVH 4NNPH 5DJCA 2FBJL 3FO9A 5DUPH 2OI9C 4GW1A 4Y4FA 3MXVL 4NNPL 2GT9B 2L4OA 3OR7B 3D2UB 5HGAB 5DUPL 2HTKC 5EU6D 1OPGH 3QPQC 2GJ6D 1BIIB 1LO3H 2PW2A 4U7SA 5GPRA 2W65A 4L4TD 5C09D 4C56B 5F7UA 4JM2B 1JZ4A 3TT1H 1OPGL 5CGTA 1MAMH 1GZQA 4QLRA 1LO3L 1BJ8A 2O5ZH 4XNMB 4UZGA 4B41A 2I07A 5IVZA 3LRGA 5A2KH 3TT1L 2VXSH 4QHKJ 1MAML 1QHOA 5E6IA 4FQXA 3MO1B 3O4LE 1LEIB 2VXSL 5I17A 3RGVC 3C2SA 5DC9B 1WFNA 1KULA 3EGSA 3F7VA 5DTFB 3B6SB 4JVPA 2FYYA 1ZA6B 2P8LA 1PD6A 4R7DB 1MHHB 4KKBC 3VXRE 3I85A 4I5BA 4WIQA 4AEFA 4Y88A 4JY6B 5J06A 1VACB 1PKQE 2BVUA 3SE9H 3ULVE 2R0LH 4YDIH 4XCNA 2YD4A 3VFPB 3IFLH 4WFGD 5F7NC 5DZLA 2OQJA 3SE9L 2Z8SA 1U8MB 4Z77B 4JG1H 2R0LL 4YDIL 3GHEH 4M3KB 3IFLL 4TVPH 1NGQH 3UTSD 4LNRB 4RGNB 1JZ2A 4JG1L 4XMPH 1JL8A 4M7LT 3GHEL 1SYVB 4P2OD 5HHME 2BSRB 4XPTH 1A21A 1NGQL 5K9QI 2YUWA 4RA3A 4IS6B 5EU5B 4EIZC 3OG6B 4XPTL 2BMKA 4JY5H 1LILA 2P45B 2DM3A 1OAQH 2O93L 2F8XC 3TO4D 4LKXA 3BH9A 4OZGB 2XTJC 4LCWB 5FUZH 1KOAA 4JY5L 2EDQA 1OAQL 4YC2B 1A3QA 2CLVA 4HK3J 4OKDA 4O58H 4X8JA 1FFNA 5GSVB 1T1ZB 5E56A 5FUZL 1VCAA 2C1PB 2NY4B 2ICWA 1EXUA 5JR1H 4X83A 2B5IB 2QHLA 3MRPB 3VE0A 4ETQB 1Y0LB 5C71A 2WWKT 1NFIB 4LK4A 4O58L 3WJJC 3F7YB 4F9PA 3RKDC 2D4FA 4L4VA 2R9HC 5BOPA 5JR1L 4ZUUA 2R56H 1FAKT 4PJDB 1BFOB 1I8IA 5HHQB 4LKCA 2R56L 4QTIH 1KV3A 5CBAA 5KSBE 1X6LA 1F3JA 4QTIL 1P1ZB 4OLUH 4YXLH 1VFAA 3K8MA 5C6TH 4F7TA 4F3FA 4WO4C 2MMXA 1KJMB 4OLUL 4V1DE 3GMNA 3CX5K 3LD8B 4YXLL 5C6TL 2IADB 1TZIB 3RBGA 1R3LA 2CDEB 5HGDB 1QOKA 3VXOB 5IHBA 3BE1H 3WL9A 4L29A 5B8CA 5IOPA 3U0PB 1P7KB 1I9RH 1TTFA 4OUOA 1A4KA 4FTVB 3BE1L 2HJKB 3HC0B 1EO5A 3T77B 4Y89A 3RPKA 4YEFA 1I1AB 5DMGC 1I9RL 5HI4D 4YH6A 3OL2A 3F5WA 3T09A 3O2DH 2GFBB 5DJYB 2QLVB 1PY9A 1LP9A 1JRHH 3UTQA 3O2DL 3QUMB 4Z7NE 4YHMH 5B4MD 2AJZB 4FQHA 3B3IA 4WEMB 1XT5A 3VFGH 1T1YA 1JRHL 4WUUE 2F53D 2FD6H 4YHML 5IV2A 3CCHA 4NN6C 4QRRD 1KPRA 1MCFA 4O2FA 3VFGL 2BVQA 2AJYH 5DT1H 2W07A 3K74B 4P3WA 2FD6L 3BN9D 3RTQB 3PJSB 1QKZH 2N7AA 2AJYL 4MA1B 5DT1L 3BMVA 1WFUA 1ZHNA 3P77B 1KGCE 4G8FB 4OFIA 4UV4H 5H94B 4DK3A 1QKZL 3BDXA 2VLRB 1IAKA 2VLKD 3BZ4A 4YDVA 2J6EA 3S88H 3RPIB 5E4EC 3EOBA 4LLQA 4Z7WF 4WVRA 3C8HA 2NZ9D 3S88L 2J8UA 4UT7H 2IFFH 1I8LA 4G8EB 1CL7I 1X7QA 5JPMA 3QNXB 4UT7L 4X7TA 2DICA 1INQA 2IFFL 4Y1AD 4JE4B 4PREB 4HKZA 4TUOB 1P5UA 5F89B 3RVUD 2BNRE 2RCSH 3SCMA 3FONA 3CVIH 1UH4A 3FAWA 3T2NH 1I3VA 5IB5B 2DLGA 2B4CH 2RCSL 2HFTA 3QIWC 1I1YA 2MCG1 4LF3A 3CVIL 2IPKA 3T2NL 2CDFA 5GRXG 1G7LA 2P4AB 2B4CL 4MXVF 4AEIH 5DK0A 3SGDH 4YHNB 3LSOB 1Q9OA 4PRPA 3MV8A 5HVFB 4TPRH 2CJUH 2AXGA 1QRKA 4LMQE 4AEIL 2YHGA 5GRYA 4CVWA 4CU6A 4OCXH 3T3ME 3O3AA 5E8PA 1MHEA 4AQ1B 4TPRL 1OQOA 2CJUL 3C60A 3M1BB 3ESVF 4JDZB 4P3CH 3ARSA 4OCXL 1S9YB 1KJ2H 4ESKA 5EIIB 3QCVH 3TVMA 1EVTC 3ZT6A 1PVHA 2BOBA 5HHPA 4P3CL 5DDHB 1KJ2L 3QQ4A 3QCVL 2YD3A 4KDWA 2ARWA 4DCQA 4PJBE 4N90D 5EN2B 1DUYB 1A1OA 2BK8A 1CFTA 2MPAH 4N5UA 3BSZH 3O41B 4F7PA 5EUOA 1CGVA 4M4PA 3TBSB 1BREA 4OIIH 3PWJA 3E2HC 5C6WH 1D5XB 2MPAL 1V7NH 5D2NE 1FO0A 2DIBA 3BSZL 4M1CD 3OR6A 4X4YB 2LU4A 4OIIL 2VDMH 3QWOB 3MRKA 3VXUA 3QDJD 1V7NL 2CLZA 3RA7H 1RV6X 1VFMA 5FUCC 3SGJC 1KPUA 5HI3C 5FYKH 2VDML 1YMHA 3RNKB 1CLZL 3RA7L 2ZOKA 5DSCB 4ZFZB 1JHTB 3A6OA 3MNWB 4KK8D 4OLYH 1R6VA 5FYKL 2FJGB 2Y5EA 5IQ9B 4YGVA 1NC4D 2FEEI 4M62H 4OLYL 3PDOA 3QIUA 2AK4A 4R4FH 4YO0A 3AAZA 5ENWA 3CVHA 5F6HI 2BDNH 2ZUQC 3MCG1 1RVFH 3L95A 3B9DA 3ARZA 3HB3C 4M62L 4PJ7B 1Z2KA 5A2FA 1AE6H 5DEGB 1QFWI 4R4FL 2VISA 5I73C 2VZ1A 2BDNL 5JUEH 1PZUB 5E6YA 1BF8A 1RVFL 4KRPC 3JV6A 3OKKB 1AE6L 1U9KA 2XN9D 5DHVH 5DJ0B 4O2CA 2UWEF 1SJHA 5JUEL 2X6MA 1VKXB 1QRND 2Q8AH 1DN2A 2H32B 3RWFB 5EU6B 1DL7H 2EIBA 4X5WB 1FL6B 4R0LC 1W72A 3OAUH 1WSST 2Q8AL 1ED3A 4L4TB 3BWUC 1M05A 4U6XA 3JTTA 1DL7L 1UGNA 4MD4B 1S7XA 3WDIA 5J6HA 5KSUA 1YNTB 4HUNB 4E41E 3RDTB 4JQIH 3KYAA 2WLYA 5IB4A 1MEXH 4G42A 5C0IA 5KG9A 1JGDA 4CADA 2XKSA 4JQIL 4M7KH 2VKXA 5T1LA 3FT3A 3U79A 1MEXL 2DM7A 2Y25A 4YK4B 2VWEC 2VKWA 3WKMH 4QRTB 1AGBB 1S7TB 1PEZA 5JPNB 1R3HA 1QFWM 1SYSA 5GSRB 4PLKD 3WKML 5FDYA 4IJ3C 5JNYA 4K94H 3KVQA 3ULUE 4OFPA 4GMTH 5D5MF 5FM5O 4Q6IC 1RURH 3W81A 5GZOD 2P49B 5T5NF 4K94L 4UT6H 1HHIB 2NYYD 5DEFB 4I4WB 4EN3A 1RURL 4K9EL 3UTSB 4BFGA 5SWZA 1KTLA 4UT6L 5D7LB 2IAMA 3EOTH 3PUCA 4EI5A 3VFMA 4L4VE 5CUSL 4P2OB 1JNJA 1N3NB 2V2XA 4ELKA 3EYSH 3EOTL 5TE7L 3KLAA 1BVLB 4PJ8B 4ZQKA 2Z92B 2QSCH 3EYSL 1EEUA 4CU7A 1HQRA 3TO4B 5J1AA 3TN0A 1DUZB 3M45A 1W0VB 1ZLUK 1RZ7H 2CRMA 4K7FA 1UB5A 2PKDA 4G9DB 3VXQB 2PN5A 2CR3A 2NNAA 4Z9KB 1M71B 4J3UA 3WKNA 1RZ7L 3MCLH 4PBXA 1MSPA 5JORA 3L3HA 1IILE 5FIEA 1S7RB 4JPIB 3V5KB 3KPTA 2ITCB 3MCLL 3UCRA 1WJ3A 2YPVH 1G7PB 3GM0A 1S7WB 3QEUA 4ZDHA 3FQTB 4NJAH 4JFYA 3RVTC 2YPVL 3MNVB 4NQXA 1AIFA 1CQKA 1U58A 1FNLA 4KMLB 4NJAL 4Y4KA 2K3TA 2R2EA 4KU1A 1T7YA 3D25B 3X11B 4S0SD 1CR9H 5CZXD 5ID0B 1MLCA 1LP9E 2GTZA 2D7NA 5HGHA 4S1RH 4Y5VC 4X7SH 1NH6A 3W39B 5GIRA 1NLBH 2D0HA 3BIKB 5ICYA 1CR9L 1ZVYA 3DX6B 3BZEB 3MLTA 4LBEB 1JWUB 4Y2DA 5DJ6B 4S1RL 5SV4A 4X7SL 1NLBL 4PJAB 1NFDF 4KVNH 2PTUA 3HE6C 2HFEB 5I16A 1QSED 4JRYB 4JRXD 4QGYA 4OQTA 4BH8A 4ZS6D 1BBJB 4KVNL 1T3FA 5B22A 4GXUM 3QZWG 2G2RA 2Q86B 2FZ3A 4RGNC 4NO0B 3GMPA 4Y7MA 3V4VL 5FA3B 4XVSH 3MV9D 3QXDA 1MRCH 3MLYH 4M7ZC 2X4SA 1A64A 4YHKH 2WUCH 1BFVH 4ZYKA 1XF2B 1J10A 4XVSL 2J8UE 3P4MB 1MRCL 3MLYL 2F53B 4Q58C 4U6HB 3UZVB 4YHKL 2WUCL 1BFVL 3KPSD 4NKIH 1BHGA 4JKWA 2Z31A 3I3EA 5FYLD 1OGAA 5SX5K 4XZUA 3CXHJ 3QEHB 3QDMA 2OSLA 4NKIL 2NW3A 1YY9C 4NBYB 1ZT7A 1CBVH 4ENED 2NR6D 4FRWA 4Y4HC 1TETH 2FR4B 2VLKB 3SDAD 3T4YB 1CBVL 3RUGF 4UI2A 1RZGA 2I24N 3WNMA 5ITFA 1Y6NR 5DQ9A 1TETL 4ZAKD 3CX2A 1TVHB 5C0CA 1IGJA 3O45A 5JW3H 4MJ5A 2PO6B 3UAJC 4PRPE 3MV8E 1QZ1A 4XBGA 2NLJA 5ISZA 1SMOA 5JW3L 1TZHA 1QPXA 1FG2B 3UBXI 1AO7A 4KUZH 4C4KO 1ZS8A 1IC7H 4TYUA 4P4RB 4NQCA 4UNUA 3D39A 2NY1D 4KUZL 5J0BA 1N6VA 3O4LD 1IC7L 3LEXB 1C7TA 4WHYH 3WLBB 5FK9A 2BVPA 4Z76B 3L7EA 3FO2B 4XWGH 4KV5F 3LN9A 3VRIA 3LS4H 4MD5B 5ANMA 4XWGL 4MVBD 5D7IB 4APQC 4HIIA 3T0AA 4FXKA 5EUOE 1MFAH 3LPFA 3VXRD 4N5ED 3N06B 2DI8A 3LS4L 1MHCB 2X10A 4DVRH 1MFAL 3I02A 2V6HA 3OAZH 3ULVD 1A8JH 3OGCB 1A9EA 1HIMH 1TMCB 5KAQG 5MEOB 3VXUE 3RWEB 1J8HA 5L0QC 3VRJA 4DVRL 4MQXC 1NCDH 5C0FA 2EDJA 4N0YH 3CJJA 3GJEA 2WP3O 3DYOA 4NZDA 4UNVA 1NCDL 3FQUA 3JTSA 2V7NA 5LXGH 4N0YL 3BP5B 3O6FA 5HHMD 1IZKA 2EYSB 5DRWA 1OWRM 4HUKB 2NX5B 2GHWB 5LXGL 3TBWA 2AK4E 2NY2D 3TGXA 4PRAB 4KQ3H 3RJDA 3S35X 3TZVD 1AGCA 3GZKA 1JUFA 3VW3H 4MD0A 4KQ3L 5IT2H 3IXTB 2DQFB 3OKEB 3QDJB 4YHLH 3VW3L 4M61B 4NRZB 5IT2L 3HI5H 3ZYZA 2ADJB 5KS9B 3UJTH 1WLHA 3S3PA 4YHLL 3HAEB 4LMQI 4QHLB 3OQ3B 4NNYA 3HI5L 5E2VH 3UJTL 4PGEB 3ARDD 1EA9C 4RAVB 1CGXA 3U4AA 4LIQE 3BT2H 3K4AA 3R8QA 5E2VL 4L8SB 5F8RC 2JB6A 3BT2L 1K5NA 4E42A 3GMQB 4ZUTA 1CVRA 4BKLB 5C0GA 1JPGA 1CLCA 1BQSA 4WI9A 5IFJB 5C92A 4V1DD 4K07A 4PJ9D 4N0CD 2E5EA 4IM8A 2NY5H 3Q5YA 4JPVH 5FGCE 2ERJB 3D6GA 1DDHA 4GRWB 2NY5L 4HIEB 5EBLB 4Z18A 4JPVL 4RAUB 4H1LA 4LQFH 5DJDB 1FVEB 1G7MB 1QVOA 3VD7A 3WFCH 3ARWA 4HWBH 1U93A 1JYVA 3DV6A 4LQFL 5JQ6H 3CFKA 3RWCB 1NGXA 3PQYA 3WFCL 4G6MH 4HWBL 4X6CF 3ROOB 2DQDH 5JQ6L 4CVXA 5SWZE 1CDBA 2ARJA 4G6ML 3ET9F 2PTTB 5DYOB 2DQDL 2XXCB 3PWNB 3BD4A 5L8LB 4WUUD 3CDYA 3WXWH 1KEGH 2XWJB 1HE7A 3TNNB 4IOSD 1ZA3A 2H26A 1FVDB 4PJEB 3VFOB 1UT9A 2R1WB 3WXWL 5CAYB 5D72H 4NOBA 3SDDA 1A6VH 2BJMH 4G6FD 1CXIA 2W9DH 4RCAA 3HG1A 5DVMA 1N2RA 3BQUA 5E8NB 5FF6A 4YHPB 5D72L 5HYEA 5CP3A 1KGCD 1A6VL 2W9DL 4HWUA 4RAHA 3UTZA 2Y6SC 1NEZG 4GAYB 5CSGA 4K9EC 1SJEB 1K8DA 1ZT4B 3ARBD 3NFNA 4ODUA 2BVOB 1IGFH 2DTSA 2APXA 2XNAA 5LQBH 3BP7A 4FG6D 4LVHC 3GHBH 3MODH 1CGYA 1IGFL 1IC5H 4U3CA 4ELMF 1U8OA 2P8PA 5AAMA 3GHBL 2ZOLB 3MODL 4F9LC 2O26U 3G04B 3MLSH 1IC5L 4U1HB 2ATKA 4R4ND 3C8DA 5C8JA 2F15A 4K8RH 1ND0B 2HN7B 5I66A 3WXVL 2BNRD 1N4XH 5TH2B 1CXKA 3MLSL 4EBQH 1TVBA 1NBYA 5BW7C 2DQEH 3IETA 4N9GA 4NQVA 1YEFH 4K8RL 3SKUD 4ZD3H 1N4XL 3QO1B 5IW1B 4D2NA 4EBQL 2DQEL 1YEDA 3QXAB 1MWAB 2VDRL 3LOWA 1YEFL 4ZD3L 5EPMB 5D7JB 4M9OA 1WZ1H 1U2HA 4E9LA 4ZPVA 3QZWA 3GSOA 2GAZA 3H8NA 1WZ1L 3U4BH 3U6RA 5EOQH 2ICWI 1SMAA 5CEXA 3NAAH 3ARED 3U4BL 3PXHA 3RHWF 2DQHH 2EICA 2AQ3A 4OLWL 1X5KA 5EOQL 4GT7A 3SO5A 1BFTA 3QUXC 1TNMA 1YJDC 4YPGA 2DQHL 3G6AA 3PP3K 3ROLB 4XXDA 3H9ZA 5IW6B 4ODVL 4U2YA 4XNQB 2R0KH 4P5KA 5FKAA 1L6ZA 4GUPA 1JGLH 1QSEB 1OGAE 3DVNB 4JRXB 5CIPH 3PIQB 3VG9B 3C5ZD 4K71B 2ICEA 3O8XD 5C1MB 2R0KL 4RFNB 1JGLL 2XQYG 5E0QA 2GJZB 3ZT7A 5HYSG 4MCYB 1VA9A 5E2WH 5HBBA 4DN4L 5IKCB 3DO3A 3IXAB 4XXCC 4R90H 4LP4A 5JTWA 3MV9B 2C1OB 4Y4FD 2GIYA 1FAIH 4ODWB 5EC2B 5E2WL 5BV7H 4P48A 4R90L 1R3KB 3EJYD 5C0CE 1DBKH 3LKOA 4LLUA 1FAIL 3LEYH 4JAMA 4ODXB 4G80B 5BV7L 3WIIH 1FORH 5DVKA 5F7DB 1K85A 5FO9B 5CJXC 5ISZE 1DN0A 2YMXH 4NOFA 4R3SB 5KANG 4AT6A 2HH0H 3LEYL 1MQ8A 3WIIL 1FORL 2R1XA 1Q9WA 3RY6A 4PD4K 2VL4A 4NQCE 5TF0A 2O61B 2HH0L 3BDYH 5C0ND 3D39E 3EKCA 5E6ID 2ZCKL 4FQXD 4IMLB 4A2LA 3V5HA 4YHYC 2G75B 5K9JL 2GK0B 5DC0A 3I2CH 2DBJA 1SVCP 3BDYL 2XTLA 1UVQA 2Z91A 1R3JB 3N1PC 3I2CL 3VCLA 1PQZA 1ZSDB 1AHWA 1P7HL 3AY4C 5ANME 4NT6A 3VXMB 2FEEL 2VR4A 1HNFA 1F8TH 5CEZE 5JLZA 2M1KA 4XGZA 2IBZX 4WHCA 1ITBB 5F96H 5IHZB 1HI6B 1RK1A 35C8H 1YEEH 2GI7A 1F8TL 3FFCA 4BZYA 2NY1B 4HC1H 4I2XA 4U1KA 2QSQA 5F96L 3O4LB 1J8HE 1VADA 35C8L 1YEEL 5BVPH 3IFOA 4HC1L 4X5XA 3MA7A 5GS1C 3RWDB 2NQCA 3VWKA 4LL9A 3P40A 1CN4A 3B9EA 3HLAA 3GSNB 4UBDD 4BSVB 5I6XB 4O00A 4OZFB 3LKRA 1KIQB 4HKJB 1OAXH 4HJGA 3VXRB 1P69B 3O6KH 3ARVA 1UA6H 4CN1A 3ULUD 1DR9A 1DEDA 1OAXL 4D0DB 3RVWD 3SPVA 5K9OB 5J9PA 3O6KL 5E2TH 4OZ4A 5B4MC 5A43C 3BUYA 1UA6L 3CH1B 4PP1D 5B38G 1F4HA 2Q87A 2D9QB 1H5BC 1OY3B 4U31A 1WFTA 4U6TA 3GMRA 4P2YA 5E2TL 5T5FH 3RFZC 1U95A 5C0AE 2EH7H 1JGEA 1F4XH 3EYQC 2CIIB 4JCLA 5F88B 4L4VD 3OB0H 1W8NA 5HHMB 5T5FL 1UJ3A 4JB9H 3BN9C 3LPGA 3S35H 2EH7L 3PDGA 1F4XL 4NO2B 4OZIF 3BPLB 3H3BC 1WBXB 4RMSA 2NY7H 4L8BB 1RJYB 3MUZ1 4HUVB 2NY2B 3CFCH 4JB9L 1ZVSB 3S35L 3ZSTA 3BVNA 3FB5A 3MREA 2NY7L 3CPLB 1RK0A 3BX7C 3CFCL 4P2QA 5F1IB 5DZOA 4MYWB 3UJJH 4TUJB 2P8MA 1KJVB 1PX4A 5FM8A 1U91A 4CN4A 4DZBA 4U6YB 3UJJL 3MRFA 1GL4B 3CC5A 2NXYD 4UUJA 2BY2A 2GCYB 3O11B 3M17B 3ARDB 5GGRA 1HKLH 4JZJA 5MENE 4HKBB 3RVUC 4MB5A 2BC4A 4NZRH 3AS0A 4PRBB 5HJ3A 5DK2A 5KSBB 1HKLL 5IHLB 1RUQH 2VAJA 2H6PA 2YA1A 4NZRL 2OJEB 5KJRH 4WTXA 2PTVA 5F9AC 4YBHA 2DYPB 3CZFA 1ERNA 1YPZF 4XNXH 4JY4B 4UOW1 2OZ4H 1VFBB 1MFBH 1RI8A 3MCKA 2E8YA 4ERSH 3FOMB 3LQAL 4XNXL 2OZ4L 3IJHA 3K80A 1MFBL 1F5WA 4Y16C 1KB5H 4UB0H 1MCBA 5CGYD 3D0LB 3AMLA 4MMXC 4ERSL 5EIQA 1KYOJ 1MLBA 3X17A 3O81A 1KB5L 3RY4A 3HG1E 4UB0L 4WU7A 5FUOH 4HFWA 1T66D 3NCJH 3AU1A 1JV5A 2E7LC 1C5DB 5FUOL 3LKQA 1XZ0A 3RWGB 3WUWG 2X40A 4WJ5A 3VRLE 1H8NA 2L0DA 2PR4H 3NCJL 3NIDE 3NIGF 2EYTB 4KTEH 4MDJA 1JZ3A 3DVGB 1MUJA 1C08A 3KPPA 1KG0A 1J0ZA 3IF1B 4GG6A 4HF5H 4M1CC 3WE6B 1G0XA 2PR4L 3ZDYF 4KTEL 4JQVC 4LDLB 4LEOA 3VFSB 3O4OB 4FP8H 1ETZA 4KHTH 2E6JA 1YZZA 3PWVB 4G6FB 5IQ7H 1XF4B 4FP8L 1XEDA 4KHTL 3F65A 1OB1B 3SCMD 4P23A 4KK8C 4YR6A 5IQ7L 1T89C 2DMBA 3CFIC 3EYUH 4U1GC 5ACZB 1T21A 4MDIB 4WFHE 2XZZA 1H3WM 3ARFA 4HWZB 1BMGA 3I75B 4ZODA 3EYUL 4LHJB 4PYGA 4L8SC 4PRPD 3MV8D 3RL2B 2E3VA 1KLGA 1QNZL 3EW3B 3U9UA 1G7QB 3PHSA 4LCYA 4XWOD 1JWMB 3VH8B 5DRXA 5JHLH 1I9IH 3UDWC 3C60D 4CUCA 4HG4J 3MOBH 2BNRB 3PP4H 1YC7A 4FZ8H 3V6ZA 3TVMD 1A1MA 5JHLL 1I9IL 2Z4QB 3MOBL 3KPOB 3CLEH 4K8RC 4XPAH 3PP4L 4FZ8L 5FM4A 3C6LB 4D3CL 4O51A 4EVNA 4MAYA 2OR8A 3CLEL 2VJXA 4XPAL 3OHXA 5I76A 4NKQB 2Q7YB 3KPNA 1CICA 3RVVC 3FQNB 1G1YA 1AC6A 3C8KB 3L6FB 4EDWH 2DWDB 3DV4A 4HUXA 1DEEA 1MIMH 1OGTB 4OFVA 2QTEA 1KTKE 4G6KH 4EDWL 3VXUD 1CFVH 2B8OT 1MIML 3RL1A 2MFNA 1R5WA 3L1OH 4G6KL 4OQ1A 2WIIB 3HNSH 4ZO6A 1CFVL 4PLKC 3L1OL 1TCRA 4PJBB 2B1HH 1VHPA 3HNSL 4P4KB 3JBG7 2BVTA 2MJWA 1KPVA 2BRQA 2CKBB 1QEWA 1U42A 2DQCH 2O5YH 5A3ID 3QIUD 1M7XA 2AK4D 2B1HL 3C5ZB 3O8XB 1U92A 2NYYC 3FTGA 3JV0A 5D2NB 3DX7A 3TIDA 1NBVH 3QB7C 1M7DA 4QT5A 2O5YL 2DQCL 3P9MB 1I7UB 1JN6A 1IGMH 4N1CA 2NXZD 4XMLH 1D5ZB 1QO3A 2WBJB 3B9AA 2NY3D 2OTUA 1NBVL 4HW6A 1LO0H 3GNMH 4XMLL 1IGML 5C07A 1CI5A 5LKNA 1P53A 4UINH 5FYJU 1ZXQA 1LO0L 4GAFB 3GM8A 4UINL 1YNLH 1N8ZA 1NANI 2PW2B 1QLRA 5DO2D 3C09B 2MHAA 4ZUVA 2YZ8A 3H9SA 3WYRA 2ESVB 5DMYA 1II4E 1KCUH 1YNLL 1K8IA 2P5WA 3MTRA 5IVZB 3BGMA 2WK2A 4X99B 3VMOA 3BJLA 3FFCE 1KCUL 1HHHA 4I2XE 4G3YH 3BEVB 2WWMC 1T0NB 2R2BA 5I17B 5T1LD 5L9DH 4G3YL 2IPUK 1C16A 4H0HB 5ECJE 5D1ZA 5F1KC 4X98B 2WUBH 5L9DL 4CVZA 3FO1A 2FYYB 3NBNA 1J8KA 1IJ9A 1CDIA 2WUBL 4I5BB 1DQTA 3L5WA 4JFFA 5CZXC 2E6PA 1D5BB 4E41B 3EJZD 4FQQB 3DUHA 1KIRB 1TLKA 3G9VA 2OQJB 3T2QA 4GO6B 3IDGA 5DMKB 1K3ZA 4K3DH 4EN3D 2LTQB 2VAAA 1J1PH 5SWZD 4DWHA 3OAYK 4LRIA 2Q8BH 2IAMD 4EI5D 4K3DL 4X6BA 1LO2H 4LHUG 3UTPE 3VG9C 1J18A 4ZS6C 4HAFA 1J1PL 3WO4B 1F58H 4RFNC 1FC1A 3TBTB 2Q8BL 2V2WA 3IJYA 4OIBA 1LO2L 1EERB 4BJLA 1F58L 2DDQH 5BZDA 1WCBA 4LKXB 2FO1A 4PJIA 3KWWA 3ZE1F 4P2QE 3TN0D 1N6UA 2DDQL 2CLVB 3VGFA 1NMAH 3WEXB 4X8JB 4OGZA 1FFNB 2HVKA 1XGYH 2Y7QA 5D6DA 1WK0A 1EXUB 1MCCA 2ICWB 1NMAL 2NPLX 4ZXBA 1ZKAA 2EC8A 3L3OA 4G9FB 4L4VB 1XGYL 5C3LD 2BERA 4HCRH 5LWYH 4FMKA 4ENEC 2NR6C 1I8IB 1T6WA 5IVXA 2NTFA 4LKCB 3QXTA 4RBPK 4OV5B 2UYLB 4HCRL 5LWYL 5CBAB 3VFNA 1PZ5B 1RAMA 3SDAC 4PTTA 3W0WA 4S10A 5E9DB 5C7XH 9CGTA 1MOEA 2JCCB 4ZAKC 1GIGH 5M95B 4D8PA 4C59B 2WSKA 2C26A 4Y4KD 1VFAB 1D9KB 4F33A 4U05A 3K2MC 1KXVC 4TNVF 2WIMA 1GIGL 3K81A 3WFEH 1FL3A 2JTDA 1BQHB 2YEZB 1RZKH 4TSBH 3MLRH 3WFEL 1DQDH 4Y2DD 2J88H 3BW9B 1YDPB 2XTJE 4Q6IA 4L29B 3T0XA 1T2XA 1RZKL 4JFXA 4TSBL 1GVIA 3MLRL 5CMAB 3RUGA 2UZXB 1A4KB 1DQDL 1KENH 1UQSB 2J88L 1SVZA 4MXVE 2B39A 3FRUA 5BOZG 1KENL 3F5WB 2BVEA 5ESVA 5CP7A 5IHUH 3EJJX 4MVBC 1LP9B 5I6XC 3IKKA 3UTQB 1V3JA 5JDJA 3KXFA 3Q3GA 1HHKA 3WDHA 4FQHB 2LV4A 5D6CA 2Q1EA 5HYJA 1T1YB 1B88A 5IHUL 3OSKA 4GG6E 4TN9A 1IQDA 4GRMA 2A83B 4JKLA 3LQAC 5IV2B 3KPLA 1KPRB 4O2FB 3S4SB 2Z31D 5JQHC 1OGAD 3ELAT 4NC0B 3QDMD 2GSIA 1BD2A 3IU3A 1LEKA 3GMMB 4P9MH 3GSXB 2EDNA 3BKYL 1ZHNB 1KJ3H 1UM6H 4P9ML 1C12A 5IVOA 1IAKB 1KLFA 2CXKA 1KXTB 1FLTX 3LDBC 5IROC 3RVXC 4M9PA 1KJ3L 4DOHB 5TDOA 2OXGA 1UM6L 2C4FT 3RNQA 2NY2C 5C0CD 1KTDA 2VQTA 1N5AB 3QO0A 2J8UB 3TZVC 4XCYB 2EDBA 1G6RB 2DLHA 3P73B 5E99H 5INDB 2P47B 4P5TA 5ISZD 4CW1B 1X7QB 5JPMB 5CJQH 4YHOH 3BRGC 2D9CA 1AO7D 1INQB 5E99L 1OW0C 1AXIB 4HKZB 1J5OL 1SHMA 4MAUH 5CJQL 4YHOL 3G08A 4NQCD 3D39D 3FONB 4GQ9H 3WHE0 2AKRA 4QRQA 3G6JF 3P9WB 1HXYA 4MAUL 5FM5M 5ETUA 4IOFD 3BPCA 2QL1A 4LF3B 3CU7A 4GQ9L 4OAWA 1YEIH 2IPKB 1DFBH 1FZJA 4OF7A 2H32H 1XGQA 5I74C 4HWNA 1EHXA 2PYFA 1Q9OB 1DVFC 4YQXL 3MV8B 1DFBL 2YPKA 4Q9BA 1A9BB 3QR2A 1ULVA 1YYMH 3GIVA 2AXGB 5CEZD 4OF6A 3QJFB 3VFRA 3O3AB 2VMFA 1CCZA 1YYML 5EFIA 2P42B 3O2DA 4PJ9C 5I1AA 4N0CC 1J8HD 1I8KA 4YFLI 4UAOB 3CMOH 5HHPB 1L7IH 1HEZA 3QEQA 3OGOE 4WTWA 3CMOL 1L7IL 4CDGC 1CE6A 1JGVH 3O6FD 1T83A 1A1OB 2X4QA 3CFEB 4CL7A 4QHKI 4M8VA 3X12A 3ME0A 1S7SA 1U8HA 1JGVL 1V8HA 4OD2B 3PWJB 4XVTH 4IRSB 3L7FA 4U7KA 3S5LG 3OR6B 5KBNC 2DAVA 2KDGA 4XVTL 1NDGA 3MRKB 3VXUB 5T3ZE 5E8OA 1REIA 1EAPB 1KPUB 3IDIB 3LQZA 5C07E 5DJAA 2UY7A 3HI1A 2ZOKB 1PG7W 4UQ3A 3HR5A 4NFBA 3O4OC 2WANA 4UDTA 4ZOEA 2Y5TB 5F97E 5F1NA 4YGVB 2YWZA 4PRIA 1L9MA 3QNZA 3QIUB 3AAZB 1MPAH 5ENWB 3VGDA 4Z7QE 2P5WE 1IGYA 3IFNH 3GSUA 3L95B 2YD8A 2P7TB 3SBWC 1OARH 3CXHK 2VLLA 1DLHA 1MPAL 1CFSB 7CGTA 3ARBC 3QAZC 5KSAA 2OR9H 3IFNL 3VFVA 5KW9H 1OARL 1QA9A 1W8OA 2VQ1A 4GSDH 4J3VA 2OR9L 2BVYA 3MLWH 2KKQA 1OAYH 1MCRA 5EC1A 3EZ8A 5FYKU 1W72B 3MLWL 1OAYL 1EJ6A 5IG7A 2HFGH 4JVUA 1M05B 4R4NC 2DL9A 4Y8AA 1YMMA 1S3KH 2G60H 3SE8H 3REVA 4YNYB 5DMIH 4JFFE 4P49A 5SX5H 2HFGL 3IKCB 1NMCB 3MGAA 1U8JB 4RGMB 5SX4I 3VGAC 1S3KL 2G60L 4QRPB 4X6DA 5FYJE 1ZOXA 3SE8L 1KJ2A 1GOFA 1IAII 5DMIL 5IB4B 3MYJA 5KG9B 4G42B 5C0IB 3PQYD 1JP5A 4CADB 4KI5F 4R2GD 3CXDH 4ELMA 5T1LB 1QFHA 3FT3B 1BWWA 5CJOH 4C58B 1KT2A 1F4WH 1JNHA 5IESL 3REWA 5FO8B 3CXDL 3WNLA 1KN4H 5FGCB 1EK3A 2A6JB 5CJOL 1SEBA 1F4WL 1R3HB 1HHGA 4KTDH 5DQJA 4HGKC 3AREC 1KN4L 1FZOA 4EXKA 5MEPA 1MCOH 3SDDD 1WWBX 4KTDL 2ZG1A 4PJIE 3HG1D 3RQ3A 3BQUD 3B9VA 3SKNA 1XCQA 5BRZB 1MCOL 4QRUA 3U7YH 1ITCA 4KUCD 4JM2F 1WV7T 4BFIB 3KYKH 2KPNA 5SWZB 3S96A 1KTLB 3EFFA 3KPMB 4NZUH 5DRZB 5AG8A 3U7YL 2IAMB 2AVGA 3VFMB 3GIZH 4FABH 3O8XC 3DI3B 4CU8A 5D7KE 2VLJE 1ORQA 4JFEB 4NZUL 2QKIA 1P7QA 2DQIH 3GIZL 3KLAB 5IVXE 4PBVC 4FABL 1F2QA 3CDGA 4QNPE 3GK8H 1AQDB 3FKUS 4UMGA 2DQIL 3W0WE 3JVGA 2KBGA 4Y4FC 5J1AB 1H15A 1K6QH 3TN0B 3QEGL 3GK8L 1EHLH 1CD8A 3EJYC 1FL5B 4K7FB 1UB5B 4PB0H 4W81A 2I26N 2NNAB 1K6QL 1IC1A 1OT1A 1MH5A 3WO3B 3E6FB 5EUKA 1EHLL 4I0PA 3C09C 4WFHD 3GBMH 3MLVH 2H9GA 4PB0L 4FA8A 1EEQA 4U0RC 2OJZH 3JV4B 4M6NH 5K9QG 1TJGH 4QTHA 1NLDH 3GBML 3MLVL 1HDMA 1I8MB 5MP6H 2OJZL 5D4QA 3RWHA 4M6NL 5C0NC 4ZDHB 5E6IC 1TJGL 4FQXC 4JDVA 1NLDL 4PY7B 2W9LA 3EOAA 5KTEH 1V7MH 3KPRA 1CS6A 1AIFB 1IKNA 1U58B 4NQXB 4A6YH 2ZPKH 4BQ6A 2ENSA 4M1GH 1U3HA 5TQ0H 1INEH 4Y4KB 2R2EB 5KTEL 1V7ML 3BGFC 3OKMB 4A6YL 2JJTC 4M93B 2ZPKL 1FNEB 4M1GL 1MLCB 5TQ0L 2GTZB 1INEL 3F12A 3KXFE 2ICES 5ICYB 3QI9B 2GQHA 4LLDB 5GIRB 2EIEA 2BFVH 4OZGF 4S1DD 3RWJA 3MLTB 1SM3H 2SEBB 4KI1A 2VE6B 1ORSA 3JWOH 1K4DB 3NA9H 3VMNA 5C86A 1QG3A 2BFVL 3I6GB 5M7QA 3G5VB 5I0ZA 3JWOL 1FRGH 3PWPB 4HIJA 4XX1E 5CZKA 3NA9L 5I15H 2DJUA 3JUZA 2HP4A 3MOAH 5I71C 2G2RB 4HMDA 4QRSA 1ROWA 2FZ3B 5IF0B 1JBJA 1FRGL 1T20A 3GKWH 3GMPB 5I15L 4I1NB 1MCEA 4LLAA 5GGSA 3MOAL 2WWKO 1UWGH 3WO4C 3KS0J 2X4SB 3GKWL 3QA3B 1ZANH 4ZYKB 3S36H 1UWGL 1ZAGA 4HPOH 5IJKA 4OCMC 4EUPG 2Z9TA 3RVWC 2Z31B 1YEKH 3BGAA 4PGDB 3S36L 2QR0A 5FO7A 4R26H 4PP1C 4HPOL 5C08E 4ISVA 3PWUA 4F15C 5BW7A 2OSLB 2NW3B 4NQDA 1S78D 4JFQA 5ESAA 2E8ZA 2HT2D 2COQA 4R26L 3H9YA 2XPGA 3MJ8B 5F9DC 4HBCH 5EWIH 3VXSE 4HH9A 1EHAA 1RZGB 5ITFB 4GKNA 3P3YA 3DECA 4HBCL 5EWIL 5C0CB 4MWFA 3CSBA 1LHZA 4AL8H 3HAEH 3O45B 3WCYA 1XAUA 3ZKSD 5C70A 3H2WA 4MJ5B 2V2TA 2WQ8A 2FECI 4XBGB 4BH7A 1RULH 2FHBA 3E6HA 5ISZB 4AL8L 1HWGB 1KNOA 1TZHB 4L3AA 1IGCH 3O3EA 2FX8H 1ZS8B 1G7JA 1KIUA 3FRPG 2DN7A 1RULL 3DX8B 3N1GC 4ZUWA 1KCRH 3QUXA 3NCCB 3FFCD 1IGCL 3D39B 5LVEA 2FX8L 4RIRA 2GUOA 4OZIA 2FNBA 2NXYC 1KIPA 1I1CA 1KCRL 4ZFOL 5BS0A 5FK9B 2BVPB 5I1GH 2E7CA 4PBWD 4UIMA 5CD3A 3DXAA 5B8CC 4KZEH 3FZUC 5F6IC 1U8NA 3VWKD 5I1GL 5ANMB 3PGCA 3U48A 3W9EA 2EDXA 2D7MA 4LLMA 4HIXH 3PGFH 4KZEL 3UYOD 1BX2B 5KN5A 2APTA 4OGYH 4PB9H 4HIXL 1CGWA 3PGFL 4M5ZL 1ZT1A 3WJLA 1AI1H 1HYSD 1A9EB 4GRLA 2HRLA 4OGYL 4PB9L 4PGBA 1J8HB 2VIRA 3QIBA 3U4EA 1J12A 4GW4A 4MA7H 2J8OA 1AI1L 4JN1H 3OKDA 3ZKXB 3BPNC 2E6QA 1XIWA 3SO3C 2H8PB 3DGGA 3GJEB 4UIKH 1Q1JH 1AR1C 5DS8A 3T8XB 3FQUB 5CGYC 3WMSA 4MA7L 4NQEA 4JN1L 1OLLA 4PRNA 5H37G 3UTPD 4K55A 4UIKL 1Q1JL 3STLB 5DRWB 5IJVA 5F7WC 4PRIE 1UXWA 4G7YH 1DCLA 1A6AA 5A16B 3TBWB 3NCMA 5KSVA 1YPZA 1NGYB 1T66C 2LAAA 4G7YL 4KMQA 1P9MA 4P59H 1SJXA 4P2QD 1BOGA 3LRHA 3DUSB 5CSBA 5CSZA 3MV01 4P59L 5C0AB 4CJ0A 1LE5B 2W0FB 2LABA 4Q74A 4ACPA 5AD0A 1I8LC 4Y5YA 4GXVH 4RWYH 4NNYB 3VGBA 1ZHLB 2MWCA 1MI5A 4TTDD 2HT4D 3RIAF 4RWYL 1YMME 1G7HA 3SCMC 2WZPD 1NC2A 4ZPTA 5HDBF 3RHWK 5GS1A 2JB6B 1K5NB 4X6DE 5GRZA 5JW4Q 1HHJA 1J11A 4D9QE 4ZUTB 4JQXA 3PV7A 3B8SA 3MRHB 4QXWA 4NC1C 2C3HA 4ELME 1TIUA 2HJFA 3P2TA 1AD0A 1JTOA 2XV6B 4HKXB 5C9JA 4BA8A 5EBMB 4WW2B 1XGTA 2ZUUA 3ARQA 1DDHB 4XWOC 4ZSOA 3QHTC 3DSFH 2XTJD 2IALA 4B7LA 5MENB 3X14B 2VLME 3C60C 4H8WC 4HS3B 5E1AA 3L3DB 4H1LB 2JF1A 4OFYA 3TVMC 3DSFL 2Q6WB 4OTXH 1EAJA 3PABA 3DV6B 3T65B 5B39A 2VXQH 3CFKB 4XRCB 1NGXB 3WIFB 1UADC 3NCBB 3HC3H 4R2GB 4M43H 4OTXL 5FYKE 2D31A 1IM3A 3TA3B 2VXQL 4H5SA 3HC3L 5ERWA 4M43L 4PJ7F 4CMHB 1AKJB 1PW3A 3CSPA 3S3JA 2AXFA 3BXNB 3K2UH 1U3ZA 2WINA 2ADGA 1ZA3B 4AQOA 1I1FA 1MVUA 3FN9A 2D4DA 1PSKH 3SDDB 3K2UL 5D1QB 1DJSA 4JZNA 1N2RB 3ESUF 1G9EA 2WMPA 1BLNA 1SQ2N 2HJLA 1RD6A 1GGTA 1PSKL 3QG6B 1MCWM 3V8CA 4P23D 1DQMH 3UTZB 1WIOA 4AIZB 4OGXH 3P4OB 1UC6A 4AH2B 1K8DB 3B2VH 1XGPB 1T0MB 5F71A 1DQML 4JFPB 3ARFD 3P30H 3BP7B 4N1HB 1IE5A 5F9WB 1WBZA 3U7AA 2R15A 3B2VL 5DMGD 1I7TA 3SJVB 3VG0H 1QLEH 2NXZC 3P30L 1U8OB 4Z0XB 2FWOA 3H9HA 2NY3C 2P8PB 1BJ1H 1Q38A 1JFQH 3VG0L 2RHEA 1QLEL 4MMZC 2ATKB 5C8JB 5I66B 3TCLA 2PCPA 1DQQA 1JFQL 4DN3H 1TVBB 2PYEB 1BZ9B 3IETB 4N9GB 2DL2A 5DO2C 2ZG2A 4Y16A 3BIAX 4DN3L 3MUHL 1NCAH 1GRWA 4PJXF 1YEDB 3QPXH 4MAYD 5AWNH 3T1FB 3K1KC 5IMMA 5IFAH 3EYOB 3IDUA 2V5TA 4DW2H 4KC3B 1NCAL 3LH2H 2ZCLH 1CICD 3QPXL 3R1GH 5AWNL 3QZWB 5IFAL 3GSOB 3LV3A 1FIGL 1TCMA 2GAZB 3FCTB 4Z0BH 2C7UA 5CILH 4DW2L 4HWBA 5GZND 3LH2L 3C6SB 1JYXA 2ZCLL 3R1GL 5CEXB 4F2MA 4Z0BL 1FYTA 5CILL 2WBWB 4P57A 3SKOB 2I9TB 5EG6C 2AQ1A 3CDFA 1CXFA 1ZGLP 2MNUA 4JQVA 5GGSY 2KZWA 4R4BB 1OD9A 3WHXA 4GG8A 5CWSA 5K59E 4RDQG 4KJPD 3EJZC 5FKAB 1U2CA 5HI5D 4GUPB 2VSDA 5BVJA 5ALCH 4OZFH 3ALPA 2ICEB 5IEHA 4J23A 5FV1L 1D3CA 4EN3C 1CT8A 4NQDE 2GJ6E 5ALCL 4PY8J 1KLUA 3TH3T 5ESQA 1KYOK 4UDUA 5H35B 2IAMC 3TEUA 4EI5C 4E0RA 4M00A 5T3ZD 3MFFA 4OCNC 4PJHA 4BUGA 4M6AA 2YK1H 5C07D 3KJ4B 3V2AR 4POUB 1A14L 5I8KH 5HGBA 3LKOB 1FSKC 2YK1L 2OTWA 4HXBH 4LLUB 4JAMB 5F7MC 5FDWA 5I8KL 3UDWA 4L8CA 5DD1H 3H9SD 1H3TA 3TN0C 1DN0B 4AT6B 3P4NA 4X9HA 4HXBL 2Y07H 3U36B 3X13B 2P5WD 1ZHKA 2R1XB 5DD1L 3K46A 3ZE0F 2NY6D 4NO5B 1NPUA