2EZKA

Solution nmr structure of the ibeta subdomain of the mu end dna binding domain of phage mu transposase, regularized mean structure
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
93
structure length
93
Chain Sequence
MIARPTLEAHDYDREALWSKWDNASDSQRRLAEKWLPAVQAADEMLNQGISTKTAFATVAGHYQVSASTLRDKYYQVQKFAKPDWAAALVDGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Mu end DNA-binding ibeta subdomain of phage Mu transposase: modular DNA recognition by two tethered domains.
pubmed doi rcsb
molecule tags Dna binding protein
molecule keywords TRANSPOSASE
total genus 22
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 1997-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ezkA00
2NVXJ 2DA3A 5K7FA 1T56A 3BTJA 5M3FJ 1B72B 3ZOBA 5K7HA 3RZOJ 5E3MA 3GBGA 2R93J 1MBGA 3QPLA 5C44J 3GTMJ 2R7ZJ 4BY1J 1P7IA 2HOTA 2L7FP 4S0HB 4RBOA 1X58A 2WAQN 2Y30A 3S16J 2JA6J 4V2GA 5GPCA 2FD5A 2MW8A 1H8AC 3S1NJ 1JKRC 3O8GA 4BY7J 1ETYA 2DN0A 1F43A 1RETA 2IEKA 2JMWA 3G1OA 3LSJA 1MH3A 5EDNA 2GM4A 1IDZA 3FIWA 1HDPA 3K7AJ 4QIWN 2CUFA 2EZIA 3MKLA 4FE7A 4IHVA 3BG3A 2E1OA 1XG1A 3I4MJ 1QVUA 1WCMJ 1DU0A 1IRZA 5GPAA 1MBJA 4HNVA 2D5VA 4I76A 2L7ZA 4DYQA 1A5JA 2XPUA 2OPTA 2XGEA 4M3DA 2Y31A 4D5FA 1GV2A 4D5CA 2LD5A 2DTZA 1JJ8C 2E19A 2HXOA 3A01B 1AU7A 2MGQA 2XPWA 2DA1A 4IEJA 3ZQGA 1JTXA 3Q0UA 2CQXA 5IYBJ 2NS8A 1FJLA 3Q0VA 5C3EJ 3BTCA 4DYCA 3GTKJ 3G1MA 3S2HJ 2VKEA 1JUSA 2PMZN 3OIOA 3JRAA 4XIDA 1JGGA 3HOWJ 2JK3A 1HDDC 1JT6A 1YRNA 3IH3A 3BG9A 1TWHJ 2FX0A 1BJZA 4AYBN 4J19A 2JA7J 2EZLA 2O9LA 2DJNA 5E3OA 2R5YB 3A02A 2NVQJ 3WHBA 4DYRA 4AC0A 3M3YJ 4B1RA 4I6ZA 1OCTC 2O8KA 1FEXA 5EF6A 2L0KA 3HDDA 3LSRA 3GTQJ 1QVTA 1SFOJ 2LP0A 5FKMA 1U9OA 3BR2A 1ETKA 1WH7A 2ELKA 2JN6A 3HGGA 4M3BA 2M9HA 3TEDA 3H3VK 1HLVA 4X1EA 3FK6A 3S1MJ 3BG5A 3C2BA 4BXXJ 3A01A 1RR7A 4L5EA 3IH2A 4XICA 3JRGA 4JYKA 3SJMA 3E7LA 2LKXA 3Q0WA 4W1UA 2ME0A 1QRYA 2XB0X 5F08A 2MG4A 3PO3J 1NTCA 4C3HJ 3TP3A 2ECBA 1H89C 3CMYA 1MBFA 5C4XJ 3OOUA 1VF9A 2EZKA 1Y1VJ 1RKTA 1HF0A 5IYDJ 1VI0A 3G1LA 3H0GJ 2HDDA 5FJ8J 4MLOA 1LE8A 2R92J 3S17J 1X2NA 1B8IB 2X48A 2CUEA 3HKZN 4BBRJ 2R5ZA 1LFUP 3BQZA 4QSHA 4IHXA 5FLVA 3HB9A 1TWGJ 3MVPA 2Y0SN 1FIAA 2AHQA 2HYJA 5FKOA 4UUTA 2DA7A 1W0TA 1GVDA 1JKOC 1B72A 2H1KA 3BR1A 3B6AA 3OSFA 4FTHA 2E2JJ 1TWCJ 4A3CJ 2EBIA 5DTDA 5F0FA 2DA5A 2LK2A 4EEFG 3WHCA 3S1QJ 2CQQA 2LR8A 1LFBA 3W6VA 1MBKA 5E3NA 3BR3A 1XS9A 3S1RJ 2E2HJ 5IP7J 3FKIJ 1MSEC 1BW6A 1WH5A 3NARA 3BTLA 2E2IJ 1PUFA 2GBYA 5M5XJ 2LTPA 2HXIA 2X9DA 1IC8A 4IHYA 3I4NJ 4DW6A 1APLC 1U78A 1U9NA 1MH4A 2ECCA 1RPWA 1RKWA 2FQ4A 2K9QA 1Q1VA 5IOYA 2ZB9A 3S15J 2EZHA 3HOXJ 2NVTJ 5IOZA 1ZR4A 5EG0A 2IBDA 1A6IA 2EQRA 5M5YJ 4V2FA 2IAIA 1ZGWA 5M3MJ 1K61A 1LE8B 1OCPA 1DU6A 5FKKA 2VI6A 5F1JA 9ANTA 5K7ZA 1T33A 2P81A 1WI3A 3BQYA 4QTRA 3IV5A 1CQTA 1FTZA 4A69C 4A3BJ 1U8BA 2DA6A 1ZR2A 1AKHA 5F04A 3MN2A 3LOCA 1ZKGA 4W97A 3PO2J 2M2EA 2DMQA 1I6HJ 1NK2P 1ZK8A 4D7MA 5C4JJ 3D1NI 2R0QC 4XRSG 4A3MJ 2M8GX 2KT0A 3JRCA 1FTTA 3TW6A 1BA5A 2WV1A 4ABZA 1K83J 1IDYA 4D7NA 1VFCA 1ORKA 3IH4A 1GDTA 3CDLA 1MBHA 2ME6A 2DMPA 2LFBA 3NAUA 1TWFJ 1MNMC 3HOYJ 2M34A 3HOZJ 2M0CA 2TRTA 2K40A 1JKQC 1H88C 4DZJA 3HOVJ 2XSDC 1X2MA 3HEFA 2NOGA 2LY9A 4BKXA 5IYCJ 1E3OC 3F0CA 4C3IJ 5EEAA 2JWTA 2Y9YA 4A3GJ 1YRNB 5FKLA 1O4XA 3SDGA 5J1YA 3LSPA 1ZTRA 2DA4A 3QQAA 2YU9J 1TWAJ 5IPAA 1ITYA 3ZQLA 4XK4A 5JLWA 5FKNA 1P7JA 3JRFA 3M4OJ 3S2DJ 1MBEA 2K9NA 1IG7A 4G12A 4JX4A 2GLOA 5F0CA 1VNDA 4GFBA 5JLXA 4UUSB 3JRHA 1AHDP 5EG0B 3QPSA 4A93J 3HBLA 3LNQA 2ID3A 4A3DJ 1FIPA 1S7EA 2LVSA 3ZQCA 4C3JJ 1GV5A 4JX5A 3GTOJ 2YS9A 1IV6A 3S14J 2I10A 3DEWA 3GTLJ 4UUSA 4B3AA 4JX6A 2Y9ZA 4Y52J 2X6OA 2XPVA 4FISA 1QPIA 4RDUA 3TW7A 5IP9J 4A3JJ 1G2HA 3UKGA 4B4CA 4XRSA 1HCRA 1I3QJ 1EF4A 1W0UA 1HOMA 2XGDA 4BBSJ 1ETWA 3BR0A 2K9SA 4XRMA 2OF7A 2B63J 2JJ7A 3HM5A 4DZPA 2QCOA 2O7OA 2H8RA 1R9TJ 5DS9A 2CJJA 2HQ5A 2HI3A 1XC5A 1JUPA 3HGYA 1I50J 2NVYJ 2FJ1A 1JTYA 2RAEA 1IGNA 1B8IA 1TC3C 4MFEA 3L1PA 4A3FJ 3PM1A 2JA5J 2XRLA 1Z0XA 2DMUA 2KDZA 2N8GA 3ZQFA 5J1RA 5M5WJ 4M6VA 1OFCX 1JKPC 1Y1WJ 3CQZJ 1UMQA 2VKVA 3A03A 3VPRA 1RESA 1WPKA 3BR6A 4MO7A 3OSGA 1ETQA 2DA2A 3FK7A 3JRBA 3GTGJ 3LSGA 3BR5A 3Q3SA 1ZQ3P 3SFIA 4A3KJ 3K2AA 5J3LA 1UG2A 5FLMJ 2CU7A 2EH3A 3JRDA 1JJ6C 2ID6A 3TP0A 2VPRA 2AO9A 3GTPJ 5J1UA 1UHSA 2HOSA 4A3EJ 2YUSA 1PUFB 1ETVA 2DMNA 3RZDJ 4A3LJ 4AUXA 3RQIA 1BL0A 4JP0A 4LOCA 4C2MJ 1NK3P 2DMTA 3JRIA 1GT0C 2R5YA 2CRGA 3JREA 4CYCB 5EGOA 2NS7A 1IUFA 3FISA 1JT0A 1MSFC 1OJLA 3BTIA 2XB5A 2L9RA 2Y2ZA 4IHWA 3O8HA 1WGXA 1BW5A 2TCTA 4Y7NJ 1AKHB 4FCYA 1ENHA 3DCFA 1POGA 3ZQIA 5HODA 4X6AJ 4NDLA 4A3IJ 4M3GA 5EZHA 4M3EA 5EGOB 3JR9A 1GUUA 5EZGA 2W48A 5E3LA 3BT9A 2WB1N 2HOAA 1ETXA 3ZQHA 1JUMA 3RKQA 1SANA 5F27A 5GP9A 3HOUJ 2COBA 3CCYA 4MIMA 1D5YA 5F0HA 5IP6A 1IJWC 4MFDA 1F36A 2R5ZB 2JA8J 2VUMJ 1ETOA 3B6CA 4M3FA 2LLKA 2MSYA 1Z77A 3GTJJ 5BNGA 4CYCA 5EYRA 2L7MP 4FE4A 2XGCA 2QF7A 2G0EA
chains in the Genus database with same CATH superfamily
2LRDA 4KIGA 5K7FA 2UZKA 5M3FJ 4XKBA 2V9KA 3LFKA 4PCQA 3TMOA 1N75A 2OAZA 4CCLA 5H2FC 5K7HA 4ENNA 5JHUA 3GBGA 3P9IA 4PSWA 5C44J 2DTRA 3GTMJ 1N77A 2CO5A 2FA5A 3RPUA 4H0EA 3I9V2 2EFPA 4XMYA 1XX5A 2RQPA 4XM3A 3KYLA 2NYXA 1R4NB 1KU9A 3DF8A 4WF2A 2M45A 4V2GA 2BEOA 4B47A 4HYEA 4RGRA 1GVJA 3S2WA 3KEQA 3CP8A 3CMAI 4B8XA 5GAGJ 3LA3A 2QLZA 1X1DA 2XDVA 3VDXA 4QPOA 1G3WA 4MTDA 2KJBA 1MH3A 2JVGA 1U8RA 1E17A 1XTAA 2V1XA 5J40A 3I54A 5F1RA 3J7ZI 1IDZA 3CD6I 1VQ6I 4LK1F 2DW4A 4RB1A 4KFCA 1FPQA 2DFHA 3MKLA 5CVIA 3RPUD 4IHVA 2A6TA 4I2OA 2E7XA 1XG1A 2M5WA 2EWNA 3SZGA 1WZ2A 3DKYA 1R4MB 1MBJA 2LC2A 3JCUC 1QZZA 4P1WA 1FYLA 3QPTA 4DYQA 1UHMA 3CO7C 1ZG1A 2XPUA 3RYPA 1A5JA 2XGEA 2YX4A 3FXQA 1DQUA 1J75A 5FROA 2F5VA 2HVSA 4D5CA 4NUBA 4E70A 2LNBA 1UAAA 2FMYA 2KISA 2WAQA 4CHUA 4L0YB 2HFHA 3A01B 2QKMB 2MGQA 4AM3A 1W36D 1Z67A 4OWRB 3SFZA 4LITA 1E2XA 3CUQC 4HOBA 1Z1DA 2XKPA 4LG0B 1BR2A 2B0LA 1SD5A 1X1AA 3AG1H 1YS7A 2R7VA 3OIOA 4RAGA 2ZCWA 2B9SA 3JRAA 1JGGA 3VSKA 5D6FA 5DEQA 3PL8A 3RYRA 1PDNC 3HOWJ 2YPRA 2L2OA 1JT6A 3FM5A 1YRNA 4M9SA 4HSRA 3BG6A 5DCFA 1LVKA 3OS1A 2MC4A 4J19A 5ERIA 2EZLA 3K6GA 1K4TA 2O9LA 2R5YB 2ZC2A 2AQEA 3A02A 5FB2A 3NWSA 2ZJRF 4K2EA 2ZO4A 3HC7A 1FEXA 2VB6A 4BXUA 2ZFUA 2GAUA 2BY2A 2EV0A 3DEEA 3OYHA 1FYKA 3J7YJ 2IA0A 2ELKA 1ZRCA 2M9HA 2ESHA 2CW0F 3BZ6A 1ULYA 4OINF 5HNHA 4NBQA 3K4BA 2LKPA 3GCMA 4PZJA 3OYIA 3TOAA 3CDIA 3A01A 4L5EA 1R49A 5L3CA 1RI7A 1MDMA 2L3DA 1LDDA 2LKXA 3Q0WA 1Y0NA 2G7HA 3A1YA 3MKZA 1N78A 3PUBA 2MA3A 3FXRA 5F08A 5IT3A 1OR7A 1NTCA 4NB5A 3ZCOA 1H89C 2TDXA 1XD7A 3SEQA 2FSWA 4WWCA 5E79C 5E20A 3DTKA 1WJFA 3OOUA 5C4XJ 1VQ4I 5E1WA 1RKTA 4IKFA 3EUHC 1FMWA 1YI2I 2QSHX 1MMGA 3F8MA 4BQOA 1VI0A 2CUJA 2W84A 2P5LC 1ZRDA 3VWBA 4MLOA 3ISPA 1LE8A 3OY9A 4A0XA 2HQAA 3C7JA 1A36A 1XGOA 4WX9A 2R5ZA 1LFUP 1REPC 4QSHA 1NH3A 2Z16A 3NEUA 4CDGA 4IHXA 5FLVA 3SDBA 3HB9A 2K3FA 3WG7H 1YE9A 3I0TA 2HYJA 3FWEA 4UUTA 1QA6A 2CG4A 2KRHA 5HS7A 4GCVA 3VYTB 2QENA 2A05A 2BY0A 4P5OA 3OSFA 3DPLC 2E2JJ 1TWCJ 2BXYA 1KQ0A 4IL6C 3ZRGA 4AVPA 5JVGF 2CQQA 2LR8A 1LFBA 3W6VA 3VB2A 4YIRX 1FMVA 3H3UA 5IP7J 1BW6A 3OL4A 3FXKA 4CGZA 2OTLI 2RDPA 1KQ9A 1FOXA 1OYYA 4G7HF 4EJTA 5FO5A 2Q2EA 2XHKA 2IS4A 2ZB9A 2EZHA 2NVTJ 1MMNA 5EG0A 5AIQA 1BC7C 1OISA 2BV6A 2GIVA 4Y4RA 2M7AA 2XAUA 3D5LA 3KP4A 2L5QA 4V2FA 2IAIA 2WY8Q 2QQAA 4PK4A 6PAXA 1RR8C 2VOOA 1PP8F 2CV0A 4KA4A 2PG4A 3F22A 1T33A 3LSMA 2JPCA 3HPHA 4HA8A 2BHZA 2DA6A 3HOTA 4IXAA 1WQ2A 1P6RA 1AKHA 2R7SA 3U1DA 2W24A 4W97A 1Z6RA 3QYEA 4KNYA 1NK2P 2JPBA 2BZTA 1U2WA 3LFUA 2K9MA 2YSRA 1ZREA 4OIPF 4II2A 3JRCA 3GUDA 2P0WA 3ZMSA 4BE0A 3CLQA 3Q9VA 4ABZA 1TZLA 1KGSA 2K86A 3LQRA 1ORKA 2DMPA 4WK8F 3HOYJ 4X0GA 3HHGA 3HOZJ 5A2QZ 2M0CA 4RB3C 1JKQC 3M8FA 4DZJA 4Y3OA 1X3ZB 2QSGX 5LBQA 4ETSA 3S93A 1EH8A 1D0ZA 2LY9A 3IKVA 4BKXA 2XAHA 2IS6A 1O3TA 3U1KA 2VJ4A 5D4SA 5BQTA 3RTRA 4O3MA 2FOKA 3GZ6A 5ILVA 4HQMA 1TL8A 4GYGA 4JQFA 1USTA 2GXBA 3S3MA 2EFQA 2J5OA 2KZVA 2Y9YA 2FMLA 4QPQA 2CGPA 3P9KA 1UELB 1DPUA 1ZTRA 3MZ8A 5J47A 3JTGA 3KP3A 1LPQA 3EUAA 1SVMA 1RUOA 2V1DA 2YU9J 2R7UA 5L3BA 4XK4A 1MD0A 3AG2H 1P7JA 3M4OJ 1SMYF 3J80K 4C2UA 2K85A 4G12A 1WJBA 5CVVA 3OIQA 5ICFA 4JX4A 2BVMA 4YG2F 2W82A 3ZPLA 5JLXA 5H6RA 2HOEA 5EG0B 1W4MA 4NQWB 3HBLA 1O7FA 2PLYA 2X6YA 4FX4A 2D45A 4UV8A 3LAPA 4LGWA 1XMAA 1SAXA 1J2XA 3K4CA 4O5VA 3LWFA 4HF0A 2EJRA 5CKTA 2EIJH 2XGXA 1D8KA 1I3AA 5LEJA 1LDKB 3GLXA 3OYFA 4UVAA 2K4BA 1WI9A 4RAFA 4WCGA 4UUSA 4B3AA 2KRCA 3RKYA 2KFDA 3Q9SA 2Y9ZA 3CLOA 4BE1A 3QRFF 2JQ7A 4A3JJ 2AXTC 2JVHA 3ULQB 2M4KA 2OU2A 4U0YA 1HCRA 1R23A 2IPQX 1EH7A 5BS6A 4V19K 1JXSA 3LA7A 1FSEA 2OF7A 2OQRA 2R7QA 3ONQA 3QAHA 5LHGA 4XRMA 3DBLB 3IP4B 2VQLA 2KL4A 2DYRH 1DP3A 2O7OA 4OAYA 2H8RA 3HKZA 1GXPA 4P9UA 5DS9A 2XAGA 2CJJA 1ZN2A 2MH9A 4BJTA 3H3ZA 2HWVA 2IP2A 3QU3A 2OBPA 1Q1HA 2FJ1A 2L9VA 3F8NA 1XPXA 1IGNA 3EYIA 2OTJI 4MFEA 5IT9Z 3DLAA 2LBFA 4L9JA 1G59A 3H5AA 2DMUA 3GX4X 1A04A 5M5WJ 4MNUA 2DODA 3CJRB 1A31A 4CCMA 4A12A 4M6YA 4DOZA 3CQZJ 3DXJF 3VPRA 5D5XB 3BR6A 1WPKA 1W5CC 2DA2A 2HYGD 3FK7A 3R0AA 3WG9A 3WTYC 1G3SA 1NHAA 1K6OA 2AS5F 2H94A 3PNTA 3SFIA 3ELKA 4M9XA 4UV9A 4NNJA 2CU7A 3CUQA 2ID6A 1D1BA 1YHQI 1WFXA 3A0BC 5J1UA 3GXOA 3WTZA 1UHSA 4CSWA 2HOSA 3QP5A 4AWXB 2Y69H 2JRTA 2DMNA 4A3LJ 3BY6A 1BBYA 3OYAA 3J81Z 2VBZA 1HA8A 1B4AA 3DWLE 2NXNB 3PSIA 5H20A 4PGGA 3JRIA 4G7ZF 3JREA 3E97A 1SVOA 4AIKA 3ERED 2QBYB 4DNCA 2P7CB 1JT0A 5EJCA 2XB5A 1MGTA 4WXDA 4HV5A 1WGXA 2KIMA 3H36A 3F3XA 4ENKA 1B9NA 1BI1A 2BVLA 4KT5C 3BJOA 4KDPA 1L3LA 1POGA 1ZRFA 2O03A 2VBYA 1DPRA 4KN7X 3ROUA 4X6AJ 3MKWB 5BPDA 4A3IJ 5FRNA 3CP2A 5EZHA 3JR9A 4UY8I 3PQKA 1GUUA 4ZTFA 3GEZA 5EZGA 3QYFA 2WB1N 4XKVA 4HPQA 2HOAA 4EQQA 3KYCB 2RVCA 1X19A 1JGSA 3CZ6A 3RKQA 1HW1A 1JHFA 1HKSA 5D5WB 1VQPI 2IGOA 3CCYA 1W7PA 1IJWC 2FUG2 4B44A 1R1UA 3E5QA 1F36A 3OYJA 2ELJA 1A6QA 1FBSA 4F55A 5K5OA 1EKEA 3EUHA 3UNGC 3B6CA 4M3FA 1XSVA 3WTVC 5BNGA 4CYCA 4XORA 1X4PA 2XAFA 2XGCA 3FMRA 2QF7A 3PIOF 2NNNA 2V7FA 2DA3A 2DT6A 2A5WA 3CCJI 2A6EF 3BTJA 4Y13A 4BAYA 1S7OA 1MBGA 1B59A 1SVLA 5HLTA 1SD7A 3F6OA 2E1MB 1R00A 3DPTA 2R7ZJ 4E7SA 5E8GA 5J4VA 1VQLI 2L7FP 3JAMZ 2DOAA 2F5EA 1AOYA 3WU2C 2VBWA 2WAQN 2Y30A 3S16J 3DKWA 4UVCA 3HJEA 1HW5A 2MW8A 4Z6YA 4IO9F 4E6KG 4P55A 2BXZA 3U21A 5FFXA 4BY7J 1QZEA 1D1AA 1RETA 3BG7A 3DP7A 5EDNA 2JSCA 3KX2A 2ZNZA 1KQ8A 2GOMA 1BI3A 1HDPA 2VXDA 3K7AJ 4QIWN 1OYWA 1TBXA 3JW4A 1Z3YA 2MH2A 3E6CC 1IRZA 2K9LA 2F48A 2D5VA 1EV7A 4I76A 1MDMB 3H5RA 3OS0A 1ZG5A 2OPTA 5BOXA 3L2CA 2R7WA 1WJDA 2NS0A 4I01A 2DTZA 1JJ8C 2E19A 3DU6A 3KP2A 1R1VA 3EPZA 5HS9A 4C9YA 2VC1A 3KP7A 3PNYA 2XPWA 1O3SA 1ZARA 2DA1A 2DXIA 4OIOF 3JSPA 2ISZA 1GLNA 3GFIA 5IYBJ 1WSUA 4MHGA 4PJ0C 1FBQA 4CA0A 1PVEA 5C3EJ 1S9HA 3G1MA 4AIHA 2HDCA 3K1PA 4B3XA 3CCQI 1JUSA 2K02A 2PMZN 1BI2A 3MEXA 3FXLA 2HPMA 1OR7C 5FFZA 3DTIA 4XIDA 3FKJA 3WGHA 3HHHA 3HRUA 2KMUA 3KEOA 1HDDC 2UV1A 4GYIA 3K70C 4RGXA 3DV8A 4RB0A 1SFXA 4R8HA 3N4MA 2MC3A 2Z3YA 2FBIA 1EH6A 2J5PA 3GZNB 4GXOA 2DJNA 5E3OA 2NVQJ 3LMMA 4B1RA 3PIPF 2O8KA 3I5UA 2KQRA 1YX3A 3GTQJ 1QVTA 1SFOJ 3FBNB 2BE5F 1U9OA 2WV0A 3GF2A 3ZMZA 1XDUA 1WH7A 2KPMA 3K0LA 3OYEA 2CFOA 3TEDA 4Q48A 3FK6A 3V8JA 5B1BH 3K4MA 2L9NA 3BG5A 3WGIA 3IRQA 3AFHA 4IPAA 2V9PA 4CH7A 4BXXJ 3V7RA 3IH2A 2IT0A 3E7LA 5J4YA 1ZGAA 2B7EA 3TL4X 1IXSB 3JTHA 4PFOA 2X6WA 2MG4A 3PO3J 3G2BA 4YIIA 3TO7A 2CFXA 4C3HJ 5TGTA 4BEHA 4RAYA 2PI0A 3BLYA 1FX7A 1IV8A 1MBFA 1T0FA 4O6JA 5HLGA 1VF9A 3HUGB 1W5SA 3GFLA 4RMNA 4UXNA 1XDSA 4C2TA 2VODA 2EV6A 4XN0A 4YEJA 5LHIA 1PP7U 3H0GJ 3G1LA 2W4SA 2UUZA 2KP6A 3AAFA 2F4IA 1YG2A 3CCVI 1Z91A 4FETA 3ASNH 3S17J 4OU0A 1B8IB 2X48A 4E7HA 3ASOH 4BBRJ 1T8IA 3M8JA 1SFEA 4RGSA 5J8FA 1F9NA 1IRFA 2NOJB 3D5SC 1TWGJ 3MVPA 1FIAA 2AHQA 2LYCA 3WE2A 2DA7A 2ESNA 3ECHA 1B72A 2H1KA 2BOLA 1E3HA 1FT9A 1ZG3A 5DTDA 1B9MA 1J0RA 5F0FA 2LK2A 3D0SA 4EEFG 1SC7A 3WHCA 1A35A 4ZC3A 1MBKA 2A69F 3C2GA 3FKIJ 2DOEA 2E2IJ 4HG2A 1IC8A 3T8RA 4YELA 1APLC 4IX7A 1U78A 2ZXIA 1P9QC 3HRMA 2FQ4A 1Q1VA 3MWMA 3S15J 3FXOA 4L9TA 2CW7A 2W85A 5KCMA 1LUJB 5M5YJ 3QOPA 1QBJA 3VODA 1K61A 5GTHC 5ICCA 2VN2A 3DBHB 2VI6A 5F1JA 5D6EA 2KZGA 5K7ZA 1I1GA 1WI3A 2QM3A 1FTZA 3FBIB 4A69C 1U8BA 1ZR2A 3CF5F 4BHBA 1ODDA 3LOCA 2EINH 3BC8A 2DMQA 4HRIA 2DT7B 4D7MA 5C4JJ 3D1NI 1IN4A 2V1UA 2M8GX 3ZP5A 3H9GA 2JUCA 3GFMA 4ITVA 1K83J 1IDYA 3G71I 1GDTA 1ZELA 1MBHA 1VQ9I 2C6YA 3LQQA 3RCOA 4R79A 4S04A 3ZQ7A 1MNMC 1DGWY 1FLIA 3RI4A 3M8EA 2WB1A 4XR6A 3BJAA 2XSDC 3MAJA 1WJCA 3CF2A 2LREA 3TDUC 5DUIA 2KIFA 1H0MA 1U6GA 2E71A 5FLXK 5DYMA 2JWTA 4AYBA 3DTEA 2P5VA 2JRMA 3MCZA 4L5JA 1H9TA 2VLAA 3GMEA 1O4XA 2VPLA 3SDGA 1YIJI 3H0DA 2DA4A 1FWZA 2OA4A 5K1YA 4AIJA 3AG3H 4XLPF 1MNEA 2OCEA 3RKWA 1ZHFA 4FX0A 1Z7LA 2H09A 1MBEA 3ABKH 1MNDA 3BPXA 5F0CA 4DIQA 3L2QA 2GXGA 2LDUA 4J01A 1SMTA 1AHDP 2IS2A 1TQPA 3JAMK 4L0ZB 1Y39A 4FHTA 3LNQA 4FQGA 3CTAA 4I09A 4BACA 1FIPA 1K6YA 3NQOA 1S72I 1R7JA 2HZDA 3TQNA 2CS3A 2ZMEB 4XLNF 2QGUA 5ED4A 3TBIA 3GTOJ 4PUSA 3CMEI 3AL0C 2M1BA 1IV6A 3S14J 2BYVE 3TO9A 2CMPA 1BR1A 3DEWA 1J5YA 1FC3A 1MKMA 4EVIA 3GTLJ 1VQKI 2DQLA 1IN8A 4AD9A 2X1DA 4Y52J 2X6OA 4ZYDA 4HLXA 4LIUA 2LG4A 2M87A 4RDUA 3TW7A 3L2RA 2W57A 1QPIA 1QHHD 5D8LB 4M71A 1R6RA 2UWMA 2CQNA 2BGCA 2HQRA 4JK1X 4M72A 1CGPA 3BR0A 2B63J 3R4KA 2XF5A 1BN5A 5FGMA 2ZMEA 3K1NA 4U0VA 1U3EM 1I50J 2NVYJ 2QA4I 1JTYA 1D0XA 1HSJA 1MJBA 1I39A 2RAEA 4XL9A 5AIPA 3OIPA 3PM1A 4M73A 3N97A 2XRLA 1M1EB 3ZMTA 3I55I 2HR3A 2ZJ2A 4HX8A 1ON1A 4M6VA 2VQGA 5AONA 1OFCX 3ZXSA 1V55H 5L3GA 1Y1WJ 2FBHA 3LSKA 3F8BA 5F64A 3JRBA 4UB6C 4XOPA 2H27A 3LSGA 3BR5A 4XONA 3KIOA 2LY1A 4A5MA 5CJ9A 3DLLF 4A3KJ 3BZCA 3PFYA 5FLMJ 2EH3A 2M0MA 2VPRA 1QO0D 4IOCF 3WGGA 4DJAA 4B48A 1ETVA 3RZDJ 3RQIA 4JP0A 4L9VA 4LOCA 3MFKA 2W00A 2DYSH 2DMTA 1LQ1A 1FP2A 4OOIA 3FHNA 5DDGA 1Y8RB 1STZA 4KJZA 3GVAA 1S7AA 1VZ0A 1I6XA 1YIOA 4CYCB 2DFEA 1VQNI 2CH0A 3P5JA 4LFUA 1JHHA 4HQEA 2CW8A 2KIQA 2IVMA 1PYVA 2MYSA 4PFPA 5KHDA 2Y2ZA 3O8HA 4XLCA 2D1VA 3K9TA 5J8CA 3CCLI 1W7PD 4HLYA 1AKHB 3ABLH 2GOXB 4N0BA 2PX9A 3HTUA 2DDBA 1VQ5I 5E1ZB 1RRJA 1V5EA 1HSTA 1XB4A 1TNTA 3DCFA 3IC7A 5DCMA 4CCKA 3ERMA 3ZQIA 2F5CA 2F5FA 4ZZDA 2NNYA 1F4KA 4E4HA 2W25A 5EGOB 4ZYHA 2ZXWH 4ZJZA 3SHFA 2W48A 3BT9A 1G8XA 3ZMUA 4BQQA 1ETXA 3IHUA 4KMUX 2CSOA 5GP9A 4KICA 4HDUA 4RAZA 5EEHA 5IY5H 3ZMDA 3HOUJ 4F92B 3CC4I 1YJNI 2MD5A 1IN7A 4MIMA 3T5XA 2YU3A 4RM3A 2K3PA 3SYTA 5F0HA 2R7OA 2FXAA 5IP6A 1D5YA 2FQ3A 2M7BA 4MFDA 3IKTA 2R5ZB 1G3TA 1P4XA 4EMSA 1DDNA 1D5VA 3U2RA 4PJJA 1TW3A 2O6GE 4LLGF 3IAM2 3W6JB 2ZSIB 1WJEA 4ZDLA 2L7MP 1B6AA 3IWZA 4FE4A 4NQWA 2EA2A 2PBIA 4BHCA 2EPFA 1Z05A 1KYWA 2IA1A 3ZOBA 1IN5A 2KIUA 4A2UA 1SAUA 5E3MA 3HTSB 3MD2A 2R93J 3QPLA 3K4JA 1FNNA 1LKXA 2EFWA 2QQBA 1J09A 2GZWA 2HOTA 4RBOA 1X58A 2L54A 3PSFA 5E8IA 3PQJA 4Z2YA 1ETYA 2DN0A 2Q2EB 2WADA 4IQJA 2WTEA 2CV2A 3BP8A 2HTJA 4I0BA 4RB2C 4CCJA 3F6VA 2JMWA 4DBRA 3K70D 1O7LA 3LSJA 1JE8A 1D8JA 4HSTA 1U5TB 1O3RA 3FIWA 4RA2A 1F5TA 3VEPA 2CUFA 3FDYA 5BPIA 2R7DA 4E7IA 3BG3A 1YFHA 4MTEA 1V4RA 3I4MJ 1QVUA 3QWLA 3BOQA 3OYLA 2FOWA 3H9QA 2CV1A 4HNVA 3K10A 1BIBA 2ZNYA 4BS9A 2ZJQF 4Y17A 4G7OF 1H88C 2R7TA 3L2UA 1YYVA 1ZH5A 3E3VA 3O3KA 1NG6A 2RV8A 4AIDA 1HXDA 2Y31A 3TO6A 1GV2A 4XNFA 4XSZF 4I98B 2I5UA 4IVNA 1YW7A 3T8TA 4ANJA 2QZ8A 2DO7A 1AU7A 3VYUB 3OMYA 2QQ8A 3FF5A 4ZZLA 2MD0A 5CVUA 4J00A 3ZQGA 1JTXA 1T98A 1HW2A 3Q0UA 5HDGA 2PQ8A 2CQXA 3I58A 1D1CA 3CJQB 5LHHA 4IQ4A 3W6KB 4KN4X 3OL3A 3Q0VA 5ILUA 2IRFG 3F23A 2Q8KA 3S2HJ 2VKEA 5TISC 3E1SA 4HAMA 4BEHB 5FD6A 5KNLA 4WXCA 1W5TA 2PJPA 5FLXZ 2PMZA 2PFBA 1W1WE 3IH3A 3BG9A 2BBYA 2XIGA 4IRGA 3S3OA 1TWHJ 2FX0A 4C30A 3KZIC 5KAIC 4AYBN 2VOPA 1IN6A 2R7XA 1FOKA 2GQQA 3ABUA 3WHBA 4DYRA 5DV5A 4WXHA 4AC0A 1SFKA 4EGZA 2HEOA 3M3YJ 1OCTC 4ZH4F 2L0KA 3RPQA 3LSRA 1S3JA 5CQEA 5ICGA 4HF2A 3FM3A 2D1HA 1BIAA 5K5RA 4IF4A 4PSXA 1O57A 2JN6A 4LB5A 3HGGA 4M3BA 2XROA 3H3VK 1UB9A 4RLQA 1HLVA 2OZUA 4X1EA 4XLFA 3KETA 3S1MJ 1P92A 5F6FA 1XCVA 4CZZA 1W7PB 4XICA 3JRGA 4JYKA 3EETA 2W7NA 4KIFA 2PMUA 3OWTA 1J9IA 4W1UA 2ME0A 3L7WA 1YO5C 1QRYA 4NC8A 2QBYA 2K27A 2FNPA 2XB0X 2XAQA 4YIFA 3E5UA 3ZN0A 5HDKA 3KE2A 4XN3A 2XF7A 2ECBA 3CMYA 1T6SA 1YX5A 2BY3A 1NG7A 4YRVA 4HF1A 1Y1VJ 3R0JA 2ZSHB 3P9CA 1HF0A 3FXUA 4A6EA 2FNAA 1ONVA 3V8KA 5IYDJ 3OYNA 1D3YA 3EUKL 2HKXA 5CPRB 5FRMA 1QPMA 5B3SH 2CUEA 5FD5A 4NHJA 3PUFA 3MMYB 5A2QK 3ABMH 1YJ9I 4KUMA 2Y0SN 1P4AA 1MW7A 5FKOA 3GZ5A 1R5HA 3OOPA 1VQMI 1IRXA 1FOYA 1LNWA 4XLHA 1GVDA 2QVOA 1JKOC 3SQNA 5JFRA 1Z9CA 3B6AA 3E6BA 3S3NA 2VQHA 4M6XA 2M4GA 4FTHA 4EM1A 2ZJPF 3LSTA 4A3CJ 4N9IA 2DQRA 2EBIA 1S6LA 3S1QJ 2QEXI 3OYDA 5E1XA 3U9GA 5E3NA 3BR3A 2CWEA 1I27A 5BMZA 1XS9A 3DBRB 3S1RJ 2E2HJ 2OCCH 3G4SI 4Y15A 3NARA 1PUFA 3LAJA 2LF7A 1U9NA 1MH4A 2ECCA 2XVCA 1RPWA 1WHUA 1RKWA 2K9QA 3HZJA 5IOYA 4BDZA 3J80Z 1WJ5A 3AG4H 5IOZA 1ZR4A 5CVRA 1TT0A 4UHTA 1YQAA 2E60A 3F21A 2R7RA 3I53A 2F4MB 4AVZA 1OCPA 4IJAA 1DU6A 1MZBA 4YFKF 3WE3A 1IF1A 1UJ8A 3W3CA 2E1CA 3BQYA 5L3EA 4RM2A 1U5TA 4A3BJ 4ENMA 4EM2A 2GIZA 2MLKA 3MN2A 3IRRA 2XUBA 2H1LA 1TQMA 2P4WA 1HKTA 1ZK8A 2R0QC 3F72A 2V6EA 4XRSG 1QNTA 4A3MJ 3I59B 2KT0A 3L00A 4FASD 4P9FA 1ZGJA 3TW6A 1BA5A 3RJPA 4D7NA 3DFGA 3BDDA 4XLEA 3IH4A 1X4OA 3CDLA 2ME6A 3NAUA 3CJTB 1UHWA 3CMMA 3OYMA 2F2EA 1S5LC 2K40A 3A0HC 3B02A 3CESA 5DD8A 2NAZA 2WBMA 4LG0A 3HOVJ 1RNLA 1X2MA 2X0LA 3HEFA 2JTVA 1K78B 4KYWA 3WTUC 1E3OC 3OYCA 1YJWI 5D5VB 3FHZA 1OCRH 2DLLA 2R4GA 2VJJA 4C3IJ 1X1BA 5EEAA 3KP5A 4P96A 5HDNA 3CO6C 4A3GJ 1YRNB 2LSOA 2L7KA 3GW2A 5DCMB 4QLCU 3GYHX 3HIFA 4G9YA 5J1YA 2DK8A 3I4PA 1TWAJ 1ITYA 5DM7F 3C3WA 1J59A 5JLWA 1X1CA 2XKOA 4CZCA 1O3QA 3P7NA 1ZLKA 1E3PA 4HNUA 2UXNA 3S2DJ 4XKWA 1IG7A 2K9NA 5J6XA 3Q5FA 1K4SA 3S32A 3WTWC 2Y48A 3HSFA 1QU3A 3FMSA 3I3LA 2K5CA 3KCCA 3OYGA 2GLOA 4GFBA 4M9ZA 1K78A 4UUSB 2BY1A 3JRHA 4BJ6C 4OMYA 3QPSA 5B1AH 4B43A 1J7KA 5D4RA 4A93J 1Z7UA 2KDOA 1QQIA 1R58A 2YR2A 4HBLA 2ID3A 4HX4A 4PJNA 1U0JA 1S7EA 2Z33A 1V54H 3ZQCA 4C3JJ 5LGUA 3SXYA 2VKHA 3H9JA 4CCNA 1VQ8I 2EA4A 5D5UB 3FZVA 3QYBA 3V7SA 2YS9A 4BGDA 1PJRA 1UCRA 2DI3A 4HX7A 2QSFX 1Z21A 2V26A 5JVTA 1CF7A 2GA2A 2XPVA 2STWA 2M8EA 2A68F 5IP9J 1G2HA 4LMYA 2LBFB 5LGTA 2FRHA 4XRSA 1YLFA 1I3QJ 2P7VB 3K4KA 4DQ2A 1W0UA 1HOMA 2XGDA 4A6DA 4BQNA 4BBSJ 1YS6A 1ETWA 1MIJA 3BWGA 4JOMA 3OYBA 5DM6F 1T0FC 3V42A 2HQNA 2XAJA 4DZPA 2QCOA 1XSDA 1BR4A 1R9TJ 2LF8A 2HI3A 1FOWA 2ZXJA 1KU2A 4LK0F 3HGYA 3MZHA 1RC9A 2EK5A 3BCAA 2P8TA 1B8IA 2VT2A 3L1PA 5LRSA 4BL0B 2VJIA 2Y75A 1Z0XA 3K69A 2N8GA 2V79A 2QWWA 1MJAA 1XGSA 4G6DA 1T08B 2VC0A 2JUGA 4F91B 1ZAOA 4MEYF 2IJLA 3WU1B 1UMQA 3OSGA 1LEAA 3WTSC 1ETQA 2V4JC 4BU2A 1RIOH 1G6NA 1BM9A 1LFPA 3Q3SA 3ZR8X 3B73A 3HL2A 4CICA 1ZQ3P 3ZQQA 2H6CA 2CUZA 2HKOA 2V6CA 3DQVC 3LSHA 1U5TC 1UG2A 5J3LA 4ENJA 2H8WA 4E7KA 3FX3A 1OCOH 5LGNA 3GTPJ 1C0WA 2IGMA 3ZGKA 4A3EJ 3G3ZA 2Z9OA 1R5GA 3LSIA 4AUXA 2AXLA 4OIQF 3BPVA 4PGHA 3HPGA 1T95A 4C2MJ 2BHYA 1TLHB 1R1TA 5DD4A 1TTYA 3V4GA 3J7AY 5CQGA 2R5YA 1Y0UA 2X1EA 1KONA 2DFIA 4AU7A 2AQFA 1IUFA 1EA3A 2HVQA 1FY7A 4XKCA 1LJ9A 3FISA 4KMFA 3BROA 1WKMA 3NRVA 2DK5A 3HRSA 3W2VA 4FT8A 4A0ZA 2L9RA 5LD2C 2A6HF 1B1BA 2O5RA 2MABA 4IHWA 3OYKA 5LFAA 4ZDPA 4XBFA 3H35A 2DAOA 3QODA 2VE9A 3PNVA 4I02A 4Y7NJ 3KLOA 2CQKA 3BZKA 1K79A 1ENHA 5K5QA 3E0JB 2ZXHA 4A0YA 5HODA 1I1SA 2VIXA 4NDLA 2DDAA 2EFOA 4M3GA 2IXSA 4ZYAA 4A5NA 5E3LA 2VONA 4U87A 2QKLB 1ERDA 2X1CA 2M3AA 4GO1A 5KK1A 3F9KA 2HGCA 5HLIA 4KT6A 5GAEJ 3W2AA 2COBA 1KYZA 2HS5A 1OLTA 3I56I 1RZ4A 4N4NB 2E1MC 2DOFA 4BJ5C 4HDVA 1UFMA 4BQAA 4CUGA 2OV7A 4F3QA 2JA8J 4JBAA 4D9JA 4KISA 2VUMJ 3X2QH 4HW0A 4ZYGA 1IXCA 2PMHA 2MSYA 1P2FA 1X1PA 1YW8A 1Y6IA 5EYRA 4N4OB 4LLLA 2XASA 2F4OB 3L9FA 1OPCA 5JI6A 4GGGA 2NVXJ 1T56A 2Y0SA 1B72B 2HU9A 3RZOJ 2V1NA 2R3SA 1OYIA 2KLOA 2DPDA 5EEGA 1BOBA 3DKXA 4MEXF 2VT3A 4BY1J 4BE2A 1G4DA 1P7IA 4S0HB 2QYOA 1R71A 3FMQA 2JA6J 5GPCA 2E5ZA 2FD5A 1R36A 3QOEA 1H8AC 3S1NJ 1JKRC 4BYYA 3E5XA 3O8GA 2UXXA 4NC6A 1IUYA 1F43A 4CYDA 2H6BA 3I59A 1R22A 2IEKA 3G1OA 3VSLA 4U0WA 1H9GA 1XMXA 3OR2C 2GM4A 3KLNA 3GLLA 5HOOA 2EZIA 4FE7A 5TRDA 1OCZH 2E1OA 1WCMJ 5B66C 1DU0A 5LLQA 4BXFA 5GPAA 4HZFA 3CDHA 2L7ZA 3O2PE 2RC4A 2L01A 3GWZA 4M3DA 4ESFA 4D5FA 5KVRA 3BJ6A 3RQ4A 4UB8C 2D2WA 2HVRA 1XSXA 4LIVA 2LD5A 1LDJA 4IRIA 2HXOA 1KA8A 3WODF 3ECOA 3VOEA 1OCCH 4I7HA 1RUNA 3CUOA 3OR1C 4IEJA 5LEKA 2P6SA 4E7JA 2NS8A 3T0YA 2EIMH 1FJLA 4UVBA 4BH9A 3BTCA 4DYCA 3GTKJ 2E34A 3IWFA 4G6TB 3CCEI 3JSOA 1IAWA 4XRFA 1BI0A 4NC7A 2OD5A 3DU5A 2F5DA 4OIRF 3WU0A 1VTNC 1IO2A 4HV6A 2ICWG 3CUQB 2JK3A 2LH9A 1FBUA 2WAEA 1MJ9A 4BDYA 3A2KA 4L18B 2PEXA 2IGNA 1BJZA 2JA7J 2VL8A 1HC8A 1ON2A 2E5NA 1LVAA 5H6QA 4CCOA 3CCSI 3KZZA 3MKYB 1XGMA 4I6ZA 5EF6A 3HDDA 3TGNA 1TT5B 4ESBA 1DUXC 2HZTA 4XSXF 2FF4A 2LP0A 2ZMEC 3G73A 4MQVA 5FKMA 1WRJA 2A5YB 3BR2A 1ETKA 4L5IA 2LKSA 3KFWX 1MMAA 1CF7B 4BUPA 3HUGA 4ZYEA 1FP1D 3HSRA 3IUOA 3O6BB 4LB6B 4Y33A 1DP7P 1LB2A 3C2BA 2WA0A 3QP6A 1RR7A 1S8NA 1Y56A 3SJMA 4U7DA 4UNOA 4BHPA 3J81K 4DBQA 2M30A 3RIRA 3CC7I 5GADJ 2RN7A 2VJ5A 4XOTA 3TP3A 1XN7A 2WWYA 2QQ9A 2RKHA 3BCBA 5L3DA 4IZZA 3GO5A 2EZKA 2X85A 5JR3A 3ABTA 3G6EI 3N05A 3SZTA 2L4AA 2RQQA 1X3WB 2HDDA 5FJ8J 4KITB 1T38A 4U7BA 2R92J 5HVQC 1X2NA 3L2WA 3HKZN 1UG0A 5TJJA 3BQZA 2LOOA 2LMDA 1ZLJA 4LLNA 2XC7A 1XMKA 4HNTA 3K4NA 3M9AA 1KU3A 1IRGA 3R61A 1W0TA 2L02A 3DPUA 2KJCA 3BR1A 1OKRA 3QPHA 3S8PA 3M1CA 4EGYA 4D1QA 2Q0OA 2PJRB 2EFNA 3PJRA 1UZCA 4EV0A 4S05A 2DA5A 2XSJC 3H1CA 3L09A 4L9NA 2OUMA 1YTYA 1GHCA 1X3UA 2G7UA 1MSEC 1SD6A 1WH5A 3BTLA 2GWRA 4IHYA 2GBYA 5M5XJ 2LTPA 2HXIA 2X9DA 1W36C 2DPUA 2ETHA 3I4NJ 2Z1DA 2W1OA 2JZYA 2O0YA 2VE8A 3HXLA 4DW6A 3UR3C 1LEBA 1Y8QB 2EV5A 2RGVA 3M1EA 3F8FA 1WJAA 2V9VA 4I0AA 3EYYA 3HOXJ 4RS8A 5HNFA 2IBDA 1A6IA 2ZBKA 3QU6A 4B09A 1HQCA 2CQ7A 3TOBA 2EQRA 3WTTC 1ZGWA 5M3MJ 1LE8B 5B5EC 1BOAA 4R1HA 5FKKA 9ANTA 3W2WA 4LG3A 2P81A 3IV5A 4QTRA 2PJRA 1CQTA 1I5ZA 3J7AO 3VYSB 2HPIA 5F04A 1XGNA 2MLGA 1IW7F 1ZKGA 3PO2J 2A3SA 1QZYA 2M2EA 5DUKA 1TNSA 1I6HJ 3DEUA 2K7LA 3A4CA 1SD4A 1TQIA 1FTTA 2X4HA 4HEA2 2DJIA 2WV1A 4D0PA 3CJNA 2WC2A 1VFCA 2FU4A 3MQ0A 2LFBA 1BJAA 1TWFJ 3I64A 2M34A 1T2KA 2TRTA 3OV8A 5CVJA 2KRFA 2NOGA 3TKYA 5IYCJ 2Y0MA 1DGRM 3F0CA 3REOA 4YFNF 4PDKA 4CXFA 4IRHA 2EIKH 2E36A 2FE3A 3IL2A 3SEZA 2KHMA 2ZKZA 4LD5A 2O61A 2IGKA 2BW3A 2PN6A 2A07F 2P6TA 4G94A 3TDZC 3CCMI 3ESWB 5FKLA 4MGRA 1AWCA 2FBKA 4EJUA 3LSPA 5CLSA 2JA2A 5ILSA 3NWTA 3QQAA 4Q4ZF 1VQ7I 3KPHA 5IPAA 1OMIA 5L3FA 2ADUA 5HS8A 3ZQLA 2NRAC 1N25A 2Z2SB 1HBXG 3M07A 1G3YA 5FKNA 3JRFA 2ISYA 2EB7A 2E7WA 2MFZA 1USSA 4OAZA 3K2ZA 4F7ZA 3RKXA 2VBXA 4ZDOA 1ZYRF 1VNDA 4XQFA 1MMSA 4G8XA 4EATA 3CCRI 1YITI 1F1ZA 1K7AA 3E6MA 3EQLF 2F6CA 1V5FA 4II3A 5KAFC 5E18F 4ZTJA 3LL7A 4GDFA 4A3DJ 2IS1A 1V5GA 2LVSA 3WTXC 3ML6A 1GV5A 3HOSA 4XLAA 1VQOI 3KZYA 3K4LA 4JX5A 1OQYA 3I71A 1QHGA 3C1DA 4Q5SF 1ACIA 3AL0B 1FZPB 2K4JA 2HNHA 1IXRC 4PJMA 1QGPA 2I10A 4N9HA 1TP4A 3IAS2 3LA2A 2EILH 2OC6A 1T39A 2RREA 4JX6A 3FXJA 4ESJA 2BW3B 2VASA 4FISA 3K1MA 5CYVA 2A61A 4EJWA 2YX7A 3MZYA 3M7GA 3UKGA 2FEZA 4B4CA 1SFUA 2KKOA 3KP6A 1WVRA 2R7FA 4ON0A 1YW9A 1EF4A 3VFZA 1V3FA 4OMZA 1Z3XA 3F8CA 2K9SA 3VYRB 4G6QA 3HRTA 1KZHA 2JJ7A 3HM5A 4EJVA 2ZFWA 2X51A 4U88A 2E1NA 2DT5A 2HQ5A 1XC5A 3HG9A 3HSEA 1GXQA 4GRIA 1JUPA 1IZ1A 4ASNA 4IOAF 1TC3C 4TV7A 3COAC 4A3FJ 1JI8A 2JA5J 1S29A 2DBBA 1YOVB 3T1BA 1FSHA 2HDWA 2KDZA 3ZQFA 1TW2A 5J1RA 1PUEE 3HYIA 1EJ9A 2I8DA 4Q47A 2O8XA 3FXMA 1JKPC 2LY2A 2VKVA 3A03A 1XCBA 1RESA 1MMDA 2G9WA 4MO7A 2O3FA 3CCUI 2JSPA 4BNCA 4CO8A 4LJZF 4PJLA 3SZPA 3GTGJ 2XV4S 3GFJA 4F52A 3K2AA 2Z5UA 5IT9K 2WAFA 2DU9A 1JJ6C 3JRDA 2MBFA 3TP0A 5E17F 2AO9A 2Z99A 3R60A 3R6SA 3L2VA 5GTIC 4I99C 4M74A 4F93B 4UUVA 2YUSA 1PUFB 2Q1ZB 5HLHA 1BL0A 2NVUB 4IHSA 3C18A 1FYMA 1NK3P 1WWXA 2GA1A 1GT0C 3KYDB 2VXZA 2CRGA 5GAHJ 1SEUA 4DGWB 2IW5A 2OJED 2WY7Q 2RNJA 2ACJA 4EJOA 5EGOA 2E35A 2HYFA 3H5NA 4EM0B 2NS7A 2JT1A 4E7LA 4RGUA 4RLFA 1MSFC 1KU7A 1OJLA 1BC8C 3BTIA 3D5RC 5JHFA 1AA7A 3V7CA 1BW5A 3RSNA 2TCTA 3V8LA 4FCYA 2STTA 1HKQA 5ICEA 2COMA 2L4MA 4MQ9F 5D8KB 4M3EA 2IA2A 1P4WA 4E7ZA 2CYYA 1L0OC 4KIBA 3ZQHA 3EDPA 1JUMA 3H92A 2DCEA 1SANA 4H4KC 2VKDA 5F27A 5LRRA 3KEYA 4IHTA 2ELHA 3RDIA 2OZ6A 1D0YA 3ZN1A 1Z6TA 1R5ID 3OS2A 2XRNA 2P5KA 2XF6A 3C2HA 2QUFA 2DFFA 2RNGA 3E6DA 2X6XA 4QWQA 3AKZA 1ETOA 2VQCA 2LLKA 3ZMVA 1Z77A 2GXAA 3GTJJ 3PFIA 2OQGA 1E0EA 2HTSA 4YFXF 2L9SA 2G0EA 3CC2I
chains in the Genus database with same CATH topology
2NVXJ 2DA3A 5K7FA 1T56A 3BTJA 5M3FJ 1B72B 3ZOBA 5K7HA 3RZOJ 5E3MA 3GBGA 2R93J 1MBGA 3QPLA 5C44J 3GTMJ 2R7ZJ 4BY1J 1P7IA 2HOTA 2L7FP 4S0HB 4RBOA 1X58A 2WAQN 2Y30A 3S16J 2JA6J 4V2GA 5GPCA 2FD5A 2MW8A 1H8AC 3S1NJ 1JKRC 3O8GA 4BY7J 1ETYA 2DN0A 1F43A 1RETA 2IEKA 2JMWA 3G1OA 3LSJA 1MH3A 5EDNA 2GM4A 1IDZA 3FIWA 1HDPA 3K7AJ 4QIWN 2CUFA 2EZIA 3MKLA 4FE7A 4IHVA 3BG3A 2E1OA 1XG1A 3I4MJ 1QVUA 1WCMJ 1DU0A 1IRZA 5GPAA 1MBJA 4HNVA 2D5VA 4I76A 2L7ZA 4DYQA 1A5JA 2XPUA 2OPTA 2XGEA 4M3DA 2Y31A 4D5FA 1GV2A 4D5CA 2LD5A 2DTZA 1JJ8C 2E19A 2HXOA 3A01B 1AU7A 2MGQA 2XPWA 2DA1A 4IEJA 3ZQGA 1JTXA 3Q0UA 2CQXA 5IYBJ 2NS8A 1FJLA 3Q0VA 5C3EJ 3BTCA 4DYCA 3GTKJ 3G1MA 3S2HJ 2VKEA 1JUSA 2PMZN 3OIOA 3JRAA 4XIDA 1JGGA 3HOWJ 2JK3A 1HDDC 1JT6A 1YRNA 3IH3A 3BG9A 1TWHJ 2FX0A 1BJZA 4AYBN 4J19A 2JA7J 2EZLA 2O9LA 2DJNA 5E3OA 2R5YB 3A02A 2NVQJ 3WHBA 4DYRA 4AC0A 3M3YJ 4B1RA 4I6ZA 1OCTC 2O8KA 1FEXA 5EF6A 2L0KA 3HDDA 3LSRA 3GTQJ 1QVTA 1SFOJ 2LP0A 5FKMA 1U9OA 3BR2A 1ETKA 1WH7A 2ELKA 2JN6A 3HGGA 4M3BA 2M9HA 3TEDA 3H3VK 1HLVA 4X1EA 3FK6A 3S1MJ 3BG5A 3C2BA 4BXXJ 3A01A 1RR7A 4L5EA 3IH2A 4XICA 3JRGA 4JYKA 3SJMA 3E7LA 2LKXA 3Q0WA 4W1UA 2ME0A 1QRYA 2XB0X 5F08A 2MG4A 3PO3J 1NTCA 4C3HJ 3TP3A 2ECBA 1H89C 3CMYA 1MBFA 5C4XJ 3OOUA 1VF9A 2EZKA 1Y1VJ 1RKTA 1HF0A 5IYDJ 1VI0A 3G1LA 3H0GJ 2HDDA 5FJ8J 4MLOA 1LE8A 2R92J 3S17J 1X2NA 1B8IB 2X48A 2CUEA 3HKZN 4BBRJ 2R5ZA 1LFUP 3BQZA 4QSHA 4IHXA 5FLVA 3HB9A 1TWGJ 3MVPA 2Y0SN 1FIAA 2AHQA 2HYJA 5FKOA 4UUTA 2DA7A 1W0TA 1GVDA 1JKOC 1B72A 2H1KA 3BR1A 3B6AA 3OSFA 4FTHA 2E2JJ 1TWCJ 4A3CJ 2EBIA 5DTDA 5F0FA 2DA5A 2LK2A 4EEFG 3WHCA 3S1QJ 2CQQA 2LR8A 1LFBA 3W6VA 1MBKA 5E3NA 3BR3A 1XS9A 3S1RJ 2E2HJ 5IP7J 3FKIJ 1MSEC 1BW6A 1WH5A 3NARA 3BTLA 2E2IJ 1PUFA 2GBYA 5M5XJ 2LTPA 2HXIA 2X9DA 1IC8A 4IHYA 3I4NJ 4DW6A 1APLC 1U78A 1U9NA 1MH4A 2ECCA 1RPWA 1RKWA 2FQ4A 2K9QA 1Q1VA 5IOYA 2ZB9A 3S15J 2EZHA 3HOXJ 2NVTJ 5IOZA 1ZR4A 5EG0A 2IBDA 1A6IA 2EQRA 5M5YJ 4V2FA 2IAIA 1ZGWA 5M3MJ 1K61A 1LE8B 1OCPA 1DU6A 5FKKA 2VI6A 5F1JA 9ANTA 5K7ZA 1T33A 2P81A 1WI3A 3BQYA 4QTRA 3IV5A 1CQTA 1FTZA 4A69C 4A3BJ 1U8BA 2DA6A 1ZR2A 1AKHA 5F04A 3MN2A 3LOCA 1ZKGA 4W97A 3PO2J 2M2EA 2DMQA 1I6HJ 1NK2P 1ZK8A 4D7MA 5C4JJ 3D1NI 2R0QC 4XRSG 4A3MJ 2M8GX 2KT0A 3JRCA 1FTTA 3TW6A 1BA5A 2WV1A 4ABZA 1K83J 1IDYA 4D7NA 1VFCA 1ORKA 3IH4A 1GDTA 3CDLA 1MBHA 2ME6A 2DMPA 2LFBA 3NAUA 1TWFJ 1MNMC 3HOYJ 2M34A 3HOZJ 2M0CA 2TRTA 2K40A 1JKQC 1H88C 4DZJA 3HOVJ 2XSDC 1X2MA 3HEFA 2NOGA 2LY9A 4BKXA 5IYCJ 1E3OC 3F0CA 4C3IJ 5EEAA 2JWTA 2Y9YA 4A3GJ 1YRNB 5FKLA 1O4XA 3SDGA 5J1YA 3LSPA 1ZTRA 2DA4A 3QQAA 2YU9J 1TWAJ 5IPAA 1ITYA 3ZQLA 4XK4A 5JLWA 5FKNA 1P7JA 3JRFA 3M4OJ 3S2DJ 1MBEA 2K9NA 1IG7A 4G12A 4JX4A 2GLOA 5F0CA 1VNDA 4GFBA 5JLXA 4UUSB 3JRHA 1AHDP 5EG0B 3QPSA 4A93J 3HBLA 3LNQA 2ID3A 4A3DJ 1FIPA 1S7EA 2LVSA 3ZQCA 4C3JJ 1GV5A 4JX5A 3GTOJ 2YS9A 1IV6A 3S14J 2I10A 3DEWA 3GTLJ 4UUSA 4B3AA 4JX6A 2Y9ZA 4Y52J 2X6OA 2XPVA 4FISA 1QPIA 4RDUA 3TW7A 5IP9J 4A3JJ 1G2HA 3UKGA 4B4CA 4XRSA 1HCRA 1I3QJ 1EF4A 1W0UA 1HOMA 2XGDA 4BBSJ 1ETWA 3BR0A 2K9SA 4XRMA 2OF7A 2B63J 2JJ7A 3HM5A 4DZPA 2QCOA 2O7OA 2H8RA 1R9TJ 5DS9A 2CJJA 2HQ5A 2HI3A 1XC5A 1JUPA 3HGYA 1I50J 2NVYJ 2FJ1A 1JTYA 2RAEA 1IGNA 1B8IA 1TC3C 4MFEA 3L1PA 4A3FJ 3PM1A 2JA5J 2XRLA 1Z0XA 2DMUA 2KDZA 2N8GA 3ZQFA 5J1RA 5M5WJ 4M6VA 1OFCX 1JKPC 1Y1WJ 3CQZJ 1UMQA 2VKVA 3A03A 3VPRA 1RESA 1WPKA 3BR6A 4MO7A 3OSGA 1ETQA 2DA2A 3FK7A 3JRBA 3GTGJ 3LSGA 3BR5A 3Q3SA 1ZQ3P 3SFIA 4A3KJ 3K2AA 5J3LA 1UG2A 5FLMJ 2CU7A 2EH3A 3JRDA 1JJ6C 2ID6A 3TP0A 2VPRA 2AO9A 3GTPJ 5J1UA 1UHSA 2HOSA 4A3EJ 2YUSA 1PUFB 1ETVA 2DMNA 3RZDJ 4A3LJ 4AUXA 3RQIA 1BL0A 4JP0A 4LOCA 4C2MJ 1NK3P 2DMTA 3JRIA 1GT0C 2R5YA 2CRGA 3JREA 4CYCB 5EGOA 2NS7A 1IUFA 3FISA 1JT0A 1MSFC 1OJLA 3BTIA 2XB5A 2L9RA 2Y2ZA 4IHWA 3O8HA 1WGXA 1BW5A 2TCTA 4Y7NJ 1AKHB 4FCYA 1ENHA 3DCFA 1POGA 3ZQIA 5HODA 4X6AJ 4NDLA 4A3IJ 4M3GA 5EZHA 4M3EA 5EGOB 3JR9A 1GUUA 5EZGA 2W48A 5E3LA 3BT9A 2WB1N 2HOAA 1ETXA 3ZQHA 1JUMA 3RKQA 1SANA 5F27A 5GP9A 3HOUJ 2COBA 3CCYA 4MIMA 1D5YA 5F0HA 5IP6A 1IJWC 4MFDA 1F36A 2R5ZB 2JA8J 2VUMJ 1ETOA 3B6CA 4M3FA 2LLKA 2MSYA 1Z77A 3GTJJ 5BNGA 4CYCA 5EYRA 2L7MP 4FE4A 2XGCA 2QF7A 2G0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVX J;  2DA3 A;  5K7F A;  1T56 A;  3BTJ A;  5M3F J;  1B72 B;  3ZOB A;  5K7H A;  3RZO J;  5E3M A;  3GBG A;  2R93 J;  1MBG A;  3QPL A;  5C44 J;  3GTM J;  2R7Z J;  4BY1 J;  1P7I A;  2HOT A;  2L7F P;  4S0H B;  4RBO A;  1X58 A;  2WAQ N;  2Y30 A;  3S16 J;  2JA6 J;  4V2G A;  5GPC A;  2FD5 A;  2MW8 A;  1H8A C;  3S1N J;  1JKR C;  3O8G A;  4BY7 J;  1ETY A;  2DN0 A;  1F43 A;  1RET A;  2IEK A;  2JMW A;  3G1O A;  3LSJ A;  1MH3 A;  5EDN A;  2GM4 A;  1IDZ A;  3FIW A;  1HDP A;  3K7A J;  4QIW N;  2CUF A;  2EZI A;  3MKL A;  4FE7 A;  4IHV A;  3BG3 A;  2E1O A;  1XG1 A;  3I4M J;  1QVU A;  1WCM J;  1DU0 A;  1IRZ A;  5GPA A;  1MBJ A;  4HNV A;  2D5V A;  4I76 A;  2L7Z A;  4DYQ A;  1A5J A;  2XPU A;  2OPT A;  2XGE A;  4M3D A;  2Y31 A;  4D5F A;  1GV2 A;  4D5C A;  2LD5 A;  2DTZ A;  1JJ8 C;  2E19 A;  2HXO A;  3A01 B;  1AU7 A;  2MGQ A;  2XPW A;  2DA1 A;  4IEJ A;  3ZQG A;  1JTX A;  3Q0U A;  2CQX A;  5IYB J;  2NS8 A;  1FJL A;  3Q0V A;  5C3E J;  3BTC A;  4DYC A;  3GTK J;  3G1M A;  3S2H J;  2VKE A;  1JUS A;  2PMZ N;  3OIO A;  3JRA A;  4XID A;  1JGG A;  3HOW J;  2JK3 A;  1HDD C;  1JT6 A;  1YRN A;  3IH3 A;  3BG9 A;  1TWH J;  2FX0 A;  1BJZ A;  4AYB N;  4J19 A;  2JA7 J;  2EZL A;  2O9L A;  2DJN A;  5E3O A;  2R5Y B;  3A02 A;  2NVQ J;  3WHB A;  4DYR A;  4AC0 A;  3M3Y J;  4B1R A;  4I6Z A;  1OCT C;  2O8K A;  1FEX A;  5EF6 A;  2L0K A;  3HDD A;  3LSR A;  3GTQ J;  1QVT A;  1SFO J;  2LP0 A;  5FKM A;  1U9O A;  3BR2 A;  1ETK A;  1WH7 A;  2ELK A;  2JN6 A;  3HGG A;  4M3B A;  2M9H A;  3TED A;  3H3V K;  1HLV A;  4X1E A;  3FK6 A;  3S1M J;  3BG5 A;  3C2B A;  4BXX J;  3A01 A;  1RR7 A;  4L5E A;  3IH2 A;  4XIC A;  3JRG A;  4JYK A;  3SJM A;  3E7L A;  2LKX A;  3Q0W A;  4W1U A;  2ME0 A;  1QRY A;  2XB0 X;  5F08 A;  2MG4 A;  3PO3 J;  1NTC A;  4C3H J;  3TP3 A;  2ECB A;  1H89 C;  3CMY A;  1MBF A;  5C4X J;  3OOU A;  1VF9 A;  2EZK A;  1Y1V J;  1RKT A;  1HF0 A;  5IYD J;  1VI0 A;  3G1L A;  3H0G J;  2HDD A;  5FJ8 J;  4MLO A;  1LE8 A;  2R92 J;  3S17 J;  1X2N A;  1B8I B;  2X48 A;  2CUE A;  3HKZ N;  4BBR J;  2R5Z A;  1LFU P;  3BQZ A;  4QSH A;  4IHX A;  5FLV A;  3HB9 A;  1TWG J;  3MVP A;  2Y0S N;  1FIA A;  2AHQ A;  2HYJ A;  5FKO A;  4UUT A;  2DA7 A;  1W0T A;  1GVD A;  1JKO C;  1B72 A;  2H1K A;  3BR1 A;  3B6A A;  3OSF A;  4FTH A;  2E2J J;  1TWC J;  4A3C J;  2EBI A;  5DTD A;  5F0F A;  2DA5 A;  2LK2 A;  4EEF G;  3WHC A;  3S1Q J;  2CQQ A;  2LR8 A;  1LFB A;  3W6V A;  1MBK A;  5E3N A;  3BR3 A;  1XS9 A;  3S1R J;  2E2H J;  5IP7 J;  3FKI J;  1MSE C;  1BW6 A;  1WH5 A;  3NAR A;  3BTL A;  2E2I J;  1PUF A;  2GBY A;  5M5X J;  2LTP A;  2HXI A;  2X9D A;  1IC8 A;  4IHY A;  3I4N J;  4DW6 A;  1APL C;  1U78 A;  1U9N A;  1MH4 A;  2ECC A;  1RPW A;  1RKW A;  2FQ4 A;  2K9Q A;  1Q1V A;  5IOY A;  2ZB9 A;  3S15 J;  2EZH A;  3HOX J;  2NVT J;  5IOZ A;  1ZR4 A;  5EG0 A;  2IBD A;  1A6I A;  2EQR A;  5M5Y J;  4V2F A;  2IAI A;  1ZGW A;  5M3M J;  1K61 A;  1LE8 B;  1OCP A;  1DU6 A;  5FKK A;  2VI6 A;  5F1J A;  9ANT A;  5K7Z A;  1T33 A;  2P81 A;  1WI3 A;  3BQY A;  4QTR A;  3IV5 A;  1CQT A;  1FTZ A;  4A69 C;  4A3B J;  1U8B A;  2DA6 A;  1ZR2 A;  1AKH A;  5F04 A;  3MN2 A;  3LOC A;  1ZKG A;  4W97 A;  3PO2 J;  2M2E A;  2DMQ A;  1I6H J;  1NK2 P;  1ZK8 A;  4D7M A;  5C4J J;  3D1N I;  2R0Q C;  4XRS G;  4A3M J;  2M8G X;  2KT0 A;  3JRC A;  1FTT A;  3TW6 A;  1BA5 A;  2WV1 A;  4ABZ A;  1K83 J;  1IDY A;  4D7N A;  1VFC A;  1ORK A;  3IH4 A;  1GDT A;  3CDL A;  1MBH A;  2ME6 A;  2DMP A;  2LFB A;  3NAU A;  1TWF J;  1MNM C;  3HOY J;  2M34 A;  3HOZ J;  2M0C A;  2TRT A;  2K40 A;  1JKQ C;  1H88 C;  4DZJ A;  3HOV J;  2XSD C;  1X2M A;  3HEF A;  2NOG A;  2LY9 A;  4BKX A;  5IYC J;  1E3O C;  3F0C A;  4C3I J;  5EEA A;  2JWT A;  2Y9Y A;  4A3G J;  1YRN B;  5FKL A;  1O4X A;  3SDG A;  5J1Y A;  3LSP A;  1ZTR A;  2DA4 A;  3QQA A;  2YU9 J;  1TWA J;  5IPA A;  1ITY A;  3ZQL A;  4XK4 A;  5JLW A;  5FKN A;  1P7J A;  3JRF A;  3M4O J;  3S2D J;  1MBE A;  2K9N A;  1IG7 A;  4G12 A;  4JX4 A;  2GLO A;  5F0C A;  1VND A;  4GFB A;  5JLX A;  4UUS B;  3JRH A;  1AHD P;  5EG0 B;  3QPS A;  4A93 J;  3HBL A;  3LNQ A;  2ID3 A;  4A3D J;  1FIP A;  1S7E A;  2LVS A;  3ZQC A;  4C3J J;  1GV5 A;  4JX5 A;  3GTO J;  2YS9 A;  1IV6 A;  3S14 J;  2I10 A;  3DEW A;  3GTL J;  4UUS A;  4B3A A;  4JX6 A;  2Y9Z A;  4Y52 J;  2X6O A;  2XPV A;  4FIS A;  1QPI A;  4RDU A;  3TW7 A;  5IP9 J;  4A3J J;  1G2H A;  3UKG A;  4B4C A;  4XRS A;  1HCR A;  1I3Q J;  1EF4 A;  1W0U A;  1HOM A;  2XGD A;  4BBS J;  1ETW A;  3BR0 A;  2K9S A;  4XRM A;  2OF7 A;  2B63 J;  2JJ7 A;  3HM5 A;  4DZP A;  2QCO A;  2O7O A;  2H8R A;  1R9T J;  5DS9 A;  2CJJ A;  2HQ5 A;  2HI3 A;  1XC5 A;  1JUP A;  3HGY A;  1I50 J;  2NVY J;  2FJ1 A;  1JTY A;  2RAE A;  1IGN A;  1B8I A;  1TC3 C;  4MFE A;  3L1P A;  4A3F J;  3PM1 A;  2JA5 J;  2XRL A;  1Z0X A;  2DMU A;  2KDZ A;  2N8G A;  3ZQF A;  5J1R A;  5M5W J;  4M6V A;  1OFC X;  1JKP C;  1Y1W J;  3CQZ J;  1UMQ A;  2VKV A;  3A03 A;  3VPR A;  1RES A;  1WPK A;  3BR6 A;  4MO7 A;  3OSG A;  1ETQ A;  2DA2 A;  3FK7 A;  3JRB A;  3GTG J;  3LSG A;  3BR5 A;  3Q3S A;  1ZQ3 P;  3SFI A;  4A3K J;  3K2A A;  5J3L A;  1UG2 A;  5FLM J;  2CU7 A;  2EH3 A;  3JRD A;  1JJ6 C;  2ID6 A;  3TP0 A;  2VPR A;  2AO9 A;  3GTP J;  5J1U A;  1UHS A;  2HOS A;  4A3E J;  2YUS A;  1PUF B;  1ETV A;  2DMN A;  3RZD J;  4A3L J;  4AUX A;  3RQI A;  1BL0 A;  4JP0 A;  4LOC A;  4C2M J;  1NK3 P;  2DMT A;  3JRI A;  1GT0 C;  2R5Y A;  2CRG A;  3JRE A;  4CYC B;  5EGO A;  2NS7 A;  1IUF A;  3FIS A;  1JT0 A;  1MSF C;  1OJL A;  3BTI A;  2XB5 A;  2L9R A;  2Y2Z A;  4IHW A;  3O8H A;  1WGX A;  1BW5 A;  2TCT A;  4Y7N J;  1AKH B;  4FCY A;  1ENH A;  3DCF A;  1POG A;  3ZQI A;  5HOD A;  4X6A J;  4NDL A;  4A3I J;  4M3G A;  5EZH A;  4M3E A;  5EGO B;  3JR9 A;  1GUU A;  5EZG A;  2W48 A;  5E3L A;  3BT9 A;  2WB1 N;  2HOA A;  1ETX A;  3ZQH A;  1JUM A;  3RKQ A;  1SAN A;  5F27 A;  5GP9 A;  3HOU J;  2COB A;  3CCY A;  4MIM A;  1D5Y A;  5F0H A;  5IP6 A;  1IJW C;  4MFD A;  1F36 A;  2R5Z B;  2JA8 J;  2VUM J;  1ETO A;  3B6C A;  4M3F A;  2LLK A;  2MSY A;  1Z77 A;  3GTJ J;  5BNG A;  4CYC A;  5EYR A;  2L7M P;  4FE4 A;  2XGC A;  2QF7 A;  2G0E A; 
#chains in the Genus database with same CATH topology
 2LRD A;  4KIG A;  5K7F A;  2UZK A;  5M3F J;  4XKB A;  2V9K A;  3LFK A;  4PCQ A;  3TMO A;  1N75 A;  2OAZ A;  4CCL A;  5H2F C;  5K7H A;  4ENN A;  5JHU A;  3GBG A;  3P9I A;  4PSW A;  5C44 J;  2DTR A;  3GTM J;  1N77 A;  2CO5 A;  2FA5 A;  3RPU A;  4H0E A;  3I9V 2;  2EFP A;  4XMY A;  1XX5 A;  2RQP A;  4XM3 A;  3KYL A;  2NYX A;  1R4N B;  1KU9 A;  3DF8 A;  4WF2 A;  2M45 A;  4V2G A;  2BEO A;  4B47 A;  4HYE A;  4RGR A;  1GVJ A;  3S2W A;  3KEQ A;  3CP8 A;  3CMA I;  4B8X A;  5GAG J;  3LA3 A;  2QLZ A;  1X1D A;  2XDV A;  3VDX A;  4QPO A;  1G3W A;  4MTD A;  2KJB A;  1MH3 A;  2JVG A;  1U8R A;  1E17 A;  1XTA A;  2V1X A;  5J40 A;  3I54 A;  5F1R A;  3J7Z I;  1IDZ A;  3CD6 I;  1VQ6 I;  4LK1 F;  2DW4 A;  4RB1 A;  4KFC A;  1FPQ A;  2DFH A;  3MKL A;  5CVI A;  3RPU D;  4IHV A;  2A6T A;  4I2O A;  2E7X A;  1XG1 A;  2M5W A;  2EWN A;  3SZG A;  1WZ2 A;  3DKY A;  1R4M B;  1MBJ A;  2LC2 A;  3JCU C;  1QZZ A;  4P1W A;  1FYL A;  3QPT A;  4DYQ A;  1UHM A;  3CO7 C;  1ZG1 A;  2XPU A;  3RYP A;  1A5J A;  2XGE A;  2YX4 A;  3FXQ A;  1DQU A;  1J75 A;  5FRO A;  2F5V A;  2HVS A;  4D5C A;  4NUB A;  4E70 A;  2LNB A;  1UAA A;  2FMY A;  2KIS A;  2WAQ A;  4CHU A;  4L0Y B;  2HFH A;  3A01 B;  2QKM B;  2MGQ A;  4AM3 A;  1W36 D;  1Z67 A;  4OWR B;  3SFZ A;  4LIT A;  1E2X A;  3CUQ C;  4HOB A;  1Z1D A;  2XKP A;  4LG0 B;  1BR2 A;  2B0L A;  1SD5 A;  1X1A A;  3AG1 H;  1YS7 A;  2R7V A;  3OIO A;  4RAG A;  2ZCW A;  2B9S A;  3JRA A;  1JGG A;  3VSK A;  5D6F A;  5DEQ A;  3PL8 A;  3RYR A;  1PDN C;  3HOW J;  2YPR A;  2L2O A;  1JT6 A;  3FM5 A;  1YRN A;  4M9S A;  4HSR A;  3BG6 A;  5DCF A;  1LVK A;  3OS1 A;  2MC4 A;  4J19 A;  5ERI A;  2EZL A;  3K6G A;  1K4T A;  2O9L A;  2R5Y B;  2ZC2 A;  2AQE A;  3A02 A;  5FB2 A;  3NWS A;  2ZJR F;  4K2E A;  2ZO4 A;  3HC7 A;  1FEX A;  2VB6 A;  4BXU A;  2ZFU A;  2GAU A;  2BY2 A;  2EV0 A;  3DEE A;  3OYH A;  1FYK A;  3J7Y J;  2IA0 A;  2ELK A;  1ZRC A;  2M9H A;  2ESH A;  2CW0 F;  3BZ6 A;  1ULY A;  4OIN F;  5HNH A;  4NBQ A;  3K4B A;  2LKP A;  3GCM A;  4PZJ A;  3OYI A;  3TOA A;  3CDI A;  3A01 A;  4L5E A;  1R49 A;  5L3C A;  1RI7 A;  1MDM A;  2L3D A;  1LDD A;  2LKX A;  3Q0W A;  1Y0N A;  2G7H A;  3A1Y A;  3MKZ A;  1N78 A;  3PUB A;  2MA3 A;  3FXR A;  5F08 A;  5IT3 A;  1OR7 A;  1NTC A;  4NB5 A;  3ZCO A;  1H89 C;  2TDX A;  1XD7 A;  3SEQ A;  2FSW A;  4WWC A;  5E79 C;  5E20 A;  3DTK A;  1WJF A;  3OOU A;  5C4X J;  1VQ4 I;  5E1W A;  1RKT A;  4IKF A;  3EUH C;  1FMW A;  1YI2 I;  2QSH X;  1MMG A;  3F8M A;  4BQO A;  1VI0 A;  2CUJ A;  2W84 A;  2P5L C;  1ZRD A;  3VWB A;  4MLO A;  3ISP A;  1LE8 A;  3OY9 A;  4A0X A;  2HQA A;  3C7J A;  1A36 A;  1XGO A;  4WX9 A;  2R5Z A;  1LFU P;  1REP C;  4QSH A;  1NH3 A;  2Z16 A;  3NEU A;  4CDG A;  4IHX A;  5FLV A;  3SDB A;  3HB9 A;  2K3F A;  3WG7 H;  1YE9 A;  3I0T A;  2HYJ A;  3FWE A;  4UUT A;  1QA6 A;  2CG4 A;  2KRH A;  5HS7 A;  4GCV A;  3VYT B;  2QEN A;  2A05 A;  2BY0 A;  4P5O A;  3OSF A;  3DPL C;  2E2J J;  1TWC J;  2BXY A;  1KQ0 A;  4IL6 C;  3ZRG A;  4AVP A;  5JVG F;  2CQQ A;  2LR8 A;  1LFB A;  3W6V A;  3VB2 A;  4YIR X;  1FMV A;  3H3U A;  5IP7 J;  1BW6 A;  3OL4 A;  3FXK A;  4CGZ A;  2OTL I;  2RDP A;  1KQ9 A;  1FOX A;  1OYY A;  4G7H F;  4EJT A;  5FO5 A;  2Q2E A;  2XHK A;  2IS4 A;  2ZB9 A;  2EZH A;  2NVT J;  1MMN A;  5EG0 A;  5AIQ A;  1BC7 C;  1OIS A;  2BV6 A;  2GIV A;  4Y4R A;  2M7A A;  2XAU A;  3D5L A;  3KP4 A;  2L5Q A;  4V2F A;  2IAI A;  2WY8 Q;  2QQA A;  4PK4 A;  6PAX A;  1RR8 C;  2VOO A;  1PP8 F;  2CV0 A;  4KA4 A;  2PG4 A;  3F22 A;  1T33 A;  3LSM A;  2JPC A;  3HPH A;  4HA8 A;  2BHZ A;  2DA6 A;  3HOT A;  4IXA A;  1WQ2 A;  1P6R A;  1AKH A;  2R7S A;  3U1D A;  2W24 A;  4W97 A;  1Z6R A;  3QYE A;  4KNY A;  1NK2 P;  2JPB A;  2BZT A;  1U2W A;  3LFU A;  2K9M A;  2YSR A;  1ZRE A;  4OIP F;  4II2 A;  3JRC A;  3GUD A;  2P0W A;  3ZMS A;  4BE0 A;  3CLQ A;  3Q9V A;  4ABZ A;  1TZL A;  1KGS A;  2K86 A;  3LQR A;  1ORK A;  2DMP A;  4WK8 F;  3HOY J;  4X0G A;  3HHG A;  3HOZ J;  5A2Q Z;  2M0C A;  4RB3 C;  1JKQ C;  3M8F A;  4DZJ A;  4Y3O A;  1X3Z B;  2QSG X;  5LBQ A;  4ETS A;  3S93 A;  1EH8 A;  1D0Z A;  2LY9 A;  3IKV A;  4BKX A;  2XAH A;  2IS6 A;  1O3T A;  3U1K A;  2VJ4 A;  5D4S A;  5BQT A;  3RTR A;  4O3M A;  2FOK A;  3GZ6 A;  5ILV A;  4HQM A;  1TL8 A;  4GYG A;  4JQF A;  1UST A;  2GXB A;  3S3M A;  2EFQ A;  2J5O A;  2KZV A;  2Y9Y A;  2FML A;  4QPQ A;  2CGP A;  3P9K A;  1UEL B;  1DPU A;  1ZTR A;  3MZ8 A;  5J47 A;  3JTG A;  3KP3 A;  1LPQ A;  3EUA A;  1SVM A;  1RUO A;  2V1D A;  2YU9 J;  2R7U A;  5L3B A;  4XK4 A;  1MD0 A;  3AG2 H;  1P7J A;  3M4O J;  1SMY F;  3J80 K;  4C2U A;  2K85 A;  4G12 A;  1WJB A;  5CVV A;  3OIQ A;  5ICF A;  4JX4 A;  2BVM A;  4YG2 F;  2W82 A;  3ZPL A;  5JLX A;  5H6R A;  2HOE A;  5EG0 B;  1W4M A;  4NQW B;  3HBL A;  1O7F A;  2PLY A;  2X6Y A;  4FX4 A;  2D45 A;  4UV8 A;  3LAP A;  4LGW A;  1XMA A;  1SAX A;  1J2X A;  3K4C A;  4O5V A;  3LWF A;  4HF0 A;  2EJR A;  5CKT A;  2EIJ H;  2XGX A;  1D8K A;  1I3A A;  5LEJ A;  1LDK B;  3GLX A;  3OYF A;  4UVA A;  2K4B A;  1WI9 A;  4RAF A;  4WCG A;  4UUS A;  4B3A A;  2KRC A;  3RKY A;  2KFD A;  3Q9S A;  2Y9Z A;  3CLO A;  4BE1 A;  3QRF F;  2JQ7 A;  4A3J J;  2AXT C;  2JVH A;  3ULQ B;  2M4K A;  2OU2 A;  4U0Y A;  1HCR A;  1R23 A;  2IPQ X;  1EH7 A;  5BS6 A;  4V19 K;  1JXS A;  3LA7 A;  1FSE A;  2OF7 A;  2OQR A;  2R7Q A;  3ONQ A;  3QAH A;  5LHG A;  4XRM A;  3DBL B;  3IP4 B;  2VQL A;  2KL4 A;  2DYR H;  1DP3 A;  2O7O A;  4OAY A;  2H8R A;  3HKZ A;  1GXP A;  4P9U A;  5DS9 A;  2XAG A;  2CJJ A;  1ZN2 A;  2MH9 A;  4BJT A;  3H3Z A;  2HWV A;  2IP2 A;  3QU3 A;  2OBP A;  1Q1H A;  2FJ1 A;  2L9V A;  3F8N A;  1XPX A;  1IGN A;  3EYI A;  2OTJ I;  4MFE A;  5IT9 Z;  3DLA A;  2LBF A;  4L9J A;  1G59 A;  3H5A A;  2DMU A;  3GX4 X;  1A04 A;  5M5W J;  4MNU A;  2DOD A;  3CJR B;  1A31 A;  4CCM A;  4A12 A;  4M6Y A;  4DOZ A;  3CQZ J;  3DXJ F;  3VPR A;  5D5X B;  3BR6 A;  1WPK A;  1W5C C;  2DA2 A;  2HYG D;  3FK7 A;  3R0A A;  3WG9 A;  3WTY C;  1G3S A;  1NHA A;  1K6O A;  2AS5 F;  2H94 A;  3PNT A;  3SFI A;  3ELK A;  4M9X A;  4UV9 A;  4NNJ A;  2CU7 A;  3CUQ A;  2ID6 A;  1D1B A;  1YHQ I;  1WFX A;  3A0B C;  5J1U A;  3GXO A;  3WTZ A;  1UHS A;  4CSW A;  2HOS A;  3QP5 A;  4AWX B;  2Y69 H;  2JRT A;  2DMN A;  4A3L J;  3BY6 A;  1BBY A;  3OYA A;  3J81 Z;  2VBZ A;  1HA8 A;  1B4A A;  3DWL E;  2NXN B;  3PSI A;  5H20 A;  4PGG A;  3JRI A;  4G7Z F;  3JRE A;  3E97 A;  1SVO A;  4AIK A;  3ERE D;  2QBY B;  4DNC A;  2P7C B;  1JT0 A;  5EJC A;  2XB5 A;  1MGT A;  4WXD A;  4HV5 A;  1WGX A;  2KIM A;  3H36 A;  3F3X A;  4ENK A;  1B9N A;  1BI1 A;  2BVL A;  4KT5 C;  3BJO A;  4KDP A;  1L3L A;  1POG A;  1ZRF A;  2O03 A;  2VBY A;  1DPR A;  4KN7 X;  3ROU A;  4X6A J;  3MKW B;  5BPD A;  4A3I J;  5FRN A;  3CP2 A;  5EZH A;  3JR9 A;  4UY8 I;  3PQK A;  1GUU A;  4ZTF A;  3GEZ A;  5EZG A;  3QYF A;  2WB1 N;  4XKV A;  4HPQ A;  2HOA A;  4EQQ A;  3KYC B;  2RVC A;  1X19 A;  1JGS A;  3CZ6 A;  3RKQ A;  1HW1 A;  1JHF A;  1HKS A;  5D5W B;  1VQP I;  2IGO A;  3CCY A;  1W7P A;  1IJW C;  2FUG 2;  4B44 A;  1R1U A;  3E5Q A;  1F36 A;  3OYJ A;  2ELJ A;  1A6Q A;  1FBS A;  4F55 A;  5K5O A;  1EKE A;  3EUH A;  3UNG C;  3B6C A;  4M3F A;  1XSV A;  3WTV C;  5BNG A;  4CYC A;  4XOR A;  1X4P A;  2XAF A;  2XGC A;  3FMR A;  2QF7 A;  3PIO F;  2NNN A;  2V7F A;  2DA3 A;  2DT6 A;  2A5W A;  3CCJ I;  2A6E F;  3BTJ A;  4Y13 A;  4BAY A;  1S7O A;  1MBG A;  1B59 A;  1SVL A;  5HLT A;  1SD7 A;  3F6O A;  2E1M B;  1R00 A;  3DPT A;  2R7Z J;  4E7S A;  5E8G A;  5J4V A;  1VQL I;  2L7F P;  3JAM Z;  2DOA A;  2F5E A;  1AOY A;  3WU2 C;  2VBW A;  2WAQ N;  2Y30 A;  3S16 J;  3DKW A;  4UVC A;  3HJE A;  1HW5 A;  2MW8 A;  4Z6Y A;  4IO9 F;  4E6K G;  4P55 A;  2BXZ A;  3U21 A;  5FFX A;  4BY7 J;  1QZE A;  1D1A A;  1RET A;  3BG7 A;  3DP7 A;  5EDN A;  2JSC A;  3KX2 A;  2ZNZ A;  1KQ8 A;  2GOM A;  1BI3 A;  1HDP A;  2VXD A;  3K7A J;  4QIW N;  1OYW A;  1TBX A;  3JW4 A;  1Z3Y A;  2MH2 A;  3E6C C;  1IRZ A;  2K9L A;  2F48 A;  2D5V A;  1EV7 A;  4I76 A;  1MDM B;  3H5R A;  3OS0 A;  1ZG5 A;  2OPT A;  5BOX A;  3L2C A;  2R7W A;  1WJD A;  2NS0 A;  4I01 A;  2DTZ A;  1JJ8 C;  2E19 A;  3DU6 A;  3KP2 A;  1R1V A;  3EPZ A;  5HS9 A;  4C9Y A;  2VC1 A;  3KP7 A;  3PNY A;  2XPW A;  1O3S A;  1ZAR A;  2DA1 A;  2DXI A;  4OIO F;  3JSP A;  2ISZ A;  1GLN A;  3GFI A;  5IYB J;  1WSU A;  4MHG A;  4PJ0 C;  1FBQ A;  4CA0 A;  1PVE A;  5C3E J;  1S9H A;  3G1M A;  4AIH A;  2HDC A;  3K1P A;  4B3X A;  3CCQ I;  1JUS A;  2K02 A;  2PMZ N;  1BI2 A;  3MEX A;  3FXL A;  2HPM A;  1OR7 C;  5FFZ A;  3DTI A;  4XID A;  3FKJ A;  3WGH A;  3HHH A;  3HRU A;  2KMU A;  3KEO A;  1HDD C;  2UV1 A;  4GYI A;  3K70 C;  4RGX A;  3DV8 A;  4RB0 A;  1SFX A;  4R8H A;  3N4M A;  2MC3 A;  2Z3Y A;  2FBI A;  1EH6 A;  2J5P A;  3GZN B;  4GXO A;  2DJN A;  5E3O A;  2NVQ J;  3LMM A;  4B1R A;  3PIP F;  2O8K A;  3I5U A;  2KQR A;  1YX3 A;  3GTQ J;  1QVT A;  1SFO J;  3FBN B;  2BE5 F;  1U9O A;  2WV0 A;  3GF2 A;  3ZMZ A;  1XDU A;  1WH7 A;  2KPM A;  3K0L A;  3OYE A;  2CFO A;  3TED A;  4Q48 A;  3FK6 A;  3V8J A;  5B1B H;  3K4M A;  2L9N A;  3BG5 A;  3WGI A;  3IRQ A;  3AFH A;  4IPA A;  2V9P A;  4CH7 A;  4BXX J;  3V7R A;  3IH2 A;  2IT0 A;  3E7L A;  5J4Y A;  1ZGA A;  2B7E A;  3TL4 X;  1IXS B;  3JTH A;  4PFO A;  2X6W A;  2MG4 A;  3PO3 J;  3G2B A;  4YII A;  3TO7 A;  2CFX A;  4C3H J;  5TGT A;  4BEH A;  4RAY A;  2PI0 A;  3BLY A;  1FX7 A;  1IV8 A;  1MBF A;  1T0F A;  4O6J A;  5HLG A;  1VF9 A;  3HUG B;  1W5S A;  3GFL A;  4RMN A;  4UXN A;  1XDS A;  4C2T A;  2VOD A;  2EV6 A;  4XN0 A;  4YEJ A;  5LHI A;  1PP7 U;  3H0G J;  3G1L A;  2W4S A;  2UUZ A;  2KP6 A;  3AAF A;  2F4I A;  1YG2 A;  3CCV I;  1Z91 A;  4FET A;  3ASN H;  3S17 J;  4OU0 A;  1B8I B;  2X48 A;  4E7H A;  3ASO H;  4BBR J;  1T8I A;  3M8J A;  1SFE A;  4RGS A;  5J8F A;  1F9N A;  1IRF A;  2NOJ B;  3D5S C;  1TWG J;  3MVP A;  1FIA A;  2AHQ A;  2LYC A;  3WE2 A;  2DA7 A;  2ESN A;  3ECH A;  1B72 A;  2H1K A;  2BOL A;  1E3H A;  1FT9 A;  1ZG3 A;  5DTD A;  1B9M A;  1J0R A;  5F0F A;  2LK2 A;  3D0S A;  4EEF G;  1SC7 A;  3WHC A;  1A35 A;  4ZC3 A;  1MBK A;  2A69 F;  3C2G A;  3FKI J;  2DOE A;  2E2I J;  4HG2 A;  1IC8 A;  3T8R A;  4YEL A;  1APL C;  4IX7 A;  1U78 A;  2ZXI A;  1P9Q C;  3HRM A;  2FQ4 A;  1Q1V A;  3MWM A;  3S15 J;  3FXO A;  4L9T A;  2CW7 A;  2W85 A;  5KCM A;  1LUJ B;  5M5Y J;  3QOP A;  1QBJ A;  3VOD A;  1K61 A;  5GTH C;  5ICC A;  2VN2 A;  3DBH B;  2VI6 A;  5F1J A;  5D6E A;  2KZG A;  5K7Z A;  1I1G A;  1WI3 A;  2QM3 A;  1FTZ A;  3FBI B;  4A69 C;  1U8B A;  1ZR2 A;  3CF5 F;  4BHB A;  1ODD A;  3LOC A;  2EIN H;  3BC8 A;  2DMQ A;  4HRI A;  2DT7 B;  4D7M A;  5C4J J;  3D1N I;  1IN4 A;  2V1U A;  2M8G X;  3ZP5 A;  3H9G A;  2JUC A;  3GFM A;  4ITV A;  1K83 J;  1IDY A;  3G71 I;  1GDT A;  1ZEL A;  1MBH A;  1VQ9 I;  2C6Y A;  3LQQ A;  3RCO A;  4R79 A;  4S04 A;  3ZQ7 A;  1MNM C;  1DGW Y;  1FLI A;  3RI4 A;  3M8E A;  2WB1 A;  4XR6 A;  3BJA A;  2XSD C;  3MAJ A;  1WJC A;  3CF2 A;  2LRE A;  3TDU C;  5DUI A;  2KIF A;  1H0M A;  1U6G A;  2E71 A;  5FLX K;  5DYM A;  2JWT A;  4AYB A;  3DTE A;  2P5V A;  2JRM A;  3MCZ A;  4L5J A;  1H9T A;  2VLA A;  3GME A;  1O4X A;  2VPL A;  3SDG A;  1YIJ I;  3H0D A;  2DA4 A;  1FWZ A;  2OA4 A;  5K1Y A;  4AIJ A;  3AG3 H;  4XLP F;  1MNE A;  2OCE A;  3RKW A;  1ZHF A;  4FX0 A;  1Z7L A;  2H09 A;  1MBE A;  3ABK H;  1MND A;  3BPX A;  5F0C A;  4DIQ A;  3L2Q A;  2GXG A;  2LDU A;  4J01 A;  1SMT A;  1AHD P;  2IS2 A;  1TQP A;  3JAM K;  4L0Z B;  1Y39 A;  4FHT A;  3LNQ A;  4FQG A;  3CTA A;  4I09 A;  4BAC A;  1FIP A;  1K6Y A;  3NQO A;  1S72 I;  1R7J A;  2HZD A;  3TQN A;  2CS3 A;  2ZME B;  4XLN F;  2QGU A;  5ED4 A;  3TBI A;  3GTO J;  4PUS A;  3CME I;  3AL0 C;  2M1B A;  1IV6 A;  3S14 J;  2BYV E;  3TO9 A;  2CMP A;  1BR1 A;  3DEW A;  1J5Y A;  1FC3 A;  1MKM A;  4EVI A;  3GTL J;  1VQK I;  2DQL A;  1IN8 A;  4AD9 A;  2X1D A;  4Y52 J;  2X6O A;  4ZYD A;  4HLX A;  4LIU A;  2LG4 A;  2M87 A;  4RDU A;  3TW7 A;  3L2R A;  2W57 A;  1QPI A;  1QHH D;  5D8L B;  4M71 A;  1R6R A;  2UWM A;  2CQN A;  2BGC A;  2HQR A;  4JK1 X;  4M72 A;  1CGP A;  3BR0 A;  2B63 J;  3R4K A;  2XF5 A;  1BN5 A;  5FGM A;  2ZME A;  3K1N A;  4U0V A;  1U3E M;  1I50 J;  2NVY J;  2QA4 I;  1JTY A;  1D0X A;  1HSJ A;  1MJB A;  1I39 A;  2RAE A;  4XL9 A;  5AIP A;  3OIP A;  3PM1 A;  4M73 A;  3N97 A;  2XRL A;  1M1E B;  3ZMT A;  3I55 I;  2HR3 A;  2ZJ2 A;  4HX8 A;  1ON1 A;  4M6V A;  2VQG A;  5AON A;  1OFC X;  3ZXS A;  1V55 H;  5L3G A;  1Y1W J;  2FBH A;  3LSK A;  3F8B A;  5F64 A;  3JRB A;  4UB6 C;  4XOP A;  2H27 A;  3LSG A;  3BR5 A;  4XON A;  3KIO A;  2LY1 A;  4A5M A;  5CJ9 A;  3DLL F;  4A3K J;  3BZC A;  3PFY A;  5FLM J;  2EH3 A;  2M0M A;  2VPR A;  1QO0 D;  4IOC F;  3WGG A;  4DJA A;  4B48 A;  1ETV A;  3RZD J;  3RQI A;  4JP0 A;  4L9V A;  4LOC A;  3MFK A;  2W00 A;  2DYS H;  2DMT A;  1LQ1 A;  1FP2 A;  4OOI A;  3FHN A;  5DDG A;  1Y8R B;  1STZ A;  4KJZ A;  3GVA A;  1S7A A;  1VZ0 A;  1I6X A;  1YIO A;  4CYC B;  2DFE A;  1VQN I;  2CH0 A;  3P5J A;  4LFU A;  1JHH A;  4HQE A;  2CW8 A;  2KIQ A;  2IVM A;  1PYV A;  2MYS A;  4PFP A;  5KHD A;  2Y2Z A;  3O8H A;  4XLC A;  2D1V A;  3K9T A;  5J8C A;  3CCL I;  1W7P D;  4HLY A;  1AKH B;  3ABL H;  2GOX B;  4N0B A;  2PX9 A;  3HTU A;  2DDB A;  1VQ5 I;  5E1Z B;  1RRJ A;  1V5E A;  1HST A;  1XB4 A;  1TNT A;  3DCF A;  3IC7 A;  5DCM A;  4CCK A;  3ERM A;  3ZQI A;  2F5C A;  2F5F A;  4ZZD A;  2NNY A;  1F4K A;  4E4H A;  2W25 A;  5EGO B;  4ZYH A;  2ZXW H;  4ZJZ A;  3SHF A;  2W48 A;  3BT9 A;  1G8X A;  3ZMU A;  4BQQ A;  1ETX A;  3IHU A;  4KMU X;  2CSO A;  5GP9 A;  4KIC A;  4HDU A;  4RAZ A;  5EEH A;  5IY5 H;  3ZMD A;  3HOU J;  4F92 B;  3CC4 I;  1YJN I;  2MD5 A;  1IN7 A;  4MIM A;  3T5X A;  2YU3 A;  4RM3 A;  2K3P A;  3SYT A;  5F0H A;  2R7O A;  2FXA A;  5IP6 A;  1D5Y A;  2FQ3 A;  2M7B A;  4MFD A;  3IKT A;  2R5Z B;  1G3T A;  1P4X A;  4EMS A;  1DDN A;  1D5V A;  3U2R A;  4PJJ A;  1TW3 A;  2O6G E;  4LLG F;  3IAM 2;  3W6J B;  2ZSI B;  1WJE A;  4ZDL A;  2L7M P;  1B6A A;  3IWZ A;  4FE4 A;  4NQW A;  2EA2 A;  2PBI A;  4BHC A;  2EPF A;  1Z05 A;  1KYW A;  2IA1 A;  3ZOB A;  1IN5 A;  2KIU A;  4A2U A;  1SAU A;  5E3M A;  3HTS B;  3MD2 A;  2R93 J;  3QPL A;  3K4J A;  1FNN A;  1LKX A;  2EFW A;  2QQB A;  1J09 A;  2GZW A;  2HOT A;  4RBO A;  1X58 A;  2L54 A;  3PSF A;  5E8I A;  3PQJ A;  4Z2Y A;  1ETY A;  2DN0 A;  2Q2E B;  2WAD A;  4IQJ A;  2WTE A;  2CV2 A;  3BP8 A;  2HTJ A;  4I0B A;  4RB2 C;  4CCJ A;  3F6V A;  2JMW A;  4DBR A;  3K70 D;  1O7L A;  3LSJ A;  1JE8 A;  1D8J A;  4HST A;  1U5T B;  1O3R A;  3FIW A;  4RA2 A;  1F5T A;  3VEP A;  2CUF A;  3FDY A;  5BPI A;  2R7D A;  4E7I A;  3BG3 A;  1YFH A;  4MTE A;  1V4R A;  3I4M J;  1QVU A;  3QWL A;  3BOQ A;  3OYL A;  2FOW A;  3H9Q A;  2CV1 A;  4HNV A;  3K10 A;  1BIB A;  2ZNY A;  4BS9 A;  2ZJQ F;  4Y17 A;  4G7O F;  1H88 C;  2R7T A;  3L2U A;  1YYV A;  1ZH5 A;  3E3V A;  3O3K A;  1NG6 A;  2RV8 A;  4AID A;  1HXD A;  2Y31 A;  3TO6 A;  1GV2 A;  4XNF A;  4XSZ F;  4I98 B;  2I5U A;  4IVN A;  1YW7 A;  3T8T A;  4ANJ A;  2QZ8 A;  2DO7 A;  1AU7 A;  3VYU B;  3OMY A;  2QQ8 A;  3FF5 A;  4ZZL A;  2MD0 A;  5CVU A;  4J00 A;  3ZQG A;  1JTX A;  1T98 A;  1HW2 A;  3Q0U A;  5HDG A;  2PQ8 A;  2CQX A;  3I58 A;  1D1C A;  3CJQ B;  5LHH A;  4IQ4 A;  3W6K B;  4KN4 X;  3OL3 A;  3Q0V A;  5ILU A;  2IRF G;  3F23 A;  2Q8K A;  3S2H J;  2VKE A;  5TIS C;  3E1S A;  4HAM A;  4BEH B;  5FD6 A;  5KNL A;  4WXC A;  1W5T A;  2PJP A;  5FLX Z;  2PMZ A;  2PFB A;  1W1W E;  3IH3 A;  3BG9 A;  2BBY A;  2XIG A;  4IRG A;  3S3O A;  1TWH J;  2FX0 A;  4C30 A;  3KZI C;  5KAI C;  4AYB N;  2VOP A;  1IN6 A;  2R7X A;  1FOK A;  2GQQ A;  3ABU A;  3WHB A;  4DYR A;  5DV5 A;  4WXH A;  4AC0 A;  1SFK A;  4EGZ A;  2HEO A;  3M3Y J;  1OCT C;  4ZH4 F;  2L0K A;  3RPQ A;  3LSR A;  1S3J A;  5CQE A;  5ICG A;  4HF2 A;  3FM3 A;  2D1H A;  1BIA A;  5K5R A;  4IF4 A;  4PSX A;  1O57 A;  2JN6 A;  4LB5 A;  3HGG A;  4M3B A;  2XRO A;  3H3V K;  1UB9 A;  4RLQ A;  1HLV A;  2OZU A;  4X1E A;  4XLF A;  3KET A;  3S1M J;  1P92 A;  5F6F A;  1XCV A;  4CZZ A;  1W7P B;  4XIC A;  3JRG A;  4JYK A;  3EET A;  2W7N A;  4KIF A;  2PMU A;  3OWT A;  1J9I A;  4W1U A;  2ME0 A;  3L7W A;  1YO5 C;  1QRY A;  4NC8 A;  2QBY A;  2K27 A;  2FNP A;  2XB0 X;  2XAQ A;  4YIF A;  3E5U A;  3ZN0 A;  5HDK A;  3KE2 A;  4XN3 A;  2XF7 A;  2ECB A;  3CMY A;  1T6S A;  1YX5 A;  2BY3 A;  1NG7 A;  4YRV A;  4HF1 A;  1Y1V J;  3R0J A;  2ZSH B;  3P9C A;  1HF0 A;  3FXU A;  4A6E A;  2FNA A;  1ONV A;  3V8K A;  5IYD J;  3OYN A;  1D3Y A;  3EUK L;  2HKX A;  5CPR B;  5FRM A;  1QPM A;  5B3S H;  2CUE A;  5FD5 A;  4NHJ A;  3PUF A;  3MMY B;  5A2Q K;  3ABM H;  1YJ9 I;  4KUM A;  2Y0S N;  1P4A A;  1MW7 A;  5FKO A;  3GZ5 A;  1R5H A;  3OOP A;  1VQM I;  1IRX A;  1FOY A;  1LNW A;  4XLH A;  1GVD A;  2QVO A;  1JKO C;  3SQN A;  5JFR A;  1Z9C A;  3B6A A;  3E6B A;  3S3N A;  2VQH A;  4M6X A;  2M4G A;  4FTH A;  4EM1 A;  2ZJP F;  3LST A;  4A3C J;  4N9I A;  2DQR A;  2EBI A;  1S6L A;  3S1Q J;  2QEX I;  3OYD A;  5E1X A;  3U9G A;  5E3N A;  3BR3 A;  2CWE A;  1I27 A;  5BMZ A;  1XS9 A;  3DBR B;  3S1R J;  2E2H J;  2OCC H;  3G4S I;  4Y15 A;  3NAR A;  1PUF A;  3LAJ A;  2LF7 A;  1U9N A;  1MH4 A;  2ECC A;  2XVC A;  1RPW A;  1WHU A;  1RKW A;  2K9Q A;  3HZJ A;  5IOY A;  4BDZ A;  3J80 Z;  1WJ5 A;  3AG4 H;  5IOZ A;  1ZR4 A;  5CVR A;  1TT0 A;  4UHT A;  1YQA A;  2E60 A;  3F21 A;  2R7R A;  3I53 A;  2F4M B;  4AVZ A;  1OCP A;  4IJA A;  1DU6 A;  1MZB A;  4YFK F;  3WE3 A;  1IF1 A;  1UJ8 A;  3W3C A;  2E1C A;  3BQY A;  5L3E A;  4RM2 A;  1U5T A;  4A3B J;  4ENM A;  4EM2 A;  2GIZ A;  2MLK A;  3MN2 A;  3IRR A;  2XUB A;  2H1L A;  1TQM A;  2P4W A;  1HKT A;  1ZK8 A;  2R0Q C;  3F72 A;  2V6E A;  4XRS G;  1QNT A;  4A3M J;  3I59 B;  2KT0 A;  3L00 A;  4FAS D;  4P9F A;  1ZGJ A;  3TW6 A;  1BA5 A;  3RJP A;  4D7N A;  3DFG A;  3BDD A;  4XLE A;  3IH4 A;  1X4O A;  3CDL A;  2ME6 A;  3NAU A;  3CJT B;  1UHW A;  3CMM A;  3OYM A;  2F2E A;  1S5L C;  2K40 A;  3A0H C;  3B02 A;  3CES A;  5DD8 A;  2NAZ A;  2WBM A;  4LG0 A;  3HOV J;  1RNL A;  1X2M A;  2X0L A;  3HEF A;  2JTV A;  1K78 B;  4KYW A;  3WTU C;  1E3O C;  3OYC A;  1YJW I;  5D5V B;  3FHZ A;  1OCR H;  2DLL A;  2R4G A;  2VJJ A;  4C3I J;  1X1B A;  5EEA A;  3KP5 A;  4P96 A;  5HDN A;  3CO6 C;  4A3G J;  1YRN B;  2LSO A;  2L7K A;  3GW2 A;  5DCM B;  4QLC U;  3GYH X;  3HIF A;  4G9Y A;  5J1Y A;  2DK8 A;  3I4P A;  1TWA J;  1ITY A;  5DM7 F;  3C3W A;  1J59 A;  5JLW A;  1X1C A;  2XKO A;  4CZC A;  1O3Q A;  3P7N A;  1ZLK A;  1E3P A;  4HNU A;  2UXN A;  3S2D J;  4XKW A;  1IG7 A;  2K9N A;  5J6X A;  3Q5F A;  1K4S A;  3S32 A;  3WTW C;  2Y48 A;  3HSF A;  1QU3 A;  3FMS A;  3I3L A;  2K5C A;  3KCC A;  3OYG A;  2GLO A;  4GFB A;  4M9Z A;  1K78 A;  4UUS B;  2BY1 A;  3JRH A;  4BJ6 C;  4OMY A;  3QPS A;  5B1A H;  4B43 A;  1J7K A;  5D4R A;  4A93 J;  1Z7U A;  2KDO A;  1QQI A;  1R58 A;  2YR2 A;  4HBL A;  2ID3 A;  4HX4 A;  4PJN A;  1U0J A;  1S7E A;  2Z33 A;  1V54 H;  3ZQC A;  4C3J J;  5LGU A;  3SXY A;  2VKH A;  3H9J A;  4CCN A;  1VQ8 I;  2EA4 A;  5D5U B;  3FZV A;  3QYB A;  3V7S A;  2YS9 A;  4BGD A;  1PJR A;  1UCR A;  2DI3 A;  4HX7 A;  2QSF X;  1Z21 A;  2V26 A;  5JVT A;  1CF7 A;  2GA2 A;  2XPV A;  2STW A;  2M8E A;  2A68 F;  5IP9 J;  1G2H A;  4LMY A;  2LBF B;  5LGT A;  2FRH A;  4XRS A;  1YLF A;  1I3Q J;  2P7V B;  3K4K A;  4DQ2 A;  1W0U A;  1HOM A;  2XGD A;  4A6D A;  4BQN A;  4BBS J;  1YS6 A;  1ETW A;  1MIJ A;  3BWG A;  4JOM A;  3OYB A;  5DM6 F;  1T0F C;  3V42 A;  2HQN A;  2XAJ A;  4DZP A;  2QCO A;  1XSD A;  1BR4 A;  1R9T J;  2LF8 A;  2HI3 A;  1FOW A;  2ZXJ A;  1KU2 A;  4LK0 F;  3HGY A;  3MZH A;  1RC9 A;  2EK5 A;  3BCA A;  2P8T A;  1B8I A;  2VT2 A;  3L1P A;  5LRS A;  4BL0 B;  2VJI A;  2Y75 A;  1Z0X A;  3K69 A;  2N8G A;  2V79 A;  2QWW A;  1MJA A;  1XGS A;  4G6D A;  1T08 B;  2VC0 A;  2JUG A;  4F91 B;  1ZAO A;  4MEY F;  2IJL A;  3WU1 B;  1UMQ A;  3OSG A;  1LEA A;  3WTS C;  1ETQ A;  2V4J C;  4BU2 A;  1RIO H;  1G6N A;  1BM9 A;  1LFP A;  3Q3S A;  3ZR8 X;  3B73 A;  3HL2 A;  4CIC A;  1ZQ3 P;  3ZQQ A;  2H6C A;  2CUZ A;  2HKO A;  2V6C A;  3DQV C;  3LSH A;  1U5T C;  1UG2 A;  5J3L A;  4ENJ A;  2H8W A;  4E7K A;  3FX3 A;  1OCO H;  5LGN A;  3GTP J;  1C0W A;  2IGM A;  3ZGK A;  4A3E J;  3G3Z A;  2Z9O A;  1R5G A;  3LSI A;  4AUX A;  2AXL A;  4OIQ F;  3BPV A;  4PGH A;  3HPG A;  1T95 A;  4C2M J;  2BHY A;  1TLH B;  1R1T A;  5DD4 A;  1TTY A;  3V4G A;  3J7A Y;  5CQG A;  2R5Y A;  1Y0U A;  2X1E A;  1KON A;  2DFI A;  4AU7 A;  2AQF A;  1IUF A;  1EA3 A;  2HVQ A;  1FY7 A;  4XKC A;  1LJ9 A;  3FIS A;  4KMF A;  3BRO A;  1WKM A;  3NRV A;  2DK5 A;  3HRS A;  3W2V A;  4FT8 A;  4A0Z A;  2L9R A;  5LD2 C;  2A6H F;  1B1B A;  2O5R A;  2MAB A;  4IHW A;  3OYK A;  5LFA A;  4ZDP A;  4XBF A;  3H35 A;  2DAO A;  3QOD A;  2VE9 A;  3PNV A;  4I02 A;  4Y7N J;  3KLO A;  2CQK A;  3BZK A;  1K79 A;  1ENH A;  5K5Q A;  3E0J B;  2ZXH A;  4A0Y A;  5HOD A;  1I1S A;  2VIX A;  4NDL A;  2DDA A;  2EFO A;  4M3G A;  2IXS A;  4ZYA A;  4A5N A;  5E3L A;  2VON A;  4U87 A;  2QKL B;  1ERD A;  2X1C A;  2M3A A;  4GO1 A;  5KK1 A;  3F9K A;  2HGC A;  5HLI A;  4KT6 A;  5GAE J;  3W2A A;  2COB A;  1KYZ A;  2HS5 A;  1OLT A;  3I56 I;  1RZ4 A;  4N4N B;  2E1M C;  2DOF A;  4BJ5 C;  4HDV A;  1UFM A;  4BQA A;  4CUG A;  2OV7 A;  4F3Q A;  2JA8 J;  4JBA A;  4D9J A;  4KIS A;  2VUM J;  3X2Q H;  4HW0 A;  4ZYG A;  1IXC A;  2PMH A;  2MSY A;  1P2F A;  1X1P A;  1YW8 A;  1Y6I A;  5EYR A;  4N4O B;  4LLL A;  2XAS A;  2F4O B;  3L9F A;  1OPC A;  5JI6 A;  4GGG A;  2NVX J;  1T56 A;  2Y0S A;  1B72 B;  2HU9 A;  3RZO J;  2V1N A;  2R3S A;  1OYI A;  2KLO A;  2DPD A;  5EEG A;  1BOB A;  3DKX A;  4MEX F;  2VT3 A;  4BY1 J;  4BE2 A;  1G4D A;  1P7I A;  4S0H B;  2QYO A;  1R71 A;  3FMQ A;  2JA6 J;  5GPC A;  2E5Z A;  2FD5 A;  1R36 A;  3QOE A;  1H8A C;  3S1N J;  1JKR C;  4BYY A;  3E5X A;  3O8G A;  2UXX A;  4NC6 A;  1IUY A;  1F43 A;  4CYD A;  2H6B A;  3I59 A;  1R22 A;  2IEK A;  3G1O A;  3VSL A;  4U0W A;  1H9G A;  1XMX A;  3OR2 C;  2GM4 A;  3KLN A;  3GLL A;  5HOO A;  2EZI A;  4FE7 A;  5TRD A;  1OCZ H;  2E1O A;  1WCM J;  5B66 C;  1DU0 A;  5LLQ A;  4BXF A;  5GPA A;  4HZF A;  3CDH A;  2L7Z A;  3O2P E;  2RC4 A;  2L01 A;  3GWZ A;  4M3D A;  4ESF A;  4D5F A;  5KVR A;  3BJ6 A;  3RQ4 A;  4UB8 C;  2D2W A;  2HVR A;  1XSX A;  4LIV A;  2LD5 A;  1LDJ A;  4IRI A;  2HXO A;  1KA8 A;  3WOD F;  3ECO A;  3VOE A;  1OCC H;  4I7H A;  1RUN A;  3CUO A;  3OR1 C;  4IEJ A;  5LEK A;  2P6S A;  4E7J A;  2NS8 A;  3T0Y A;  2EIM H;  1FJL A;  4UVB A;  4BH9 A;  3BTC A;  4DYC A;  3GTK J;  2E34 A;  3IWF A;  4G6T B;  3CCE I;  3JSO A;  1IAW A;  4XRF A;  1BI0 A;  4NC7 A;  2OD5 A;  3DU5 A;  2F5D A;  4OIR F;  3WU0 A;  1VTN C;  1IO2 A;  4HV6 A;  2ICW G;  3CUQ B;  2JK3 A;  2LH9 A;  1FBU A;  2WAE A;  1MJ9 A;  4BDY A;  3A2K A;  4L18 B;  2PEX A;  2IGN A;  1BJZ A;  2JA7 J;  2VL8 A;  1HC8 A;  1ON2 A;  2E5N A;  1LVA A;  5H6Q A;  4CCO A;  3CCS I;  3KZZ A;  3MKY B;  1XGM A;  4I6Z A;  5EF6 A;  3HDD A;  3TGN A;  1TT5 B;  4ESB A;  1DUX C;  2HZT A;  4XSX F;  2FF4 A;  2LP0 A;  2ZME C;  3G73 A;  4MQV A;  5FKM A;  1WRJ A;  2A5Y B;  3BR2 A;  1ETK A;  4L5I A;  2LKS A;  3KFW X;  1MMA A;  1CF7 B;  4BUP A;  3HUG A;  4ZYE A;  1FP1 D;  3HSR A;  3IUO A;  3O6B B;  4LB6 B;  4Y33 A;  1DP7 P;  1LB2 A;  3C2B A;  2WA0 A;  3QP6 A;  1RR7 A;  1S8N A;  1Y56 A;  3SJM A;  4U7D A;  4UNO A;  4BHP A;  3J81 K;  4DBQ A;  2M30 A;  3RIR A;  3CC7 I;  5GAD J;  2RN7 A;  2VJ5 A;  4XOT A;  3TP3 A;  1XN7 A;  2WWY A;  2QQ9 A;  2RKH A;  3BCB A;  5L3D A;  4IZZ A;  3GO5 A;  2EZK A;  2X85 A;  5JR3 A;  3ABT A;  3G6E I;  3N05 A;  3SZT A;  2L4A A;  2RQQ A;  1X3W B;  2HDD A;  5FJ8 J;  4KIT B;  1T38 A;  4U7B A;  2R92 J;  5HVQ C;  1X2N A;  3L2W A;  3HKZ N;  1UG0 A;  5TJJ A;  3BQZ A;  2LOO A;  2LMD A;  1ZLJ A;  4LLN A;  2XC7 A;  1XMK A;  4HNT A;  3K4N A;  3M9A A;  1KU3 A;  1IRG A;  3R61 A;  1W0T A;  2L02 A;  3DPU A;  2KJC A;  3BR1 A;  1OKR A;  3QPH A;  3S8P A;  3M1C A;  4EGY A;  4D1Q A;  2Q0O A;  2PJR B;  2EFN A;  3PJR A;  1UZC A;  4EV0 A;  4S05 A;  2DA5 A;  2XSJ C;  3H1C A;  3L09 A;  4L9N A;  2OUM A;  1YTY A;  1GHC A;  1X3U A;  2G7U A;  1MSE C;  1SD6 A;  1WH5 A;  3BTL A;  2GWR A;  4IHY A;  2GBY A;  5M5X J;  2LTP A;  2HXI A;  2X9D A;  1W36 C;  2DPU A;  2ETH A;  3I4N J;  2Z1D A;  2W1O A;  2JZY A;  2O0Y A;  2VE8 A;  3HXL A;  4DW6 A;  3UR3 C;  1LEB A;  1Y8Q B;  2EV5 A;  2RGV A;  3M1E A;  3F8F A;  1WJA A;  2V9V A;  4I0A A;  3EYY A;  3HOX J;  4RS8 A;  5HNF A;  2IBD A;  1A6I A;  2ZBK A;  3QU6 A;  4B09 A;  1HQC A;  2CQ7 A;  3TOB A;  2EQR A;  3WTT C;  1ZGW A;  5M3M J;  1LE8 B;  5B5E C;  1BOA A;  4R1H A;  5FKK A;  9ANT A;  3W2W A;  4LG3 A;  2P81 A;  3IV5 A;  4QTR A;  2PJR A;  1CQT A;  1I5Z A;  3J7A O;  3VYS B;  2HPI A;  5F04 A;  1XGN A;  2MLG A;  1IW7 F;  1ZKG A;  3PO2 J;  2A3S A;  1QZY A;  2M2E A;  5DUK A;  1TNS A;  1I6H J;  3DEU A;  2K7L A;  3A4C A;  1SD4 A;  1TQI A;  1FTT A;  2X4H A;  4HEA 2;  2DJI A;  2WV1 A;  4D0P A;  3CJN A;  2WC2 A;  1VFC A;  2FU4 A;  3MQ0 A;  2LFB A;  1BJA A;  1TWF J;  3I64 A;  2M34 A;  1T2K A;  2TRT A;  3OV8 A;  5CVJ A;  2KRF A;  2NOG A;  3TKY A;  5IYC J;  2Y0M A;  1DGR M;  3F0C A;  3REO A;  4YFN F;  4PDK A;  4CXF A;  4IRH A;  2EIK H;  2E36 A;  2FE3 A;  3IL2 A;  3SEZ A;  2KHM A;  2ZKZ A;  4LD5 A;  2O61 A;  2IGK A;  2BW3 A;  2PN6 A;  2A07 F;  2P6T A;  4G94 A;  3TDZ C;  3CCM I;  3ESW B;  5FKL A;  4MGR A;  1AWC A;  2FBK A;  4EJU A;  3LSP A;  5CLS A;  2JA2 A;  5ILS A;  3NWT A;  3QQA A;  4Q4Z F;  1VQ7 I;  3KPH A;  5IPA A;  1OMI A;  5L3F A;  2ADU A;  5HS8 A;  3ZQL A;  2NRA C;  1N25 A;  2Z2S B;  1HBX G;  3M07 A;  1G3Y A;  5FKN A;  3JRF A;  2ISY A;  2EB7 A;  2E7W A;  2MFZ A;  1USS A;  4OAZ A;  3K2Z A;  4F7Z A;  3RKX A;  2VBX A;  4ZDO A;  1ZYR F;  1VND A;  4XQF A;  1MMS A;  4G8X A;  4EAT A;  3CCR I;  1YIT I;  1F1Z A;  1K7A A;  3E6M A;  3EQL F;  2F6C A;  1V5F A;  4II3 A;  5KAF C;  5E18 F;  4ZTJ A;  3LL7 A;  4GDF A;  4A3D J;  2IS1 A;  1V5G A;  2LVS A;  3WTX C;  3ML6 A;  1GV5 A;  3HOS A;  4XLA A;  1VQO I;  3KZY A;  3K4L A;  4JX5 A;  1OQY A;  3I71 A;  1QHG A;  3C1D A;  4Q5S F;  1ACI A;  3AL0 B;  1FZP B;  2K4J A;  2HNH A;  1IXR C;  4PJM A;  1QGP A;  2I10 A;  4N9H A;  1TP4 A;  3IAS 2;  3LA2 A;  2EIL H;  2OC6 A;  1T39 A;  2RRE A;  4JX6 A;  3FXJ A;  4ESJ A;  2BW3 B;  2VAS A;  4FIS A;  3K1M A;  5CYV A;  2A61 A;  4EJW A;  2YX7 A;  3MZY A;  3M7G A;  3UKG A;  2FEZ A;  4B4C A;  1SFU A;  2KKO A;  3KP6 A;  1WVR A;  2R7F A;  4ON0 A;  1YW9 A;  1EF4 A;  3VFZ A;  1V3F A;  4OMZ A;  1Z3X A;  3F8C A;  2K9S A;  3VYR B;  4G6Q A;  3HRT A;  1KZH A;  2JJ7 A;  3HM5 A;  4EJV A;  2ZFW A;  2X51 A;  4U88 A;  2E1N A;  2DT5 A;  2HQ5 A;  1XC5 A;  3HG9 A;  3HSE A;  1GXQ A;  4GRI A;  1JUP A;  1IZ1 A;  4ASN A;  4IOA F;  1TC3 C;  4TV7 A;  3COA C;  4A3F J;  1JI8 A;  2JA5 J;  1S29 A;  2DBB A;  1YOV B;  3T1B A;  1FSH A;  2HDW A;  2KDZ A;  3ZQF A;  1TW2 A;  5J1R A;  1PUE E;  3HYI A;  1EJ9 A;  2I8D A;  4Q47 A;  2O8X A;  3FXM A;  1JKP C;  2LY2 A;  2VKV A;  3A03 A;  1XCB A;  1RES A;  1MMD A;  2G9W A;  4MO7 A;  2O3F A;  3CCU I;  2JSP A;  4BNC A;  4CO8 A;  4LJZ F;  4PJL A;  3SZP A;  3GTG J;  2XV4 S;  3GFJ A;  4F52 A;  3K2A A;  2Z5U A;  5IT9 K;  2WAF A;  2DU9 A;  1JJ6 C;  3JRD A;  2MBF A;  3TP0 A;  5E17 F;  2AO9 A;  2Z99 A;  3R60 A;  3R6S A;  3L2V A;  5GTI C;  4I99 C;  4M74 A;  4F93 B;  4UUV A;  2YUS A;  1PUF B;  2Q1Z B;  5HLH A;  1BL0 A;  2NVU B;  4IHS A;  3C18 A;  1FYM A;  1NK3 P;  1WWX A;  2GA1 A;  1GT0 C;  3KYD B;  2VXZ A;  2CRG A;  5GAH J;  1SEU A;  4DGW B;  2IW5 A;  2OJE D;  2WY7 Q;  2RNJ A;  2ACJ A;  4EJO A;  5EGO A;  2E35 A;  2HYF A;  3H5N A;  4EM0 B;  2NS7 A;  2JT1 A;  4E7L A;  4RGU A;  4RLF A;  1MSF C;  1KU7 A;  1OJL A;  1BC8 C;  3BTI A;  3D5R C;  5JHF A;  1AA7 A;  3V7C A;  1BW5 A;  3RSN A;  2TCT A;  3V8L A;  4FCY A;  2STT A;  1HKQ A;  5ICE A;  2COM A;  2L4M A;  4MQ9 F;  5D8K B;  4M3E A;  2IA2 A;  1P4W A;  4E7Z A;  2CYY A;  1L0O C;  4KIB A;  3ZQH A;  3EDP A;  1JUM A;  3H92 A;  2DCE A;  1SAN A;  4H4K C;  2VKD A;  5F27 A;  5LRR A;  3KEY A;  4IHT A;  2ELH A;  3RDI A;  2OZ6 A;  1D0Y A;  3ZN1 A;  1Z6T A;  1R5I D;  3OS2 A;  2XRN A;  2P5K A;  2XF6 A;  3C2H A;  2QUF A;  2DFF A;  2RNG A;  3E6D A;  2X6X A;  4QWQ A;  3AKZ A;  1ETO A;  2VQC A;  2LLK A;  3ZMV A;  1Z77 A;  2GXA A;  3GTJ J;  3PFI A;  2OQG A;  1E0E A;  2HTS A;  4YFX F;  2L9S A;  2G0E A;  3CC2 I; 
#chains in the Genus database with same CATH homology
 2NVX J;  2DA3 A;  5K7F A;  1T56 A;  3BTJ A;  5M3F J;  1B72 B;  3ZOB A;  5K7H A;  3RZO J;  5E3M A;  3GBG A;  2R93 J;  1MBG A;  3QPL A;  5C44 J;  3GTM J;  2R7Z J;  4BY1 J;  1P7I A;  2HOT A;  2L7F P;  4S0H B;  4RBO A;  1X58 A;  2WAQ N;  2Y30 A;  3S16 J;  2JA6 J;  4V2G A;  5GPC A;  2FD5 A;  2MW8 A;  1H8A C;  3S1N J;  1JKR C;  3O8G A;  4BY7 J;  1ETY A;  2DN0 A;  1F43 A;  1RET A;  2IEK A;  2JMW A;  3G1O A;  3LSJ A;  1MH3 A;  5EDN A;  2GM4 A;  1IDZ A;  3FIW A;  1HDP A;  3K7A J;  4QIW N;  2CUF A;  2EZI A;  3MKL A;  4FE7 A;  4IHV A;  3BG3 A;  2E1O A;  1XG1 A;  3I4M J;  1QVU A;  1WCM J;  1DU0 A;  1IRZ A;  5GPA A;  1MBJ A;  4HNV A;  2D5V A;  4I76 A;  2L7Z A;  4DYQ A;  1A5J A;  2XPU A;  2OPT A;  2XGE A;  4M3D A;  2Y31 A;  4D5F A;  1GV2 A;  4D5C A;  2LD5 A;  2DTZ A;  1JJ8 C;  2E19 A;  2HXO A;  3A01 B;  1AU7 A;  2MGQ A;  2XPW A;  2DA1 A;  4IEJ A;  3ZQG A;  1JTX A;  3Q0U A;  2CQX A;  5IYB J;  2NS8 A;  1FJL A;  3Q0V A;  5C3E J;  3BTC A;  4DYC A;  3GTK J;  3G1M A;  3S2H J;  2VKE A;  1JUS A;  2PMZ N;  3OIO A;  3JRA A;  4XID A;  1JGG A;  3HOW J;  2JK3 A;  1HDD C;  1JT6 A;  1YRN A;  3IH3 A;  3BG9 A;  1TWH J;  2FX0 A;  1BJZ A;  4AYB N;  4J19 A;  2JA7 J;  2EZL A;  2O9L A;  2DJN A;  5E3O A;  2R5Y B;  3A02 A;  2NVQ J;  3WHB A;  4DYR A;  4AC0 A;  3M3Y J;  4B1R A;  4I6Z A;  1OCT C;  2O8K A;  1FEX A;  5EF6 A;  2L0K A;  3HDD A;  3LSR A;  3GTQ J;  1QVT A;  1SFO J;  2LP0 A;  5FKM A;  1U9O A;  3BR2 A;  1ETK A;  1WH7 A;  2ELK A;  2JN6 A;  3HGG A;  4M3B A;  2M9H A;  3TED A;  3H3V K;  1HLV A;  4X1E A;  3FK6 A;  3S1M J;  3BG5 A;  3C2B A;  4BXX J;  3A01 A;  1RR7 A;  4L5E A;  3IH2 A;  4XIC A;  3JRG A;  4JYK A;  3SJM A;  3E7L A;  2LKX A;  3Q0W A;  4W1U A;  2ME0 A;  1QRY A;  2XB0 X;  5F08 A;  2MG4 A;  3PO3 J;  1NTC A;  4C3H J;  3TP3 A;  2ECB A;  1H89 C;  3CMY A;  1MBF A;  5C4X J;  3OOU A;  1VF9 A;  2EZK A;  1Y1V J;  1RKT A;  1HF0 A;  5IYD J;  1VI0 A;  3G1L A;  3H0G J;  2HDD A;  5FJ8 J;  4MLO A;  1LE8 A;  2R92 J;  3S17 J;  1X2N A;  1B8I B;  2X48 A;  2CUE A;  3HKZ N;  4BBR J;  2R5Z A;  1LFU P;  3BQZ A;  4QSH A;  4IHX A;  5FLV A;  3HB9 A;  1TWG J;  3MVP A;  2Y0S N;  1FIA A;  2AHQ A;  2HYJ A;  5FKO A;  4UUT A;  2DA7 A;  1W0T A;  1GVD A;  1JKO C;  1B72 A;  2H1K A;  3BR1 A;  3B6A A;  3OSF A;  4FTH A;  2E2J J;  1TWC J;  4A3C J;  2EBI A;  5DTD A;  5F0F A;  2DA5 A;  2LK2 A;  4EEF G;  3WHC A;  3S1Q J;  2CQQ A;  2LR8 A;  1LFB A;  3W6V A;  1MBK A;  5E3N A;  3BR3 A;  1XS9 A;  3S1R J;  2E2H J;  5IP7 J;  3FKI J;  1MSE C;  1BW6 A;  1WH5 A;  3NAR A;  3BTL A;  2E2I J;  1PUF A;  2GBY A;  5M5X J;  2LTP A;  2HXI A;  2X9D A;  1IC8 A;  4IHY A;  3I4N J;  4DW6 A;  1APL C;  1U78 A;  1U9N A;  1MH4 A;  2ECC A;  1RPW A;  1RKW A;  2FQ4 A;  2K9Q A;  1Q1V A;  5IOY A;  2ZB9 A;  3S15 J;  2EZH A;  3HOX J;  2NVT J;  5IOZ A;  1ZR4 A;  5EG0 A;  2IBD A;  1A6I A;  2EQR A;  5M5Y J;  4V2F A;  2IAI A;  1ZGW A;  5M3M J;  1K61 A;  1LE8 B;  1OCP A;  1DU6 A;  5FKK A;  2VI6 A;  5F1J A;  9ANT A;  5K7Z A;  1T33 A;  2P81 A;  1WI3 A;  3BQY A;  4QTR A;  3IV5 A;  1CQT A;  1FTZ A;  4A69 C;  4A3B J;  1U8B A;  2DA6 A;  1ZR2 A;  1AKH A;  5F04 A;  3MN2 A;  3LOC A;  1ZKG A;  4W97 A;  3PO2 J;  2M2E A;  2DMQ A;  1I6H J;  1NK2 P;  1ZK8 A;  4D7M A;  5C4J J;  3D1N I;  2R0Q C;  4XRS G;  4A3M J;  2M8G X;  2KT0 A;  3JRC A;  1FTT A;  3TW6 A;  1BA5 A;  2WV1 A;  4ABZ A;  1K83 J;  1IDY A;  4D7N A;  1VFC A;  1ORK A;  3IH4 A;  1GDT A;  3CDL A;  1MBH A;  2ME6 A;  2DMP A;  2LFB A;  3NAU A;  1TWF J;  1MNM C;  3HOY J;  2M34 A;  3HOZ J;  2M0C A;  2TRT A;  2K40 A;  1JKQ C;  1H88 C;  4DZJ A;  3HOV J;  2XSD C;  1X2M A;  3HEF A;  2NOG A;  2LY9 A;  4BKX A;  5IYC J;  1E3O C;  3F0C A;  4C3I J;  5EEA A;  2JWT A;  2Y9Y A;  4A3G J;  1YRN B;  5FKL A;  1O4X A;  3SDG A;  5J1Y A;  3LSP A;  1ZTR A;  2DA4 A;  3QQA A;  2YU9 J;  1TWA J;  5IPA A;  1ITY A;  3ZQL A;  4XK4 A;  5JLW A;  5FKN A;  1P7J A;  3JRF A;  3M4O J;  3S2D J;  1MBE A;  2K9N A;  1IG7 A;  4G12 A;  4JX4 A;  2GLO A;  5F0C A;  1VND A;  4GFB A;  5JLX A;  4UUS B;  3JRH A;  1AHD P;  5EG0 B;  3QPS A;  4A93 J;  3HBL A;  3LNQ A;  2ID3 A;  4A3D J;  1FIP A;  1S7E A;  2LVS A;  3ZQC A;  4C3J J;  1GV5 A;  4JX5 A;  3GTO J;  2YS9 A;  1IV6 A;  3S14 J;  2I10 A;  3DEW A;  3GTL J;  4UUS A;  4B3A A;  4JX6 A;  2Y9Z A;  4Y52 J;  2X6O A;  2XPV A;  4FIS A;  1QPI A;  4RDU A;  3TW7 A;  5IP9 J;  4A3J J;  1G2H A;  3UKG A;  4B4C A;  4XRS A;  1HCR A;  1I3Q J;  1EF4 A;  1W0U A;  1HOM A;  2XGD A;  4BBS J;  1ETW A;  3BR0 A;  2K9S A;  4XRM A;  2OF7 A;  2B63 J;  2JJ7 A;  3HM5 A;  4DZP A;  2QCO A;  2O7O A;  2H8R A;  1R9T J;  5DS9 A;  2CJJ A;  2HQ5 A;  2HI3 A;  1XC5 A;  1JUP A;  3HGY A;  1I50 J;  2NVY J;  2FJ1 A;  1JTY A;  2RAE A;  1IGN A;  1B8I A;  1TC3 C;  4MFE A;  3L1P A;  4A3F J;  3PM1 A;  2JA5 J;  2XRL A;  1Z0X A;  2DMU A;  2KDZ A;  2N8G A;  3ZQF A;  5J1R A;  5M5W J;  4M6V A;  1OFC X;  1JKP C;  1Y1W J;  3CQZ J;  1UMQ A;  2VKV A;  3A03 A;  3VPR A;  1RES A;  1WPK A;  3BR6 A;  4MO7 A;  3OSG A;  1ETQ A;  2DA2 A;  3FK7 A;  3JRB A;  3GTG J;  3LSG A;  3BR5 A;  3Q3S A;  1ZQ3 P;  3SFI A;  4A3K J;  3K2A A;  5J3L A;  1UG2 A;  5FLM J;  2CU7 A;  2EH3 A;  3JRD A;  1JJ6 C;  2ID6 A;  3TP0 A;  2VPR A;  2AO9 A;  3GTP J;  5J1U A;  1UHS A;  2HOS A;  4A3E J;  2YUS A;  1PUF B;  1ETV A;  2DMN A;  3RZD J;  4A3L J;  4AUX A;  3RQI A;  1BL0 A;  4JP0 A;  4LOC A;  4C2M J;  1NK3 P;  2DMT A;  3JRI A;  1GT0 C;  2R5Y A;  2CRG A;  3JRE A;  4CYC B;  5EGO A;  2NS7 A;  1IUF A;  3FIS A;  1JT0 A;  1MSF C;  1OJL A;  3BTI A;  2XB5 A;  2L9R A;  2Y2Z A;  4IHW A;  3O8H A;  1WGX A;  1BW5 A;  2TCT A;  4Y7N J;  1AKH B;  4FCY A;  1ENH A;  3DCF A;  1POG A;  3ZQI A;  5HOD A;  4X6A J;  4NDL A;  4A3I J;  4M3G A;  5EZH A;  4M3E A;  5EGO B;  3JR9 A;  1GUU A;  5EZG A;  2W48 A;  5E3L A;  3BT9 A;  2WB1 N;  2HOA A;  1ETX A;  3ZQH A;  1JUM A;  3RKQ A;  1SAN A;  5F27 A;  5GP9 A;  3HOU J;  2COB A;  3CCY A;  4MIM A;  1D5Y A;  5F0H A;  5IP6 A;  1IJW C;  4MFD A;  1F36 A;  2R5Z B;  2JA8 J;  2VUM J;  1ETO A;  3B6C A;  4M3F A;  2LLK A;  2MSY A;  1Z77 A;  3GTJ J;  5BNG A;  4CYC A;  5EYR A;  2L7M P;  4FE4 A;  2XGC A;  2QF7 A;  2G0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...