2EZ0D

Crystal structure of the s107a/e148q/y445a mutant of ecclc, in complex with a fab fragment
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ion-binding properties of the ClC chloride selectivity filter.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords H(+)/Cl(-) exchange transporter clcA
total genus 48
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ez0D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ez0D01
4JZOA 2F5BL 1FAIH 3UBXI 4MDJA 1C16A 3PP3H 1JNJA 1CWVA 2EYTA 3AAZB 3CX5K 4XXCA 1QZ1A 2XACC 3MOBH 2LQRA 2JF1A 1MLCA 4CW1A 1K6QL 1XF3A 4Y5VC 4BKLA 5IHUH 1GYAA 3PGFL 3PL6B 4O58H 4X6DE 2IG2L 1UKQA 4ELMB 4PJGA 4TVPL 3K4AA 1NAKL 4D0CB 2MQ0A 1F4AA 1T7ZA 1R5WA 1FL6A 4P57B 4GRWH 3T0DA 1HQ4A 5EIVA 2Q3AA 4LASL 4WFGE 2R0LH 5CILL 4Z77B 1EFXB 4H5SA 3HI6L 3FTGB 5DD0H 4MDJB 3MLXH 4AT6A 1BX2B 4HIEB 4KAQH 5EU5B 5JIPA 1OLZA 3VXPA 1MRDH 1P84J 1I9EA 1IL1A 4ZFOB 2QADB 1QHPA 2XTLA 1A3LH 2F5AL 2RB8A 3CSPA 2V5TA 1U42A 3P73A 2DN7A 3HG1B 2DJUA 3NACH 5GGRA 4EXPX 1G7IB 3BP5B 2R1YB 2V7NA 2Y36L 5DFWH 2LV4A 5DLMH 4LPVA 5KSBE 4PJDB 3D48R 1HHJB 2NY7L 4NKMA 5DS8B 2P5EA 2QR0A 1CK0H 1EEQA 1KCRL 1NCBH 2HA1A 1FG2B 1AGEA 4L3EE 4EI5C 2F53A 3UXFA 5BOZG 2ARWA 4G42A 5J12B 15C8H 4N5ED 3PHQA 5HDBF 1KYOJ 4ORGB 3B9KC 3CNKA 1QFWM 2IFFL 5DJCB 2EEBA 3UO1H 2RJMA 4M5ZL 4QRRA 1CQKA 3VXOA 1E6JH 3C5ZA 1G1YA 4ZXBD 1ZLUK 4YPGA 5KVGL 3K2MC 4QF1A 5KVGH 3MRLA 3IDYB 1QFWI 5C9JB 4OGXL 1FYTD 3TYGH 4C56E 2RGSA 2H9GB 4JO4L 3WHXA 3OR6B 2APBA 2DMKA 5FO9B 3GM8A 2FJFB 3BPOB 2V5YA 2R1XB 3FT2A 2JB5L 1A6VH 4B5EA 5I1EL 1D9KA 1XR8B 2EIEA 4PJXF 1JYVA 1GOGA 1R3LB 1HHKA 1RIUH 1QYGH 3BE1H 5F9DC 1FLRL 1QKZL 2AW2A 5IB1A 5E1AA 2AV1A 3ALXA 4X7SL 4DVBA 5DD0L 2DYPD 3PHSA 4G43A 5JO5A 5IVXF 2CK0L 4XCYB 1NCDH 2O61B 4X5WA 4YO0B 1OQOA 5DJ6A 1BF8A 1MJJB 4LSPH 3G6JA 1RUQL 2DQDL 1SHMA 5HDLA 2XXMB 2ZWLT 1KG0B 2V5SA 1CE6A 1YUHA 2IBGA 2P8PA 4M9PA 3B9DA 2Q8BH 1JV5B 5I8EA 2J4WL 4PJ8C 2R4SH 3GSRB 4ELKA 4TNVF 2BDNH 1CS6A 4L3CB 2JK5A 1IGIL 4OCMC 4K2UH 4LSQL 2JB6A 1T83C 3UX9B 3WJLC 4XPBL 4F33B 1RJYA 4KRPB 1FAIL 3W5NA 1FCGA 2EO1A 2PXYA 1CD1A 4KI5D 1B90A 2B2XL 1HNFA 2ZCLH 4W6YB 5C08B 1BFTA 4ZO8A 1JV5A 1ZT7A 3RZCA 3NPSC 3CUPB 4JN1L 4B7LA 4YLQT 1E28A 5C7XH 2QL1A 3QFJA 3LPGA 3JWNC 3C8HA 3FZUC 4YO0A 2ED8A 4P46B 5M95B 2VL5B 1TVHA 3HFML 2L4OA 1BM3H 5SWZB 1C08B 2I26N 1TVBB 3GDBA 4MB5A 3IDJB 1QO3A 5JPMA 3V5HB 1UXWA 3D1MC 1BD2A 4LIQE 3KLHD 2FZ3B 1V3KA 4O4YH 4U0QB 3P9LA 3V9FA 3CFCH 3CCHB 3U1SH 3HN3A 2W9EL 3N85L 1Q1JL 4UV4H 4NQSB 4AEHH 1BLNA 3TA3D 5KZCB 3O0RL 4MWFB 2DQEL 3SE8L 5FM8A 1WWCA 4WRLA 2WINA 3QRGH 1WC7B 3CVIH 5C09E 5GISL 3L5WA 3I6LE 5BV7C 5C0ND 3D3VE 4PJ8A 5JW3H 3GMRA 4HCRL 3VMNA 1X5HA 1A6ZB 4EXKA 1GZQB 3LCYA 2FHBA 4NQEA 2ZCHL 2VLRE 1RZKH 1L7IL 3DTXB 4FFWD 4GW1B 3KYOB 4R4BA 4JFPA 1XGTA 3AB0B 3VFSB 4D9RD 2G75A 5FA4B 3SBWA 3EJZD 3ALPA 1I8IB 5TE6L 5E4EB 1T22B 1QACA 1YQVH 5ENWA 2F74A 5J56B 1D5ZB 4MA1B 3UTPE 4OLWH 4LVNB 5E8NA 5D2LE 3HB3D 4NCC1 3LQZB 3PF2A 2PW1A 2Z31B 5CWSB 2RBLA 5F96H 1GOFA 3MV8D 3IDNB 2AK4E 3GEWB 3MZGB 3DYOA 1BFSA 3MV11 2FJFA 1I8IA 4MA3B 1Q0YL 1GPOH 1SY6H 1Z6JT 3FCTA 4I2XE 1QFOA 4PJAA 4ZSOB 4JFPB 1TJIL 4JG1L 1CLCA 4MQXC 4HXAH 1KCSL 2YOCA 5L2KD 3E6HA 5E5RB 4NDMB 3SCMC 1JPSH 5DA0B 1N7ML 1NANH 4KTEL 4LCCA 3U7AA 2B4CH 3TO2B 1CE6B 3P0GB 4HJJH 4OJFH 1U3YA 3WL9B 3X11B 3SE9H 1HYRC 3G6JB 4XMLL 1S3KH 5IBLC 4PGEB 5I71B 4N1CA 3IDNA 3SJVE 4UT9H 3UTQB 5J3HD 1DQDH 4OZIA 1FH5H 4RAHA 5D93C 4BELD 2HLFC 4BSVB 4YNYB 1RULH 4FZEH 4KK5D 3ZHKA 4J3VA 3QCVL 1RULL 4FMKA 5L7XL 3UJJL 1VGEL 5GSRA 5IMMA 4LVHB 4ODTL 3LZFL 5C0BA 4DTGH 3MCG1 2ADFH 2EDTA 3BD5A 1UZ8B 1S9VA 1RZFH 1R5VA 2WP3T 2X4TA 2ICWI 4GJTB 4L8BB 2UZIL 2NYYC 2UYLA 4XCNB 4PRIB 1D9KD 3QUXC 3ZDYF 3DGCR 1FE8L 2V5MA 3SDDB 5JA8B 4KC3B 3QI9C 1IM9B 4NM8H 5MI0C 2Q86A 4I77L 1T4KA 4YDVA 2KUTA 5CZXD 4X4XA 4HBCH 4A6YL 1TFHA 1MH5A 5BRZD 2ESVD 2EIBA 3MRQB 4LEXH 1UA6L 5DRNB 3WD5H 4DK3A 1OTSC 5JPNB 4L1DA 4JJ5B 2KH2B 1GGCL 4JFXA 3KJ6L 5EDXA 2ZUQC 3FO1A 4OT1L 1LVEA 2VERN 5LKNA 3K0WA 4FQXB 4O5LL 1C16B 5JW4Q 4OKDA 4ZQKA 5DYOB 4MAYB 4RGOH 4TUJA 1UXSA 1JHLL 2G60H 1QSEB 5I18H 4HDIB 5F93C 4APQD 2AK1L 2MPAL 2Y5TB 1NEZG 3MLUL 4HQQL 2V2TB 1LO4L 3HI5H 4KZDL 5IMKB 5EZLB 2ZG3A 3PUCA 3JTTB 5FYKL 3B2UD 5CZXC 1ZVHA 4YBHA 1RK0B 3VD4A 3OZ9L 4G3YH 1ITBB 1RSFA 4MD4B 1NGWB 4G5ZL 4KDVA 4M61B 1NMCB 3GSNL 3VFPA 1TMCB 4QKXB 2NY4B 3TN0B 4N9OB 5SV4A 1DSFL 4NO5B 3SOBH 1RZGA 2NTFB 3GKZA 4A2MA 3WUWA 2ITDA 5C0CD 4GS7B 3VFUB 4E41B 3OXSA 3QNYA 1X4XA 4FXKA 4GAYA 5DC0A 4L8CA 3EYSH 5IQ7L 4OQTH 3RHWK 3NA9H 4KRPD 4N90E 4MD5B 5JW4R 5D9SA 1I8LC 2FIKA 4GLRI 4R6UA 4P2QD 1IFHL 3P4OB 3PHQB 3CSYA 1A1MA 4LQ1A 2VUOA 5D72H 5IQ9B 3MRDB 5DD3L 4M1DH 2FX8H 5J13C 1HI6B 2X89A 1U8LB 4I77H 1BFVH 1I3UA 3OJDB 3ILPB 4LF3B 3SDXE 3BSZH 3I9GL 2G2RB 5F7DB 3ILQD 1CN4A 2VWEE 4Z76A 3PWLB 1MQKL 4K8RL 3VI3F 4GRWE 5J11C 1BF2A 5FUZH 4GXUM 1AHWB 1V7NL 4GQ9L 4PTTA 2UY7A 5FO9A 1RMFH 3IRZA 1GXEA 4IRJC 1LNUB 1U8LA 4JKMA 1G6RA 2PYEB 1MREL 5IMMB 1MIEH 1A1MB 1UGNA 5I1HH 2CSPA 4GH7B 5BW7A 4P2RB 4WW2B 3ZKND 1WFNA 2ZSWB 5CJQH 3DIFA 4XRCB 1QBBA 3MA7A 3MJ7A 3TEUA 3IU4L 12E8H 4XVSH 4N8VB 3VXSD 4LHUB 5HHNB 2A9ML 4D0CA 5E8PA 1AD0B 3STLA 1J11A 2V9RA 3NIFE 5TQ2L 4OCXH 4PJBA 1CGSL 5CGYD 4OLUL 1GGUA 4J3XA 3O6MH 4K23H 2X4UB 1FYTB 5JIKA 3WXVH 1XF5B 4YE4L 3W0WE 4IRJD 3IJHA 3B8YA 5HTSA 5JOFA 3RTQB 5LJYH 1T20A 1Z9OA 3NGBB 2VIRB 4FQJH 4L4TE 1P4IH 4AY0A 5BZWA 4IRJB 4JFYA 4KDTA 3LKRB 1KTLA 2RIKA 5A3IC 5C7XL 4YDJB 4UT6H 1YQ2A 2D7PA 2GYSA 2HYMA 2YXFA 4I8DA 4U3XA 2W92A 2NW3A 4AIZB 5DK0A 4DFIA 3WFBH 3GI8H 4LGPB 3O2VL 3QDME 5DJZA 4D9LH 3VFTB 5EC1A 4JZJB 1ZT1B 3MLVH 4QY8A 2F74B 5CBEB 3BHBB 2GSIB 1AGDA 4F58L 1MCKA 3CLFH 1XF5A 1QLRA 4PJ7F 1JFQL 2ARJA 4O51B 3SE4C 4Y4HB 1NBQA 4CNIB 1KCUL 3MCKB 2G9HA 4Y1AE 2A2QT 3CXHK 3TZVD 1GGTA 4DN3L 1BFOB 1B3JA 4WU5A 1F11B 1MCLA 2UWEE 4BSWA 1MCPL 3BDYL 2F19L 4N0FA 3MNVA 5DWUH 1MWAH 5CP3H 3CDGB 3QEGL 4JFQB 2GSIA 2IJ0C 3STZA 3SDYL 3U46B 3VRIB 2BXZA 2VMFA 4TPRH 1FP5A 3A0OA 1FNEB 5GISH 1BAFH 4PGDB 2NY7H 3L9RB 4KZEL 4HS3B 1YECH 3JV0A 3Q0HA 2YUZA 3HKFA 4NO0D 4XC1H 5C0RL 2VLJD 2LAAA 3WEXB 3PL6D 4QRTA 3HUJA 4WFGD 3Q48A 2VLKA 4P5TB 1CXEA 5INDA 4J12A 1KV3A 2QJDA 3CIQA 1FNLA 5HGBA 2ORBH 5CSGA 4NKIH 4RX4A 4BQ6A 4M7KL 3S37L 3BQUA 3DLQR 4JHWL 4LF3A 1KTDB 2V9TA 3MUZ1 4R7DB 4B7IA 3EIFA 4I5BB 2DQUH 4PRPD 2NW2A 5ADOL 4BFIA 2CDFA 5CIPA 3C8DA 3FHQA 5CJOH 3UBXG 4PJIA 1B4JH 4MQXD 3GMNB 4LMQE 5F9JB 1VCAA 2DQCL 3HE6A 1A14L 1VFOA 4ZTPL 1KULA 4HS8L 5HYSA 3V6OA 4U1MA 1MRCH 5DMJB 3LHPL 4QLRA 4RDQG 32C2A 2PYEA 1RZKC 5GRXG 4MNGB 4BUHA 3GO1L 4X5XB 2HT4D 4TOYL 4XPGL 2J88H 4XHJC 2JK5B 3IVKB 4KHXH 5DUBA 3TNMA 2VDNL 1EERB 5D7IF 1KXQE 3VWJB 3FOLA 4EZMA 3DURA 4H88H 3BW9B 3RUGA 25C8H 5AZEH 1U95B 25C8L 2YBRB 1GHFH 4U1LB 5DFVC 1OSZA 3ARVA 3EBAA 3QDMD 3IJHB 1RU9L 5F7HA 4PJDF 3KAAA 3MLZH 2CQVA 1FGNH 1P7QA 5JOEA 1P1ZB 4HDIA 4OM0H 3P0YH 4LSSL 3QIWD 4LL9A 3HI6H 3TPKA 2X4RA 3RI5F 5TJWK 3GFUA 2DM7A 2GCYB 3N9GH 1UZ6E 4QXWA 3JWDL 4BKLB 4PJIE 3G6AB 4XTRC 1NLDL 2KZWA 1YNKL 1NDMA 4N1HB 1I8KA 5BMFL 2R8SL 3P3YA 4ZOBA 5J6GB 2YUWA 3QFJE 4QY8B 5CBEA 1CYGA 1QLEH 1A5FL 1F4WL 4JO3H 3GMRB 3UYPA 1HQRA 1N64H 3WUWB 4ODHL 1A6AA 1JZ3A 4H0HB 5EFIB 5DK0B 3TO4D 3NABL 4JAMA 3KWWB 5J89A 1T7WA 1UQSB 1F3RB 2CR6A 5HXMA 3HNTH 2VLKE 1QUNA 2ZPKL 3BAEH 4PG9A 1P6AB 1HE7A 3QO0A 4BQBA 1RAMA 4WW1A 3R8BB 2P8LB 2FDBP 5D71H 1LO2H 2DQTL 5T5FH 4HCRA 1OOAA 5C07D 3E1F1 4RGMC 1U36A 4PJAF 3O3BB 1JTOA 4U1IA 4D0DB 4XH2A 1RIUL 4M8QB 4JDVB 3UYRH 3MV9B 5DJXB 2VDLL 1HHHB 3ECBB 3MRMA 2VR5A 4KKBD 2VRAA 4Y19E 2V7NB 1HH9B 4QXUH 4L9DA 3PNWB 1IBGL 5HDQH 3TO4C 2UZXB 1G0XA 4PJ9C 4MA7H 2HFEA 9CGTA 3NTCL 3SJVA 2UV3A 4PRAB 4RBPH 1V05A 4M1CC 1MCRA 1JPGA 1WCQA 2A6IB 1L0QA 1JHTB 4TRPL 1G6RB 2GW5A 2QKIB 5M94B 1HSAA 4YHMH 2JJSA 3WNLA 4GMTH 4NDMA 5D5ME 5F88A 2ZG1A 4H8WC 1KJ2A 4HG4J 1AR1C 4OD3L 4PJ5E 3RKPA 4BYHA 4J2XA 2IFGA 2YWYA 4M5YL 3WFCL 5C6PB 2BOBB 1GGCH 4MA1C 4PRHE 3RNKA 2X4UA 5TQ0L 1A6UH 4GRWF 4ZG1A 3QAZB 3QYCA 3I02B 3QSKB 4QO1A 1KJMA 3BO8B 4MJIA 3SDXF 3I3BA 2MTPA 1NFIB 2APVA 5F1SA 5IVZA 4YNYA 1X7QA 43C9A 2EO9A 1CGTA 5A43C 4OLXL 1S7RB 4P2CG 3HZKB 2R0KL 5IBTH 3SQOH 2HN7B 2EYSA 4P4KA 4FNLL 3PGDB 1DQJB 5D6CB 2F53D 4Y7MA 1RZ7L 3FRPA 3DVNB 1NBVH 3C6SA 5ALCL 3RWJB 3CFIC 4HEME 4JFFE 4O2EB 5D7IB 3ZKNC 5IB3B 3HRPA 3S35X 1OAYL 4WTWA 4Z95L 3WO4C 4GXVH 3VFRA 4QRPE 1K9TA 3JWOH 4JZNA 4PIRF 3S4SB 3VG9C 5T3XH 1J7VR 3UBXA 1BQLH 5DMIL 3VD7A 1AFVL 2P24B 4QNPF 1HIMH 2WLZA 3K8LA 2DQFB 4JDZA 2OTUA 3AU1B 3MV7B 3VRJB 4JFZL 1QBLH 4HLZH 2CIKA 4DOHE 2VE6A 5E03A 1FGVL 3G5YB 4BSJA 4EDXA 2YC1B 4KH2A 3D39E 4C54A 3OQ3B 4ZQKB 1CU4H 1TPXB 4XPAH 4JFHE 1XGYL 1FG9C 4TNVK 5EO1B 2Q8AL 4Y8AA 1X9QA 1U93A 3ARRA 1NDGA 3H3PL 4Z6AT 3QHZL 1FO0A 2IPTH 3TT1H 3QXVA 5L6YH 5DD1L 3OG4B 3OKYA 2E27L 2PXYD 4F8QA 3H0TB 3GSNB 5ITBH 4DKDC 3U7WH 1KIQB 4OFYA 2BSTB 2DQFA 3D0LA 4OT1H 1G6VK 1KXVC 4PJBF 3VXUB 1AY1L 4EOWH 3T65A 3IFNH 4J8RB 3LMJH 4P23B 3HG1D 1RK0A 2Z93A 3NFSH 5C92A 3DGGA 1DSFH 5IBUB 3M07A 1F13A 2DKMA 4JHAL 2Y07L 3KPSA 3GIZL 3ZYZA 2O93L 1SYSB 3P11H 4H1LG 3DROB 4U33A 1ZA3A 3FQWA 5TE7L 4I3GA 2BRQA 3SKUD 4YHLL 5IW6A 4I0CC 3WLBB 5T3XL 2E6QA 2VZOA 4DVBB 3B2VH 4Y4FB 3H9SA 1MCSA 3BZEA 4ODTH 4DTGL 4Q0XL 4I13B 3U4EA 4D0BB 3UYOD 3WCYA 1PQZA 2A74B 3GSXA 5D70L 4QTHB 5JHDB 3EDFA 4UT7L 4Q7DA 4GKOA 4ZFGL 3VXQA 1O0VA 1BQUA 5TFSH 3JWOC 3O9WC 4Y2DA 5ICXA 1T0MB 3KVQA 4FXLA 5F7EL 3ULUF 3RNQA 1G7QA 5HGGS 4JQVC 3TCLA 4P2RD 3BUTA 4FZEL 2QEJA 3KPLA 4JY6A 5BVJA 3H9SE 5D5MF 4XVUD 3O41B 3BWAB 5K9QI 4OI7A 3WE6B 3B9AA 1YEGL 5FUCE 3EDKA 2ADIA 3SE9L 2HLAA 4PJEA 5EU6B 1FFPB 3MRPA 3EOYG 1D5MB 5C0NC 2EXYD 3RU8L 5EB9A 2JCCE 4WHCA 1FNSH 1R24A 3NZHH 4X6BA 3O41A 3VWKD 2P5EE 1J86A 1MHHB 1R3LA 1P7KA 4R8WH 3L3OB 4M43L 3VXTA 4LQFL 2WK2A 2P8LA 2F53E 3MV01 3HE6C 3DUUB 1WIOA 1NGYA 4X0KA 1H3UA 4NCC2 4NRZB 2ZKHH 3DO7A 4JRYE 1UWGH 3DHMA 4ZXBC 3VGDA 4Z5RA 3OKLA 4KPHL 2MHAA 5I1EH 1I7RB 4BZ2L 2QBWA 2WINB 2MCG1 5EOCL 4PRPB 1FLTX 3K2UL 1SBBA 4KTDL 1HWHB 3E2HB 2HFEB 2OSLB 3SDDD 4Z77A 1I9IH 2MCPH 1ZA6A 4NQVA 4HIXH 2XIDA 2G9HB 4FQ2H 3IU3B 1D5BA 2IPKB 3OKMA 2YRPA 4PJDA 4PY8I 1FDLL 1BVZA 1CG9B 4LHQB 3TH3T 4HK3J 2Z93B 5CD5D 3FQTA 4K9EC 1C5BL 5J3HC 3HG1A 3HNTL 3IFOB 3BWUC 5GGQL 5LQBH 2VQUA 4L4VB 3BAEL 4XC3H 2CLRA 4GBXA 4OD1H 3GHBL 2J8UE 4DGIL 3MBXH 4ZFFA 3X14B 4GW4B 3GI9L 4WWKA 4KY1L 3BKCL 4MCZA 4ZFZA 1MEXL 4M93B 5TDOA 2PTTA 3VXUD 5GS1C 1DR9A 3HFMH 4G6KH 3MRGB 3MRBB 3LS4H 3EZJB 3DRTB 3GJEA 4WEUD 5HHNA 5T3XE 4XNMB 2BHZA 3C9NA 5ADOH 4BFIB 4RNRB 4U6YB 4HKXA 2FGWL 1MNUH 2BNRD 1Q1JH 2IAMA 1AO7E 1OT2A 4PJFA 2Z9TA 4LVOC 3H7LA 4NKIL 4X6EA 1FL5A 2WMPA 3V8CA 2PUQT 1SQ2N 2R2EA 5FGBA 1ZAGA 4JEGB 1LP9E 4NN7C 3QDJE 3S3JA 3RIFF 1FSKB 3FQRA 5J9PB 5FAAA 3E2HC 4PTTB 3MREA 4PYGA 3BX7C 4HUUA 3RVWC 3N85H 3L7FB 1WBZA 3DSNA 1A6PA 5KW9H 5DMKA 1NMBL 3PWLA 1I7ZA 5IVXB 1A6TA 2V5RA 2AEWA 5E9DA 2AGJL 3MRJB 4E0RB 3DXAE 2BP3A 3S6CA 1ZSDB 5LBSH 3TLRA 4E9LA 4OUUA 4L3CA 4RAUB 4M03A 3UTZB 2ATKB 3G6AA 3DMMC 2A1WH 2PYEE 1CFQB 5CS7A 5I6XB 1NFIA 3ARGA 3F7YA 4JRYD 4HF5L 3QQ9C 4KJYA 2KBGA 5BV7H 2WBJD 2HVKA 4K7PL 3OMZA 4I4WA 5BS0B 2HKHL 3EJZC 4DGIH 5HYJB 2FBJH 1IEAB 1ZSDA 3DVGB 3V6ZA 4NOFA 4BZ1H 1A2YB 5E2TL 2AJXH 4G8FB 5TF1L 3GMMB 4KUZH 5HI3C 1MLBB 3SHSA 1CL7I 2R1YA 5JXED 3QB7C 3QG6B 2R0WH 4Z7WE 3UJTL 3EYVA 5TDPB 2QQNH 1NJ9A 4YXLH 4G6KL 5EZOH 1P2CB 4NN7B 4DAGH 3W9EA 2HJLB 2QSVA 3CFKA 4F7PB 4HIXL 4U1NB 2AJVL 2UUDK 4XZUB 3D18B 4AL8H 3VD9A 2X4NB 4PRHD 2I24N 1CICB 3EUUA 4GLRH 1N5YH 5IFAL 3ZSSA 4KQ4L 4TVPH 2YPKA 3IDMA 3HNSH 4HKJA 4XAWH 3BH8A 5IHZA 1PYWA 1YNTA 2EH8H 1J8HD 4YHYC 1U6AL 4P3DB 3KPSD 1RHFA 2YD7A 3SBWC 4PD4K 4OCRH 5HPOA 4XC3L 3GBMH 1WSST 3HAEH 2RCSH 4Y4HA 5I2IA 5CLTA 2OQJA 1QLRB 2AAVA 3ULVL 3LV3B 3OAUH 1YN6B 4TSCL 2C3GA 1S7TA 5I0DA 15C8L 3L1OL 2KQMA 3EW3B 3QQ3B 4S0SD 4MQ7A 5JHLL 4YEFA 1CIUA 4QHUB 3VE0B 1IM3A 1L6XA 1M7DA 1U2HA 3OKNB 4L4TD 3W0WB 2IH3A 5JDSB 3F7VA 4JR9H 4BUGA 2XOTA 3T2OA 4YAQA 3FT3B 3KWWA 2Y25A 4YUEH 1OP5H 3WIHH 4LPWA 5EFIA 4KUCD 5CGYC 5E08H 3U46A 3VRIA 4Q6IA 1Q0XH 4JPKL 1TCRB 3DI3B 1JZ4A 12E8L 4HKXB 4FTVD 2F58L 2VUYA 3SDCB 1U0QA 1TPXC 1Z5LB 2AQ3A 2YS4A 1XZ0B 3LH2H 1R0AH 1AQDA 4YHZH 2L0DA 3FQXA 1NGXB 3A6CH 3O9WD 4X6CA 1I3GH 4H8WH 3TT3L 4EN3B 5AD0B 4GG6B 1H5BC 4N8VA 5GGTH 1DE4B 3VXME 3VMOA 1OQXA 1W72H 2W0LA 4PJCF 1JGUH 2ED9A 3RVXC 2H2PD 2ZSWA 2Z91A 1C5DA 4IIQB 4NC1E 2IPUK 3JV4A 3BP7A 1OM3L 1H8NA 1KF9B 1OTTC 1T2XA 5D1QC 5C8JA 1U8QB 3MV8B 5BQ7B 4LCIL 1T6WA 4CKVX 2XN9B 4BQCA 2G5RA 5LWYL 2GHWB 3R0MA 4Z7VA 3B2UC 3RDTA 3QUKB 4GRLA 3B5HA 4QYOB 2VL4A 5T3ZE 3PIQA 1FYTA 5GGQH 3CLEH 1X6NA 2C1OB 2V7HA 3ULUE 4EIGB 1RI8A 1ZLWH 2WWKO 3K3QA 1U9KA 4KKLC 4OQTL 4XNUL 4X9IA 3QUZA 3KPTA 4PR5A 4Y4HD 5T1DH 1HZHL 4R0LB 2VLME 3IETB 4K3EL 4FQHA 3U36B 2WANA 5C3LD 3PDGA 4WHYG 1J5OH 3MO1A 4HFWB 5EA0H 2X4QA 3E6FB 4G9DA 1X4ZA 4U1GB 5CEZD 4WGWB 3TO4A 1A1NA 5DD3H 1TITA 2Q8AH 1NUNB 1T7VA 5C0RH 5DRNA 3H3KA 4LGRB 5C2BH 3BGAA 5ID1B 5AZ2L 4UDUA 2NLJB 1AE6H 4P49A 2RFXB 1NL0H 3RWDA 2XFXA 4MXVF 4HAFA 3SDDC 3RWIB 1V3MA 3D39A 3MLSH 3QHFH 4QOKE 3V0WH 2BVUA 5IFJB 4G6FD 1I3RA 1WT5C 4HS3A 5CZVH 4DCQA 1SJHB 4DJMA 1MI5B 2YMXL 4ONGL 5I9QB 2GJ6D 3ULUH 2CO7B 4PP2A 5CHNB 3T77B 3VFWA 3VXRE 1IQDA 2BNQE 1U92B 2IPKA 2ADFL 4HQQH 3BIKA 4ODVH 4QRPA 5CD5C 2XWTA 4NC0B 5FM5O 4K94L 4WI9A 2NLJA 3ZT5A 1S7TB 4JM2D 1FBIL 4YX2L 4G8GE 4AM0B 1AQKH 4U49A 2X10A 1BD2B 3THML 5I2IB 1P69B 5T5NF 2CKBB 4K94C 3TBTB 1NCAL 2P5WE 1FE8H 1ORQB 4HLJA 3IF1A 4N9GB 4YHOH 3RTQD 1B6UA 1CXFA 2IH1A 3IKKA 1KEGL 4X98A 2I5YH 4HPOL 4DGVL 4CADA 5JW5A 4W6WB 3FO0L 3G5VA 3W39A 1KBGH 4Y2DB 1KBGL 3FT4B 3AVEA 3LQAH 2IBZX 1T03L 1I7TB 5D7LA 1S5IL 5J1AA 3EFFB 1CD9B 1KJVB 2DQIH 5DEFB 1OAYH 5ECJE 2D9QB 3I3EA 2ADGA 4QHLA 5HYJD 5H35A 5EU4A 1LGVA 4IDJL 4K7FA 1PJ9A 5I8CA 2MQ3A 2GITA 1S7WB 3HUJE 3O6KL 3WXWH 5CKAA 1BQLL 5DMIH 1WWAX 4JRXB 2R2BB 4PJ8D 2X4TB 4Y5VA 5I8EB 5A3ID 4S11A 2YWZA 3GMMA 2W9DL 3WFCH 3EJJX 4GKNA 5KVFL 3MZTA 3DVGA 5E8NB 3V6ZB 5DJ6B 1SM3H 3EHBC 3SEPA 5INCA 1AI1H 1EPFA 1Y18A 1BQHA 2XKNB 3HNSL 3BP4B 4GXVL 5GS1B 4P2RA 3MRKA 1N0XH 4OI8A 5ISZA 2A6DB 4KJQC 2OK0L 1N7MH 3AY4A 4BM7A 5GRUL 1G7LB 3CVHL 3NN8B 2FHCA 3SO3C 1A4JB 1I3VA 2BVYA 2YPLE 5J0BA 3QQ9D 3OJMB 4U1JA 4TNWK 5IVOA 5C0AD 4OLEA 1YPZA 1IFHH 1UZ8A 2XZCL 2FEEL 1G1CA 2GFBA 2LE9A 4XPTH 3I50H 3FFDA 1IJ9A 5FOBB 3DXAD 3VGGA 4MNHB 1KEGH 4HC1A 5LAXB 2Q87A 2L7JA 2P47B 4JPKH 3QQ3A 4XCFL 3ROOA 1TJGL 5BO1H 3PV7A 4WO4B 2KKQA 3ULVE 3OAZH 5DHVA 3LV3A 3MV7D 1K4CA 2FZ3A 3MSPA 4G80B 4XPHL 1FVCB 5HGDB 3A6OA 2VE6B 5F96L 5CGTA 1UEYA 2CIKB 4P46C 1TZGH 2M8XA 4LSVH 5TE4H 4Q97A 1IGYB 5CZVL 4HUVA 4TRPH 1IZJA 2YRZA 3S8WA 1CLOL 2YXMA 1MFDL 4E41A 3WFDH 2EEAA 3IJYB 4Q2ZA 3P77A 3QUMH 3FRUB 2HFGH 3U6RB 5GGTL 1LILA 2CGRL 1QTYT 4OZ4B 2DIJA 2ARJQ 3GMQA 4W6XB 3VXQB 2BY1A 4ZXBB 2N56A 5DJ2B 4F3FA 4JPIB 1F00I 3I84A 5F72S 1AIFB 1SJEA 3C09C 3BGMA 3F58L 4N8VG 3VFOA 2X4NA 5GZNC 4KHTL 4XPGH 4OLVL 5DJ8B 4GW4A 4WUUD 1BD2D 3IT8D 1RHHA 3D0LB 3TFKC 4HEPG 3U30B 2AGJH 3GZKA 3L95B 1N5AA 2LVEA 4L4VA 4NWTH 1MSPA 4UUJA 2E7CA 1MOEA 2QV2A 3JTSA 2CKBA 3ULVC 2ADJB 1QSEA 4HH9A 1D5XB 3QUYB 4Z78B 1IKNA 3L3IB 3LEVH 3U6RA 3HG1E 3O6LL 5DYOA 1X5JA 1J88A 2CPCA 3DX7B 4R3SB 3RUGE 1CF8H 1SYSA 5ALCH 1FVDA 1ZANH 4FQLL 5AZEL 1B2WH 2VLKD 3MQIA 3T3PE 3IDJA 2B2XH 5C0BE 3WN5C 1MIMH 5C09D 3BP6B 3SCMD 5GXBB 1ZVYA 3BKML 2VDRL 35C8L 2ADJA 1MEXH 1QRNB 3FJTA 3C2AL 3QO0B 4GOSA 4N0UB 1A5FH 3FT3A 3K8KA 4PGCB 4OZIF 5DZOA 4XP4H 3QDJB 2P5WB 4QT5A 3P0YL 4LSSH 3VDAA 5F8QC 2ZNXA 5B39G 3TPUB 4HBQA 1ZLVH 3L5WB 3MLWL 3VWKB 3UC0L 2DB8A 3U9PH 5IMLB 2OMNA 2Y23A 3GSWA 4NFCA 3FONB 1MCNA 3ULVD 3PQYE 4PRAA 4YFDB 1UM4H 3T1FB 3RGVC 3UTTA 1WVZA 5EU6E 5KS9B 4UV7L 4WI3A 3L7FA 1CL7H 3QPXL 2Q7YB 2VITA 4JM2A 3QUXA 5D71L 3ZL4H 2OP4L 3PP4H 1HH9A 3RVXD 5B4MD 1NUDA 3FFCB 4Z7UB 3QUYD 5DUMH 2NNAA 4OCSL 3QEGH 3BZDA 4L9LB 4M7KH 3S37H 1PG7L 4N0UA 5FKAB 1QEWB 1ZMYA 3EYFA 1D9KC 3FO9B 5F3BA 4JE4B 4L29B 4LNRA 4YEEA 4IRSD 4K9EH 5EULV 4XCYA 4JVPA 4JFDE 2LTQB 5F7KC 4DEPB 2XTJD 5ALBH 3EYQD 4NUGL 4PJEB 5EU6A 4MSWB 2WSKA 1X5KA 3QXWA 2ADIB 1F6AA 4XPFL 2PW2B 5E5UB 4F57L 3VWJC 1VB9A 4OLYH 5ITFA 4G7VH 3LKSB 1WAAA 5E8OB 1E6JL 5BQ7A 3EOAA 1OAXL 1FZKA 1NC4B 3QEHB 4YUEL 2EDQA 2W60B 3QO1A 4S2SA 1ETZB 5B4MC 1D3CA 3QUYC 4G6ML 3UCRA 5DFTA 2AJSH 3MXWL 4AG4L 1FSKC 5I30L 4ZFFB 5EZOL 3RX7A 2ICEB 4IMLB 3WDHA 1WZLA 3PWVA 1SEBA 4HZAA 1I8KB 4HIEA 1N59B 2ZNWA 1NBYB 2P1YA 4XMKH 3WNMA 4Z7NE 4ZUWA 4KUZL 1FNFA 4ODUB 4KQ4H 2AEQL 2BY2A 4YC2C 3F5WB 4G42B 4OCYH 2YD6A 4U6XB 1BZ9B 2WNGA 3VWJD 3CH1B 2NX5D 3F58H 4NQEE 3WN5A 4U2ZA 2DQGL 4RA0C 3O3AB 5KG9A 1A47A 5BVPH 4JDTL 1I1AC 3VA6A 4NQDB 1QP1A 5INDB 4WV1C 1VKXA 1KSRA 4HKBB 1J1XH 4YAQB 1EEUA 1FFNB 4MQTB 4K7FB 4JGJA 1WFOA 1G0YR 4IIQC 1RU9H 4RFNB 5GJTH 4V1DD 2X1PA 3S96A 2I07A 4I3RH 4LSRH 5IT2H 5TDNB 1VADB 4RX4D 3O6LH 3PWPD 4YDLC 1JN6B 2YD2A 4KK8D 4N90D 5E5MA 3RI5K 4YPGB 2A9NL 1I3RB 1EEZB 4L3AA 5FDWA 4YBLC 1UEMA 6FABH 3HRZA 4K9EL 5JOPE 3U2SA 1BX2A 4P3CH 3N0PB 4TN9A 1IC4H 3VFVA 5DK2B 1XGUB 3GI9H 4N0UE 4NZUL 5IHBA 5D7SL 2BCKB 3U79A 2VDRH 1QNZH 35C8H 1DTUA 4LLYA 2W1NA 3TBTA 5E00A 5IK3A 3P4MB 3T0EE 4EI5A 3O8XD 5JORB 3MRKB 1LP9B 1LWRA 4PJGF 3HS0B 2X1QA 2P43B 4HPOH 3R1GL 4M7LL 3MRRB 5IBUG 4MQSB 5SWQA 4X7TA 5BRZA 3N1PC 1FORL 4P2RE 5FYKU 1JIBA 5D5MA 4U6VH 2HH0L 4JFFB 2QADD 4MAYC 1D5MA 1V3LA 1DLHB 3O3EA 1UCBH 3ARBA 2GFBB 3QR2A 3REWB 3MFFB 5I1GH 3QIUD 3WFDL 1MWAA 5IEKB 3MGOB 2GITB 1T1XA 3HZMA 2VISB 1MCWW 4OUOA 1G84A 2PXYC 3B83A 2R2HB 3S88L 5I1HL 1GSMA 4KTDH 4NZTH 5EIIB 3SO5A 5BOPA 4FQ1L 1T80A 1JK8A 4C56D 1NPUA 2CK0H 1U8JA 3T0EC 4XX1E 4OLVH 5JHDA 1MFEH 4HPYH 3RWJA 2ZJSH 1KNOB 5BXFB 1F4YH 3WSQL 5TE7H 4UIKL 1J87A 1IGCL 2UWEB 1EMTH 2CDFB 5CIPB 5HHPA 3MJ7B 3FB6B 1DN0B 3IFPA 3B9VA 4K3JL 4PB9L 3SOBL 1Q9WA 1A22B 4DN4H 2OK0H 4NO0B 5F89A 4E41E 4GKSB 3SKJH 1WICA 2PO6D 3FOLB 1A4KB 3SE3C 1ERNA 1CDHA 3S4SG 4RIRB 3KR3L 2J12B 2PTVA 1S7VB 4QOKD 1AJ7L 2YD1A 4IRSB 1AE6L 4OF7A 4LARH 5GGSA 1CXKA 2FATL 3NA9L 1RJCA 2E9BA 2PYFA 1QFUL 1TQBB 3WFEL 3JWOL 3T0ED 4DCQB 2XN9A 4PRPE 2VZVA 1LHZA 3I50L 2D0FA 1AP2B 1TTFA 2E3VA 5FXCH 1OW0A 3H9SD 4NSKA 3NIGF 2VLLB 4EI6B 4CN4A 1LEIB 4OKVB 1DBKH 5DA4A 4AMKL 1CTNA 2EDWA 1QQDB 3MNVB 1RJZB 4ODXA 3H0TA 1MHPL 1FGVH 1BFOA 4PPTA 1UA6H 1ED3B 3HA0A 3EOTL 4QOKA 2DWDA 2NXYD 5FUZL 3MRGA 3WDIA 3HUJF 5D4QA 3RAJL 4CNIA 2R23B 5HHOA 4DZ8B 1AY1H 2P5EB 1N0XL 2HTKD 5F7MC 3MLPA 4NQXB 2VB5A 1DVFC 5IHZB 4OAWB 2C3XA 2Q7NA 3IJSB 4TULH 5IOPB 1XGUA 4PS4H 3DMMD 4L8SB 2OL3B 4XVSL 2XZZA 1H0DA 2PNDA 1I9JH 3MNWB 1OGAB 3RX5A 1AQKL 4WU7B 5D7SH 2LU4A 2OLDA 5DMGD 4P2QA 5GGSY 1PZ5A 3H9SB 1TDQA 1Q72L 3V4PL 3O4LE 1WEJL 3QJFA 3RIFK 5I8KL 3WLBA 4QHUA 4KXZI 3OJVC 4WO4D 1SMAA 3QJHB 1KC5H 4ELMA 2DKUA 1E4XI 5DXWA 5ESQB 3D5OF 1AD0A 5EU7E 3DVNA 1KTKE 2EH7L 3WFZA 1T03H 4JKLA 2DQJL 1R0AL 4LLWA 4XHJD 4P5MA 4OZFB 1IC7H 1JTPA 1HH6A 5KAQF 3BPOC 4PJBE 5ESVA 3EO9L 5D7KD 3T65B 1WCBB 5D1QA 3ZE0E 1JGLH 1JWUA 2XG4A 5CINH 5AZ2H 3BSZL 3QFDA 3G5XB 4U1LA 5C07B 4XMPL 1U95A 2BNQD 3K7UA 1AHWA 2J8UA 3QIWC 4F7EB 2DLFL 1WT5A 2UYLB 4RSVA 4XMLH 43CAB 3ZKQD 4ZYKB 4LHJB 5ACMA 3IRPX 5JHLH 2AK4B 5C8JB 5I19H 1LQSR 4M9OA 1GAFL 4DKAA 3EYQC 1HHIB 4WI5A 1M7IA 3MYZA 3TVMB 1K5NA 5EBMA 4OTXL 5KS9F 2BY3A 1G7PB 1KEMH 4X6EB 3IFPB 1LE5B 3RWHA 2GJ6B 1JNLH 4FQIH 1NL0L 4FABL 1INDL 4K8RD 3GMNA 3H7BB 5C0GB 3QPQC 1EX0A 2FEDD 5ACZB 5E6YA 1S7UA 4F9LC 1KJ3H 5BZDB 4JFDA 5I1AA 1M7IB 3TVMA 3WL9A 3X11A 2NR6C 4EI6A 5FDYA 3FL7A 4XP9H 4JZNB 1VERA 2C3VB 3TBYA 2YD3A 4LOUC 4YFLF 1I3GL 2M2DA 4H8WL 5EUOA 5C0BD 1J1OL 5FDWB 4A6YH 2NZIA 2DL2A 4WCYL 1ITCA 2NPLX 5BW7C 1U8OB 4NNXB 3RL2A 3QI9A 3Q2CA 4PJCE 4UV4L 3MLSL 1RQ5A 1K8IA 3ZL4L 3F7VB 1OF2A 3W0WA 1WAAF 4YZFF 2X4PA 1DFBL 3NFNB 1CCZA 4FQQB 4U7SA 3D0VA 5C0DB 4ZAKA 3AUVA 2FEDC 3MRRA 2RR3A 1DN0A 3PV6A 4PJHA 1U3JA 1EAPB 3VXMB 5T33L 2R0KH 2VDKH 1KPRA 4U6XA 2ILLA 1GGIL 4JFXB 4H88L 1WZ1H 4R3SA 1CICC 3QRFM 4LOUD 3VXNA 1YYLL 5DRWA 1CBVH 3VRLE 2BMKA 3PQYD 2OL3H 5CSZB 3ZZ1A 3HRZB 4K2UL 1MAJA 1INEH 3CVHB 4R7NA 1IGIH 2R2HA 3VXUA 4HJ0C 1YEFL 2QKIA 5SX5K 1DBBL 2IALB 4PJ7A 3S3SA 4YDIL 5AYUH 2I07B 4TSAH 2PO6A 3RWEB 3VFGH 3HZVB 3I6KB 3G9AB 5HI3D 1DBAL 4P3CL 4ZUSB 3MUHL 1IC4L 2BNRE 4I0PD 1NC2B 1I1YB 2QHRH 4HLZG 2VKXA 5I1DB 1UYWL 4PJGE 3MMEB 4OGYH 4WIQA 4XBEH 1FFOA 3CX5J 1DQTA 4I0PB 1XF4B 5C0EA 5D5MB 4BQ9A 1OP3K 5FF6B 2IFFH 4D94A 4PTUA 4GMSH 5KSUA 2VQ1A 4NNYB 1Z9LA 3HZYB 2HT3C 1KN4H 3QXUA 4OCYL 5CSBA 3JWDC 2R23A 1CFTB 1PX4A 3LS4L 4F7CB 5JORA 4OFDA 3DX6B 1FVCA 2N4IA 1MAML 5IK3B 4MAUL 2XTJB 1U6AH 5EZJB 4UAOC 3TGXA 2D3VA 4KKAD 2RCSL 5F1IB 3SE3A 3MOAH 2DMBA 1G7JA 3DYPA 4FP8H 3OPZL 2BJML 4X6CF 4IBLT 2GT9A 3TIEB 2VR4A 3R0NA 2VTFA 2FSEB 4JM2C 3VFRB 1Y0LB 1X5FA 2J1KA 3ARDA 5DZLA 4R26L 3SKOA 2D2OA 3QWRA 4XP1H 3GKWL 5DJDA 2IQAA 4E5XB 3T3ME 1T0NB 4MJ6A 4PJXE 2YSSB 1IBGH 5HDQL 1NCDL 4DVRH 3G6JF 1MCOH 1ZHBA 1RZKL 4OFYD 1G7LA 2XPGA 5FM4A 4MCYB 3NTCH 2AJUL 4F57H 5GGVH 5CJ5A 1X5YA 2PO6C 2WW8A 1KG0A 1CXHA 2AJXL 1A02N 3BZ4A 3UTSE 1KJMB 4UTBH 4TUKH 1RUML 3MR9B 3PQYA 3NCCB 4LQFH 2XWBB 3QDMB 4YE4H 3VU2A 4K71C 4OF6A 3L3JA 3QFJB 4ODUA 3ARQA 1WFTA 3KYKH 4OIIL 1EHAA 5D7IE 4HKZA 5CBAA 3VDCA 2XG5A 5KJRH 5TDOB 5DD5L 2EYRA 4J4PC 4ZFOL 5B8CA 1CLOH 4X6CE 3ZDXE 3ULSB 4S1DD 4UINL 5FIEA 5DRZB 1Z0NA 5DJAB 4YXLL 1IKFL 5IB2B 1NC4A 3ZE2E 1LK2B 1C7SA 5J1AB 2Q20A 4S1SH 3LKSA 1LE9B 4YPJA 4Y5XC 1YEIH 1OTTD 4O4YL 1QFHA 5CSZA 4FS0A 2GTZA 1BLNB 5BZWB 2WBJA 4RGND 3JTTA 4I48A 2A0LD 4NUJB 5JUEL 1Z3GL 3HPLA 4R7DA 3HPJA 3CZFB 3NACL 1T21B 1GIGH 4YK4C 2IAND 1AGEB 3HS0A 3D2UA 3BESR 4QEGA 3FFCD 3ZTJG 5EO1A 1U58B 5MP6L 4R4BB 4LLYB 4Y4HC 3ZE1F 5KAQG 4X6DF 3CVHH 1T1ZA 1M05A 4APQB 4PLJD 5D93B 5GSVA 5EBLA 4NQUA 3X3GH 5FECA 3QPXH 1I1YA 5E6IA 4M7JH 5F7EH 4ZS7L 3BWAA 4PLNC 4NC1C 1RURL 5K9KA 3VWKA 3KPLB 4JY6B 5BVJB 2OTUB 3VRJA 4Y5XB 1XCQA 5DUPL 4RGNC 2ORBL 3D87B 3PWUA 3IDYC 3STZB 4P46D 4AEFA 2OJEB 3RNQB 4P4KD 2LAGB 2PN5A 4LCYB 3IB4A 3MLTB 3U7YL 1XF1A 2FD6H 4PRIA 3ZKMD 5FCUL 1OB1B 2FGWH 3PL6A 3UPRA 4KHTH 5C0GA 4X6BB 1P1ZA 1KPRB 3LEYL 5GZND 1HSBB 3CFBA 2C4XA 3F5WA 5IUSA 1PW3A 4OZGA 4W81A 4YZFE 2XQBL 3GK8H 3UJIH 5IVZB 2AXFA 4M43H 4MB3A 3QUZB 5FOBA 4QXTB 3J7HA 1S9YB 1NCTA 3UTQA 2DLTA 5GRWA 3OWEA 5HGAB 2I60H 1MUJA 1RJYB 4PGEA 4HIHB 4WFEE 2DLFH 4FXKB 1CTOA 2YUXA 3O6FB 4FXGB 2R29H 3DGGB 4ZOCA 1MWAL 4ZXBA 3QNZA 4NHCH 5KN5A 4DGYH 4GRMA 4Y16C 4PJXA 4K8RC 1GAFH 3VCLB 4ETYA 4OZGF 2BNUB 1CGUA 1P7QD 4HKZB 2NY4D 5CBAB 3V0VA 3GSOA 1JZ7A 2A6DA 3QEQA 2P48B 3U4BH 3VXNB 3O9WA 1VFBB 1QBAA 2NR6D 4RZCA 1EEYB 5HGHA 2COQA 1KT2A 3D39D 3FN0L 1UJ3B 3H7BA 5J8OA 1ODAA 5KS9E 1PG7W 4FFYL 1DANU 5KVMC 1RIVL 4CVXB 1SM3L 4K3DL 1LEKA 5IW6B 5I1CL 3GJFH 2V2XB 3LN4A 4U0RB 4HWZA 1FYTE 4PUBH 1HCFX 2ZOLA 2P46B 5KSAA 4Z0XB 1OTSD 4PGZA 2I9TB 4Y4KC 1K3ZA 4CL7A 3HLAB 3EHBD 1DUZA 3MLWH 1JF1B 3TF7C 2W91A 2EDBA 4LEOB 1OD7A 5DRXA 1A7PH 5J12C 7FABL 3MRHB 3EOTH 3C08L 5I75B 2JTDA 1XGTB 1RVFL 3MGTA 2NY4C 4UOW1 3TN0C 1DJSA 1MF2H 2DM3A 4RISH 4WTZA 4YJZL 4ZD3L 5HDOA 2JJVA 2YPLA 4DKFH 1WZMA 4Y89A 3VGEA 3X13A 3ARYA 3LB6C 4JRXE 1S7XB 1IGJA 2P5WA 1UADC 1ZLSH 3CDGA 2A6IA 4UU9B 1ZK9A 2NQCA 1F11A 4ZTOH 3NFSL 4RFOH 1T2QL 4K3GA 3ARPA 5DRWB 1XH3B 1OGTA 4YQXL 3CGTA 1FHGA 1AXTH 4CDGC 2Y07H 4APQA 1NUFA 1V3JA 4U0RC 2E7LC 2JJTC 1M05B 2HG5A 2P7TA 4ZUUA 1RIHH 1H3PL 2JIXB 5D7LD 1RZ8A 1T89C 3PV6B 4PJHB 1EGJH 1DEEA 1U8IA 4JDVA 5TE6H 5EO0A 3QAZC 2NTFA 4I9WE 4LHUG 5EO9A 2GK2A 4H25B 1PKQA 5D7KE 4YHML 1CT8A 5C71A 1XFPA 5FKPB 5F44A 5C2UB 3RWEA 2VH5L 4CVWA 2AJZB 2V6HA 1JGUL 4M93C 1GZPA 1NEUA 2HT3D 3CX2A 5DO2D 1KLFA 3TO2A 3HC0A 1EJOL 4Z7OE 5MEQB 4OM1L 4N0RA 4HV8A 2HVJA 1KB5B 4WJ5B 1OP5K 1NAMH 1DLFH 3K74B 3ILQC 4UILH 3TVMD 1N8ZA 4X5XA 1L7TL 4UT9L 5C9KA 4BA8A 1I1AD 3O2DA 3BRFA 4U1SB 2GAZA 2A83B 5EUOF 4F15C 2Y9RT 4W4OA 1JPGB 4PP1D 4HIHA 4JO2H 1MUJB 2CDGB 2ZSVB 4LCWD 3LN5A 3GIZH 3CFCL 1JGLL 1DE4A 1ZT4B 1A9BB 2XRAL 3C6LC 3KYAA 1G0DA 3EGSB 3RWHB 1F4YL 3WSQH 3WO3B 4AEHL 3ARGB 4NKDA 3ZT7A 3GMLB 3T2NL 3BO8A 4MJIB 3T0WA 2DOCA 5E99H 4YDVB 4MNHA 5I73C 1KACB 4N0YL 1Q38A 2IQ9H 2W38A 1F4HA 5JQHC 1Z2KA 1U8OA 4HS6B 3V7AE 4YR6A 2CXKA 3VFNB 5HGBB 1QBLL 4FN0A 4X99B 5BJTB 3IS1X 3KYOA 3PXHA 2RQ8A 1AXTL 2VXUH 4XNUH 4A6YB 4HUUB 3L3GA 4NZUH 4GUPB 4U6VL 5BMFH 2V2WA 2R8SH 5FGBC 2BNRA 1RV6X 5D1QB 1H3VA 3BDBA 4PV8B 1KJ2L 4XP6H 2WAHA 3IDIB 5EZIL 2QADC 1TZIA 4MAYD 5F3HB 1BWMA 2ZOLB 3MBEC 1FFRA 3RVUD 3BPLC 1A1NB 5DUPH 1HHGA 5L2KE 1LO5B 2AJ3B 2WUCH 5K93A 1HINH 4OV5B 1KTRL 3QWOA 5JXEA 5GSVB 3RIAF 2X4QB 2CRYA 3TWCH 3HMXA 4JKPH 3ZDZE 4IHOA 1UCBL 3HC4L 1F58L 5E00B 3U0TA 1K5NB 3V5DA 1GOHA 5I73B 1YY8B 2GI7A 4LU5L 2VAJA 2DBLL 2DQCH 2ZZUT 4L5FH 5KANI 2OMBA 2P45B 2QLVB 3REVA 3LKNB 3VFVB 4ZO9A 4NWUH 5J6HA 3ARGC 4JANA 4J6RH 4O51A 5FHAL 2XZAL 2DIBA 4MNQE 2AJYH 3MX0A 2YEZB 3S88H 1OTUC 2CD0A 2WBJB 3QISA 4GSDL 4WEBH 3ARZA 4NKOB 4Q74A 2NW3B 3QIWA 5BV7L 4S10A 5B39B 4Q9RH 1J8HA 4OLZL 3SKMA 3HHRB 1HEZB 4HULB 1EZVX 4V2BA 4LAQL 1B88A 1LK2A 1S8DA 2X70A 5GGTA 5IW1B 4Z8FH 5JUEH 2CO6B 5JZ7D 1BJ1H 1T89A 4OGZA 5DGQA 3MRNB 1AO7A 1QFUH 4PLJC 4JFOB 1QOKA 2GSGA 3V0AC 3ZYOA 3M45A 3HAEG 3VGAC 4WI7A 4Y19B 4MGXA 3U4BL 4XBPB 4M8VA 3M1BA 3V7AG 3QJHA 4DAGL 3GSQA 3INUH 5BVPL 3UTTD 1T6VN 3QFJD 2DQGH 1ZHKA 3V52H 1XGPB 1EAPA 3VXMA 3L6FB 3BQUB 1YMME 1JF6A 4ODHH 1OD9A 1QRKA 4JO1L 1TJHH 3MUGA 1KB9K 7CGTA 4D9RE 3R8QA 2VKWA 3P4LA 4RQQA 3SPVA 2XPGB 3V6OC 2O5XH 2EDYA 3U7YH 1NCCL 4JFEB 1MHEB 5C70A 4PJIF 4OCNC 1B6DA 1A3LL 3L1OH 4FFVD 5DJDB 2ZUTA 3SGDH 3OAUL 5IIEB 2JE8A 2HT4C 1MCPH 5EU6D 4XB8A 1N3NA 1T66D 1JGVH 1IMHC 2D03H 3OPZH 4DK6A 4JQXC 4E42A 1U8HB 3MJ9H 5DSCB 3TBWB 4XP4L 4XNXH 2VL5A 3UYRL 1HXMA 1LO3H 2E9IA 2PCPA 4FQHB 1CFQA 1RJZA 4ZUVB 2IC2A 3MRPB 4G6MH 3MJ9A 2VDNH 2VN7A 4PRHA 4IDLA 5MI0B 4RMSA 1YMMB 4XVUC 1P4BL 2NZ9D 1UWEL 3VCLA 2P8MA 2YPVH 4OSUH 2CMRL 1SEQH 3TCXA 4C58B 1JZ6A 4D8PA 3GIVA 5LCVL 5IIEA 5ABDE 4PJEE 5E4IA 1FO0H 2XKSA 5H94B 1ZT1A 5KSBF 3MLZL 3O6ML 2DTML 4K23L 4KRNA 5EORL 1LDSA 2PF6A 4ONHA 3NCEB 4X6DA 1BIIB 1FLRH 1NC2A 1QKZH 1W72L 4IM8A 4GAJH 2H2SD 4DUWA 5SWZD 2HKFH 4MNGE 2FB4H 4HH8A 1O7SA 3MJGX 5DC4B 5I1IL 4DZBA 3TH4T 3HE6D 4JFQA 3SCMA 2R4SL 1UJ3A 2OCFD 3GI8L 1F8TH 4EN3A 5AD0A 2Q8BL 2Y5TA 4BSWB 1NFDF 4NKDB 4EUPB 3JXAA 3VFMA 5ILTH 1TETH 1UXSB 4WI8A 4C4KT 3MGAA 1OSPL 3PWPA 2FCBA 4ZUTA 4NGHH 4FQXA 3LKQB 4S1SL 4AEEA 4LFHD 5CLWA 5A16B 3KPSB 3DX8A 4XNQB 1XT5A 2K1MA 1ZANL 4LPXA 1JNLL 3UPAA 4KKBC 4Y5XA 2OL3L 4OZIE 3VXUE 3M8OL 4JFDD 4O58L 1HEZA 3P30H 5ISZD 4Y5YC 4Y4FD 2BHYA 3I2CH 1ONQB 1PFCA 4MJID 3ARXA 3LKRA 1A3RH 1BMGA 4X80H 1C7TA 3IFOA 1IGJB 3LAFA 4ONOA 5EBLB 5EOTB 4MD4A 4KK9C 4HD9A 3OGCA 3VE0A 4ORGA 1BFVL 4YHNB 4OZHF 4GG6F 5DURB 3RUGF 4NO3B 5BRZE 2F54D 2NX5A 3RY5A 2AABH 5GRJL 5I15L 2KQNA 1I4FA 1WTGT 1B4JL 3C60A 3UPRB 3BPCA 5IFAH 1KJ2H 3IYLW 4XVTH 3HPLB 1YY8A 2VQ1B 5HVHC 1DUYB 4H1LH 5FF6A 3MRDA 4PJ5A 4NPYB 2OXHA 4M1GH 3CSYB 3CU1A 3OHXA 2HG5B 2P7TB 4ZUUB 4G7YL 3G6DL 3QUXB 4I9WD 4JREC 4L3ED 3VGAB 5KS9A 3TYGL 1N4XL 4NCDA 1P4IL 1MHCA 4M6OH 2L7UA 4ZDHA 4LLUA 5C0IB 1G7PA 2HTKC 4JKKA 1VPOL 3OX8B 2C4FT 3KPMB 5E6IB 1MJ8H 1SVZA 2Q86B 2O26U 4XPFH 2VDOH 5I75C 3ARFC 3ABZA 1CICD 3WO4B 4PY8J 2AXHA 3BZFB 1IAIH 1OARH 1UM6H 4ERSL 2YA2A 2XICA 3VXTB 4ZSOA 4DUXA 3MLUH 3D85A 5KOMC 2NY1B 4O2FA 4QRQB 4O2EA 5KG9B 1S5HA 3QG7L 2EIDA 2EKJA 1IGYA 3G5ZB 4WUUA 3QWQB 4IRSA 4NRYA 3KPRA 4RIRA 1FJ1A 3L5XH 4HIJA 3LQAL 1J0ZA 3MR9A 2XTJE 1S7RA 2A73A 5FM5M 3T0EB 1G9NH 1P4LB 3MLRH 3WJJC 4RMUA 4HWZB 1G7MA 4OGYL 2CJUL 2BSRA 1FZOB 3X12A 5IROA 2OR9L 1FRGL 4AQOA 1I7UB 1D9KB 1AKJA 3MLVL 4PRPA 4X6DB 3GMPB 2GUOB 3RVVD 4NZDA 2FX8L 3CJJA 3PDOA 4LDLB 5CJ8A 3WUWG 2IBBA 3JZ7A 2LABA 4QRPD 3EO9H 5DJ8A 3S9DB 5EC2B 1ETZA 1JGEB 1RIVH 4PGJA 5L0QB 2OZ4H 1JYNA 1XMWA 4R2GD 4IRZH 1MFCH 3VFPB 3Q3GA 5DI8A 3L3DA 1JTTA 4BZYA 3NIDF 4Q9CA 3DECA 1HOCA 4G9FB 1WC7A 3U9UA 3D25B 4OZHB 3PWJB 4I18C 3U0PB 4Z0BH 3S34H 1H0DB 4Z0BL 1KEML 1OGAD 2BSRB 5K59E 3RPKA 1NDGB 3O6FD 4F2MB 4PGBB 2YPLD 1DL7L 5ANMB 5AG8A 4BH8B 4C56B 1IGML 1FBIH 3RWCB 5HJ3B 1DVFB 1Q9KB 4DKFL 1WFUA 2P5WD 3K1KC 5E6IC 3FHAA 5EOQH 4TQEH 3VXRA 1P5UA 3WE6A 3MCLH 4OBRA 1G9ML 1AHWC 5GGRB 5JPNA 5GPRA 2MKLC 3CZFA 2G75B 1CDYA 1YQVL 5JZ7C 4QXGH 5SWSA 3PWJA 3U0PA 4QXGL 3D69B 4YHNA 3HE7A 1HOCB 4PG9B 3P11L 3MBEA 5K59F 1MHPH 3U2SB 3WBDA 2FHFA 1BD2E 2FIRT 2EE2A 3W9DA 1EV2E 5HYQA 4D0BA 2BMKB 1H15B 4XP9L 3IDGA 2B1HL 1T5WB 1VA9A 3HC3L 5D2LB 3DV4A 5D6CA 4MA3A 4F9LA 4YBLB 2EYSB 3TT1L 3VXRB 4POUB 5L6YL 4PD4J 2AK1H 3CFJB 2ZUYA 1EHXA 3DX7A 4WW2C 4JRXD 4W68A 1JPSL 5IF0B 5LVEA 4FTVA 4XVJL 5D1ZB 2XRAH 5C0AB 3PJSB 4HIIB 4JFFD 5D7JC 4G8EA 4M48H 3HNVL 1DLFL 2XY2A 4UILL 4X7CC 1NBZB 5ID0A 1LEGB 4OZIB 3V6OE 1IGCH 2FJGB 1JWMB 4RGOL 2GTWB 1HNGA 5IV2B 3R4DA 1EUTA 3ARFA 4XX1G 2VXQL 1YN7A 3S3PA 1SYVB 3S35L 3W9DB 2X41A 1VGEH 2FO4B 1BPVA 5MERA 4U1JB 4N8CH 5IVNA 1N59A 3LSOB 5IFJA 2ZJSL 3MTRA 1L4IA 2IBZY 2F54A 5F88B 2X05A 2GQHA 3B5GA 3OZ9H 4HWUA 4KU1A 5DHYB 4NP4L 4JN1H 5JQ6L 1EMTL 3K1DA 2F8OA 3MPCA 3P30L 4DW2H 3B9EA 1S7UB 1MQ8A 4RWYH 3GMPA 4EVNA 1OAQL 2QSQA 5D7JA 1G9MH 1BM3L 2GT9B 4F9PA 3SDXA 1OAUL 4ZTOL 4G80A 4R90L 43C9B 1DQQB 4HGKC 1LO5A 5FV1L 1TIUA 3JUYA 4KDWA 4UNUA 4GS7C 3QIBA 2ICCA 1H8SA 4PJCA 2BVOA 4KXZH 1U92A 4OBSA 4WHTA 3MACH 4ACPA 1WBYA 2JKXA 3IXTA 5E4EC 3WFEH 5D7JB 2C1OA 3N1GC 3D2UB 3ZKMC 3P4NA 3UDWA 1HHJA 3RAJH 1BECA 4EJ1C 4N5EC 4FOMA 5HPMA 3NCBB 1EO8H 1KIUA 4HC1L 4MDIB 3WLWD 3FAWA 4JM2B 4TULL 6FABL 4NZRL 3VG0L 4XP5H 4LLVA 3ARBD 3ARWA 1UQSA 4M5YH 5B21A 1JN6A 5HHMD 4M48L 4H26A 5HVHB 3TZVA 1FIGH 5FECB 3VXOB 1DDHB 3CVHA 4JR9L 2B20A 2DM2A 5IR1A 4HXBL 5LXGL 5DJXA 3CMOL 3G04A 3TJEH 1YMMD 3N06B 1E4KC 3KYKL 3KDMA 4QGTA 2AK4A 2LU7A 5A2KH 2VZ3A 4ONFL 2G5BB 2AJUH 3SDCA 4LRIC 4G8GD 4PTUB 5BS0D 5L88L 4NT6A 3M8OH 4Q6IB 5C0EB 3D85B 2NY3C 5C0JA 1A9EB 1SY6L 3CXDL 5EBWA 1PZ5B 4TVPD 1JPFA 5CJXC 4CN6A 4BFEA 4X80L 4U3HA 5FKPA 4Q9QH 5CKGA 2X4PB 5D96B 4UNVA 1CT8B 1HSAB 3IVKA 5EO9B 4MZ2A 3JWDH 4L9LC 2NXYB 1JWSB 1DBML 3RTQC 3MYJA 3SJVD 4XCEA 2QHRL 4X98B 3GGWA 3BVNB 3EO1A 2ESVB 3HI1B 3MFGB 2VLRA 4NC2B 3WIFB 1F8TL 1R5WB 1QLEL 4P57A 3TBYB 1U93B 2IANE 3NABH 1K85A 1BP3B 1FPTL 1RZJL 5JXAL 2AS5M 4M1GL 4K3JH 4QRRB 2EH8L 3NCYS 1CLZL 4AIOA 3DMMB 3UEZA 4V1DE 1ORSA 3BPCB 1YEIL 4G6AD 1F97A 2A9NH 3RX8A 5KSBB 4JFOA 1RZIA 4W4NA 4XRCA 3F7RA 3RY6C 2R56L 1A6WL 3R06A 4R0LC 1AP2A 4P9HC 3X3GL 3MROB 3D0VB 2QQQA 2NY2C 4NIKB 1VGKA 4CMMB 3DV6A 5FYLD 4YFLI 4ZPTB 3S4SA 1FFOB 2NXYC 1X5ZA 1MCFA 1C8PA 4KI1A 2VC2L 1FORH 4HF5H 5ADPL 1DN2A 1NEZA 3DRQB 5JXEC 2OBGA 1NFDE 4HS6A 4RA3A 4OZFH 3TH2T 4JHBA 3C09B 3DWTA 3R06B 1E6OL 1E6OH 1AXSB 2XWJA 1KYOK 4W4OC 3LH2L 4S1RH 4HHAB 1FZOA 4K71B 3DJ9A 4ALAL 1KNOA 1G7MB 2NY2D 2YHGA 4J3SA 3TBWA 3PE9A 3QWOB 1FDLH 2A73B 5CUSL 3T0EA 3WYRA 5FYKE 3LKPB 1EBAA 2BNQB 3OF6A 2EDHA 1OSPH 4KAQL 4F7TB 3RVTC 1X5LA 1NMCC 3ZDXF 3C87A 4Z7VB 3BHBA 4Y8DC 4Y16B 1MJ8L 1IAOA 4X83A 3EYOB 2GIYA 4MNQA 1WGOA 3LKOB 4RQQB 3WKNA 4JN2B 5HDBE 5E95B 1EXUB 5DURD 4PGDA 4LSQH 1FNEA 4JPVH 1HDMA 1GZPB 1UVQB 4D2NA 2YEZA 3LRSA 5E9DE 2BNQA 5D7LB 3N1MC 5C0AE 1YN6A 4F3FB 4D3CL 3INUL 2AV7A 2V17H 1RUAL 4LVHC 2HJFB 4DN3H 4RRPG 2YN3A 4U3CA 4FABH 3BKCH 4DFHA 3ZTNH 3OHXB 2F19H 4KY1H 1AC0A 3TA3A 3QEUA 3GJEB 1GVIA 4UB0H 1XCTB 3MV9A 1KJ3L 1U8MA 3LN5B 2B5IC 4PBVC 2GSGB 4MA8L 2OJEA 1ZXQA 3FN3A 5HHME 3LQMA 3MLYL 4M6NH 2GAZB 1PD6A 3UTSD 2ESVA 3HI1A 4LKCA 4OGXH 3LRSB 1MAMH 1VFUA 4XCEB 4MAUH 1I7RA 2YD4A 1KGCD 1C5CL 4M62L 3OR7A 4U7KA 3MBEB 3OKEA 4OCSH 5I19L 2GJZA 2FYYA 2GK0B 2AERT 5LBSL 3RTQA 5I17B 2UWEF 3IKCA 5GZOC 1KCVH 3PABA 3GNML 2BXYA 5KSAD 3BEVB 1LMKA 2A6JA 1TQCC 2DF3A 2O5XL 1A4JA 1V7MH 4H20H 5D96C 1RPQA 3RWIA 4I3SL 1KCRH 4KVCL 3LB6D 1CFNB 3OJDA 5EWIH 3VG0H 4XNMA 2I25N 3WUZA 5B38B 1EO5A 3DMMA 4WHTB 4JFDB 1JRHI 5D6DA 3LEXA 3RBSA 1FNGA 4M6ML 5EBGA 3S5LA 5FHAH 4NQDD 4K7PX 1P7QB 3RGVD 1RJLA 1Q9WB 4R8WL 2VN4A 5DEGA 4GSDH 4WW2A 3K2UH 2UWEA 4F7PA 2IWGA 3D9AH 5AYUL 1IGFL 1CF8L 5FYLL 3Q3GB 5DI8B 1PGRB 1YMHA 1S5IH 1OAZH 4JPWH 4QYOA 3EAKA 4IRSC 1NGYB 2GEEA 4YHLH 4IDJH 1MJ7L 3P2TA 4HUMB 1URLA 1DFBH 3NIFF 3PGFH 5H94A 1UACL 3ZDZF 4RWYL 3O6KH 3WXWL 1OL0A 4QHKI 5IB5A 3QWRD 5T1KD 5T1LB 4HXAL 4NOBA 4R90H 3CDCA 1TJIH 4JG1H 4MD0A 2XWBA 5IMKA 5CWSA 5I9QC 2J6EH 1MCBA 3BZ4B 2OJZH 1OCWL 3JV6A 2EIZB 4HJ0D 2B0SL 4ZFGH 1BEYH 3O3DA 3O4OB 1W72B 3KG5A 3EO0B 1J0HA 1IARB 3KPRB 3TBVB 1ZGLP 1INQB 4YHPB 2AJ3A 3PGCA 3NFPB 3BD4A 5EU7C 2MMXA 2BOCA 5F9OL 3VFUA 1KFAH 4WGVB 5TPWL 3K81A 2B4CC 4ONGH 1T66C 1WBZB 2P5ED 3IDIA 5F3HA 3BVNA 4CN1A 3GBNL 1F3JB 3B3IB 2FWOB 3K4DA 4JG0H 3AC0A 5C09B 2DLEA 1MVUB 1F2QA 2YN5A 3CMGA 5IQ7H 1J8KA 1DQML 5EOCJ 4QRUB 1EVTC 1KIQA 2AP2A 5CAYB 1MWAB 4I18B 3ULUD 4EN3D 3MNWA 5GGRY 1S9YA 3H42H 1PKQB 1T1YA 4F7CA 1GC1C 4KJPD 3V4UH 5D7LE 3CPLA 5BO1L 3BISA 2Q6WA 2DMCA 3DRTA 2HLAB 1V8HA 4LVOB 5EG6C 3ZYIA 5F7NC 3MBED 4KK8C 2E27H 1UB6B 4WY7H 3ES6B 2Q7YA 5CEZL 1YPZE 3HNVH 5I8CB 5ICYA 4NRXB 3L95A 3T1WA 1MH5B 3QDGD 2ADGB 2B8OT 2BVQB 4NZTL 4OQ1A 5DEFA 2IALA 3QEQB 1E4WH 5FUCC 3O8XC 3JSSA 3OKOB 3ARGD 2OJZL 1FNHA 2EICA 4KJPC 4TSBL 4F33A 4XMPH 3KPNA 4TUOB 1YY9C 1ADQH 1RIHL 1ES0B 3FRUA 1VACB 2AXJA 1OTUD 3T0AA 3JBG7 1AI1L 1VEPA 4U1HA 5EUKA 2W60A 4S0TD 4GW5B 5E0QA 1KIRB 1DQJA 1Q72H 4NQCA 4XXDA 2IPUG 1FH5L 4KFZC 4MLSA 5L2JA 3B9KB 1UB6A 1ZTXH 3N1FC 1ZEAL 3RRQA 2H45A 3CLEL 3STLB 3QIUC 2AKRA 3P9WB 1HIML 4C56A 3CFJA 2FH8A 4F7TA 2D0GA 4PB0H 4OD3H 4NJ9L 2AI0H 4KQ3H 4KK9D 3QUZD 2YUVA 3SN6N 4RBPK 4UTAL 5FV2A 4JPWL 2OZ4L 3MUY1 5JQ6H 5C08D 3CSGA 3OKKA 1YPZB 4NHUB 3O9WB 2VZTA 4X8JB 5MEOA 2WBWB 4PUBL 2BNUA 3Q6FB 1G6RL 2R39A 1LE9A 3V8OA 5MEPA 4Z7WA 3V5KA 2A0LC 4GRMB 3QNZB 4X0KB 3S34L 1GZQA 4Z7VF 3GSNA 4MJ6B 3AMLA 3DVFA 3T8XB 1C1EL 4PJ8B 3L3OA 3GIVB 4ISVB 1YJDH 7FABH 1YEDB 3EDJA 3WIIL 3S96B 3FB7A 3TBVA 3LEYH 4PRHB 5L9DH 5C0CB 3PL6C 2GKIA 1QSFA 4HK3N 3RQ3A 1PDKA 3NIGE 4PJ9B 4F2MA 3ZT6A 2DIAA 2QHLA 3MJ8A 4OZGE 4ERSH 5C6TL 5I0ZA 1DQQA 3OXRA 3CK0H 4V1DA 1U58A 3GSVB 5J4MA 5FK9B 2YA0A 2ZCHH 5JPMB 4YXKH 3DROA 3TM6A 2J6EA 3H9YA 4MJ2A 4OFVA 4OZHA 4MA7L 1KLUB 3ZE1E 1WWWX 5DQJA 3OB0H 2W0PA 5EOQL 1VFMA 5DJYB 4AIXA 5I6XC 3OB8A 5HHVL 1N8ZB 5JR1L 4HH9B 1OARL 4AH2B 2YZ8A 5J7CC 3TN0A 1DCLA 4ZUWB 1F42A 4MX7B 2CLZB 4GMTL 3Q6GH 1XCQB 4OB5L 1A1OB 4WHDA 1F3DJ 1TZHB 4QXUL 5CP7A 2QQNL 3BN9C 2APXA 2A6KB 4B0MM 3MYJB 3LOWA 3BIBX 3T4YB 1RUKL 5E2TH 4CMHB 1EGJL 3BPNB 3QDJA 4XAKE 1XGPA 1XGRB 1FZKB 3QEHA 1MJ7H 5GS0L 5E2VL 3PNWA 4YHIB 2MSPA 2H2SC 4LCIH 4M3JA 1QHOA 2BFVL 3TV3H 4NM4H 5HI4C 4YIQB 1UCTA 1D5ZA 5ILTL 4HIJB 1RZ8B 1T22A 4JFED 1IEAA 2DWEA 2J2ZA 3HPJB 3OGOE 3N50A 1T3FB 3G5ZA 4WUUB 4YK4B 4MZ3A 1SVCP 3QZWB 4QHMA 1OCWH 3SQBA 1T5WA 1S5HB 3QQ4A 4LP4A 1JYWA 2VLMD 3IAPA 4WO4C 5E1AB 4NO3A 3G04B 3IGAA 1CI5A 1PG7X 1OLLA 4FRWA 3EFFA 1MF2L 5EPMB 3ZMRA 1XGRA 3QXTA 3O11B 4GRLC 2C7UB 5H8DA 5LGJB 3ARDC 1UB5A 3NCJH 3FFCA 4Z7UA 5DQDH 5CEYA 3V6FA 2XNAA 3D2UD 1VEMA 1EVUA 4IS6B 3AFLA 5E2UL 3SGEH 1P9MC 4MXWH 4XPBH 1NCBL 1X5GA 2DQHH 1HQRB 4HG4K 5MENE 3C6SB 3MREB 4WFFE 1YMMA 3HR6A 3KYNB 4WNQB 3LEXB 1CFVL 3CDYA 2PW2A 4ESKA 4K3DH 5MEPB 2HRLA 3QIUA 3Q6FA 3MO1B 3I75A 2NY6D 4JRWA 3IAGC 1IVLA 4GG6E 1QO3B 4R0LA 1BVKA 5L2KB 3LN4B 4EBQH 3ZO0A 1NSNH 4TUKL 4BSVA 3PQYB 2VC2H 1EHNA 1LEKB 4F37F 5I74C 4GRLD 5F7LB 2ZCKL 4XNYH 4GT7A 1FJ1B 1FFQA 4P46A 4XXCC 3G6DH 3AU1A 3MV7A 2FECL 4OIIH 4KJWD 3NMEA 4PV8A 4QRQA 2YZ1A 3BW9A 1QRNE 4MHHI 4OSUL 2JJUA 4WNQA 4JN2A 4S1RL 5JHDD 4C55A 1KENL 4ZTPH 3RWDB 3MV9D 2EE9A 4PJ9D 5M7QA 1A3QA 1U91B 1MLBA 3ZSTA 1O5DT 5D7JD 4HX1B 3ALWA 4P9HH 4X7FC 2E6JA 2VXVL 1JVKA 3HR5B 5IP4A 5IJVB 4NJAH 5D2NB 2UVFA 4QGYA 1OP3H 4V2CB 1DBMH 3X12B 3QIBD 5HHXH 3SGKC 4PGCA 5DHXB 5GGUB 1T5XB 2X4SA 1JE6A 4H0GA 3GHBH 1QRNA 4Z7NF 5IJKA 3VGBA 2VYRE 4NWTL 4Y4KB 1AR1D 1RUAH 4LKXA 4TTDD 3CSBA 5I71C 1MFAL 3DX6A 2B1AL 3DOSA 2BK8A 4HUVB 1ORQA 2LFGA 2R1WB 1RUMH 5D2NA 3UTSB 5IB1B 4JPVL 3T3MF 5EIIA 3TNNB 1ZHNA 3DBXA 3MXWH 2O5ZH 1JHKH 3MV7E 4K7PH 3T3PF 1NC4D 3WS6C 1U91A 4EDWL 4FQJL 5F71A 3N9GL 4LAQH 1C12B 2AJVH 3IFLL 2EEDA 3FN9A 3G9VA 1RUPH 3OKEB 1F3DH 3FFDB 1N5AB 1F4WH 2XA8L 4NKOA 5F21B 4E5XA 4ZNCD 1ZLVK 4GMSL 2DD8H 5K9KB 3U0WH 1JNNL 1WCBA 3V6BR 4UOJA 4QF1B 1FV1B 5H2BB 4QRUA 4EI5D 1PG7H 3NGBC 4KUCF 1E4XH 1LP9A 4R2GC 1QSZA 1ND0B 1HH6B 4QWWC 5CINL 5CCKL 1F90H 4EI5B 5C1MB 5D2NC 1MRDL 1CFSB 4NRXA 4PJ7E 5BS0E 4I5BA 4ZUTB 3W2DL 2OP4H 2D7TH 3WS3A 2Y06H 5FUOL 1W8OA 3W0WD 1AH1A 1YEJL 2HTLD 4LPCA 5ISZB 2VABA 2D7OA 3MOAL 3QHTC 4NN5C 3MRFA 3BP4A 1MRCL 3SGDI 3WIFA 5KZCD 3VGHA 2CKBH 4P2YA 1R5IB 4ELME 2E9JA 5E2UH 1EO8L 3KPPA 4HC1H 4R97C 1NLBL 5C6TH 2YK1L 1NGQH 3UP1A 2D7MA 5BCAA 5EOTA 3SPVB 4YQXH 4UZGA 3DURB 2BNRB 3ULVF 5KW9L 4K94H 1EH9A 3AS3A 3LKOA 5E2WL 5DUBB 4GUPA 1YYLH 5T1LA 2YPVL 1FIGL 5DJAA 1UWEH 4U2YA 3WS6A 3E8UH 1D5IL 5EUOB 2NY5H 2C3VA 4KKAC 3ET9F 3P0VH 3VXRD 5HYEA 2EDXA 1YMHB 5TH2A 4X4YB 2WUCL 3BOVA 1HINL 4LGSB 3V79C 2NY3D 5KANG 1TJGH 3NPZB 1MCIA 4U6HA 3DUHA 4P5KA 1KB9J 1QR1A 1B2WL 1GGBH 3EGSA 1HXMB 3MOBL 3L5IA 4W70A 2HJKB 3AMKA 2IH1B 3UAJD 5CEZH 1AXSA 1W72A 3V2AR 1MFDH 2BFVH 2NXZC 3IETA 5T3XD 5GJSH 1QSFD 5EORH 2EIZA 3HR5A 4M02A 1A8JH 5SX5H 4PR5B 4LLMB 4U6HB 1OY3B 1ZA3B 3WHE0 2VXQH 5B39A 2FX9H 4POZC 1GC1H 2VLKB 4ONHB 5IWLA 5HYFA 5E8OA 1C5BH 4XVJH 1KCUH 2HFTA 4JHAH 5AAMA 1CVRA 1MFEL 1DVFD 3L3GB 4L3EB 2ZUVA 4L4VE 2F8VA 2W0FA 3BT2H 4PJFF 1H3GA 3VI4E 2VWEC 2G5BA 3AREB 4FG6D 4G6JH 2BVPB 5CD3A 1REIA 2ZUWA 1EFQA 1FZJA 3O3EB 5IESL 4PJIB 4Z7OF 5BZDA 5CFHA 4N8CL 5IESH 2E7BA 3NCYP 1IAIM 4KMLB 3TA3C 3GSQB 2FGZA 4PJHE 4S1DC 4RMWA 1PY4A 2FH6A 4XBPA 4PRDA 4OUUB 4JB9L 5E9DB 1NGXA 1YEHH 4WWKD 5CEXB 4J3OC 1NGPH 3O4OC 1M71B 4UQ2B 4AM0A 4NNYA 1UKTA 5EA0L 4LLVB 4ZNEA 4WWKB 5D8JH 2XWTB 3ZE0F 4FFVC 2EXYC 2XNAB 4FFZH 2YD9A 3A6CL 3TPUA 1I9RL 1N6VA 1R3JB 3GHEL 3QJFB 3RGVB 3P73B 4HZLA 4RFEA 5K9JL 1R3HB 5F6HI 2HVJB 2FD6L 4LRIA 4LCWA 2H6PB 3STBA 3J8F7 3TIDB 2K3TA 5T3ZD 2GJZB 2F58H 1IQWL 1DQLH 1IRAY 2IAMB 2ID5A 3DNKA 2GTWA 3FAXA 5DD6A 2ENSA 3WMSA 3KJ6H 4RNRA 2MOVA 5AWNL 1XF2A 3VG9B 3WLWC 4PG2A 3QDGA 1T1WA 3DSFH 1W8NA 4LDEB 3DSFL 2CRMA 3TT3H 1HILB 2YK1H 1Q8MA 3V5DB 2Z4QA 3ARDD 1QPPA 1BOGA 2CDGA 2ZSVA 3PGDA 3DHJA 3UTSA 1WJ3A 1WLHA 3SQOL 3FO0H 4N0CD 4TSBH 1RZ7H 3Q5OA 1R3IH 3MV8E 4FQCH 3G08B 4LBEA 5DHYA 4M6MH 4PRIE 2R29L 3F7YB 4KROB 2CK2A 3FQUB 5EN2A 1HXYA 2DQIL 5ERWA 2VZ1A 1Q9LA 4NNPH 2MHAB 2OXGA 1KUMA 2P42B 3UTPD 4MVBD 4OF8A 3T0BA 3QPQD 3S35H 2YRLA 1FRGH 4JFHD 5KVDH 1XEDA 5IBLD 3O4LD 4G8IB 5F6IC 3MGTB 1LO0L 4X99A 5BJTA 4L8BA 2BHUA 1G9NL 3KR3H 4YR6B 3VFNA 4LEOA 4FFYH 4HMDA 1QNZL 3MOQA 3DPBA 4V1DB 4LLMA 4F9PC 2M26A 3WN5B 3I6LD 1VGKB 5C0CA 4UMGA 3GNMH 5E6ZA 5FFLA 4Y16D 1HHGB 1S7QB 1N4XH 4QCIB 3QUXD 1WZKA 1Q94A 2PCPB 4ODVL 5FA4A 1LO2L 1J8HE 1ZHLA 2DQTH 4GO6B 5FA3A 5T5FL 2OX5A 1XZ0A 4KKNA 1KELL 3MRBA 1JGDA 4G6AC 1W0VA 4F8TA 2BVPA 3LPFA 1SY6A 3NVQA 4XGZA 3ESUF 3FRPG 2A1WL 1CR9H 2W0FB 1E27B 4LCUA 3CD4A 4PY7B 3CVIL 3HC0B 5GIRA 4X8JA 2BOCB 4ZAKD 3U82B 1MCOL 1T2QH 1YNLH 5DDHB 4OZHE 1L7IH 4JRYB 4NBZB 2AJZA 5MENA 2PKDA 1J12A 5EZLA 3BI9X 2FBJL 3L9RA 3QIBB 4UQ3B 1F4XL 5IFHH 4I0PC 2EC9U 2WIIB 4M6AA 3QQ4B 3FQWB 1YJDC 1ZT4A 4HMCA 3ZKXB 3CZJA 4QHMB 3QA3B 1KC5L 4ALAH 3NZ8B 1HKFA 4ORZC 3P4MA 2AJSL 2ITCB 4CBPA 3I6GB 1G9EA 4BH7B 4ENED 2HT2C 1Y6KR 4Y19A 1OWRM 2BRRL 5T3ZH 5ICXB 1OAZL 2AV7B 4UI2A 4YXHH 1OM3H 4JVWA 2EDLA 3U0WL 1UWXH 2BVQA 2VISA 1J05B 4P99A 5IEKA 4Y0GA 5ICYB 3RUGB 1TZHA 3HCVB 5CP7B 2C7UA 5JIHA 4G9FD 2ICWB 1GCFA 2XZQL 1CLYH 4MWFA 4P3WA 2B0SH 3L3HB 1DQDL 4JQXA 2ITCA 3FO2B 3CH1A 5BS0A 3EFDH 1I4FB 1TQCB 3EOBB 5FK9A 3SDYH 4LNRB 3MRQA 1H3XA 1JHKL 1EBPA 4HAGA 2N1KA 5AUMA 3ROOB 5EU3A 4IHOB 3MLYH 1EEYA 2R0ZL 4NO2A 5HGHB 1Z0MA 5A2FA 3BDXA 4OF5A 1NKRA 4ZODA 3L3DB 3C60D 3LS5L 5DF0A 1HCVA 3MRJA 4XVTL 1BOYA 3L5JA 4H0IA 2YSSA 3LVEA 1MNUL 3C6LD 3UO1L 4G8GB 3V95A 2C5DC 4Z5RB 1PY9A 4MA8H 1P84K 2PYFB 5EOCH 1U2CA 1MPAH 5AAWA 2H1PL 5C86A 3HLAA 3FB5B 5KVEH 2E5EA 3RWCA 2I9TA 4R4FH 3P9LB 4BH8A 3QCTH 3VFMB 5I1JH 2DQDH 4Y4FA 2R1WA 1ZVSA 4G7VL 1KCVL 3BGFC 2BVOB 4AK1A 4C83A 1T3FA 1A21A 3IU3A 3QIUB 4GKNB 3KHQA 1EXUA 5HY9B 2D4FA 5I1LA 2Z31D 3CMOH 5HHXL 1CE1H 4LHUD 4YDIH 1XR8A 4PJEF 2XZQH 3BJLA 5I1DA 2ARJB 3BYYA 1FAKT 2OI9C 5DRZA 2X6MA 2JJSC 1AGDB 4HWBA 4J3UA 1D6EA 3IDGB 3TCLB 3IDXH 3DX8B 5DVNA 5T1KB 3BEWB 1JRHL 5CZKA 1SJVA 2NY3B 3OKOA 1FYHB 1JNHB 3VA2C 2JJTA 2CLZA 4LASH 4P48A 3GUTA 5MP6H 3S98A 4AG4H 5I30H 1CQYA 2W0KA 4GAJL 4AH2A 2ZCLL 2Z92B 2X40A 1MJJA 5C0JB 2WM0A 1DEDA 4LVNC 5CP3A 2FJGA 5ENWB 1DUYA 3EYUH 1YNKH 5LGHL 1E0OB 5EZJA 1NBZA 4P4KC 1P7KB 2Z31C 3KPRE 2F5AH 5B22A 3MRIA 3KDMB 3DARA 4NM4L 4YIQA 2DJSA 1IT9L 2NMSA 4GXUN 4G9FE 4Y88A 3RA7L 2KZ1B 2CKNA 1ZLUH 3OG6B 1KN2H 4WO4A 4YHIA 5HJ3A 5I17A 4P59L 2AEIT 1MIEL 5IT2L 3F8UB 1X5AA 5LQBL 2W9DH 4WUUE 3MA7B 1IC5H 2X1WL 4R4ND 2IF7A 1ZT7B 4NFBA 4UV7H 5FYLE 3SKOB 1FL3B 2C1PA 4P5TC 4LU5H 5I1JL 2JCCB 2X5PA 3L6FA 3VD5A 1JGVL 3EKCA 3B6SA 4KVNL 4FHBD 1MJUL 1UB5B 1CLZH 4JLRB 4CU7A 3O11A 1ZWIA 4EBQL 5BV7B 4NO2B 2HMIC 3ESVF 3LMJL 2XFXB 2QSCL