2EZ5W

Solution structure of the dnedd4 ww3* domain- comm lpsy peptide complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
b'GPLGSGEEEPLPPRWSMQVAPNGRTFFIDHASRRTTWIDPRNGRAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase NEDD4
publication title Structural Determinants for High-Affinity Binding in a Nedd4 WW3(*) Domain-Comm PY Motif Complex
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signalling protein,ligase
total genus 5
structure length 46
sequence length 46
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2005-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2ez5W01
2XP7A 2LAJA 2BA1A 2ZR4A 3TC5A 3NTPA 2ZR6A 2M3OW 3ODKA 2DJYA 3KABA 2YSHA 2XP6A 3KCEA 1O6WA 3TCZA 3M7NA 2YSGA 4QIBA 2XPAA 3LE4A 2Q5AA 4U86A 3WH0A 4REXA 1K9RA 2XP3A 2ZR5A 2XP5A 2DK7A 2L4JA 2XP9A 3L4HA 2ZAJA 2XP4A 1I5HW 1NMVA 4U85A 1PINA 5CQ2A 3M85A 4U84A 3KAGA 2YSBA 1EG3A 2DK1A 2JX8A 3CNGA 2ZQVA 2YSIA 2RE3A 2JXWA 2F21A 1WR7A 4E5RA 2ZQSA 1ZCNA 1WMVA 2DMVA 1JMQA 5AHTA 2YSFA 1YW5A 3OOBA 2M8IA 2KXQA 2JV4A 1K9QA 3KAIA 2ZQUA 3TDBA 2ZQTA 2XP8A 2JMFA 2MDIA 2EZ5W 3KAFA 1F8AB 2DWVA 1TK7A 2XPBA 2E45A 1EG4A 3KAHA 2M8JA 3KADA 2ITKA
chains in the Genus database with same CATH superfamily
2XP7A 2LAJA 2BA1A 2ZR4A 3TC5A 1FLCA 3NTPA 2ZR6A 2M3OW 3ODKA 2DJYA 3KABA 2YSHA 5E65A 2XP6A 3FSCA 3KCEA 1O6WA 3TCZA 3M7NA 2YSGA 4QIBA 3LKXA 3PQHA 2XPAA 3LE4A 2Q5AA 4U86A 3WH0A 4REXA 1TR8A 1K9RA 2XP3A 2ZR5A 4GLXA 2XP5A 3MQGA 2YAJB 2DK7A 2L4JA 2XP9A 3L4HA 3FS8A 2ZAJA 3MCBB 2XP4A 1I5HW 1NMVA 4U85A 3LKXB 1PINA 5CQ2A 3M85A 4U84A 3KAGA 2YSBA 1EG3A 2DK1A 2JX8A 3CNGA 4A0UA 2ZQVA 2YSIA 2RE3A 2JXWA 5U47A 2F21A 3MQHA 1WR7A 4E5RA 2ZQSA 1ZCNA 1WMVA 2DMVA 3FSBA 1JMQA 5AHTA 5E64A 2YSFA 1YW5A 3OOBA 1RP5A 2M8IA 2KXQA 2JV4A 1K9QA 3KAIA 2Y8NB 2ZQUA 3TDBA 2ZQTA 2XP8A 2QRVA 2OWOA 5E62A 5E5WA 2WADA 2JMFA 2MDIA 4A0TA 2EZ5W 3KAFA 1F8AB 2DWVA 1TK7A 2WAEA 2XPBA 3MCBA 5E66A 2E45A 1EG4A 3KAHA 2M8JA 3KADA 2ITKA
chains in the Genus database with same CATH topology
2XP7A 2LAJA 2BA1A 2ZR4A 3TC5A 1FLCA 3NTPA 2ZR6A 2M3OW 3ODKA 2DJYA 3KABA 2YSHA 5E65A 2XP6A 3FSCA 3KCEA 1O6WA 3TCZA 3M7NA 2YSGA 4QIBA 3LKXA 3PQHA 2XPAA 3LE4A 2Q5AA 4U86A 3WH0A 4REXA 1TR8A 1K9RA 2XP3A 2ZR5A 4GLXA 2XP5A 3MQGA 2YAJB 2DK7A 2L4JA 2XP9A 3L4HA 3FS8A 2ZAJA 3MCBB 2XP4A 1I5HW 1NMVA 4U85A 3LKXB 1PINA 5CQ2A 3M85A 4U84A 3KAGA 2YSBA 1EG3A 2DK1A 2JX8A 3CNGA 4A0UA 2ZQVA 2YSIA 2RE3A 2JXWA 5U47A 2F21A 3MQHA 1WR7A 4E5RA 2ZQSA 1ZCNA 1WMVA 2DMVA 3FSBA 1JMQA 5AHTA 5E64A 2YSFA 1YW5A 3OOBA 1RP5A 2M8IA 2KXQA 2JV4A 1K9QA 3KAIA 2Y8NB 2ZQUA 3TDBA 2ZQTA 2XP8A 2QRVA 2OWOA 5E62A 5E5WA 2WADA 2JMFA 2MDIA 4A0TA 2EZ5W 3KAFA 1F8AB 2DWVA 1TK7A 2WAEA 2XPBA 3MCBA 5E66A 2E45A 1EG4A 3KAHA 2M8JA 3KADA 2ITKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP7 A;  2LAJ A;  2BA1 A;  2ZR4 A;  3TC5 A;  3NTP A;  2ZR6 A;  2M3O W;  3ODK A;  2DJY A;  3KAB A;  2YSH A;  2XP6 A;  3KCE A;  1O6W A;  3TCZ A;  3M7N A;  2YSG A;  4QIB A;  2XPA A;  3LE4 A;  2Q5A A;  4U86 A;  3WH0 A;  4REX A;  1K9R A;  2XP3 A;  2ZR5 A;  2XP5 A;  2DK7 A;  2L4J A;  2XP9 A;  3L4H A;  2ZAJ A;  2XP4 A;  1I5H W;  1NMV A;  4U85 A;  1PIN A;  5CQ2 A;  3M85 A;  4U84 A;  3KAG A;  2YSB A;  1EG3 A;  2DK1 A;  2JX8 A;  3CNG A;  2ZQV A;  2YSI A;  2RE3 A;  2JXW A;  2F21 A;  1WR7 A;  4E5R A;  2ZQS A;  1ZCN A;  1WMV A;  2DMV A;  1JMQ A;  5AHT A;  2YSF A;  1YW5 A;  3OOB A;  2M8I A;  2KXQ A;  2JV4 A;  1K9Q A;  3KAI A;  2ZQU A;  3TDB A;  2ZQT A;  2XP8 A;  2JMF A;  2MDI A;  2EZ5 W;  3KAF A;  1F8A B;  2DWV A;  1TK7 A;  2XPB A;  2E45 A;  1EG4 A;  3KAH A;  2M8J A;  3KAD A;  2ITK A; 
#chains in the Genus database with same CATH topology
 2XP7 A;  2LAJ A;  2BA1 A;  2ZR4 A;  3TC5 A;  1FLC A;  3NTP A;  2ZR6 A;  2M3O W;  3ODK A;  2DJY A;  3KAB A;  2YSH A;  5E65 A;  2XP6 A;  3FSC A;  3KCE A;  1O6W A;  3TCZ A;  3M7N A;  2YSG A;  4QIB A;  3LKX A;  3PQH A;  2XPA A;  3LE4 A;  2Q5A A;  4U86 A;  3WH0 A;  4REX A;  1TR8 A;  1K9R A;  2XP3 A;  2ZR5 A;  4GLX A;  2XP5 A;  3MQG A;  2YAJ B;  2DK7 A;  2L4J A;  2XP9 A;  3L4H A;  3FS8 A;  2ZAJ A;  3MCB B;  2XP4 A;  1I5H W;  1NMV A;  4U85 A;  3LKX B;  1PIN A;  5CQ2 A;  3M85 A;  4U84 A;  3KAG A;  2YSB A;  1EG3 A;  2DK1 A;  2JX8 A;  3CNG A;  4A0U A;  2ZQV A;  2YSI A;  2RE3 A;  2JXW A;  5U47 A;  2F21 A;  3MQH A;  1WR7 A;  4E5R A;  2ZQS A;  1ZCN A;  1WMV A;  2DMV A;  3FSB A;  1JMQ A;  5AHT A;  5E64 A;  2YSF A;  1YW5 A;  3OOB A;  1RP5 A;  2M8I A;  2KXQ A;  2JV4 A;  1K9Q A;  3KAI A;  2Y8N B;  2ZQU A;  3TDB A;  2ZQT A;  2XP8 A;  2QRV A;  2OWO A;  5E62 A;  5E5W A;  2WAD A;  2JMF A;  2MDI A;  4A0T A;  2EZ5 W;  3KAF A;  1F8A B;  2DWV A;  1TK7 A;  2WAE A;  2XPB A;  3MCB A;  5E66 A;  2E45 A;  1EG4 A;  3KAH A;  2M8J A;  3KAD A;  2ITK A; 
#chains in the Genus database with same CATH homology
 2XP7 A;  2LAJ A;  2BA1 A;  2ZR4 A;  3TC5 A;  1FLC A;  3NTP A;  2ZR6 A;  2M3O W;  3ODK A;  2DJY A;  3KAB A;  2YSH A;  5E65 A;  2XP6 A;  3FSC A;  3KCE A;  1O6W A;  3TCZ A;  3M7N A;  2YSG A;  4QIB A;  3LKX A;  3PQH A;  2XPA A;  3LE4 A;  2Q5A A;  4U86 A;  3WH0 A;  4REX A;  1TR8 A;  1K9R A;  2XP3 A;  2ZR5 A;  4GLX A;  2XP5 A;  3MQG A;  2YAJ B;  2DK7 A;  2L4J A;  2XP9 A;  3L4H A;  3FS8 A;  2ZAJ A;  3MCB B;  2XP4 A;  1I5H W;  1NMV A;  4U85 A;  3LKX B;  1PIN A;  5CQ2 A;  3M85 A;  4U84 A;  3KAG A;  2YSB A;  1EG3 A;  2DK1 A;  2JX8 A;  3CNG A;  4A0U A;  2ZQV A;  2YSI A;  2RE3 A;  2JXW A;  5U47 A;  2F21 A;  3MQH A;  1WR7 A;  4E5R A;  2ZQS A;  1ZCN A;  1WMV A;  2DMV A;  3FSB A;  1JMQ A;  5AHT A;  5E64 A;  2YSF A;  1YW5 A;  3OOB A;  1RP5 A;  2M8I A;  2KXQ A;  2JV4 A;  1K9Q A;  3KAI A;  2Y8N B;  2ZQU A;  3TDB A;  2ZQT A;  2XP8 A;  2QRV A;  2OWO A;  5E62 A;  5E5W A;  2WAD A;  2JMF A;  2MDI A;  4A0T A;  2EZ5 W;  3KAF A;  1F8A B;  2DWV A;  1TK7 A;  2WAE A;  2XPB A;  3MCB A;  5E66 A;  2E45 A;  1EG4 A;  3KAH A;  2M8J A;  3KAD A;  2ITK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...