2EZKA

Solution nmr structure of the ibeta subdomain of the mu end dna binding domain of phage mu transposase, regularized mean structure
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
93
structure length
93
Chain Sequence
MIARPTLEAHDYDREALWSKWDNASDSQRRLAEKWLPAVQAADEMLNQGISTKTAFATVAGHYQVSASTLRDKYYQVQKFAKPDWAAALVDGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSPOSASE
publication title Solution structure of the Mu end DNA-binding ibeta subdomain of phage Mu transposase: modular DNA recognition by two tethered domains.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 22
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 1997-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ezkA00
2LK2A 1IRZA 4V2FA 2ECCA 3CQZJ 2HI3A 1QRYA 5IP9J 2YUSA 5K7ZA 5J1RA 1BW5A 5J3LA 1ITYA 5F1JA 1IC8A 2M2EA 3TW7A 4UUSA 1TWGJ 2X48A 1P7IA 3HOZJ 2R5ZB 2JA5J 4XRSA 3PM1A 2Y31A 2DA3A 3FISA 5IPAA 3S2HJ 3MVPA 3A01A 1ZR4A 2H1KA 5EZHA 2XGCA 5M3FJ 4JP0A 3SFIA 2MG4A 1GV5A 3IH2A 2LKXA 3FKIJ 4C3JJ 1MBKA 5F0FA 5IOYA 4X6AJ 3DEWA 3BR0A 1MNMC 4W1UA 4FCYA 3TP3A 2LD5A 3BG3A 4M3GA 1TWCJ 4BXXJ 2HOSA 4I6ZA 3F0CA 1MBHA 3O8GA 3JRAA 3LSPA 2R5YB 2DA5A 4A3MJ 3HOVJ 5E3NA 1IDYA 2QCOA 5F27A 1HDDC 1JT6A 1I6HJ 2JN6A 2ZB9A 3OSFA 5E3MA 2TRTA 3Q0UA 4QIWN 1HCRA 3G1OA 4A3GJ 2ME6A 5HODA 3TP0A 3GTGJ 3HB9A 4D5FA 5FJ8J 1JUSA 3ZQCA 1AU7A 2GLOA 1MH4A 2GM4A 2HDDA 3MN2A 4FE4A 5K7HA 3L1PA 1ETYA 2XB5A 5FLVA 3BG5A 3GTPJ 3IH4A 4QTRA 3HOYJ 2X9DA 3S14J 2E19A 3M3YJ 3GTOJ 5E3OA 2O9LA 4FE7A 1S7EA 2IBDA 3I4MJ 5M3MJ 5C4JJ 1UG2A 2LTPA 4QSHA 4DZPA 2E2IJ 1MBGA 2AHQA 3JRIA 3HGGA 2NVXJ 1XC5A 2IAIA 4NDLA 1ZGWA 5FKKA 3PO2J 1MBJA 2EZHA 2L7ZA 4BKXA 1VI0A 1WI3A 3ZOBA 2JA6J 2K9QA 1ZR2A 2HXOA 3JRGA 3QPSA 5EZGA 2Y0SN 3HGYA 3LSGA 2W48A 2OPTA 4FISA 4UUSB 1RETA 1Y1VJ 4UUTA 4XRSG 5C3EJ 2TCTA 2DA2A 4M6VA 1YRNA 1RR7A 3B6AA 2CUFA 4AYBN 1ZQ3P 1BJZA 3G1MA 1K83J 2WAQN 1DU0A 2B63J 2L0KA 1UHSA 1H88C 1JJ8C 2I10A 1MBEA 1E3OC 4A3BJ 4G12A 2VI6A 3S2DJ 1W0UA 1PUFA 1T33A 3RQIA 4C2MJ 5EF6A 4GFBA 2HXIA 2K9SA 3BTLA 3SJMA 1OFCX 3HOUJ 9ANTA 5FLMJ 1CQTA 3GTQJ 4M3FA 1VFCA 1U9NA 2DN0A 5EGOB 2EQRA 1HLVA 2HOAA 1BL0A 3LSJA 4BY1J 3K7AJ 3GTKJ 1WPKA 2VUMJ 2CRGA 2NS8A 4A69C 1H89C 3WHBA 2VPRA 2WV1A 3CDLA 2G0EA 3S15J 1IG7A 2D5VA 3I4NJ 1FIAA 1R9TJ 5F08A 2R0QC 4JX4A 1TWHJ 2DJNA 2M34A 1SANA 1G2HA 1DU6A 2JWTA 1B8IB 1ZK8A 2DMPA 3JREA 3CCYA 4CYCA 1WH7A 2M0CA 3K2AA 4HNVA 1VF9A 2ID6A 1W0TA 3BR6A 2ID3A 1XS9A 2H8RA 2EH3A 1FTZA 3PO3J 1A6IA 1APLC 1IUFA 3RZOJ 2ECBA 3B6CA 3OIOA 2XPVA 2N8GA 5FKMA 5IYCJ 1JT0A 2JA7J 4DYCA 4Y7NJ 4A3FJ 1X2NA 1BW6A 1ORKA 3SDGA 1WCMJ 3BR2A 1GDTA 2COBA 3LSRA 2JA8J 4RBOA 3S1RJ 1QVTA 2LVSA 2EZLA 1VNDA 1Y1WJ 5EG0B 3ZQIA 1LE8B 3DCFA 1GT0C 1RKTA 5M5XJ 1JGGA 1A5JA 5EEAA 2DA4A 3GBGA 4MIMA 1WH5A 4B1RA 4M3BA 5BNGA 2DTZA 3GTLJ 2DMTA 1SFOJ 2R5ZA 4DZJA 1RPWA 1JKRC 3CMYA 1B72B 2XPWA 2EBIA 2FD5A 1ETVA 2VKVA 4MFDA 3HDDA 1ZTRA 3HM5A 2CQXA 2OF7A 4AC0A 3D1NI 3MKLA 2AO9A 4MFEA 4D7NA 4D7MA 3ZQGA 1U8BA 2O7OA 2DA7A 4B3AA 2DMNA 3JR9A 2JMWA 1ETQA 4IHVA 2R5YA 4LOCA 3TEDA 2QF7A 1OCPA 2L9RA 1TWFJ 3H3VK 1WGXA 3A03A 3A01B 3BQZA 1BA5A 1X2MA 1U9OA 2YS9A 2E2HJ 3GTMJ 1JTXA 4Y52J 4X1EA 3FK7A 1H8AC 1AHDP 3UKGA 3QPLA 3JRHA 4MLOA 1LFBA 1ENHA 4AUXA 3O8HA 2MSYA 3LNQA 3S16J 1OCTC 4J19A 4BY7J 3BR3A 5JLXA 4A3LJ 2YU9J 1EF4A 2Y9ZA 2EZKA 1I3QJ 5C44J 3BTJA 1I50J 2EZIA 2K9NA 3HOWJ 1JUMA 4IEJA 1FIPA 2NOGA 1NK3P 1QVUA 4M3DA 2FQ4A 3Q3SA 2KDZA 2LR8A 2Y30A 2NVYJ 1MSEC 4C3IJ 1JTYA 2L7FP 3GTJJ 1ETOA 3JRCA 1JKOC 5FKOA 5F04A 1FEXA 5F0CA 1HOMA 3M4OJ 4IHYA 4EEFG 5FKNA 1Z0XA 1F43A 1JUPA 4ABZA 4A93J 3HKZN 3BTIA 2X6OA 4XK4A 5C4XJ 4XIDA 3Q0VA 1XG1A 1Z77A 5K7FA 2Y2ZA 5M5WJ 3FK6A 1F36A 1U78A 2RAEA 1ETWA 2CU7A 4S0HB 4XICA 3RZDJ 1AKHA 2LFBA 1TC3C 5EDNA 3QQAA 4W97A 2XB0X 4I76A 3E7LA 3OOUA 4A3IJ 4RDUA 4IHXA 2DA1A 4MO7A 2R92J 1ZKGA 2NVTJ 1MBFA 2M8GX 2HYJA 3C2BA 3VPRA 5F0HA 4IHWA 3S1MJ 1OJLA 4XRMA 1YRNB 3H0GJ 3BQYA 3BR5A 2LLKA 3HBLA 3JRDA 3RKQA 4M3EA 1X58A 3S17J 1ETXA 5EGOA 1D5YA 3BR1A 1O4XA 2LY9A 5J1UA 2XGDA 1PUFB 1LFUP 5J1YA 4JYKA 2E2JJ 2KT0A 2XRLA 1QPIA 1ETKA 2E1OA 2ELKA 1FJLA 1GVDA 2CQQA 4BBSJ 3FIWA 4D5CA 3LOCA 4A3EJ 3NAUA 4B4CA 2DMUA 2HQ5A 3IH3A 4C3HJ 4JX6A 3S1NJ 1IDZA 5GP9A 1B8IA 2NVQJ 3BT9A 2GBYA 4DYRA 1GV2A 2IEKA 1NTCA 5DS9A 2LP0A 1IV6A 3IV5A 5EYRA 2XSDC 1HDPA 2M9HA 3ZQHA 1RKWA 3HOXJ 4A3DJ 1IGNA 2XPUA 3WHCA 2PMZN 2K40A 5GPCA 3G1LA 3HEFA 3ZQFA 1JKQC 3W6VA 2FX0A 1IJWC 4A3JJ 1NK2P 2P81A 2CJJA 4CYCB 2O8KA 4A3CJ 3Q0WA 3TW6A 1UMQA 1RESA 3JRBA 1AKHB 5IOZA 1Q1VA 5IP7J 2NS7A 5M5YJ 3BG9A 4L5EA 2XGEA 5E3LA 5IP6A 5EG0A 1LE8A 2JJ7A 3BTCA 3NARA 2L7MP 3OSGA 2HOTA 2R93J 1TWAJ 5GPAA 1T56A 5JLWA 2DA6A 4DYQA 2FJ1A 1HF0A 1JJ6C 2ME0A 1P7JA 2WB1N 1GUUA 2Y9YA 4FTHA 1POGA 2MW8A 3S1QJ 3JRFA 2CUEA 4A3KJ 5IYDJ 1JKPC 2VKEA 4V2GA 5DTDA 5FKLA 4BBRJ 2R7ZJ 1FTTA 3ZQLA 1B72A 2JK3A 3A02A 1MH3A 2MGQA 1MSFC 4JX5A 1K61A 4DW6A 5IYBJ 2DMQA
chains in the Genus database with same CATH superfamily
5LGTA 2LK2A 2X1EA 1MNDA 2ECCA 2Q8KA 2QZ8A 1BW5A 2L4MA 1Z67A 3TL4X 4IXAA 3TDUC 5F1JA 2QSHX 3GUDA 2DT6A 4BQOA 2CSOA 2V1XA 1LB2A 1IRXA 3KP2A 1RI7A 2Y31A 2Z9OA 3BCAA 4ETSA 1ZR4A 1HBXG 3VYSB 3SFIA 2LOOA 4EGYA 4XBFA 3NWTA 4IOAF 2VPLA 2VB6A 1TNTA 5F0FA 1Z05A 5IOYA 3AAFA 3ZQQA 5TJJA 2IA0A 2DCEA 2O03A 3SDBA 2GAUA 2EJRA 4AVPA 4I6ZA 2LBFB 1TNSA 4II3A 3LSPA 2V26A 5E3NA 3CJQB 5F27A 1JT6A 1QHHD 1HW5A 1FP1D 4BU2A 3CUQA 2VOPA 4K2EA 2VQCA 2GOMA 1YS6A 3HKZA 5HODA 1MDMB 2ZXWH 2H27A 1H9GA 3GZ5A 5FJ8J 3F8MA 4U0VA 1Y39A 2QSGX 4Z6YA 2GLOA 2ICWG 1NHAA 3FX3A 4AU7A 2HDDA 3MN2A 4BEHA 1LVKA 3L1PA 1USSA 3RIRA 3GTPJ 2L3DA 2UZKA 4PJNA 4WWCA 1PJRA 4QTRA 3HOYJ 3S14J 2F5CA 3GTOJ 3S3OA 2HVSA 2BEOA 2IBDA 1BBYA 5M3MJ 3E6CC 1WJ5A 5J47A 4F55A 3DBRB 1FC3A 3ELKA 2WADA 4ZTJA 3PIOF 1BN5A 2LH9A 4E6KG 5DM7F 1F4KA 3G2BA 2EV6A 1BI1A 2HDCA 3IP4B 1XC5A 1YX3A 5LHGA 1L3LA 5DDGA 3ZOBA 4WF2A 3I0TA 1ZR2A 2HZTA 2HXOA 2DFEA 2B7EA 2QQAA 5EZGA 5D5XB 4AVZA 1S5LC 2M7BA 1O7FA 2E60A 1YYVA 3DU6A 2QVOA 3K9TA 2TCTA 2DA2A 3LQQA 3FDYA 4YELA 3KP7A 1RR7A 3HRTA 3EUHA 3K6GA 1BJZA 4NQWA 3G1MA 4OMYA 2WAQN 1BI3A 4B48A 4CO8A 5DUIA 2GXBA 2FNPA 2I10A 3CO6C 4ENKA 3B02A 4P9FA 3DKWA 3CC2I 2VI6A 4HDUA 2CW0F 3QU6A 3PNYA 1PUFA 1ZLJA 1R1VA 3F9KA 3T5XA 1B6AA 4UVAA 1TQMA 2F5DA 4BGDA 2EV0A 4GFBA 1U0JA 1Y6IA 3E6DA 3TOAA 2VBYA 2K85A 3J7YJ 2Q2EB 4G6DA 3VSKA 2VONA 2KDOA 2Z99A 1FPQA 1P4AA 1HKQA 2JRMA 1IW7F 2EQRA 3BCBA 2WV0A 1WI9A 3LSJA 3MMYB 4BY1J 3Q9VA 2KKOA 4NHJA 3WG9A 4A69C 3TGNA 1H89C 2V9PA 2HQAA 1E2XA 2UXXA 3G73A 2WV1A 5TRDA 2G0EA 1A35A 3EQLF 1X4OA 3CCSI 1R9TJ 2YSRA 3C1DA 2V4JC 2W24A 3RKXA 1T39A 1BR2A 1A04A 1SANA 2M34A 1XGMA 1G2HA 3OYEA 3Q5FA 2IRFG 2V7FA 1SD5A 4G8XA 1YITI 2HNHA 2KL4A 4U88A 4HNVA 1RC9A 1VQ6I 3BR6A 1EKEA 2ID3A 2H8RA 2EH3A 5BPDA 2DOEA 2ELJA 1KONA 2DQLA 3DWLE 1ZG1A 4EM0B 3IAM2 3NWSA 4A6EA 1IUFA 1EH8A 3SFZA 1S9HA 4ZDPA 4XSZF 1V5GA 2XPVA 2A5YB 1WJCA 3BZCA 2CQ7A 2XC7A 4NNJA 4HF2A 2P7CB 4A3FJ 1X2NA 3J7AO 3K70D 1WCMJ 4MQ9F 1IUYA 2IXSA 3EUKL 1YW9A 2COBA 2G7HA 3BJ6A 3LSRA 2V79A 4BE1A 1JI8A 1M1EB 3EYIA 2YX4A 2EZLA 1Y1WJ 1LE8B 5EG0B 4FHTA 3JSPA 4BHCA 1V4RA 1GT0C 4Y33A 2DAOA 1E0EA 1HW1A 3BZ6A 3QWLA 5M5XJ 5CYVA 3ERED 3CCRI 1JGGA 2BE5F 4RLQA 2PLYA 4CHUA 4F91B 2H1LA 3GZ6A 1ZLKA 4B1RA 3BJOA 3IAS2 3CF2A 3E97A 4L5IA 2VLAA 1R4MB 4KIFA 2PI0A 2JT1A 1V55H 1J0RA 1ETVA 2FBKA 2RREA 3K70C 1ZTRA 2CQXA 2G7UA 2OF7A 4AC0A 2X1CA 5K5RA 4FT8A 4CDGA 3SZTA 4FX0A 2CV2A 3ROUA 1Z21A 2VJIA 3ISPA 3WODF 1U8BA 1KU2A 2DA7A 5LGNA 2DXIA 4Q48A 1ETQA 1DP7P 4IHVA 3R0JA 1Q1HA 3V8LA 1MZBA 2CG4A 4RM3A 1WRJA 2R5YA 1O7LA 3MAJA 4LOCA 1A36A 1YIJI 3VWBA 1KU7A 1TWFJ 3H3VK 2F5VA 3A03A 4KJZA 4S05A 5ICEA 3BC8A 3OYIA 3BOQA 2HU9A 3OYHA 3VODA 1VZ0A 1T2KA 4NB5A 2MFZA 1H8AC 3UKGA 1J2XA 1OMIA 2ZJPF 3QPLA 2LY1A 4Y3OA 4F7ZA 3OL4A 4AUXA 2RNJA 4XOTA 2X51A 2MSYA 1SEUA 1CGPA 3LNQA 3V8KA 3GCMA 4OAZA 1Y8RB 1S8NA 2YU9J 4A5NA 2HVQA 4II2A 3M9AA 3OYGA 1YJNI 3CUQB 4KA4A 4RM2A 3FMRA 1TQPA 5IT3A 5FGMA 2GQQA 2QQBA 4B43A 4PK4A 2KDZA 2LR8A 3VYUB 5ICCA 1X1PA 1KGSA 4HNUA 5IY5H 2RQQA 1NH3A 3PNVA 4WX9A 2LREA 5D8KB 3PQJA 4BEHB 4FX4A 2L7FP 3GTJJ 2VQHA 5AONA 4HEA2 5F0CA 2X1DA 4IHYA 4EEFG 1Z0XA 2JA2A 1JUPA 4ABZA 5FB2A 5D5UB 3CCQI 1D8JA 2X6OA 5C4XJ 2F5FA 5K5QA 4XIDA 3WTYC 3Q0VA 2OC6A 2CV1A 1ACIA 2D2WA 1XG1A 2ZSIB 1Z77A 2DFIA 4B44A 2Y2ZA 5K5OA 4AIJA 3FK6A 2GA1A 2UWMA 3M8FA 3KYLA 3R4KA 3RZDJ 3OS1A 1AKHA 1ZREA 4L0YB 2MABA 4HBLA 3JSOA 1R00A 5EDNA 2V1NA 1RNLA 4I76A 4IHXA 2Q0OA 3DBHB 4BE2A 2R92J 3HXLA 3ASNH 4CCMA 1UELB 2XAHA 2NVTJ 2XDVA 2MLKA 5J8FA 2ZKZA 5L3GA 3VPRA 5F0HA 2DBBA 4KYWA 2KP6A 3JTHA 3HYIA 4XRMA 1NG7A 4HX8A 4PJMA 1T38A 3JRDA 4NQWB 1Z9CA 4M3EA 4RGUA 4XKWA 2HPMA 4PJ0C 3FXLA 5FD6A 4CZZA 3H5NA 5EGOA 1IZ1A 3PIPF 1Z1DA 1BM9A 1PUFB 2MH2A 3MZ8A 4JYKA 3V7CA 2HTJA 2E2JJ 2XRLA 1X3WB 2RN7A 3KYCB 2CQQA 3FIWA 3NRVA 3L7WA 3LOCA 4D5CA 4A3EJ 1B9NA 1OQYA 4OIQF 1VQMI 1SFXA 2ZO4A 4F93B 3ESWB 3K10A 2J5PA 3OL3A 5KAFC 2HQ5A 4DGWB 1N78A 1YIOA 3FMQA 1L0OC 3DU5A 2DDBA 4TV7A 2I8DA 5ERIA 2RC4A 3A1YA 2XUBA 2L01A 3BT9A 2GBYA 4DYRA 2BZTA 4EGZA 1IV6A 2FA5A 5EYRA 1G3SA 1HDPA 3ZQHA 2LBFA 3DPTA 3MD2A 1D0XA 3L2QA 2NNNA 1FMWA 2VJJA 3BPVA 2CO5A 5F1RA 1J75A 3IUOA 4BL0B 5GPCA 1FSHA 1EA3A 3G71I 2JQ7A 1K79A 1N75A 2FSWA 1WZ2A 1WJAA 4AM3A 4KICA 4EJTA 4LIUA 3OYDA 2IGMA 3U21A 3F8FA 5HS7A 1XSVA 3F8CA 2VE9A 4A3CJ 1PDNC 3HTUA 1UMQA 3AG2H 3JRBA 5KVRA 1BOBA 5IOZA 4RMNA 1FSEA 1MMNA 2DK5A 6PAXA 4L5EA 2XGEA 3ZPLA 3NARA 2CFXA 3OYBA 2HOTA 1LJ9A 5GPAA 3BP8A 1T56A 1X3UA 1STZA 2QLZA 1Z91A 2VXDA 2FJ1A 1JJ6C 5B1BH 1OISA 1P9QC 1D0YA 3FXMA 1PUEE 4IJAA 2OA4A 3JRFA 1P6RA 1Z3XA 3F21A 1QO0D 2OD5A 4RGRA 2R7ZJ 1B72A 2JK3A 1MJ9A 3CZ6A 2BV6A 2MC4A 4LJZF 1QGPA 1VQ7I 1K61A 4IHSA 4IRGA 4DW6A 5IYBJ 3RYRA 1QRYA 5IP9J 3SEZA 4GYIA 3FKJA 5J3LA 1ITYA 3WU0A 4PFOA 1KQ8A 2LNBA 3L2VA 4MEYF 1SD6A 5J6XA 2PMUA 4HF1A 4I02A 3PM1A 1USTA 3FISA 2Z2SB 3WTXC 5B5EC 5EZHA 2XGCA 2M87A 2ELHA 2F48A 1GV5A 3Q9SA 3B73A 1VQPI 4C3JJ 4X6AJ 3QODA 5E1XA 3O3KA 3BR0A 4E7IA 1OR7A 4W1UA 4ENMA 4LLNA 4IZZA 2LD5A 3X2QH 3BG3A 5J8CA 1KQ0A 2Y48A 1TWCJ 3OIPA 2XKPA 2AS5F 2E1CA 3O8GA 2R5YB 1XGOA 4CUGA 2W84A 4A3MJ 3K4KA 3ECHA 3GFJA 1I6HJ 2FU4A 3OS2A 3I58A 4EJWA 1BIBA 2LYCA 4OIOF 4E7KA 2TRTA 2HVRA 1GVJA 4G9YA 3WGGA 1HCRA 3E1SA 3G1OA 1I27A 2ME6A 3TP0A 4N9HA 4LMYA 1Z6RA 2E7XA 4RAFA 4AWXB 1ZGJA 1FX7A 2RVCA 4JBAA 4FE4A 1IXSB 2R4GA 1UHMA 4KIBA 4D0PA 1ETYA 2E36A 2XB5A 3KYDB 3SZPA 4FETA 2P0WA 4XM3A 2X9DA 4BHPA 3MKYB 2CQNA 3M8JA 1D8KA 3BG7A 5E3OA 1VQ9I 4E7ZA 3I4MJ 4HZFA 5GAEJ 5C4JJ 1J5YA 1XX5A 1FOXA 3DP7A 3IWFA 4QSHA 3WU2C 4DZPA 5LBQA 3MZYA 4YIRX 2F6CA 2AHQA 3KP6A 4OIRF 1SVLA 2LKPA 2V9KA 5FKKA 3PO2J 5E20A 4BKXA 3RJPA 1VI0A 3OYLA 3R60A 3LA3A 2NNYA 2VKHA 3GFMA 5CVUA 3QPSA 4OIPF 2JPCA 2QEXI 2Y0SN 2NOJB 3C3WA 2EIJH 3HGYA 2JSPA 2L9SA 4CYDA 3HOTA 3HC7A 4R79A 3LA2A 1Y1VJ 2EINH 5C3EJ 5DV5A 1U6GA 4I99C 2CFOA 2B63J 2A61A 4E7HA 2L0KA 3QOEA 1Y56A 1JJ8C 3DPUA 1N77A 3MZHA 4BXUA 5HNFA 1W0UA 1V5FA 1G4DA 4BQNA 2COMA 5HNHA 1WSUA 2HXIA 2K9SA 5GTHC 2Z1DA 3J81Z 2Z5UA 4B47A 2O8XA 1OFCX 1LNWA 2B0LA 4N0BA 3DPLC 3FHZA 4V19K 9ANTA 5FLMJ 4D9JA 1S3JA 4BHBA 1UAAA 1UJ8A 3GTQJ 2EK5A 1X1AA 3TDZC 2JZYA 1VFCA 1U9NA 2DN0A 4UV9A 1X3ZB 5L3EA 5EGOB 2HOAA 1BL0A 2EWNA 3ZMVA 3K7AJ 3GTKJ 3TKYA 3H35A 5DD4A 2CW8A 4ENNA 4UB8C 2D1VA 1IXCA 3U2RA 4RAYA 3CDLA 3PFYA 2VBZA 3ZCOA 2PEXA 2D5VA 1FIAA 1WKMA 1LEBA 5F08A 2R0QC 2L7KA 3DFGA 2LF8A 4BS9A 2FXAA 4EATA 2QA4I 2PQ8A 2STTA 1SC7A 1DU6A 2PJRB 3CC7I 4GDFA 3K1MA 1B4AA 4M9XA 4CYCA 2M0CA 3QOPA 3F6OA 1LVAA 3ZGKA 1HXDA 1RZ4A 1VF9A 1Y0UA 3OMYA 4IVNA 5F6FA 3P9IA 2ID6A 4DBRA 2X85A 1W0TA 1Z7LA 4UY8I 1TT5B 2XV4S 5LLQA 5ICGA 4HSRA 5JVTA 3PO3J 2E5ZA 2QWWA 4XRFA 2E1MC 1W7PA 2M4KA 4PFPA 3I55I 5L3FA 1D0ZA 4GYGA 1BI2A 2FF4A 2ECBA 5FKMA 5ILSA 5IYCJ 2IGNA 2N8GA 2JA7J 4HLYA 1MGTA 4DYCA 4Y7NJ 1BJAA 2LF7A 2XHKA 4BDZA 1E3HA 2VC0A 4CCOA 3BR2A 3TQNA 5GAGJ 4L9VA 4CCKA 2KRFA 2H6CA 3S1RJ 2XF5A 2ZJRF 1U3EM 3RPUD 5LRRA 2ZFUA 4D1QA 2DDAA 5D5VB 1VNDA 3DCFA 3CMMA 1W36D 2FUG2 3JAMK 1RKTA 1AOYA 4H4KC 1O3RA 4LK0F 5EEAA 3GBGA 3HTSB 5KHDA 4MIMA 1W7PD 3LSMA 5E79C 1D1CA 2CH0A 3CUOA 2LY2A 5BNGA 1Z6TA 3N97A 4DBQA 1TBXA 2R5ZA 1RPWA 2DO7A 4U87A 1JKRC 1B72B 2XPWA 3RKWA 2EBIA 2FD5A 4QLCU 3WTTC 5E17F 2VKVA 5HLGA 2BW3B 3HM5A 1IO2A 3D1NI 4IQJA 1VQ4I 2CGPA 1FYLA 4MFEA 2OQRA 4D7NA 3ZQGA 4XLAA 3GZNB 2O7OA 4OWRB 3I54A 4XLEA 3C2GA 1W36C 4B3AA 3JR9A 2BOLA 4CCJA 1WJFA 3OYJA 3VFZA 1KYZA 5ILVA 3CLQA 1I3AA 3AG3H 4I7HA 2K9MA 3K4JA 1YJ9I 2HR3A 2QF7A 1OCPA 4O3MA 1R22A 3GLXA 3BG6A 1WGXA 3IHUA 2EV5A 2CW7A 2E2HJ 3GTMJ 4FASD 2PBIA 4Y52J 1YOVB 4E7JA 3FK7A 5D4SA 2FEZA 3GEZA 2CUJA 5HVQC 4MLOA 4C9YA 1LFBA 2HOEA 3HZJA 3H3ZA 3P9CA 3MFKA 4J00A 2ZJQF 4ZYDA 2W00A 4A3LJ 2D1HA 1HC8A 2XAUA 1Y0NA 1WFXA 2FMLA 2LDUA 4YRVA 1D1AA 2Y9ZA 2DW4A 1UCRA 3SEQA 3BTJA 3OYKA 2L2OA 2EZIA 2QKMB 2M0MA 1ZAOA 2FBHA 2IA2A 3LWFA 3J7AY 4IEJA 3D5SC 2NOGA 1QVUA 4M3DA 3Q3SA 3F6VA 2Y30A 1T08B 2NVYJ 4C3IJ 1XTAA 2DT7B 3I3LA 5BS6A 3DKYA 3FXRA 2HGCA 1JTYA 2R7VA 4R8HA 1KZHA 3JRCA 1R23A 5FKOA 1OYIA 1I5ZA 2W57A 3PL8A 4ESFA 4Q4ZF 2R7UA 4UB6C 2HKOA 3HKZN 3BTIA 3SZGA 3QPHA 3ECOA 3QYFA 3K1NA 3N05A 3VOEA 3RCOA 5HLIA 3M1EA 5M5WJ 3R0AA 2DODA 1R49A 3RYPA 2OZUA 3RI4A 1F36A 4PZJA 5DCMA 4S0HB 3G4SI 4A0ZA 3IKTA 1OYWA 3OYNA 4BYYA 3GW2A 4MEXF 2OCCH 2LG4A 2KIMA 1TC3C 3CC4I 1LUJB 3I4PA 4BUPA 2XB0X 3BROA 3E7LA 3OOUA 3REOA 4BH9A 1H9TA 4IO9F 4MO7A 3WTZA 1J9IA 2KZVA 1ZKGA 2M8GX 1QA6A 3OY9A 2KJCA 3KEOA 1Z7UA 3C2BA 1SFUA 4C2UA 3H0GJ 1E17A 5EEHA 3BR5A 2LLKA 3WU1B 2KZGA 1ZG5A 1X58A 2W4SA 3J81K 3LSHA 4BDYA 1YJWI 2FMYA 1SVOA 4M9SA 1FOKA 2V1UA 1TW2A 4E7SA 1LFUP 3W3CA 5J1YA 1XDSA 2KT0A 2HQNA 1ETKA 2E1OA 2ELKA 4BBSJ 3PUFA 2DYRH 3H9JA 3OYCA 3H36A 1FYMA 4RLFA 4A0YA 3PSIA 3DTKA 4U0YA 4C3HJ 3QPTA 3GF2A 3M1CA 2RQPA 4PCQA 2EIKH 1GV2A 4E70A 1NTCA 5CJ9A 3V7SA 5DS9A 2LP0A 4G94A 2NVUB 2ZCWA 1FP2A 4I01A 1YW7A 4P96A 2XSDC 4ZZDA 2GIZA 5CVRA 2X6XA 4CCLA 3L2WA 2IPQX 2O5RA 4A3DJ 3KP3A 3AL0C 2XPUA 2K40A 1ZYRF 5FD5A 3T8RA 2QQ9A 2O0YA 5LD2C 2WY8Q 3P5JA 2H8WA 3NQOA 1JKQC 4I09A 1IJWC 2A6TA 2FNAA 2RNGA 4A3JJ 5E1WA 4DQ2A 1NK2P 4KFCA 4I2OA 4HPQA 2HPIA 2CJJA 4CYCB 2V1DA 3Q0WA 3TW6A 1V5EA 2HQRA 2ZXIA 1Q1VA 3FMSA 2NS7A 2QM3A 3MCZA 1H0MA 4HV6A 3LMMA 2GOXB 2PMHA 5IP6A 3HSRA 2A6EF 1IN8A 1OLTA 2XAJA 5GTIC 3MQ0A 1ODDA 1ZN2A 1W7PB 3CP2A 4Z2YA 3PNTA 3OSGA 2M1BA 2R93J 4YG2F 1TWAJ 1K7AA 2XAGA 1VQ5I 2XGXA 4LG3A 3RPQA 4ZYHA 5JLWA 2P6TA 4BJ6C 2ME0A 1ZGAA 5JFRA 2WB1N 1GUUA 1T0FC 2Y9YA 1FZPB 1POGA 3S1QJ 3ZN0A 2XRNA 5IYDJ 4Y17A 4A3KJ 2ACJA 4BBRJ 5DTDA 5FKLA 1DPRA 4CA0A 1YW8A 4KITB 3A02A 1QQIA 1MH3A 3H9GA 4WXDA 5DEQA 2KHMA 1MKMA 2MGQA 4XKVA 5D4RA 1K4TA 1XD7A 1MSFC 4G6QA 2W7NA 2RV8A 1B59A 4BJ5C 3H5AA 1QZEA 2Z16A 4V2FA 1R4NB 3CJTB 2HI3A 5HLHA 5K7ZA 4HOBA 1IC8A 3LFKA 2M2EA 3LSKA 3H92A 2HDWA 1MD0A 2X48A 5KCMA 5FRMA 3D5RC 1P7IA 3DTIA 5D5WB 2ETHA 1BC8C 3SYTA 2R5ZB 5ILUA 2JA5J 2DA3A 3ABTA 4YIIA 2KRHA 3S2HJ 3MVPA 1YE9A 4O5VA 3CTAA 3ERMA 3KX2A 1BR1A 4P1WA 3A01A 5B66C 1TTYA 3IH2A 2HWVA 3A0HC 3HOSA 3H9QA 4EV0A 3DEWA 1SVMA 2ZXHA 4GO1A 2H6BA 4M3GA 4BXFA 3WTSC 4BXXJ 4NBQA 2H94A 1MBHA 1J09A 4LD5A 5J4VA 1BIAA 1I6XA 2DA5A 3HOVJ 1HDDC 1IDYA 2QCOA 2C6YA 3OSFA 2AXTC 4WCGA 5E3MA 3HRUA 5LHHA 1T98A 4GGGA 1OCZH 3D5LA 3Q0UA 4QIWN 2VBXA 5JVGF 3I9V2 3OIQA 4GCVA 4LB5A 2ZMEC 4A3GJ 3GTGJ 3GXOA 3HB9A 2MH9A 1JUSA 4ESBA 3K69A 5CVVA 1JE8A 2ZXJA 1MH4A 4LITA 2M45A 3CLOA 2GM4A 3CCVI 2J5OA 5K7HA 3WE2A 3WTUC 3W6JB 1DPUA 4KUMA 1HSJA 3IH4A 1FWZA 1EH6A 5CLSA 3KP5A 3CCLI 1S7EA 2A69F 2PJRA 1G8XA 1S29A 2PX9A 2XAQA 4IHTA 1YX5A 5H2FC 4E4HA 1R6RA 2LTPA 1Y8QB 3BLYA 2HEOA 2R3SA 3S3MA 1IAWA 4LFUA 2ZSHB 4KDPA 2EFWA 1MBGA 2VN2A 1G3WA 4DIQA 2L54A 3JRIA 3CDHA 1XCBA 2NVXJ 4NDLA 5KAIC 1ZGWA 2L7ZA 1WI3A 4XKBA 2X6WA 2EA4A 2JA6J 2K9QA 2F5EA 1BC7C 3OR1C 3JRGA 4P5OA 5TGTA 2R7TA 2A05A 2MLGA 3LSGA 2W48A 2BBYA 2OPTA 2VT2A 3HHGA 4FISA 1XB4A 3KLNA 4UUSB 1GHCA 1RETA 4ITVA 4UUTA 3DEEA 4XRSG 1IN4A 5DCMB 3B6AA 4AYBN 2BXZA 4CSWA 2GIVA 1QZZA 3VYRB 2MD0A 1GLNA 4XLHA 1ZELA 4U0WA 3PSFA 4IQ4A 4M74A 2XSJC 5E1ZB 4PSWA 1O3SA 3AG1H 1MBEA 1WWXA 4YEJA 4F92B 4G12A 1UFMA 1T33A 2IS6A 4C2MJ 2K3FA 3T1BA 3W2WA 1U5TC 5LGUA 3RSNA 3SJMA 3W2AA 2PN6A 3JAMZ 2DJIA 3KEYA 3HOUJ 1W5CC 3IRQA 4AIKA 3HRMA 2BW3A 4M3FA 4ANJA 1VTNC 2R7XA 4QPOA 5E8GA 5BPIA 2XF6A 3P9KA 2CQKA 4M9ZA 5CPRB 1ZRCA 1QHGA 4RGXA 1XGNA 3HSEA 3MWMA 2CRGA 4C30A 3WGHA 2NS8A 2WWYA 1JXSA 4YFXF 1IRGA 2VPRA 2P8TA 5IT9K 3S15J 1IG7A 1GXQA 3U1KA 3CCMI 2CWEA 3I4NJ 4ZDOA 2MBFA 1XMAA 4U7DA 3F8NA 2MYSA 4JX4A 3VEPA 4PUSA 3RQ4A 4CICA 2KFDA 3QU3A 2QBYB 1ZK8A 1OCCH 2Y0MA 2DMPA 1WH7A 2X4HA 3K2AA 2ESNA 2E35A 5DCFA 1DGWY 5CVIA 2M8EA 1WJBA 2WAEA 2WTEA 4HF0A 5FROA 2HYGD 4RB3C 2YX7A 1FTZA 2Z33A 4B09A 4XONA 2LSOA 3GMEA 3ZRGA 4EM1A 3RZOJ 3T0YA 2RKHA 3L09A 3F22A 2BY0A 3QYBA 3OIOA 2R7OA 3K4LA 2L4AA 5FRNA 3QP5A 1X19A 1R5ID 4IX7A 3SDGA 1ORKA 2W25A 2W85A 1O3TA 2IS2A 2IP2A 4RBOA 2CMPA 4CZCA 4EMSA 3ONQA 2K02A 2VE8A 5B1AH 3ZP5A 2NRAC 2M30A 3K0LA 3ZQIA 2XIGA 2VASA 3EUAA 1A5JA 1FT9A 2DA4A 3ZXSA 1X1CA 1KYWA 1WH5A 1ZHFA 4PJLA 1IN7A 3F3XA 3J80K 2VQLA 2HZDA 2MA3A 4LIVA 3RTRA 3KETA 2NAZA 3OWTA 3GTLJ 1I1GA 4KT5C 4KT6A 2DMTA 2ZMEB 1SFOJ 2CYYA 2FQ3A 2WY7Q 1XSXA 2VKDA 4DZJA 5ED4A 3KCCA 5D8LB 1P4WA 3CMYA 1C0WA 4RB1A 2XKOA 4M73A 1WJDA 4BQQA 2I5UA 2HKXA 4CCNA 5HOOA 1VQNI 3MKLA 3L2CA 2AO9A 4AIDA 4D7MA 4UNOA 4XN0A 2DMNA 2PFBA 5FFXA 2JMWA 1G6NA 2EILH 2JSCA 1J7KA 4MGRA 4FQGA 2DPDA 4DJAA 3AKZA 4MQVA 2XF7A 4IF4A 3A01B 3BQZA 3JTGA 1U9OA 2NYXA 3V8JA 4XLCA 2HFHA 4I0BA 1JTXA 2EB7A 3DQVC 2FRHA 5DD8A 1AHDP 2DK8A 3HL2A 5H6QA 1W5TA 1QNTA 3C18A 2O6GE 3O8HA 1V54H 3FZVA 2L5QA 1ZRFA 2XVCA 4KNYA 3I5UA 3S16J 4IRHA 1OCTC 1JHHA 4J19A 4KMUX 1XGSA 1DDNA 2K86A 1FLIA 2PG4A 1KU9A 3E5XA 1EF4A 2EIMH 1LQ1A 1MW7A 2QUFA 2EZKA 5C44J 4UUVA 1I50J 2FE3A 2K9NA 4NC7A 3N4MA 3CJRB 3PQKA 1JUMA 4F3QA 2K7LA 2AXLA 4JQFA 4HLXA 2QYOA 1AWCA 2OAZA 4MTEA 4UXNA 5J40A 2E5NA 4S04A 5LFAA 4BE0A 1WVRA 2E34A 2K9LA 1ETOA 1LDDA 2B9SA 1PP7U 5F04A 1FEXA 1TP4A 3FBIB 3M4OJ 5KNLA 2WAQA 5FKNA 4EVIA 1F43A 4A93J 4Q5SF 4U7BA 4HYEA 3OS0A 3DLLF 3KIOA 4HA8A 4RGSA 2STWA 4GXOA 2BY2A 3F8BA 5EEGA 5K7FA 3ML6A 1HQCA 3RPUA 2DTRA 3DXJF 2KLOA 4ZZLA 1DUXC 1QPMA 1FOWA 1HSTA 2CU7A 4XICA 4MNUA 2F2EA 2DLLA 3KZYA 4EJVA 2DYSH 1MMGA 2EFOA 2HYFA 3QQAA 1YHQI 4A3IJ 3I64A 4RDUA 2DA1A 4BJTA 2JRTA 1GXPA 2Z3YA 1YTYA 1IV8A 5LRSA 3I53A 4LLGF 1MBFA 2L02A 2HYJA 3GX4X 1IF1A 4IHWA 2IT0A 1OJLA 3AG4H 3CMEI 3HBLA 2BY3A 3RKQA 3R6SA 2RGVA 3S17J 3E5QA 3K1PA 4RAGA 4A12A 1S7OA 4AIHA 2V9VA 1D5YA 5A2QZ 4OINF 3SHFA 1O4XA 2LY9A 1MNEA 2XGDA 2ZC2A 3IC7A 5AIQA 2VJ4A 2HTSA 3VSLA 2BXYA 4ZYAA 2X0LA 4HX4A 1GVDA 1O3QA 1ULYA 1IXRC 4Y15A 3NAUA 2GXGA 2VT3A 2DMUA 3OYFA 3IH3A 3UR3C 1OCRH 4X0GA 1HA8A 2UUZA 2MD5A 2LC2A 1B1BA 3PFIA 5HS9A 1B8IA 2IS1A 2IEKA 3FXOA 4L9TA 2QSFX 4XOPA 1VQKI 3CJNA 3DLAA 4EM2A 4QWQA 3KZIC 3UNGC 3HOXJ 4KN4X 2KIFA 1SFEA 1OCOH 3E3VA 2XAFA 4G7HF 2R7DA 2PMZN 3WHCA 1YO5C 3D0SA 2FOWA 4A2UA 3ZQFA 3FXQA 2P5KA 4L5JA 4MHGA 2FX0A 3EETA 4CXFA 3LFUA 1IN6A 2P81A 4BQAA 1S7AA 3RKYA 3FXKA 4XSXF 5HDGA 5F64A 2P5LC 2VIXA 2GXAA 4OOIA 1IRFA 3CUQC 4HV5A 2L9NA 5IP7J 3WGIA 5M5YJ 3CCEI 3FXJA 1TZLA 2L7MP 1UB9A 3H3UA 4XR6A 3H0DA 2KMUA 3SQNA 1QZYA 3QP6A 2DA6A 4ASNA 4DYQA 4UVCA 1HF0A 3M07A 3FM3A 3R61A 1P7JA 1PYVA 2DOAA 1TLHB 4R1HA 1X4PA 1K78A 3JCUC 2CS3A 3W2VA 4KMFA 4WK8F 4HDVA 1ZARA 1TL8A 1JKPC 4V2GA 5JI6A 1FTTA 2P4WA 1S72I 2VOOA 4UVBA 4XKCA 3H1CA 1A6QA 4JX5A 4HQEA 1MMSA 3DEUA 4LLLA 2QKLB 3F23A 2DQRA 2DMQA 2ISYA 1YS7A 2R7WA 4P9UA 3ZMDA 1IRZA 4BAYA 3CQZJ 3V42A 2YUSA 1BOAA 4CH7A 5J1RA 4XLFA 4IRIA 5CQEA 2F4IA 4RAZA 3TW7A 4UUSA 1TWGJ 4C2TA 3HOZJ 1SMYF 1MIJA 4XRSA 2JPBA 4LK1F 2KQRA 4IPAA 5IPAA 3ABLH 2H1KA 3MKWB 1PVEA 4JP0A 4MTDA 5M3FJ 2AQEA 2MG4A 3A0BC 2IW5A 3E5UA 1SMTA 5CQGA 2LKXA 1TQIA 3FKIJ 2WBMA 1AA7A 3ABUA 1MBKA 5ICFA 2GZWA 4IKFA 3KLOA 4HX7A 1W1WE 1MNMC 5FLXK 4FCYA 2DT5A 2LKSA 3TP3A 2BVLA 3EUHC 3K4CA 3KP4A 2WB1A 3FWEA 1ZG3A 2HOSA 5L3CA 1FOYA 3F0CA 4CGZA 4PSXA 3JRAA 2TDXA 3ASOH 4LG0A 3HUGB 4HW0A 2ISZA 2P7VB 2YU3A 2JN6A 2ZB9A 1HKTA 1N25A 3M8EA 5EJCA 3TMOA 3ULQB 2DPUA 2R7QA 3CDIA 3WTWC 5HLTA 3HHHA 5D6FA 1VQOI 2E1MB 3OV8A 1RIOH 4XLPF 4D5FA 3FBNB 2KRCA 3ZQCA 1AU7A 4O6JA 1G3YA 3TBIA 1O57A 1FNNA 1DGRM 4G7ZF 1T0FA 2BHZA 3P7NA 1R5GA 4XMYA 2VXZA 4ZJZA 5FLVA 4PGGA 3BG5A 1I1SA 3BWGA 2IA1A 1WHUA 2P6SA 3FHNA 2E19A 4G6TB 2LRDA 3M3YJ 1E3PA 3F72A 4FE7A 4EJOA 2O9LA 4M71A 2QBYA 1UG2A 5IT9Z 1LEAA 2XROA 4JOMA 3QYEA 4ZTFA 2O3FA 2E2IJ 4ZDLA 2W1OA 2IGKA 5LEKA 1DP3A 1F1ZA 1OPCA 1LKXA 2G9WA 3HGGA 2IAIA 2AQFA 1YI2I 1XN7A 1K6OA 1MBJA 2EZHA 1R71A 3G3ZA 4UHTA 1VQLI 2VBWA 3V7RA 4M6YA 1CF7A 4N4OB 1LFPA 2EFQA 1R36A 2KISA 2OBPA 4PGHA 1F5TA 1PP8F 4M6VA 1YRNA 2OQGA 3GVAA 3GO5A 2CUFA 1ZQ3P 1YLFA 3DBLB 3PJRA 1K83J 1DU0A 2PJPA 3OR2C 3CCUI 1W4MA 4NC6A 1UHSA 1H88C 1REPC 2MC3A 1G3TA 1UG0A 4EJUA 3IKVA 1E3OC 5HDNA 4A3BJ 3A2KA 3S3NA 3U1DA 3ZMUA 1MJAA 3S2DJ 4ZH4F 1K6YA 3E6BA 3HIFA 5E18F 1R5HA 3RQIA 5A2QK 1X1BA 3WG7H 5EF6A 2ZNYA 3BTLA 2K3PA 2A6HF 2ZMEA 1U8RA 3MKZA 5L3BA 1RRJA 2K5CA 3FM5A 4HAMA 3V4GA 1CQTA 2IGOA 2ZBKA 3ABMH 1OYYA 5BOXA 2VODA 2R7FA 3J80Z 2NXNB 1HLVA 2OCEA 2OUMA 2K4JA 5J4YA 3ZQ7A 1WPKA 4XORA 2IVMA 2VUMJ 4ENJA 1MMAA 2A5WA 3WHBA 3L9FA 2DFFA 3KPHA 4XL9A 4H0EA 3A4CA 4LGWA 4Q47A 3HRSA 4AYBA 3LAJA 3DF8A 4M72A 4B3XA 1TWHJ 2DJNA 4YFNF 3G6EI 2X6YA 3SXYA 3I59A 3S32A 3CO7C 1EH7A 5H6RA 2JWTA 1B8IB 2JVHA 1K4SA 3JREA 1R1UA 3CCYA 3J7ZI 2GA2A 3ZMTA 1T8IA 5HDKA 2V6EA 5JR3A 3HG9A 2WAFA 2L9VA 4NC8A 3TO6A 4WXHA 1XS9A 4M6XA 1BR4A 3CP8A 4RA2A 1A6IA 4LB6B 1APLC 3IL2A 3KEQA 3HSFA 3K2ZA 3GFLA 3GYHX 3B6CA 2UXNA 2ZNZA 3S93A 1JT0A 3HPGA 3KFWX 4PDKA 1J59A 5GADJ 2ESHA 1S6LA 2M7AA 1BW6A 3E0JB 1GDTA 1B9MA 5KK1A 2JA8J 4A0XA 2FOKA 1QVTA 4RS8A 2LVSA 2BY1A 3C2HA 3O6BB 1D3YA 1DQUA 2BVMA 1U5TA 2OV7A 1ZH5A 3OOPA 2A3SA 1HW2A 4HQMA 1P2FA 2JVGA 3K4NA 5H20A 3E6MA 2JUCA 3BDDA 3GWZA 4IOCF 4RB0A 4E7LA 3AFHA 4M3BA 2RDPA 4KISA 2DTZA 4GRIA 1K78B 1A31A 3TO7A 2WA0A 2EA2A 3KE2A 3ZMSA 4YFKF 1SD4A 4BNCA 1XMXA 4MFDA 3HDDA 1R7JA 2EPFA 3CF5F 4WXCA 1P4XA 4OAYA 1W5SA 3LSIA 1R58A 1ON1A 3U9GA 1FBUA 5CKTA 4I0AA 1QU3A 1XSDA 2OZ6A 4RB2C 5JHUA 5LHIA 2M3AA 3W6KB 3COAC 1MMDA 3FF5A 1WJEA 3EDPA 5GAHJ 4I98B 1I39A 3OYMA 4G7OF 3TEDA 1FBQA 2VQGA 4N9IA 2L9RA 2QENA 1X2MA 1BA5A 5B3SH 2YS9A 3LQRA 2KPMA 2UV1A 2K4BA 3AL0B 1FMVA 3K4MA 2ZJ2A 3LL7A 3PUBA 4X1EA 1MDMA 3HPHA 1D5VA 2WC2A 4P55A 4DNCA 3JRHA 2R7SA 3OYAA 1ENHA 3TO9A 4IL6C 1TT0A 3ZN1A 4LG0B 1UZCA 3C7JA 1XPXA 4BY7J 2Y75A 2YPRA 3BR3A 5JLXA 4L9JA 2M4GA 5K1YA 1EV7A 3M7GA 2A07F 1BI0A 2QQ8A 3VDXA 1SAUA 5CVJA 2D45A 2GWRA 3I71A 3TOBA 1I3QJ 4BACA 3I56I 2E1NA 4HNTA 2V6CA 3HOWJ 3T8TA 4KIGA 1FIPA 1NK3P 3BZKA 2F4MB 2FQ4A 1QBJA 4F52A 2P5VA 2Y0SA 2IJLA 1SD7A 2DI3A 1MSEC 5FFZA 1G59A 2Y69H 1FY7A 3GFIA 3LA7A 1XDUA 1YG2A 3H5RA 1JKOC 1HOMA 3DKXA 3IRRA 3CD6I 1ERDA 3L2UA 4OU0A 2OU2A 3L2RA 3LSTA 4PJJA 4XK4A 1SFKA 3L00A 3CMAI 4HSTA 1OKRA 4ESJA 3K4BA 4HG2A 2RAEA 1ETWA 1U78A 4B8XA 3EYYA 2OTLI 4L0ZB 4J01A 1ON2A 3QAHA 2LFBA 1LPQA 1UHWA 1FBSA 4A5MA 2K27A 2JUGA 4W97A 1NG6A 3S2WA 1FYKA 1JHFA 2VL8A 4L9NA 2KJBA 1JGSA 1Z3YA 2EFNA 4ZYGA 4A6DA 3CCJI 4XLNF 1CF7B 1VQ8I 1ZRDA 5BQTA 3BY6A 3S1MJ 1KQ9A 2JTVA 3ZR8X 4NUBA 2Q2EA 1YRNB 3BJAA 3FXUA 3BQYA 2FBIA 4XQFA 4OMZA 2YR2A 1F9NA 3EPZA 5DYMA 1ETXA 1IN5A 3WE3A 2BGCA 3BR1A 2ZFWA 5J1UA 1KU3A 1R1TA 4XN3A 3O2PE 2HS5A 1V3FA 2W82A 5TISC 2Q1ZB 2VJ5A 2E7WA 3DTEA 4KN7X 2M5WA 1QPIA 1XMKA 1FJLA 5DUKA 4QPQA 2F4OB 4JK1X 1D1BA 2R7RA 1RR8C 4B4CA 1T6SA 3ZMZA 4XNFA 1T95A 5HS8A 1YFHA 4JX6A 1EJ9A 3S1NJ 2OJED 3DV8A 1IDZA 2BHYA 5GP9A 4ZYEA 1U2WA 2NVQJ 1X1DA 3HJEA 5LEJA 2KIUA 4EQQA 2XASA 2A68F 5E8IA 3IV5A 5AIPA 5JHFA 4HRIA 3WTVC 2M9HA 1RKWA 3QRFF 2DFHA 3HUGA 2H09A 3IWZA 1IGNA 2OTJI 4DOZA 2DOFA 1LDJA 5FLXZ 1OR7C 5DM6F 3RDIA 1RUOA 3BPXA 3G1LA 3HEFA 3I59B 3KZZA 2E71A 2IS4A 1LDKB 5FO5A 3W6VA 3GLLA 1SAXA 3JW4A 1ONVA 2O8KA 3CESA 1RESA 1RUNA 4AD9A 3LAPA 2LMDA 1AKHB 1TW3A 1MJBA 3BG9A 5E3LA 1LE8A 5EG0A 1YQAA 2NS0A 2JJ7A 3BTCA 3ABKH 2KIQA 3VB2A 2VC1A 1P92A 5BMZA 5L3DA 1KA8A 4Y4RA 4Y13A 4ZC3A 4UV8A 4FTHA 2O61A 4N4NB 3S8PA 2DU9A 2MW8A 2EFPA 3VYTB 2CUEA 4YIFA 1XCVA 4ON0A 2VKEA 2CUZA 2QGUA 3ZQLA 1HKSA 5D6EA 2ADUA 1U5TB 4L18B 1WQ2A 2BYVE 2PMZA 3MEXA 2CV0A 3NEUA
chains in the Genus database with same CATH topology
2LK2A 1IRZA 4V2FA 2ECCA 3CQZJ 2HI3A 1QRYA 5IP9J 2YUSA 5K7ZA 5J1RA 1BW5A 5J3LA 1ITYA 5F1JA 1IC8A 2M2EA 3TW7A 4UUSA 1TWGJ 2X48A 1P7IA 3HOZJ 2R5ZB 2JA5J 4XRSA 3PM1A 2Y31A 2DA3A 3FISA 5IPAA 3S2HJ 3MVPA 3A01A 1ZR4A 2H1KA 5EZHA 2XGCA 5M3FJ 4JP0A 3SFIA 2MG4A 1GV5A 3IH2A 2LKXA 3FKIJ 4C3JJ 1MBKA 5F0FA 5IOYA 4X6AJ 3DEWA 3BR0A 1MNMC 4W1UA 4FCYA 3TP3A 2LD5A 3BG3A 4M3GA 1TWCJ 4BXXJ 2HOSA 4I6ZA 3F0CA 1MBHA 3O8GA 3JRAA 3LSPA 2R5YB 2DA5A 4A3MJ 3HOVJ 5E3NA 1IDYA 2QCOA 5F27A 1HDDC 1JT6A 1I6HJ 2JN6A 2ZB9A 3OSFA 5E3MA 2TRTA 3Q0UA 4QIWN 1HCRA 3G1OA 4A3GJ 2ME6A 5HODA 3TP0A 3GTGJ 3HB9A 4D5FA 5FJ8J 1JUSA 3ZQCA 1AU7A 2GLOA 1MH4A 2GM4A 2HDDA 3MN2A 4FE4A 5K7HA 3L1PA 1ETYA 2XB5A 5FLVA 3BG5A 3GTPJ 3IH4A 4QTRA 3HOYJ 2X9DA 3S14J 2E19A 3M3YJ 3GTOJ 5E3OA 2O9LA 4FE7A 1S7EA 2IBDA 3I4MJ 5M3MJ 5C4JJ 1UG2A 2LTPA 4QSHA 4DZPA 2E2IJ 1MBGA 2AHQA 3JRIA 3HGGA 2NVXJ 1XC5A 2IAIA 4NDLA 1ZGWA 5FKKA 3PO2J 1MBJA 2EZHA 2L7ZA 4BKXA 1VI0A 1WI3A 3ZOBA 2JA6J 2K9QA 1ZR2A 2HXOA 3JRGA 3QPSA 5EZGA 2Y0SN 3HGYA 3LSGA 2W48A 2OPTA 4FISA 4UUSB 1RETA 1Y1VJ 4UUTA 4XRSG 5C3EJ 2TCTA 2DA2A 4M6VA 1YRNA 1RR7A 3B6AA 2CUFA 4AYBN 1ZQ3P 1BJZA 3G1MA 1K83J 2WAQN 1DU0A 2B63J 2L0KA 1UHSA 1H88C 1JJ8C 2I10A 1MBEA 1E3OC 4A3BJ 4G12A 2VI6A 3S2DJ 1W0UA 1PUFA 1T33A 3RQIA 4C2MJ 5EF6A 4GFBA 2HXIA 2K9SA 3BTLA 3SJMA 1OFCX 3HOUJ 9ANTA 5FLMJ 1CQTA 3GTQJ 4M3FA 1VFCA 1U9NA 2DN0A 5EGOB 2EQRA 1HLVA 2HOAA 1BL0A 3LSJA 4BY1J 3K7AJ 3GTKJ 1WPKA 2VUMJ 2CRGA 2NS8A 4A69C 1H89C 3WHBA 2VPRA 2WV1A 3CDLA 2G0EA 3S15J 1IG7A 2D5VA 3I4NJ 1FIAA 1R9TJ 5F08A 2R0QC 4JX4A 1TWHJ 2DJNA 2M34A 1SANA 1G2HA 1DU6A 2JWTA 1B8IB 1ZK8A 2DMPA 3JREA 3CCYA 4CYCA 1WH7A 2M0CA 3K2AA 4HNVA 1VF9A 2ID6A 1W0TA 3BR6A 2ID3A 1XS9A 2H8RA 2EH3A 1FTZA 3PO3J 1A6IA 1APLC 1IUFA 3RZOJ 2ECBA 3B6CA 3OIOA 2XPVA 2N8GA 5FKMA 5IYCJ 1JT0A 2JA7J 4DYCA 4Y7NJ 4A3FJ 1X2NA 1BW6A 1ORKA 3SDGA 1WCMJ 3BR2A 1GDTA 2COBA 3LSRA 2JA8J 4RBOA 3S1RJ 1QVTA 2LVSA 2EZLA 1VNDA 1Y1WJ 5EG0B 3ZQIA 1LE8B 3DCFA 1GT0C 1RKTA 5M5XJ 1JGGA 1A5JA 5EEAA 2DA4A 3GBGA 4MIMA 1WH5A 4B1RA 4M3BA 5BNGA 2DTZA 3GTLJ 2DMTA 1SFOJ 2R5ZA 4DZJA 1RPWA 1JKRC 3CMYA 1B72B 2XPWA 2EBIA 2FD5A 1ETVA 2VKVA 4MFDA 3HDDA 1ZTRA 3HM5A 2CQXA 2OF7A 4AC0A 3D1NI 3MKLA 2AO9A 4MFEA 4D7NA 4D7MA 3ZQGA 1U8BA 2O7OA 2DA7A 4B3AA 2DMNA 3JR9A 2JMWA 1ETQA 4IHVA 2R5YA 4LOCA 3TEDA 2QF7A 1OCPA 2L9RA 1TWFJ 3H3VK 1WGXA 3A03A 3A01B 3BQZA 1BA5A 1X2MA 1U9OA 2YS9A 2E2HJ 3GTMJ 1JTXA 4Y52J 4X1EA 3FK7A 1H8AC 1AHDP 3UKGA 3QPLA 3JRHA 4MLOA 1LFBA 1ENHA 4AUXA 3O8HA 2MSYA 3LNQA 3S16J 1OCTC 4J19A 4BY7J 3BR3A 5JLXA 4A3LJ 2YU9J 1EF4A 2Y9ZA 2EZKA 1I3QJ 5C44J 3BTJA 1I50J 2EZIA 2K9NA 3HOWJ 1JUMA 4IEJA 1FIPA 2NOGA 1NK3P 1QVUA 4M3DA 2FQ4A 3Q3SA 2KDZA 2LR8A 2Y30A 2NVYJ 1MSEC 4C3IJ 1JTYA 2L7FP 3GTJJ 1ETOA 3JRCA 1JKOC 5FKOA 5F04A 1FEXA 5F0CA 1HOMA 3M4OJ 4IHYA 4EEFG 5FKNA 1Z0XA 1F43A 1JUPA 4ABZA 4A93J 3HKZN 3BTIA 2X6OA 4XK4A 5C4XJ 4XIDA 3Q0VA 1XG1A 1Z77A 5K7FA 2Y2ZA 5M5WJ 3FK6A 1F36A 1U78A 2RAEA 1ETWA 2CU7A 4S0HB 4XICA 3RZDJ 1AKHA 2LFBA 1TC3C 5EDNA 3QQAA 4W97A 2XB0X 4I76A 3E7LA 3OOUA 4A3IJ 4RDUA 4IHXA 2DA1A 4MO7A 2R92J 1ZKGA 2NVTJ 1MBFA 2M8GX 2HYJA 3C2BA 3VPRA 5F0HA 4IHWA 3S1MJ 1OJLA 4XRMA 1YRNB 3H0GJ 3BQYA 3BR5A 2LLKA 3HBLA 3JRDA 3RKQA 4M3EA 1X58A 3S17J 1ETXA 5EGOA 1D5YA 3BR1A 1O4XA 2LY9A 5J1UA 2XGDA 1PUFB 1LFUP 5J1YA 4JYKA 2E2JJ 2KT0A 2XRLA 1QPIA 1ETKA 2E1OA 2ELKA 1FJLA 1GVDA 2CQQA 4BBSJ 3FIWA 4D5CA 3LOCA 4A3EJ 3NAUA 4B4CA 2DMUA 2HQ5A 3IH3A 4C3HJ 4JX6A 3S1NJ 1IDZA 5GP9A 1B8IA 2NVQJ 3BT9A 2GBYA 4DYRA 1GV2A 2IEKA 1NTCA 5DS9A 2LP0A 1IV6A 3IV5A 5EYRA 2XSDC 1HDPA 2M9HA 3ZQHA 1RKWA 3HOXJ 4A3DJ 1IGNA 2XPUA 3WHCA 2PMZN 2K40A 5GPCA 3G1LA 3HEFA 3ZQFA 1JKQC 3W6VA 2FX0A 1IJWC 4A3JJ 1NK2P 2P81A 2CJJA 4CYCB 2O8KA 4A3CJ 3Q0WA 3TW6A 1UMQA 1RESA 3JRBA 1AKHB 5IOZA 1Q1VA 5IP7J 2NS7A 5M5YJ 3BG9A 4L5EA 2XGEA 5E3LA 5IP6A 5EG0A 1LE8A 2JJ7A 3BTCA 3NARA 2L7MP 3OSGA 2HOTA 2R93J 1TWAJ 5GPAA 1T56A 5JLWA 2DA6A 4DYQA 2FJ1A 1HF0A 1JJ6C 2ME0A 1P7JA 2WB1N 1GUUA 2Y9YA 4FTHA 1POGA 2MW8A 3S1QJ 3JRFA 2CUEA 4A3KJ 5IYDJ 1JKPC 2VKEA 4V2GA 5DTDA 5FKLA 4BBRJ 2R7ZJ 1FTTA 3ZQLA 1B72A 2JK3A 3A02A 1MH3A 2MGQA 1MSFC 4JX5A 1K61A 4DW6A 5IYBJ 2DMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LK2 A;  1IRZ A;  4V2F A;  2ECC A;  3CQZ J;  2HI3 A;  1QRY A;  5IP9 J;  2YUS A;  5K7Z A;  5J1R A;  1BW5 A;  5J3L A;  1ITY A;  5F1J A;  1IC8 A;  2M2E A;  3TW7 A;  4UUS A;  1TWG J;  2X48 A;  1P7I A;  3HOZ J;  2R5Z B;  2JA5 J;  4XRS A;  3PM1 A;  2Y31 A;  2DA3 A;  3FIS A;  5IPA A;  3S2H J;  3MVP A;  3A01 A;  1ZR4 A;  2H1K A;  5EZH A;  2XGC A;  5M3F J;  4JP0 A;  3SFI A;  2MG4 A;  1GV5 A;  3IH2 A;  2LKX A;  3FKI J;  4C3J J;  1MBK A;  5F0F A;  5IOY A;  4X6A J;  3DEW A;  3BR0 A;  1MNM C;  4W1U A;  4FCY A;  3TP3 A;  2LD5 A;  3BG3 A;  4M3G A;  1TWC J;  4BXX J;  2HOS A;  4I6Z A;  3F0C A;  1MBH A;  3O8G A;  3JRA A;  3LSP A;  2R5Y B;  2DA5 A;  4A3M J;  3HOV J;  5E3N A;  1IDY A;  2QCO A;  5F27 A;  1HDD C;  1JT6 A;  1I6H J;  2JN6 A;  2ZB9 A;  3OSF A;  5E3M A;  2TRT A;  3Q0U A;  4QIW N;  1HCR A;  3G1O A;  4A3G J;  2ME6 A;  5HOD A;  3TP0 A;  3GTG J;  3HB9 A;  4D5F A;  5FJ8 J;  1JUS A;  3ZQC A;  1AU7 A;  2GLO A;  1MH4 A;  2GM4 A;  2HDD A;  3MN2 A;  4FE4 A;  5K7H A;  3L1P A;  1ETY A;  2XB5 A;  5FLV A;  3BG5 A;  3GTP J;  3IH4 A;  4QTR A;  3HOY J;  2X9D A;  3S14 J;  2E19 A;  3M3Y J;  3GTO J;  5E3O A;  2O9L A;  4FE7 A;  1S7E A;  2IBD A;  3I4M J;  5M3M J;  5C4J J;  1UG2 A;  2LTP A;  4QSH A;  4DZP A;  2E2I J;  1MBG A;  2AHQ A;  3JRI A;  3HGG A;  2NVX J;  1XC5 A;  2IAI A;  4NDL A;  1ZGW A;  5FKK A;  3PO2 J;  1MBJ A;  2EZH A;  2L7Z A;  4BKX A;  1VI0 A;  1WI3 A;  3ZOB A;  2JA6 J;  2K9Q A;  1ZR2 A;  2HXO A;  3JRG A;  3QPS A;  5EZG A;  2Y0S N;  3HGY A;  3LSG A;  2W48 A;  2OPT A;  4FIS A;  4UUS B;  1RET A;  1Y1V J;  4UUT A;  4XRS G;  5C3E J;  2TCT A;  2DA2 A;  4M6V A;  1YRN A;  1RR7 A;  3B6A A;  2CUF A;  4AYB N;  1ZQ3 P;  1BJZ A;  3G1M A;  1K83 J;  2WAQ N;  1DU0 A;  2B63 J;  2L0K A;  1UHS A;  1H88 C;  1JJ8 C;  2I10 A;  1MBE A;  1E3O C;  4A3B J;  4G12 A;  2VI6 A;  3S2D J;  1W0U A;  1PUF A;  1T33 A;  3RQI A;  4C2M J;  5EF6 A;  4GFB A;  2HXI A;  2K9S A;  3BTL A;  3SJM A;  1OFC X;  3HOU J;  9ANT A;  5FLM J;  1CQT A;  3GTQ J;  4M3F A;  1VFC A;  1U9N A;  2DN0 A;  5EGO B;  2EQR A;  1HLV A;  2HOA A;  1BL0 A;  3LSJ A;  4BY1 J;  3K7A J;  3GTK J;  1WPK A;  2VUM J;  2CRG A;  2NS8 A;  4A69 C;  1H89 C;  3WHB A;  2VPR A;  2WV1 A;  3CDL A;  2G0E A;  3S15 J;  1IG7 A;  2D5V A;  3I4N J;  1FIA A;  1R9T J;  5F08 A;  2R0Q C;  4JX4 A;  1TWH J;  2DJN A;  2M34 A;  1SAN A;  1G2H A;  1DU6 A;  2JWT A;  1B8I B;  1ZK8 A;  2DMP A;  3JRE A;  3CCY A;  4CYC A;  1WH7 A;  2M0C A;  3K2A A;  4HNV A;  1VF9 A;  2ID6 A;  1W0T A;  3BR6 A;  2ID3 A;  1XS9 A;  2H8R A;  2EH3 A;  1FTZ A;  3PO3 J;  1A6I A;  1APL C;  1IUF A;  3RZO J;  2ECB A;  3B6C A;  3OIO A;  2XPV A;  2N8G A;  5FKM A;  5IYC J;  1JT0 A;  2JA7 J;  4DYC A;  4Y7N J;  4A3F J;  1X2N A;  1BW6 A;  1ORK A;  3SDG A;  1WCM J;  3BR2 A;  1GDT A;  2COB A;  3LSR A;  2JA8 J;  4RBO A;  3S1R J;  1QVT A;  2LVS A;  2EZL A;  1VND A;  1Y1W J;  5EG0 B;  3ZQI A;  1LE8 B;  3DCF A;  1GT0 C;  1RKT A;  5M5X J;  1JGG A;  1A5J A;  5EEA A;  2DA4 A;  3GBG A;  4MIM A;  1WH5 A;  4B1R A;  4M3B A;  5BNG A;  2DTZ A;  3GTL J;  2DMT A;  1SFO J;  2R5Z A;  4DZJ A;  1RPW A;  1JKR C;  3CMY A;  1B72 B;  2XPW A;  2EBI A;  2FD5 A;  1ETV A;  2VKV A;  4MFD A;  3HDD A;  1ZTR A;  3HM5 A;  2CQX A;  2OF7 A;  4AC0 A;  3D1N I;  3MKL A;  2AO9 A;  4MFE A;  4D7N A;  4D7M A;  3ZQG A;  1U8B A;  2O7O A;  2DA7 A;  4B3A A;  2DMN A;  3JR9 A;  2JMW A;  1ETQ A;  4IHV A;  2R5Y A;  4LOC A;  3TED A;  2QF7 A;  1OCP A;  2L9R A;  1TWF J;  3H3V K;  1WGX A;  3A03 A;  3A01 B;  3BQZ A;  1BA5 A;  1X2M A;  1U9O A;  2YS9 A;  2E2H J;  3GTM J;  1JTX A;  4Y52 J;  4X1E A;  3FK7 A;  1H8A C;  1AHD P;  3UKG A;  3QPL A;  3JRH A;  4MLO A;  1LFB A;  1ENH A;  4AUX A;  3O8H A;  2MSY A;  3LNQ A;  3S16 J;  1OCT C;  4J19 A;  4BY7 J;  3BR3 A;  5JLX A;  4A3L J;  2YU9 J;  1EF4 A;  2Y9Z A;  2EZK A;  1I3Q J;  5C44 J;  3BTJ A;  1I50 J;  2EZI A;  2K9N A;  3HOW J;  1JUM A;  4IEJ A;  1FIP A;  2NOG A;  1NK3 P;  1QVU A;  4M3D A;  2FQ4 A;  3Q3S A;  2KDZ A;  2LR8 A;  2Y30 A;  2NVY J;  1MSE C;  4C3I J;  1JTY A;  2L7F P;  3GTJ J;  1ETO A;  3JRC A;  1JKO C;  5FKO A;  5F04 A;  1FEX A;  5F0C A;  1HOM A;  3M4O J;  4IHY A;  4EEF G;  5FKN A;  1Z0X A;  1F43 A;  1JUP A;  4ABZ A;  4A93 J;  3HKZ N;  3BTI A;  2X6O A;  4XK4 A;  5C4X J;  4XID A;  3Q0V A;  1XG1 A;  1Z77 A;  5K7F A;  2Y2Z A;  5M5W J;  3FK6 A;  1F36 A;  1U78 A;  2RAE A;  1ETW A;  2CU7 A;  4S0H B;  4XIC A;  3RZD J;  1AKH A;  2LFB A;  1TC3 C;  5EDN A;  3QQA A;  4W97 A;  2XB0 X;  4I76 A;  3E7L A;  3OOU A;  4A3I J;  4RDU A;  4IHX A;  2DA1 A;  4MO7 A;  2R92 J;  1ZKG A;  2NVT J;  1MBF A;  2M8G X;  2HYJ A;  3C2B A;  3VPR A;  5F0H A;  4IHW A;  3S1M J;  1OJL A;  4XRM A;  1YRN B;  3H0G J;  3BQY A;  3BR5 A;  2LLK A;  3HBL A;  3JRD A;  3RKQ A;  4M3E A;  1X58 A;  3S17 J;  1ETX A;  5EGO A;  1D5Y A;  3BR1 A;  1O4X A;  2LY9 A;  5J1U A;  2XGD A;  1PUF B;  1LFU P;  5J1Y A;  4JYK A;  2E2J J;  2KT0 A;  2XRL A;  1QPI A;  1ETK A;  2E1O A;  2ELK A;  1FJL A;  1GVD A;  2CQQ A;  4BBS J;  3FIW A;  4D5C A;  3LOC A;  4A3E J;  3NAU A;  4B4C A;  2DMU A;  2HQ5 A;  3IH3 A;  4C3H J;  4JX6 A;  3S1N J;  1IDZ A;  5GP9 A;  1B8I A;  2NVQ J;  3BT9 A;  2GBY A;  4DYR A;  1GV2 A;  2IEK A;  1NTC A;  5DS9 A;  2LP0 A;  1IV6 A;  3IV5 A;  5EYR A;  2XSD C;  1HDP A;  2M9H A;  3ZQH A;  1RKW A;  3HOX J;  4A3D J;  1IGN A;  2XPU A;  3WHC A;  2PMZ N;  2K40 A;  5GPC A;  3G1L A;  3HEF A;  3ZQF A;  1JKQ C;  3W6V A;  2FX0 A;  1IJW C;  4A3J J;  1NK2 P;  2P81 A;  2CJJ A;  4CYC B;  2O8K A;  4A3C J;  3Q0W A;  3TW6 A;  1UMQ A;  1RES A;  3JRB A;  1AKH B;  5IOZ A;  1Q1V A;  5IP7 J;  2NS7 A;  5M5Y J;  3BG9 A;  4L5E A;  2XGE A;  5E3L A;  5IP6 A;  5EG0 A;  1LE8 A;  2JJ7 A;  3BTC A;  3NAR A;  2L7M P;  3OSG A;  2HOT A;  2R93 J;  1TWA J;  5GPA A;  1T56 A;  5JLW A;  2DA6 A;  4DYQ A;  2FJ1 A;  1HF0 A;  1JJ6 C;  2ME0 A;  1P7J A;  2WB1 N;  1GUU A;  2Y9Y A;  4FTH A;  1POG A;  2MW8 A;  3S1Q J;  3JRF A;  2CUE A;  4A3K J;  5IYD J;  1JKP C;  2VKE A;  4V2G A;  5DTD A;  5FKL A;  4BBR J;  2R7Z J;  1FTT A;  3ZQL A;  1B72 A;  2JK3 A;  3A02 A;  1MH3 A;  2MGQ A;  1MSF C;  4JX5 A;  1K61 A;  4DW6 A;  5IYB J;  2DMQ A; 
#chains in the Genus database with same CATH topology
 5LGT A;  2LK2 A;  2X1E A;  1MND A;  2ECC A;  2Q8K A;  2QZ8 A;  1BW5 A;  2L4M A;  1Z67 A;  3TL4 X;  4IXA A;  3TDU C;  5F1J A;  2QSH X;  3GUD A;  2DT6 A;  4BQO A;  2CSO A;  2V1X A;  1LB2 A;  1IRX A;  3KP2 A;  1RI7 A;  2Y31 A;  2Z9O A;  3BCA A;  4ETS A;  1ZR4 A;  1HBX G;  3VYS B;  3SFI A;  2LOO A;  4EGY A;  4XBF A;  3NWT A;  4IOA F;  2VPL A;  2VB6 A;  1TNT A;  5F0F A;  1Z05 A;  5IOY A;  3AAF A;  3ZQQ A;  5TJJ A;  2IA0 A;  2DCE A;  2O03 A;  3SDB A;  2GAU A;  2EJR A;  4AVP A;  4I6Z A;  2LBF B;  1TNS A;  4II3 A;  3LSP A;  2V26 A;  5E3N A;  3CJQ B;  5F27 A;  1JT6 A;  1QHH D;  1HW5 A;  1FP1 D;  4BU2 A;  3CUQ A;  2VOP A;  4K2E A;  2VQC A;  2GOM A;  1YS6 A;  3HKZ A;  5HOD A;  1MDM B;  2ZXW H;  2H27 A;  1H9G A;  3GZ5 A;  5FJ8 J;  3F8M A;  4U0V A;  1Y39 A;  2QSG X;  4Z6Y A;  2GLO A;  2ICW G;  1NHA A;  3FX3 A;  4AU7 A;  2HDD A;  3MN2 A;  4BEH A;  1LVK A;  3L1P A;  1USS A;  3RIR A;  3GTP J;  2L3D A;  2UZK A;  4PJN A;  4WWC A;  1PJR A;  4QTR A;  3HOY J;  3S14 J;  2F5C A;  3GTO J;  3S3O A;  2HVS A;  2BEO A;  2IBD A;  1BBY A;  5M3M J;  3E6C C;  1WJ5 A;  5J47 A;  4F55 A;  3DBR B;  1FC3 A;  3ELK A;  2WAD A;  4ZTJ A;  3PIO F;  1BN5 A;  2LH9 A;  4E6K G;  5DM7 F;  1F4K A;  3G2B A;  2EV6 A;  1BI1 A;  2HDC A;  3IP4 B;  1XC5 A;  1YX3 A;  5LHG A;  1L3L A;  5DDG A;  3ZOB A;  4WF2 A;  3I0T A;  1ZR2 A;  2HZT A;  2HXO A;  2DFE A;  2B7E A;  2QQA A;  5EZG A;  5D5X B;  4AVZ A;  1S5L C;  2M7B A;  1O7F A;  2E60 A;  1YYV A;  3DU6 A;  2QVO A;  3K9T A;  2TCT A;  2DA2 A;  3LQQ A;  3FDY A;  4YEL A;  3KP7 A;  1RR7 A;  3HRT A;  3EUH A;  3K6G A;  1BJZ A;  4NQW A;  3G1M A;  4OMY A;  2WAQ N;  1BI3 A;  4B48 A;  4CO8 A;  5DUI A;  2GXB A;  2FNP A;  2I10 A;  3CO6 C;  4ENK A;  3B02 A;  4P9F A;  3DKW A;  3CC2 I;  2VI6 A;  4HDU A;  2CW0 F;  3QU6 A;  3PNY A;  1PUF A;  1ZLJ A;  1R1V A;  3F9K A;  3T5X A;  1B6A A;  4UVA A;  1TQM A;  2F5D A;  4BGD A;  2EV0 A;  4GFB A;  1U0J A;  1Y6I A;  3E6D A;  3TOA A;  2VBY A;  2K85 A;  3J7Y J;  2Q2E B;  4G6D A;  3VSK A;  2VON A;  2KDO A;  2Z99 A;  1FPQ A;  1P4A A;  1HKQ A;  2JRM A;  1IW7 F;  2EQR A;  3BCB A;  2WV0 A;  1WI9 A;  3LSJ A;  3MMY B;  4BY1 J;  3Q9V A;  2KKO A;  4NHJ A;  3WG9 A;  4A69 C;  3TGN A;  1H89 C;  2V9P A;  2HQA A;  1E2X A;  2UXX A;  3G73 A;  2WV1 A;  5TRD A;  2G0E A;  1A35 A;  3EQL F;  1X4O A;  3CCS I;  1R9T J;  2YSR A;  3C1D A;  2V4J C;  2W24 A;  3RKX A;  1T39 A;  1BR2 A;  1A04 A;  1SAN A;  2M34 A;  1XGM A;  1G2H A;  3OYE A;  3Q5F A;  2IRF G;  2V7F A;  1SD5 A;  4G8X A;  1YIT I;  2HNH A;  2KL4 A;  4U88 A;  4HNV A;  1RC9 A;  1VQ6 I;  3BR6 A;  1EKE A;  2ID3 A;  2H8R A;  2EH3 A;  5BPD A;  2DOE A;  2ELJ A;  1KON A;  2DQL A;  3DWL E;  1ZG1 A;  4EM0 B;  3IAM 2;  3NWS A;  4A6E A;  1IUF A;  1EH8 A;  3SFZ A;  1S9H A;  4ZDP A;  4XSZ F;  1V5G A;  2XPV A;  2A5Y B;  1WJC A;  3BZC A;  2CQ7 A;  2XC7 A;  4NNJ A;  4HF2 A;  2P7C B;  4A3F J;  1X2N A;  3J7A O;  3K70 D;  1WCM J;  4MQ9 F;  1IUY A;  2IXS A;  3EUK L;  1YW9 A;  2COB A;  2G7H A;  3BJ6 A;  3LSR A;  2V79 A;  4BE1 A;  1JI8 A;  1M1E B;  3EYI A;  2YX4 A;  2EZL A;  1Y1W J;  1LE8 B;  5EG0 B;  4FHT A;  3JSP A;  4BHC A;  1V4R A;  1GT0 C;  4Y33 A;  2DAO A;  1E0E A;  1HW1 A;  3BZ6 A;  3QWL A;  5M5X J;  5CYV A;  3ERE D;  3CCR I;  1JGG A;  2BE5 F;  4RLQ A;  2PLY A;  4CHU A;  4F91 B;  2H1L A;  3GZ6 A;  1ZLK A;  4B1R A;  3BJO A;  3IAS 2;  3CF2 A;  3E97 A;  4L5I A;  2VLA A;  1R4M B;  4KIF A;  2PI0 A;  2JT1 A;  1V55 H;  1J0R A;  1ETV A;  2FBK A;  2RRE A;  3K70 C;  1ZTR A;  2CQX A;  2G7U A;  2OF7 A;  4AC0 A;  2X1C A;  5K5R A;  4FT8 A;  4CDG A;  3SZT A;  4FX0 A;  2CV2 A;  3ROU A;  1Z21 A;  2VJI A;  3ISP A;  3WOD F;  1U8B A;  1KU2 A;  2DA7 A;  5LGN A;  2DXI A;  4Q48 A;  1ETQ A;  1DP7 P;  4IHV A;  3R0J A;  1Q1H A;  3V8L A;  1MZB A;  2CG4 A;  4RM3 A;  1WRJ A;  2R5Y A;  1O7L A;  3MAJ A;  4LOC A;  1A36 A;  1YIJ I;  3VWB A;  1KU7 A;  1TWF J;  3H3V K;  2F5V A;  3A03 A;  4KJZ A;  4S05 A;  5ICE A;  3BC8 A;  3OYI A;  3BOQ A;  2HU9 A;  3OYH A;  3VOD A;  1VZ0 A;  1T2K A;  4NB5 A;  2MFZ A;  1H8A C;  3UKG A;  1J2X A;  1OMI A;  2ZJP F;  3QPL A;  2LY1 A;  4Y3O A;  4F7Z A;  3OL4 A;  4AUX A;  2RNJ A;  4XOT A;  2X51 A;  2MSY A;  1SEU A;  1CGP A;  3LNQ A;  3V8K A;  3GCM A;  4OAZ A;  1Y8R B;  1S8N A;  2YU9 J;  4A5N A;  2HVQ A;  4II2 A;  3M9A A;  3OYG A;  1YJN I;  3CUQ B;  4KA4 A;  4RM2 A;  3FMR A;  1TQP A;  5IT3 A;  5FGM A;  2GQQ A;  2QQB A;  4B43 A;  4PK4 A;  2KDZ A;  2LR8 A;  3VYU B;  5ICC A;  1X1P A;  1KGS A;  4HNU A;  5IY5 H;  2RQQ A;  1NH3 A;  3PNV A;  4WX9 A;  2LRE A;  5D8K B;  3PQJ A;  4BEH B;  4FX4 A;  2L7F P;  3GTJ J;  2VQH A;  5AON A;  4HEA 2;  5F0C A;  2X1D A;  4IHY A;  4EEF G;  1Z0X A;  2JA2 A;  1JUP A;  4ABZ A;  5FB2 A;  5D5U B;  3CCQ I;  1D8J A;  2X6O A;  5C4X J;  2F5F A;  5K5Q A;  4XID A;  3WTY C;  3Q0V A;  2OC6 A;  2CV1 A;  1ACI A;  2D2W A;  1XG1 A;  2ZSI B;  1Z77 A;  2DFI A;  4B44 A;  2Y2Z A;  5K5O A;  4AIJ A;  3FK6 A;  2GA1 A;  2UWM A;  3M8F A;  3KYL A;  3R4K A;  3RZD J;  3OS1 A;  1AKH A;  1ZRE A;  4L0Y B;  2MAB A;  4HBL A;  3JSO A;  1R00 A;  5EDN A;  2V1N A;  1RNL A;  4I76 A;  4IHX A;  2Q0O A;  3DBH B;  4BE2 A;  2R92 J;  3HXL A;  3ASN H;  4CCM A;  1UEL B;  2XAH A;  2NVT J;  2XDV A;  2MLK A;  5J8F A;  2ZKZ A;  5L3G A;  3VPR A;  5F0H A;  2DBB A;  4KYW A;  2KP6 A;  3JTH A;  3HYI A;  4XRM A;  1NG7 A;  4HX8 A;  4PJM A;  1T38 A;  3JRD A;  4NQW B;  1Z9C A;  4M3E A;  4RGU A;  4XKW A;  2HPM A;  4PJ0 C;  3FXL A;  5FD6 A;  4CZZ A;  3H5N A;  5EGO A;  1IZ1 A;  3PIP F;  1Z1D A;  1BM9 A;  1PUF B;  2MH2 A;  3MZ8 A;  4JYK A;  3V7C A;  2HTJ A;  2E2J J;  2XRL A;  1X3W B;  2RN7 A;  3KYC B;  2CQQ A;  3FIW A;  3NRV A;  3L7W A;  3LOC A;  4D5C A;  4A3E J;  1B9N A;  1OQY A;  4OIQ F;  1VQM I;  1SFX A;  2ZO4 A;  4F93 B;  3ESW B;  3K10 A;  2J5P A;  3OL3 A;  5KAF C;  2HQ5 A;  4DGW B;  1N78 A;  1YIO A;  3FMQ A;  1L0O C;  3DU5 A;  2DDB A;  4TV7 A;  2I8D A;  5ERI A;  2RC4 A;  3A1Y A;  2XUB A;  2L01 A;  3BT9 A;  2GBY A;  4DYR A;  2BZT A;  4EGZ A;  1IV6 A;  2FA5 A;  5EYR A;  1G3S A;  1HDP A;  3ZQH A;  2LBF A;  3DPT A;  3MD2 A;  1D0X A;  3L2Q A;  2NNN A;  1FMW A;  2VJJ A;  3BPV A;  2CO5 A;  5F1R A;  1J75 A;  3IUO A;  4BL0 B;  5GPC A;  1FSH A;  1EA3 A;  3G71 I;  2JQ7 A;  1K79 A;  1N75 A;  2FSW A;  1WZ2 A;  1WJA A;  4AM3 A;  4KIC A;  4EJT A;  4LIU A;  3OYD A;  2IGM A;  3U21 A;  3F8F A;  5HS7 A;  1XSV A;  3F8C A;  2VE9 A;  4A3C J;  1PDN C;  3HTU A;  1UMQ A;  3AG2 H;  3JRB A;  5KVR A;  1BOB A;  5IOZ A;  4RMN A;  1FSE A;  1MMN A;  2DK5 A;  6PAX A;  4L5E A;  2XGE A;  3ZPL A;  3NAR A;  2CFX A;  3OYB A;  2HOT A;  1LJ9 A;  5GPA A;  3BP8 A;  1T56 A;  1X3U A;  1STZ A;  2QLZ A;  1Z91 A;  2VXD A;  2FJ1 A;  1JJ6 C;  5B1B H;  1OIS A;  1P9Q C;  1D0Y A;  3FXM A;  1PUE E;  4IJA A;  2OA4 A;  3JRF A;  1P6R A;  1Z3X A;  3F21 A;  1QO0 D;  2OD5 A;  4RGR A;  2R7Z J;  1B72 A;  2JK3 A;  1MJ9 A;  3CZ6 A;  2BV6 A;  2MC4 A;  4LJZ F;  1QGP A;  1VQ7 I;  1K61 A;  4IHS A;  4IRG A;  4DW6 A;  5IYB J;  3RYR A;  1QRY A;  5IP9 J;  3SEZ A;  4GYI A;  3FKJ A;  5J3L A;  1ITY A;  3WU0 A;  4PFO A;  1KQ8 A;  2LNB A;  3L2V A;  4MEY F;  1SD6 A;  5J6X A;  2PMU A;  4HF1 A;  4I02 A;  3PM1 A;  1UST A;  3FIS A;  2Z2S B;  3WTX C;  5B5E C;  5EZH A;  2XGC A;  2M87 A;  2ELH A;  2F48 A;  1GV5 A;  3Q9S A;  3B73 A;  1VQP I;  4C3J J;  4X6A J;  3QOD A;  5E1X A;  3O3K A;  3BR0 A;  4E7I A;  1OR7 A;  4W1U A;  4ENM A;  4LLN A;  4IZZ A;  2LD5 A;  3X2Q H;  3BG3 A;  5J8C A;  1KQ0 A;  2Y48 A;  1TWC J;  3OIP A;  2XKP A;  2AS5 F;  2E1C A;  3O8G A;  2R5Y B;  1XGO A;  4CUG A;  2W84 A;  4A3M J;  3K4K A;  3ECH A;  3GFJ A;  1I6H J;  2FU4 A;  3OS2 A;  3I58 A;  4EJW A;  1BIB A;  2LYC A;  4OIO F;  4E7K A;  2TRT A;  2HVR A;  1GVJ A;  4G9Y A;  3WGG A;  1HCR A;  3E1S A;  3G1O A;  1I27 A;  2ME6 A;  3TP0 A;  4N9H A;  4LMY A;  1Z6R A;  2E7X A;  4RAF A;  4AWX B;  1ZGJ A;  1FX7 A;  2RVC A;  4JBA A;  4FE4 A;  1IXS B;  2R4G A;  1UHM A;  4KIB A;  4D0P A;  1ETY A;  2E36 A;  2XB5 A;  3KYD B;  3SZP A;  4FET A;  2P0W A;  4XM3 A;  2X9D A;  4BHP A;  3MKY B;  2CQN A;  3M8J A;  1D8K A;  3BG7 A;  5E3O A;  1VQ9 I;  4E7Z A;  3I4M J;  4HZF A;  5GAE J;  5C4J J;  1J5Y A;  1XX5 A;  1FOX A;  3DP7 A;  3IWF A;  4QSH A;  3WU2 C;  4DZP A;  5LBQ A;  3MZY A;  4YIR X;  2F6C A;  2AHQ A;  3KP6 A;  4OIR F;  1SVL A;  2LKP A;  2V9K A;  5FKK A;  3PO2 J;  5E20 A;  4BKX A;  3RJP A;  1VI0 A;  3OYL A;  3R60 A;  3LA3 A;  2NNY A;  2VKH A;  3GFM A;  5CVU A;  3QPS A;  4OIP F;  2JPC A;  2QEX I;  2Y0S N;  2NOJ B;  3C3W A;  2EIJ H;  3HGY A;  2JSP A;  2L9S A;  4CYD A;  3HOT A;  3HC7 A;  4R79 A;  3LA2 A;  1Y1V J;  2EIN H;  5C3E J;  5DV5 A;  1U6G A;  4I99 C;  2CFO A;  2B63 J;  2A61 A;  4E7H A;  2L0K A;  3QOE A;  1Y56 A;  1JJ8 C;  3DPU A;  1N77 A;  3MZH A;  4BXU A;  5HNF A;  1W0U A;  1V5F A;  1G4D A;  4BQN A;  2COM A;  5HNH A;  1WSU A;  2HXI A;  2K9S A;  5GTH C;  2Z1D A;  3J81 Z;  2Z5U A;  4B47 A;  2O8X A;  1OFC X;  1LNW A;  2B0L A;  4N0B A;  3DPL C;  3FHZ A;  4V19 K;  9ANT A;  5FLM J;  4D9J A;  1S3J A;  4BHB A;  1UAA A;  1UJ8 A;  3GTQ J;  2EK5 A;  1X1A A;  3TDZ C;  2JZY A;  1VFC A;  1U9N A;  2DN0 A;  4UV9 A;  1X3Z B;  5L3E A;  5EGO B;  2HOA A;  1BL0 A;  2EWN A;  3ZMV A;  3K7A J;  3GTK J;  3TKY A;  3H35 A;  5DD4 A;  2CW8 A;  4ENN A;  4UB8 C;  2D1V A;  1IXC A;  3U2R A;  4RAY A;  3CDL A;  3PFY A;  2VBZ A;  3ZCO A;  2PEX A;  2D5V A;  1FIA A;  1WKM A;  1LEB A;  5F08 A;  2R0Q C;  2L7K A;  3DFG A;  2LF8 A;  4BS9 A;  2FXA A;  4EAT A;  2QA4 I;  2PQ8 A;  2STT A;  1SC7 A;  1DU6 A;  2PJR B;  3CC7 I;  4GDF A;  3K1M A;  1B4A A;  4M9X A;  4CYC A;  2M0C A;  3QOP A;  3F6O A;  1LVA A;  3ZGK A;  1HXD A;  1RZ4 A;  1VF9 A;  1Y0U A;  3OMY A;  4IVN A;  5F6F A;  3P9I A;  2ID6 A;  4DBR A;  2X85 A;  1W0T A;  1Z7L A;  4UY8 I;  1TT5 B;  2XV4 S;  5LLQ A;  5ICG A;  4HSR A;  5JVT A;  3PO3 J;  2E5Z A;  2QWW A;  4XRF A;  2E1M C;  1W7P A;  2M4K A;  4PFP A;  3I55 I;  5L3F A;  1D0Z A;  4GYG A;  1BI2 A;  2FF4 A;  2ECB A;  5FKM A;  5ILS A;  5IYC J;  2IGN A;  2N8G A;  2JA7 J;  4HLY A;  1MGT A;  4DYC A;  4Y7N J;  1BJA A;  2LF7 A;  2XHK A;  4BDZ A;  1E3H A;  2VC0 A;  4CCO A;  3BR2 A;  3TQN A;  5GAG J;  4L9V A;  4CCK A;  2KRF A;  2H6C A;  3S1R J;  2XF5 A;  2ZJR F;  1U3E M;  3RPU D;  5LRR A;  2ZFU A;  4D1Q A;  2DDA A;  5D5V B;  1VND A;  3DCF A;  3CMM A;  1W36 D;  2FUG 2;  3JAM K;  1RKT A;  1AOY A;  4H4K C;  1O3R A;  4LK0 F;  5EEA A;  3GBG A;  3HTS B;  5KHD A;  4MIM A;  1W7P D;  3LSM A;  5E79 C;  1D1C A;  2CH0 A;  3CUO A;  2LY2 A;  5BNG A;  1Z6T A;  3N97 A;  4DBQ A;  1TBX A;  2R5Z A;  1RPW A;  2DO7 A;  4U87 A;  1JKR C;  1B72 B;  2XPW A;  3RKW A;  2EBI A;  2FD5 A;  4QLC U;  3WTT C;  5E17 F;  2VKV A;  5HLG A;  2BW3 B;  3HM5 A;  1IO2 A;  3D1N I;  4IQJ A;  1VQ4 I;  2CGP A;  1FYL A;  4MFE A;  2OQR A;  4D7N A;  3ZQG A;  4XLA A;  3GZN B;  2O7O A;  4OWR B;  3I54 A;  4XLE A;  3C2G A;  1W36 C;  4B3A A;  3JR9 A;  2BOL A;  4CCJ A;  1WJF A;  3OYJ A;  3VFZ A;  1KYZ A;  5ILV A;  3CLQ A;  1I3A A;  3AG3 H;  4I7H A;  2K9M A;  3K4J A;  1YJ9 I;  2HR3 A;  2QF7 A;  1OCP A;  4O3M A;  1R22 A;  3GLX A;  3BG6 A;  1WGX A;  3IHU A;  2EV5 A;  2CW7 A;  2E2H J;  3GTM J;  4FAS D;  2PBI A;  4Y52 J;  1YOV B;  4E7J A;  3FK7 A;  5D4S A;  2FEZ A;  3GEZ A;  2CUJ A;  5HVQ C;  4MLO A;  4C9Y A;  1LFB A;  2HOE A;  3HZJ A;  3H3Z A;  3P9C A;  3MFK A;  4J00 A;  2ZJQ F;  4ZYD A;  2W00 A;  4A3L J;  2D1H A;  1HC8 A;  2XAU A;  1Y0N A;  1WFX A;  2FML A;  2LDU A;  4YRV A;  1D1A A;  2Y9Z A;  2DW4 A;  1UCR A;  3SEQ A;  3BTJ A;  3OYK A;  2L2O A;  2EZI A;  2QKM B;  2M0M A;  1ZAO A;  2FBH A;  2IA2 A;  3LWF A;  3J7A Y;  4IEJ A;  3D5S C;  2NOG A;  1QVU A;  4M3D A;  3Q3S A;  3F6V A;  2Y30 A;  1T08 B;  2NVY J;  4C3I J;  1XTA A;  2DT7 B;  3I3L A;  5BS6 A;  3DKY A;  3FXR A;  2HGC A;  1JTY A;  2R7V A;  4R8H A;  1KZH A;  3JRC A;  1R23 A;  5FKO A;  1OYI A;  1I5Z A;  2W57 A;  3PL8 A;  4ESF A;  4Q4Z F;  2R7U A;  4UB6 C;  2HKO A;  3HKZ N;  3BTI A;  3SZG A;  3QPH A;  3ECO A;  3QYF A;  3K1N A;  3N05 A;  3VOE A;  3RCO A;  5HLI A;  3M1E A;  5M5W J;  3R0A A;  2DOD A;  1R49 A;  3RYP A;  2OZU A;  3RI4 A;  1F36 A;  4PZJ A;  5DCM A;  4S0H B;  3G4S I;  4A0Z A;  3IKT A;  1OYW A;  3OYN A;  4BYY A;  3GW2 A;  4MEX F;  2OCC H;  2LG4 A;  2KIM A;  1TC3 C;  3CC4 I;  1LUJ B;  3I4P A;  4BUP A;  2XB0 X;  3BRO A;  3E7L A;  3OOU A;  3REO A;  4BH9 A;  1H9T A;  4IO9 F;  4MO7 A;  3WTZ A;  1J9I A;  2KZV A;  1ZKG A;  2M8G X;  1QA6 A;  3OY9 A;  2KJC A;  3KEO A;  1Z7U A;  3C2B A;  1SFU A;  4C2U A;  3H0G J;  1E17 A;  5EEH A;  3BR5 A;  2LLK A;  3WU1 B;  2KZG A;  1ZG5 A;  1X58 A;  2W4S A;  3J81 K;  3LSH A;  4BDY A;  1YJW I;  2FMY A;  1SVO A;  4M9S A;  1FOK A;  2V1U A;  1TW2 A;  4E7S A;  1LFU P;  3W3C A;  5J1Y A;  1XDS A;  2KT0 A;  2HQN A;  1ETK A;  2E1O A;  2ELK A;  4BBS J;  3PUF A;  2DYR H;  3H9J A;  3OYC A;  3H36 A;  1FYM A;  4RLF A;  4A0Y A;  3PSI A;  3DTK A;  4U0Y A;  4C3H J;  3QPT A;  3GF2 A;  3M1C A;  2RQP A;  4PCQ A;  2EIK H;  1GV2 A;  4E70 A;  1NTC A;  5CJ9 A;  3V7S A;  5DS9 A;  2LP0 A;  4G94 A;  2NVU B;  2ZCW A;  1FP2 A;  4I01 A;  1YW7 A;  4P96 A;  2XSD C;  4ZZD A;  2GIZ A;  5CVR A;  2X6X A;  4CCL A;  3L2W A;  2IPQ X;  2O5R A;  4A3D J;  3KP3 A;  3AL0 C;  2XPU A;  2K40 A;  1ZYR F;  5FD5 A;  3T8R A;  2QQ9 A;  2O0Y A;  5LD2 C;  2WY8 Q;  3P5J A;  2H8W A;  3NQO A;  1JKQ C;  4I09 A;  1IJW C;  2A6T A;  2FNA A;  2RNG A;  4A3J J;  5E1W A;  4DQ2 A;  1NK2 P;  4KFC A;  4I2O A;  4HPQ A;  2HPI A;  2CJJ A;  4CYC B;  2V1D A;  3Q0W A;  3TW6 A;  1V5E A;  2HQR A;  2ZXI A;  1Q1V A;  3FMS A;  2NS7 A;  2QM3 A;  3MCZ A;  1H0M A;  4HV6 A;  3LMM A;  2GOX B;  2PMH A;  5IP6 A;  3HSR A;  2A6E F;  1IN8 A;  1OLT A;  2XAJ A;  5GTI C;  3MQ0 A;  1ODD A;  1ZN2 A;  1W7P B;  3CP2 A;  4Z2Y A;  3PNT A;  3OSG A;  2M1B A;  2R93 J;  4YG2 F;  1TWA J;  1K7A A;  2XAG A;  1VQ5 I;  2XGX A;  4LG3 A;  3RPQ A;  4ZYH A;  5JLW A;  2P6T A;  4BJ6 C;  2ME0 A;  1ZGA A;  5JFR A;  2WB1 N;  1GUU A;  1T0F C;  2Y9Y A;  1FZP B;  1POG A;  3S1Q J;  3ZN0 A;  2XRN A;  5IYD J;  4Y17 A;  4A3K J;  2ACJ A;  4BBR J;  5DTD A;  5FKL A;  1DPR A;  4CA0 A;  1YW8 A;  4KIT B;  3A02 A;  1QQI A;  1MH3 A;  3H9G A;  4WXD A;  5DEQ A;  2KHM A;  1MKM A;  2MGQ A;  4XKV A;  5D4R A;  1K4T A;  1XD7 A;  1MSF C;  4G6Q A;  2W7N A;  2RV8 A;  1B59 A;  4BJ5 C;  3H5A A;  1QZE A;  2Z16 A;  4V2F A;  1R4N B;  3CJT B;  2HI3 A;  5HLH A;  5K7Z A;  4HOB A;  1IC8 A;  3LFK A;  2M2E A;  3LSK A;  3H92 A;  2HDW A;  1MD0 A;  2X48 A;  5KCM A;  5FRM A;  3D5R C;  1P7I A;  3DTI A;  5D5W B;  2ETH A;  1BC8 C;  3SYT A;  2R5Z B;  5ILU A;  2JA5 J;  2DA3 A;  3ABT A;  4YII A;  2KRH A;  3S2H J;  3MVP A;  1YE9 A;  4O5V A;  3CTA A;  3ERM A;  3KX2 A;  1BR1 A;  4P1W A;  3A01 A;  5B66 C;  1TTY A;  3IH2 A;  2HWV A;  3A0H C;  3HOS A;  3H9Q A;  4EV0 A;  3DEW A;  1SVM A;  2ZXH A;  4GO1 A;  2H6B A;  4M3G A;  4BXF A;  3WTS C;  4BXX J;  4NBQ A;  2H94 A;  1MBH A;  1J09 A;  4LD5 A;  5J4V A;  1BIA A;  1I6X A;  2DA5 A;  3HOV J;  1HDD C;  1IDY A;  2QCO A;  2C6Y A;  3OSF A;  2AXT C;  4WCG A;  5E3M A;  3HRU A;  5LHH A;  1T98 A;  4GGG A;  1OCZ H;  3D5L A;  3Q0U A;  4QIW N;  2VBX A;  5JVG F;  3I9V 2;  3OIQ A;  4GCV A;  4LB5 A;  2ZME C;  4A3G J;  3GTG J;  3GXO A;  3HB9 A;  2MH9 A;  1JUS A;  4ESB A;  3K69 A;  5CVV A;  1JE8 A;  2ZXJ A;  1MH4 A;  4LIT A;  2M45 A;  3CLO A;  2GM4 A;  3CCV I;  2J5O A;  5K7H A;  3WE2 A;  3WTU C;  3W6J B;  1DPU A;  4KUM A;  1HSJ A;  3IH4 A;  1FWZ A;  1EH6 A;  5CLS A;  3KP5 A;  3CCL I;  1S7E A;  2A69 F;  2PJR A;  1G8X A;  1S29 A;  2PX9 A;  2XAQ A;  4IHT A;  1YX5 A;  5H2F C;  4E4H A;  1R6R A;  2LTP A;  1Y8Q B;  3BLY A;  2HEO A;  2R3S A;  3S3M A;  1IAW A;  4LFU A;  2ZSH B;  4KDP A;  2EFW A;  1MBG A;  2VN2 A;  1G3W A;  4DIQ A;  2L54 A;  3JRI A;  3CDH A;  1XCB A;  2NVX J;  4NDL A;  5KAI C;  1ZGW A;  2L7Z A;  1WI3 A;  4XKB A;  2X6W A;  2EA4 A;  2JA6 J;  2K9Q A;  2F5E A;  1BC7 C;  3OR1 C;  3JRG A;  4P5O A;  5TGT A;  2R7T A;  2A05 A;  2MLG A;  3LSG A;  2W48 A;  2BBY A;  2OPT A;  2VT2 A;  3HHG A;  4FIS A;  1XB4 A;  3KLN A;  4UUS B;  1GHC A;  1RET A;  4ITV A;  4UUT A;  3DEE A;  4XRS G;  1IN4 A;  5DCM B;  3B6A A;  4AYB N;  2BXZ A;  4CSW A;  2GIV A;  1QZZ A;  3VYR B;  2MD0 A;  1GLN A;  4XLH A;  1ZEL A;  4U0W A;  3PSF A;  4IQ4 A;  4M74 A;  2XSJ C;  5E1Z B;  4PSW A;  1O3S A;  3AG1 H;  1MBE A;  1WWX A;  4YEJ A;  4F92 B;  4G12 A;  1UFM A;  1T33 A;  2IS6 A;  4C2M J;  2K3F A;  3T1B A;  3W2W A;  1U5T C;  5LGU A;  3RSN A;  3SJM A;  3W2A A;  2PN6 A;  3JAM Z;  2DJI A;  3KEY A;  3HOU J;  1W5C C;  3IRQ A;  4AIK A;  3HRM A;  2BW3 A;  4M3F A;  4ANJ A;  1VTN C;  2R7X A;  4QPO A;  5E8G A;  5BPI A;  2XF6 A;  3P9K A;  2CQK A;  4M9Z A;  5CPR B;  1ZRC A;  1QHG A;  4RGX A;  1XGN A;  3HSE A;  3MWM A;  2CRG A;  4C30 A;  3WGH A;  2NS8 A;  2WWY A;  1JXS A;  4YFX F;  1IRG A;  2VPR A;  2P8T A;  5IT9 K;  3S15 J;  1IG7 A;  1GXQ A;  3U1K A;  3CCM I;  2CWE A;  3I4N J;  4ZDO A;  2MBF A;  1XMA A;  4U7D A;  3F8N A;  2MYS A;  4JX4 A;  3VEP A;  4PUS A;  3RQ4 A;  4CIC A;  2KFD A;  3QU3 A;  2QBY B;  1ZK8 A;  1OCC H;  2Y0M A;  2DMP A;  1WH7 A;  2X4H A;  3K2A A;  2ESN A;  2E35 A;  5DCF A;  1DGW Y;  5CVI A;  2M8E A;  1WJB A;  2WAE A;  2WTE A;  4HF0 A;  5FRO A;  2HYG D;  4RB3 C;  2YX7 A;  1FTZ A;  2Z33 A;  4B09 A;  4XON A;  2LSO A;  3GME A;  3ZRG A;  4EM1 A;  3RZO J;  3T0Y A;  2RKH A;  3L09 A;  3F22 A;  2BY0 A;  3QYB A;  3OIO A;  2R7O A;  3K4L A;  2L4A A;  5FRN A;  3QP5 A;  1X19 A;  1R5I D;  4IX7 A;  3SDG A;  1ORK A;  2W25 A;  2W85 A;  1O3T A;  2IS2 A;  2IP2 A;  4RBO A;  2CMP A;  4CZC A;  4EMS A;  3ONQ A;  2K02 A;  2VE8 A;  5B1A H;  3ZP5 A;  2NRA C;  2M30 A;  3K0L A;  3ZQI A;  2XIG A;  2VAS A;  3EUA A;  1A5J A;  1FT9 A;  2DA4 A;  3ZXS A;  1X1C A;  1KYW A;  1WH5 A;  1ZHF A;  4PJL A;  1IN7 A;  3F3X A;  3J80 K;  2VQL A;  2HZD A;  2MA3 A;  4LIV A;  3RTR A;  3KET A;  2NAZ A;  3OWT A;  3GTL J;  1I1G A;  4KT5 C;  4KT6 A;  2DMT A;  2ZME B;  1SFO J;  2CYY A;  2FQ3 A;  2WY7 Q;  1XSX A;  2VKD A;  4DZJ A;  5ED4 A;  3KCC A;  5D8L B;  1P4W A;  3CMY A;  1C0W A;  4RB1 A;  2XKO A;  4M73 A;  1WJD A;  4BQQ A;  2I5U A;  2HKX A;  4CCN A;  5HOO A;  1VQN I;  3MKL A;  3L2C A;  2AO9 A;  4AID A;  4D7M A;  4UNO A;  4XN0 A;  2DMN A;  2PFB A;  5FFX A;  2JMW A;  1G6N A;  2EIL H;  2JSC A;  1J7K A;  4MGR A;  4FQG A;  2DPD A;  4DJA A;  3AKZ A;  4MQV A;  2XF7 A;  4IF4 A;  3A01 B;  3BQZ A;  3JTG A;  1U9O A;  2NYX A;  3V8J A;  4XLC A;  2HFH A;  4I0B A;  1JTX A;  2EB7 A;  3DQV C;  2FRH A;  5DD8 A;  1AHD P;  2DK8 A;  3HL2 A;  5H6Q A;  1W5T A;  1QNT A;  3C18 A;  2O6G E;  3O8H A;  1V54 H;  3FZV A;  2L5Q A;  1ZRF A;  2XVC A;  4KNY A;  3I5U A;  3S16 J;  4IRH A;  1OCT C;  1JHH A;  4J19 A;  4KMU X;  1XGS A;  1DDN A;  2K86 A;  1FLI A;  2PG4 A;  1KU9 A;  3E5X A;  1EF4 A;  2EIM H;  1LQ1 A;  1MW7 A;  2QUF A;  2EZK A;  5C44 J;  4UUV A;  1I50 J;  2FE3 A;  2K9N A;  4NC7 A;  3N4M A;  3CJR B;  3PQK A;  1JUM A;  4F3Q A;  2K7L A;  2AXL A;  4JQF A;  4HLX A;  2QYO A;  1AWC A;  2OAZ A;  4MTE A;  4UXN A;  5J40 A;  2E5N A;  4S04 A;  5LFA A;  4BE0 A;  1WVR A;  2E34 A;  2K9L A;  1ETO A;  1LDD A;  2B9S A;  1PP7 U;  5F04 A;  1FEX A;  1TP4 A;  3FBI B;  3M4O J;  5KNL A;  2WAQ A;  5FKN A;  4EVI A;  1F43 A;  4A93 J;  4Q5S F;  4U7B A;  4HYE A;  3OS0 A;  3DLL F;  3KIO A;  4HA8 A;  4RGS A;  2STW A;  4GXO A;  2BY2 A;  3F8B A;  5EEG A;  5K7F A;  3ML6 A;  1HQC A;  3RPU A;  2DTR A;  3DXJ F;  2KLO A;  4ZZL A;  1DUX C;  1QPM A;  1FOW A;  1HST A;  2CU7 A;  4XIC A;  4MNU A;  2F2E A;  2DLL A;  3KZY A;  4EJV A;  2DYS H;  1MMG A;  2EFO A;  2HYF A;  3QQA A;  1YHQ I;  4A3I J;  3I64 A;  4RDU A;  2DA1 A;  4BJT A;  2JRT A;  1GXP A;  2Z3Y A;  1YTY A;  1IV8 A;  5LRS A;  3I53 A;  4LLG F;  1MBF A;  2L02 A;  2HYJ A;  3GX4 X;  1IF1 A;  4IHW A;  2IT0 A;  1OJL A;  3AG4 H;  3CME I;  3HBL A;  2BY3 A;  3RKQ A;  3R6S A;  2RGV A;  3S17 J;  3E5Q A;  3K1P A;  4RAG A;  4A12 A;  1S7O A;  4AIH A;  2V9V A;  1D5Y A;  5A2Q Z;  4OIN F;  3SHF A;  1O4X A;  2LY9 A;  1MNE A;  2XGD A;  2ZC2 A;  3IC7 A;  5AIQ A;  2VJ4 A;  2HTS A;  3VSL A;  2BXY A;  4ZYA A;  2X0L A;  4HX4 A;  1GVD A;  1O3Q A;  1ULY A;  1IXR C;  4Y15 A;  3NAU A;  2GXG A;  2VT3 A;  2DMU A;  3OYF A;  3IH3 A;  3UR3 C;  1OCR H;  4X0G A;  1HA8 A;  2UUZ A;  2MD5 A;  2LC2 A;  1B1B A;  3PFI A;  5HS9 A;  1B8I A;  2IS1 A;  2IEK A;  3FXO A;  4L9T A;  2QSF X;  4XOP A;  1VQK I;  3CJN A;  3DLA A;  4EM2 A;  4QWQ A;  3KZI C;  3UNG C;  3HOX J;  4KN4 X;  2KIF A;  1SFE A;  1OCO H;  3E3V A;  2XAF A;  4G7H F;  2R7D A;  2PMZ N;  3WHC A;  1YO5 C;  3D0S A;  2FOW A;  4A2U A;  3ZQF A;  3FXQ A;  2P5K A;  4L5J A;  4MHG A;  2FX0 A;  3EET A;  4CXF A;  3LFU A;  1IN6 A;  2P81 A;  4BQA A;  1S7A A;  3RKY A;  3FXK A;  4XSX F;  5HDG A;  5F64 A;  2P5L C;  2VIX A;  2GXA A;  4OOI A;  1IRF A;  3CUQ C;  4HV5 A;  2L9N A;  5IP7 J;  3WGI A;  5M5Y J;  3CCE I;  3FXJ A;  1TZL A;  2L7M P;  1UB9 A;  3H3U A;  4XR6 A;  3H0D A;  2KMU A;  3SQN A;  1QZY A;  3QP6 A;  2DA6 A;  4ASN A;  4DYQ A;  4UVC A;  1HF0 A;  3M07 A;  3FM3 A;  3R61 A;  1P7J A;  1PYV A;  2DOA A;  1TLH B;  4R1H A;  1X4P A;  1K78 A;  3JCU C;  2CS3 A;  3W2V A;  4KMF A;  4WK8 F;  4HDV A;  1ZAR A;  1TL8 A;  1JKP C;  4V2G A;  5JI6 A;  1FTT A;  2P4W A;  1S72 I;  2VOO A;  4UVB A;  4XKC A;  3H1C A;  1A6Q A;  4JX5 A;  4HQE A;  1MMS A;  3DEU A;  4LLL A;  2QKL B;  3F23 A;  2DQR A;  2DMQ A;  2ISY A;  1YS7 A;  2R7W A;  4P9U A;  3ZMD A;  1IRZ A;  4BAY A;  3CQZ J;  3V42 A;  2YUS A;  1BOA A;  4CH7 A;  5J1R A;  4XLF A;  4IRI A;  5CQE A;  2F4I A;  4RAZ A;  3TW7 A;  4UUS A;  1TWG J;  4C2T A;  3HOZ J;  1SMY F;  1MIJ A;  4XRS A;  2JPB A;  4LK1 F;  2KQR A;  4IPA A;  5IPA A;  3ABL H;  2H1K A;  3MKW B;  1PVE A;  4JP0 A;  4MTD A;  5M3F J;  2AQE A;  2MG4 A;  3A0B C;  2IW5 A;  3E5U A;  1SMT A;  5CQG A;  2LKX A;  1TQI A;  3FKI J;  2WBM A;  1AA7 A;  3ABU A;  1MBK A;  5ICF A;  2GZW A;  4IKF A;  3KLO A;  4HX7 A;  1W1W E;  1MNM C;  5FLX K;  4FCY A;  2DT5 A;  2LKS A;  3TP3 A;  2BVL A;  3EUH C;  3K4C A;  3KP4 A;  2WB1 A;  3FWE A;  1ZG3 A;  2HOS A;  5L3C A;  1FOY A;  3F0C A;  4CGZ A;  4PSX A;  3JRA A;  2TDX A;  3ASO H;  4LG0 A;  3HUG B;  4HW0 A;  2ISZ A;  2P7V B;  2YU3 A;  2JN6 A;  2ZB9 A;  1HKT A;  1N25 A;  3M8E A;  5EJC A;  3TMO A;  3ULQ B;  2DPU A;  2R7Q A;  3CDI A;  3WTW C;  5HLT A;  3HHH A;  5D6F A;  1VQO I;  2E1M B;  3OV8 A;  1RIO H;  4XLP F;  4D5F A;  3FBN B;  2KRC A;  3ZQC A;  1AU7 A;  4O6J A;  1G3Y A;  3TBI A;  1O57 A;  1FNN A;  1DGR M;  4G7Z F;  1T0F A;  2BHZ A;  3P7N A;  1R5G A;  4XMY A;  2VXZ A;  4ZJZ A;  5FLV A;  4PGG A;  3BG5 A;  1I1S A;  3BWG A;  2IA1 A;  1WHU A;  2P6S A;  3FHN A;  2E19 A;  4G6T B;  2LRD A;  3M3Y J;  1E3P A;  3F72 A;  4FE7 A;  4EJO A;  2O9L A;  4M71 A;  2QBY A;  1UG2 A;  5IT9 Z;  1LEA A;  2XRO A;  4JOM A;  3QYE A;  4ZTF A;  2O3F A;  2E2I J;  4ZDL A;  2W1O A;  2IGK A;  5LEK A;  1DP3 A;  1F1Z A;  1OPC A;  1LKX A;  2G9W A;  3HGG A;  2IAI A;  2AQF A;  1YI2 I;  1XN7 A;  1K6O A;  1MBJ A;  2EZH A;  1R71 A;  3G3Z A;  4UHT A;  1VQL I;  2VBW A;  3V7R A;  4M6Y A;  1CF7 A;  4N4O B;  1LFP A;  2EFQ A;  1R36 A;  2KIS A;  2OBP A;  4PGH A;  1F5T A;  1PP8 F;  4M6V A;  1YRN A;  2OQG A;  3GVA A;  3GO5 A;  2CUF A;  1ZQ3 P;  1YLF A;  3DBL B;  3PJR A;  1K83 J;  1DU0 A;  2PJP A;  3OR2 C;  3CCU I;  1W4M A;  4NC6 A;  1UHS A;  1H88 C;  1REP C;  2MC3 A;  1G3T A;  1UG0 A;  4EJU A;  3IKV A;  1E3O C;  5HDN A;  4A3B J;  3A2K A;  3S3N A;  3U1D A;  3ZMU A;  1MJA A;  3S2D J;  4ZH4 F;  1K6Y A;  3E6B A;  3HIF A;  5E18 F;  1R5H A;  3RQI A;  5A2Q K;  1X1B A;  3WG7 H;  5EF6 A;  2ZNY A;  3BTL A;  2K3P A;  2A6H F;  2ZME A;  1U8R A;  3MKZ A;  5L3B A;  1RRJ A;  2K5C A;  3FM5 A;  4HAM A;  3V4G A;  1CQT A;  2IGO A;  2ZBK A;  3ABM H;  1OYY A;  5BOX A;  2VOD A;  2R7F A;  3J80 Z;  2NXN B;  1HLV A;  2OCE A;  2OUM A;  2K4J A;  5J4Y A;  3ZQ7 A;  1WPK A;  4XOR A;  2IVM A;  2VUM J;  4ENJ A;  1MMA A;  2A5W A;  3WHB A;  3L9F A;  2DFF A;  3KPH A;  4XL9 A;  4H0E A;  3A4C A;  4LGW A;  4Q47 A;  3HRS A;  4AYB A;  3LAJ A;  3DF8 A;  4M72 A;  4B3X A;  1TWH J;  2DJN A;  4YFN F;  3G6E I;  2X6Y A;  3SXY A;  3I59 A;  3S32 A;  3CO7 C;  1EH7 A;  5H6R A;  2JWT A;  1B8I B;  2JVH A;  1K4S A;  3JRE A;  1R1U A;  3CCY A;  3J7Z I;  2GA2 A;  3ZMT A;  1T8I A;  5HDK A;  2V6E A;  5JR3 A;  3HG9 A;  2WAF A;  2L9V A;  4NC8 A;  3TO6 A;  4WXH A;  1XS9 A;  4M6X A;  1BR4 A;  3CP8 A;  4RA2 A;  1A6I A;  4LB6 B;  1APL C;  3IL2 A;  3KEQ A;  3HSF A;  3K2Z A;  3GFL A;  3GYH X;  3B6C A;  2UXN A;  2ZNZ A;  3S93 A;  1JT0 A;  3HPG A;  3KFW X;  4PDK A;  1J59 A;  5GAD J;  2ESH A;  1S6L A;  2M7A A;  1BW6 A;  3E0J B;  1GDT A;  1B9M A;  5KK1 A;  2JA8 J;  4A0X A;  2FOK A;  1QVT A;  4RS8 A;  2LVS A;  2BY1 A;  3C2H A;  3O6B B;  1D3Y A;  1DQU A;  2BVM A;  1U5T A;  2OV7 A;  1ZH5 A;  3OOP A;  2A3S A;  1HW2 A;  4HQM A;  1P2F A;  2JVG A;  3K4N A;  5H20 A;  3E6M A;  2JUC A;  3BDD A;  3GWZ A;  4IOC F;  4RB0 A;  4E7L A;  3AFH A;  4M3B A;  2RDP A;  4KIS A;  2DTZ A;  4GRI A;  1K78 B;  1A31 A;  3TO7 A;  2WA0 A;  2EA2 A;  3KE2 A;  3ZMS A;  4YFK F;  1SD4 A;  4BNC A;  1XMX A;  4MFD A;  3HDD A;  1R7J A;  2EPF A;  3CF5 F;  4WXC A;  1P4X A;  4OAY A;  1W5S A;  3LSI A;  1R58 A;  1ON1 A;  3U9G A;  1FBU A;  5CKT A;  4I0A A;  1QU3 A;  1XSD A;  2OZ6 A;  4RB2 C;  5JHU A;  5LHI A;  2M3A A;  3W6K B;  3COA C;  1MMD A;  3FF5 A;  1WJE A;  3EDP A;  5GAH J;  4I98 B;  1I39 A;  3OYM A;  4G7O F;  3TED A;  1FBQ A;  2VQG A;  4N9I A;  2L9R A;  2QEN A;  1X2M A;  1BA5 A;  5B3S H;  2YS9 A;  3LQR A;  2KPM A;  2UV1 A;  2K4B A;  3AL0 B;  1FMV A;  3K4M A;  2ZJ2 A;  3LL7 A;  3PUB A;  4X1E A;  1MDM A;  3HPH A;  1D5V A;  2WC2 A;  4P55 A;  4DNC A;  3JRH A;  2R7S A;  3OYA A;  1ENH A;  3TO9 A;  4IL6 C;  1TT0 A;  3ZN1 A;  4LG0 B;  1UZC A;  3C7J A;  1XPX A;  4BY7 J;  2Y75 A;  2YPR A;  3BR3 A;  5JLX A;  4L9J A;  2M4G A;  5K1Y A;  1EV7 A;  3M7G A;  2A07 F;  1BI0 A;  2QQ8 A;  3VDX A;  1SAU A;  5CVJ A;  2D45 A;  2GWR A;  3I71 A;  3TOB A;  1I3Q J;  4BAC A;  3I56 I;  2E1N A;  4HNT A;  2V6C A;  3HOW J;  3T8T A;  4KIG A;  1FIP A;  1NK3 P;  3BZK A;  2F4M B;  2FQ4 A;  1QBJ A;  4F52 A;  2P5V A;  2Y0S A;  2IJL A;  1SD7 A;  2DI3 A;  1MSE C;  5FFZ A;  1G59 A;  2Y69 H;  1FY7 A;  3GFI A;  3LA7 A;  1XDU A;  1YG2 A;  3H5R A;  1JKO C;  1HOM A;  3DKX A;  3IRR A;  3CD6 I;  1ERD A;  3L2U A;  4OU0 A;  2OU2 A;  3L2R A;  3LST A;  4PJJ A;  4XK4 A;  1SFK A;  3L00 A;  3CMA I;  4HST A;  1OKR A;  4ESJ A;  3K4B A;  4HG2 A;  2RAE A;  1ETW A;  1U78 A;  4B8X A;  3EYY A;  2OTL I;  4L0Z B;  4J01 A;  1ON2 A;  3QAH A;  2LFB A;  1LPQ A;  1UHW A;  1FBS A;  4A5M A;  2K27 A;  2JUG A;  4W97 A;  1NG6 A;  3S2W A;  1FYK A;  1JHF A;  2VL8 A;  4L9N A;  2KJB A;  1JGS A;  1Z3Y A;  2EFN A;  4ZYG A;  4A6D A;  3CCJ I;  4XLN F;  1CF7 B;  1VQ8 I;  1ZRD A;  5BQT A;  3BY6 A;  3S1M J;  1KQ9 A;  2JTV A;  3ZR8 X;  4NUB A;  2Q2E A;  1YRN B;  3BJA A;  3FXU A;  3BQY A;  2FBI A;  4XQF A;  4OMZ A;  2YR2 A;  1F9N A;  3EPZ A;  5DYM A;  1ETX A;  1IN5 A;  3WE3 A;  2BGC A;  3BR1 A;  2ZFW A;  5J1U A;  1KU3 A;  1R1T A;  4XN3 A;  3O2P E;  2HS5 A;  1V3F A;  2W82 A;  5TIS C;  2Q1Z B;  2VJ5 A;  2E7W A;  3DTE A;  4KN7 X;  2M5W A;  1QPI A;  1XMK A;  1FJL A;  5DUK A;  4QPQ A;  2F4O B;  4JK1 X;  1D1B A;  2R7R A;  1RR8 C;  4B4C A;  1T6S A;  3ZMZ A;  4XNF A;  1T95 A;  5HS8 A;  1YFH A;  4JX6 A;  1EJ9 A;  3S1N J;  2OJE D;  3DV8 A;  1IDZ A;  2BHY A;  5GP9 A;  4ZYE A;  1U2W A;  2NVQ J;  1X1D A;  3HJE A;  5LEJ A;  2KIU A;  4EQQ A;  2XAS A;  2A68 F;  5E8I A;  3IV5 A;  5AIP A;  5JHF A;  4HRI A;  3WTV C;  2M9H A;  1RKW A;  3QRF F;  2DFH A;  3HUG A;  2H09 A;  3IWZ A;  1IGN A;  2OTJ I;  4DOZ A;  2DOF A;  1LDJ A;  5FLX Z;  1OR7 C;  5DM6 F;  3RDI A;  1RUO A;  3BPX A;  3G1L A;  3HEF A;  3I59 B;  3KZZ A;  2E71 A;  2IS4 A;  1LDK B;  5FO5 A;  3W6V A;  3GLL A;  1SAX A;  3JW4 A;  1ONV A;  2O8K A;  3CES A;  1RES A;  1RUN A;  4AD9 A;  3LAP A;  2LMD A;  1AKH B;  1TW3 A;  1MJB A;  3BG9 A;  5E3L A;  1LE8 A;  5EG0 A;  1YQA A;  2NS0 A;  2JJ7 A;  3BTC A;  3ABK H;  2KIQ A;  3VB2 A;  2VC1 A;  1P92 A;  5BMZ A;  5L3D A;  1KA8 A;  4Y4R A;  4Y13 A;  4ZC3 A;  4UV8 A;  4FTH A;  2O61 A;  4N4N B;  3S8P A;  2DU9 A;  2MW8 A;  2EFP A;  3VYT B;  2CUE A;  4YIF A;  1XCV A;  4ON0 A;  2VKE A;  2CUZ A;  2QGU A;  3ZQL A;  1HKS A;  5D6E A;  2ADU A;  1U5T B;  4L18 B;  1WQ2 A;  2BYV E;  2PMZ A;  3MEX A;  2CV0 A;  3NEU A; 
#chains in the Genus database with same CATH homology
 2LK2 A;  1IRZ A;  4V2F A;  2ECC A;  3CQZ J;  2HI3 A;  1QRY A;  5IP9 J;  2YUS A;  5K7Z A;  5J1R A;  1BW5 A;  5J3L A;  1ITY A;  5F1J A;  1IC8 A;  2M2E A;  3TW7 A;  4UUS A;  1TWG J;  2X48 A;  1P7I A;  3HOZ J;  2R5Z B;  2JA5 J;  4XRS A;  3PM1 A;  2Y31 A;  2DA3 A;  3FIS A;  5IPA A;  3S2H J;  3MVP A;  3A01 A;  1ZR4 A;  2H1K A;  5EZH A;  2XGC A;  5M3F J;  4JP0 A;  3SFI A;  2MG4 A;  1GV5 A;  3IH2 A;  2LKX A;  3FKI J;  4C3J J;  1MBK A;  5F0F A;  5IOY A;  4X6A J;  3DEW A;  3BR0 A;  1MNM C;  4W1U A;  4FCY A;  3TP3 A;  2LD5 A;  3BG3 A;  4M3G A;  1TWC J;  4BXX J;  2HOS A;  4I6Z A;  3F0C A;  1MBH A;  3O8G A;  3JRA A;  3LSP A;  2R5Y B;  2DA5 A;  4A3M J;  3HOV J;  5E3N A;  1IDY A;  2QCO A;  5F27 A;  1HDD C;  1JT6 A;  1I6H J;  2JN6 A;  2ZB9 A;  3OSF A;  5E3M A;  2TRT A;  3Q0U A;  4QIW N;  1HCR A;  3G1O A;  4A3G J;  2ME6 A;  5HOD A;  3TP0 A;  3GTG J;  3HB9 A;  4D5F A;  5FJ8 J;  1JUS A;  3ZQC A;  1AU7 A;  2GLO A;  1MH4 A;  2GM4 A;  2HDD A;  3MN2 A;  4FE4 A;  5K7H A;  3L1P A;  1ETY A;  2XB5 A;  5FLV A;  3BG5 A;  3GTP J;  3IH4 A;  4QTR A;  3HOY J;  2X9D A;  3S14 J;  2E19 A;  3M3Y J;  3GTO J;  5E3O A;  2O9L A;  4FE7 A;  1S7E A;  2IBD A;  3I4M J;  5M3M J;  5C4J J;  1UG2 A;  2LTP A;  4QSH A;  4DZP A;  2E2I J;  1MBG A;  2AHQ A;  3JRI A;  3HGG A;  2NVX J;  1XC5 A;  2IAI A;  4NDL A;  1ZGW A;  5FKK A;  3PO2 J;  1MBJ A;  2EZH A;  2L7Z A;  4BKX A;  1VI0 A;  1WI3 A;  3ZOB A;  2JA6 J;  2K9Q A;  1ZR2 A;  2HXO A;  3JRG A;  3QPS A;  5EZG A;  2Y0S N;  3HGY A;  3LSG A;  2W48 A;  2OPT A;  4FIS A;  4UUS B;  1RET A;  1Y1V J;  4UUT A;  4XRS G;  5C3E J;  2TCT A;  2DA2 A;  4M6V A;  1YRN A;  1RR7 A;  3B6A A;  2CUF A;  4AYB N;  1ZQ3 P;  1BJZ A;  3G1M A;  1K83 J;  2WAQ N;  1DU0 A;  2B63 J;  2L0K A;  1UHS A;  1H88 C;  1JJ8 C;  2I10 A;  1MBE A;  1E3O C;  4A3B J;  4G12 A;  2VI6 A;  3S2D J;  1W0U A;  1PUF A;  1T33 A;  3RQI A;  4C2M J;  5EF6 A;  4GFB A;  2HXI A;  2K9S A;  3BTL A;  3SJM A;  1OFC X;  3HOU J;  9ANT A;  5FLM J;  1CQT A;  3GTQ J;  4M3F A;  1VFC A;  1U9N A;  2DN0 A;  5EGO B;  2EQR A;  1HLV A;  2HOA A;  1BL0 A;  3LSJ A;  4BY1 J;  3K7A J;  3GTK J;  1WPK A;  2VUM J;  2CRG A;  2NS8 A;  4A69 C;  1H89 C;  3WHB A;  2VPR A;  2WV1 A;  3CDL A;  2G0E A;  3S15 J;  1IG7 A;  2D5V A;  3I4N J;  1FIA A;  1R9T J;  5F08 A;  2R0Q C;  4JX4 A;  1TWH J;  2DJN A;  2M34 A;  1SAN A;  1G2H A;  1DU6 A;  2JWT A;  1B8I B;  1ZK8 A;  2DMP A;  3JRE A;  3CCY A;  4CYC A;  1WH7 A;  2M0C A;  3K2A A;  4HNV A;  1VF9 A;  2ID6 A;  1W0T A;  3BR6 A;  2ID3 A;  1XS9 A;  2H8R A;  2EH3 A;  1FTZ A;  3PO3 J;  1A6I A;  1APL C;  1IUF A;  3RZO J;  2ECB A;  3B6C A;  3OIO A;  2XPV A;  2N8G A;  5FKM A;  5IYC J;  1JT0 A;  2JA7 J;  4DYC A;  4Y7N J;  4A3F J;  1X2N A;  1BW6 A;  1ORK A;  3SDG A;  1WCM J;  3BR2 A;  1GDT A;  2COB A;  3LSR A;  2JA8 J;  4RBO A;  3S1R J;  1QVT A;  2LVS A;  2EZL A;  1VND A;  1Y1W J;  5EG0 B;  3ZQI A;  1LE8 B;  3DCF A;  1GT0 C;  1RKT A;  5M5X J;  1JGG A;  1A5J A;  5EEA A;  2DA4 A;  3GBG A;  4MIM A;  1WH5 A;  4B1R A;  4M3B A;  5BNG A;  2DTZ A;  3GTL J;  2DMT A;  1SFO J;  2R5Z A;  4DZJ A;  1RPW A;  1JKR C;  3CMY A;  1B72 B;  2XPW A;  2EBI A;  2FD5 A;  1ETV A;  2VKV A;  4MFD A;  3HDD A;  1ZTR A;  3HM5 A;  2CQX A;  2OF7 A;  4AC0 A;  3D1N I;  3MKL A;  2AO9 A;  4MFE A;  4D7N A;  4D7M A;  3ZQG A;  1U8B A;  2O7O A;  2DA7 A;  4B3A A;  2DMN A;  3JR9 A;  2JMW A;  1ETQ A;  4IHV A;  2R5Y A;  4LOC A;  3TED A;  2QF7 A;  1OCP A;  2L9R A;  1TWF J;  3H3V K;  1WGX A;  3A03 A;  3A01 B;  3BQZ A;  1BA5 A;  1X2M A;  1U9O A;  2YS9 A;  2E2H J;  3GTM J;  1JTX A;  4Y52 J;  4X1E A;  3FK7 A;  1H8A C;  1AHD P;  3UKG A;  3QPL A;  3JRH A;  4MLO A;  1LFB A;  1ENH A;  4AUX A;  3O8H A;  2MSY A;  3LNQ A;  3S16 J;  1OCT C;  4J19 A;  4BY7 J;  3BR3 A;  5JLX A;  4A3L J;  2YU9 J;  1EF4 A;  2Y9Z A;  2EZK A;  1I3Q J;  5C44 J;  3BTJ A;  1I50 J;  2EZI A;  2K9N A;  3HOW J;  1JUM A;  4IEJ A;  1FIP A;  2NOG A;  1NK3 P;  1QVU A;  4M3D A;  2FQ4 A;  3Q3S A;  2KDZ A;  2LR8 A;  2Y30 A;  2NVY J;  1MSE C;  4C3I J;  1JTY A;  2L7F P;  3GTJ J;  1ETO A;  3JRC A;  1JKO C;  5FKO A;  5F04 A;  1FEX A;  5F0C A;  1HOM A;  3M4O J;  4IHY A;  4EEF G;  5FKN A;  1Z0X A;  1F43 A;  1JUP A;  4ABZ A;  4A93 J;  3HKZ N;  3BTI A;  2X6O A;  4XK4 A;  5C4X J;  4XID A;  3Q0V A;  1XG1 A;  1Z77 A;  5K7F A;  2Y2Z A;  5M5W J;  3FK6 A;  1F36 A;  1U78 A;  2RAE A;  1ETW A;  2CU7 A;  4S0H B;  4XIC A;  3RZD J;  1AKH A;  2LFB A;  1TC3 C;  5EDN A;  3QQA A;  4W97 A;  2XB0 X;  4I76 A;  3E7L A;  3OOU A;  4A3I J;  4RDU A;  4IHX A;  2DA1 A;  4MO7 A;  2R92 J;  1ZKG A;  2NVT J;  1MBF A;  2M8G X;  2HYJ A;  3C2B A;  3VPR A;  5F0H A;  4IHW A;  3S1M J;  1OJL A;  4XRM A;  1YRN B;  3H0G J;  3BQY A;  3BR5 A;  2LLK A;  3HBL A;  3JRD A;  3RKQ A;  4M3E A;  1X58 A;  3S17 J;  1ETX A;  5EGO A;  1D5Y A;  3BR1 A;  1O4X A;  2LY9 A;  5J1U A;  2XGD A;  1PUF B;  1LFU P;  5J1Y A;  4JYK A;  2E2J J;  2KT0 A;  2XRL A;  1QPI A;  1ETK A;  2E1O A;  2ELK A;  1FJL A;  1GVD A;  2CQQ A;  4BBS J;  3FIW A;  4D5C A;  3LOC A;  4A3E J;  3NAU A;  4B4C A;  2DMU A;  2HQ5 A;  3IH3 A;  4C3H J;  4JX6 A;  3S1N J;  1IDZ A;  5GP9 A;  1B8I A;  2NVQ J;  3BT9 A;  2GBY A;  4DYR A;  1GV2 A;  2IEK A;  1NTC A;  5DS9 A;  2LP0 A;  1IV6 A;  3IV5 A;  5EYR A;  2XSD C;  1HDP A;  2M9H A;  3ZQH A;  1RKW A;  3HOX J;  4A3D J;  1IGN A;  2XPU A;  3WHC A;  2PMZ N;  2K40 A;  5GPC A;  3G1L A;  3HEF A;  3ZQF A;  1JKQ C;  3W6V A;  2FX0 A;  1IJW C;  4A3J J;  1NK2 P;  2P81 A;  2CJJ A;  4CYC B;  2O8K A;  4A3C J;  3Q0W A;  3TW6 A;  1UMQ A;  1RES A;  3JRB A;  1AKH B;  5IOZ A;  1Q1V A;  5IP7 J;  2NS7 A;  5M5Y J;  3BG9 A;  4L5E A;  2XGE A;  5E3L A;  5IP6 A;  5EG0 A;  1LE8 A;  2JJ7 A;  3BTC A;  3NAR A;  2L7M P;  3OSG A;  2HOT A;  2R93 J;  1TWA J;  5GPA A;  1T56 A;  5JLW A;  2DA6 A;  4DYQ A;  2FJ1 A;  1HF0 A;  1JJ6 C;  2ME0 A;  1P7J A;  2WB1 N;  1GUU A;  2Y9Y A;  4FTH A;  1POG A;  2MW8 A;  3S1Q J;  3JRF A;  2CUE A;  4A3K J;  5IYD J;  1JKP C;  2VKE A;  4V2G A;  5DTD A;  5FKL A;  4BBR J;  2R7Z J;  1FTT A;  3ZQL A;  1B72 A;  2JK3 A;  3A02 A;  1MH3 A;  2MGQ A;  1MSF C;  4JX5 A;  1K61 A;  4DW6 A;  5IYB J;  2DMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...