2EZ5W

Solution structure of the dnedd4 ww3* domain- comm lpsy peptide complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
46
structure length
46
Chain Sequence
GPLGSGEEEPLPPRWSMQVAPNGRTFFIDHASRRTTWIDPRNGRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase NEDD4
publication title Structural Determinants for High-Affinity Binding in a Nedd4 WW3(*) Domain-Comm PY Motif Complex
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signalling protein,ligase
total genus 5
structure length 46
sequence length 46
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2005-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2ez5W01
2YSIA 3M85A 3ODKA 2LAJA 2YSGA 2E45A 3KAIA 4U84A 3TCZA 2YSBA 3KCEA 2XPAA 2ZR5A 2JXWA 2XP5A 2DK1A 2XPBA 3NTPA 2XP6A 2ZQVA 3KABA 3KAHA 2YSHA 2RE3A 1NMVA 1EG3A 3KAGA 2ZQSA 2JX8A 1EG4A 2JMFA 1WR7A 2DJYA 1I5HW 2ZR4A 3CNGA 3LE4A 3M7NA 2ZQTA 1ZCNA 2Q5AA 1K9RA 2XP7A 2MDIA 1TK7A 5AHTA 1YW5A 2ITKA 2DWVA 2ZR6A 1PINA 2EZ5W 2XP3A 2DMVA 2XP9A 4REXA 3WH0A 2ZQUA 2JV4A 2DK7A 2F21A 5CQ2A 3KAFA 3KADA 3L4HA 2M3OW 4E5RA 4U85A 1JMQA 1O6WA 2M8JA 3OOBA 3TDBA 2YSFA 2XP4A 2M8IA 1K9QA 2KXQA 2XP8A 3TC5A 2L4JA 2ZAJA 4QIBA 4U86A 1F8AB 2BA1A 1WMVA
chains in the Genus database with same CATH superfamily
2YSIA 3M85A 3ODKA 2LAJA 2YSGA 2E45A 3KAIA 5E5WA 4U84A 3TCZA 2YSBA 3KCEA 2XPAA 3PQHA 2ZR5A 2JXWA 2XP5A 2DK1A 2XPBA 3MQGA 3NTPA 4GLXA 4A0TA 2XP6A 3FSCA 3MCBA 3MCBB 2ZQVA 3KABA 3KAHA 2OWOA 2WADA 2YSHA 1FLCA 2RE3A 1NMVA 1EG3A 3KAGA 2ZQSA 2JX8A 3FS8A 1EG4A 2JMFA 2WAEA 5E62A 1WR7A 2DJYA 1I5HW 2Y8NB 2ZR4A 3CNGA 3LE4A 3FSBA 2QRVA 3M7NA 2ZQTA 5E65A 1ZCNA 3MQHA 2Q5AA 1K9RA 2XP7A 2MDIA 1TK7A 5AHTA 1YW5A 1RP5A 2ITKA 2DWVA 2ZR6A 1PINA 2EZ5W 2XP3A 2DMVA 2XP9A 4REXA 3WH0A 2ZQUA 2JV4A 5E64A 2DK7A 2F21A 5U47A 3KAFA 2YAJB 5CQ2A 3KADA 3L4HA 3LKXA 3LKXB 2M3OW 4E5RA 4U85A 1TR8A 1JMQA 1O6WA 2M8JA 3OOBA 3TDBA 2YSFA 2XP4A 2M8IA 4A0UA 1K9QA 5E66A 2KXQA 2XP8A 3TC5A 2L4JA 2ZAJA 4QIBA 4U86A 1F8AB 2BA1A 1WMVA
chains in the Genus database with same CATH topology
2YSIA 3M85A 3ODKA 2LAJA 2YSGA 2E45A 3KAIA 5E5WA 4U84A 3TCZA 2YSBA 3KCEA 2XPAA 3PQHA 2ZR5A 2JXWA 2XP5A 2DK1A 2XPBA 3MQGA 3NTPA 4GLXA 4A0TA 2XP6A 3FSCA 3MCBA 3MCBB 2ZQVA 3KABA 3KAHA 2OWOA 2WADA 2YSHA 1FLCA 2RE3A 1NMVA 1EG3A 3KAGA 2ZQSA 2JX8A 3FS8A 1EG4A 2JMFA 2WAEA 5E62A 1WR7A 2DJYA 1I5HW 2Y8NB 2ZR4A 3CNGA 3LE4A 3FSBA 2QRVA 3M7NA 2ZQTA 5E65A 1ZCNA 3MQHA 2Q5AA 1K9RA 2XP7A 2MDIA 1TK7A 5AHTA 1YW5A 1RP5A 2ITKA 2DWVA 2ZR6A 1PINA 2EZ5W 2XP3A 2DMVA 2XP9A 4REXA 3WH0A 2ZQUA 2JV4A 5E64A 2DK7A 2F21A 5U47A 3KAFA 2YAJB 5CQ2A 3KADA 3L4HA 3LKXA 3LKXB 2M3OW 4E5RA 4U85A 1TR8A 1JMQA 1O6WA 2M8JA 3OOBA 3TDBA 2YSFA 2XP4A 2M8IA 4A0UA 1K9QA 5E66A 2KXQA 2XP8A 3TC5A 2L4JA 2ZAJA 4QIBA 4U86A 1F8AB 2BA1A 1WMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSI A;  3M85 A;  3ODK A;  2LAJ A;  2YSG A;  2E45 A;  3KAI A;  4U84 A;  3TCZ A;  2YSB A;  3KCE A;  2XPA A;  2ZR5 A;  2JXW A;  2XP5 A;  2DK1 A;  2XPB A;  3NTP A;  2XP6 A;  2ZQV A;  3KAB A;  3KAH A;  2YSH A;  2RE3 A;  1NMV A;  1EG3 A;  3KAG A;  2ZQS A;  2JX8 A;  1EG4 A;  2JMF A;  1WR7 A;  2DJY A;  1I5H W;  2ZR4 A;  3CNG A;  3LE4 A;  3M7N A;  2ZQT A;  1ZCN A;  2Q5A A;  1K9R A;  2XP7 A;  2MDI A;  1TK7 A;  5AHT A;  1YW5 A;  2ITK A;  2DWV A;  2ZR6 A;  1PIN A;  2EZ5 W;  2XP3 A;  2DMV A;  2XP9 A;  4REX A;  3WH0 A;  2ZQU A;  2JV4 A;  2DK7 A;  2F21 A;  5CQ2 A;  3KAF A;  3KAD A;  3L4H A;  2M3O W;  4E5R A;  4U85 A;  1JMQ A;  1O6W A;  2M8J A;  3OOB A;  3TDB A;  2YSF A;  2XP4 A;  2M8I A;  1K9Q A;  2KXQ A;  2XP8 A;  3TC5 A;  2L4J A;  2ZAJ A;  4QIB A;  4U86 A;  1F8A B;  2BA1 A;  1WMV A; 
#chains in the Genus database with same CATH topology
 2YSI A;  3M85 A;  3ODK A;  2LAJ A;  2YSG A;  2E45 A;  3KAI A;  5E5W A;  4U84 A;  3TCZ A;  2YSB A;  3KCE A;  2XPA A;  3PQH A;  2ZR5 A;  2JXW A;  2XP5 A;  2DK1 A;  2XPB A;  3MQG A;  3NTP A;  4GLX A;  4A0T A;  2XP6 A;  3FSC A;  3MCB A;  3MCB B;  2ZQV A;  3KAB A;  3KAH A;  2OWO A;  2WAD A;  2YSH A;  1FLC A;  2RE3 A;  1NMV A;  1EG3 A;  3KAG A;  2ZQS A;  2JX8 A;  3FS8 A;  1EG4 A;  2JMF A;  2WAE A;  5E62 A;  1WR7 A;  2DJY A;  1I5H W;  2Y8N B;  2ZR4 A;  3CNG A;  3LE4 A;  3FSB A;  2QRV A;  3M7N A;  2ZQT A;  5E65 A;  1ZCN A;  3MQH A;  2Q5A A;  1K9R A;  2XP7 A;  2MDI A;  1TK7 A;  5AHT A;  1YW5 A;  1RP5 A;  2ITK A;  2DWV A;  2ZR6 A;  1PIN A;  2EZ5 W;  2XP3 A;  2DMV A;  2XP9 A;  4REX A;  3WH0 A;  2ZQU A;  2JV4 A;  5E64 A;  2DK7 A;  2F21 A;  5U47 A;  3KAF A;  2YAJ B;  5CQ2 A;  3KAD A;  3L4H A;  3LKX A;  3LKX B;  2M3O W;  4E5R A;  4U85 A;  1TR8 A;  1JMQ A;  1O6W A;  2M8J A;  3OOB A;  3TDB A;  2YSF A;  2XP4 A;  2M8I A;  4A0U A;  1K9Q A;  5E66 A;  2KXQ A;  2XP8 A;  3TC5 A;  2L4J A;  2ZAJ A;  4QIB A;  4U86 A;  1F8A B;  2BA1 A;  1WMV A; 
#chains in the Genus database with same CATH homology
 2YSI A;  3M85 A;  3ODK A;  2LAJ A;  2YSG A;  2E45 A;  3KAI A;  5E5W A;  4U84 A;  3TCZ A;  2YSB A;  3KCE A;  2XPA A;  3PQH A;  2ZR5 A;  2JXW A;  2XP5 A;  2DK1 A;  2XPB A;  3MQG A;  3NTP A;  4GLX A;  4A0T A;  2XP6 A;  3FSC A;  3MCB A;  3MCB B;  2ZQV A;  3KAB A;  3KAH A;  2OWO A;  2WAD A;  2YSH A;  1FLC A;  2RE3 A;  1NMV A;  1EG3 A;  3KAG A;  2ZQS A;  2JX8 A;  3FS8 A;  1EG4 A;  2JMF A;  2WAE A;  5E62 A;  1WR7 A;  2DJY A;  1I5H W;  2Y8N B;  2ZR4 A;  3CNG A;  3LE4 A;  3FSB A;  2QRV A;  3M7N A;  2ZQT A;  5E65 A;  1ZCN A;  3MQH A;  2Q5A A;  1K9R A;  2XP7 A;  2MDI A;  1TK7 A;  5AHT A;  1YW5 A;  1RP5 A;  2ITK A;  2DWV A;  2ZR6 A;  1PIN A;  2EZ5 W;  2XP3 A;  2DMV A;  2XP9 A;  4REX A;  3WH0 A;  2ZQU A;  2JV4 A;  5E64 A;  2DK7 A;  2F21 A;  5U47 A;  3KAF A;  2YAJ B;  5CQ2 A;  3KAD A;  3L4H A;  3LKX A;  3LKX B;  2M3O W;  4E5R A;  4U85 A;  1TR8 A;  1JMQ A;  1O6W A;  2M8J A;  3OOB A;  3TDB A;  2YSF A;  2XP4 A;  2M8I A;  4A0U A;  1K9Q A;  5E66 A;  2KXQ A;  2XP8 A;  3TC5 A;  2L4J A;  2ZAJ A;  4QIB A;  4U86 A;  1F8A B;  2BA1 A;  1WMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...