2EZ0D

Crystal structure of the s107a/e148q/y445a mutant of ecclc, in complex with a fab fragment
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ion-binding properties of the ClC chloride selectivity filter.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords H(+)/Cl(-) exchange transporter clcA
total genus 48
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ez0D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ez0D01
1OGAA 3OKEA 1YPZB 3BJLA 3MV7D 1ZSDB 3TIDB 3VFUA 3C5SA 5C71A 1R5WA 2BX5A 4PJXE 5E6ID 4ZMAT 3IU3A 3QFJD 2NTFB 5FHBH 1VFMA 1I75A 2KH2B 4JFYA 5C0FA 3MV8D 4M93C 3VD7A 4POYA 4D9QD 1AD0A 3QJHB 4JZJA 2O5YL 5CJQL 2HN7A 3DX8A 5GXBB 1UVQA 2L7JA 3VWKA 2Z8SA 3NN8A 2AXHA 3RWJA 1I85A 1F11B 3O8XA 5F7EL 3VRIB 2VSDA 3FQWB 2JELL 2XIDA 2DQCL 1K5NA 3WKMH 4EIGB 1ODAA 3U0PA 4FP8L 4KKBC 3FB8B 4ONFL 3MNWA 1E0OB 5HPMB 5E1AB 1T1ZA 2ZG1A 1O0VA 1TLKA 4LLQB 2VLKE 3C5ZA 3WXWH 2Y07L 2Z31C 1MJUL 3RY4A 3OKOA 5CEXB 3MJ8A 3I6LE 4IS6A 5KVGH 1T0NA 4NQEB 3LMJL 3SJVD 4ZYKA 1TCRA 1C08A 4D9QE 2XKUA 5JW3L 1FV1B 1J1PH 5F72S 2NY2B 3JTTB 2CDFB 3U9PL 1CG9B 5FYKE 3S35X 2W60A 3Q2CA 4X4YB 1G7MB 2R0LL 1HI6A 4DGIH 3LN9A 5JXAL 3W5NA 3D18B 3QUYD 1CGUA 1UCBL 3PQYA 5IT2L 1A6TB 1D9KC 4ZNEA 1XT5A 5SWZB 4CADB 5JHDA 3TO4A 3E2HB 4N1HB 4MCZA 4NDMA 1OLZA 4HK3J 4YXHL 3BP6A 3P77B 3S98A 3BDXA 2V5RA 3GBNH 3PL6C 5FYJH 5E94B 1S9XB 5FDWB 5CD5C 3JV5A 4XPAH 4HXBL 2IALB 1ORSB 4NZUL 3MRBA 3R1GH 5FOJA 4EUPH 3TN0B 4GW4A 2BOCB 3ARWA 4HH9A 1QD0A 4NN7B 1CGYA 4W4OA 3MRFA 1BIHA 3ARSA 3T3ME 2BVQB 1I1FB 4QRUA 5D93C 2F19L 3L6FA 5DLML 3RZCD 4NKIL 5TH2B 1X4YA 4GUPB 1A7NL 5DVLA 1BP3B 1V3KA 1NC2B 4Z5RA 1ZLUK 2FX9L 1OAYL 3RTQA 1JGDA 1QSVA 4OKVB 1NC2A 2WSKA 2DBLH 3ZE1E 2VDOL 1D9KD 3HUJB 4YZFF 3T4AB 3QDJD 3T0BA 5HJ3A 3MOBL 5HD8C 5GRVL 2B20A 4CL7A 1ONQB 4XP9L 1R5IA 3KHQA 2Q7YA 43C9B 5IVZA 1JIBA 1BD2D 2ATKA 4WDIB 3D87B 4OZ4A 3KPNB 2OI9C 5DQJA 2VITA 4F2MB 3MODH 4AK1A 3QDAA 4TOYH 4N0CD 4Z76B 2X4QA 3QDJB 2M2DA 1OAKL 3CCHB 4WTWA 4LEXH 4WHYH 1MCWW 2ADGB 2QR0A 4D3CL 2IH1B 2ORBL 3BP7B 5H2BA 3VD3A 4FQJH 5DD5L 2HFEA 4H88L 1JGEA 4F33B 4R3SA 5GRJL 4M1CC 4P99A 5HHOE 4B41A 5I1IL 4Y1AA 4LQFL 1J88A 1OARH 2VRAA 2VDQL 3MLZL 5I9QB 4ALAL 3ME0A 4JRYA 2QQQA 1T04B 5J11C 1FVDA 5EU4B 4YE4L 5BW7C 3TGXA 1MI5A 3IXAB 3IDIB 2XA8L 4L3EB 3V5HB 4XXCA 5EU7E 3FFCB 12E8L 5T3ZE 4P49A 1TJHL 1BX2B 5ALBH 1YN7A 1RI8A 4LNVA 3RWHA 4BQ8A 2BJML 4ZQKB 1HNGA 1TZHB 1IC4L 2QQLH 4YAQA 1YN7B 3H9SD 4LQFH 1BVKA 4JZNA 5BRZE 1ZHBA 2F15A 4G7YH 3NA4A 1FRGH 3GSNA 4H1LH 5TFSH 3ARFD 5F6IC 5GZOD 2BSSA 3TJEH 3ELAT 4LLWA 4JPWH 5L7XH 1M7IA 4PY8J 3ES6B 3LKSB 2EDYA 3O3BB 4MXVF 4JFFD 2UVFA 3LKPA 1NANH 5ESVA 5BV7B 2LAAA 1DL7H 3ZZ1A 3C5JA 1OTSC 4P23C 4W81A 1KJ2H 2X1OA 4ELKA 4O02H 1JWUA 2P5WD 3MPCA 4HUNB 3SCMC 1A7RL 3UTPD 1PKQE 1S3KH 1YC7A 1JTPA 1AGFA 3G5XA 5SV4A 5ABDE 5H94A 5CBEA 5GGRB 3DUUB 3PWVA 1MCEA 2ZUWA 4D0CA 3MLWL 4FFWD 3OPZL 2Q7NA 1HKLH 4FXLA 5C86A 5J06A 5DD5H 5HYJA 4GRMA 4P57B 4D8PA 3ULUF 4HZLA 5C0AE 2APBA 2HVJB 4X80L 5FHAH 1U3HA 3W11D 4G5ZH 1YMHB 2OYPA 3MBXL 2V9QA 3HPLA 1AJ7L 4FN0A 3SDCC 4M7JH 3T4AA 4MNGA 3KXFA 3KLHD 4ETYA 3B6SB 4DZ8B 3HI1A 3OWEA 3HR5A 1FE8L 4P0DA 1Q9OA 1RUML 3QG6A 1IMHC 1U3ZA 1Q9KA 4FZ8H 2HA1A 3L3HB 3NIDE 2FIKA 3HMXL 4XVJL 4A6YB 1P53A 5A43C 5EU7C 1X7QA 4X98A 3L3OB 5LGJB 4MNHA 2VLRB 3K2UL 4JG1H 3MLSL 1BZ7B 2GK0A 5HDOA 1KFAL 1J7VR 3UO1L 4GMSH 2BVYA 2I9TA 5EWIL 5TQ2L 3AXLB 5ESAB 3ILQC 4RMQA 4U33A 4O5LH 4TNWK 4OZHF 1ZGLB 1QSFB 3OKMA 1JI2A 2AXFA 4PUBL 2F54D 4NKIH 2HT2D 2YC1B 1D6VL 5EULV 2Q6WA 5IFJA 3QFDB 1JHLL 5IQ9B 2QADC 3F7PC 3VGGA 4X4MA 1Y0LB 5INDA 4KMQA 1VB9A 5J1AA 4HXBH 4NZUH 4R97C 1RZGB 3FB5A 3V7AE 5E94A 2BP3A 3U6RB 1B4RA 4OZGE 3FB7A 3C6SA 4TYUA 2NYYC 2JK5B 1KCVH 1TTUA 4HZAA 3MXWL 2QHRL 3E1F1 5CBAA 2W60B 2HVKB 35C8H 3TN0A 3ZKNC 3UTZB 5MENE 1H8OA 3TNNB 3CDCA 4OQ1A 1A6TA 3O4OB 2PTTA 2F74B 3O3EA 5ISZE 4FA8A 1G7MA 4WCYH 1RUMH 2CRYA 1DANU 2DBLL 2EXYD 3IFNH 4M9OA 2Y36H 4FQQA 1CFVL 3KLDA 3FQXA 4I48B 5ID0B 2E8YA 5ACZB 1Y6KR 4RMRA 1NCAL 1KCLA 1TPXC 2X89A 5HGDB 3QI9D 2JIXA 2XG4A 4QHKJ 3GSVA 1V3JA 4KTYA 3IFPB 3QIBC 1WT5C 5T1LB 4NRYA 4Z9KB 5D5MF 3BIBX 3UTTE 4Y5YC 2YUWA 4JR9L 1IVLA 4J3XA 3CZFB 3F7YA 5J3HC 2CMRL 2VQTA 3RTQD 3AAZA 4KMTH 4L4TD 4BKLB 4X7FC 5F7DB 4YHLH 4OT1H 1NGWA 4IIQC 3I6KA 4XNUH 2VUYA 3OKKA 5FO8A 4WEBH 1T0PB 5J57B 4L4TA 2A77H 4LGPB 3C5SB 5I75B 3BH8A 5E00A 1KG0B 2WUBL 1SHMA 5JQ6H 3TNNA 1I1CA 4CVWA 3NN8B 5DA0B 5DQDH 2YZ8A 4Q6IC 5LVEA 1YNKH 5E00B 3QI9C 4F37F 1DDHB 2RAMA 2BJMH 2VTFA 3VWJD 1KCRL 2VXVH 1AD0B 1AKJB 5IBTH 1Z3GH 2C3VB 5E8OB 5JXED 4X98B 2AJ3A 1OD7A 2YK1H 1HIMH 2AJXH 5I1JL 1OM3H 4N90E 5FUOH 5JA9A 5C8JA 3BISA 2EH8H 4LARL 4RDQF 4AENA 3KPQA 1ZS8A 1KELH 1U3YA 3GSUA 3NZ8A 5KW9L 1N64L 1JWMA 5SWSE 3AMKA 3RWHB 2KL6A 1ZE3C 3R0NA 4A6YL 2K7PA 3EW3B 5AWNH 4X6DF 1D9KB 1QSFA 3OKMB 4JB9H 3RQ3A 1VESA 2A6DA 4X0KA 4UOW0 4Y16C 4LVEA 5HGHB 1MI5B 3IXAA 1IC1A 1MCQA 5HHXL 1LP9F 4Q2ZB 3CGTA 4O58H 5MENB 5B38G 5ITBL 1CVRA 4HG4J 2YD2A 5EU6E 2F53B 1DVFD 3S5LB 3GSWB 5AWNL 5GS2H 1ZLWK 1FFQA 5L8KB 5MI0B 3FTGB 4MGXA 1U58A 1I8KB 2PCPA 5MEPA 4ODWA 5C07A 1NUGA 3HPJA 1OAZL 3JWOC 5DUBA 2F58H 2EYRA 1EEYB 1V3LA 3WNMA 1IKFL 5FUZH 1NGYA 4LVHC 1JPSH 5C09E 2WINB 4KQ3H 3CVHL 4LNRB 3KYMA 5CJOH 4XCCL 3S34H 5JW4Q 2CGRL 1S7XB 3M45A 3VXNA 3ZT5A 1MCCA 2OL3H 1LO4L 4X7CC 4MNGE 1S7TB 2FJFB 1RHHB 3PV7A 4PJEE 4TNVK 2Q3AA 4HQQH 3QQ4B 1TPXB 3R4DA 1KFAH 4P5KA 1LNUB 2A74A 2BCKA 2W0FA 4X5WA 4IRJB 2Z35B 4X7SH 1U92B 1YEIL 4PJ8A 4F9PA 4AMKL 5EU6A 5CD5D 1DBAL 3UZQA 5SX5H 4HUXB 5I0ZA 4WTZG 4DTGL 5GS1C 4QNPE 3PGCA 5GS0L 25C8H 3QDJE 3WL9A 3L95B 3O4OC 2DWEA 3X14B 3KXFD 2UUDK 1WC7B 2PUQT 4XNQA 1A64A 4M6NH 4YHMH 3T77B 1P7QD 2J8OA 2IPUG 4PJBA 1N8ZB 3O3DB 3MRKA 5D7KD 1NFKA 3U2SB 2R0KH 1K4CA 2B1HL 5TF1H 2AXGB 3HE6B 5GHWH 4RNRB 1A22B 2AV1A 1F8TH 2DTMH 2C3WA 3WXVH 3MCKA 5GSVB 2DQIH 4CVZB 3WUWG 3S35L 3VFNA 4PG9A 1W0YT 3LVEA 4D0BA 4G8IA 5AG9A 2OSLB 1TJGH 4J3UA 3VRLE 2BNRD 2HFGL 2HKHH 5DVNA 5L0QB 4GG6A 4GRMB 5LWYL 5FOBA 4HUUB 3BMWA 1J8HA 4G8IB 3BYTA 4K9EL 5I16A 1D3CA 4ZO9A 1AQDB 3KPSB 2Y5TA 5D2LE 5F7DA 3T0VA 1QRKA 5D7LD 4GRWF 4ZOCA 4HLZG 5CJXC 3EYUH 3IS1X 2ITCB 1UZ6F 4ETQB 4O2FB 4O2CA 4NQSA 2CDFA 4MNGB 4HCRL 1M7DA 3V4UL 5LQBH 2B5IC 1T1YA 1QSEB 3CX2A 2H2SC 4P48A 4ZYKB 3L1OH 3U6RA 3CNKA 1H9VA 1W8OA 3EOBA 1KXQE 1KENL 4LCCC 4RCAA 1UZ8A 4X6CB 2YPLD 4PV9B 4XP1L 2QSQA 5J1AB 3S36L 3G08A 5HDLA 5C0AD 1LE5B 4M7LT 4NFCA 3S4SG 2VLRD 5FGBA 4E5XB 4DGVL 3QNXB 4Z7QE 5SWZE 4NN7C 3BKJH 1QKZH 2BY3A 1UWXH 4Y4KB 3AXLA 3T0WA 1RIHH 2YPVH 4BQ9A 2R4SH 2ZJSH 5DZOA 3MLWH 4LHQB 3L3DB 5GGUA 5J56B 4FTVD 1DJSA 5J8OA 3RI5K 3KWWA 2BMKB 4UAOB 4R4ND 2F54B 2XZQL 2D7QA 2ESVB 5CZXD 5L2JA 2V2TA 1QSFD 4CVXA 5EWIH 1GC1C 5CHNB 2HH0L 5C7XH 1XZ0A 2XFXB 1Z3GL 2GITB 2DLFH 2IH3B 3DSFH 5F96L 5DD0L 4Y5YB 4JRWA 4BZ2H 3LDBB 1BM3L 4IDJH 3B9KD 4WNQA 1KPRB 3VXQB 1GC1L 3LAFA 4XX1E 1HH9A 4XCEB 3UMTA 3VXME 5GZOC 2UWEB 4R7NB 4U3XA 5TGBB 2V5YA 4R90H 1K3ZA 5EO9A 5C9JB 5FIEA 1X9QA 2YUXA 2DQDH 2AERT 3IDJA 3SCMA 1EO5A 4JREB 3ZTJG 5LXGH 2VL5B 1HQRA 1ZT1A 2WBJA 1TDQA 1WAAF 2D4FA 4M00A 2VWEE 1XCTB 3IB4A 2I25N 4YXLH 3O6LH 3H9HB 2DQTH 3BQUB 3BPNB 1CT8B 3UBXB 1OT2A 4GBXC 4BSWA 1S5IH 5B39A 1XF1A 4QHLB 4YE4H 2Q7YB 4FFWC 4R97B 4ELMB 1CFTB 5DA4A 4XCFH 4Y8AA 4IMLB 1CQYA 3BQUC 4FQ1H 4HWEL 4N0CC 5IHZB 3GMMB 3CDGA 1LK2A 4PGBA 4YDVA 1ROWA 4UI2A 5ALBL 3BEWB 1P1ZA 4OZGF 1KCVL 4CVXB 1QRND 1J0IA 1I85C 5C0FB 4XNMA 3QQ4A 4D8PB 1IGIL 5IOPB 3HZVB 1BVLB 1XGUA 1U93B 4PV8A 5IB3A 1EPFA 2XY1A 4OLEA 3SDDC 3VFRA 3NCEB 5L8JB 1H8SA 1MQKH 1IM9D 3HMWH 5GJTH 4HMDA 3NA9H 2YD9A 5E99L 1J10A 5T3ZD 1UKTA 3MUY1 4Y7MA 4J8RA 1RUQH 4K2UH 4DKAA 5BZWA 2R15A 3ILQD 1JGVH 5C0IB 4QTHA 5DGRA 4MDJA 4ZPTB 4EN3A 5DJZA 1XR8A 4YAQB 2GIYA 4RBPH 2EDFA 1EEUA 4X7TA 4LRIC 4BH7A 2AEQL 5IK3A 5F7NC 1QO3A 4GG8A 3FCTB 4DVBB 1ZA6B 4JAMA 3TH4T 4PREB 2QADD 2FSEB 1HHHA 1F6AB 1TZHA 2OJZH 1YQVH 2Z4QB 4QHLA 3WJLA 4LKCB 3MRJA 4JFQB 4YIQB 4OD1H 1LHZA 1U0QA 5EOTA 5T1KD 3NA9L 1FDLL 1FL6B 4HWEH 5KSAB 4PJ9D 2NYYD 2XRAH 4F57L 3QEQA 1CLOH 5I1DB 1B0RA 5EZJA 1F45A 3TBVB 4XXCC 5IT2H 1P1ZB 3PP3H 3BRDA 2JE8A 1TVDA 1FAIH 5IWLC 3HMXH 4YJZL 3C5ZB 3WHXB 1A9BB 1RFDL 1EJ6A 1UXSA 3R8QA 1GGBH 3F5WA 3NVQA 5AZEL 3T8XA 1H3PL 1F4XL 4P3CH 1H5BB 4OF6A 5MEND 4PS4H 1NSNL 5DD3H 2MQ3A 4WI2A 3FO2A 2CR6A 3UCRA 4O02L 3OKNA 1M6OB 1FV1A 3PGDB 2R0ZH 4M6ML 5HVWA 4EDXA 4Z95L 3T0AA 3HC3L 3UJIL 5EU6B 5ALCL 5HHMD 3GMPB 4X9IA 1CD1B 5CD3B 4P23A 3O3AA 4Z7OE 2IJ0C 2JJUA 4LBEB 5GIRB 4MCYB 5J3HD 1YY8A 3IJYA 3CJJA 1FZMB 4S1DD 1TZGL 4QXTA 3BPCA 4DGVH 2CXKA 4OZFG 3RA7H 2QSCH 3L1OL 5HPMA 1OGTB 4M03A 4NM8L 5DI8A 3WNLA 4F3FA 5DWUL 4Y19A 4WNQB 3BP5A 1SJHA 3PHQB 3MRQA 4JM2B 1I8IB 3IDXH 4P9HC 3EOBB 1OP3K 1XR9B 1NC2D 1TIUA 3BP5B 4OLYL 5F3BA 5DJCA 5ADPL 1E4XI 5GGQL 3RIFK 3VXSD 2ADIA 1E4WL 2BOCA 3MTRA 3TCXA 4P2RD 4H0IA 4N5UA 4BA8A 3WIFA 4HIEB 2VL4A 2Z93A 3EJJX 4FQ2L 4S1RH 5JIKA 4RX4D 4ZFFB 1NCTA 2AJUH 2DIAA 3GKZA 5DT1H 1H15B 4YXKL 2ARJB 1XIWB 2VZ1A 3B6SA 1AE6L 3QZWG 3EO1B 4UOW1 4DTGH 3MACH 4EI5B 3C2AH 3P9MB 4H88H 5E5MB 5IKCA 3V0VB 2A2QT 3FN3A 1T1ZB 3JXAA 3DUHA 4RX4A 2VR5A 4R2GB 5EA0L 3BX7C 4B0MM 1A3LH 3HNVH 3DX6B 4J23A 2HTKD 4IS6B 2EC9U 5C07B 4TSAH 2D31A 2C1OA 3HNSL 1GGTA 3LSOA 1OAUH 3SKOA 2ZUUA 2XKSA 3HI6H 1MIML 1XF3A 5J6HB 5F1NA 3P30L 5BRZB 1Z9SA 5EORH 2AV7B 4NRYB 4X8JA 5C0DB 2R1WA 2R56L 2X4RB 3V7MA 3VGBA 1F11A 1UEMA 4QEGA 2P45B 3IDNA 1BFSA 1FORH 5TQ0L 2DWDA 4NZDA 1DQJA 5F1OB 5LBSL 5ACZA 2O5XH 4K94H 3HN3A 3L3KA 5CP7B 4EVNB 2OK0L 3T3PF 5T1DH 1ZHBB 3I2CL 1XCQA 1URLA 2CIIB 4NPYB 1B6DA 3RGVB 5LGKA 4QKXB 2DOCA 1QR1B 1T21B 1WZMA 5GS0H 3PNWA 1J9CT 3KDMA 4E42B 5IEKB 4AG4H 2ZCKH 1I9IH 3LD8B 4U0QB 5IG7A 2Y4SA 4E41D 2DQHL 3A6BL 3OF6D 4Y16B 3FHQA 4P3WA 1T6VN 3NH7L 4EOWL 1BREA 1K4DB 4K94L 2HFTA 1OAYH 4NQCB 4AL8L 4UQ2A 1T2QL 5I73C 2H45A 5ITFA 3SDCA 2DLEA 2YRLA 1PG7X 1BLNA 4FNLL 4PJ8C 4PLJC 4K8RD 3KHOA 1J18A 1QA9B 5F89B 1XCTA 1YMMD 2FBJH 4WUUD 1DN0B 5T5NG 1AHWA 4WRLA 1L4IA 2HVJA 4Y88A 3LY6A 2V17H 2A77L 4Y1AB 1JRHL 1G9MH 3VJ6A 2ICCA 5LGHL 1WIPA 2CRIA 3VDCA 1J0HA 3U4EB 1KB5H 3HFMH 35C8L 3U48A 1J8HE 1ZWIB 4ODUA 1V8HA 4PJEA 3CX5K 1FFNB 1N3NA 1QBBA 4F7CA 4OSUL 5TDPB 2IGFH 5HYSG 2UYLB 3KPNA 2D7OA 4L3EA 3V5HA 5IFAH 1JF6A 4PJHF 2HP4A 2YSSB 3IFNL 3ARRA 4JDZB 4Z7VF 1F4AA 2MKLC 1DUYA 4NBXB 4GRWB 1MSPA 2IADB 4CNIA 3TVMD 4QLRA 3OJ2C 3H2WA 2ZSWA 3FT2A 4KDTC 3MQIA 3MCG1 1QFWM 3GEWB 3MRRA 1F4XH 4P3CL 4PJFF 4CUCA 3VWJA 4QOKA 4WW2B 4YUEL 4EIZC 3CSYB 2JB6A 3D2UA 5BXFA 3GSNB 2H3NB 4S2SB 1OT1A 3I50L 3QPQC 4ODSH 5JXEA 5FECA 1DBJH 5CSZB 3QG7H 3V0VA 3PQYE 4HS6A 2DIJA 3UTSA 3NFNB 5B38B 3T0ED 4Z95H 4RGOL 5L2JB 3RY5A 4ZAKB 4XZUA 3RY6C 5JDSA 3QPXH 3X3GH 2FD6H 1RZ8B 5HHXH 4BYHA 4ELKB 1CICA 3BAEH 3QJFB 2Y06L 5F71A 2XWJA 3SDAC 3V5KA 2R0ZL 4M6MH 1TZGH 1UADC 4KQ4H 2Y9RT 4GAGL 5E6IC 3WCYA 3WV0A 1HH9B 4L3CA 4XPFH 3MV9A 2I9TB 1FVDB 2V2TB 3BZ4A 3IKKA 5F7YC 3H7BA 4NOFA 1KB5L 3HFML 2J8UE 3IGAA 1WBZB 4XCNB 1MNUH 3MNVA 4Y5YA 3IJSB 1BWWA 1BBDH 2FATH 3FONB 3NOIA 5IMOA 4OLYH 3T0DA 1HI6B 1U8QB 4RWYL 5DD3L 1IEBB 1VHPA 4ORZC 4H20H 2DM3A 4MJIE 3ULVL 2VC2L 1XGQB 4HH8A 4OQTH 1PQZA 3CUPB 4LSDA 3ARQA 2DLHA 1F2XK 3T0XA 2KPNA 4NC1C 2QADB 4OZGB 3QAZC 4AZ8A 1CXIA 2VR4A 3QUMA 1VERA 1R0AL 5HVFB 5E70A 1A1NA 2J3SA 2JKXA 4KJYA 4LGSB 2AK1H 5C0CD 2DLTA 3MNWB 1CL7I 5IW6B 5EORL 2PO6D 5HI5C 3RBSA 3QH3B 1OAUL 3HMWL 4TNWF 1QSFE 4PLKD 5ISZD 1A9BA 2XZAH 2F8VA 3QDGA 3SO3B 5FYKL 4OTXL 4YBLC 3S36X 1BD2A 3TN0C 4UNVA 5AEAA 2MWCA 3GI9L 4MXQD 1XGTA 2PETA 1U9KA 2Q3ZA 4X5WB 3UTTB 4N0RA 1DEEA 4L3AA 3IGAB 4J8RB 3I9GH 2XQYG 3CMOL 5DSCA 3QIWB 4Z7UA 3STZA 2X4OB 1K8DB 2GY7B 3C60C 4OCYH 1FLTX 2VZUA 1W72B 5IR1B 3T2PA 4OCSL 1ZV5A 4JVPA 1G7PA 3OKLB 2ENSA 4Q7DA 5CZKA 1VPOL 5CEZH 5F9OH 2A6JB 4WI4A 4HHAB 3MBEB 1OGAB 4ODVH 5GGRY 2BVPA 3GHBH 4ZXBD 3FCTA 3VFSB 3VXOA 3CPLB 3T2QA 3RUGB 5KTEH 1ZVSB 1SYSA 1I7RB 3GSOA 3MO1B 3SQOH 3U7WH 1ADQA 2GK0B 2A6IA 3ZHKA 4OUUA 3I3EA 4AQOA 4TUOB 1ZLVH 2H3NA 2RR3A 2I60H 4OCNC 3AS3A 2VH5H 4R8WH 3U7AA 3MRFB 3TA3C 2XQBL 1I3RB 5ETUA 4JZJB 1AGDB 4NO3B 4NQVA 4HWZB 5IGXH 2CO7B 3N9GL 5I19H 3TT3H 4I0KA 1KBGL 3FB6B 3QAZB 1NCWL 2W0KA 2J88H 1L0QA 1BQHA 5DZNA 1CIUA 4JDTL 2NPLX 5CZXC 3NCYP 2ITDB 5DD6B 4ZFZA 4F7TA 5AD0B 1RZJH 2FIRT 3OJVC 5D7KE 5EC1A 1C5BL 1T7VA 2J6EA 4DW2H 1U58B 1HQ4A 5DMGC 2H9GB 2G5BB 4QOKD 1IKNC 3QUYB 1FCGA 3UZEA 3OZ9L 1CD0A 1ZGLP 1NBZA 4V1DB 5T1KA 4XCEA 4URTB 1VADA 5E9DA 4HWBA 5C7XL 4PPTA 3QCVL 4PJ9C 4N1EA 2Z8WC 5IIEA 4ONOA 1YEJL 3P0YH 2QQKH 1XGRB 1Z9LA 4PJCF 1T0MB 3OHXB 3H9HA 3UTPE 1NLBH 1YZZA 2J88L 4RQQB 5FYKD 5ESQA 1WK0A 5DJYB 5MENA 5I8CA 4J7RA 3RIAF 1FNGB 1T3FB 4K3DH 5F6HJ 4ELMA 2PYEB 1JNHA 4CKVX 4XGZB 1LO3L 4LCCA 3TP4A 3WSQL 2R2EA 2WWMC 4FZEH 5E7BA 2YPLB 5H35B 2DDQL 1R3HB 5SX4I 2LFGA 4GKSB 4UIKH 4MSWA 1OTTC 1F2QA 4R96A 3R0MA 3REVB 1R3HA 1F02I 1S7UA 3X3GL 3HI5L 4PJ5A 4PJAB 3C08L 4HSQA 2VMFA 3QCTL 3BJ91 5SV3A 3DOSA 2DL9A 4U1JA 4S10A 2XICA 2AI0L 1ES0A 1ZLUH 2CUIA 2VXTH 3TPUB 3QO1B 4NC0B 3QWOB 3EYUL 3CFEB 3EYFA 4OD1L 2P7TA 1WFOA 2CDEB 2D03H 4G6JH 3ESVF 5IB4B 4J6RL 4Z7OF 4HCRH 2C3VA 1DQMH 2GKIA 1RAMA 4UV4H 3HAEG 2MSPA 3Q6FA 4NT6B 1TJGL 3DX6A 2DI9A 1X5FA 2VUOA 1VFUA 3QQ9C 3BQUA 2OXHA 3KPSA 4XRCA 3SKOB 1P4IH 3WFHA 1OAKH 3CIQA 5CLTA 3M17B 1JK8A 2BNRA 1JPGA 1AGCB 3GNML 1N5YH 3VA6A 2BNRB 4K23L 3OL2A 1QSEA 2VITB 3LHPH 4GKNA 1S7QB 4M48H 2WIIB 4IJ3B 3QRGL 1UQSB 2HJKB 5D6DC 2I5YL 4JCLA 5E95B 4JANA 3D1MC 3VMOA 2V7HB 3MRJB 4LPUA 4DKFH 3P0YL 2GUOA 1IQWL 2EIDA 5EUOB 3RWDA 1RZGA 3FB5B 4HWUA 1UXSB 5FOBB 4QRRD 1GHFL 5MI0C 4ODTL 3HCVB 4Z7UE 3UTQB 2X4PA 4GXVL 5C6WH 2BNUB 3QFDA 5IVOA 3CVHA 4UZGA 2NZ9C 4L5FL 2NY0B 4IOSD 3IRPX 1KLFA 5FEBA 5IMLA 5C0IA 1V7ML 32C2A 1IILE 2EEBA 5K9KB 4R9HA 3DO3A 2EDLA 1INDH 2IAMD 3B8YA 5D93B 3WFBH 3GHBL 3OJDA 4DN3H 2B1AH 3DMMD 4FQIL 4R4FL 4D9LL 1CXEA 4XVSH 1LO4H 4JY5H 2DRUA 4YUEH 5JOEA 4PREA 3FQWA 3S96A 2O5ZL 3DJ9A 1UB5B 1FSKB 2VQ1B 1T66C 5KSAC 5HGAA 3CK0H 3FZUD 5ICXB 2G9HA 1YDPB 5C07D 1CL7H 4JJHA 3O8XD 4PJ8B 1KBGH 3ARBA 1I8IA 3AU1A 5DJ2A 4CN4A 1MVUB 5J6GA 3QH3A 4KMLB 3PQYB 3IS0X 4JKMA 4ONHA 5FV2A 1AGBB 3ZKND 1EO8H 5E8NA 4JANB 4NKDB 1ZEAH 4FQHB 3RDTD 1QG3A 5D1XD 4IRJA 1S7XA 4G6KH 5B39B 1FGVL 4OB5H 4MA7H 3MLUH 4MA3A 5K59E 4P9ML 4KPHL 2C4FT 2A9NH 1S7TA 4LPWA 4LHUG 4X83A 4WJ5A 5GGRA 1UM6H 4U3CA 3LKRA 4IRJD 2BNQB 3VXRD 5F9OL 2EO1A 1KIRA 1PDKA 2R9HC 1MHCA 5KVEH 1JMZA 1P5UA 4AEEA 2VISB 1FBIL 4LIQL 3BKYH 1AY1H 2VC2H 4PJBB 5F7HA 4DKDC 4UDUA 1NMAL 4APQC 4KKAD 4KK6D 4JM2C 5HHPA 2V5MA 4QRPD 4XMKL 4LEOA 2H32B 1U8JA 5J12B 2BNQD 4PJGF 4G42B 2CJUH 5C0CE 4P46D 3G5VA 2OSLA 5TF0A 3G5ZB 4N68A 1JL8A 2DQIL 2VN4A 3NCYS 5DK0A 4X4XB 3S3SA 4GAFB 4KK8D 4QRRA 4QY8A 4WFHE 2VXUH 4ODXA 3ET9F 1E27A 3F8UB 4L4VE 4FMKA 1FAKT 1TVHA 3PWLB 1F6LL 5DD0H 1HILB 1RZ8A 2OLDA 4LPVA 3VMNA 4P5TD 1NAMH 2R1XB 2ICES 4NYLB 4U1NB 4DWHA 1OSPL 3OR7A 3DX7A 4CDHA 1MCRA 5DO2D 4UINH 4JAMB 1IAMA 2VZVA 3ZTNL 3V6ZB 1MH5B 2VLKA 4MAYB 2EDNA 4TOYL 3QHFH 5IROC 1YEIH 3RGVA 2FYYA 2OR7A 2GW5A 1NC4A 1NFDF 3I3DA 4UT7L 4H20L 4PY7B 1P84J 2YMXH 1U36A 4OIBA 3NH7H 5D7LE 3S5LA 1HYSC 2W9DL 4KI5E 3TNMB 1IEAA 5F9AC 1GGBL 4K3JH 3DGCR 3VFMB 4M6NL 1AKJA 3RAJH 4Y4HA 1NBVH 4BH8A 3KLSA 4V1DA 4JRXE 3NIFF 4XC3H 1WCBA 1G7HB 3MOQA 1JGEB 4F33A 3C60B 1VKXB 4O2EB 5FM8A 2E6QA 3RRQA 4B50A 5EO0B 4MD0A 5KVFL 5F7UA 1EHLH 4R7NA 2BDNL 5JOPD 2NY1B 5D2NE 1OSZB 1DSFH 1CD8A 1XGTB 4PLJD 3WYRA 2OTWB 1QZ1A 3LV3B 2YPKB 4BFEA 2WLYA 4KUZL 3I6GA 4LIQH 5JMOC 2HKHL 2VXUL 3CXHJ 1IQWH 3IDXL 1DFBH 2VE6B 3I75B 1WTLA 2MQ0A 2Q76A 3KPRE 4JY6A 1DBAH 4M5YL 5FXCH 3OKDA 4ZS6C 1MHEB 1UKQA 1ZANL 3MRHB 3W39A 3FRUA 1DCLA 2AGJL 8FABA 3U9UA 3DGGB 1B2WL 1SBSL 2D0GA 3VXRA 4F3FB 5INCA 4FFYL 1VEMA 1ZVSA 3K2MC 1NUNB 5FCUL 4MVBD 5D6CB 4WJ5B 4EEEA 5GRWA 5JW4R 3ZTJH 1ZT4B 4Y89A 3PWNA 5F70A 3RDTB 1IE5A 1FC1A 3BT2H 4JQXC 5DQ9B 4QNPF 3WLBB 2WAHA 3PWNB 4YGVA 1FP5A 1J86A 5IVZB 2NR6C 2H2PD 2G60H 5ESAA 4ZAKA 1FG2A 2WLZA 1FIGH 2V2XB 2Z93B 2YK1L 4XHJC 1G1CA 1RULH 5BCAA 4LSSH 1A4KA 4KI5D 4S1QH 1RZFL 2P5ED 4G9FA 5E2VL 4XVJH 4FQXC 3WHE0 5DI8B 4Z5RB 3HR5B 1IQDA 2DAVA 4RFNC 1DBMH 5CILH 4Z6AT 1X5LA 4GG6B 2Y72A 3RAJL 2HJLB 5HHME 1A5FL 2A9NL 4UU9B 4ONGH 2AK4B 2Q76B 4ISVB 2OMNA 2ID5A 1CG9A 4M7LH 1HWHB 3UTQA 2FX8L 3OAUH 1LE5A 4PJHA 3WD5L 2YUZA 1I7TA 5A40E 8FABB 1MHPH 1N8ZA 4R2GD 3S37H 1JNHB 3LS4H 3ROLA 4Q9RL 3DYMA 2OP4H 3N1QC 5EB9A 2ZJSL 1UA6L 4QYOA 4XHJD 3O6FA 1P7HL 4V1DD 3TYFB 3DO7A 3TJEL 1T0MA 1KCUH 2GYSA 4XAWH 4JFZH 2VJXA 4NQDD 2HMID 2PW1A 1NUFA 2BRRL 1QACA 2EDBA 4FQ1L 1ZAGA 4BK5A 1ZKAA 1KJ3H 1YYML 5JOFA 2GTZB 5DVMA 2NY5C 5GGVL 3GK8H 1J8KA 3VGFA 1RZKH 1JNLL 3BKCL 3MJ7B 3MLUL 1TXKA 4GRLB 3Q6GL 4WO4A 1K8IA 4JREC 2B0SH 4P2QD 3V4PL 5IB4A 4WTZA 5C92A 4HV8B 2HVKA 4WO4B 4FQ2H 1AIFB 3DURA 2XQBH 1J0JA 1ITBB 3JWDH 2C4XA 3GJFB 2H6PA 4KHTH 4L8BA 5KG9A 1AE6H 2ICWJ 4JFEB 1FFOA 2HFFA 2OS7A 2WNGA 1RHFA 4NQTA 1MFBH 3MLYL 4YR6B 5C0NC 3MZTA 3QDGD 1EMTH 1X5IA 4R4BB 4HF5L 4JEGB 4RAHA 1QRNE 4JFEA 4HK3N 3RVWC 3LN5A 1BVZA 4HK0A 3BRGC 4J4PA 4YHZL 4P2OC 2Q8AL 3MGOB 1E4KA 2CKBA 3B9KC 2VB5A 3K8MA 3SJVE 3LEYH 1RV6X 5BRZA 2VISA 1R24A 5T5NF 2I9LB 3UPCA 1X4ZA 1Q9LB 4MJ4A 2WBJD 1S7UB 2DKUA 1FGNH 4OCMC 1LP9A 2CMRH 3QULA 4JQVC 5EO1A 1EEQA 3QEGL 4U1KB 1EVUA 1FNHA 2X9WA 3GMLB 3EDJA 3CFCL 3TIEA 3VXTA 3G6DL 3MV8E 1WICA 1YEJH 4ODXB 4GXUN 1TTFA 4JRYB 4ODTH 3DRTB 5DS8B 2P8PA 2BVTA 3X11A 1YUHB 4GLRI 4NM4L 5E2TL 5IB2A 4NQXB 4XBPB 3Q5TA 3H9SE 4NKOA 3F58H 1SY6A 1GIGH 3WFBL 3EUUA 5GS0C 3INUL 4G6AD 3BP7A 5LG1A 4TVPE 1GCFA 4XB7A 5CBAB 1U41A 5EUOF 1I1YA 2X9YA 2X44D 1FO0A 5FGSA 1KIQB 1KJVA 1YEKH 4M5ZH 5ISZB 2FDBP 2GITA 4FTVA 1PD6A 5C1MB 1J05A 1MCPL 3GHEH 3PWJA 4PJIF 1ND0A 4LVOC 3AB0B 5GGTH 3B2UD 1DN0A 1TVHB 3LEYL 4RFEA 4F2MA 4NJAH 1IC7H 3O4LD 4NWUL 4RWYH 4Y5XC 4KTDL 3DIFB 3UC0H 4DCQB 1CDYA 4U1HA 1S7RA 3T4YA 4GAYA 2ZCLH 1H3UA 3KAAA 1BM3H 4IDJL 4A2MA 3QNYA 5FF6B 5A16A 5E6IB 4PJIA 3BH9A 5EPMB 5DK2A 5SWZA 1OTTD 2EO9A 3GMRB 4YHZH 2AKRA 1CGWA 3TA3A 3T1FB 3VXUB 4NP4L 4G3YL 5IJKC 2VLJB 4CMMB 5I1EL 1M1SA 5I15H 4U6XB 3GM8A 4NUJA 4PGJA 4PJGB 1MRFL 3RPIA 5TE4H 4F80A 3CXDL 3TBSA 1KIPA 1DQML 4KGLA 3ZKXB 4LLUB 3AMLA 3H3PH 1YMHA 5D5MB 2VNCA 3RNQA 2HWZH 1GSMA 3GMPA 5CD3A 5CZVH 1F4YL 1GOHA 3TT3L 3UTTD 4M7LL 2W65A 2NXZD 3CAFA 1PAMA 1M6OA 1N7MH 3DGGA 4WI6A 3TO4D 1RVFH 3TESA 1E6JL 4LVNC 1CDJA 1YEEL 4QRTB 5D4QA 2EDEA 3BI9X 4E41A 2YZ1A 1FZKB 1RZJL 3HHRB 1UH4A 4WHCA 5J6GB 2VOTA 5C0AB 3K46A 4Q9QH 1EGJA 1WWAX 3EBAA 3MGTB 3TJHC 3CC5A 4HIHA 3UDWA 4MJ2A 3UTSE 1QRNB 3HKFA 4JFZL 4DAGH 3MA7B 4AH2A 3U9PH 1VPOH 4G6FB 4ZUVB 4YPJA 4ZAKD 4DCQA 5CEZL 5IW6A 1WT5A 3QIBA 2DS4A 4QGYA 2Q6WB 3BEVB 1JYXA 4BM7A 5BMFH 1VA9A 2J6EL 1ZHKA 3MYZA 3L7EA 1X5GA 3FQUA 5I1HH 5K9OB 4Q97A 5F9DC 3DVNA 2LTQB 4QT5A 2VYRE 4NN6B 3SE4A 1T83A 1NBVL 4UAOC 3OR7B 4KZEL 1F6AA 1UM4L 3FB7B 2OZ4A 1CICC 3FJTA 5I1JH 4XNXH 4Z77A 1HXYB 4JQIL 3QCUL 5AYQA 2Q1EA 1CD1A 3O3DA 5EN2A 4AEHL 4HC1L 1MCFA 2OTUA 4LPXA 4PFEA 3SGEI 1YY9C 6FABH 1KNOB 4NN6C 2MHAA 2D7TH 4RGMC 1AXSB 4GH7B 3UTSB 1C5BH 4KUCF 3F7VA 5F88A 2RFXB 3G5ZA 3BGFC 1RK0B 5DJXA 4DGYL 1FH5H 5IUSA 1AFVL 3L3JB 2J12B 2FR4B 3WFEL 2P5EB 4R7DA 4PGDA 1BMGA 4M62L 1JNNL 3GSWA 5K59F 1JGLH 5D1QA 2PTUA 2EDHA 5I17B 4YFLI 4CU8A 1FBIH 1PKQA 3BKJL 2C26A 3GB7A 3CVHH 4PYGA 5AG8A 5DUBB 2F53E 2YA0A 4U6TA 4KVCL 1MOEA 5E08H 3VXSB 4N8PA 4LHUA 5DLMH 1U8HB 5HHOB 3L3KB 2MNUA 3QFJB 1WSST 5DJ0B 4OZHB 3VXMD 4ZFZB 3WS6C 5JO5B 1UB6A 4N0FB 3LKSA 1T4KB 4OCSH 5BVJA 3HC4H 1MAML 4Y2DA 3SDXA 3EGSA 4MA8L 4EOWH 3O45B 2E7LA 3QUYA 1JNJA 5J9PB 2OXGA 4MNQD 5KG9B 4N8CL 4HS3B 2XTJC 3FT3A 1L7IH 1Q8MA 1AGFB 4PGZA 4I18B 5C0BE 2R29H 5HGAB 4KPHH 4LP5A 3ZDZF 1OVZA 2DQFB 2R39A 4XX1G 4KKAC 3ARFA 4PJ7A 5KOVC 5J1SC 3JUYA 1QTYT 4NQDE 3KJ6H 3RGHA 3V52H 1FNFA 4ZS6D 3OTTA 4XI5D 5HI4C 3MGOA 2L7UA 3D39E 1IKNA 2DM2A 4XVTL 3V8OA 5FO8B 2WP3T 1P7KB 4JFDD 1AGBA 1XGUB 1P4IL 1QFPA 2VZSA 5DD1L 4XP5H 1INDL 3E3QE 3VFVB 4X6FB 4I18C 1RJZB 1QOKA 3T09A 4XTRD 2VLLB 1ADQH 1IGMH 1K8DA 2QJDA 1QFUH 1DDHA 4I9WE 1UH2A 3HE6D 4DGYH 5F7FA 3IETB 3MFFA 5EC2B 3MLRL 1XR9A 3GBMH 1MIMH 1LEGB 3UTTA 3LSOB 2MCG1 3AGVA 5F7LB 5I76A 3NCBB 4PJ8D 1VADB 2DLIA 1CU4H 4OZHA 1MFEH 4JFDE 4U7MA 3F12A 4I5BB 5DO2C 1IFHH 3CPLA 3S9DB 4MDIA 5D7SL 4HUMB 4DN4H 1RUPL 5A3ID 3PF2A 2BOBA 4X6EB 1V7NH 1JE6A 4GXVH 2FO1A 4WEBL 3MA9L 3VD4A 4UINL 4PJGE 4X8XA 5GSVA 3ZSTA 4LRNL 1OB1A 2PR4H 4IRSA 4ODHH 3MLVL 4M6OH 3OZ9H 3CFKB 5AYUH 3LKNA 3WSQH 5JPNA 1N7ML 3FB6A 3MRNB 1MJJA 4RIRB 5DRXB 5FGCE 4JN2B 1QEWB 1I1AD 1HHGA 4Z78B 1F6FB 2VDLL 4UT7H 2QR0B 5KW9H 3KJ4C 4AYFA 1GOFA 1DL7L 3A6BH 4FFVD 2R29L 5IVXF 4WV1A 1M71A 5KVEL 1FNAA 5I71B 1S78D 3C9NA 3EOAA 3LIZL 4GSDH 4JDTH 3VE0B 5DD1H 1HIML 2AJXL 3LQAH 5CGYC 1LEKA 1MWAA 1CLZL 3QO1A 4L3CB 3GKWL 5E8DL 43CAB 5FCSH 3JTSA 4L8CB 5EO9B 3GIVA 1WBZA 3MJ8B 4XCNA 4OF8A 1CQKA 2Z92B 1XGQA 4GQ9L 5GGVY 3BDYL 1AR1D 4UT6H 2R8SH 1A6ZB 1P2CA 4HBQA 5EOTB 3EHBC 4UV4L 1H3GA 4X6DB 1YEFH 2BNUA 3DUSB 4Z7VE 1IEBA 1TJIL 3V0WL 3QDMD 3KYMB 1BJ1J 4P2RB 4L4VB 3NFNA 1CDCA 2FH8A 1YPZA 5EUKB 5T3XD 5ADOL 5SWSD 3GRWA 4KKLC 4XBEL 3VH8B 1UC6A 4G8EA 1GZQB 3LQZB 5F6IB 1OY3B 3H9SA 2IGFL 4LCCB 4HDIB 1KPUB 1JMXA 5FGBC 2EYSA 1DQDL 4JKPL 3DRQB 4MJIA 4PS4L 4OB5L 4HAFA 1BPVA 2VABB 4HC1A 4HS3A 3B9AA 4HDIA 4XP6H 4XNXL 1YMMB 4WUUB 1ZLWH 1UQSA 4JM2A 2ZOLA 1TETL 4I3RH 4XPBH 5GISL 2EDOA 4WFFE 3LV3A 4I4WB 3BZ4B 1RFDH 4YHYB 4C56D 2HRPH 5DHYA 5DS8A 2OI9B 1LE9B 4P2OA 1ORSA 4WTXA 1IGCL 4P57A 3SDYH 4KRPB 3VE0A 1C1EL 1WAAE 2B4CL 4XRCB 1SEQH 3CVHB 3U0PB 1HXMA 1I1YB 3DXAA 5DDHA 4QRSB 3CLFH 3MV7E 3VXRB 5EU3A 4ZUUB 3S88L 4EI5C 2DYPD 3MSPA 4PJDF 4NKOB 1D5IH 2ZUSA 4NWUH 5FYJU 3SY0B 2WBWB 4CJ1A 3HTLX 3MXWH 2Y5TB 4KJYB 5B3NA 3VWKB 2B7DT 1S9VB 1MJ8H 2E9JA 4PJXA 2X4SB 4PLNC 3EZJB 2VH5L 1KJ2L 4R8WL 5IF0A 5GZND 1A7NH 1FYTE 4HGWA 4JFXA 3ZYZA 2CRZA 2PN5A 2ADFH 3VRLF 4OM0L 4LCYB 3C2AL 1MCKA 1P9MA 5EBGA 4DN3L 4FABH 1EUTA 3MRGB 4M4RA 2ENYA 1YNLH 4HX1A 3W9EA 4MD4B 4W6WB 3ULUC 2BC4A 4QWWD 4NO2B 3B9KB 4XPAL 2IEPA 3U30C 2GTWA 3I02B 5KS9B 4N8VA 3HNSH 4NKMB 2GJ6B 3VFMA 5EU4A 4Z7WF 2IANE 4JRYE 4EI5D 5T3XH 2X05A 3RHWK 1BBJA 5K9QI 2HN7B 2OMBA 4LCWD 3ISWA 4GW5B 1WBXB 5TDOA 4HKBB 4LSUL 5DF0A 4N9GB 1IZKA 2H1PH 4QTHB 4JZOB 4RAUA 5EUOE 3ARGB 3KR3L 3O2WL 1BFTA 4OLVH 3QB7C 4FABL 2V7NA 3X12A 1MCIA 8CGTA 1HQRB 4M8VA 4JZNB 1XEDA 1PZ5A 1MCNA 5D71L 3FFCA 4XMLH 4PJEF 1FZKA 1T2JA 3LZFL 4AIOA 4F7MB 1TQBC 3UBXA 4MYWB 4CN6A 2BNRE 4O5LL 2AK1L 1YMME 4LLMA 4WUUE 5JQHC 5CKGA 4AJ0A 1RUKH 4YPGB 2AK4E 4ZD3H 5L8LB 3RVWD 2A9MH 2H26B 2E3VA 1D6VH 4P2OD 5DK0B 3MJ9A 2ZOKB 2JJSA 4Y4KD 4DZBA 3NCFB 3QEUB 3L3IB 1A4JA 3C8DA 3O6FC 4GRWH 3WLWC 3F65A 5KVMC 5I74C 3IRZA 3MRLB 1MHCB 4PRPD 1MLCA 4CMMA 1EH9A 1ZLSH 3QQNA 2PYED 3HZMB 4LKXA 5C08A 2Y25A 1QFUL 3OXRA 3K4DA 5TPWH 3ROOA 1UA6H 5FYKU 4Q6YA 5ANME 4PGEA 1Z0MA 5I1AB 3NGBC 2A38A 4LLDB 1KIRB 5EH1A 4JG0L 5DRNB 4L4TE 2CIKA 4NQCE 1NBYA 4ZTOH 3HUJE 4K3HA 1JUFB 5DRZA 4LIQE 1I9RH 1XGPA 4OZHE 5H8DA 2DJ4A 3BMVA 1NKRA 4GFTB 1GH7A 5I1LA 4XWGH 2BVQA 1SEBB 4HIIB 4OZ4B 4X9HA 2DM7A 3B9VA 5FM5O 1IQDB 1JPSL 4OLZL 3KPQB 5C0BD 1G9ML 4XCFL 1DQDH 2R2HB 4PP2B 3TWCH 4PJ9B 4WHTA 1S9VA 5ISZA 4IIQB 4U6YB 4DQOH 4MQ7B 3EYQD 3WLWD 3FO1A 1MHPL 1FJ1B 1SJHB 3X3FH 1U42A 1NFDB 1EFQA 4JPWL 4YHPA 2GCYB 3DV6A 1T1YB 1BQLH 1FG2B 4KK9C 3FT4A 5KAQG 2GSGB 4NO5B 1XF3B 2FCBA 1TVBA 1VFAB 4RFOH 4C83A 3LKNB 5JPNB 3C2SA 3RHWF 3G08B 4L4VA 2R0WH 4U1LB 4Y4HC 4OZFH 3X11B 4JDZA 3QIWD 1TCRB 2X7LA 4TNVF 4OGAD 4MZ3A 4BFBD 1Z5LA 2EH7H 1I9JH 3BN3B 2EZ0D 3K4AA 4LSPH 1NEZG 2OJEB 3EFDL 5CP7A 1KIPB 5JW3H 3FOLB 3EO1A 1OGAD 3EJZD 4KJQC 1A2YA 3HRZB 3JTSB 3MRPA 5FYLE 4L8CA 5GHWL 4UT9L 3FFDB 3L5XH 4PB0L 4FFYH 5DC0A 3HPJB 3U4BL 3M17A 4Y4HB 3Q6GH 3C6LA 4XBGB 2W9LA 2YA1A 1NGXA 4YHOH 1S5HA 3PIQA 5GGVH 4LSQL 1M4KA 1O7VA 3QA3B 4P2YA 3BXNB 1R6VA 4NQDB 5KSUA 4N9OB 4PTTB 3TO2A 1IBGL 4WU7B 3TO4C 3T2NL 4M6OL 1MIEL 5ANMB 2GAZA 3EO9H 3F6LA 4GMTL 1S7RB 3T4YB 1XAUA 3IAPA 2BVOB 3OGCB 2JF1A 4NKMA 1JRHH 4KFZC 2UZIH 1NL0H 1J5OL 3KYNA 4FRWA 2XNAA 4I4WA 4NHCL 3W2DH 4RWHA 4YFEA 3KPPA 3BWAA 1R0AH 2FGZA 4PV8B 4HD9A 2HJLA 4OCWH 4ONFH 2I27N 5KSAA 4CMHB 5DURB 3MOAH 4P23B 5C70A 5FHBL 1CGXA 2XTJD 3ZDYE 4OI9A 3LOWA 4M7KL 4ZAKC 1JZ6A 1ZSDA 4YHKL 1QKZL 1RULL 3QO0B 2NY2D 4ZFOA 3L95A 5BZWB 1CFSA 3HG1A 5FB8B 4LHUD 1QHOA 2DLGA 3PJSA 3Q3GB 1NCAH 1OTSD 4P23D 2WV3A 2YSSA 3EOYG 2MKWA 3LCYA 5E1HB 4DZ8A 5FYLH 1DLHB 4B7LA 4HLZH 3TBTB 4JLRA 3V8CA 5I1HL 4JM4L 2KUTA 3WUWA 1V7NL 3H0TA 4JN1L 3RDTA 2P5EE 3CDYA 1BVLA 2AJSL 3D39D 4NM8H 3MLTB 3PWPA 4P4KA 1QP1A 3BH8B 1WZKA 5D1ZA 1BQHG 5M7QA 4Z7VB 3VI3E 4WI3A 4YHNB 2QLVB 3ARTA 1AQKH 2FL5B 3Q1SL 3QHZL 4KKCC 2PO6B 4ZOBA 1BQHB 3EOAB 3HC4L 2FX7L 4YFDB 1IM3A 2Z8VC 5C08B 5AD0A 3JZ7A 4DOHB 1OP3H 4LOUC 4PR5A 5E8PB 1DE4A 2XWTB 2AS5M 4E41E 4YHOL 4CU6A 3ESUF 5D1QB 3QUKA 4Q6IA 3CFDA 2M26A 1QPXA 1KXVC 4OUUB 3RX7A 2Q20A 1WQVT 5E9DB 3BFOA 2ADIB 2FWOA 2ZCLL 2A83B 4YHKH 5A2FA 4RGND 3AB0C 4GAGH 3V6ZA 5HHOA 3RI5F 3TVMA 2P48B 3O4LE 5DRWB 1DQLL 2A6IB 3F7VB 5BVPL 4KUCD 3WKNA 5L88L 1LEIA 3MXVH 3UYRH 2VLKD 4KVCH 1BFOB 1G7HA 2CKBB 4KDTA 1Q72H 1T83C 1Q9WB 4XXDA 1Q0YL 1S78C 5E8NB 5HHOD 4G6KL 3LQAC 2EDWA 1GHFH 5HYSB 2NW3A 4X4XA 5IHBA 1BFVH 3ZKXC 4OFYD 3ARDD 2AJSH 4HWBH 3M1BB 1G0XA 4QTIH 3MUJA 1EHAA 1EFXA 5KANG 4WWKA 3P9LB 2WWKT 2LVEA 5J6HA 2VQ1A 1OW0C 3D85A 2BVUA 4O58L 4O2FA 2AEPL 4PJDE 2R0WL 3D18A 1OM3L 4YQXL 3BOVA 5LKNA 3UPRB 3ZHDA 5CCKH 1KGCE 2P4AB 4NSKA 1MPAL 5KS9E 2X4OA 2SEBA 5JW4M 1K8IB 4Y5XB 1YY8B 3IJYB 4XTRC 3EDEA 4OZFB 4ZTOL 4JQVA 4QRRE 3L7FB 3WFEH 5JHDE 3GI8L 2VLMD 1UM4H 4LF3A 5CEZD 1MJ7L 5I66A 3E2HC 4QHMB 5IFHH 4NO5A 3BEVA 5E0QA 1IL1B 1X7QB 3VU2A 5MERA 1PEWA 4PB0H 4I5BA 4NNPH 3BGMB 4GOSA 2XV6B 5DJCB 4K71C 2OBGA 1CXFA 15C8H 3CH1A 2QHRH 1XIWD 3X14A 2DICA 1MJJB 4H0GA 1LMKA 1HSBB 2V2WB 2BVEA 3QXWA 3X3FL 4L1DA 3VGAC 1EIBA 1J0ZA 2NXYD 1UM6L 4FHBD 2JCCF 3P2TA 4UDTA 4KRMB 2MJWA 3LS5L 2FJGB 2UZIL 1AQDA 1D5ZB 1FDLH 2FNBA 5BRZD 3ARXA 3D69A 4PUBH 3P9MA 4GMTH 1JP5A 4O9HH 1IGTA 1C5CH 1JWSA 1VFAA 3RNKB 4EUPB 2LQRA 4GW4B 5DTFB 5BOZG 1R5IB 1S3KL 2VLJA 3BKMH 5HSFA 1X5HA 5C0EA 1IGTB 3ARGD 1JNNH 1F42A 3CX5J 1T1WB 4MS8C 5GS2D 1MRCL 4DEPC 2YXMA 3BN9C 2VSCA 3OQ3B 3QWQB 1TCMA 1J0YA 1FL5A 5B8CA 1WIUA 1TJIH 4HJJL 4JKWA 3WDIA 1RURL 4KI5C 1BIIA 1RPQA 1ZVHA 1LNUA 4U6YA 5F1IB 2D4DA 3EHBD 2BNQE 4NNXB 3B3IB 4GQPH 5IJKA 1IL1A 4N0UA 4TTDD 1OL0A 4F7PA 2L4OA 4JFFB 2JJVA 1WGOA 3B83A 1QSZA 3G5YB 4G8GE 4U1SB 5IBLD 4KKLD 4RAVA 1PBYA 1A4JB 3NIDF 4JVWA 3MUZ1 3U0WL 5JHLH 3L9RA 1QHPA 4Y5VB 5GRVK 3QQ3A 3W39B 3EYVA 3W0WE 4RGNE 5I8OH 3DNKA 4LKCA 2QHLA 3BPOC 4ERSL 4XMPL 3ZE0E 1CK0H 4LNRA 2VXVL 2EDRA 4XNZC 3MROA 1MREH 1MCHA 1G9NH 4ZFOL 4XP1H 5CP3H 3MOBH 4HGMA 2AQ1A 3LRSA 4JRYD 4JZOA 2FWOB 4RAUB 4WI8A 1RY7B 5C3LD 3ULUE 5KJRL 2N7BA 3P4NB 4HS8L 1CL7L 2Y1VA 1JF1B 4LLYB 4Q9QL 1KSRA 1NBZB 5E4EC 4G6ML 3OV6A 3RKDD 4F58H 2IMMA 2W07A 1G7JA 3DX8B 3IXTA 5ECJE 4J6RH 1YEGH 3GMQA 2DJSA 2WBJB 2P47B 3DETC 4HKJB 5T33H 5J1TC 4P3DB 1MJ8L 5HYSA 4JFFE 1XMWA 4RNRA 1NDMA 4D0DB 5LWYH 1FC2D 3SBWA 4LLQA 5AZEH 5IM7A 1BZ9B 3LQAL 4WO4D 4F8TA 2P5EA 4R7DB 4S1SL 1EHXA 3L3GA 4JFED 3S4SA 1I3RA 2GTZA 2XA8H 1EERB 3QSKB 1G6VK 5JIHA 1CN4A 4YDJB 2IAMB 3ECBB 3KVQA 4TUJA 3KYKL 1Y6MR 3K1DA 4RGMB 3ULVE 3SPVA 5JDJA 4ZXBA 2WP3O 1C5DA 1IM9B 2VDQH 2Z91B 3VFGL 3OXSA 3GMMA 3CFJA 3KPRD 3BIAX 1I4FB 4UILH 2IG2H 4MD4A 3RX5A 1HEZA 2H32A 1R5VB 2NY1C 4YXLL 3BGFB 2W0PA 5K9QG 4GT7A 4J3SA 1I9EA 5L7XL 3A67H 3OR6A 1YEDB 1MFCL 1KIQA 4FNLH 1G9NL 1XF2B 5FGRA 1BQUA 2G2RA 4QY8B 1KIUA 4R90L 2UZXB 4NQDA 3GB7B 2APFA 1FNGA 4AIXA 4BSVA 3BKCH 4RRPG 5FA4A 5IKCB 4G7VH 4G6MH 3VA2C 2IG2L 2WZPD 3ZO0A 3K3QA 1CE6B 2ADJA 2IPKB 3A6CH 4LCWA 2D9QB 1AH1A 4PR5B 2DMCA 3ROLB 2NCMA 5EBLB 4ZSOE 3RIFF 3MUGB 1DUZA 4RISH 1MVUA 3HS0A 2CK0H 4X80H 2JB5H 2J1KA 4K94C 3DV4A 5DFTA 4KRNA 4KQ3L 1YDPA 1ED3B 1GZPA 1QR4A 1YNTB 1A6AB 1X5YA 4X4ME 1G6RA 2WQ8A 3HRZA 4OUOA 3VXSE 2GY5A 3BWAB 3QXVA 2UWEA 32C2B 5HPOA 1KUMA 3JWDL 4HH9B 2JJTC 5HGBA 3ZT7A 1OWWA 5FDYA 5ELIA 2FX9H 4NBZB 4OAWB 4RZCA 5F21B 4PJ7E 4MAUH 3V4VH 5KSVA 1IGCH 4HUVA 1KT2B 1YN6B 4NZTH 2FGWH 2FJGA 2IH3A 5CJXA 1ADQL 2JJSC 1CVSC 4PTUB 4V1DE 3O2VH 2R2HA 2Z9TA 3OJMB 1XF4B 2WIMA 4ZUWA 3GSNL 3HNTH 4LCUA 3OKNB 3GGWB 4W70A 1I3VA 1DLFL 4GUPA 4X9GA 3TYGL 5I66B 2B4CC 2VLJE 1NAKH 5IB2B 2XZCL 3KPLB 1CU4L 3MODL 4JB9L 1DR9A 4CGTA 4LCWB 5E8PA 5A2JH 4HULB 1L0YA 1CYGA 3D6GA 1J8HB 5T3ZH 1FZOA 3FHAA 5TDPA 3NGBB 4X9FA 2K9UA 2V2WA 5DEFA 3VRJB 5FUOL 2E7MA 5D7JC 5GQBA 4JHWH 5EC1B 2FLBT 2P42B 4Y0GA 1IAKB 2BOBB 4X6EA 2NXZC 3EFFA 4KRPC 1QBLL 2HTLC 3GO1L 1RZIA 3DBXA 3HE7D 3EOTL 2CLZA 4BZ2L 2BERA 4UT6L 4OGAC 4GKNB 1D6EB 3NABH 4YHYC 2P8PB 3RUGE 4DEPB 5I76B 5ETUB 2D0FA 3HI1B 3LIZH 4WV1C 3F7QA 1P7QB 1KEML 3WHXA 2CDEA 1IAII 2VKWA 1KT2A 3H42H 3MXVL 3UYRL 3WMSA 2VLME 3MUHL 2FL5A 1NH6A 2LV4A 3U0TA 4LSVH 2A6KB 3U1SH 2GK2A 2FSEA 1UJTA 2XWJB 1JGLL 2DTSA 1CDHA 5DGQA 1E27B 1L0XA 2ARJQ 2GSGA 4ZOAA 1A5FH 1R5WB 1F8TL 3WXVL 3KYNB 3O2VL 1A1OB 4RRPA 1UCBH 5KBNC 5DJZB 2D9CA 1J1OH 4K7PL 5JUEL 2FGWL 1KULA 4LHJB 3U83A 4ELMF 3BO8B 1YC8A 4P3DA 3BP4A 4CN1A 1FFRA 1QSEE 1KC5H 2DB8A 1F58L 4J1UA 4E0RA 3IDNB 3MV9B 1YNKL 2AXJA 4NNPL 4F9LC 5JPMB 1RD6A 4Y1AE 5IG7B 4X6DE 2BSSB 1ZANH 5CP3A 4OM1L 5I2IA 1I3GL 5CIPB 5F7KC 1GGYA 3GI8H 4H8WH 4DGIL 3EYOA 3NIFE 1MY7A 2NY2C 4JFPB 1JV5A 5C0RH 1I7ZB 4PJHE 1U3HC 3OMZA 4Q2ZA 4KTEL 2WUCL 3U9UB 5DJ8A 3H0TB 3L9RB 4H25A 2YBRB 4X4ZA 3EOTH 4L4VD 1JV5B 1AJ7H 4FQQB 1MFNA 1E4XL 1LP9B 1JGVL 4IMLA 5D1ZB 3ORJA 1PZ5B 2VERN 4ZTPH 4XPHL 3QWRD 2P24A 4J2XA 1CS6A 4YO0A 1FQ9C 4PGBB 3GRWL 4OFDA 3PHOB 3V5DA 1FFPA 3R1GL 5DHVB 2HRPL 4PRBB 1DE4B 3AREC 4KRLB 4QXUL 1KF9B 1TITA 4OF5A 4YC2C 4YHNA 2IAMA 2JK5A 3ECBA 4R4BA 4LPCA 5IMKA 4RA3A 3IFLH 2NX5A 3GJFA 2PYFA 4PP1D 3S5LG 1WAAA 1EO8L 3H3BC 4LSUH 1N5AB 1Q9LA 1P9MC 4H0HB 4M1DL 5DC9B 2BVPB 3WFZA 2YC1A 1D9KA 3NBNA 5BO1L 4P9MH 2VAAA 1T1WA 4U0RB 4PV9A 3O9WB 4MA1C 4JFDA 5DC4B 2EH8L 2ICWI 3NCCB 4HWZA 4N0UB 2NY7L 4Q58C 2RCSH 5C07E 3SCMD 2VDPH 4KC3B 5TJWK 1A6UL 1L6XA 5LAXA 5B38A 5CJQH 1BZ7A 4MB3A 1WJ3A 3QBTB 5D8JL 3O9WC 4MA1B 1P7QA 2FO4A 3AS1A 3C09C 3L3DA 4JHZA 1MJUH 2XTJB 3DMMB 4PJCA 5I8OL 1AXSA 5ACMA 3TC9A 3HCVA 1B4JL 2WBKA 4ESKA 2CDGB 3BN9D 1INQA 3F62A 5EIVA 5EU5B 3G04B 3MROB 3MRLA 4FZEL 1IAOA 3W81A 3GDBA 1ORQB 3DTXA 5F7EH 3E6HB 3D25B 5HYEA 5BS0D 4LVHB 5JLZB 4TN9A 1IAKA 3P3YA 2ZUXA 3WJLC 2BFVH 5JDSB 2QSCL 2OL3A 3HAEH 4BZYA 1GL4B 5FV1L 2BXZA 4YWGH 3CDFA 4KJWD 1F5WA 4U2ZA 2DQGH 2X42A 1A21A 1PYWB 1SJEB 1KCUL 4TVPL 4LLDA 4PD4J 1DBKL 2EECA 4BQBA 3A0OA 5DQDL 4KTDH 3RNQB 4EN3D 2X7LB 5BV7L 2ITCA 2NY5H 5KSBB 3IDGA 3KPLA 1PZUB 4WUKH 1A8JH 5EFIB 3OB0H 1S8DA 1Q38A 3RIAK 5TDNB 4ZPVB 1VENA 4GKZA 3SJVA 4Y19D 5FM5M 4XVUC 4G80A 1BLNB 3X17A 3L7FA 5DUPH 3HLAA 3BUTA 4XP9H 3THMH 2R2BB 4CW1B 4ZUTA 1U8KB 3TYGH 3FMGL 3WL9B 3CUPA 2AJYL 2BZDA 3ETBF 5FUCC 1FL3A 1NCWH 4ZDHB 4H25B 1VGKA 2ED7A 4HT1H 4L8SB 3V4UH 5LQBL 3D3VA 2CIKB 4K23H 2R69H 1IGYA 3S37X 2ZNWA 4IHOA 2AXGA 2DQFA 3HE6A 2ZOLB 3RVTC 4LLAA 5E56A 4X6CE 2AJVL 3WFCL 3IU4H 1WZLA 2FBOJ 3QWOA 1S7WB 2R56H 1X6LA 3C5ZC 2XYCA 1I9JL 5CZVL 2DI7A 4OV5A 2LU3A 5SX5K 4CNIB 2P5WB 4WO4C 3N06B 4NBYB 1BEYL 5KAQF 3ROOB 1KCSL 2R4SL 4MNQA 3VXPB 3AVEA 2R4RL 1ES0B 3TPUA 3HAEA 4WFHD 5FKPA 3QXAB 1MEXH 5D2LB 3L5XL 3BRFA 5E99H 4NCDA 2WIIA 4HPOH 1PVHA 4O00A 4HS6B 4MQSB 3D85D 4POZD 1CLYL 2OCFD 2YEZA 1A9EA 2GJ6D 4WW1A 3ZMRA 5H94B 1GOGA 3PXHA 3TWCL 4WCYL 5I1GL 4YX2L 4AM0A 3QRFM 3QQ3B 5I17A 2EKSB 3FMGH 4XCYB 2A83A 3VDAA 1BFVL 2DWDB 5JHDD 4JFFA 2HH0H 3VXRE 5JA8B 5I1CH 4AIZA 1YEKL 1FIGL 4LLWB 3FL7A 2NY6B 1R3IL 3ULVD 4XAKE 2ESVE 5F88B 4TQEH 1KLUB 2ZKHH 2DQTL 5JO5A 2GTWB 2VZ3A 1JHLH 3I02A 3P73A 1ACZA 4KKBD 2EYSB 2AJYH 2QQLL 4XNYH 2FHBA 5E2WL 5EN2B 1W0VA 1A1MA 3G6JE 2HJFA 1WBYA 3MCLH 1A3RL 1JGUL 4TPRL 3N1MC 2V7NB 2R0KL 4W68A 3LKOA 2H6PB 2AP2A 3R06A 2RHEA 2ZUTA 1YYLH 3B5GA 4XMLL 1CDGA 4ERSH 4ODBD 4YQXH 1DLHA 4F9PC 1N6VA 3B5TA 5JZ7D 2NY4B 5CIPA 3EKCA 3LN5B 5GJSH 5ILTH 4QWWC 5DSCB 3WXWL 3H9ZA 1FCCA 3IF1B 5GS3A 2A9ML 4PTTA 3TO2B 4PGDB 2MMXA 1G7QA 1CDIA 1MRDH 1A7RH 3P11L 4NPYA 2X4UB 4TULL 3JWOL 4MXWH 3ZLQC 5D7LB 5KTEL 4IDLA 1PY4A 1BJ1H 4K3GA 4RQQA 5CWSB 4OCRL 4MCZB 4NDMB 1U8KA 3WN5B 2ZSVA 2R4RH 4ZFOB 4L8BB 3PHQA 5I8EA 1A7OH 4Z7NF 2V17L 1HWGB 2NY7H 1U91A 2ZG3A 3ARBD 4RGOH 1HHIB 3LEXB 5HVHB 1C12B 1S9YB 1NQBA 3QFJA 5AZ2L 5ADOH 2E6JA 3QP3A 2YPLA 3NAAH 3MRBB 1CLYH 3STBA 4IHOB 5CSGA 4KHXH 3O6LL 2I26N 1DBKH 4BFGA 3TCLA 3QDMB 3VFNB 4MJ6A 1U2CA 3FO0L 3OKKB 4DUVA 5GJTL 3D0LA 2W1NA 4BK4A 2PO6C 3FQXB 3RWGB 3U36B 1CZ8H 4HF5H 4DW2L 3MFGB 4HKXB 5SWSB 2C3GA 3QHFL 1CFQB 2BHUA 5C0CB 3W5MA 4ETQA 3H3KA 2A0LC 1BD2B 4EJ1C 1RJLB 3RL2B 5C0CA 2LU4A 1MI5D 1MCWM 5DYOB 3MLZH 3WNKA 4ALAH 5I16B 3MRNA 5DRXA 1HZHL 7FABL 5GSRA 1A7PH 1RK1A 1PYWA 4TVPD 1Q1JL 5FK9B 2WANA 5C6PB 1EFXB 2Y5EA 1IFHL 4WW1B 1CWVA 3FQTA 5FYJD 3KJ4B 1UACH 3TF7C 1WLHA 4PLOB 1B9ZA 2YD4A 3IDMB 3M8OH 4I0PD 3RZCA 4YEEA 3MLRH 2DQUH 1KN2H 3AROA 1OGTA 2ERJB 3C6LD 4JFQA 4YIQA 3NACL 5IFJB 1IT9H 4M4PA 3DXAD 2X41A 3PUCA 3DI3B 5LXGL 5I30H 4C83B 2NX5D 1U8NA 3CZJA 1KJ2A 4U6XA 1UYWH 3QNZA 4JM2F 4ZO6A 3SE4C 4TSCL 4G43B 3SKMA 4KTEH 4ZPTA 4M5ZL 1NGXB 3Q5YA 3VH8A 3KGRA 2FO4B 2EYTA 5EOCJ 3DVGA 3L3IA 3CU1A 1B88A 3WE6A 2XN9B 4NWTH 1NDGA 3VFPA 4PRHE 1T4KA 1AD9B 4G8FA 1OQOA 1I7UB 1L7IL 4UNUA 4B7IA 4RIRA 5F96H 3MMEB 2HYMA 1A6UH 1LEKB 1PEZA 4TUKH 3T3PE 4FTVB 2UWEE 4XH2B 3N85L 4CW1A 2HLFD 5HI3D 2R2EB 5CILL 3HS0B 3V52L 3C6LC 4QXUH 3T65A 4FTVE 1NCBL 1KB5B 5IW1B 4MD0B 2Y6SC 5C9JA 1U8MA 1U6AH 1KEMH 2FX7H 3WJJA 4LSSL 3BSZH 3HPLB 1Z0NA 1T1XA 4MJ5B 3LKPB 4A2LA 4R0LA 5BJTB 3NZHH 1FG9C 4PRBA 3HNVL 5FYJL 3BD3A 3F5WB 3SDDD 1QSED 3PDGA 1ERNA 3NCJL 5KVFH 2GI7A 1CT8A 3RX8A 4B53A 4ENEC 4ZG1A 5DZLA 1A02N 4YEFA 4HLJA 3PWVB 1HH6A 2IPTL 1S7WA 2Z8RA 1U3JA 1WEJH 1NLDH 4OZFA 2Z4QA 3E6FB 3MV8A 4G3YH 4QGTA 2CQVA 3GMNB 2OTUB 4IEFB 3IF1A 3VXOB 1NJ9A 4L5FH 5D8JH 1UJ3C 5EZOH 5A2LH 3C60A 3IFOA 2RCSL 3VFRB 4JO1L 5CBEB 1U95A 3U1SL 4KKNA 5D2LA 3ARVA 2DQEH 4C58B 3QHTC 4TULH 1KLUA 4QT5B 1R5VA 4L9LB 2HKFH 5K9JL 2RQ8A 4OIIH 2VLRE 1A0QL 1NDMB 4ZODA 4JO2H 1FSKC 1L7TL 1MFDH 4FFZH 1SBBA 3MRIB 2E27H 2DTML 2WK2A 2R23A 1NCBH 3QI9B 2PTVA 1NSNH 4MD5B 4PJFA 1DUYB 1KJ3L 3QUKB 4Q6IB 4PJXF 5F1NB 2EKSA 3CC5B 4XCYA 1U8MB 4GW1A 4YHIB 4YDLC 1F58H 4O2CB 4ENED 4HG4K 1QLEL 1AY1L 4XVSL 3QUZB 5HHQA 2R1WB 5CKAA 4JKKA 3VCLA 4JFHE 5E8EA 5KSBA 3BZFA 1F3RB 1N59A 4A6YH 3SE9L 4I3SH 5HHNB 1X5JA 1NEZB 2D2OA 4XP4H 4Z76A 1I7TB 3K2UH 4JG1L 3GRWH 1U6AL 1MF2L 3DWTA 3NIGF 4U1SA 3RPKA 3DLQR 4QF1B 5DJ6B 3WN5C 2PW1B 3QYCA 1PKQB 2K7QA 2ED9A 4NNXA 1LK3H 3JSSA 5I8CB 4HJGA 1CF8H 4MAUL 3V4VL 4QRPE 2O5XL 1ZOXA 3DO7B 2VR9A 5C0GA 5FA3A 5KSBF 1BIIB 4S1DC 5T1DL 1F3DH 4PJBF 3RGVD 2FEDD 3LQMA 2O5YH 5HDBF 1U3HD 5F7MC 3T0EA 3KG5A 3MJGX 3NPSC 12E8H 1UACL 4JR9H 1HKLL 4YBQC 1CXHA 2XFXA 5MP6H 1QVOB 3MV9E 4JJ5B 4EQ2A 4WFGD 3W2DL 3LZFH 1Y18B 5F44A 2FR4A 3LH2H 1T22A 3CFBA 4XPGL 5D2LF 4Z0BH 4OT1L 1LK3L 3CXHK 4QXTB 4M62H 3GIZL 3SBWC 1EZVX 1A7PL 1KCSH 5I30L 3ZDXF 5JQ6L 4TVSa 1P84K 4P5TB 5HHVL 1YPZE 2VIRA 1P2CB 1EAPB 1JJUA 4KY1L 3QIUA 5E08L 1WWBX 1FZMA 5BO1H 3PGDA 4RMVA 1Q0XH 1RIVH 2FECI 2GJJA 2JJWA 2QL1A 3RVVC 1JZ7A 5JW4N 2VLRA 1XH3B 4NFDA 4Z7WE 2ICWA 4Y16A 3P30H 1QLEH 4PYHA 1UEYA 2DQDL 3AAZB 4OGYH 5B22A 1NUDA 4LPTA 2G75B 3NCMA 1RZKL 1DQQA 4OZIA 4HBCL 3RVTD 1ETZB 2ED8A 3NFPB 4APQA 1MLCB 2DM4A 3FAWA 2W59A 4JO3H 5M94B 3K74B 4NCC2 1OPGH 2VXQH 5KZCD 1HZHH 1JZ8A 2E5EA 5HYJE 1NCUA 1YYMH 1OB1B 3CMGA 3QEUA 3D3VB 4QHNA 4S1SH 1WF5A 1ZT4A 2CIIA 4FZ8L 1QEWA 2ATPB 4O51A 2CO6B 1NBYB 1G9EA 4HFWA 3I6KB 3O2DH 2N4IA 5C08D 1IZJA 1HSBA 2ATPA 4O51B 3KYKH 4HEPG 5IMKB 2A1WL 1VDGA 4UDTB 3UO1H 5IQ7H 1L9MA 3KPOA 1ZA3B 4MQTB 1Q0YH 1QUNA 1H0DB 1IAOB 1FORL 1S9WA 4FQJL 5JHDB 3P0VH 4K3EH 3CFJB 3WFDH 4KJPD 4XC3L 4PY7A 4HS8H 3GMOB 4OLWL 2J8UF 4X7EC 4AY0A 5HYJD 2IPKA 1HHGB 3MCLL 4U05A 4P46B 4Z78A 3O9WA 4LDEB 2VO5A 1B0GB 3ZYOA 3AREB 4OJFH 1CFVH 1LO3H 4F57H 4DUWA 2DBJA 3W0WD 2IF7A 4OQTL 3NFSH 5IESH 2MQCA 1PLGH 5HYQB 3BPNC 4UMGA 2BY2A 4ISVA 4PJDB 3ZHLA 3IDYB 1NGZB 5HGHA 4G9FD 4P5TC 4FG6D 3D48R 1FAIL 4PJ7B 5JHLL 3U0WH 3NPSB 2XOTA 1WCQA 2D3VA 2M8XA 4P4RB 5EPMA 5B8CC 4J12A 4NO0B 4J3VA 1EVTC 4OI8A 4XVUD 2IBZY 4NSKB 2Q87A 4O2EA 1EBPA 5FYKH 2GFBA 1YECL 3ARGC 4Y4FB 1AO7E 3JUZA 1YQVL 3CLEL 1AI1L 4U1HB 3BPLC 4KMTL 1M7XA 4OCRH 2DKSA 2G60L 1NAMA 3V2AR 4FMFA 4QCIB 1GRWA 3O11A 5FO7A 4PJIB 5H37G 2NW3B 1O5DT 2F5BL 4H1LB 1AHWC 5KSVB 4HUVB 3H7BB 2RJMA 4GAJH 1WTGT 5FO7B 3TH2T 4ODWB 1HYSD 1EGJL 1TNMA 4WW2C 4KJPC 4NJ9H 5IBUG 2EIEA 4YZFE 1P4BL 1R3LB 3AM8A 5F97E 3SDDA 3GSRA 3CDGB 1D5MA 3UBXI 3OHXA 2HTKC 4PRAB 5DMKB 1U8IB 1JPFB 4KZDL 3CU7A 3VG9B 1WZ1L 4L9DA 5IMMB 2UVEA 4R26L 2FEEI 1P69B 2XPGB 5IBLC 2YRPA 3MJ7A 4YLQT 3C5ZD 5KN5B 3BD5A 4PY8I 1MVFA 5INCB 4XPTL 4F15C 3KYOB 1N3NB 5HYJB 4JHAH 1FL6A 3PGFL 4YBLB 3MX0A 3KYOA 2LTQC 2APWA 1X4XA 4NJ9L 1FHGA 3I75A 1W72L 4G7YL 1NL0L 3FQNA 1J5OH 1G0DA 5B3JE 3D39A 4POZC 5B21A 4L9LC 4MZ2A 1ZTXH 5JXEC 2KZWA 3SDAD 3IKCB 3FQNB 5EU3B 4ZUUA 2GT9B 5J7CC 3SHSA 1MEXL 4KDWA 3RKDC 5A2IH 1NFIA 3Q3GA 1KTLB 4UILL 3ZL4H 4PRIA 1B90A 1HXYA 2X4TA 3SDAA 2BK8A 4EKXA 4LVNB 4C59B 1NLBL 3GSXA 2MHAB 4CRPA 2A6DB 4OFVA 1CXLA 3FAXA 4RDQG 3ULVC 2NR6D 4GXUM 4Z77B 2DQGL 3FQUB 1I4FA 3ALPA 2D7MA 3L5IA 2B0SL 4RAVB 3OKLA 5E7FA 4XAWL 3RU8L 2I24N 4WFFD 4APQB 5D72H 3BIKA 1VGEH 2HG5A 3LS5H 4MDJB 4U6HA 1SMOA 4JJ5A 3BZEA 3RUGA 4I3GA 4X5LA 3QEQE 3AREA 4M7JL 1VCAA 1CFNB 1AR2A 3UYOD 4HGKC 2AJVH 3BXNA 3SDXF 1WFTA 4WEMB 5JZ7C 3DX7B 4P59L 3MRMB 4HPYL 1KB9K 3LMJH 3ZKMD 1RIVL 2JB5L 3G9VA 4F15B 1I8MB 3U7YH 5HXMA 3PP4L 4UIMA 1T6WA 4PRPB 4PLKC 3O2DL 5FYLD 1Z6JT 2YPLE 3BUYA 1NANI 3VGDA 3O3AB 3QUXC 1G6RB 4MXQC 2R0LH 5GJSL 1U8OA 2QEJA 3BP6B 3BUYB 3P77A 1REIA 4G80B 4NGHL 4X9BA 4LFHD 3UAJD 1U8OB 3JV6B 3O6FB 2R2BA 1B3JA 1YEDA 3M07A 5GGTA 3OKDB 3TFKC 3VFTA 3LKQA 2DQJL 2FHCA 3DVIA 3SQOL 1HINH 2X1XR 3DVGB 3MRDB 3BZDA 1F3DJ 4HKXA 4IJ3C 5SWSA 1EX0A 3AS2A 3AUVA 1FRGL 3PGCB 1MF2H 3BESR 1OLLA 2XI9A 4FQXA 4C54A 4P9HL 4FFZL 4ZS7L 2G9HB 5JXAH 3B43A 5C2UB 5FUCE 1JYVA 2X5PA 1CBVH 2WM0A 3MJ9H 9CGTA 1G9MC 1M05A 4J4PC 5BZDB 1BOGB 4QRUB 1E4KC 3D3VD 4JPKH 4LRIA 3TA3D 3QUYC 5HVHC 4W4NA 4OZIB 5IP4A 3H9YA 5JTWA 4RMUA 3DTXB 25C8L 4YHIA 4NQCD 4GBXD 4Q9CA 4WWKD 4LAQH 2FIKB 4MWFA 1KCRH 3VH8G 4I2XB 15C8L 5F3BB 4OGXH 3OB8A 1XR8B 4I8DA 2EDDA 4IBLT 4V2CB 3SKJL 2YMXL 4YDJA 4FQLH 3RVXC 5DMGD 1JHTA 1FIEA 1KYOJ 5L6YL 1XGRA 1RJYB 3K7UA 5FA4B 5T1MB 2VLKB 5D7JB 2X89D 4K8RH 2V7HA 3V9FA 1H5BC 1CFTA 4K3DL 3MGAA 4XP4L 1HN1A 3S35H 5IV2A 4XP5L 1R3IH 4QO1A 5BOPA 1CD9B 3MRGA 2HT4C 4CVZA 4Q0XL 1BWMA 1EO7A 1CI5A 4DAGL 2IC2A 1BJ8A 2UY6A 1ED3A 1GZPB 5DVOA 4BH8B 5F9JB 3TN0D 2F19H 1JYWA 3CD4A 1KENH 5GGSA 2ZUQB 3IDYC 4U3HA 2OTPA 4P2CG 1NFIB 4KRPD 4R4NC 1I7UA 1DFBL 5GRXG 5GRUL 2HT3C 2NXZB 1MELA 4DFIA 5C8JB 2DL2A 3FKUS 5HJ3B 3BO8A 5FO9A 1F4HA 4KQ4L 2AEIT 3ZYIA 4GMSL 1I3UA 4R6UA 3NTCL 4KROB 4NQUA 4UUJA 4JDVB 1A1OA 3ES6A 5FM4A 4GJTB 4M9PA 1OF2B 2Y6SD 4HV8A 5E6YA 1IEAB 2X4QB 3QDJA 2F53D 1FLRH 4N1CA 1T21A 4M1CD 3DROA 4K3EL 4M1GH 3VXUD 2HT4D 3UPRA 3QEHB 4FOMA 4K8RL 1O7SA 4WI7A 2F58L 1TTGA 4OIAA 3RFZC 4JO3L 4QHKI 3VFPB 3B3IA 3SKJH 5EZOL 2VDKL 2EXWD 3B2VL 4YDIL 4MHHI 5D1QD 3IAGC 3O6ML 1KTLA 1KYOK 1NC4B 3GKWH 5A2KH 1XZ0B 4LQ1A 1NKOA 2GJZB 1TQCC 5DFWH 3LPWA 3E0GA 1GZQA 3LQZA 4Z0XB 3QO0A 4KV5F 4R0LC 1C7TA 3ARDA 3PWUA 4WGVB 1UWGH 1SMAA 3JBG7 5T3ZL 1D6EA 4L8SC 1IM3B 3WO3B 1R3KA 2C1PB 1OWRM 3JV6A 2MCPH 2R1YA 2R2CA 4X5XB 5EZLA 3ILPB 2UY7A 1DEEB 3SCMB 1QFOA 3P73B 5HBBA 1TFHA 1D5BB 3MLPA 4M1DH 1SVZA 5HDBE 3D0VB 1YEHH 4ZUSB 2B5IB 3DX9B 1LO5B 1N0LA 2X4SA 3O2DA 1FH5L 4M61B 3KNBB 4F37K 2KBGA 2EXWC 5T1LD 4S1RL 3RU8H 3VD5A 5JOPE 2IAMC 4GRWE 2GUOB 1NGQH 3DXAB 4TSCH 1NFDA 2DN7A 5EOCH 1KPUA 3LH2L 3RP1A 1RIUH 5HDQH 1I8LC 3B9EA 2EIZA 1CFSB 5TQ0H 1LO0L 1HHKB 4KWUA 4QYOB 4EXKA 5CJ5A 1HCVA 4IRSB 2BY1A 2YRZA 5MEOB 2JCCE 5ENWB 3W11C 2YEZB 1T5WB 1SQ2N 3JV0A 4MA7L 2VDKH 4HIEA 2I60L 1YYLL 3QJFA 1ZGLA 2XN9D 5D70L 5CMAA 1I8MA 2DI8A 2ARJA 1RURH 1EXUA 1X5ZA 4RMSA 4LSTH 4LSRL 5CMAB 2MFNA 4HIJA 1LEIB 3WE6B 1PJ9A 4G7VL 2RGSA 5C0RL 1AP2A 2AKRB 4YBQD 3REWA 1VSCA 1JBJA 1BJMA 2JTDA 2PXYA 4TQEL 5MHSD 3BW9B 1AP2B 3KPRA 4OCXH 1I7RA 3GSOB 1RIHL 5EOQL 2XXCB 4WY7H 1MFAL 4U6HB 3C6SB 4IRJC 4OFKA 1LD9B 2X40A 3V4PH 1YN6A 5KS9F 1HDMB 2P8MA 4X6FA 3BPOB 4PJFE 3K1KC 4K9EC 3VI3F 4BSVB 3GBML 4LLVA 3UJJH 3NZHL 3ULSB 5E5RB 4M8QA 4MNQE 1QFWI 3RVVD 4PJHB 2FB4L 3QEQB 1FL3B 5GSRB 4DFHA 4MCYA 4DJMA 1ZWIA 4NHUB 4ODUB 4ZTPL 4JPKL 2VQUA 4S1QL 5J12C 1YEEH 5D6CA 3SEPA 4F7MA 4Z8FL 1MCPH 2BSTA 3TV3L 2QKIA 4N0UE 3D25A 5I8EB 1ZTXL 1JTOA 1TNNA 4PJGA 5I1AA 5D2NB 4OJFL 4U1MA 2YWZA 1UH3A 3VD9A 4NN5C 4Y2DB 4A6YA 3X13B 3I6GB 1C5DB 3KPOB 4YO0B 2I5YH 1VGEL 3H6JA 3QDHA 3QDMA 4YR6A 5IBUB 3SOBL 1T7ZA 4C56E 5LAXB 3KPMA 2IAND 3D0LB 4PRDB 4HFUH 3RWCB 1EA9C 4L3EE 4L9LA 4HW6A 3VFOA 2AI0H 1DVFC 3L5WB 5D71H 4QXGL 4NUGL 4NM4H 1UFUA 3OF6A 4DK3A 2PW2B 5I1LB 5DRWA 3JWDC