2EZ0D

Crystal structure of the s107a/e148q/y445a mutant of ecclc, in complex with a fab fragment
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ion-binding properties of the ClC chloride selectivity filter.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords H(+)/Cl(-) exchange transporter clcA
total genus 48
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ez0D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ez0D01
3IFPB 3LY6A 3MRQA 3FMGH 5HHOB 3MCG1 4N8CL 4PJXE 1Q0XH 5C3LD 5AYUH 3RL1A 4OLEA 4AG4L 1S7TA 1FO0A 1KCVL 3CMGA 1VEOA 3SGDH 2GJ6B 4QRPD 2BSRA 3GMPA 1TZHB 4NOFA 3GMPB 1K6QL 3VFPA 4ZAKC 4K71C 3GHBL 4ZUSA 4MWFB 2Z31D 4P59L 4Y4KC 3SPVA 1P7QD 1CXLA 3CSPA 4OTXL 2EDDA 5BV7L 5A2KH 2ZKHL 2MKLC 5JPMB 5FYJE 5DURB 4FQ2H 5EWIL 4PJEB 5TE7L 1B4RA 3EGSA 3PWVA 4YXKL 1MY7A 4OZHE 3FQNB 5FKPA 4IRSD 4LNRA 3VWJA 3RA7H 3UTZA 1A7NH 5IOPA 3IF1B 4YR6A 2GK0B 5DQDH 2AXFB 3RZCC 3LB6D 4NKMB 5E24E 2E7LA 1N0XH 3RGVA 4OFYD 4U49A 4KROB 4G7VH 5JXEC 1HEZA 4XNUH 4Z18A 3Q3GB 1KFAL 1MCIA 4UDTB 3DUSB 4KGJA 4GS7C 4PY7A 3NACL 4WJ5A 4FMFA 3R06A 1W0VB 5AEAA 1NC4A 4L8BA 5E00A 4JKMA 4HK3J 3D85A 1T5WA 3GSQB 3BKYH 4PUBH 1J05A 4LP4A 5IFHL 3P73B 3MRMA 4KTEL 4Y5YB 2R56L 4K71B 4NO0B 5I9QC 3LEYH 1HZHL 1D5XA 3B9KD 2DIJA 2CPCA 5K9OB 2R0KL 3EFFB 3QA3A 4E0RA 3FQTA 4WENB 1ZT4B 1I1YA 4JFDB 1I7ZB 1OD9A 3MRIB 4W81A 1BEYH 4XBEH 3VMOA 4JHWH 4OV5B 5F3HB 2B5IB 1NL0L 1HHGB 4PGJA 1V3KA 5FOBA 2HVJA 2LAAA 2NY6C 5D7LB 3P3YA 1C5BH 3FONA 4ELMF 4OGYH 1I1AA 5E99H 3IGAB 4G9DA 3VCLA 4U2YA 2XFXA 3VCLB 3C2AL 2FX7H 2ZP0T 1F97A 4OCXL 1AGCB 3QDGA 2PO6C 3LRSA 3MV8A 5D1XA 4FOMA 3DGGB 3WIIL 5B38A 4LCIL 3WIFB 3CFBB 5EFIB 3ZL4L 5I1KH 4H26B 4K7FA 2BVPA 3ARGA 3M8OH 3WXVH 3RVWD 1NAKH 1KB9K 5FOJA 5KOVC 5A16B 3UZVB 4S1SH 1SJEB 5TDOA 1CFQB 3O2VL 1MCJA 5F6IC 3RBSA 1PYWB 4A2MA 1BAFH 4NKDB 4Z78A 2XZAL 1IQWL 4MXWH 4OV6F 3ZDZE 5IW6B 5HPMA 1FNLA 3C08L 3T1FB 3VRJB 3HE7C 2XN9B 3QI9C 4QO1A 3C60D 5I1AB 1Q38A 2YXFA 4FZEH 5C0GB 2ZCLL 4GBXC 5IMMA 2D7PA 3UYRL 2JJWA 5K59F 3QRGL 4XVJL 4WHCA 1L9MA 2GI7A 5DLMH 9CGTA 3DRQA 2R39A 1A6AB 4X9GA 5C0BB 2AQ3A 3MNWA 5CBAA 1JPFB 3NZHL 1OVZA 5CGTA 3G5ZB 2PTVA 5C0JB 5A2JH 4EZMA 4ZNEA 4S0SD 5F7UA 1EHLH 3MO1A 3CUPA 5J13C 1Q9WB 4LLDA 4MJ6A 1UACH 3CH8A 1FNEA 2CLRB 4MJIB 1DBBL 1BD2B 1IILE 4Z7UB 1QRNA 4LPWA 1LEGA 4NO3B 4N8PA 3PABA 1CXIA 4HC1L 2B4CC 1EHXA 3IDGA 4JZOB 4RGNB 1E6JL 1SMAA 4UU9A 2DQEH 4P3CL 4DKFH 1F00I 1ZSDA 4ZUTA 2Q8AL 3B83A 3TFKC 1T66D 3BWAB 4P23D 4EUPH 1JRHL 3T4YA 5IQ7L 1E4KC 3MUHL 1BFVH 5I18L 5AYUL 3EO9L 3SGJC 3WKML 3OKDB 4YBLB 5HYFA 2GJJA 4MAYB 2P5ED 3ULVF 3LKSA 1MFBL 3MRBB 2H1PH 5C0EA 3F6IA 3SKMB 4DCQA 1T5XB 3M45A 3NIGE 4K3EL 3QNXB 3KPSA 4LIQL 5D2LF 1JYXA 2EDNA 4OT1H 3LRSB 2LTQC 3MV8B 5D4QA 4LEOB 3LS4H 2BVQB 4P5TA 3DMMB 1CFVH 4QOKA 4LGRB 1N3NB 5FK9B 4HMCA 2BFVL 1AFVL 1I7TB 1FYTD 4U1GC 2JB5L 5IWLA 4P48A 1XGRA 5M95B 5DUPH 4MA8L 2H2SD 4JPIB 4NCC2 4M02A 3L3GB 4QTIL 3WFBL 3P4OB 4KZDH 3FKUS 4DZBA 4HC1A 5DHYB 4EI5D 4K3JH 5SX5K 1LK2B 2X4UA 4HJGB 2IBZY 3EDEA 3UCRA 4HWEL 3IXAA 3UTTD 1QLEL 1YN7A 1K4DB 1MAJA 5DFWH 3UTSA 4F7TA 3QDJA 2IG2H 4H26A 4ZFOL 1YEGH 1MI5D 2BVPB 3ARGB 5BW7C 4J7RA 5LQBL 2E7CA 5DFVC 2VC2H 4WDIB 1MI5B 2F5BH 3ARGD 3WEXA 2Y72A 2CRZA 4ZSOA 1Q0XL 2WINB 1X3DA 2GUOA 3AM8A 2VLJE 4IOSD 3MGTB 1X5LA 1RMFH 1GCFA 3ILPA 3MV9D 2GW5A 4PJDB 3SKOB 4HIJB 1PD6A 5F96L 1DQJA 4XPFL 3LRHA 1X4XA 3MRRB 2P5WD 4C83B 3BHBA 5F7DA 2Q8BH 3IXTB 1FZMA 3HZYA 1NPUA 1V3JA 3D9AL 5CJXA 1IGCH 2A6KA 4NHUA 4HWEH 1MCWM 5EZJB 1P1ZB 3V5DA 4QRRA 3JWDC 4OGZA 3UTQB 4U1MA 3HRPA 4J3XA 1RVFH 3HC3H 3MMEB 2EZ0D 4YPJA 3W9DA 3QEUA 3TWCH 3L6FB 4D3CH 1DBBH 3U46A 4ETQA 1Z2KA 3RPIA 4XP4H 2FH8A 3QEQD 3MLSH 2Q6WB 4E41B 2V2WA 2ESVE 4JHAH 1QBLH 4PJ5E 1CWVA 1NFKA 1C1EH 4ZUUB 4JFFA 2J5LC 5JW4R 2UVEA 1U9KA 4AMKL 5HGDA 1X9QA 1BBJB 4H1LA 1VFUA 1G9EA 1XF2B 1FYHB 4ZTPH 3SPVB 2Z91A 2EYSB 5E8NA 5I74C 5C0NC 3FB6A 2FSEA 1V8HA 2EDJA 2O26U 4G8IA 4XPHH 4EXPX 2H9GB 4RISH 3VD7A 3VD5A 1EO7A 1S7TB 4OCYH 2KZ1B 5C07A 3ARTA 3T4YB 3T0AA 4NRZA 1ETZB 4LGPB 1Z3GH 1MVFA 1GRWA 4JY6B 2Y36L 3DNKA 3C08H 3GZKA 2ZZUT 3O0RH 3LEXA 1B3JA 1XIWA 2E9WA 2XZCL 4JZJA 1MELA 4YZFE 3SN6N 4XPAL 1HINL 2HG5B 3SCMB 5JPMA 1FLTX 5E8DL 1FL5B 3AY4C 3ZE2E 1OF2B 2D7NA 1FNGA 1UZ6F 2FX8H 1U95B 1MCWW 5KSAB 4BZYA 1IT9L 1MQKH 1A4JA 3HAEH 4WW2F 3WIIH 4EDWL 1SYVA 2OTWA 4PBWD 4PJ7B 1JZ5A 4H1LG 1GGUA 1KENL 3ARDA 3CSGA 3QIUA 3KPRA 5CSZB 4L8SC 1DEDA 2BSED 3QPQC 3BP4A 5ITBH 3X14B 2X09A 4PJAF 2ADJA 2AXFA 2PN5A 4KRPD 5C08A 2O5XH 1A1MA 5C6PB 3UO1H 1OWRM 1EVUA 2I60H 4GLRH 4U1HB 4QXGL 3QQ4A 4DGVL 2UZXB 2RIKA 1RHHA 5DJZA 5C6WH 4IRZH 3WS6A 4WWID 2CQVA 3REWA 3UTSD 5D7IE 4CJ1A 3B8YA 4G3YH 4BQ6A 2EE3A 2YK1H 3CZFA 5I1EH 3MLSL 3NAAH 2DAVA 4HKJA 1T5WB 4J23A 4EN3B 3ORJA 2FB4L 1R3HB 5EORL 4J3VA 5MENA 4J12A 1Y18B 4NZJA 4D94A 1TJHH 5D6DA 4OCRH 4U33A 4GLRI 4PS4L 5BRZD 1UZ6E 4MX7A 5CEZD 2BOBB 2VOTA 1AY1H 3CFJA 3C8HA 4EQ3A 1ZT7A 4F8TA 3JVGA 2OTUA 5F8QC 3F6LA 5EU5A 3JWOH 1PSKL 4G7VL 4PV9B 4CN1A 3IKCA 4PGCB 4Z0XB 3MREB 3KG5A 5T1KB 5H35B 2ITCA 3LKOB 3HE6A 4U1LB 3SDCB 3BDYH 3C5JB 1OQOA 6FABH 1E28A 4HJJL 5FO9B 5EUOA 2YUVA 2IF7A 2K1MA 1EGJL 2PUQT 4P3DA 4FFZL 5E9DB 3UMTA 2G5BA 3DVNA 1IAKA 5CMAA 3BD5A 1U3HB 3V4UL 2Z92A 3DECA 4JFFD 2R2HA 2FHBA 1R0AL 1DBAL 4D9RE 3ARDB 1LO2H 2Z93A 3ROOB 4QHKJ 3DVIA 4I48A 3U4EA 4DAGH 4M1GH 3EYSL 1TMCB 4PJAE 5HYQA 1F3JA 3OGCB 3G5VA 1XF5B 1MFEH 1MCHA 4BSWA 4PFEA 4D9LH 1YN7B 3HUJA 3OAZH 5I17B 3IXAB 4Q58C 5E2VL 5EU4A 5GS2D 3LPWA 3Q3GA 4LGSB 4O58L 2EH8H 1R24B 4OD2B 2Y6SD 3DYOA 3FO9B 5MP6H 3ZMRA 4M7LL 3GIZH 5C92A 4JPVH 3WD5L 4DGYL 1WCBA 3TA3C 1JI1A 3MBXH 2E9JA 2GFBA 1MSPA 1JV5B 3LRGA 4RBPH 3ILPB 4OUOA 4CU8A 1HCFX 2YMXL 3TBYB 4LHUB 5LCVL 5ALBH 3RUGF 3IYLW 4WEBL 3BZFA 3P9LA 4HLZH 3S37X 2UUDH 2FJHA 1HDMB 2V2WB 4XI5D 4M6NL 4OLWH 1MUJB 3JV0A 1JGLH 1A9BA 4XB7A 1BWMA 4CADA 1X6LA 5D7SL 2W1NA 3KPRD 3ILQD 3U9UB 3CXDH 1DQLL 1T3FB 3CVIL 1EEQA 3S36L 3UTQA 1V3MA 4KU1A 3H7BB 3TYFA 4ZOAA 5T3XD 1U2HA 1BIIB 3ARFC 4GW4A 4MJ2A 3U46B 5FF6B 5BV7H 1L0QA 3QHZH 3QEUB 1G9NH 3MCKB 6CGTA 3C5JA 1EXUB 4ODWB 3TA3A 1O0VA 3FQRB 3TH2T 3NABL 4PYHA 1RUKL 4JFEE 4X9FA 4MA1B 1DFBH 2NZIA 4UTAH 1QEWA 2DJ4A 1QRNB 5DGRA 1NUGA 3I6GB 1CL7H 4YXLL 5T1KA 5JIKA 3I6GA 1TCMA 1QA9A 4DGIH 4OLZH 1J86A 4H0HB 3REVA 4UV4H 4JO2H 1I9RL 3L3KB 1U3YA 3FB6B 2BOBA 1BQSA 3O45B 3RVVC 4OD1L 2W9LA 2P47B 2VDML 4KK9D 3SBWC 3LIZL 3BKML 1YEDB 4XNXH 3FRUB 1LE9A 1OGTB 4FQXB 5FO7B 4M6ML 1N26A 2ARJQ 3I6KA 1J0IA 5GS0C 2BCKA 4WDIA 4UT9H 1ERNA 1A4KA 1DQML 4DUWA 1UJ3B 3GMMA 3KJ4C 5B39B 1PY9A 5D1ZC 3OX8B 4OZ4A 3HI5L 5ICXB 4YAQA 4V1DA 4FQQA 4H5SA 5D5ME 5HHNB 4BFIB 3V8OA 1NGZB 1OP3K 3PL6D 3CXHJ 3GGWB 1KLGA 4WFEE 5JTWA 5B8CA 3NZ8A 1AD0A 4X6CB 2HKFH 3TO2B 3WBDA 1J5OH 4CADB 4QXTA 4CMMA 1UKTA 2JJVA 1ZHBA 1A4KB 4JO1H 3BMWA 2J8UE 5HYSA 3WO4C 4Y5XC 4PREA 4PYGA 1INQB 1T2QH 3UC0H 1OTUC 3V79C 1MREH 3BQUB 3MJ9H 3BP7B 5E8OB 1TVHA 2E9IA 4EDXA 1NGPH 3CZFB 1FVCA 2CUHA 1WCBB 4KUCF 1OAYH 2VDNH 5C0CD 1WVZA 3GK8H 2EKSA 1OAKH 3SDDD 1GL4B 5F89B 4Z7OE 4QRRB 3EYQC 1HHIB 3G6JB 1RVFL 1IM9B 1LMKA 2OQJA 4YHPB 1T1WB 3KPLB 4LAJH 4MXVF 1OLLA 1HE7A 2GITA 4NQCA 1JWUB 2N56A 4OKDA 3VWKD 5IESH 4I0KA 1YYLL 4K9EC 4PD4J 1Q1JL 2Z8VC 3GSVB 5T1LD 4BZ2L 4PJBB 1KUMA 5JW3H 5D2LB 1UH2A 3VGDA 4B53A 4EBQH 4PGZA 4NRXA 3LH2H 1I7TA 4NN5B 3ZHLA 1T6WA 3W0WE 3RPKA 5D7KE 4OLVL 2QLVB 4GUPA 3DXAE 3TN0D 3ULVD 4X6FA 4RDQG 4PLKC 1J1XH 1RU9L 4X6EA 5D1QD 3LB6C 2Q76A 3P9MA 4LRNH 4ODXA 3QNXA 2OP4H 1PJ9A 1JGEA 4XMPL 4KKLC 4NM4H 3GRWL 4NUJA 1XR8A 5TF1L 1ONQA 3K4DA 2N7AA 4HUWA 3B2UC 4NHCH 1C8PA 3TP4A 3U0TB 1HI6A 2DKUA 1SEBB 4RZCA 5TDOB 3U0PA 2UWEF 2VZSA 3CVHL 1JF1B 2OSLA 5K9KA 4NFDA 4Z78B 2YOCA 4HFWA 4JO4H 1X4YA 4I5BB 4NCDA 4S11A 4P59H 2CO7B 3DX6B 5E1AB 4Z8FL 1KJMB 3GMLB 4R90H 1LO0H 2J6EH 1F4XL 1XR8B 4PGEB 1FLRL 2A6IA 2YD5A 3ARDC 2DB8A 2IBBA 3OJDA 4JM4H 4QHUA 4Y19A 1S7WA 4MNQB 3BZEB 2P4AB 3U82B 4HUMB 4NQDD 3U9PL 3PIQA 2Z31A 2BDNL 2R8SH 5ALBL 2NLJB 1AGEB 1S7UB 5JHDE 5FHBL 2IANE 2X7LB 4ONFH 5DC0A 5C2BL 1A14L 1HN1A 5DJZB 3HZVA 3GSNA 3RNQB 4XAWL 1CF8H 4AH2B 5GRWA 4M93B 3RA7L 2DRUA 1BD2E 4NQCB 2RAMA 3CJJA 3I2CH 3FFDB 1MEXH 3RWDB 1G7JB 3PL6A 5EU6A 4YUEL 2AJ3A 1NLDH 3G6DH 4PRHA 3RRQA 1IARB 3P2TA 1KB5H 3D69A 4WU7A 2HFTA 4F37K 3QWOB 1RZFL 2B1AH 1KB5A 4O9HL 2JK5A 3R4DA 4X6BA 4R4ND 4AEIL 4HZAA 2EYTA 4NKOA 3BESR 3GSQA 5EOCH 2XKNB 4D0DA 1VPOL 2OI9C 3S8WA 3GI8H 5IBLC 4P2YA 3H7LA 2VLJB 2R9HC 3CFJB 5D2NA 5HGGS 4FA8A 1WISA 4YHYB 2ARWA 3EYQD 2HTKD 3HFML 3OF6A 3BP6B 1MCOL 2RGSA 1E0OB 4K7FB 4NM4L 3WV0A 2VB5A 4Y4HB 1VKXB 1IGIH 2FATH 4JKKA 3QXAB 2C4FU 2YPLE 1CG9A 2XXCB 1CDIA 3N1PC 4PRBB 4NZRL 1R3JA 3KPSE 5AUMB 3GBNH 3QO0A 3SGEI 1I3UA 4RAHA 4NQXB 4LSQH 1UVQA 4H25B 4Y4KB 3T3MF 2OSLB 2NMSA 4QOKE 3K1DA 5K9KB 1J5OL 1FFRA 5I1IL 4K7PL 4DGYH 3K1KC 4FZEL 1QBMH 1JFQL 4P0DA 5FK9A 4M8VA 3MRDB 4LSRL 3RUGB 1IT9H 1MQKL 4WI7A 5DEGB 4WGWB 2H8PB 3FB7A 4HQQH 1R24A 4OD2A 1IQDA 5FGRA 5C6TL 1O7VA 4I2XA 3V52L 3TN0A 4PRBA 4ZDHA 4JFQA 5DSCB 1JK8A 3QZWB 3QFJA 3OHXB 2UYLB 2DM7A 3QG6A 4AY0A 4YGAB 2ESVD 4LF3A 3UDWA 3MA7A 4GQ9H 3DI3B 1D5MA 1JHKL 3CFKA 3H9SE 1UACL 4G6JL 3WHE1 4ZFOB 3FQUB 4B0MM 4JDVB 3KYOA 3G5YB 4G7YH 1HHKA 2E3VA 3MFFA 1KJVA 4OZGA 3HKFA 4PG2C 1WBZA 1ZA3A 2IBZX 3CSYB 5IM7A 1FVEB 4K8RC 1PBYA 3OB8A 3LHPH 1FC2D 4Q74A 4FN0A 1F4WH 3GDBA 1AO7B 1WFUA 1ZHBB 4KJWC 4DGIL 4GAYB 3ZYZA 1KCRH 5TF0A 1JPTL 3DVFA 3OQ3B 3ZO0A 3CU7A 1JCKA 1FGNH 5IQ9B 2P8PA 3P40A 4JRYD 3DV6A 1YEKH 4RWYL 4BK4A 4KKCC 1PKQA 1LNUB 2XNAB 3V0WL 5JHDB 3PP3H 4NO5A 5TFSH 2JE8A 5F7FA 4HUKB 2GJ6D 4QRPB 5A3IC 1PQZB 4RA3A 3QXVA 4FQJL 1MI5E 5DRZA 2CRMA 2E6PA 4YC2B 5A2LH 4WTZA 4C56B 4P2QB 3CC5A 5FM5M 1T0NB 3IFLH 3BSZH 5DT1H 1MHHA 4FFWD 4LLMA 2W07A 3LS5L 5I66B 1A3RH 2PO6A 1NCAL 1EA9C 5IBUB 4KPHH 5BS0E 3AC0A 2GAZA 2VSDA 5KOMC 1FG9C 5KVFL 1JFQH 3P9WB 5FOBB 3GSXA 3DROB 1I9JH 4YFLI 4UIMB 2CH8A 5CEYB 3D18A 1OM3L 1SEBA 4LSVH 5HYJA 1NFIA 4Z5RB 4DZ8A 1T89A 1WEJH 5KAQF 1AI1L 5F7LB 2DTSA 1WFNA 43C9B 1DLHA 4HGKC 2NY4D 5C0AA 3EKCA 3OX8A 4OZ4B 3GHEL 2VDOL 5C0EB 4HIHB 2BNQD 4DK6A 4XCFL 5JW4N 4NBXB 4XTRC 2DQJL 3L5XH 1GVIA 3MJ7B 2VLKE 2LE9A 3GSWA 1VFOA 5SX4H 2R2HB 2ARJB 3JVGC 3PGFH 1DBJL 2B0SL 3KYOB 1RUML 2DLHA 2AS5M 3MNZB 1FFPA 5FM8A 4HS6A 4GJTB 2CJUH 4UT6L 3FT2B 3IDJB 5J11B 3KXFB 3WL9B 3UTPD 4L4VD 1MPAL 2EDOA 1LP9F 1BFTA 2I07A 2Y06L 1H3PH 1EJOH 5DUBA 2EYRB 4FQCL 4F7MB 2MQ3A 3ECBA 3Q6GL 3EO1B 2X70A 5F89A 4ALAH 4JLRA 1MF2H 2NLJA 4ZOEA 5DEFA 5DJAA 1FAIL 4YX2L 3T0EA 5ANME 2XG5A 3TBWB 3FAWA 2EE9A 3BGMB 3K81A 1FZKA 2EDHA 1F11A 1OB1B 5FXCH 3MFGB 1BFVL 1ZVYA 3RWFB 1UKQA 4KMTL 5FDWA 4JM4L 3RWFA 5DD0H 5HYSG 1L9NA 3PNWB 5SWSA 3CDFA 5F6HI 5DK0B 3SE9H 4XAKE 5IEKA 1J12A 4GS7B 4NSKA 3IDIA 3HA0A 1F58L 1SY6L 3QUYB 1WAAE 2VLRE 3TIDB 5L8LB 4X5LA 2JTDA 1H3TA 1R3IH 3WO3B 5DMIL 1NFIB 4Z5RA 2ZOLA 2FL5B 4KJPD 3VXSA 5I76B 1FIEA 2OJZL 4GRLC 4JDTL 1AQDA 1AKJD 1G1CA 1DBKL 2VAAB 2P5WA 3PHSA 5I0DA 3M17A 2V5TA 3NN8A 4R4FH 3LKPA 1A02N 4DGVH 5GJSL 3JV4A 4UIKH 4O51B 4X6EB 4ZNEE 3FQXA 2ED8A 3DETD 5DLML 1FRGH 3KYKH 2AXJA 3A6CL 3MUY1 2L0DA 5D2NC 1MFNA 3TNMB 1S9XB 2WWMC 2A6JA 2GY7B 2A6DB 4OIAA 3TVMD 3QUZD 1PG7L 3QNYA 2FCBA 5E1HB 1SBSL 2EDKA 5IQ7H 4ELKA 4XTRD 3KPMB 3SDAA 2EDLA 3VH8B 3TN0B 2C1OB 3O6LH 4YGVA 4ODSL 4YBQD 5TGBA 4JO4L 5E8DH 4HWZB 2DQCH 3LZFH 3V4PL 4LEXH 3EOBA 5EBLA 2J12B 5DMIH 5DJ8B 1QFHA 4HIHA 4PG9A 4S2SA 4TTGA 1OPGL 4QF1B 1MRFL 2LV4A 5EZLB 4R8WH 2AV1A 2J88L 1RUAL 5AAMA 1AXIB 2VISB 5TDNB 3OKLB 3N0PB 4LEOA 2W59A 3DMMA 3MR9B 1WFTA 3ARBD 4LDEB 1VHPA 4UILL 4J4PD 4PJIA 2EO1A 2JJSC 1UM5L 4HJJH 2YD3A 4NQEA 3RZCD 2CLVB 4NSKB 5C9JA 3G5XA 4GKNB 1IC4H 2NY2D 1L0XA 2ADFH 4MJ5A 4Q0XL 3SO5A 4J2XA 4Y5VB 5DMGC 2A0LC 1U92B 3DRQB 2FJHB 4E5XA 1UJ3C 3KJ4B 1X5JA 2O5YH 4PGEA 4MQ7A 5DZLA 2D9QB 2QKIB 3RWIA 3WHXB 2XNAA 3RGVC 3JWOL 4YIQB 2ZSVA 3QUMA 4I13B 5T5FH 1NEZA 1KPUA 2UZIL 2OM5A 4GQ9L 4LASH 3QWRA 1CGSL 3BT2H 3I84A 5HHVH 3WJJC 2EIZB 5HDBF 1CGVA 2X41A 3G08A 4U1KA 5LXGL 4JQVC 4Y4FA 4NQDB 3ZDXE 4X99B 2CJUL 4ZSOE 3EDDA 3FQWB 4GFTB 1MFAL 5IVXF 5DD3H 1RZGA 5EU6B 4PRIE 4RMQA 1NC2B 1ZS8A 2WK2A 4E41D 2ZNWA 2A73B 5JW5B 4NBYB 5C0RH 1WTGT 2ICWA 4PJHA 3VXUB 2C3HA 3S3PA 1CDYA 5FYKU 5C7XL 4XC1L 3VFUA 4B41A 2EYSA 1TJGH 2GYSA 3PDGA 1EBPA 2HT3C 4LNVA 3U2SA 4YQXH 4JVPA 3VXSB 4ZDHB 5I76A 1VENA 5DYOA 1BECA 4RIRA 4Z7OF 5IMOB 1XCTB 3VXSD 1U8QA 1HSBB 4X83A 3S37L 3IRPX 5I74B 1KCLA 1NL0H 2VJXA 4WFFD 4MNHA 4P4KA 4QRRE 1HXMA 5LWYL 1X5FA 4L8DA 3HFMH 1GC1C 2ZUQB 4JHBA 5JIHA 3PDDA 2D7QA 2X4RB 3ARSA 3U30B 3B2VL 1AD9B 5EWIH 1BZQK 2NY0D 3OXSA 4WI9A 3TO4C 3TZVA 5IF0A 1K8DA 7FABL 1HI6B 4K3JL 5HHPA 4HXAL 2X05A 1MIMH 4M5ZL 2GT9A 3OKMA 1DUYB 5L88L 2OR9L 4RGND 1JZ6A 2DM2A 5F3BA 4BSJA 3U7WH 5GSRA 4Y16B 4HG4K 2IALA 5IB4B 1HXMB 1YYML 1KPVB 3GB7A 2HT4D 4XX1G 2BNRB 5FV1L 5E5UB 3KPQA 5J6HB 5I1IH 3ZKMC 4TRPH 5KG9B 1S5IH 3O8XB 1D5ZA 2YD7A 2GUOB 4DVRH 1BQHG 5EZLA 5HVHB 1AGDB 3GO1H 3S5LG 4DVBA 1OTTD 1J88A 1SYSA 3P11L 1PYWA 2NYYC 1CGXA 5F93C 3B9EA 4F3FB 4I18B 5FA3B 1NMAH 1UFUA 1I75A 1RV6X 5FKPB 2H2PD 5ISZB 3CNKA 3MRIA 5CBEA 4MQXD 1CD0A 1I3VA 1T1WA 2DTMH 3BHBB 3P0VH 1CD1B 1AGFB 3DTXB 4G9FE 1DQQB 1I9IH 5B3NA 3GJFB 1IGYB 2FJGB 1G7IB 3G9AB 4HX1B 4QRTA 3ZE0F 5E7BA 4WW1A 4Y4KD 4G80A 1DLFL 2X89D 3MRMB 3GM0A 1NCNA 1W72H 3OG6B 4NN6B 5C0BA 2YA2A 4KKLD 3HE7A 2OTUB 2C5DC 2ICCA 4L1DA 4AJ0A 1WK0A 4KDTA 4I0PD 1EGJH 4FP8L 3DUHA 4X6DF 4YHOH 4RSVA 4F2MA 4MA3A 3WS3A 1RQ5A 4OV5A 1JK8B 3NIFF 5TQ0H 4UBDD 4MAYA 2NXYD 2OL3A 1CXHA 1XAUA 1ZGLB 1RZGB 1TQCC 3PGDA 3WDIA 3OKNA 2GT9B 3OKMB 1I1YB 2AXGA 5EO1A 4Y5XB 3BYTA 2XY2A 1GZPB 1ZV5A 3UTOA 4EIZC 1N64H 3D0LA 4ODVL 2G2RA 3QDMD 3KPNA 1MH5B 4MSWB 2DKSA 2H3NA 3L95A 2W38A 1KT2B 3DARA 2VDQH 5FA4B 1A21A 2VXVL 4FG6D 1S7QA 4HXBH 3HNTH 1U8QB 3E2HC 1NANH 1R3IL 4QYOB 2XFXB 3T3PE 1RK0B 3L7EB 4O5LL 2AXHA 1Y0LA 3PWJA 1M6OB 1BVZA 4F15C 4ENED 4XXDB 1HIML 1JGUH 3D2UD 4GG6A 4KI1A 3EO1A 1ZHLA 3WFCH 5TPWH 5IB1A 5L0QC 4LHUG 1ZTXH 3V6OC 5J11C 4JCMA 4LIQH 1S7QB 1KV3A 4BK5A 1U41A 1Z9LA 4LPYA 1WBYA 2IAMD 4P46D 4Z95H 2ZPKH 3ZYOA 3BPNB 1LD9A 3VGEA 2HP4A 3T65A 2XN9A 2X40A 1EFXA 5F7NC 1NEZB 1RJYB 3QQNA 1IJ9A 3O81A 3LN4A 2DDQH 1FPTL 1S9VB 1JE6A 1EGJA 2P45B 2AJYL 5T1DL 4Y5YA 2ERJB 1EFQA 1B2WH 1J1OL 1ES0A 2D7OA 5T3XH 4NYLB 43CAB 2OMBA 3RKDD 2G75A 2XZQL 3MYZA 4ZO9A 5T5FL 3FOLB 3FT3A 2F15A 3WN5A 3V0WH 3S4SB 1RJZA 2J8UB 3WJJA 3L5XL 4LCYA 3VE0A 3Q6FB 2HRPL 4U1NA 5LWYH 3C2AH 2VDPL 1L4IA 2BVYA 3KXFE 2AQ1A 4LSDA 4QXGH 1EJ6A 1P7QA 4PGCA 4Y4KA 3KYAA 5BQ7A 3TT1L 1VGKB 1MAML 1U91B 1ZGLM 3KLAA 1PG7W 3SDCC 3FRUA 2I07B 1A3LL 3W9EA 1HQ4A 4L8DB 5GGTA 4I0PA 2Z8SA 5CIPA 4PGBB 5HDQL 4R96A 3W82A 4JY4A 2MNUA 4NBZB 2NXZB 4WHYG 4P2RA 4HGWB 1Q1JH 5HDLA 4HUNB 4MB5A 5FYJD 4HS6B 4FQ1H 3P30L 4LPUA 1ND0B 2EE2A 4M61A 2AJZB 1A7RL 3GSNB 3RNQA 3O6LL 1QFUH 4LP5A 1T1YA 1MJ7L 4WFGD 2JF1A 1JMZA 4X7TB 4K2UL 3HG1B 1G6RB 4GXUN 2NW2A 5CZXD 3FN9A 4I0CC 3H8NA 2Y25A 4QT5B 5BMFH 4TTDC 3ZKMD 1HQ4B 4JM2C 3CLFH 4LAQL 2NY1C 5I75C 1DVFA 4HS3B 1ED3B 2H45A 4U6YB 2DLFH 3H3BC 4P99A 2XT1B 4R26H 4PRPB 3F58H 4AM0B 4JG0L 4YE4H 1CT8B 2XIDA 4G6AD 4ZAKB 3FB8A 3HC0B 5IIEA 2R2EB 1U2CA 4QRPE 3KXFD 4XXDA 5I1GL 2V7NB 2ZSWA 4H0IA 4MA7L 3H9YA 3NCYP 3LSOB 4LRIC 1YNLH 4HS8H 4JREB 2R1YA 3GJFK 3CU1A 5MENE 1FNAA 1KN4L 3H3PH 2EEAA 1G7PB 2W0PA 4Y19D 3HNVH 3RI5F 4Z7VA 1HHHA 3BIKB 4HUVB 1R3HA 1KTDB 4PJ9A 3SDDB 3DV4B 1HKFA 4ODHL 5GRJH 4H0GA 5SWZB 5FDYA 5BZDB 1AXSA 3FB8B 3HC0A 4PUBL 3TGXA 3WN5B 1UC6A 4LCUB 2FO4A 3BMVA 4LHQB 5HYJE 3MYJB 3MV9E 3ETBF 1ZSDB 4ZUTB 3GSXB 2DS4A 2Y7QB 3VRIB 5D9SB 5DHVH 3TCLA 2NY3B 3CFEA 2VR9A 1IGML 1FIGL 4OB5L 4NN6C 1MCFA 4U6HB 3BH9B 2VDLL 5HBBA 5H94B 1FFOB 4NDMA 5KSUB 3DJ9A 5DA0B 2GITB 1MLCB 1UM6H 2ID5A 5CWSA 2HN7B 2IPTL 4NZUL 4IS6A 2BVEA 3QQ3A 3A6OA 1U95A 4GG6B 1CYGA 3OGOE 2BSRB 1FSKC 1LO0L 5E9DE 4JPKL 3EDFA 5HGAB 1BVLB 4JQIH 2XTLA 3RQ3A 3RZCB 4FQ2L 3CFEB 1TJHL 2DLGA 1F6FB 1BFSA 3QHZL 1IE5A 4NZTH 3QP3A 2F9BT 4OI7A 4GSDH 3V5KA 1MCQA 2H6PA 3KHOA 5T33L 1HXYA 4Y1AB 1DBAH 4OFPA 1ZT1B 2HTLD 2V2XB 4AQ1B 2Q3ZA 2FEEI 1T7WA 1YMHB 3L5JA 3HMXH 5DDHB 1YMHA 4NWUL 5IK3A 5KS9B 2PYEE 4HKBB 4IRZL 4FQLH 3D6GA 3DLQR 4TUKL 3VFOA 3GHEH 3S34L 1KELH 5EBWA 3KDMA 1ADQA 3FMGL 3PP4L 3I02B 2VL5B 4PRID 3V4VH 2CRIA 2WBJA 5C0IB 4MHHI 3JUYA 4Y5VA 5D70L 5FGCB 3VXTA 2IH3A 1XF5A 4POYA 4F80A 1AXTH 5H37G 1BX2A 2AV7A 4Z6AT 3CLFL 1GOHA 4P9ML 1FE8L 5GGSB 2XQYK 3IJYB 3HAEB 4XCCH 2WMPA 1DVFD 4KK8C 2GTZB 5KBNC 3PGCB 3MRJB 4QXUL 3ZT5A 3CFCH 5JXAH 2P42B 3FO1B 3AS2A 1A7OL 2R2EA 5HI3C 4L3ED 2QSVA 3HPJA 4GBXB 1HINH 5F70A 3BH9A 4L3EB 3S9DB 3VFRA 3E8UL 2YPLD 4P4KB 5BCAA 1B6UA 3VXQB 3KHQA 1AGCA 3FFDA 3QXAA 4HKZA 4LLQB 1F90L 1JJUA 4NNXA 2YHGA 4PJ9D 4FG6C 5A40E 1WC7B 1ODAA 3VFPB 5EZIL 2HWZH 3GMQA 2FO1A 4F7CA 3QIWD 4OGAD 3QRGH 4ZS6C 2BC4A 4JZNA 4GKZB 1ZVSA 4FHBD 2ZNXA 3QJFA 2DWDB 2ATKA 2EEBA 1YECL 2RFXB 4XNZB 4JFZL 3WUZA 1F3DJ 2AJSL 2ZCKH 1NDGB 3CSBA 3RWJB 3EYFB 4R0LA 3TWCL 1PEZA 2YZ8A 2NX5B 1E4WH 4NKIL 5FECA 1EERB 1MJ7H 5KZCD 1N5AB 1DN0B 5D5MA 3U0TA 2Y9RT 2OMNA 4X6CF 3F5WB 3MGTA 5FUZL 5C0AD 4IIQC 3U48A 1C5CH 2AEWA 2VDRL 4FQQB 4LVNB 5I30L 3I75A 2XV6B 2DQGL 1FBIL 4OZFG 4YHNA 1A6WL 5HHXH 3CXHK 4JFOA 4BA8A 2ZUQC 3O2DL 1HH6A 1I9RH 1F6AA 5C09A 2R2BB 2BXZA 5IFJB 1A7NL 3GBNL 4RGOL 5BVPL 4HIIA 5J9PB 1MVUA 1NLBL 4YQXL 2AK4B 1JUFA 5ICXA 3IFOB 2VC2L 1WSST 4YHKH 3UEZA 4PRDB 4CNIB 4XBEL 1J11A 4J8RA 4RGMC 2X4OA 3MLXL 3ZKQD 2KZWA 2PTTB 3BX7C 2JELH 1B0WA 4IRSA 4M7KH 3ROLB 3TCLB 4KZEL 5EPMB 4UI2A 5FM4A 5EPMA 5BO1H 1OTSC 4Z7UA 3FQXB 3JWOC 4DQOH 3ZTNL 4PRIA 3PXHA 3VD3A 4YHPA 1NFDF 4TUOB 5CINH 4G43A 3AROA 4PBXA 4BH8B 5ACZB 3VFGH 1GPOL 3QJHA 1YUHA 3E3QE 3QA3B 1G0XA 5A1AA 5IG7A 4QWWD 4R3SA 4LCWD 1AXSB 4G8FB 1M71A 1IGCL 3I3EA 2X9YA 3CXDL 2DYPD 3BH8B 1OAQH 3DI2B 2OZ4A 3P0YH 3RL1B 2YRZA 1KCVH 4MAUL 4LCYB 4B50A 3BWAA 3MOBL 2ZUVA 5EBMA 4F37F 3QBTB 3RIFF 1GGIH 5D96B 4OD1H 4OAWB 1YDPB 1XIWD 3TBTA 2RCSL 3CH1B 1G9MH 3F65A 4M9OA 4GAJH 3F7VB 5DRZB 2APXA 4L3EA 1FRGL 4XPBL 5BRZE 1NANI 4HWUA 1L7TL 4NC1E 4QCIB 3ULSB 4KMQA 4P2OC 4UIKL 3AUVA 2FWOA 4FQCH 1RI8A 3GBLA 1D5BB 3TVMC 1OW0C 1S7VA 3TZVB 4DKFL 1EUUA 3FQNA 1TETH 1NGXA 1NMCC 1MWAL 2R0LH 2Y1VA 1KBGL 1OAZL 3CLEH 5FYLH 1WIPA 4KKCD 1FZJA 3C6LA 4UQ3A 3RVWC 4ZFFB 4RQQA 5GGRA 1B6DA 1T04A 5DJ2A 25C8H 3B5HA 5CINL 5C0IA 4X7TA 4GKZA 3QPQD 3BDBA 5IVZB 1WBXB 5E9DD 2NTFB 1HEZB 4MVBD 3P0GB 3O3BA 2V5YA 4G8GB 2ICEA 4PV8B 5C0AE 2P48B 3VWKC 2XICA 4WFFE 3NZ8B 4JLRB 1ITCA 5KAQG 1KN2H 4X7CC 4OCSL 4XHQA 5FKAB 4LRNL 5F9WC 1YJDH 2FBJL 4H1LH 1FNGB 3SGKA 3VMNA 5I1CL 5ESAA 4JCLA 5I1HL 3EIFA 2E9BA 3PV6B 1ZT4A 3S96B 4Z76B 5ETUB 5C0RL 1UYWL 5KVGL 1NBYB 3NH7L 4KROD 5CBEB 3QWQB 4JO3H 1MLBA 1WWWX 4ZUWA 1IBGH 5EUOF 3D25B 1S9YA 2HA1A 5J7CC 2CLRA 4MJIA 4FS0A 2IG2L 1HKLH 3DMMD 4RDQF 4Z0BL 4K2UH 1M7DB 4U1IA 5D7JC 4I1NB 1C08A 2HFFA 4UBDC 2BNRE 2P8LA 3MLTA 1AGEA 1S7UA 4PREB 3VI4E 2Z9TA 4K8RH 4JDZB 3LCYA 3MLUH 5E08L 5BZWA 4Z7WF 2XZCH 2DQUH 1S7SA 4TUJA 3VA6A 4X8JB 3QHTC 1OAKL 1XF4A 3B2VH 1G1YA 5KN5B 4LLMB 1KYOK 4Z7VB 3NFNA 4L3CB 1FNSL 4F9PA 1LO5B 2PTUA 4P5MB 1A0QL 2YD8A 4OGXL 5CJ8A 3SE8H 3MNVA 2R9HD 3DROA 2CK0H 4JZJC 2MFNA 4IRJB 3U0PB 5E0QA 5E8NB 4P2OD 4EOWL 3O8XC 1VB9A 5K59E 5DK2B 1M7XA 4OZIB 3T77B 3VWKB 1D5BA 4YHMH 3W2DH 3O2DH 5FYKE 1WAAA 4ACPA 2ATKB 1PSKH 4N0CC 1QBBA 5TE6L 5I17A 5T1MB 3QCUH 1OGTA 4QHNB 1RUAH 4U6XB 1C16A 4MXWL 3QIUB 2VZVA 2CIIB 4PJ8C 5CUSH 3LKSB 3FFCB 4C57C 2EIDA 4U7KA 5GRZA 2NY3D 2W9DL 4WO4C 2EDQA 2C3VA 3L7FA 5I1DA 1IVLA 2CR6A 3REVB 5E6ID 4GG6E 4N1CA 3QQ4B 4WY7H 1OQXA 4DWHA 3LQAC 2DBLH 2C7UB 2MCG1 1FSKB 1IAKB 1KIPB 3EZ8A 4EN3C 1SQ2N 4RFNC 3DX6A 5E4EB 3QEQB 3H9SB 2I25N 4DFHA 1U8OA 5CSZA 1CD1A 2A1WH 2V17H 2AJ3B 1X5ZA 3LV3A 2JCCB 1DP0A 3RZWA 4ZTOL 2E8YA 1ZA6B 2YD6A 3FO1A 5H37H 1NEZG 1J9CT 2I5YL 3MPCA 3HNSL 5F72S 5FGSA 1G7HB 1Q72H 2RJMA 4M48L 4YIQA 2VQ1A 5C0JA 4DEPB 1NAML 3VDBA 1AGDA 1MJUL 5J13B 2XTJC 1MI5A 4MHHG 1ZKAA 1JP5A 1TVHB 4OZFH 1QFWI 1HSAA 4F2MB 3D85B 3MUJA 3TN0C 4JM2A 4JRXD 1IKNC 1BBDL 3U7YL 5DO2D 4Z9KB 1QQDB 43CAA 1JBJA 3SKMA 1NBVH 5IMKB 4ETQB 3GSRA 3DXAD 3BH8A 2ZJSL 1KB5L 4G80B 2DQFB 3KYMB 2B4CH 1QYGH 4NPYB 1VEPA 2V7HB 4JEGB 4PRPE 3H9ZA 2Y36H 1LNUA 3MRJA 1UA6H 4MJ4A 1N3NA 1FQ9C 1T1XB 5EU5B 1C7SA 4OT1L 4PJHF 1UADC 2HRLA 3C5ZC 1KB5B 1OCWL 2QADB 4FFWC 3QEHA 2ZPKL 3BJ91 3QI9D 4R7NA 3GI9L 1IL1B 3FO0L 3ZT7A 4QRRD 2CSPA 3F7VA 4P2OB 5LG1A 3CMOH 3FQTB 2R8SL 4ODXB 2M8XA 2EC8A 3PWUA 1DUZA 2K3TA 3QDGB 1WT5A 4UNUA 1AC0A 2FR4B 4Q9RL 1OSZA 4WUUE 1QP1A 5TPWL 1SHMA 5LQBH 2KKQA 2MHAB 3PJSB 5I1LB 1S7RB 4YXKH 3QUXD 2MHAA 3PJSA 3CFKB 1A9EA 3TT3L 5I2IA 1ACZA 2XA3A 3PHOA 1H8SA 1DZBA 1QLEH 4D9LL 4MD4B 1WJ3A 1DDHA 4TOYH 4PBVC 4D3CL 1PZ5B 5ESQA 1I3RB 4DEPC 4QXTB 4P2OA 3SGJA 4JFQB 3SKJH 3LKOA 1P4BH 2VH5L 2ERJC 4OTXH 1J0ZA 4G5ZL 2R29L 3S36H 3CVHA 1ZE3C 3T08A 2IADA 1KJMA 4POZD 5IHUH 3SKNA 5KVMC 1T7YA 5IKCA 5CZKA 1JRHI 1TZGH 2NY5L 1K8IB 4XP9H 5HI5C 4XNYH 3SY0A 4F9PC 1BMGA 3HZMA 1LILA 4OZFA 5B39A 2FGWH 4RZCB 4JGMA 3OHXA 4OZHB 4HIIB 4JG0H 5KJRH 1ZWIA 4HWBL 1LE5A 2BVOA 3K8MA 4P5TC 1XIWC 2MOVA 2BY0A 4HIXL 3BUYB 3EDJA 4X0KA 2R1YB 5EULV 3THMH 2WBJC 4YHOL 1JYWA 4Z7QF 5GHWH 2DL2A 3TIEA 1S9KC 1MCCA 1A6VH 3VW3L 2WIMA 3HMXL 5SWSB 2B4CL 1YMMB 1J8HB 3ULVH 3RU8H 1KGCE 3O4OC 2P8LB 5ISZD 1RJYA 4TSAH 4BH8A 1NBVL 2X70B 3V5DB 3O2VH 5LBSH 2FH6A 4F7EA 5DEZA 4UIMA 5C71A 4X6DE 1KTKE 1RSFA 1U8PA 25C8L 2BNUB 3G9VA 4UU9B 2Z4QA 5J89A 4NZTL 3T0DA 4ZXBD 4NCC1 2X4OB 2F8XC 3WFDL 2IANA 5MEQA 4UNTA 3SJVE 4KKNA 4MS8D 2RFXA 1T0MB 3WIFA 5K9JH 1NLDL 1BD2A 5FO7A 4M1DL 4TSBH 1A9EB 4C58B 5EU6E 4YDVB 4C55A 4N8CH 4GRLD 4FNLL 2ZWLT 2ARJA 1NFDA 2JK5B 3VFUB 1MLCA 4OCNC 4KJPC 2ADIB 3EYUL 3ROOA 4JPWL 1MF2L 5L2JB 5C0CE 4NT6A 5AD0A 4I18C 1VFMA 1I9JL 1IGFL 2GSIB 3ZKXB 2PETA 5I19H 1AJ7H 2NTFA 1NGYB 4IOFD 1IC5L 3DX8B 5JO5B 4JY6A 3GMLA 4XWOD 5D6DC 5C08E 4KK6D 5BMFL 5JXED 5D2NE 5IMMB 2H8PA 2ATPB 1TVBA 3ZKND 3ZYJA 4NQTA 4BJLA 3PV7A 5ESQB 4RAVB 3QDGE 4ETYA 2OJEA 3CIQA 5JW4M 2R0WL 3VDCA 1JNNH 1KULA 3L3DA 1JV5A 4AT6A 4LSPL 2OR9H 4A6YH 3P4LA 2EXYC 5DMYA 2VQTA 3UJIH 2BVQA 3BQUA 3QDHA 5E8OA 3X3GH 2JIXB 4RMSA 5JIIA 1D5MB 4P57B 1UB5A 4NQEE 1YECH 4ZSOB 3LQAH 4NUGH 1HH9A 3EOAB 2P24B 4HIEB 3QIBA 4NP4H 2D7TL 4RQQB 4KXZH 1N0XL 3QIBB 1WQVT 5KVEH 2VR4A 5LGKA 3P4NA 3CDYA 1JF1A 1QFWH 2IH1A 3KYNB 4HJGA 4JQXC 4KY1H 3B4NA 5ESVA 3FB5A 3BN9C 3S34H 5E8PB 1AH1A 3F12B 1ZTXL 3EOTH 5CCKH 1HQRA 2HLFD 1JHTB 5T5NF 1UH4A 2NY4C 4L4TB 3QUMH 5B8CC 3D0VA 2CD0A 3LD8C 4LVNC 4ELMB 1A6TA 3BJLA 4FQHB 2DQTH 4OCWL 3B9DA 3I9GL 1WTLA 4PJFE 5I8EB 4MD0B 2UY6A 2AI0L 1U3HC 3L3HA 3TBTB 4NQSB 3FHAA 4FFVD 4NJ9H 2ZKHH 3T0XA 2BNUA 1XGYL 3OXRB 1JWMB 4PLJD 4TNWK 3NIDE 2W9DH 1A7RH 4ODSH 5IFAH 4PJXB 5E8PA 5JZ7C 1FCGA 3GMNA 1IAII 2ZOLB 2E6JA 2XA8H 4D0BB 1BWWA 1ZHNA 4KWUA 3T4AA 1CICA 3GBML 2V5RA 4PJBA 4WWKD 4O4YH 4EDXB 4R4BA 1JTPA 1YC7A 4I3RH 4Y2DD 1AJ7L 1IAOB 4OD3H 4BZ1H 4NGHH 1C16B 3UPAA 1K4CB 5TH2A 3E0GA 5EO9A 2PW1A 4NN7C 5KJRL 4KY1L 1JF5A 1CE1L 3LQZA 5ELIA 2CK0L 2X1QA 4XVUC 3QFJB 5ECJE 2BX5A 1F4AA 5F1NB 1B90A 4Q6YA 4K23H 2C7UA 2APWA 2CMRL 4X5WA 2A0LD 2QV2A 4X5WB 4HLJA 3RUGA 5GS0D 1ZEAL 2VISA 3T2PA 3O41B 4EI6A 3E8UH 3EFDL 4EJ1C 2CKBB 4CRPA 3GKWL 3TO4A 4FABH 5GRUH 2H26B 3HC3L 4W4OA 2JJUA 5ID0A 1V7ML 3WFBH 4YO0A 3KXFA 4KDWA 4QT5A 1DL7H 4APQD 5EU4B 1GC1L 1WFOA 4AL8L 2BFVH 3H3PL 5SV4A 2AEPL 4LFHD 5E1AA 3FOMB 4N5ED 2BHYA 4FXKB 4ONGL 3SDAB 2Q8BL 4BFBD 2WSKA 5ICYB 4MA7H 4OF0A 4K7PX 3VI3F 4U1IB 3SY0B 3HZMB 1NGQH 4XPFH 4NO5B 3FFCD 1N6QH 1CT8A 4ZAKA 1QHPA 4X80L 3UBXB 2H1PL 2VXQL 2X9XA 1Z0MA 4XGZB 4PG9B 1G7HA 4ODBD 1R3KA 1G9ML 3OAZK 5E5RB 4V1DD 5DC9B 1CFBA 5DI8B 1UCBH 4Y5YC 2VITB 2PO6D 4R4FL 4EBQL 4IRSB 3VRLE 3KPRB 1XGPB 2Y06H 3WMSA 5I6XB 1RZJL 3RWCA 1B4JL 1D5IL 2VXTH 3IAPA 3WUWA 4B5EA 5C0BE 2RBLA 4UTBH 4Z77A 2APVA 1MFEL 3VWJD 1FORL 5KG9A 3NGBC 5GXBB 4X98A 3KR3L 2B1HH 3F12A 4FQ1L 3FN0L 4X98B 5EH1A 1I1AB 4HXAH 2VXSL 2EEDA 3C6SB 2XTJE 1PX4A 3VXOA 4Z7WB 5E2WH 3CVIH 1E28B 4WWKB 3VGHA 2EO9A 1NCWL 3O9WD 3UPRB 1NDMA 4F8QA 4QRPA 3QEHB 4R7DA 2DIAA 5JUEH 3KVQA 1JTTA 2I26N 3J7HA 3THML 1MCPL 1FFQA 3K2UH 2DM4A 2E6QA 4JRYE 5DRWA 4R97B 4EXKA 4GAFB 1INEH 1HYRC 3TEUA 2HJFB 1QACA 3DX7A 1L7TH 4D9QD 5E6IB 5D7JB 1RU9H 3PGDB 3NA9L 2WQ8A 1VGEH 4M9PA 4YAQB 4I0PC 1UXWB 2RCSH 2BDNH 3WO4B 3FN3A 1CICD 1G6RH 3WKMH 3H9HB 1X5GA 4WWKA 1XFPA 4DN3L 4EDWH 5B3JF 2Z8RA 3OMZA 1QZ1A 5TH2B 5FHAH 3VH8A 5DJ2B 4ORGB 5FB8A 1C12A 2GEEA 2D0HA 4GRWE 5LKNA 2WBKA 1QFUL 1F3JB 3TBVA 1KNOB 1F8TL 1W72L 3RHWK 3QQ9D 3V6ZB 4P2RB 3L7FB 5I1DB 4F57L 1RY7B 4YPGB 5E4IA 1RZKL 4RX4D 3MOQA 4JR9L 5ALCH 1M6OA 5SV3A 2UZIH 4M5YH 1MFDL 1BZ7A 3ARYA 2XKUA 3RTQB 1S7WB 3TJEL 5TE6H 3MV8D 1R5IB 5D7LE 4PJAB 3NGBB 5FFLA 4AIOA 3MJ9L 3D85D 3C09B 5MHSE 5E8EB 1S3KL 3G6JA 1DVFC 3TO4D 5HYQB 4PJ5D 4X9IA 3ULUE 2XN9E 3K80A 3BDYL 1KACB 4IJ3B 2VKWA 4YPGA 5J56B 1D5ZB 4ODTH 1MFCL 2BP3A 4LPTA 2F58H 2A83A 3L9RA 4XCYA 5J9PA 4FXKA 3FHQA 4XPGH 4PTTB 2GTZA 1AKJA 1NC4B 3LQAL 4NUGL 1JGUL 2BNRA 4OIIL 3CGTA 5JDSB 3BRDA 2Q1EA 1FVCB 1UA6L 4RGNC 5E5MB 3X3GL 2DIBA 5F9JB 4U31A 5JQ6H 2P5EB 4PS4H 5I30H 4XWOC 3SHSA 5GRXG 2GJZB 1Y18A 2Z4QB 5IEHB 1JNNL 2WBJB 4YR6B 4X99A 1UXSA 4XPAH 3STLB 4HBCL 1FPTH 4ZFZB 4QRSA 3ZDYF 3TVMA 3MCLL 5GGQH 3ZL4H 3FT4A 4NRXB 4JY5L 1J10A 3SE3A 4HIXH 5I9QB 1TTFA 2HJFA 1UG9A 3PGCA 2QSTA 2ATPA 5EO9B 3MRGA 3C6SA 2C1OA 2I9TA 2BXYA 4U1GB 4JZNB 1Q8MA 5BJTA 3SE8L 4QHKI 1CK0H 3BISA 1RJLB 2J4WL 2DICA 1KXQE 1Q9LB 3HZKB 5TE4H 3HCVB 4O58H 1G7LA 3S5LB 1ORQB 4OKVB 1GZQB 3VFMB 3RVUC 4ZFOA 1QNZL 2VLLB 3AXLB 3OKLA 4OF7A 4XNZC 1V7NH 1QPPA 2R4RH 5ADOH 5F88A 2C4XA 2WIIA 4PTUB 4C59B 1KEMH 5EIIA 4KZDL 1TJIL 4PJHE 2CLZA 2VWEC 3QDME 5F71A 5JOPE 3V7AG 1KJ2L 2X2YA 4GXUM 3LPGA 4HFWB 3EOBB 3HI6H 5EBLB 5FYLL 4Z76A 1T03H 2DMCA 2JB6A 4M03A 3HG1A 2VITA 1G7JA 4KGLA 1ZVSB 4LASL 4PJAA 4XHJD 1HHKB 3MLZH 4I2XB 1FVDB 3N1FC 3MXWH 5AAWA 1FH5L 2VRAA 1DQDL 2VLLA 3AXLA 5C09B 2JLLA 3AGVA 1ZOXA 3W2DL 4MDJA 5BW7A 3WLWC 2AK4A 3BPCB 1RMFL 5FHBH 1NUFA 4RX4A 3QEGH 3BP7A 4XCNB 1A7QH 4XP1L 3CC5B 3S35X 3I75B 5FDWB 2F5BL 1XF1A 4MQ7B 4U1JB 4P23B 1REIA 3KNBA 1KPVA 4MD0A 1RZKC 1BVKB 3R8BB 5DVMA 5CILH 5C0FB 4CMMB 4JGJA 5F1IB 3QFDB 4M8QB 3MJGX 1QFOA 1IGYA 1W8NA 2FJGA 1S9VA 4R3SB 4M93C 3UAJC 5E08H 4XNQA 4GG8B 4PRPA 1DEEB 2F8OA 3X17A 1UM4H 2WLZA 3HN3A 3HRZA 1WZLA 4LQFH 4NM8H 4Q9QH 1H8NA 4I3SH 1I8LC 1IAOA 1KTLA 3BP6A 2ICES 4KMTH 5DD1H 4DTGH 4LLVB 5ACMA 5HGHB 2R4SL 1ULVA 3BIKA 2CDEA 3UZQA 5LVEA 5J8OA 2E27L 2NTSP 4NNXB 3VDAA 1UWGL 4HT1H 4WUUA 1KF9B 3X13A 1XCQB 4Y0GA 4A6YA 4G9FA 3SQOH 4YFLF 4Z7UE 5E9DA 3QUKB 3LKQA 4G8FA 1WWCA 4JY5H 4Q6IB 1FGVH 1I3GL 3E6HA 4XMLL 2BRRL 5DO2C 4R97C 3LN5B 2FZ3B 5FO8A 3ZE0E 2CKBA 2FX8L 4LQ1A 2WQRA 3BE1L 2YKLL 3QSKB 3U36A 3RL2A 5MEOA 3IJSB 4C56D 3Q5YA 4CDHA 1MNUH 2NXYB 4I5BA 4Y8AA 2CO6B 3DIFB 2YC1B 1N5AA 1SM3H 5CUSL 4OLUL 2QQLH 7FABH 1Q9LA 2AV1B 3VGAC 1K3ZA 2APFA 2AABL 2UY7A 4IIQB 4L3EE 4IOIA 3QO1B 4NKDA 3QUMB 4MNQA 1HH9B 3EOAA 4K7PY 3PNWA 5AWNH 5JORB 1YEKL 2FECL 3CCHB 4L5FH 3CCHA 3UC0L 2GTWA 3T3ME 1I8LA 1MCEA 1LE5B 3P4NB 5CSGA 2BVOB 3EJJX 3GJFH 2QADC 2YRPA 1QSED 3G5XB 4JPIA 1NJ9B 5F3BB 4G8EA 3I50L 4HKXB 5AG8A 4U6VL 4ZXBB 4XH2B 4UB0L 4XWGH 3RKPA 1ZHNB 5DK3A 4UAOC 4HAFA 5D8JH 5TDNA 2RHEA 5DDHA 4U6YA 2XTJD 3WS6C 3P77A 5ALCL 1P2CA 4G42A 3DRTB 2K7PA 1H5BC 4HZLB 3PWPB 1G0DA 3CPLA 1EBAA 2A9ML 3PWPD 1AGFA 4MA3B 1B2WL 3ZE1E 4G6FD 1RFDH 1DR9A 2FHFA 3P9MB 1X7QB 3SJVA 1I8MB 1GPOH 1QOKA 4HEPG 1EHAA 4YNYA 3GSUA 4MD5A 1RUPL 1QRNE 3U7YH 4JVUA 3K74B 3BVNB 1MJ8L 3RAJH 3SDYL 3GK8L 4Y89A 1EZVY 1RD6A 3MZGB 4P9MH 4R4BB 1ORQA 4OKVA 4G6AC 4QKXB 3HLAA 5GGSA 2ICWB 4PJHB 3VXUA 3HLAB 2WUBH 4G3YL 2LVEA 3RVTD 4XCEB 1R5WB 3OKEA 3E6FA 3MNZA 5CFHA 5EBGA 2X4PA 2CKBH 4FZ8L 2UUDK 2X9WA 3RX5A 1WGOA 4R7NB 2HYMA 1AI1H 2MQCA 2QSQA 1SY6A 3IVKB 3FQWA 1QFWL 3W0WA 2CGRL 1VGKA 1ETZA 1I1RA 2JB6B 4TTDD 4H8WC 1UWEH 3VFRB 5HI5D 3HE6B 4U1LA 3ALXA 1OM3H 3UYRH 4I3GA 4NP4L 1TNMA 4PJFB 2QSCH 3O9WB 1NCDH 5DJ6B 2CXKA 2G2RB 1JNHA 4C54A 2NY2C 1UZ8B 3VE0B 3TBVB 3DX7B 3BOVA 4QOKB 4XPTL 1P53A 4ZXBC 4P5MA 1SM3L 2LU3A 2ORBL 1RZKH 1S9WA 1HZHH 3OKNB 4PJ8B 4V1DB 4U7MA 1PX3A 4LF3B 4QTIH 4S1SL 1T04B 1NJ9A 4GKNA 4H20L 2YKLH 4MJ5B 2HH0L 4X4XA 4MZ3A 1HDMA 2IALB 4MNHB 3VXTB 5JHLH 1UWXH 1CFVL 1EEYA 2DDQL 4MNGB 4HPYL 4KQ3H 2VAJA 4P46C 2FEEL 1LK3H 3SE4A 3LIZH 5D8JL 1CFNB 2H32H 3AVEA 5KS9A 3QDJE 4Z7WE 1K8DB 4HKBA 2EZ0C 5MEND 3UJTH 1MFCH 5DUML 5DEFB 5DJAB 3SDXB 1UWGH 5GRVK 4W68A 5HHQB 1Z5LA 1FIGH 1IGMH 4IRJD 3REWB 4ERSL 2HWZL 4J4PC 3X11A 3UBXG 3RWHB 1I7UB 4KK9C 4PRAB 2ZG3A 3PL6B 4J3TA 5AZEH 3T0WA 1DTUA 4JKPL 1QEWB 3CDGB 1NCWH 1BEYL 1RIVL 2X1PA 3CFDA 5DQJA 4LLDB 4MJ6B 2A74A 1IAIM 1CN4A 2IPKA 1DSFL 3BXNA 1CGUA 5D5MF 2HTLC 3QUYD 5GIRA 2YR3A 1YEFH 1T4KA 4XXCC 2DQUL 2ADIA 2F54A 4TQEL 1FYTB 4R6UA 4JFHD 1HHGA 4K8RL 1MNUL 4D0BA 4UUJB 1AHWC 2FNBA 3K46A 3WSQH 1P6AB 3CDCA 5CJQH 1QNZH 5FAAA 5FYLE 1EFXB 3VA2C 1E27B 3ARGC 3DUSA 3DO7B 3H0TA 5TF1H 3QUXA 1I7ZA 5D7IF 1JZ7A 2Q6WA 3NZHH 3L95B 3FRPA 4HBQA 1N4XH 3GRWA 1U8HB 4Y4FD 3OB0H 1D9KC 4N0UB 5I1HH 43C9A 4F15B 4GRLB 5DUMH 2EICA 4Z7VE 4NQXA 4NKQB 5CS7A 2Q87A 5JIPA 5D5MB 1OCWH 2B2XL 3TYGL 4Y8DC 1CFQA 1PW3A 3FO2A 3PDOA 2HTKC 4PGDA 2AK1L 5J6GA 3ARXA 1FO0H 2AKRB 5HXMA 1XMWA 4HUUA 2PF6A 1FJ1A 4U1NB 3OB0K 1FFNA 3E6HB 2EXYD 1HILB 3I85A 1ZLSH 5J0BA 3SOBH 4CMHB 2PW2A 1MPAH 5IVOA 5T1MA 1CDCA 5B38B 3SO3C 1E4JA 2G5RA 3PWLA 1I4FA 4FFVC 2GKIA 4YGVB 5F1OB 4OI8A 1NGWB 3W11D 3GNML 3JBG7 2CDFB 2DLIA 2R2CA 1AC6A 3KJ6L 3U1SH 2GY5A 5IROA 4XZUA 4HWNA 3W0WD 3H6JA 3MRBA 3QG7L 5ADOL 3HR6A 3VFVB 4XBPB 3EFDH 2AGJH 2ZCKL 5DMJB 1OL0A 3RVXD 1LD9B 5IIEB 3C8KB 1H3WM 2IMNA 3K8KA 1J87A 3QFJE 5JR1H 3U0WH 3EGSB 5EOCJ 4EVNB 1OTTC 5HGBA 1EHLL 2C3WA 3QUML 1U3HA 2QADD 2KQNA 5E4EC 1CK0L 2NXYC 2YS4A 5ISZA 2FLRT 4RGMB 3I2CL 2I60L 5DD5L 1G7QB 5TJWK 1FNEB 5HVHC 4JO1L 5CSBA 1PGRB 3KPRE 5SWZD 3ME0A 4K94C 4MJIE 5IT2L 3T4AB 5FYKL 1D6EB 1JUFB 2UWEA 4MMXC 1JPFA 2VZOA 5C0FA 3L3JB 3WCYA 4PJFF 4M1CD 3L3JA 2W0LA 1A6WH 5HHXL 3S4SA 5GGQL 3GM8A 4GRWB 3SDYH 3IJYA 5L2KB 4PLKD 3MO1B 3WEXB 5D7IA 4CDGC 2HKHH 4JM2B 2CDGB 1ES0B 2H2PC 1U8MA 3SGEH 2ZG1A 4FRWA 4JFED 4P23C 3MMEA 4NKMA 2AEQH 2W9EH 3DMMC 1NC2D 3KLAB 3O0RL 4PJCF 4K3DH 3V95A 4KI5F 1NMCB 4XNXL 1MY5A 1ZEAH 3MLPA 4X4MA 5K9QG 3T2OA 5D71L 2V7HA 1AD9A 1AE6H 3QUYA 4OQ1A 5F7KC 4DOHE 1JN6B 3MROB 1OARL 3PQYA 5DRNB 1Q72L 1MHCA 3O8XD 1WT5C 2IAMC 2Y5TB 5GS3A 3CH1A 2YBRA 4KJYB 35C8L 3GUTB 3RJDA 1MCPH 3V5KB 2BY2A 1LO4L 2NY1B 2P5EE 4NWUH 4DN4L 1XF4B 5GJTL 4IIQA 3MLWH 3CFBA 5EFIA 4BELD 1E6OH 5IGXL 2AAVA 2MTPA 4PGBA 1X4ZA 1MJ8H 3PIQB 1FBIH 1WITA 4V2CB 4W4OC 3QG7H 1XCQA 1T66C 4YDVA 4M6OL 4QYOA 4YDIL 3HNTL 4HXBL 4F58H 3T1WA 1A47A 3FZUD 1RFDL 4HCRH 5HHOA 1X5HA 5DI8A 4R9HA 3ARQA 2VDQL 3D9AH 3RX8A 1FV1A 5K33A 1FV1B 4RCAA 5HGBB 1JPGB 2ZG2A 4XAKD 4PRHB 1EZVX 4GAGH 4EQ2A 5EC1B 3OG4B 4DN3H 3EHBC 3WIHA 1LE9B 4FTVB 4ODUB 1AGBA 3ARVA 5DS8A 1P6FA 2EC9U 2EE6A 4KVNL 4KMLB 1BJMA 3IDXL 1AQKH 4LL9A 2Z31B 1FL5A 2QHRL 5CKAA 1I1CA 2HT2C 5IB2A 3MRFB 3DGCR 2IAMB 1R3LB 3MNWB 5T1LB 3RVVD 3O3BB 4D8PA 4PG2A 4WHTB 3UTSB 4X7SH 5T1LA 4F7TB 2XWJA 2YPLA 1V3LA 4EUPA 1T7ZA 3LEVH 4YHNB 5FIEA 2IGFL 5DWUL 5IVNA 4EIGB 4BUGA 5L2KD 1U3HD 1X6NA 3ROLA 5B8CB 2FIKB 1HIMH 4UDTA 3S3JA 4IEFB 3VFSB 2P44B 1VACB 4NQDA 2DI9A 2EDXA 4YK4C 3X3FL 3EW3B 3MRKB 1W0WB 4TYUA 1YMMA 4XH2A 4KRNA 5SWSE 3BRFA 5SWZA 1F2QA 1AO7D 4YWGL 5ADPL 4BQCA 1SY6H 5MHSD 2HVJB 3K8LA 2ZCHL 3LQMA 2VUOA 1I85A 4Y5XA 3TYFB 5E2UH 1KIRB 1F3DH 2HKHL 5C09E 5ID1A 3SE9L 1WZMA 3GKZA 5KSAD 2YWZA 5C0DB 1N6UA 1Z9OA 2FZ3A 5FO8B 1UJTA 1HOCB 3SCMC 3INUL 1MRDH 1Q9KA 4WEMB 3WS3B 2H41A 1B88A 1GGCH 1Q9OA 1TQCB 4Z95L 1FAIH 2BMKA 4HH8A 4C4KO 4YX2H 3LAFA 5LGJA 4U6TA 1T83C 3TPUB 1HSBA 5B4MD 3UJTL 1ZANH 3EYUH 4A6YB 2NY1D 2DWEB 3QQ3B 3WD5H 1OF2A 4LHUD 4HKZB 3B6SB 2VZ1A 15C8H 3GSWB 2X1XR 1T21B 1H3PL 3G6JF 4Q7DA 1YNTB 1KT2A 3SGKC 5IHUL 1Q9KB 1T7VA 5ERWA 5C8JA 1G7QA 2YN3A 3OAYH 3E2HB 2CLZB 2BOCB 3IVKA 4YHIA 3BO8A 4ELME 1QTYT 4XP5L 4Y4FC 4ZPVA 4TQEH 1OOAA 2JIXD 3G5VB 2QR0B 1WIOA 5J3HD 1DN2A 2B1AL 5GGVH 4O02L 3MA9L 5D6CA 1DUZB 3EUUA 2JELL 3F62A 1BX2B 1KN4H 1TITA 2FEDC 2CMRH 2YK1L 4YBLC 3QUZB 4WU5B 3B9AA 1QHOA 4W70A 1NCBH 4PJEE 2Z92B 5E00B 4UT7L 2AK1H 2QHLA 2P24A 3TBSA 2O5ZL 1DBMH 1HHHB 3TBSB 4HUVA 2I5YH 3UZEA 5E94B 5D1QC 1QRND 3BIBX 3I6LE 1T1ZA 4H8WH 5IB3B 4NYLA 1F11B 1OB1A 1W72B 5IB4A 3B3IA 3ZTJH 3IFNH 4PP1D 3RY5A 1X5XA 5D6CB 2AJXL 4WO4D 2J6EA 4Y2OA 1D3CA 3K7UA 4JFHE 3MLZL 1U8NB 4LKCA 1PKQB 4X6DA 2XZQH 1F5WA 4J1UB 2UV3A 1J0JA 5E2VH 1BAFL 5I6XC 4KUCD 5C08B 5IW1A 2R29H 4WNQB 3D48R 4UT6H 5T1DH 1HHIA 3RNKB 5HYIA 4ZS6D 3JUZA 4F7CB 1P5VA 4XGZA 4D8PB 1T83A 3BZ4B 4TUJB 1N0LA 1TTUA 3KPSD 3DO7A 4LRIA 1AR2A 3H0TB 3IRZA 4QY8B 5DJXA 4CN6A 1A6ZA 1EMTL 4P2QA 5DQ9B 4JJ5B 4JN2B 3BKMH 5HVGB 5DA4A 4BQBA 1RIVH 1TTGA 4LLQA 1HK6A 2F19L 4QOKD 5K93A 1OW0A 4W6YB 4YHML 2J8HA 1FHGA 3ZHDA 1FYTA 2GJ6A 1T3FA 1ZVHA 3D69B 1IC4L 3C6LD 3QFJD 3GO1L 3O4LA 2XXMB 4HPOL 3RNKA 2Q7YB 3QEQE 1A3QA 2V9QA 1UM5H 3O6FC 4KTDH 3W81A 2VDPH 4ONOA 1NMBL 1LK2A 2CR3A 2Y7QA 2VR5A 1MCSA 1RIHL 2A1WL 5JDJA 3LH2L 1GSMA 2KL6A 3TA3B 2L7UA 3FQRA 1QKZL 2B20A 4UZGA 2X4NB 4KQ3L 4N0UA 1CDJA 1Y6KR 3H9SD 4R0LB 3PHOB 5DJYB 4XZUB 4JM2F 1N6VA 2R56H 2HN7A 5HJ3A 1A6AA 4WEUD 1FNHA 1A6UH 3BE1H 4JRYB 3D3VA 4JRYA 1QSFA 3WLWD 2BNQA 4BSWB 3ZLQC 3GMRA 4XCCL 2ENYA 2BY1A 5DK0A 3R1GL 2AJXH 4ZYKB 1BF8A 1K8IA 1MJUH 3NIGF 2PCPA 5J4MA 1KJ2B 1T2QL 5JW4Q 2FLBT 1LP9E 4GG8A 3I50H 1Q94A 4JANB 4HPOH 2Y23A 3CVHB 4JFDD 3SEPA 3C9NB 2CKBL 1KN2L 4DKDC 2AJVL 3PWVB 5DRXA 1P84K 5BXFB 3C60B 5GRYA 1MQ8A 3S96A 5IJVB 3FO9A 4G7YL 5E5MA 4LSSL 2BHUA 4V2BA 2VXUL 3LKNA 4Y16C 3STZA 1WAAF 4ZUVA 5D7IB 2ZUSA 1RZIA 5TE7H 2Q86B 1Y6NR 4JQVA 3G5YA 1KJVB 3ZDZF 3EHBD 2R23A 3TF7C 1D6VL 2FYYB 2ED7A 3MV7D 4NJAL 2VXSH 1A64A 3HI5H 2OS7A 3S4SG 1QVOB 2B1HL 3H3KA 4Z77B 3D39E 4PJBE 4W4NA 4PJCE 3T0ED 4UOW0 3TIDA 2R0WH 2XYCA 1K6QH 2DQIH 5B38G 3CFCL 5JXAL 3ULVL 4WO4A 3DHJA 1IKFL 1CGSH 3BT2L 1DANU 5MERB 3LKRA 5AZEL 3IXTA 5F44A 4ZUVB 3B9KC 2D3VA 4PJGE 1Z3GL 4JFYB 5C8JB 2NY0B 4MGXA 4EI5C 2P7TB 3DUUA 3V6OA 3L3GA 4GBXA 3LEXB 1CXKA 3OPZH 3BW9A 5H35A 5LJYH 4H8WL 1IRAY 2V9TA 5E6IA 1KGCD 2Q7NA 4KFZC 3VXRD 4FQXD 1FH5H 2FWOB 5CZVH 1P5UA 2XY1A 1EJOL 1FLRH 4ZUUA 4JY4B 5CIPH 3WFHA 2GAZB 4ZD3H 5C9KA 4AL8H 1EEZB 5C0CB 1HHJB 1P4LB 1XF2A 1FZJB 3UTPE 3RX7A 2IBGA 4HIEA 3O4LD 1DLFH 1T1ZB 4XMKL 3ZSSA 3BRGC 4GSDL 2J7LA 4AM0A 4XPTH 5KANI 2NYYD 2WAHA 3OAUH 4N0YH 1U8JB 3NAAL 1FVDA 3BGFC 5DVOA 3QDGD 3WLBA 3QUZA 4QRQB 4P3DB 5KS9E 4HGMA 4OFKA 2QSCL 5B39G 1FZOB 5SWSD 4QNPE 3N50A 4OBSA 3EYVA 1VFBA 4JB9L 4O2CA 3H9SA 1OT2A 3KS0H 1QPXA 4QTHB 5E6YA 1UB6A 1T1YB 1WEJL 3ABZA 3SKOA 3OPZL 4LOUD 3D3VD 4Q9BA 3TNNA 3VMPA 5KW9H 1QSFD 2P1YA 3UPCA 4X8JA 2FJFA 1CZ8L 1UENA 4KJQD 2OTWB 4PJ7A 1N4XL 4Y16D 3MQIA 4ZYKA 1WZ1L 2DF3A 2Z8WC 1YZZA 4ONGH 1AY1L 4XRCB 2DI7A 3N1QC 5ICYA 1IKFH 1VADB 2XZAH 3ALPA 4KI5C 2R2BA 1M7DA 3A6BL 4OLXL 4HJ0C 1ZLWH 4S1QH 5DJDA 2YBRB 4F7PA 4MNGE 3KAAA 3BZ4A 5JQHC 3LSOA 1YA5A 2ITCB 3TBWA 2QL1A 1F6LL 2VDNL 3MCKA 4HK3N 4Z7NE 2AK4E 3QCUL 3EO0A 4L8SA 5LAXA 5DTFA 1M7IB 3IDMA 4QRSB 5JA9A 1EO5A 4JKPH 4OCLC 4AENB 1NMAL 4RWYH 5KSBB 3NCMA 1WICA 4FQIL 4JN1L 3W39A 1N2RA 3OBAA 3BW9B 4XHJC 2VZTA 5HHMB 1CE1H 1T5XA 3GSRB 5EZIH 2Y07L 3O3EA 3T2QA 1CXFA 1NCTA 4MCZB 1UVQB 4LCWA 3TH3T 1CBVH 2OXGA 4AMKH 2WP3T 1S7SB 5DMKA 1QSFB 2Q76B 1G6RA 1OAXH 1T21A 2HRPH 3TZVC 3DX8A 4M4RA 4E41A 5HDOA 1QSZA 2AABH 5C0GA 3F7QA 2E8ZA 5GRVL 5I16B 5IK3B 3O6ML 1QR4A 1RUPH 1K3IA 4GBXD 4YHZL 1A6UL 1FN4A 2YC1A 3H42L 3HI6L 4WI3A 1T03L 3S98A 1TFHA 1NFDB 3NCJL 4TSCL 4L4VE 3BWUC 1HXYB 4HD9A 3O11A 5DMGD 5FA3A 3DVGB 4URTB 1I3GH 2I24N 4NRZB 4XMLH 4AH2A 5CD5C 4P5TD 4Y4HD 4M7KL 1IC5H 3MLWL 1P7KB 3BDXA 4KUZH 2X44D 4XPGL 4WV1B 4N1HB 4YHKL 3BKCL 2PXYB 1S5HB 1VGEL 2RQ8A 1IFHL 3L5IA 1Q94B 4JANA 1W72A 5MI0B 4P9HH 3K4ZA 1INEL 1DBML 1A7BA 4NQUA 4K3HA 5EDXA 5GZOC 2AV7B 5CJOL 3V5HA 1JI2A 4L1HA 2IAND 1HWGB 3T3PF 1KENH 1TVDA 3BZEA 2IANB 1HOCA 3HR5B 4UAOB 5SWQA 3Q5OA 2KBGA 4ENEC 2FD6H 3I02A 4S1RH 4AK1A 1UB6B 4U2ZA 5I75B 1XGUA 1C5CL 1XH3A 4TULL 4GMSL 4UQ2A 1F58H 5DRWB 4D9RD 1P7HL 3ULSA 4G6KH 4IRJA 4S1DC 4OLXH 4CVXB 2VLRA 2X4TA 5FF6A 4HCRA 5IVXE 4OI9A 4G8GD 4Y7MA 4BKLB 4LKXA 4UDUB 3BIAX 4P5TB 3RIAF 15C8L 3VXSE 3ELAT 2XWBA 4JFFB 5DJ0B 1FO0L 4ZS7H 2GIYA 1I85C 4GUPB 1VKXA 3DURB 4JFXA 3NA9H 1I3RA 5E99L 3ARFA 2YMXH 1QFWM 4GAJL 5FUOH 4HT1L 5I73B 3BEVB 4FFYH 3L3DB 1U93B 3GSOA 4DK3A 5C0BD 4G9FB 4OGXH 1IGIL 4XP9L 5I1LA 2EDRA 4GKSB 3DVGA 1IMHC 2Q20A 5ENWA 5D1ZD 3VJ6A 5T3ZD 3U0WL 5JR1L 2ZUTA 1CD9B 1UQSA 2F74B 3ESUF 3WE6B 1MFDH 1EMTH 3LN5A 3SCMA 1YY9C 3BPOC 2QQLL 2BVUA 4DUXA 1SEQH 5EOCL 3VXUE 3B5TA 4AEEA 5F7WC 3X3FH 3AMKA 4UV7H 4LK4A 1I9IL 4M00A 1MVUB 3D87B 4LBEB 4K07A 4YEFA 4NN5C 4EN3D 3RVXC 5TE4L 3FOMA 3G5ZA 1FDLL 3AS3A 3IU4H 1PG7H 2HG5A 5SWQB 1QBML 12E8H 4F33A 2P46B 1J05B 1TCRB 4L8CA 4WEBH 2CDGA 2DJUA 1TIUA 2F54D 5CHNB 5KW9L 1H3UA 4JDZA 4PJIE 1I7UA 3LVEA 5HYSB 3V4VL 3BZFB 1XF3A 1IM3A 4XCNA 2P43B 3QISA 5GJSH 1BFOB 4IMLB 5DTFB 2X4TB 1R6VA 3MBEC 2R69L 5FGCE 2DQFA 4ZUWB 3JTSA 3QIUD 2VDKL 4LQFL 2NCMA 4U7SA 1U3ZA 1ITBB 1OGAE 4HC1H 3OKYA 5DJDB 4HH9B 5ADPH 3JXAA 3IETB 1K4CA 1CFSB 3QH3B 5I8CB 4FQJH 3SQBA 3KPLA 4M7ZC 1H8OA 3ES6B 1RURH 4WO4B 3KLHD 4X4ZA 3O45A 1SYSB 2G60L 2XOTA 2XN9D 3ESVF 3TT3H 5DWUH 3UYPA 3ARBB 3B5GA 5B21A 5DQJB 1VERA 4LMQE 3QQ9C 1GZQA 3VFMA 2LQRA 1KCRL 4ZPTB 5JNYB 4POZC 4K3EH 4BH7B 4AIXA 4K8RD 1HNGA 3S88H 4B7IA 4HX1A 5TDPB 3L3OB 2Y6SC 3GSVA 4GRWF 1SJHA 1F4YL 4J3OC 4BZ1L 1L6XA 3HUJB 1U91A 5JO5A 4X7EC 5I2IB 2R0ZL 4O2EB 1JRHH 4PV9A 3ULUH 4HUXA 3ARRA 5DHVB 3EBAA 4JR9H 4KDTC 1L7IH 1A3RL 3EYVB 4I48B 5FYJH 3L3IA 2WINA 3A67L 3ARFD 2NR6D 1F3RB 2OI9B 1YPZE 4ONHA 3QG6B 1QO3B 5DZOA 1ZK9A 4L9LB 4YDKL 3V5HB 3DVNB 4S0TD 3ILQC 4RFNB 4S1RL 3O3DB 5GS1A 1EFXD 2DQTL 4OCWH 2HLAB 3VFOB 1A3LH 1FFNB 4P4RA 1HILA 3NTCL 4WI8A 4XRCA 3QAZC 4PLJC 4P2RD 2B5IC 5E70A 4UQ2B 1J0KA 5K9QI 3KPPA 4L9DA 3KPPB 2J8OA 1JWUA 2EYTB 2NX5E 1SMOA 3BUTA 2F8VA 4H5SB 4KVNH 3VFNA 8CGTA 4WFHD 3MODH 4HW6A 1AE6L 2K7QA 1HSAB 3LDBC 2YZ1A 4EVNA 1DCLA 4F33B 4PPTA 2EKSB 4KK5D 3MSPA 1YDPA 4LCCA 3RAJL 4YDKH 3IDNB 3LS5H 4DUVA 3LPFA 2ZUUA 2IPUK 3K4AA 1OAUH 1BIIA 1U6AH 2W60A 3RWEB 3RWEA 1A2YA 3NCJH 5CWSB 1T89C 3T0BA 5IV2A 3JTTA 3RPIB 3BKYL 5I1JH 4NKIH 4JN2A 4M3KB 2FR4A 2C3XA 1CICB 5DMKB 1RJCA 1I7RB 1FO0B 3TNMA 4FXGB 1OAYL 4TPRL 1TZIB 1II4E 2A6KB 4NHUB 2Y4SA 2WP3O 4LSUH 3O41A 4KAQH 4Z0XA 4NQSA 4Z7QE 4PP1C 4UB0H 4DZ8B 3BEWA 1FL3B 3R0MA 1RIUH 1GGBH 4TVSa 3VXMB 5INDB 1Z6JT 4KDVA 5HY9B 3GIZL 1RZ7H 2QTEA 5GGVY 2J8UF 5L9DL 1QR1A 5KSAA 5T3XE 4NNYB 2LAGB 3MRLB 1BD2D 3FT3B 3I6KB 3ZKNC 1BOYA 3MJ7A 1NAMB 4JDTH 1GXEA 4HG4J 3SDXF 4UV7L 4CMHC 4HWBA 1QSFE 1VFAB 5GGRB 2X4PB 5DF0A 5ID0B 1MHCB 1VFAA 1DQTA 3CFIC 2BNQE 2NY0C 1J1OH 5HVFB 3ZKSD 1YNKH 3NCEB 1MCBA 2R1WB 4UTBL 3JV6B 1CS6A 1OP5H 2A6DA 3P9LB 2DTML 3TCXA 4MMZC 2DLEA 5GGTH 1M05A 4ZNCD 2NXZC 1B4JH 1D5IH 3N85L 5BVJB 4NNYA 1CE6A 4RMTA 1CI5A 4M6MH 3LS4L 4WI6A 1G9NC 2YPVH 3HMWH 2PXYA 1ORSA 4LIQE 1UEYA 4MLSA 1P84J 2EIEA 1FG2B 5F7HA 1BQHB 4WU7B 5JOEA 4JREC 1WWAX 3JWNC 2X42A 3OKOA 1GOFA 4F7PB 4U1HA 1AO7A 4KI5E 3SDXA 1GGYA 5KTEL 4WTWA 1YJDL 2FBJH 3MV01 2O5ZH 3U6RB 2HJKA 3FQUA 1QSEE 4LLUA 1M05B 4GAGL 5F1SA 5BVJA 2A77H 1D6EA 2F54E 1WV7T 5KSAC 4PB0H 1BJ8A 3ZTJG 3OJVC 4XNMB 3RTQC 1CDGA 4OZIE 2OJZH 3LN4B 5GGVL 5ACZA 5EZJA 1CFTA 1N7ML 4EKXA 2AGJL 1GJIA 4X6BB 3OZ9L 3MUGB 4GXVL 3QH3A 2P8MA 5I8CA 3VFNB 4EUPG 1D6VH 1X7QA 3SJVB 4ZQKA 4M7JH 3QCTL 3X11B 2VXVH 4OFYA 3U30C 3GIVB 5MEQB 5SX4I 3MRDA 3MJ8B 5FGBC 1G84A 3QIWC 1URLA 4JG1L 4LSSH 2X4QB 3DX9A 2EIZA 4FMKA 5L9DH 2ILLA 2P7TA 4LVEA 4X9BA 1R5VB 1FL6B 5IMLA 3TT1H 1A7QL 4XP1H 3RBGA 3VFSA 35C8H 2OP4L 3HNSH 1F02I 3OXSB 2C3VB 3LOWA 5AUMA 3F58L 2D0FA 5C2BH 1MCKA 2V2TB 3V7AE 2X4SA 4P46B 5GGUA 2Q7YA 4WCYL 5BJTB 3GMRB 12E8L 1GGIL 5KVFH 2IQ9H 5T5NG 3QJFB 1IQDB 1BQUA 3FAXA 4MAUH 2J6EL 3N85H 4NQVA 3OKKB 4LU5H 2YRLA 3V6FA 5KSVA 4LLYB 3M1BB 3U2SB 1NCCL 1KXVC 3RY6A 1H0DB 1UZ8A 4WW2C 4CL7A 2V5SA 1VESA 2PNDA 4Y88A 4YDIH 1U6AL 5GRJL 5HY9A 3DIFA 1RZ8A 1QSEB 4S2SB 2AXGB 5EO1B 5IHZB 2QQNL 3JWDL 2R0ZH 3MGOB 2V6HA 3MGOA 3O2WH 4OCXH 4PRAA 3VXPB 1F4YH 1KCSL 5KZCB 5BS0D 1ADQH 2F58L 3NFSH 1J8HA 2X7LA 4XNMA 1G7MB 2OL3H 3O3AA 3UO1L 1G7MA 1FAKT 5L7XH 5IV2B 4ZTOH 4PRPD 4R26L 5I8OL 1HCVA 4L4TE 3AREC 3LHPL 5IFJA 4XCYB 2IEPA 1W2KT 4QGTA 1CLOH 1F2XK 4P2QD 4XT1C 1OD7A 2V17L 2UWEB 3R06B 5E2TL 5D72H 3QAZB 1JZ4A 4RMVA 4P5KB 4XBGA 4JRWA 2PXYD 4L4VB 2I9LA 4PRDA 4CNIA 3F8UB 5I8EA 4U1KB 4HBCH 3HB3D 4MNQE 4FXLA 2WUCL 5I1JL 5IJKC 3MRGB 4GW4B 4ESKA 5AZ2L 4AQOA 5EUKB 5FV2A 2AJYH 4E9LA 1A1OB 1I1AD 4JFDA 3A6BH 1KEGL 4KJWD 2IQAB 3V52H 3DV6B 1PY4A 4GQPH 3FT4B 2OYPA 3PQYE 3QB7C 4P4KC 4Z7UF 3NH7H 3RGHA 4Q6IA 1HHJA 2ADGA 2OTPA 1IGFH 5BS0B 2XTJB 4XVTH 1UT9A 4N8VB 1EUTA 3BKJL 3MUGA 4JO2L 2GJZA 2XKNA 2Y5TA 3MACL 4C56A 4MYWB 4E41E 4OCSH 4HV8A 4TUKH 1WWBX 2E5EA 5H8DA 3HPLB 5DD1L 2DYPA 3JV5A