2EZKA

Solution nmr structure of the ibeta subdomain of the mu end dna binding domain of phage mu transposase, regularized mean structure
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
93
structure length
93
Chain Sequence
MIARPTLEAHDYDREALWSKWDNASDSQRRLAEKWLPAVQAADEMLNQGISTKTAFATVAGHYQVSASTLRDKYYQVQKFAKPDWAAALVDGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSPOSASE
publication title Solution structure of the Mu end DNA-binding ibeta subdomain of phage Mu transposase: modular DNA recognition by two tethered domains.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 22
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 1997-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ezkA00
3Q3SA 4V2GA 4D5FA 3JR9A 1ETKA 1Y1WJ 1JKPC 3H3VK 3BQZA 3Q0WA 5JLWA 4W97A 4UUTA 2P81A 3FK7A 1B72B 1H88C 2WAQN 1IG7A 1IRZA 1WPKA 2ZB9A 3JRHA 2EZLA 3JRIA 1HF0A 1AKHB 5K7ZA 1MBJA 3HEFA 1MBGA 2XB5A 5EG0B 2JWTA 1JTYA 2K9QA 4CYCB 2AO9A 2CQXA 5F0HA 4XK4A 1WI3A 3S2DJ 2K9SA 2HQ5A 2DMTA 3K2AA 1OCTC 2Y0SN 3QPSA 4XIDA 3DEWA 3RKQA 2HDDA 1F43A 2DMQA 4DYRA 1A6IA 3BTJA 5E3OA 1YRNA 4NDLA 3ZQHA 1B8IA 2NVTJ 4A69C 2R5YA 1AHDP 4B3AA 2DMPA 5EF6A 2H8RA 3JRBA 3SDGA 3O8HA 2TRTA 4C2MJ 1GUUA 1QRYA 3OOUA 2XPVA 5DS9A 3TP3A 4IHWA 4JX4A 4V2FA 1FTTA 5J3LA 2VI6A 3MN2A 1CQTA 1NTCA 1H89C 3CCYA 1WH5A 2QF7A 4LOCA 5IOYA 5J1UA 3VPRA 2E2JJ 2HOAA 4DYCA 4HNVA 3BG9A 5EEAA 2XGDA 4JX6A 1RR7A 2YS9A 4FISA 2R92J 4I76A 3MKLA 5IOZA 1JKOC 5EZHA 3HOYJ 1Q1VA 5M5YJ 4A3BJ 1ETWA 2D5VA 1P7JA 3HOWJ 4A3DJ 1U9NA 2DMUA 2LK2A 3CDLA 4B4CA 2EBIA 4AC0A 1HDPA 4XRMA 4A3KJ 1T56A 4A3MJ 1UMQA 1SFOJ 2COBA 5HODA 3S15J 2FX0A 4M6VA 5DTDA 4AYBN 1BA5A 1ITYA 2DA6A 2XSDC 1YRNB 4FCYA 1B8IB 1RKWA 2R5YB 1JKRC 5FKLA 2O8KA 2CUFA 5J1YA 3BTCA 3S1RJ 1IDYA 2JN6A 1Y1VJ 3LSRA 1QVUA 2XGEA 1PUFA 2LFBA 3M3YJ 1MNMC 1FJLA 1GDTA 5C4XJ 4D7NA 4EEFG 1K83J 4C3HJ 3S17J 2CUEA 4Y52J 5C3EJ 1X2MA 1U9OA 1OFCX 2KDZA 1IV6A 3Q0VA 2Y9YA 1U78A 3I4NJ 2K40A 5F0FA 2LP0A 4DW6A 2E2IJ 5E3NA 1UG2A 1RETA 3GTPJ 1GVDA 1VFCA 1MBKA 1IGNA 2JA7J 5K7HA 1LFUP 2VUMJ 2E1OA 5FKNA 3ZQLA 2HOSA 4ABZA 2KT0A 3HOUJ 1POGA 2Y30A 1I50J 2LY9A 3OSFA 1HCRA 4MFEA 4C3IJ 1MSFC 4D7MA 3GTMJ 1E3OC 3HM5A 3BR1A 2HYJA 5IPAA 4W1UA 5J1RA 2XB0X 1P7IA 2O7OA 3ZQGA 2R93J 3RZDJ 1MH4A 1VI0A 2MW8A 3ZOBA 2LVSA 4DYQA 2LTPA 1T33A 1ZGWA 1QPIA 3JRCA 2JK3A 4A3GJ 3RZOJ 2NS7A 1PUFB 1JKQC 3BG5A 4B1RA 1BJZA 2CJJA 2FJ1A 2HXIA 5IYDJ 4L5EA 1TWGJ 3DCFA 2LKXA 2L7MP 1DU0A 1JJ6C 2E19A 1JGGA 1HOMA 2M8GX 4BXXJ 3LSJA 2XRLA 5C4JJ 3G1OA 3F0CA 5FKKA 4RBOA 2XPUA 3FKIJ 5EYRA 5F27A 4M3BA 2G0EA 4J19A 3I4MJ 3LNQA 2Y9ZA 5M5XJ 1FTZA 3BR6A 1F36A 3WHCA 5FLVA 1JUSA 2IAIA 1SANA 5EGOA 1QVTA 3JRDA 2MGQA 3WHBA 5GPAA 3S14J 1MBFA 4MO7A 3CMYA 3S1QJ 1ZR2A 1IC8A 1XS9A 3L1PA 1WH7A 2LD5A 3S2HJ 2CQQA 3IV5A 1MH3A 2NVYJ 4X1EA 3JRGA 2JA8J 3SFIA 2ELKA 3W6VA 3PO3J 3IH3A 5E3MA 1JT6A 3FK6A 4G12A 2ECCA 1D5YA 2R0QC 3GTGJ 2ECBA 3LSPA 2DA7A 3BR2A 4MLOA 1IJWC 5F08A 1UHSA 1ETYA 3D1NI 2JA6J 2OPTA 1NK3P 3K7AJ 1BL0A 2R7ZJ 1TWAJ 3C2BA 1JT0A 1MBHA 2QCOA 4JYKA 1OCPA 3E7LA 2NVQJ 1BW5A 5K7FA 1FIPA 1ETVA 1WCMJ 3HOZJ 4A3CJ 1ETOA 1ETQA 4BY7J 5GPCA 1ETXA 2H1KA 2DA1A 3GTLJ 4XICA 1X58A 3TW7A 1A5JA 1Z77A 2NVXJ 2K9NA 4DZPA 3IH2A 2R5ZA 4GFBA 2Y31A 3HOXJ 3BR5A 3HGGA 2FQ4A 2MG4A 4M3GA 2IBDA 3BG3A 2DN0A 2L7ZA 2YUSA 4X6AJ 2DA2A 2ME6A 3Q0UA 4BKXA 2JMWA 3GTKJ 2XGCA 2RAEA 2L0KA 5EGOB 1JUPA 3RQIA 1ZK8A 2YU9J 3M4OJ 4A3FJ 2DMNA 3BR3A 4RDUA 2HOTA 1LE8A 3QPLA 1XG1A 4IHVA 5FKMA 3HBLA 3S1NJ 3FISA 2TCTA 3JRFA 4A93J 2VKEA 3UKGA 5IYCJ 1IDZA 2CU7A 3OSGA 3PO2J 2Y2ZA 1I6HJ 3A03A 5EDNA 5M3FJ 3ZQCA 1RESA 5M5WJ 1TWCJ 1GV5A 2X9DA 1U8BA 4Y7NJ 2M9HA 4IHXA 2DA5A 2NOGA 4MFDA 4UUSA 1ZR4A 1OJLA 4MIMA 1Z0XA 2W48A 1W0UA 5M3MJ 2WB1N 2AHQA 3MVPA 4BBSJ 1JUMA 1TWFJ 1W0TA 5IYBJ 3O8GA 2DTZA 4AUXA 1GV2A 1WGXA 3TW6A 2MSYA 2OF7A 1RPWA 1GT0C 1TC3C 2X48A 5IP9J 3BR0A 5GP9A 5IP6A 2R5ZB 3ZQFA 5F1JA 1JJ8C 5E3LA 1NK2P 5F04A 2PMZN 1FIAA 3B6AA 1APLC 3LOCA 1HDDC 3BQYA 3A02A 2IEKA 1K61A 1EF4A 4DZJA 1LE8B 1AU7A 2LLKA 2WV1A 3TEDA 4BBRJ 4A3JJ 3GTJJ 2ME0A 1ZTRA 3HDDA 1DU6A 4XRSG 4FTHA 1VF9A 1ZKGA 3TP0A 1HLVA 2XPWA 3HB9A 2E2HJ 2FD5A 3A01A 1S7EA 3SJMA 3LSGA 3GTOJ 3BT9A 1ZQ3P 2GM4A 2NS8A 1ENHA 1TWHJ 2HI3A 1VNDA 2JA5J 3IH4A 1MBEA 4FE4A 1O4XA 1LFBA 2M0CA 4M3DA 3H0GJ 2EH3A 4UUSB 1X2NA 4XRSA 2DA4A 3BTIA 3HGYA 2DJNA 3OIOA 3ZQIA 2VKVA 1R9TJ 1B72A 5EZGA 4A3IJ 5FKOA 5IP7J 1AKHA 3HOVJ 4IEJA 3NAUA 5EG0A 2O9LA 2B63J 2N8GA 5FLMJ 1JTXA 4CYCA 2CRGA 3BTLA 2ID3A 2M2EA 2EZKA 2JJ7A 4FE7A 2GLOA 2EZIA 4QIWN 2LR8A 4QSHA 1H8AC 3QQAA 2EQRA 4S0HB 2GBYA 2DA3A 2I10A 3GBGA 3S1MJ 3JRAA 3G1LA 4JP0A 4M3EA 2M34A 4D5CA 3G1MA 3B6CA 3HKZN 1FEXA 1IUFA 1G2HA 4M3FA 5C44J 4A3EJ 3S16J 5JLXA 2L7FP 9ANTA 3CQZJ 2HXOA 3GTQJ 4C3JJ 3A01B 3FIWA 4IHYA 5BNGA 1BW6A 2VPRA 1I3QJ 5FJ8J 4A3LJ 2L9RA 1MSEC 2X6OA 1RKTA 1ORKA 1XC5A 4JX5A 4QTRA 3NARA 3JREA 5F0CA 4BY1J 2EZHA 3PM1A 2ID6A 4I6ZA
chains in the Genus database with same CATH superfamily
3PIPF 2CG4A 2IGMA 2ELHA 1A31A 1JKPC 1SD7A 2JA2A 4W97A 4UUTA 2P81A 2QSFX 2IA1A 3KP6A 2W82A 4LG0B 1IRZA 4XKBA 1VZ0A 1WPKA 2XF7A 1J09A 2UXNA 1T95A 3JRHA 4E7LA 3JRIA 1HF0A 2QYOA 1MBJA 2KIMA 2HDWA 3F8CA 2IA2A 1JTYA 4CYCB 2CQXA 5F0HA 2IRFG 4A2UA 5E1ZB 1G8XA 2DMTA 3OYLA 3BP8A 4G94A 4NHJA 3QPSA 1Z91A 3F8BA 2ZNZA 4AIHA 2A6EF 3RKQA 1FYMA 1F43A 3RPQA 2WV0A 3DKYA 1T08B 4DYRA 5E8IA 1A6IA 4XKCA 2ZMEA 2M0MA 5E3OA 1B8IA 1J59A 3DPUA 1GLNA 4B3AA 2IJLA 3A4CA 1VTNC 3I71A 2H8RA 5TJJA 3WTUC 2TRTA 1OR7A 1P2FA 4CYDA 1LUJB 4XL9A 3P5JA 1HSJA 2K86A 4BL0B 4RB3C 2XPVA 3TP3A 3AAFA 2DPUA 3GFMA 2PJRA 3SEZA 3GW2A 4QPOA 2D1VA 3VSKA 5LHIA 2FOKA 2E34A 4GRIA 1CQTA 1WZ2A 3N97A 2VL8A 1P92A 2A5YB 3WG9A 2VJ4A 1CF7B 3LL7A 4LOCA 5CVJA 3CCQI 5IOYA 4MNUA 3IL2A 1TW3A 1UFMA 3C18A 3BG9A 4HBLA 4E7IA 3VOEA 1TT5B 3C1DA 4XKWA 1Y0UA 4XQFA 2ZCWA 2FMYA 1XB4A 4FT8A 4GCVA 5EZHA 3RTRA 2M8EA 4J00A 3IC7A 2PFBA 2W84A 2IS2A 2A05A 2IXSA 5DCMA 3HOWJ 1P7JA 4LIVA 4IHTA 2CW7A 2LRDA 3CF5F 3QRFF 1HSTA 3ULQB 4B4CA 2NRAC 3AG2H 2YPRA 4I09A 2HWVA 4AC0A 2VT2A 4BE1A 1GHCA 4FHTA 1USSA 1T56A 4HOBA 1NH3A 4LGWA 1N77A 1NG7A 2CFXA 1MNDA 4H0EA 5DD4A 4I01A 5HODA 2RV8A 3S15J 4M6VA 3LFUA 5DTDA 1X3WB 2OAZA 2ZMEB 3VWBA 3G2BA 1B8IB 4BQNA 3HRUA 3LA2A 5KAFC 2IS4A 2O8KA 3BTCA 3ASOH 4BAYA 3CCSI 2LBFA 3LSRA 2DQRA 1AOYA 1QGPA 1PUFA 1BJAA 1EJ9A 3K1MA 3CLQA 3OYJA 1GDTA 3CJRB 3REOA 5LFAA 2GOXB 4WX9A 2BEOA 4Y52J 4IZZA 2PJRB 1ACIA 1YW9A 2CQNA 2Y48A 2KDZA 3CMEI 2P5VA 1X19A 3GYHX 1K4TA 1SD4A 1EH7A 3EUKL 4XONA 4RAZA 1U78A 3I4NJ 2K40A 2CWEA 2EV6A 3BJ6A 5F0FA 4OMYA 2V1UA 4D1QA 3HHGA 2FSWA 4CCJA 1FMWA 1IGNA 1Q1HA 2QZ8A 1MJBA 3W6KB 4BE0A 4BACA 2JSCA 2EIKH 4ABZA 3R0JA 1KYZA 3RKWA 4RB0A 3OSFA 4MFEA 5DCMB 3GEZA 4D7MA 1T39A 2WWYA 2HDCA 4G7ZF 3D5SC 5J1RA 4KNYA 4MTEA 3ZQGA 1W36C 3ERED 2VE9A 4JOMA 3MKZA 4DOZA 3ML6A 2L4MA 4F91B 1Y6IA 1YG2A 3VYSB 1T33A 4CCLA 2MC3A 3JRCA 4B48A 1FOYA 2DI3A 1K78A 2LBFB 2NS7A 1WJ5A 5LEKA 1PUFB 1W7PD 2P5LC 1LEBA 4B1RA 5K5RA 2KRCA 2HNHA 2FJ1A 2FMLA 5HS7A 1QQIA 1YHQI 3NWSA 2V4JC 3ZRGA 1V4RA 2NAZA 3KETA 4PJLA 4N9IA 3ZP5A 3AG4H 3CCVI 4F3QA 5JHUA 4KIFA 3W2WA 3BC8A 2X6XA 4ZYEA 5ILVA 1W7PA 5FKKA 4M3BA 3LAPA 3HC7A 5HOOA 4HNTA 4XLFA 3GXOA 3K2ZA 4L9JA 3U1KA 2ICWG 1N75A 3BZ6A 1JUSA 4GXOA 3X2QH 5FGMA 2O0YA 4I99C 3JRDA 1DDNA 1WSUA 4MO7A 1I3AA 3CLOA 1H9GA 1SFEA 2IT0A 3W2AA 3HHHA 1JI8A 1IRFA 1QU3A 1BR1A 4CCNA 4Y15A 3S2HJ 1MH3A 3FXJA 1FYKA 3CUOA 4X1EA 3W6JB 3JRGA 3SFIA 1K78B 2KIQA 3FDYA 4G6DA 3PO3J 5E3MA 4XLCA 2XV4S 4G12A 2ECCA 5F64A 4KIGA 2KQRA 3LSKA 4HQEA 3L2WA 4YFNF 3C2HA 2F5VA 4E7ZA 2QSGX 2JA6J 5CJ9A 1BL0A 4CHUA 1TWAJ 2Q1ZB 1YQAA 2VJJA 4XNFA 1JT0A 1MBHA 3J7AO 2EV5A 3E7LA 1UZCA 1W7PB 5KK1A 2K4BA 1FBUA 1FIPA 4ENKA 4XOPA 2GAUA 3OMYA 3GX4X 1ETXA 3GTLJ 2VLAA 1Z77A 3WTXC 2K9NA 4YG2F 3IH2A 2RN7A 2Y31A 3HOXJ 2DN0A 2O61A 4IPAA 3S2WA 1B9MA 3LA3A 2ME6A 4CSWA 1RI7A 1YITI 4KJZA 2XGCA 2RAEA 2ZKZA 1YJ9I 4OIQF 1ZK8A 2YU9J 1YJNI 1IXCA 1QZEA 1YLFA 4FASD 4RDUA 3K4MA 4L5JA 2OUMA 1XG1A 5D6EA 3HZJA 1Z1DA 2H09A 4XMYA 2R7DA 5A2QK 2FUG2 5J40A 1LFPA 2GZWA 2VXZA 3RYRA 2YSRA 2E5ZA 3HUGA 4LG3A 2CU7A 3QU6A 2RC4A 2Y2ZA 5CQGA 1FMVA 1SAUA 4EJVA 2X0LA 1JGSA 4IO9F 5M3FJ 3EUHC 3WTSC 1IN4A 3K0LA 1GVJA 1T98A 4IHXA 3HXLA 1IRXA 4MFDA 1FBQA 4AU7A 4UUSA 1J2XA 2M87A 2W48A 2WB1N 3MVPA 3GWZA 1TQIA 1TTYA 5IYBJ 3ZQQA 1GV2A 3TW6A 3V7SA 1S9HA 1RPWA 2QVOA 2X48A 3OL4A 1WJFA 1OCCH 4RAFA 3TOBA 3ZQFA 5JVTA 5E3LA 3GLLA 5EEHA 2PMZN 1BI2A 3TO7A 3K1PA 4U7DA 2F4MB 2DFFA 4RGSA 3GZ6A 4RS8A 4ZTJA 2MLKA 2K02A 3HRMA 1R58A 2BHZA 1BOBA 2IEKA 3FM3A 1VQ5I 1X1AA 2H94A 1K61A 4P9FA 3C7JA 1K4SA 4PFPA 1XGNA 2V79A 3BJAA 1KU7A 2KDOA 4A3JJ 3ZMTA 1BI0A 4MEYF 5HDKA 2PLYA 3GTJJ 3DQVC 1ZTRA 4G6QA 2KKOA 2W4SA 3U21A 2LYCA 1HLVA 1PYVA 4U0YA 3HUGB 5ILUA 1WHUA 1S7EA 3CD6I 1YW8A 4HPQA 1ZQ3P 4GDFA 2PMHA 3DBRB 3J80K 1TWHJ 2MD5A 4K2EA 2LKPA 1VNDA 3ABLH 4P9UA 2XSJC 2IW5A 2AS5F 3IRRA 3T5XA 5ICEA 4UUSB 2EH3A 3K70C 1K6OA 4I2OA 5E1WA 4NQWA 2DYRH 4GO1A 1HKSA 3TDZC 2E71A 5FD5A 1FNNA 3BLYA 3ZQIA 1OYYA 2VKVA 3KYDB 2O03A 5FB2A 4OU0A 1B72A 3HYIA 2R7VA 3TGNA 4BYYA 4Y33A 2BXZA 5B1BH 5EEGA 4OIOF 1R4NB 3FHNA 5IP7J 1ZLKA 2EV0A 5TRDA 4KYWA 3OWTA 3CESA 5K5QA 5EG0A 4Z2YA 4BDYA 5FLMJ 2CRGA 4JBAA 5A2QZ 3KLOA 1FLIA 3DLLF 2E35A 1OQYA 3V8JA 2M5WA 1H8AC 4KT5C 2F4IA 1TZLA 4BJ6C 1OLTA 1YS6A 3S1MJ 1FSEA 2D1HA 1BM9A 2CO5A 4C9YA 4NC6A 2Z99A 1FEXA 5C44J 2WBMA 1J5YA 4ZTFA 2L54A 2L7FP 9ANTA 3DKXA 2HVRA 1UG0A 3GTQJ 1XCVA 1MDMA 4IHYA 4CCOA 3CJQB 5KVRA 1P4AA 2EINH 3H9GA 4OINF 3ZXSA 2L9RA 4A3LJ 3Q5FA 4BHCA 4JX5A 2KIFA 4QTRA 4IOCF 4MQ9F 5F0CA 5FFXA 4DQ2A 1F4KA 5L3GA 2A69F 1SMTA 2VODA 2YX7A 1R1UA 3Q3SA 4V2GA 4NQWB 1ETKA 5B5EC 5JLWA 1PVEA 2TDXA 1D8JA 3TMOA 1LVKA 2HQNA 3RYPA 1B72B 1P4WA 2FBIA 4ZYGA 2XC7A 3HJEA 2WB1A 2Z9OA 1Y8QB 3ZQ7A 1U5TA 1KQ0A 2XB5A 5EG0B 1PJRA 3OS0A 1ERDA 3L2CA 4MGRA 4XK4A 4HW0A 2FBKA 5H6QA 1WI3A 1YI2I 1XX5A 1IN8A 3F21A 2HQ5A 2VBWA 2WADA 2CUJA 2Y0SN 4E70A 4Q48A 1LJ9A 4M73A 4UB6C 4E7JA 2LG4A 2PMZA 4HAMA 3BTJA 3COAC 1TNTA 2MA3A 2ZFWA 2K5CA 1YFHA 1YRNA 4TV7A 1JXSA 2X6WA 1STZA 3DLAA 3SQNA 2DMPA 3E6CC 2EB7A 2VN2A 3JRBA 3SDGA 3VSLA 2KL4A 2ZXJA 1UB9A 1WJAA 4C2MJ 4CXFA 2DFIA 1MDMB 2HEOA 1S8NA 2J5PA 5DS9A 4D9JA 3BG7A 2DBBA 2NOJB 1MJAA 3HIFA 1IZ1A 2VI6A 3MN2A 3HTSB 5HLIA 3WTVC 3I9V2 3KZYA 1XMXA 4ON0A 3KEOA 1XD7A 1H89C 2EA4A 1WH5A 2EILH 3WU1B 2KPMA 2DODA 2HOAA 4IHSA 2BW3A 2XGDA 2MD0A 2R92J 4I76A 4YFKF 3ABUA 3CC7I 1TW2A 1YS7A 5IOZA 4IOAF 1Q1VA 2OCCH 3WTZA 3FMRA 1RUNA 2VOPA 1U5TB 4R79A 1W5TA 2UV1A 3F8FA 4A3BJ 3FXOA 1YIJI 3L7WA 3H9JA 4A3DJ 1U9NA 3CDLA 2RQPA 4P96A 2XASA 2EBIA 3QPHA 4E4HA 3FWEA 2BV6A 4A3KJ 5GTHC 4ZDPA 3K4LA 4A3MJ 1HC8A 3JW4A 5BOXA 1SFOJ 4HLYA 1K79A 2BE5F 3H5AA 3V42A 2FX0A 2DA6A 4YRVA 3ISPA 2XSDC 1YRNB 4U7BA 3OYDA 1YW7A 2PBIA 3H0DA 2DO7A 3S3NA 1JKRC 1MMSA 1Y0NA 4GYIA 1IDYA 3QOEA 4DBQA 1J75A 1DUXC 4OOIA 1Y1VJ 1GXPA 3E5XA 4N0BA 2KLOA 1D8KA 4XOTA 4D7NA 4E7KA 3R61A 1MZBA 1X4OA 4A0XA 5B1AH 5L3DA 4EJOA 5HNFA 5C3EJ 2G9WA 5J47A 1X2MA 2X1CA 4N4NB 3V8KA 3KCCA 2DLLA 3F6OA 4RB2C 1G3SA 3MQ0A 1MJ9A 1IRGA 5KCMA 2LP0A 4FX4A 1UG2A 1X1BA 2BW3B 4M6YA 1VFCA 2LMDA 3TDUC 4S04A 4IXAA 3KEYA 2W24A 4IVNA 5FKNA 2HOSA 1CF7A 1G3YA 3I5UA 2Y30A 1I50J 4EQQA 1HCRA 1MSFC 2L3DA 1R5ID 1E3OC 1XMKA 3PIOF 3JCUC 4A0YA 1Z05A 5GAEJ 1ZRDA 3BR1A 2HYJA 4BGDA 3RKXA 2M4GA 1SMYF 4W1UA 4PJMA 3N4MA 1Y56A 3ZMZA 5HVQC 1P7IA 1IF1A 2A6TA 2ZBKA 1BR2A 1VI0A 5K1YA 2MW8A 1OYWA 2LTPA 2OBPA 4AIJA 3FXMA 5H20A 2Y0SA 1ZGWA 1EKEA 1DPUA 2X85A 1OCZH 2RREA 3K69A 2HQRA 3SZTA 2ISZA 4E6KG 3BG5A 4NNJA 4BUPA 1BJZA 3KP7A 1R23A 2HXIA 3M9AA 4I98B 2K9MA 5FFZA 1E0EA 3DCFA 2HVQA 4AIKA 5E79C 5D4RA 2HZTA 1JJ6C 2E19A 3FXRA 3CTAA 2M8GX 1HOMA 4B43A 2P7CB 1MMNA 1XSVA 3K1NA 3ZCOA 4BXXJ 3IKTA 1QA6A 4HV6A 5J4YA 2R7UA 1R1VA 3FXUA 2XDVA 2CV2A 4RBOA 2CSOA 3ABTA 2XPUA 3BCAA 3EYYA 4EM2A 5EYRA 3J7ZI 5D8KB 4PSXA 2OD5A 2G0EA 4J19A 3GO5A 3TBIA 3E5UA 3H1CA 2Y9ZA 2PX9A 5M5XJ 1ON2A 4M74A 5FLVA 2RNJA 1Z21A 2ISYA 5DV5A 1O3RA 1R7JA 1I39A 3QAHA 2G7HA 1F5TA 3SFZA 5EGOA 2STTA 3TO6A 3BG6A 1RNLA 1WRJA 3BCBA 4PSWA 2CUZA 3J81K 2VT3A 4HNUA 3CMYA 3L2VA 3RIRA 4Q4ZF 5LEJA 5DM6F 1ZR2A 1R1TA 2DDBA 1IC8A 1WH7A 1S7AA 2CQQA 2QENA 2NVYJ 1PUEE 4HZFA 3QODA 1TQMA 3IH3A 5D6FA 2KP6A 3I54A 1FP2A 1ZREA 2M3AA 4HF0A 2R0QC 1RC9A 4LIUA 4BHBA 5DUIA 2QSHX 4KMFA 3GTGJ 3LSPA 2L9NA 4ZH4F 2DA7A 1QO0D 3D1NI 2OPTA 2R7ZJ 4BNCA 3C2BA 3E97A 2P6SA 2DDAA 1V5FA 3KP5A 1RIOH 4JYKA 1OCPA 2ZO4A 2OZ6A 2NVQJ 3CUQA 1TBXA 5L3FA 1PP8F 1XPXA 2OZUA 3HOZJ 1ETOA 1ETQA 1D1CA 2IP2A 3H35A 2DA1A 3R0AA 1PDNC 3DXJF 1X58A 2RVCA 2ZFUA 3VB2A 2H6CA 2F5EA 2HYGD 3BR5A 4G7HF 4ENJA 2DK8A 4F52A 4X6AJ 2DA2A 3Q0UA 4FETA 4BKXA 2IS1A 5DD8A 1BC8C 3GTKJ 1GXQA 2QQAA 5EGOB 4OIRF 3M4OJ 3KP4A 1FX7A 3HSFA 1WQ2A 5HDGA 2DMNA 3BR3A 5B3SH 2HPMA 5HLHA 4HG2A 5KHDA 1A04A 4ESBA 4EMSA 1ZARA 3O6BB 2ZMEC 4F55A 2CS3A 2P7VB 3JRFA 1D3YA 4A93J 1VQ8I 2VKEA 1EV7A 2DAOA 3K4NA 3K4CA 5IYCJ 3M8EA 2HKXA 2XUBA 3WU2C 1OR7C 1KGSA 4M6XA 1W5CC 5E8GA 5ICGA 1HKQA 4RGRA 2QQBA 1LDDA 1YYVA 3PUBA 2PEXA 1DP3A 3GF2A 2DA5A 4C2TA 4N4OB 1OJLA 3RSNA 3U2RA 1Z0XA 4BBSJ 3I4PA 3L9FA 1JUMA 1TWFJ 2L01A 3CUQB 4ESFA 1BOAA 1TNSA 2IGNA 4R8HA 1ODDA 2F6CA 5IP9J 2E1CA 2EFQA 3J81Z 4AIDA 1VQ9I 4QWQA 3CC4I 3L2QA 3B02A 3CCUI 1V5EA 1FIAA 3B6AA 3LOCA 5AONA 1HDDC 2GXBA 3HSEA 3TOAA 1CGPA 3A02A 3IKVA 3LFKA 3SXYA 4BJTA 3IAM2 1O7FA 2JPCA 2L2OA 3M1CA 1X4PA 4DZJA 4XKVA 4HEA2 1VQNI 1FPQA 2FEZA 4UVBA 1E17A 3K9TA 4B44A 3QYFA 3SDBA 1X1CA 1R36A 2EPFA 1DU6A 4XRSG 4WWCA 1G4DA 4CGZA 2F4OB 5GADJ 2ZXHA 4UY8I 4DJAA 4NB5A 5DYMA 3LSGA 3GTOJ 3ABMH 3WGIA 2GM4A 3SHFA 3ZN1A 3J7AY 4LLGF 1O57A 2R7OA 4OMZA 2HI3A 4I02A 3KP3A 4FE4A 3ZGKA 3RJPA 2CMPA 1Z7UA 3P9CA 3HGYA 2DJNA 3V7RA 4OWRB 2LNBA 4C30A 4ZDOA 4CCKA 2QBYA 2XRNA 4HYEA 2QKLB 2RQQA 4I0BA 3WTTC 4HX7A 2VKDA 2E36A 3DP7A 4BH9A 1OCRH 2V26A 3OYCA 2RGVA 3QYEA 1J7KA 2FQ3A 2D2WA 2N8GA 1JTXA 3F3XA 4PDKA 3BTLA 2M2EA 2AXTC 2V9KA 2EZKA 3BJOA 3DU6A 4CZCA 2EZIA 4B8XA 2F5FA 3DU5A 1BN5A 1Z6TA 2LR8A 4QSHA 3CO7C 2V1XA 3DKWA 4HQMA 2M7BA 2HKOA 3GBGA 1WJCA 3SYTA 4HA8A 1OPCA 4Y3OA 1R4MB 3P9IA 1YO5C 2M34A 4D5CA 4ENMA 3C3WA 1B6AA 3G1MA 3I3LA 1T2KA 3KEQA 3HKZN 3MZ8A 5CPRB 1IUFA 5B66C 1G2HA 4PFOA 5D5WB 2DFHA 4WK8F 3KYLA 3M7GA 3T8RA 2B0LA 2EIMH 1X3UA 3DEEA 4HDUA 2F5CA 5FJ8J 1HW5A 5EJCA 3KPHA 1MSEC 2X6OA 1B59A 3A1YA 4LLNA 2FNAA 2DOFA 2HYFA 3JREA 1E2XA 2E60A 4LK1F 4BXUA 1R49A 3KLNA 2FNPA 2VE8A 3G6EI 3FMSA 3JAMK 3JR9A 5HS9A 1Y1WJ 3AG1H 3H3VK 3BQZA 2QM3A 3Q0WA 3RKYA 4XLPF 3MWMA 5DEQA 2UZKA 4XN0A 2BY3A 1H0MA 2QBYB 1H88C 2ACJA 1SFXA 4Y13A 2WAQN 3HPGA 1A36A 4A5NA 2ZB9A 4P5OA 1SAXA 2EZLA 1MMGA 5K7ZA 2O6GE 1YOVB 1MBGA 2OCEA 2R4GA 2AO9A 1W1WE 3P7NA 3S2DJ 1OCTC 4WCGA 4XIDA 3DEWA 2XF6A 4WF2A 5BQTA 1K7AA 1NHAA 2BY0A 2DMQA 2L9SA 2J5OA 3CJTB 1FSHA 1W4MA 5CKTA 5LHGA 2KISA 3DV8A 4UUVA 4M9ZA 4NDLA 1LKXA 2NVTJ 3T1BA 4A69C 3JTHA 3DPTA 2QKMB 3BOQA 3OL3A 4NUBA 3MFKA 5EF6A 2P6TA 4XRFA 2A68F 3OYFA 1QNTA 3LQQA 4CICA 1GUUA 2X6YA 4MHGA 1QRYA 1ZYRF 3OS2A 1B4AA 1LEAA 1UHMA 4IHWA 4JX4A 3E6DA 5BS6A 1IUYA 5J3LA 5AIPA 5K5OA 1NTCA 3MKYB 2W25A 2V6EA 2F2EA 4L9TA 3CCYA 1QHGA 4CCMA 3ONQA 3ZR8X 1MD0A 4B3XA 4YEJA 5J1UA 2HGCA 2BBYA 4XN3A 2GA2A 4BHPA 1RUOA 3WG7H 5IT3A 4V19K 2YS9A 4FISA 4DIQA 1ZRFA 2DU9A 3K6GA 3MKLA 3GFJA 5ICCA 4IQJA 1S72I 2E1NA 1D0ZA 2ETHA 2P8TA 2EJRA 5F1RA 3PL8A 1I5ZA 3DWLE 2EA2A 2IA0A 5E1XA 3U1DA 4EV0A 5J4VA 2LK2A 2DMUA 3F8NA 2DK5A 2XAQA 2O8XA 1JHFA 5H2FC 1WI9A 1XSDA 2JVHA 2W7NA 2STWA 2P4WA 2COBA 3MCZA 2GA1A 1ITYA 4AYBN 3M1EA 2H27A 3BZKA 3H3ZA 5E20A 1KZHA 4FCYA 4M72A 1RKWA 1P9QC 5FKLA 2CUFA 2R7QA 4U87A 3S1RJ 1ZG5A 2E5NA 1ZN2A 2JN6A 1JHHA 3MZYA 4B09A 3LMMA 1KU3A 2RKHA 2LFBA 3CP2A 2JT1A 2VASA 3FBIB 1M1EB 1MNMC 5C4XJ 3I64A 4IKFA 3HKZA 4C3HJ 4IRGA 2CH0A 3CCJI 4WXHA 4ITVA 1U9OA 1OFCX 4P55A 2WC2A 5FRNA 2CYYA 1IV6A 3Q0VA 1D0YA 1RR8C 5E18F 1YTYA 3PNVA 5IT9K 3BZCA 3SEQA 1QZYA 2GXAA 1S7OA 2XAJA 3QP5A 3MAJA 1RETA 3GTPJ 1MBKA 1USTA 3AL0B 3RQ4A 5FROA 3O2PE 2LC2A 4EM1A 2V9VA 1B9NA 2QQ9A 5K7HA 4ZYDA 2JA7J 2ZJQF 3K4JA 2K27A 1HW1A 1T6SA 3S32A 1LFUP 3ZQLA 2HR3A 3I58A 2KJCA 2KT0A 3LQRA 4RM2A 4BQQA 1RZ4A 2ZSHB 2I5UA 5CVIA 3OYMA 1VQMI 4C3IJ 4EGZA 4LD5A 1MMDA 2BVLA 2VKHA 3CDIA 3RI4A 1T8IA 4MTDA 2WAQA 2PMUA 1Z9CA 5CLSA 5CVUA 2K7LA 4M9SA 3DPLC 4PJ0C 4FQGA 1WFXA 1IW7F 2O7OA 4F7ZA 3GZ5A 3ELKA 4U88A 2DFEA 5FD6A 2JPBA 4DYQA 4MEXF 3I59A 3AG3H 4RA2A 2PN6A 2VBXA 2AQEA 3I0TA 1T0FA 2IPQX 3IAS2 3BDDA 1QPIA 2CW0F 1IV8A 1XGOA 2CW8A 2JK3A 4LK0F 4A3GJ 1YX5A 4UB8C 1JKQC 3LA7A 1VQ7I 2M30A 2CJJA 3TQNA 3J80Z 3OR1C 1S5LC 5LHHA 5HLTA 4X0GA 5FO5A 3GLXA 1TWGJ 4A12A 5FLXK 2JRMA 3EYIA 2LKXA 2L7MP 1DU0A 2BY2A 2E1MB 3CJNA 3LSJA 4FX0A 5HNHA 5C4JJ 1G6NA 2Z33A 1REPC 3F0CA 2CFOA 4KICA 4CUGA 2BYVE 5DCFA 3WGHA 3D5LA 5F27A 3DF8A 3WE2A 3AKZA 2E7XA 3KZIC 3I4MJ 2ADUA 4IJAA 2BZTA 2NS0A 1FTZA 2EFPA 3BR6A 3WHCA 2CGPA 2HS5A 2IAIA 1QHHD 1ZG3A 3PSFA 3CCEI 3EPZA 2PJPA 4KA4A 1BR4A 2M7AA 5HDNA 1AA7A 1F9NA 2MFZA 1QVTA 2YR2A 3Q9VA 3WHBA 3HRTA 3S14J 1DPRA 3RCOA 4AVPA 2XKOA 3JSOA 3A0BC 3I59B 4A0ZA 4KDPA 2VPLA 2MC4A 4YIFA 1BC7C 4YIIA 5D8LB 3L1PA 1XS9A 3E6MA 3FXKA 3IV5A 3B73A 2A6HF 2EK5A 1XTAA 4A6DA 2JA8J 1XDSA 5LGTA 3GFLA 3BPXA 1HKTA 2DT5A 4AYBA 2BXYA 2PG4A 5CYVA 1D5YA 3RDIA 2ECBA 4ZYHA 4UHTA 4XLEA 4BS9A 4I0AA 1WVRA 1IJWC 5L3CA 1N78A 2L9VA 1UHSA 1ETYA 2FRHA 5F08A 2ESHA 1R00A 1NK3P 3K7AJ 4IF4A 1YJWI 1RRJA 6PAXA 2V9PA 4U0WA 2QCOA 4YFXF 1TLHB 5BMZA 1ZGJA 5CVVA 4XLNF 1ETVA 1WCMJ 3DEUA 4L0ZB 4ENNA 1L0OC 5GPCA 4A6EA 3TW7A 3DBLB 1VQLI 1D0XA 2DQLA 3H5RA 4DZPA 2B9SA 4GFBA 3JSPA 4XLAA 3DTKA 3TO9A 2WAFA 3NEUA 3PQKA 2MG4A 1KU9A 1U5TC 2IBDA 4M3GA 3CCRI 4PJJA 1WJDA 2YUSA 4Z6YA 2X1DA 3K4KA 4AWXB 5LD2C 2UUZA 1UAAA 3IP4B 1TL8A 2E7WA 4BQAA 5JFRA 3KYCB 1ZH5A 4HSRA 1LE8A 3QPLA 1O7LA 4YIRX 3L00A 4IHVA 1IXSB 5FKMA 3HBLA 3J7YJ 3FISA 2VQHA 2B7EA 2UXXA 1KA8A 1XSXA 3MZHA 2JQ7A 4RMNA 1I27A 2DPDA 2CV1A 4OAZA 3UKGA 4HX4A 3N05A 5L3BA 4EJUA 3OSGA 1HQCA 1I6HJ 2DW4A 3A03A 3L2RA 2OTJI 2BVMA 2L02A 3IWFA 3G3ZA 4JQFA 1TWCJ 3S3MA 2X9DA 1U8BA 2M9HA 2NOGA 1MNEA 1ZR4A 3FF5A 5TISC 4BU2A 2JTVA 4PK4A 2DT7B 2AHQA 4LFUA 2KMUA 5M3MJ 2K3PA 3WODF 4UVCA 3S8PA 4HDVA 4IQ4A 3CZ6A 3FXLA 4L5IA 1IO2A 3O8GA 1W0TA 3FX3A 1W36D 1V5GA 2DTZA 1Z7LA 4AUXA 1WGXA 2OQRA 1WJBA 2ZJPF 2W85A 1KQ9A 4PGHA 1XDUA 1GT0C 5GP9A 5IP6A 2EFWA 2ZC2A 1Z3XA 2K4JA 5F04A 3PFYA 1U2WA 1APLC 4H4KC 4UXNA 4KN4X 3F22A 3BQYA 2UWMA 3IHUA 5GAHJ 1HA8A 1Y39A 4KISA 1LPQA 4MQVA 5J8CA 2VBZA 2IGOA 2Q2EA 3VYUB 1LE8B 1AU7A 3ZMSA 2MABA 2LLKA 2GOMA 3MD2A 3TEDA 4II3A 5CVRA 3P9KA 3A2KA 1ZKGA 2WA0A 4LJZF 3G71I 3HB9A 2E2HJ 5LRRA 3S3OA 2LKSA 4R1HA 2FD5A 3A01A 1ONVA 2ZJ2A 4ZZDA 5JR3A 1I6XA 4IRIA 2Z5UA 3HPHA 1MGTA 3BT9A 1U3EM 2NS8A 4XSZF 1OISA 1SFKA 1O4XA 3GUDA 3UNGC 2GIZA 4M3DA 3NRVA 1DGRM 3FM5A 1ZELA 2R3SA 3RPUD 1X2NA 4XRSA 2DA4A 3OIOA 1R9TJ 1KONA 3VYRB 2LH9A 3VODA 5FKOA 2JUCA 1G3TA 5HLGA 1G3WA 3LWFA 3QYBA 4C2UA 1AKHA 2W1OA 3OOPA 3NWTA 4OIPF 4IEJA 3K4BA 3NAUA 4PCQA 4S05A 5JHFA 4RLFA 3L2UA 4ASNA 3RPUA 5D4SA 2O5RA 4ZC3A 3ECOA 5LGUA 2ZNYA 1YX3A 4RLQA 3LAJA 4QIWN 4E7HA 3TKYA 2DXIA 3QQAA 1LB2A 4S0HB 4KITB 2HU9A 1R5HA 2MH9A 2WTEA 4O5VA 2FXAA 2FBHA 5HS8A 1F1ZA 2Q2EB 3VFZA 2YU3A 4BEHA 3B6CA 2EFOA 2DT6A 4EJTA 2NNNA 3ZMDA 3S16J 5ICFA 2KHMA 3A01B 2VJIA 4GGGA 2NVUB 5D5UB 1A6QA 2QEXI 1S29A 3ZN0A 2OTLI 1BW6A 2MYSA 3I53A 2EIJH 1ORKA 1XC5A 3ABKH 3NARA 3F23A 3D5RC 4B47A 2Q0OA 1O3QA 4BY1J 2EZHA 3M8FA 2QQ8A 1ZGAA 2ID6A 3HG9A 1U6GA 4I6ZA 1IAWA 2Y75A 4HV5A 3CCLI 3E0JB 4D5FA 1HXDA 4L0YB 2VB6A 3PNTA 4ESJA 4NC7A 3IUOA 5BPIA 3FK7A 4ZYAA 2IS6A 1I1GA 1IG7A 2KZGA 3ECHA 3ASNH 3EDPA 3F6VA 2GXGA 1AKHB 4ZZLA 4ZJZA 3HEFA 1A35A 1G59A 2JWTA 2FE3A 1IN6A 1R22A 2K9QA 1V55H 2G7UA 2H8WA 3ESWB 2LOOA 4I7HA 4L9VA 4UNOA 3PFIA 2A5WA 2HZDA 2Y0MA 2K9SA 1V54H 1X1DA 3K2AA 5GTIC 3FBNB 2XROA 4Y17A 2HDDA 2O3FA 1SC7A 4HLXA 3KFWX 5J6XA 4BEHB 4KN7X 3ZQHA 5D5XB 2HQAA 1AHDP 2R5YA 5CQEA 1X1PA 3HL2A 1FC3A 2H6BA 1XMAA 5H6RA 3OIQA 4LB5A 1EH6A 2KFDA 3VYTB 1TT0A 2DJIA 3O8HA 1DP7P 1ZHFA 3FHZA 1VQ6I 1ON1A 2F48A 2FF4A 3OOUA 3EUHA 2V6CA 1D1BA 4V2FA 1JE8A 2KJBA 2RDPA 1FTTA 2Z16A 3JTGA 1KQ8A 4WXDA 4BQOA 3GZNB 4RGXA 3A0HC 2QF7A 4BJ5C 5DDGA 3VPRA 2E2JJ 4DYCA 4HNVA 4NBQA 3PSIA 1C0WA 5D5VB 3CUQC 3W3CA 4QLCU 5EEAA 4JX6A 1RR7A 1W5SA 3OR2C 3C2GA 3I55I 2OU2A 1JKOC 3HOYJ 2VQLA 2ZXWH 5M5YJ 2Z2SB 3O3KA 2OV7A 4XORA 1ETWA 2D5VA 4HX8A 4WXCA 5E17F 2DCEA 3GMEA 4EM0B 3DTEA 2A07F 4Q5SF 2IGKA 3KX2A 1P4XA 1HDPA 4XRMA 2BHYA 4D0PA 1UMQA 1S3JA 3KP2A 2R7XA 1J9IA 1MW7A 4BE2A 1YE9A 2EWNA 3ERMA 1BA5A 2F5DA 1Z3YA 3FXQA 1FWZA 3K70D 4RAGA 2R5YB 1LQ1A 5J1YA 3CMMA 3WTWC 3FZVA 5FRMA 4GYGA 2ELJA 3E1SA 1QVUA 2AQFA 2KRHA 3M07A 2XGEA 2VOOA 3M3YJ 1XN7A 3E6BA 3KZZA 1SFUA 1QPMA 1FJLA 4UVAA 5GAGJ 4EEFG 2BGCA 1K83J 2WY8Q 1SD6A 4NC8A 3S17J 2CUEA 2P5KA 3F9KA 1O3SA 2CV0A 3Q9SA 3H5NA 3LSHA 4AM3A 2DOEA 2Y9YA 3WGGA 1K6YA 3HSRA 4ANJA 4XLHA 1OCOH 2L7KA 4DW6A 2E2IJ 5E3NA 2I8DA 4G6TB 1GVDA 1VQ4I 2NYXA 1R5GA 1FOXA 3OS1A 1FT9A 5ILSA 3QOPA 4CA0A 2DOAA 3OYNA 1J0RA 3ZMVA 2R7TA 2VUMJ 2E1OA 1HW2A 5DUKA 3ZMUA 2R7RA 3HOUJ 1POGA 4EVIA 2LY9A 4HSTA 3GFIA 2K9LA 3GTMJ 4YELA 1I1SA 5TGTA 3T0YA 1DQUA 3HM5A 3E3VA 5IPAA 4II2A 1OKRA 3H36A 4DBRA 2VXDA 2XB0X 4O6JA 2R93J 5J8FA 3RZDJ 1MKMA 1MH4A 3DFGA 3ZOBA 2LVSA 2LDUA 3CMAI 4HF2A 2V7FA 5LLQA 3SZGA 3H92A 2PQ8A 3HRSA 2XAUA 4KUMA 4CH7A 3RZOJ 2PI0A 3CCMI 2VQGA 3R60A 2COMA 2KZVA 1L3LA 3ROUA 5KNLA 1R71A 1E3PA 2KRFA 3OYHA 5IYDJ 1BIAA 4L5EA 2JSPA 1ZRCA 3H9QA 1JGGA 3G4SI 1XGSA 2X1EA 2VC0A 4OAYA 2XRLA 4JK1X 1VQOI 4G7OF 3OV8A 2GIVA 2LF8A 3G1OA 2XHKA 4HRIA 1H9TA 1P6RA 3OYIA 2ZXIA 1IN7A 1N25A 1FOWA 3FKIJ 1X3ZB 1R6RA 2XVCA 3BPVA 3QPTA 4AVZA 4ZDLA 2MH2A 2KIUA 3LNQA 3BROA 3PNYA 4IX7A 1F36A 2OQGA 2FOWA 1WJEA 4L9NA 2L5QA 3OYBA 4DGWB 2RNGA 1SANA 3R4KA 3KE2A 3HOSA 2MGQA 3QWLA 2FA5A 3GVAA 5GPAA 3TL4X 2P0WA 1MBFA 3S1QJ 2JRTA 4P1WA 2WAEA 2ZSIB 2WY7Q 3PQJA 5F6FA 2CQ7A 2LD5A 2QWWA 4XM3A 1BI3A 3EQLF 1UELB 2LSOA 3EUAA 3L09A 4J01A 3QU3A 2ELKA 2XAHA 3W6VA 2Z1DA 1MMAA 1JT6A 3FK6A 4XR6A 3UR3C 3QP6A 3H3UA 1FZPB 2OA4A 1BI1A 4RB1A 3BR2A 4BDZA 1UCRA 4MLOA 2YX4A 2R7FA 3MKWB 1HBXG 1EA3A 2VBYA 4LMYA 1IXRC 1VQKI 3JAMZ 2LREA 3IRQA 4PUSA 4RGUA 4LLLA 1BW5A 1IN5A 2BOLA 5K7FA 3KIOA 4F93B 4N9HA 4A3CJ 4BY7J 1T38A 2H1KA 2GWRA 1UHWA 2NXNB 4XICA 4PZJA 1E3HA 1ZLJA 1A5JA 2NVXJ 1ULYA 4HF1A 1LNWA 2R5ZA 4IRHA 2V1DA 3HGGA 2FQ4A 3OIPA 3T8TA 2HPIA 3BG3A 2NNYA 2L7ZA 3OYEA 2VC1A 2R7SA 4Q47A 4CO8A 5LRSA 2JMWA 2X51A 2DYSH 3DBHB 2L0KA 3V4GA 1JUPA 3BY6A 2XKPA 3HTUA 3RQIA 4KMUX 1D1AA 4RM3A 4A3FJ 2VJ5A 1SVMA 2HOTA 2LF7A 1LDJA 2QUFA 3S1NJ 2XGXA 1FYLA 2TCTA 1FBSA 2HOEA 3LSIA 2VONA 4KT6A 2HFHA 3V8LA 1D5VA 2LY2A 1IDZA 4LB6B 1SEUA 4G8XA 3PO2J 3LSTA 5L3EA 3BWGA 4ETSA 1U0JA 2IVMA 1TP4A 5EDNA 3DTIA 2DTRA 3ZQCA 1RESA 2V1NA 5M5WJ 2JZYA 1GV5A 4Y7NJ 3S93A 4QPQA 4A5MA 1BBYA 2ESNA 2HTSA 1AWCA 4MIMA 1QZZA 1W0UA 4UV8A 1OYIA 4E7SA 4M71A 3OY9A 2EFNA 1Y8RB 4PGGA 3R6SA 5KAIC 1XGMA 2JVGA 2BY1A 3AL0C 5IY5H 2MSYA 2L4AA 1ZAOA 2OF7A 1V3FA 1TC3C 3PJRA 3WU0A 3BR0A 1YIOA 3OYAA 1BIBA 1XCBA 2R5ZB 5F1JA 1JJ8C 3LSMA 3W2VA 1NK2P 3M8JA 1U8RA 1FOKA 2K85A 3F72A 2LY1A 2JUGA 1UJ8A 4CZZA 1SD5A 2HVSA 3EETA 2M45A 5DM7F 3CC2I 2ZJRF 3GCMA 2HTJA 1PP7U 1EF4A 3K10A 4DNCA 2XIGA 1S6LA 5BPDA 5JI6A 2WV1A 3PUFA 1Z6RA 5AIQA 4BBRJ 1DGWY 3CF2A 2ME0A 5LBQA 3NQOA 5ERIA 3HDDA 4EATA 4FTHA 3ZPLA 1VF9A 3TP0A 2XPWA 2Z3YA 1FP1D 4UV9A 4XBFA 1Z67A 2W00A 2VIXA 3SJMA 3G73A 4Y4RA 2QLZA 2M1BA 1EH8A 3SZPA 4KIBA 1OMIA 2H1LA 4KFCA 1ENHA 2K3FA 3OYGA 2JA5J 2XAGA 2VQCA 1MBEA 3IH4A 1LFBA 5ED4A 2M0CA 5IT9Z 3H0GJ 2XF5A 2MLGA 3V7CA 1KYWA 2FU4A 2E1MC 4IL6C 3BTIA 1WKMA 2CQKA 3D0SA 3AFHA 5LGNA 4F92B 5EZGA 4PJNA 4A3IJ 4LG0A 2M4KA 3OYKA 3E5QA 2X4HA 2OJED 4RAYA 1QBJA 3HOVJ 2C6YA 2GQQA 3HOTA 2O9LA 2B63J 4CYCA 2W57A 2XAFA 4M9XA 4L18B 2ID3A 2JJ7A 4FE7A 2D45A 2GLOA 2A61A 3U9GA 2QA4I 4AD9A 3MEXA 2Y69H 2MBFA 2Q8KA 3FMQA 2EQRA 2GBYA 2DA3A 3FKJA 2I10A 3VEPA 3MMYB 3WTYC 4EGYA 3JRAA 3G1LA 4JP0A 4M3EA 4U0VA 3F8MA 2A3SA 1NG6A 2AXLA 4BXFA 1TQPA 3IWZA 4EJWA 1T0FC 4M3FA 4A3EJ 1KU2A 4G9YA 5JLXA 1B1BA 3VDXA 4LITA 3CQZJ 2HXOA 4C3JJ 3FIWA 3WE3A 1LVAA 5BNGA 2QGUA 2R7WA 4XSXF 5JVGF 1SVOA 2VPRA 1I3QJ 2OC6A 1VQPI 3CDHA 4O3MA 3CP8A 1RKTA 1SVLA 3I56I 5FLXZ 1WWXA 1LDKB 3CO6C 1ZG1A 1MIJA 1O3TA 4CDGA 1FY7A 3PM1A
chains in the Genus database with same CATH topology
3Q3SA 4V2GA 4D5FA 3JR9A 1ETKA 1Y1WJ 1JKPC 3H3VK 3BQZA 3Q0WA 5JLWA 4W97A 4UUTA 2P81A 3FK7A 1B72B 1H88C 2WAQN 1IG7A 1IRZA 1WPKA 2ZB9A 3JRHA 2EZLA 3JRIA 1HF0A 1AKHB 5K7ZA 1MBJA 3HEFA 1MBGA 2XB5A 5EG0B 2JWTA 1JTYA 2K9QA 4CYCB 2AO9A 2CQXA 5F0HA 4XK4A 1WI3A 3S2DJ 2K9SA 2HQ5A 2DMTA 3K2AA 1OCTC 2Y0SN 3QPSA 4XIDA 3DEWA 3RKQA 2HDDA 1F43A 2DMQA 4DYRA 1A6IA 3BTJA 5E3OA 1YRNA 4NDLA 3ZQHA 1B8IA 2NVTJ 4A69C 2R5YA 1AHDP 4B3AA 2DMPA 5EF6A 2H8RA 3JRBA 3SDGA 3O8HA 2TRTA 4C2MJ 1GUUA 1QRYA 3OOUA 2XPVA 5DS9A 3TP3A 4IHWA 4JX4A 4V2FA 1FTTA 5J3LA 2VI6A 3MN2A 1CQTA 1NTCA 1H89C 3CCYA 1WH5A 2QF7A 4LOCA 5IOYA 5J1UA 3VPRA 2E2JJ 2HOAA 4DYCA 4HNVA 3BG9A 5EEAA 2XGDA 4JX6A 1RR7A 2YS9A 4FISA 2R92J 4I76A 3MKLA 5IOZA 1JKOC 5EZHA 3HOYJ 1Q1VA 5M5YJ 4A3BJ 1ETWA 2D5VA 1P7JA 3HOWJ 4A3DJ 1U9NA 2DMUA 2LK2A 3CDLA 4B4CA 2EBIA 4AC0A 1HDPA 4XRMA 4A3KJ 1T56A 4A3MJ 1UMQA 1SFOJ 2COBA 5HODA 3S15J 2FX0A 4M6VA 5DTDA 4AYBN 1BA5A 1ITYA 2DA6A 2XSDC 1YRNB 4FCYA 1B8IB 1RKWA 2R5YB 1JKRC 5FKLA 2O8KA 2CUFA 5J1YA 3BTCA 3S1RJ 1IDYA 2JN6A 1Y1VJ 3LSRA 1QVUA 2XGEA 1PUFA 2LFBA 3M3YJ 1MNMC 1FJLA 1GDTA 5C4XJ 4D7NA 4EEFG 1K83J 4C3HJ 3S17J 2CUEA 4Y52J 5C3EJ 1X2MA 1U9OA 1OFCX 2KDZA 1IV6A 3Q0VA 2Y9YA 1U78A 3I4NJ 2K40A 5F0FA 2LP0A 4DW6A 2E2IJ 5E3NA 1UG2A 1RETA 3GTPJ 1GVDA 1VFCA 1MBKA 1IGNA 2JA7J 5K7HA 1LFUP 2VUMJ 2E1OA 5FKNA 3ZQLA 2HOSA 4ABZA 2KT0A 3HOUJ 1POGA 2Y30A 1I50J 2LY9A 3OSFA 1HCRA 4MFEA 4C3IJ 1MSFC 4D7MA 3GTMJ 1E3OC 3HM5A 3BR1A 2HYJA 5IPAA 4W1UA 5J1RA 2XB0X 1P7IA 2O7OA 3ZQGA 2R93J 3RZDJ 1MH4A 1VI0A 2MW8A 3ZOBA 2LVSA 4DYQA 2LTPA 1T33A 1ZGWA 1QPIA 3JRCA 2JK3A 4A3GJ 3RZOJ 2NS7A 1PUFB 1JKQC 3BG5A 4B1RA 1BJZA 2CJJA 2FJ1A 2HXIA 5IYDJ 4L5EA 1TWGJ 3DCFA 2LKXA 2L7MP 1DU0A 1JJ6C 2E19A 1JGGA 1HOMA 2M8GX 4BXXJ 3LSJA 2XRLA 5C4JJ 3G1OA 3F0CA 5FKKA 4RBOA 2XPUA 3FKIJ 5EYRA 5F27A 4M3BA 2G0EA 4J19A 3I4MJ 3LNQA 2Y9ZA 5M5XJ 1FTZA 3BR6A 1F36A 3WHCA 5FLVA 1JUSA 2IAIA 1SANA 5EGOA 1QVTA 3JRDA 2MGQA 3WHBA 5GPAA 3S14J 1MBFA 4MO7A 3CMYA 3S1QJ 1ZR2A 1IC8A 1XS9A 3L1PA 1WH7A 2LD5A 3S2HJ 2CQQA 3IV5A 1MH3A 2NVYJ 4X1EA 3JRGA 2JA8J 3SFIA 2ELKA 3W6VA 3PO3J 3IH3A 5E3MA 1JT6A 3FK6A 4G12A 2ECCA 1D5YA 2R0QC 3GTGJ 2ECBA 3LSPA 2DA7A 3BR2A 4MLOA 1IJWC 5F08A 1UHSA 1ETYA 3D1NI 2JA6J 2OPTA 1NK3P 3K7AJ 1BL0A 2R7ZJ 1TWAJ 3C2BA 1JT0A 1MBHA 2QCOA 4JYKA 1OCPA 3E7LA 2NVQJ 1BW5A 5K7FA 1FIPA 1ETVA 1WCMJ 3HOZJ 4A3CJ 1ETOA 1ETQA 4BY7J 5GPCA 1ETXA 2H1KA 2DA1A 3GTLJ 4XICA 1X58A 3TW7A 1A5JA 1Z77A 2NVXJ 2K9NA 4DZPA 3IH2A 2R5ZA 4GFBA 2Y31A 3HOXJ 3BR5A 3HGGA 2FQ4A 2MG4A 4M3GA 2IBDA 3BG3A 2DN0A 2L7ZA 2YUSA 4X6AJ 2DA2A 2ME6A 3Q0UA 4BKXA 2JMWA 3GTKJ 2XGCA 2RAEA 2L0KA 5EGOB 1JUPA 3RQIA 1ZK8A 2YU9J 3M4OJ 4A3FJ 2DMNA 3BR3A 4RDUA 2HOTA 1LE8A 3QPLA 1XG1A 4IHVA 5FKMA 3HBLA 3S1NJ 3FISA 2TCTA 3JRFA 4A93J 2VKEA 3UKGA 5IYCJ 1IDZA 2CU7A 3OSGA 3PO2J 2Y2ZA 1I6HJ 3A03A 5EDNA 5M3FJ 3ZQCA 1RESA 5M5WJ 1TWCJ 1GV5A 2X9DA 1U8BA 4Y7NJ 2M9HA 4IHXA 2DA5A 2NOGA 4MFDA 4UUSA 1ZR4A 1OJLA 4MIMA 1Z0XA 2W48A 1W0UA 5M3MJ 2WB1N 2AHQA 3MVPA 4BBSJ 1JUMA 1TWFJ 1W0TA 5IYBJ 3O8GA 2DTZA 4AUXA 1GV2A 1WGXA 3TW6A 2MSYA 2OF7A 1RPWA 1GT0C 1TC3C 2X48A 5IP9J 3BR0A 5GP9A 5IP6A 2R5ZB 3ZQFA 5F1JA 1JJ8C 5E3LA 1NK2P 5F04A 2PMZN 1FIAA 3B6AA 1APLC 3LOCA 1HDDC 3BQYA 3A02A 2IEKA 1K61A 1EF4A 4DZJA 1LE8B 1AU7A 2LLKA 2WV1A 3TEDA 4BBRJ 4A3JJ 3GTJJ 2ME0A 1ZTRA 3HDDA 1DU6A 4XRSG 4FTHA 1VF9A 1ZKGA 3TP0A 1HLVA 2XPWA 3HB9A 2E2HJ 2FD5A 3A01A 1S7EA 3SJMA 3LSGA 3GTOJ 3BT9A 1ZQ3P 2GM4A 2NS8A 1ENHA 1TWHJ 2HI3A 1VNDA 2JA5J 3IH4A 1MBEA 4FE4A 1O4XA 1LFBA 2M0CA 4M3DA 3H0GJ 2EH3A 4UUSB 1X2NA 4XRSA 2DA4A 3BTIA 3HGYA 2DJNA 3OIOA 3ZQIA 2VKVA 1R9TJ 1B72A 5EZGA 4A3IJ 5FKOA 5IP7J 1AKHA 3HOVJ 4IEJA 3NAUA 5EG0A 2O9LA 2B63J 2N8GA 5FLMJ 1JTXA 4CYCA 2CRGA 3BTLA 2ID3A 2M2EA 2EZKA 2JJ7A 4FE7A 2GLOA 2EZIA 4QIWN 2LR8A 4QSHA 1H8AC 3QQAA 2EQRA 4S0HB 2GBYA 2DA3A 2I10A 3GBGA 3S1MJ 3JRAA 3G1LA 4JP0A 4M3EA 2M34A 4D5CA 3G1MA 3B6CA 3HKZN 1FEXA 1IUFA 1G2HA 4M3FA 5C44J 4A3EJ 3S16J 5JLXA 2L7FP 9ANTA 3CQZJ 2HXOA 3GTQJ 4C3JJ 3A01B 3FIWA 4IHYA 5BNGA 1BW6A 2VPRA 1I3QJ 5FJ8J 4A3LJ 2L9RA 1MSEC 2X6OA 1RKTA 1ORKA 1XC5A 4JX5A 4QTRA 3NARA 3JREA 5F0CA 4BY1J 2EZHA 3PM1A 2ID6A 4I6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q3S A;  4V2G A;  4D5F A;  3JR9 A;  1ETK A;  1Y1W J;  1JKP C;  3H3V K;  3BQZ A;  3Q0W A;  5JLW A;  4W97 A;  4UUT A;  2P81 A;  3FK7 A;  1B72 B;  1H88 C;  2WAQ N;  1IG7 A;  1IRZ A;  1WPK A;  2ZB9 A;  3JRH A;  2EZL A;  3JRI A;  1HF0 A;  1AKH B;  5K7Z A;  1MBJ A;  3HEF A;  1MBG A;  2XB5 A;  5EG0 B;  2JWT A;  1JTY A;  2K9Q A;  4CYC B;  2AO9 A;  2CQX A;  5F0H A;  4XK4 A;  1WI3 A;  3S2D J;  2K9S A;  2HQ5 A;  2DMT A;  3K2A A;  1OCT C;  2Y0S N;  3QPS A;  4XID A;  3DEW A;  3RKQ A;  2HDD A;  1F43 A;  2DMQ A;  4DYR A;  1A6I A;  3BTJ A;  5E3O A;  1YRN A;  4NDL A;  3ZQH A;  1B8I A;  2NVT J;  4A69 C;  2R5Y A;  1AHD P;  4B3A A;  2DMP A;  5EF6 A;  2H8R A;  3JRB A;  3SDG A;  3O8H A;  2TRT A;  4C2M J;  1GUU A;  1QRY A;  3OOU A;  2XPV A;  5DS9 A;  3TP3 A;  4IHW A;  4JX4 A;  4V2F A;  1FTT A;  5J3L A;  2VI6 A;  3MN2 A;  1CQT A;  1NTC A;  1H89 C;  3CCY A;  1WH5 A;  2QF7 A;  4LOC A;  5IOY A;  5J1U A;  3VPR A;  2E2J J;  2HOA A;  4DYC A;  4HNV A;  3BG9 A;  5EEA A;  2XGD A;  4JX6 A;  1RR7 A;  2YS9 A;  4FIS A;  2R92 J;  4I76 A;  3MKL A;  5IOZ A;  1JKO C;  5EZH A;  3HOY J;  1Q1V A;  5M5Y J;  4A3B J;  1ETW A;  2D5V A;  1P7J A;  3HOW J;  4A3D J;  1U9N A;  2DMU A;  2LK2 A;  3CDL A;  4B4C A;  2EBI A;  4AC0 A;  1HDP A;  4XRM A;  4A3K J;  1T56 A;  4A3M J;  1UMQ A;  1SFO J;  2COB A;  5HOD A;  3S15 J;  2FX0 A;  4M6V A;  5DTD A;  4AYB N;  1BA5 A;  1ITY A;  2DA6 A;  2XSD C;  1YRN B;  4FCY A;  1B8I B;  1RKW A;  2R5Y B;  1JKR C;  5FKL A;  2O8K A;  2CUF A;  5J1Y A;  3BTC A;  3S1R J;  1IDY A;  2JN6 A;  1Y1V J;  3LSR A;  1QVU A;  2XGE A;  1PUF A;  2LFB A;  3M3Y J;  1MNM C;  1FJL A;  1GDT A;  5C4X J;  4D7N A;  4EEF G;  1K83 J;  4C3H J;  3S17 J;  2CUE A;  4Y52 J;  5C3E J;  1X2M A;  1U9O A;  1OFC X;  2KDZ A;  1IV6 A;  3Q0V A;  2Y9Y A;  1U78 A;  3I4N J;  2K40 A;  5F0F A;  2LP0 A;  4DW6 A;  2E2I J;  5E3N A;  1UG2 A;  1RET A;  3GTP J;  1GVD A;  1VFC A;  1MBK A;  1IGN A;  2JA7 J;  5K7H A;  1LFU P;  2VUM J;  2E1O A;  5FKN A;  3ZQL A;  2HOS A;  4ABZ A;  2KT0 A;  3HOU J;  1POG A;  2Y30 A;  1I50 J;  2LY9 A;  3OSF A;  1HCR A;  4MFE A;  4C3I J;  1MSF C;  4D7M A;  3GTM J;  1E3O C;  3HM5 A;  3BR1 A;  2HYJ A;  5IPA A;  4W1U A;  5J1R A;  2XB0 X;  1P7I A;  2O7O A;  3ZQG A;  2R93 J;  3RZD J;  1MH4 A;  1VI0 A;  2MW8 A;  3ZOB A;  2LVS A;  4DYQ A;  2LTP A;  1T33 A;  1ZGW A;  1QPI A;  3JRC A;  2JK3 A;  4A3G J;  3RZO J;  2NS7 A;  1PUF B;  1JKQ C;  3BG5 A;  4B1R A;  1BJZ A;  2CJJ A;  2FJ1 A;  2HXI A;  5IYD J;  4L5E A;  1TWG J;  3DCF A;  2LKX A;  2L7M P;  1DU0 A;  1JJ6 C;  2E19 A;  1JGG A;  1HOM A;  2M8G X;  4BXX J;  3LSJ A;  2XRL A;  5C4J J;  3G1O A;  3F0C A;  5FKK A;  4RBO A;  2XPU A;  3FKI J;  5EYR A;  5F27 A;  4M3B A;  2G0E A;  4J19 A;  3I4M J;  3LNQ A;  2Y9Z A;  5M5X J;  1FTZ A;  3BR6 A;  1F36 A;  3WHC A;  5FLV A;  1JUS A;  2IAI A;  1SAN A;  5EGO A;  1QVT A;  3JRD A;  2MGQ A;  3WHB A;  5GPA A;  3S14 J;  1MBF A;  4MO7 A;  3CMY A;  3S1Q J;  1ZR2 A;  1IC8 A;  1XS9 A;  3L1P A;  1WH7 A;  2LD5 A;  3S2H J;  2CQQ A;  3IV5 A;  1MH3 A;  2NVY J;  4X1E A;  3JRG A;  2JA8 J;  3SFI A;  2ELK A;  3W6V A;  3PO3 J;  3IH3 A;  5E3M A;  1JT6 A;  3FK6 A;  4G12 A;  2ECC A;  1D5Y A;  2R0Q C;  3GTG J;  2ECB A;  3LSP A;  2DA7 A;  3BR2 A;  4MLO A;  1IJW C;  5F08 A;  1UHS A;  1ETY A;  3D1N I;  2JA6 J;  2OPT A;  1NK3 P;  3K7A J;  1BL0 A;  2R7Z J;  1TWA J;  3C2B A;  1JT0 A;  1MBH A;  2QCO A;  4JYK A;  1OCP A;  3E7L A;  2NVQ J;  1BW5 A;  5K7F A;  1FIP A;  1ETV A;  1WCM J;  3HOZ J;  4A3C J;  1ETO A;  1ETQ A;  4BY7 J;  5GPC A;  1ETX A;  2H1K A;  2DA1 A;  3GTL J;  4XIC A;  1X58 A;  3TW7 A;  1A5J A;  1Z77 A;  2NVX J;  2K9N A;  4DZP A;  3IH2 A;  2R5Z A;  4GFB A;  2Y31 A;  3HOX J;  3BR5 A;  3HGG A;  2FQ4 A;  2MG4 A;  4M3G A;  2IBD A;  3BG3 A;  2DN0 A;  2L7Z A;  2YUS A;  4X6A J;  2DA2 A;  2ME6 A;  3Q0U A;  4BKX A;  2JMW A;  3GTK J;  2XGC A;  2RAE A;  2L0K A;  5EGO B;  1JUP A;  3RQI A;  1ZK8 A;  2YU9 J;  3M4O J;  4A3F J;  2DMN A;  3BR3 A;  4RDU A;  2HOT A;  1LE8 A;  3QPL A;  1XG1 A;  4IHV A;  5FKM A;  3HBL A;  3S1N J;  3FIS A;  2TCT A;  3JRF A;  4A93 J;  2VKE A;  3UKG A;  5IYC J;  1IDZ A;  2CU7 A;  3OSG A;  3PO2 J;  2Y2Z A;  1I6H J;  3A03 A;  5EDN A;  5M3F J;  3ZQC A;  1RES A;  5M5W J;  1TWC J;  1GV5 A;  2X9D A;  1U8B A;  4Y7N J;  2M9H A;  4IHX A;  2DA5 A;  2NOG A;  4MFD A;  4UUS A;  1ZR4 A;  1OJL A;  4MIM A;  1Z0X A;  2W48 A;  1W0U A;  5M3M J;  2WB1 N;  2AHQ A;  3MVP A;  4BBS J;  1JUM A;  1TWF J;  1W0T A;  5IYB J;  3O8G A;  2DTZ A;  4AUX A;  1GV2 A;  1WGX A;  3TW6 A;  2MSY A;  2OF7 A;  1RPW A;  1GT0 C;  1TC3 C;  2X48 A;  5IP9 J;  3BR0 A;  5GP9 A;  5IP6 A;  2R5Z B;  3ZQF A;  5F1J A;  1JJ8 C;  5E3L A;  1NK2 P;  5F04 A;  2PMZ N;  1FIA A;  3B6A A;  1APL C;  3LOC A;  1HDD C;  3BQY A;  3A02 A;  2IEK A;  1K61 A;  1EF4 A;  4DZJ A;  1LE8 B;  1AU7 A;  2LLK A;  2WV1 A;  3TED A;  4BBR J;  4A3J J;  3GTJ J;  2ME0 A;  1ZTR A;  3HDD A;  1DU6 A;  4XRS G;  4FTH A;  1VF9 A;  1ZKG A;  3TP0 A;  1HLV A;  2XPW A;  3HB9 A;  2E2H J;  2FD5 A;  3A01 A;  1S7E A;  3SJM A;  3LSG A;  3GTO J;  3BT9 A;  1ZQ3 P;  2GM4 A;  2NS8 A;  1ENH A;  1TWH J;  2HI3 A;  1VND A;  2JA5 J;  3IH4 A;  1MBE A;  4FE4 A;  1O4X A;  1LFB A;  2M0C A;  4M3D A;  3H0G J;  2EH3 A;  4UUS B;  1X2N A;  4XRS A;  2DA4 A;  3BTI A;  3HGY A;  2DJN A;  3OIO A;  3ZQI A;  2VKV A;  1R9T J;  1B72 A;  5EZG A;  4A3I J;  5FKO A;  5IP7 J;  1AKH A;  3HOV J;  4IEJ A;  3NAU A;  5EG0 A;  2O9L A;  2B63 J;  2N8G A;  5FLM J;  1JTX A;  4CYC A;  2CRG A;  3BTL A;  2ID3 A;  2M2E A;  2EZK A;  2JJ7 A;  4FE7 A;  2GLO A;  2EZI A;  4QIW N;  2LR8 A;  4QSH A;  1H8A C;  3QQA A;  2EQR A;  4S0H B;  2GBY A;  2DA3 A;  2I10 A;  3GBG A;  3S1M J;  3JRA A;  3G1L A;  4JP0 A;  4M3E A;  2M34 A;  4D5C A;  3G1M A;  3B6C A;  3HKZ N;  1FEX A;  1IUF A;  1G2H A;  4M3F A;  5C44 J;  4A3E J;  3S16 J;  5JLX A;  2L7F P;  9ANT A;  3CQZ J;  2HXO A;  3GTQ J;  4C3J J;  3A01 B;  3FIW A;  4IHY A;  5BNG A;  1BW6 A;  2VPR A;  1I3Q J;  5FJ8 J;  4A3L J;  2L9R A;  1MSE C;  2X6O A;  1RKT A;  1ORK A;  1XC5 A;  4JX5 A;  4QTR A;  3NAR A;  3JRE A;  5F0C A;  4BY1 J;  2EZH A;  3PM1 A;  2ID6 A;  4I6Z A; 
#chains in the Genus database with same CATH topology
 3PIP F;  2CG4 A;  2IGM A;  2ELH A;  1A31 A;  1JKP C;  1SD7 A;  2JA2 A;  4W97 A;  4UUT A;  2P81 A;  2QSF X;  2IA1 A;  3KP6 A;  2W82 A;  4LG0 B;  1IRZ A;  4XKB A;  1VZ0 A;  1WPK A;  2XF7 A;  1J09 A;  2UXN A;  1T95 A;  3JRH A;  4E7L A;  3JRI A;  1HF0 A;  2QYO A;  1MBJ A;  2KIM A;  2HDW A;  3F8C A;  2IA2 A;  1JTY A;  4CYC B;  2CQX A;  5F0H A;  2IRF G;  4A2U A;  5E1Z B;  1G8X A;  2DMT A;  3OYL A;  3BP8 A;  4G94 A;  4NHJ A;  3QPS A;  1Z91 A;  3F8B A;  2ZNZ A;  4AIH A;  2A6E F;  3RKQ A;  1FYM A;  1F43 A;  3RPQ A;  2WV0 A;  3DKY A;  1T08 B;  4DYR A;  5E8I A;  1A6I A;  4XKC A;  2ZME A;  2M0M A;  5E3O A;  1B8I A;  1J59 A;  3DPU A;  1GLN A;  4B3A A;  2IJL A;  3A4C A;  1VTN C;  3I71 A;  2H8R A;  5TJJ A;  3WTU C;  2TRT A;  1OR7 A;  1P2F A;  4CYD A;  1LUJ B;  4XL9 A;  3P5J A;  1HSJ A;  2K86 A;  4BL0 B;  4RB3 C;  2XPV A;  3TP3 A;  3AAF A;  2DPU A;  3GFM A;  2PJR A;  3SEZ A;  3GW2 A;  4QPO A;  2D1V A;  3VSK A;  5LHI A;  2FOK A;  2E34 A;  4GRI A;  1CQT A;  1WZ2 A;  3N97 A;  2VL8 A;  1P92 A;  2A5Y B;  3WG9 A;  2VJ4 A;  1CF7 B;  3LL7 A;  4LOC A;  5CVJ A;  3CCQ I;  5IOY A;  4MNU A;  3IL2 A;  1TW3 A;  1UFM A;  3C18 A;  3BG9 A;  4HBL A;  4E7I A;  3VOE A;  1TT5 B;  3C1D A;  4XKW A;  1Y0U A;  4XQF A;  2ZCW A;  2FMY A;  1XB4 A;  4FT8 A;  4GCV A;  5EZH A;  3RTR A;  2M8E A;  4J00 A;  3IC7 A;  2PFB A;  2W84 A;  2IS2 A;  2A05 A;  2IXS A;  5DCM A;  3HOW J;  1P7J A;  4LIV A;  4IHT A;  2CW7 A;  2LRD A;  3CF5 F;  3QRF F;  1HST A;  3ULQ B;  4B4C A;  2NRA C;  3AG2 H;  2YPR A;  4I09 A;  2HWV A;  4AC0 A;  2VT2 A;  4BE1 A;  1GHC A;  4FHT A;  1USS A;  1T56 A;  4HOB A;  1NH3 A;  4LGW A;  1N77 A;  1NG7 A;  2CFX A;  1MND A;  4H0E A;  5DD4 A;  4I01 A;  5HOD A;  2RV8 A;  3S15 J;  4M6V A;  3LFU A;  5DTD A;  1X3W B;  2OAZ A;  2ZME B;  3VWB A;  3G2B A;  1B8I B;  4BQN A;  3HRU A;  3LA2 A;  5KAF C;  2IS4 A;  2O8K A;  3BTC A;  3ASO H;  4BAY A;  3CCS I;  2LBF A;  3LSR A;  2DQR A;  1AOY A;  1QGP A;  1PUF A;  1BJA A;  1EJ9 A;  3K1M A;  3CLQ A;  3OYJ A;  1GDT A;  3CJR B;  3REO A;  5LFA A;  2GOX B;  4WX9 A;  2BEO A;  4Y52 J;  4IZZ A;  2PJR B;  1ACI A;  1YW9 A;  2CQN A;  2Y48 A;  2KDZ A;  3CME I;  2P5V A;  1X19 A;  3GYH X;  1K4T A;  1SD4 A;  1EH7 A;  3EUK L;  4XON A;  4RAZ A;  1U78 A;  3I4N J;  2K40 A;  2CWE A;  2EV6 A;  3BJ6 A;  5F0F A;  4OMY A;  2V1U A;  4D1Q A;  3HHG A;  2FSW A;  4CCJ A;  1FMW A;  1IGN A;  1Q1H A;  2QZ8 A;  1MJB A;  3W6K B;  4BE0 A;  4BAC A;  2JSC A;  2EIK H;  4ABZ A;  3R0J A;  1KYZ A;  3RKW A;  4RB0 A;  3OSF A;  4MFE A;  5DCM B;  3GEZ A;  4D7M A;  1T39 A;  2WWY A;  2HDC A;  4G7Z F;  3D5S C;  5J1R A;  4KNY A;  4MTE A;  3ZQG A;  1W36 C;  3ERE D;  2VE9 A;  4JOM A;  3MKZ A;  4DOZ A;  3ML6 A;  2L4M A;  4F91 B;  1Y6I A;  1YG2 A;  3VYS B;  1T33 A;  4CCL A;  2MC3 A;  3JRC A;  4B48 A;  1FOY A;  2DI3 A;  1K78 A;  2LBF B;  2NS7 A;  1WJ5 A;  5LEK A;  1PUF B;  1W7P D;  2P5L C;  1LEB A;  4B1R A;  5K5R A;  2KRC A;  2HNH A;  2FJ1 A;  2FML A;  5HS7 A;  1QQI A;  1YHQ I;  3NWS A;  2V4J C;  3ZRG A;  1V4R A;  2NAZ A;  3KET A;  4PJL A;  4N9I A;  3ZP5 A;  3AG4 H;  3CCV I;  4F3Q A;  5JHU A;  4KIF A;  3W2W A;  3BC8 A;  2X6X A;  4ZYE A;  5ILV A;  1W7P A;  5FKK A;  4M3B A;  3LAP A;  3HC7 A;  5HOO A;  4HNT A;  4XLF A;  3GXO A;  3K2Z A;  4L9J A;  3U1K A;  2ICW G;  1N75 A;  3BZ6 A;  1JUS A;  4GXO A;  3X2Q H;  5FGM A;  2O0Y A;  4I99 C;  3JRD A;  1DDN A;  1WSU A;  4MO7 A;  1I3A A;  3CLO A;  1H9G A;  1SFE A;  2IT0 A;  3W2A A;  3HHH A;  1JI8 A;  1IRF A;  1QU3 A;  1BR1 A;  4CCN A;  4Y15 A;  3S2H J;  1MH3 A;  3FXJ A;  1FYK A;  3CUO A;  4X1E A;  3W6J B;  3JRG A;  3SFI A;  1K78 B;  2KIQ A;  3FDY A;  4G6D A;  3PO3 J;  5E3M A;  4XLC A;  2XV4 S;  4G12 A;  2ECC A;  5F64 A;  4KIG A;  2KQR A;  3LSK A;  4HQE A;  3L2W A;  4YFN F;  3C2H A;  2F5V A;  4E7Z A;  2QSG X;  2JA6 J;  5CJ9 A;  1BL0 A;  4CHU A;  1TWA J;  2Q1Z B;  1YQA A;  2VJJ A;  4XNF A;  1JT0 A;  1MBH A;  3J7A O;  2EV5 A;  3E7L A;  1UZC A;  1W7P B;  5KK1 A;  2K4B A;  1FBU A;  1FIP A;  4ENK A;  4XOP A;  2GAU A;  3OMY A;  3GX4 X;  1ETX A;  3GTL J;  2VLA A;  1Z77 A;  3WTX C;  2K9N A;  4YG2 F;  3IH2 A;  2RN7 A;  2Y31 A;  3HOX J;  2DN0 A;  2O61 A;  4IPA A;  3S2W A;  1B9M A;  3LA3 A;  2ME6 A;  4CSW A;  1RI7 A;  1YIT I;  4KJZ A;  2XGC A;  2RAE A;  2ZKZ A;  1YJ9 I;  4OIQ F;  1ZK8 A;  2YU9 J;  1YJN I;  1IXC A;  1QZE A;  1YLF A;  4FAS D;  4RDU A;  3K4M A;  4L5J A;  2OUM A;  1XG1 A;  5D6E A;  3HZJ A;  1Z1D A;  2H09 A;  4XMY A;  2R7D A;  5A2Q K;  2FUG 2;  5J40 A;  1LFP A;  2GZW A;  2VXZ A;  3RYR A;  2YSR A;  2E5Z A;  3HUG A;  4LG3 A;  2CU7 A;  3QU6 A;  2RC4 A;  2Y2Z A;  5CQG A;  1FMV A;  1SAU A;  4EJV A;  2X0L A;  1JGS A;  4IO9 F;  5M3F J;  3EUH C;  3WTS C;  1IN4 A;  3K0L A;  1GVJ A;  1T98 A;  4IHX A;  3HXL A;  1IRX A;  4MFD A;  1FBQ A;  4AU7 A;  4UUS A;  1J2X A;  2M87 A;  2W48 A;  2WB1 N;  3MVP A;  3GWZ A;  1TQI A;  1TTY A;  5IYB J;  3ZQQ A;  1GV2 A;  3TW6 A;  3V7S A;  1S9H A;  1RPW A;  2QVO A;  2X48 A;  3OL4 A;  1WJF A;  1OCC H;  4RAF A;  3TOB A;  3ZQF A;  5JVT A;  5E3L A;  3GLL A;  5EEH A;  2PMZ N;  1BI2 A;  3TO7 A;  3K1P A;  4U7D A;  2F4M B;  2DFF A;  4RGS A;  3GZ6 A;  4RS8 A;  4ZTJ A;  2MLK A;  2K02 A;  3HRM A;  1R58 A;  2BHZ A;  1BOB A;  2IEK A;  3FM3 A;  1VQ5 I;  1X1A A;  2H94 A;  1K61 A;  4P9F A;  3C7J A;  1K4S A;  4PFP A;  1XGN A;  2V79 A;  3BJA A;  1KU7 A;  2KDO A;  4A3J J;  3ZMT A;  1BI0 A;  4MEY F;  5HDK A;  2PLY A;  3GTJ J;  3DQV C;  1ZTR A;  4G6Q A;  2KKO A;  2W4S A;  3U21 A;  2LYC A;  1HLV A;  1PYV A;  4U0Y A;  3HUG B;  5ILU A;  1WHU A;  1S7E A;  3CD6 I;  1YW8 A;  4HPQ A;  1ZQ3 P;  4GDF A;  2PMH A;  3DBR B;  3J80 K;  1TWH J;  2MD5 A;  4K2E A;  2LKP A;  1VND A;  3ABL H;  4P9U A;  2XSJ C;  2IW5 A;  2AS5 F;  3IRR A;  3T5X A;  5ICE A;  4UUS B;  2EH3 A;  3K70 C;  1K6O A;  4I2O A;  5E1W A;  4NQW A;  2DYR H;  4GO1 A;  1HKS A;  3TDZ C;  2E71 A;  5FD5 A;  1FNN A;  3BLY A;  3ZQI A;  1OYY A;  2VKV A;  3KYD B;  2O03 A;  5FB2 A;  4OU0 A;  1B72 A;  3HYI A;  2R7V A;  3TGN A;  4BYY A;  4Y33 A;  2BXZ A;  5B1B H;  5EEG A;  4OIO F;  1R4N B;  3FHN A;  5IP7 J;  1ZLK A;  2EV0 A;  5TRD A;  4KYW A;  3OWT A;  3CES A;  5K5Q A;  5EG0 A;  4Z2Y A;  4BDY A;  5FLM J;  2CRG A;  4JBA A;  5A2Q Z;  3KLO A;  1FLI A;  3DLL F;  2E35 A;  1OQY A;  3V8J A;  2M5W A;  1H8A C;  4KT5 C;  2F4I A;  1TZL A;  4BJ6 C;  1OLT A;  1YS6 A;  3S1M J;  1FSE A;  2D1H A;  1BM9 A;  2CO5 A;  4C9Y A;  4NC6 A;  2Z99 A;  1FEX A;  5C44 J;  2WBM A;  1J5Y A;  4ZTF A;  2L54 A;  2L7F P;  9ANT A;  3DKX A;  2HVR A;  1UG0 A;  3GTQ J;  1XCV A;  1MDM A;  4IHY A;  4CCO A;  3CJQ B;  5KVR A;  1P4A A;  2EIN H;  3H9G A;  4OIN F;  3ZXS A;  2L9R A;  4A3L J;  3Q5F A;  4BHC A;  4JX5 A;  2KIF A;  4QTR A;  4IOC F;  4MQ9 F;  5F0C A;  5FFX A;  4DQ2 A;  1F4K A;  5L3G A;  2A69 F;  1SMT A;  2VOD A;  2YX7 A;  1R1U A;  3Q3S A;  4V2G A;  4NQW B;  1ETK A;  5B5E C;  5JLW A;  1PVE A;  2TDX A;  1D8J A;  3TMO A;  1LVK A;  2HQN A;  3RYP A;  1B72 B;  1P4W A;  2FBI A;  4ZYG A;  2XC7 A;  3HJE A;  2WB1 A;  2Z9O A;  1Y8Q B;  3ZQ7 A;  1U5T A;  1KQ0 A;  2XB5 A;  5EG0 B;  1PJR A;  3OS0 A;  1ERD A;  3L2C A;  4MGR A;  4XK4 A;  4HW0 A;  2FBK A;  5H6Q A;  1WI3 A;  1YI2 I;  1XX5 A;  1IN8 A;  3F21 A;  2HQ5 A;  2VBW A;  2WAD A;  2CUJ A;  2Y0S N;  4E70 A;  4Q48 A;  1LJ9 A;  4M73 A;  4UB6 C;  4E7J A;  2LG4 A;  2PMZ A;  4HAM A;  3BTJ A;  3COA C;  1TNT A;  2MA3 A;  2ZFW A;  2K5C A;  1YFH A;  1YRN A;  4TV7 A;  1JXS A;  2X6W A;  1STZ A;  3DLA A;  3SQN A;  2DMP A;  3E6C C;  2EB7 A;  2VN2 A;  3JRB A;  3SDG A;  3VSL A;  2KL4 A;  2ZXJ A;  1UB9 A;  1WJA A;  4C2M J;  4CXF A;  2DFI A;  1MDM B;  2HEO A;  1S8N A;  2J5P A;  5DS9 A;  4D9J A;  3BG7 A;  2DBB A;  2NOJ B;  1MJA A;  3HIF A;  1IZ1 A;  2VI6 A;  3MN2 A;  3HTS B;  5HLI A;  3WTV C;  3I9V 2;  3KZY A;  1XMX A;  4ON0 A;  3KEO A;  1XD7 A;  1H89 C;  2EA4 A;  1WH5 A;  2EIL H;  3WU1 B;  2KPM A;  2DOD A;  2HOA A;  4IHS A;  2BW3 A;  2XGD A;  2MD0 A;  2R92 J;  4I76 A;  4YFK F;  3ABU A;  3CC7 I;  1TW2 A;  1YS7 A;  5IOZ A;  4IOA F;  1Q1V A;  2OCC H;  3WTZ A;  3FMR A;  1RUN A;  2VOP A;  1U5T B;  4R79 A;  1W5T A;  2UV1 A;  3F8F A;  4A3B J;  3FXO A;  1YIJ I;  3L7W A;  3H9J A;  4A3D J;  1U9N A;  3CDL A;  2RQP A;  4P96 A;  2XAS A;  2EBI A;  3QPH A;  4E4H A;  3FWE A;  2BV6 A;  4A3K J;  5GTH C;  4ZDP A;  3K4L A;  4A3M J;  1HC8 A;  3JW4 A;  5BOX A;  1SFO J;  4HLY A;  1K79 A;  2BE5 F;  3H5A A;  3V42 A;  2FX0 A;  2DA6 A;  4YRV A;  3ISP A;  2XSD C;  1YRN B;  4U7B A;  3OYD A;  1YW7 A;  2PBI A;  3H0D A;  2DO7 A;  3S3N A;  1JKR C;  1MMS A;  1Y0N A;  4GYI A;  1IDY A;  3QOE A;  4DBQ A;  1J75 A;  1DUX C;  4OOI A;  1Y1V J;  1GXP A;  3E5X A;  4N0B A;  2KLO A;  1D8K A;  4XOT A;  4D7N A;  4E7K A;  3R61 A;  1MZB A;  1X4O A;  4A0X A;  5B1A H;  5L3D A;  4EJO A;  5HNF A;  5C3E J;  2G9W A;  5J47 A;  1X2M A;  2X1C A;  4N4N B;  3V8K A;  3KCC A;  2DLL A;  3F6O A;  4RB2 C;  1G3S A;  3MQ0 A;  1MJ9 A;  1IRG A;  5KCM A;  2LP0 A;  4FX4 A;  1UG2 A;  1X1B A;  2BW3 B;  4M6Y A;  1VFC A;  2LMD A;  3TDU C;  4S04 A;  4IXA A;  3KEY A;  2W24 A;  4IVN A;  5FKN A;  2HOS A;  1CF7 A;  1G3Y A;  3I5U A;  2Y30 A;  1I50 J;  4EQQ A;  1HCR A;  1MSF C;  2L3D A;  1R5I D;  1E3O C;  1XMK A;  3PIO F;  3JCU C;  4A0Y A;  1Z05 A;  5GAE J;  1ZRD A;  3BR1 A;  2HYJ A;  4BGD A;  3RKX A;  2M4G A;  1SMY F;  4W1U A;  4PJM A;  3N4M A;  1Y56 A;  3ZMZ A;  5HVQ C;  1P7I A;  1IF1 A;  2A6T A;  2ZBK A;  1BR2 A;  1VI0 A;  5K1Y A;  2MW8 A;  1OYW A;  2LTP A;  2OBP A;  4AIJ A;  3FXM A;  5H20 A;  2Y0S A;  1ZGW A;  1EKE A;  1DPU A;  2X85 A;  1OCZ H;  2RRE A;  3K69 A;  2HQR A;  3SZT A;  2ISZ A;  4E6K G;  3BG5 A;  4NNJ A;  4BUP A;  1BJZ A;  3KP7 A;  1R23 A;  2HXI A;  3M9A A;  4I98 B;  2K9M A;  5FFZ A;  1E0E A;  3DCF A;  2HVQ A;  4AIK A;  5E79 C;  5D4R A;  2HZT A;  1JJ6 C;  2E19 A;  3FXR A;  3CTA A;  2M8G X;  1HOM A;  4B43 A;  2P7C B;  1MMN A;  1XSV A;  3K1N A;  3ZCO A;  4BXX J;  3IKT A;  1QA6 A;  4HV6 A;  5J4Y A;  2R7U A;  1R1V A;  3FXU A;  2XDV A;  2CV2 A;  4RBO A;  2CSO A;  3ABT A;  2XPU A;  3BCA A;  3EYY A;  4EM2 A;  5EYR A;  3J7Z I;  5D8K B;  4PSX A;  2OD5 A;  2G0E A;  4J19 A;  3GO5 A;  3TBI A;  3E5U A;  3H1C A;  2Y9Z A;  2PX9 A;  5M5X J;  1ON2 A;  4M74 A;  5FLV A;  2RNJ A;  1Z21 A;  2ISY A;  5DV5 A;  1O3R A;  1R7J A;  1I39 A;  3QAH A;  2G7H A;  1F5T A;  3SFZ A;  5EGO A;  2STT A;  3TO6 A;  3BG6 A;  1RNL A;  1WRJ A;  3BCB A;  4PSW A;  2CUZ A;  3J81 K;  2VT3 A;  4HNU A;  3CMY A;  3L2V A;  3RIR A;  4Q4Z F;  5LEJ A;  5DM6 F;  1ZR2 A;  1R1T A;  2DDB A;  1IC8 A;  1WH7 A;  1S7A A;  2CQQ A;  2QEN A;  2NVY J;  1PUE E;  4HZF A;  3QOD A;  1TQM A;  3IH3 A;  5D6F A;  2KP6 A;  3I54 A;  1FP2 A;  1ZRE A;  2M3A A;  4HF0 A;  2R0Q C;  1RC9 A;  4LIU A;  4BHB A;  5DUI A;  2QSH X;  4KMF A;  3GTG J;  3LSP A;  2L9N A;  4ZH4 F;  2DA7 A;  1QO0 D;  3D1N I;  2OPT A;  2R7Z J;  4BNC A;  3C2B A;  3E97 A;  2P6S A;  2DDA A;  1V5F A;  3KP5 A;  1RIO H;  4JYK A;  1OCP A;  2ZO4 A;  2OZ6 A;  2NVQ J;  3CUQ A;  1TBX A;  5L3F A;  1PP8 F;  1XPX A;  2OZU A;  3HOZ J;  1ETO A;  1ETQ A;  1D1C A;  2IP2 A;  3H35 A;  2DA1 A;  3R0A A;  1PDN C;  3DXJ F;  1X58 A;  2RVC A;  2ZFU A;  3VB2 A;  2H6C A;  2F5E A;  2HYG D;  3BR5 A;  4G7H F;  4ENJ A;  2DK8 A;  4F52 A;  4X6A J;  2DA2 A;  3Q0U A;  4FET A;  4BKX A;  2IS1 A;  5DD8 A;  1BC8 C;  3GTK J;  1GXQ A;  2QQA A;  5EGO B;  4OIR F;  3M4O J;  3KP4 A;  1FX7 A;  3HSF A;  1WQ2 A;  5HDG A;  2DMN A;  3BR3 A;  5B3S H;  2HPM A;  5HLH A;  4HG2 A;  5KHD A;  1A04 A;  4ESB A;  4EMS A;  1ZAR A;  3O6B B;  2ZME C;  4F55 A;  2CS3 A;  2P7V B;  3JRF A;  1D3Y A;  4A93 J;  1VQ8 I;  2VKE A;  1EV7 A;  2DAO A;  3K4N A;  3K4C A;  5IYC J;  3M8E A;  2HKX A;  2XUB A;  3WU2 C;  1OR7 C;  1KGS A;  4M6X A;  1W5C C;  5E8G A;  5ICG A;  1HKQ A;  4RGR A;  2QQB A;  1LDD A;  1YYV A;  3PUB A;  2PEX A;  1DP3 A;  3GF2 A;  2DA5 A;  4C2T A;  4N4O B;  1OJL A;  3RSN A;  3U2R A;  1Z0X A;  4BBS J;  3I4P A;  3L9F A;  1JUM A;  1TWF J;  2L01 A;  3CUQ B;  4ESF A;  1BOA A;  1TNS A;  2IGN A;  4R8H A;  1ODD A;  2F6C A;  5IP9 J;  2E1C A;  2EFQ A;  3J81 Z;  4AID A;  1VQ9 I;  4QWQ A;  3CC4 I;  3L2Q A;  3B02 A;  3CCU I;  1V5E A;  1FIA A;  3B6A A;  3LOC A;  5AON A;  1HDD C;  2GXB A;  3HSE A;  3TOA A;  1CGP A;  3A02 A;  3IKV A;  3LFK A;  3SXY A;  4BJT A;  3IAM 2;  1O7F A;  2JPC A;  2L2O A;  3M1C A;  1X4P A;  4DZJ A;  4XKV A;  4HEA 2;  1VQN I;  1FPQ A;  2FEZ A;  4UVB A;  1E17 A;  3K9T A;  4B44 A;  3QYF A;  3SDB A;  1X1C A;  1R36 A;  2EPF A;  1DU6 A;  4XRS G;  4WWC A;  1G4D A;  4CGZ A;  2F4O B;  5GAD J;  2ZXH A;  4UY8 I;  4DJA A;  4NB5 A;  5DYM A;  3LSG A;  3GTO J;  3ABM H;  3WGI A;  2GM4 A;  3SHF A;  3ZN1 A;  3J7A Y;  4LLG F;  1O57 A;  2R7O A;  4OMZ A;  2HI3 A;  4I02 A;  3KP3 A;  4FE4 A;  3ZGK A;  3RJP A;  2CMP A;  1Z7U A;  3P9C A;  3HGY A;  2DJN A;  3V7R A;  4OWR B;  2LNB A;  4C30 A;  4ZDO A;  4CCK A;  2QBY A;  2XRN A;  4HYE A;  2QKL B;  2RQQ A;  4I0B A;  3WTT C;  4HX7 A;  2VKD A;  2E36 A;  3DP7 A;  4BH9 A;  1OCR H;  2V26 A;  3OYC A;  2RGV A;  3QYE A;  1J7K A;  2FQ3 A;  2D2W A;  2N8G A;  1JTX A;  3F3X A;  4PDK A;  3BTL A;  2M2E A;  2AXT C;  2V9K A;  2EZK A;  3BJO A;  3DU6 A;  4CZC A;  2EZI A;  4B8X A;  2F5F A;  3DU5 A;  1BN5 A;  1Z6T A;  2LR8 A;  4QSH A;  3CO7 C;  2V1X A;  3DKW A;  4HQM A;  2M7B A;  2HKO A;  3GBG A;  1WJC A;  3SYT A;  4HA8 A;  1OPC A;  4Y3O A;  1R4M B;  3P9I A;  1YO5 C;  2M34 A;  4D5C A;  4ENM A;  3C3W A;  1B6A A;  3G1M A;  3I3L A;  1T2K A;  3KEQ A;  3HKZ N;  3MZ8 A;  5CPR B;  1IUF A;  5B66 C;  1G2H A;  4PFO A;  5D5W B;  2DFH A;  4WK8 F;  3KYL A;  3M7G A;  3T8R A;  2B0L A;  2EIM H;  1X3U A;  3DEE A;  4HDU A;  2F5C A;  5FJ8 J;  1HW5 A;  5EJC A;  3KPH A;  1MSE C;  2X6O A;  1B59 A;  3A1Y A;  4LLN A;  2FNA A;  2DOF A;  2HYF A;  3JRE A;  1E2X A;  2E60 A;  4LK1 F;  4BXU A;  1R49 A;  3KLN A;  2FNP A;  2VE8 A;  3G6E I;  3FMS A;  3JAM K;  3JR9 A;  5HS9 A;  1Y1W J;  3AG1 H;  3H3V K;  3BQZ A;  2QM3 A;  3Q0W A;  3RKY A;  4XLP F;  3MWM A;  5DEQ A;  2UZK A;  4XN0 A;  2BY3 A;  1H0M A;  2QBY B;  1H88 C;  2ACJ A;  1SFX A;  4Y13 A;  2WAQ N;  3HPG A;  1A36 A;  4A5N A;  2ZB9 A;  4P5O A;  1SAX A;  2EZL A;  1MMG A;  5K7Z A;  2O6G E;  1YOV B;  1MBG A;  2OCE A;  2R4G A;  2AO9 A;  1W1W E;  3P7N A;  3S2D J;  1OCT C;  4WCG A;  4XID A;  3DEW A;  2XF6 A;  4WF2 A;  5BQT A;  1K7A A;  1NHA A;  2BY0 A;  2DMQ A;  2L9S A;  2J5O A;  3CJT B;  1FSH A;  1W4M A;  5CKT A;  5LHG A;  2KIS A;  3DV8 A;  4UUV A;  4M9Z A;  4NDL A;  1LKX A;  2NVT J;  3T1B A;  4A69 C;  3JTH A;  3DPT A;  2QKM B;  3BOQ A;  3OL3 A;  4NUB A;  3MFK A;  5EF6 A;  2P6T A;  4XRF A;  2A68 F;  3OYF A;  1QNT A;  3LQQ A;  4CIC A;  1GUU A;  2X6Y A;  4MHG A;  1QRY A;  1ZYR F;  3OS2 A;  1B4A A;  1LEA A;  1UHM A;  4IHW A;  4JX4 A;  3E6D A;  5BS6 A;  1IUY A;  5J3L A;  5AIP A;  5K5O A;  1NTC A;  3MKY B;  2W25 A;  2V6E A;  2F2E A;  4L9T A;  3CCY A;  1QHG A;  4CCM A;  3ONQ A;  3ZR8 X;  1MD0 A;  4B3X A;  4YEJ A;  5J1U A;  2HGC A;  2BBY A;  4XN3 A;  2GA2 A;  4BHP A;  1RUO A;  3WG7 H;  5IT3 A;  4V19 K;  2YS9 A;  4FIS A;  4DIQ A;  1ZRF A;  2DU9 A;  3K6G A;  3MKL A;  3GFJ A;  5ICC A;  4IQJ A;  1S72 I;  2E1N A;  1D0Z A;  2ETH A;  2P8T A;  2EJR A;  5F1R A;  3PL8 A;  1I5Z A;  3DWL E;  2EA2 A;  2IA0 A;  5E1X A;  3U1D A;  4EV0 A;  5J4V A;  2LK2 A;  2DMU A;  3F8N A;  2DK5 A;  2XAQ A;  2O8X A;  1JHF A;  5H2F C;  1WI9 A;  1XSD A;  2JVH A;  2W7N A;  2STW A;  2P4W A;  2COB A;  3MCZ A;  2GA1 A;  1ITY A;  4AYB N;  3M1E A;  2H27 A;  3BZK A;  3H3Z A;  5E20 A;  1KZH A;  4FCY A;  4M72 A;  1RKW A;  1P9Q C;  5FKL A;  2CUF A;  2R7Q A;  4U87 A;  3S1R J;  1ZG5 A;  2E5N A;  1ZN2 A;  2JN6 A;  1JHH A;  3MZY A;  4B09 A;  3LMM A;  1KU3 A;  2RKH A;  2LFB A;  3CP2 A;  2JT1 A;  2VAS A;  3FBI B;  1M1E B;  1MNM C;  5C4X J;  3I64 A;  4IKF A;  3HKZ A;  4C3H J;  4IRG A;  2CH0 A;  3CCJ I;  4WXH A;  4ITV A;  1U9O A;  1OFC X;  4P55 A;  2WC2 A;  5FRN A;  2CYY A;  1IV6 A;  3Q0V A;  1D0Y A;  1RR8 C;  5E18 F;  1YTY A;  3PNV A;  5IT9 K;  3BZC A;  3SEQ A;  1QZY A;  2GXA A;  1S7O A;  2XAJ A;  3QP5 A;  3MAJ A;  1RET A;  3GTP J;  1MBK A;  1UST A;  3AL0 B;  3RQ4 A;  5FRO A;  3O2P E;  2LC2 A;  4EM1 A;  2V9V A;  1B9N A;  2QQ9 A;  5K7H A;  4ZYD A;  2JA7 J;  2ZJQ F;  3K4J A;  2K27 A;  1HW1 A;  1T6S A;  3S32 A;  1LFU P;  3ZQL A;  2HR3 A;  3I58 A;  2KJC A;  2KT0 A;  3LQR A;  4RM2 A;  4BQQ A;  1RZ4 A;  2ZSH B;  2I5U A;  5CVI A;  3OYM A;  1VQM I;  4C3I J;  4EGZ A;  4LD5 A;  1MMD A;  2BVL A;  2VKH A;  3CDI A;  3RI4 A;  1T8I A;  4MTD A;  2WAQ A;  2PMU A;  1Z9C A;  5CLS A;  5CVU A;  2K7L A;  4M9S A;  3DPL C;  4PJ0 C;  4FQG A;  1WFX A;  1IW7 F;  2O7O A;  4F7Z A;  3GZ5 A;  3ELK A;  4U88 A;  2DFE A;  5FD6 A;  2JPB A;  4DYQ A;  4MEX F;  3I59 A;  3AG3 H;  4RA2 A;  2PN6 A;  2VBX A;  2AQE A;  3I0T A;  1T0F A;  2IPQ X;  3IAS 2;  3BDD A;  1QPI A;  2CW0 F;  1IV8 A;  1XGO A;  2CW8 A;  2JK3 A;  4LK0 F;  4A3G J;  1YX5 A;  4UB8 C;  1JKQ C;  3LA7 A;  1VQ7 I;  2M30 A;  2CJJ A;  3TQN A;  3J80 Z;  3OR1 C;  1S5L C;  5LHH A;  5HLT A;  4X0G A;  5FO5 A;  3GLX A;  1TWG J;  4A12 A;  5FLX K;  2JRM A;  3EYI A;  2LKX A;  2L7M P;  1DU0 A;  2BY2 A;  2E1M B;  3CJN A;  3LSJ A;  4FX0 A;  5HNH A;  5C4J J;  1G6N A;  2Z33 A;  1REP C;  3F0C A;  2CFO A;  4KIC A;  4CUG A;  2BYV E;  5DCF A;  3WGH A;  3D5L A;  5F27 A;  3DF8 A;  3WE2 A;  3AKZ A;  2E7X A;  3KZI C;  3I4M J;  2ADU A;  4IJA A;  2BZT A;  2NS0 A;  1FTZ A;  2EFP A;  3BR6 A;  3WHC A;  2CGP A;  2HS5 A;  2IAI A;  1QHH D;  1ZG3 A;  3PSF A;  3CCE I;  3EPZ A;  2PJP A;  4KA4 A;  1BR4 A;  2M7A A;  5HDN A;  1AA7 A;  1F9N A;  2MFZ A;  1QVT A;  2YR2 A;  3Q9V A;  3WHB A;  3HRT A;  3S14 J;  1DPR A;  3RCO A;  4AVP A;  2XKO A;  3JSO A;  3A0B C;  3I59 B;  4A0Z A;  4KDP A;  2VPL A;  2MC4 A;  4YIF A;  1BC7 C;  4YII A;  5D8L B;  3L1P A;  1XS9 A;  3E6M A;  3FXK A;  3IV5 A;  3B73 A;  2A6H F;  2EK5 A;  1XTA A;  4A6D A;  2JA8 J;  1XDS A;  5LGT A;  3GFL A;  3BPX A;  1HKT A;  2DT5 A;  4AYB A;  2BXY A;  2PG4 A;  5CYV A;  1D5Y A;  3RDI A;  2ECB A;  4ZYH A;  4UHT A;  4XLE A;  4BS9 A;  4I0A A;  1WVR A;  1IJW C;  5L3C A;  1N78 A;  2L9V A;  1UHS A;  1ETY A;  2FRH A;  5F08 A;  2ESH A;  1R00 A;  1NK3 P;  3K7A J;  4IF4 A;  1YJW I;  1RRJ A;  6PAX A;  2V9P A;  4U0W A;  2QCO A;  4YFX F;  1TLH B;  5BMZ A;  1ZGJ A;  5CVV A;  4XLN F;  1ETV A;  1WCM J;  3DEU A;  4L0Z B;  4ENN A;  1L0O C;  5GPC A;  4A6E A;  3TW7 A;  3DBL B;  1VQL I;  1D0X A;  2DQL A;  3H5R A;  4DZP A;  2B9S A;  4GFB A;  3JSP A;  4XLA A;  3DTK A;  3TO9 A;  2WAF A;  3NEU A;  3PQK A;  2MG4 A;  1KU9 A;  1U5T C;  2IBD A;  4M3G A;  3CCR I;  4PJJ A;  1WJD A;  2YUS A;  4Z6Y A;  2X1D A;  3K4K A;  4AWX B;  5LD2 C;  2UUZ A;  1UAA A;  3IP4 B;  1TL8 A;  2E7W A;  4BQA A;  5JFR A;  3KYC B;  1ZH5 A;  4HSR A;  1LE8 A;  3QPL A;  1O7L A;  4YIR X;  3L00 A;  4IHV A;  1IXS B;  5FKM A;  3HBL A;  3J7Y J;  3FIS A;  2VQH A;  2B7E A;  2UXX A;  1KA8 A;  1XSX A;  3MZH A;  2JQ7 A;  4RMN A;  1I27 A;  2DPD A;  2CV1 A;  4OAZ A;  3UKG A;  4HX4 A;  3N05 A;  5L3B A;  4EJU A;  3OSG A;  1HQC A;  1I6H J;  2DW4 A;  3A03 A;  3L2R A;  2OTJ I;  2BVM A;  2L02 A;  3IWF A;  3G3Z A;  4JQF A;  1TWC J;  3S3M A;  2X9D A;  1U8B A;  2M9H A;  2NOG A;  1MNE A;  1ZR4 A;  3FF5 A;  5TIS C;  4BU2 A;  2JTV A;  4PK4 A;  2DT7 B;  2AHQ A;  4LFU A;  2KMU A;  5M3M J;  2K3P A;  3WOD F;  4UVC A;  3S8P A;  4HDV A;  4IQ4 A;  3CZ6 A;  3FXL A;  4L5I A;  1IO2 A;  3O8G A;  1W0T A;  3FX3 A;  1W36 D;  1V5G A;  2DTZ A;  1Z7L A;  4AUX A;  1WGX A;  2OQR A;  1WJB A;  2ZJP F;  2W85 A;  1KQ9 A;  4PGH A;  1XDU A;  1GT0 C;  5GP9 A;  5IP6 A;  2EFW A;  2ZC2 A;  1Z3X A;  2K4J A;  5F04 A;  3PFY A;  1U2W A;  1APL C;  4H4K C;  4UXN A;  4KN4 X;  3F22 A;  3BQY A;  2UWM A;  3IHU A;  5GAH J;  1HA8 A;  1Y39 A;  4KIS A;  1LPQ A;  4MQV A;  5J8C A;  2VBZ A;  2IGO A;  2Q2E A;  3VYU B;  1LE8 B;  1AU7 A;  3ZMS A;  2MAB A;  2LLK A;  2GOM A;  3MD2 A;  3TED A;  4II3 A;  5CVR A;  3P9K A;  3A2K A;  1ZKG A;  2WA0 A;  4LJZ F;  3G71 I;  3HB9 A;  2E2H J;  5LRR A;  3S3O A;  2LKS A;  4R1H A;  2FD5 A;  3A01 A;  1ONV A;  2ZJ2 A;  4ZZD A;  5JR3 A;  1I6X A;  4IRI A;  2Z5U A;  3HPH A;  1MGT A;  3BT9 A;  1U3E M;  2NS8 A;  4XSZ F;  1OIS A;  1SFK A;  1O4X A;  3GUD A;  3UNG C;  2GIZ A;  4M3D A;  3NRV A;  1DGR M;  3FM5 A;  1ZEL A;  2R3S A;  3RPU D;  1X2N A;  4XRS A;  2DA4 A;  3OIO A;  1R9T J;  1KON A;  3VYR B;  2LH9 A;  3VOD A;  5FKO A;  2JUC A;  1G3T A;  5HLG A;  1G3W A;  3LWF A;  3QYB A;  4C2U A;  1AKH A;  2W1O A;  3OOP A;  3NWT A;  4OIP F;  4IEJ A;  3K4B A;  3NAU A;  4PCQ A;  4S05 A;  5JHF A;  4RLF A;  3L2U A;  4ASN A;  3RPU A;  5D4S A;  2O5R A;  4ZC3 A;  3ECO A;  5LGU A;  2ZNY A;  1YX3 A;  4RLQ A;  3LAJ A;  4QIW N;  4E7H A;  3TKY A;  2DXI A;  3QQA A;  1LB2 A;  4S0H B;  4KIT B;  2HU9 A;  1R5H A;  2MH9 A;  2WTE A;  4O5V A;  2FXA A;  2FBH A;  5HS8 A;  1F1Z A;  2Q2E B;  3VFZ A;  2YU3 A;  4BEH A;  3B6C A;  2EFO A;  2DT6 A;  4EJT A;  2NNN A;  3ZMD A;  3S16 J;  5ICF A;  2KHM A;  3A01 B;  2VJI A;  4GGG A;  2NVU B;  5D5U B;  1A6Q A;  2QEX I;  1S29 A;  3ZN0 A;  2OTL I;  1BW6 A;  2MYS A;  3I53 A;  2EIJ H;  1ORK A;  1XC5 A;  3ABK H;  3NAR A;  3F23 A;  3D5R C;  4B47 A;  2Q0O A;  1O3Q A;  4BY1 J;  2EZH A;  3M8F A;  2QQ8 A;  1ZGA A;  2ID6 A;  3HG9 A;  1U6G A;  4I6Z A;  1IAW A;  2Y75 A;  4HV5 A;  3CCL I;  3E0J B;  4D5F A;  1HXD A;  4L0Y B;  2VB6 A;  3PNT A;  4ESJ A;  4NC7 A;  3IUO A;  5BPI A;  3FK7 A;  4ZYA A;  2IS6 A;  1I1G A;  1IG7 A;  2KZG A;  3ECH A;  3ASN H;  3EDP A;  3F6V A;  2GXG A;  1AKH B;  4ZZL A;  4ZJZ A;  3HEF A;  1A35 A;  1G59 A;  2JWT A;  2FE3 A;  1IN6 A;  1R22 A;  2K9Q A;  1V55 H;  2G7U A;  2H8W A;  3ESW B;  2LOO A;  4I7H A;  4L9V A;  4UNO A;  3PFI A;  2A5W A;  2HZD A;  2Y0M A;  2K9S A;  1V54 H;  1X1D A;  3K2A A;  5GTI C;  3FBN B;  2XRO A;  4Y17 A;  2HDD A;  2O3F A;  1SC7 A;  4HLX A;  3KFW X;  5J6X A;  4BEH B;  4KN7 X;  3ZQH A;  5D5X B;  2HQA A;  1AHD P;  2R5Y A;  5CQE A;  1X1P A;  3HL2 A;  1FC3 A;  2H6B A;  1XMA A;  5H6R A;  3OIQ A;  4LB5 A;  1EH6 A;  2KFD A;  3VYT B;  1TT0 A;  2DJI A;  3O8H A;  1DP7 P;  1ZHF A;  3FHZ A;  1VQ6 I;  1ON1 A;  2F48 A;  2FF4 A;  3OOU A;  3EUH A;  2V6C A;  1D1B A;  4V2F A;  1JE8 A;  2KJB A;  2RDP A;  1FTT A;  2Z16 A;  3JTG A;  1KQ8 A;  4WXD A;  4BQO A;  3GZN B;  4RGX A;  3A0H C;  2QF7 A;  4BJ5 C;  5DDG A;  3VPR A;  2E2J J;  4DYC A;  4HNV A;  4NBQ A;  3PSI A;  1C0W A;  5D5V B;  3CUQ C;  3W3C A;  4QLC U;  5EEA A;  4JX6 A;  1RR7 A;  1W5S A;  3OR2 C;  3C2G A;  3I55 I;  2OU2 A;  1JKO C;  3HOY J;  2VQL A;  2ZXW H;  5M5Y J;  2Z2S B;  3O3K A;  2OV7 A;  4XOR A;  1ETW A;  2D5V A;  4HX8 A;  4WXC A;  5E17 F;  2DCE A;  3GME A;  4EM0 B;  3DTE A;  2A07 F;  4Q5S F;  2IGK A;  3KX2 A;  1P4X A;  1HDP A;  4XRM A;  2BHY A;  4D0P A;  1UMQ A;  1S3J A;  3KP2 A;  2R7X A;  1J9I A;  1MW7 A;  4BE2 A;  1YE9 A;  2EWN A;  3ERM A;  1BA5 A;  2F5D A;  1Z3Y A;  3FXQ A;  1FWZ A;  3K70 D;  4RAG A;  2R5Y B;  1LQ1 A;  5J1Y A;  3CMM A;  3WTW C;  3FZV A;  5FRM A;  4GYG A;  2ELJ A;  3E1S A;  1QVU A;  2AQF A;  2KRH A;  3M07 A;  2XGE A;  2VOO A;  3M3Y J;  1XN7 A;  3E6B A;  3KZZ A;  1SFU A;  1QPM A;  1FJL A;  4UVA A;  5GAG J;  4EEF G;  2BGC A;  1K83 J;  2WY8 Q;  1SD6 A;  4NC8 A;  3S17 J;  2CUE A;  2P5K A;  3F9K A;  1O3S A;  2CV0 A;  3Q9S A;  3H5N A;  3LSH A;  4AM3 A;  2DOE A;  2Y9Y A;  3WGG A;  1K6Y A;  3HSR A;  4ANJ A;  4XLH A;  1OCO H;  2L7K A;  4DW6 A;  2E2I J;  5E3N A;  2I8D A;  4G6T B;  1GVD A;  1VQ4 I;  2NYX A;  1R5G A;  1FOX A;  3OS1 A;  1FT9 A;  5ILS A;  3QOP A;  4CA0 A;  2DOA A;  3OYN A;  1J0R A;  3ZMV A;  2R7T A;  2VUM J;  2E1O A;  1HW2 A;  5DUK A;  3ZMU A;  2R7R A;  3HOU J;  1POG A;  4EVI A;  2LY9 A;  4HST A;  3GFI A;  2K9L A;  3GTM J;  4YEL A;  1I1S A;  5TGT A;  3T0Y A;  1DQU A;  3HM5 A;  3E3V A;  5IPA A;  4II2 A;  1OKR A;  3H36 A;  4DBR A;  2VXD A;  2XB0 X;  4O6J A;  2R93 J;  5J8F A;  3RZD J;  1MKM A;  1MH4 A;  3DFG A;  3ZOB A;  2LVS A;  2LDU A;  3CMA I;  4HF2 A;  2V7F A;  5LLQ A;  3SZG A;  3H92 A;  2PQ8 A;  3HRS A;  2XAU A;  4KUM A;  4CH7 A;  3RZO J;  2PI0 A;  3CCM I;  2VQG A;  3R60 A;  2COM A;  2KZV A;  1L3L A;  3ROU A;  5KNL A;  1R71 A;  1E3P A;  2KRF A;  3OYH A;  5IYD J;  1BIA A;  4L5E A;  2JSP A;  1ZRC A;  3H9Q A;  1JGG A;  3G4S I;  1XGS A;  2X1E A;  2VC0 A;  4OAY A;  2XRL A;  4JK1 X;  1VQO I;  4G7O F;  3OV8 A;  2GIV A;  2LF8 A;  3G1O A;  2XHK A;  4HRI A;  1H9T A;  1P6R A;  3OYI A;  2ZXI A;  1IN7 A;  1N25 A;  1FOW A;  3FKI J;  1X3Z B;  1R6R A;  2XVC A;  3BPV A;  3QPT A;  4AVZ A;  4ZDL A;  2MH2 A;  2KIU A;  3LNQ A;  3BRO A;  3PNY A;  4IX7 A;  1F36 A;  2OQG A;  2FOW A;  1WJE A;  4L9N A;  2L5Q A;  3OYB A;  4DGW B;  2RNG A;  1SAN A;  3R4K A;  3KE2 A;  3HOS A;  2MGQ A;  3QWL A;  2FA5 A;  3GVA A;  5GPA A;  3TL4 X;  2P0W A;  1MBF A;  3S1Q J;  2JRT A;  4P1W A;  2WAE A;  2ZSI B;  2WY7 Q;  3PQJ A;  5F6F A;  2CQ7 A;  2LD5 A;  2QWW A;  4XM3 A;  1BI3 A;  3EQL F;  1UEL B;  2LSO A;  3EUA A;  3L09 A;  4J01 A;  3QU3 A;  2ELK A;  2XAH A;  3W6V A;  2Z1D A;  1MMA A;  1JT6 A;  3FK6 A;  4XR6 A;  3UR3 C;  3QP6 A;  3H3U A;  1FZP B;  2OA4 A;  1BI1 A;  4RB1 A;  3BR2 A;  4BDZ A;  1UCR A;  4MLO A;  2YX4 A;  2R7F A;  3MKW B;  1HBX G;  1EA3 A;  2VBY A;  4LMY A;  1IXR C;  1VQK I;  3JAM Z;  2LRE A;  3IRQ A;  4PUS A;  4RGU A;  4LLL A;  1BW5 A;  1IN5 A;  2BOL A;  5K7F A;  3KIO A;  4F93 B;  4N9H A;  4A3C J;  4BY7 J;  1T38 A;  2H1K A;  2GWR A;  1UHW A;  2NXN B;  4XIC A;  4PZJ A;  1E3H A;  1ZLJ A;  1A5J A;  2NVX J;  1ULY A;  4HF1 A;  1LNW A;  2R5Z A;  4IRH A;  2V1D A;  3HGG A;  2FQ4 A;  3OIP A;  3T8T A;  2HPI A;  3BG3 A;  2NNY A;  2L7Z A;  3OYE A;  2VC1 A;  2R7S A;  4Q47 A;  4CO8 A;  5LRS A;  2JMW A;  2X51 A;  2DYS H;  3DBH B;  2L0K A;  3V4G A;  1JUP A;  3BY6 A;  2XKP A;  3HTU A;  3RQI A;  4KMU X;  1D1A A;  4RM3 A;  4A3F J;  2VJ5 A;  1SVM A;  2HOT A;  2LF7 A;  1LDJ A;  2QUF A;  3S1N J;  2XGX A;  1FYL A;  2TCT A;  1FBS A;  2HOE A;  3LSI A;  2VON A;  4KT6 A;  2HFH A;  3V8L A;  1D5V A;  2LY2 A;  1IDZ A;  4LB6 B;  1SEU A;  4G8X A;  3PO2 J;  3LST A;  5L3E A;  3BWG A;  4ETS A;  1U0J A;  2IVM A;  1TP4 A;  5EDN A;  3DTI A;  2DTR A;  3ZQC A;  1RES A;  2V1N A;  5M5W J;  2JZY A;  1GV5 A;  4Y7N J;  3S93 A;  4QPQ A;  4A5M A;  1BBY A;  2ESN A;  2HTS A;  1AWC A;  4MIM A;  1QZZ A;  1W0U A;  4UV8 A;  1OYI A;  4E7S A;  4M71 A;  3OY9 A;  2EFN A;  1Y8R B;  4PGG A;  3R6S A;  5KAI C;  1XGM A;  2JVG A;  2BY1 A;  3AL0 C;  5IY5 H;  2MSY A;  2L4A A;  1ZAO A;  2OF7 A;  1V3F A;  1TC3 C;  3PJR A;  3WU0 A;  3BR0 A;  1YIO A;  3OYA A;  1BIB A;  1XCB A;  2R5Z B;  5F1J A;  1JJ8 C;  3LSM A;  3W2V A;  1NK2 P;  3M8J A;  1U8R A;  1FOK A;  2K85 A;  3F72 A;  2LY1 A;  2JUG A;  1UJ8 A;  4CZZ A;  1SD5 A;  2HVS A;  3EET A;  2M45 A;  5DM7 F;  3CC2 I;  2ZJR F;  3GCM A;  2HTJ A;  1PP7 U;  1EF4 A;  3K10 A;  4DNC A;  2XIG A;  1S6L A;  5BPD A;  5JI6 A;  2WV1 A;  3PUF A;  1Z6R A;  5AIQ A;  4BBR J;  1DGW Y;  3CF2 A;  2ME0 A;  5LBQ A;  3NQO A;  5ERI A;  3HDD A;  4EAT A;  4FTH A;  3ZPL A;  1VF9 A;  3TP0 A;  2XPW A;  2Z3Y A;  1FP1 D;  4UV9 A;  4XBF A;  1Z67 A;  2W00 A;  2VIX A;  3SJM A;  3G73 A;  4Y4R A;  2QLZ A;  2M1B A;  1EH8 A;  3SZP A;  4KIB A;  1OMI A;  2H1L A;  4KFC A;  1ENH A;  2K3F A;  3OYG A;  2JA5 J;  2XAG A;  2VQC A;  1MBE A;  3IH4 A;  1LFB A;  5ED4 A;  2M0C A;  5IT9 Z;  3H0G J;  2XF5 A;  2MLG A;  3V7C A;  1KYW A;  2FU4 A;  2E1M C;  4IL6 C;  3BTI A;  1WKM A;  2CQK A;  3D0S A;  3AFH A;  5LGN A;  4F92 B;  5EZG A;  4PJN A;  4A3I J;  4LG0 A;  2M4K A;  3OYK A;  3E5Q A;  2X4H A;  2OJE D;  4RAY A;  1QBJ A;  3HOV J;  2C6Y A;  2GQQ A;  3HOT A;  2O9L A;  2B63 J;  4CYC A;  2W57 A;  2XAF A;  4M9X A;  4L18 B;  2ID3 A;  2JJ7 A;  4FE7 A;  2D45 A;  2GLO A;  2A61 A;  3U9G A;  2QA4 I;  4AD9 A;  3MEX A;  2Y69 H;  2MBF A;  2Q8K A;  3FMQ A;  2EQR A;  2GBY A;  2DA3 A;  3FKJ A;  2I10 A;  3VEP A;  3MMY B;  3WTY C;  4EGY A;  3JRA A;  3G1L A;  4JP0 A;  4M3E A;  4U0V A;  3F8M A;  2A3S A;  1NG6 A;  2AXL A;  4BXF A;  1TQP A;  3IWZ A;  4EJW A;  1T0F C;  4M3F A;  4A3E J;  1KU2 A;  4G9Y A;  5JLX A;  1B1B A;  3VDX A;  4LIT A;  3CQZ J;  2HXO A;  4C3J J;  3FIW A;  3WE3 A;  1LVA A;  5BNG A;  2QGU A;  2R7W A;  4XSX F;  5JVG F;  1SVO A;  2VPR A;  1I3Q J;  2OC6 A;  1VQP I;  3CDH A;  4O3M A;  3CP8 A;  1RKT A;  1SVL A;  3I56 I;  5FLX Z;  1WWX A;  1LDK B;  3CO6 C;  1ZG1 A;  1MIJ A;  1O3T A;  4CDG A;  1FY7 A;  3PM1 A; 
#chains in the Genus database with same CATH homology
 3Q3S A;  4V2G A;  4D5F A;  3JR9 A;  1ETK A;  1Y1W J;  1JKP C;  3H3V K;  3BQZ A;  3Q0W A;  5JLW A;  4W97 A;  4UUT A;  2P81 A;  3FK7 A;  1B72 B;  1H88 C;  2WAQ N;  1IG7 A;  1IRZ A;  1WPK A;  2ZB9 A;  3JRH A;  2EZL A;  3JRI A;  1HF0 A;  1AKH B;  5K7Z A;  1MBJ A;  3HEF A;  1MBG A;  2XB5 A;  5EG0 B;  2JWT A;  1JTY A;  2K9Q A;  4CYC B;  2AO9 A;  2CQX A;  5F0H A;  4XK4 A;  1WI3 A;  3S2D J;  2K9S A;  2HQ5 A;  2DMT A;  3K2A A;  1OCT C;  2Y0S N;  3QPS A;  4XID A;  3DEW A;  3RKQ A;  2HDD A;  1F43 A;  2DMQ A;  4DYR A;  1A6I A;  3BTJ A;  5E3O A;  1YRN A;  4NDL A;  3ZQH A;  1B8I A;  2NVT J;  4A69 C;  2R5Y A;  1AHD P;  4B3A A;  2DMP A;  5EF6 A;  2H8R A;  3JRB A;  3SDG A;  3O8H A;  2TRT A;  4C2M J;  1GUU A;  1QRY A;  3OOU A;  2XPV A;  5DS9 A;  3TP3 A;  4IHW A;  4JX4 A;  4V2F A;  1FTT A;  5J3L A;  2VI6 A;  3MN2 A;  1CQT A;  1NTC A;  1H89 C;  3CCY A;  1WH5 A;  2QF7 A;  4LOC A;  5IOY A;  5J1U A;  3VPR A;  2E2J J;  2HOA A;  4DYC A;  4HNV A;  3BG9 A;  5EEA A;  2XGD A;  4JX6 A;  1RR7 A;  2YS9 A;  4FIS A;  2R92 J;  4I76 A;  3MKL A;  5IOZ A;  1JKO C;  5EZH A;  3HOY J;  1Q1V A;  5M5Y J;  4A3B J;  1ETW A;  2D5V A;  1P7J A;  3HOW J;  4A3D J;  1U9N A;  2DMU A;  2LK2 A;  3CDL A;  4B4C A;  2EBI A;  4AC0 A;  1HDP A;  4XRM A;  4A3K J;  1T56 A;  4A3M J;  1UMQ A;  1SFO J;  2COB A;  5HOD A;  3S15 J;  2FX0 A;  4M6V A;  5DTD A;  4AYB N;  1BA5 A;  1ITY A;  2DA6 A;  2XSD C;  1YRN B;  4FCY A;  1B8I B;  1RKW A;  2R5Y B;  1JKR C;  5FKL A;  2O8K A;  2CUF A;  5J1Y A;  3BTC A;  3S1R J;  1IDY A;  2JN6 A;  1Y1V J;  3LSR A;  1QVU A;  2XGE A;  1PUF A;  2LFB A;  3M3Y J;  1MNM C;  1FJL A;  1GDT A;  5C4X J;  4D7N A;  4EEF G;  1K83 J;  4C3H J;  3S17 J;  2CUE A;  4Y52 J;  5C3E J;  1X2M A;  1U9O A;  1OFC X;  2KDZ A;  1IV6 A;  3Q0V A;  2Y9Y A;  1U78 A;  3I4N J;  2K40 A;  5F0F A;  2LP0 A;  4DW6 A;  2E2I J;  5E3N A;  1UG2 A;  1RET A;  3GTP J;  1GVD A;  1VFC A;  1MBK A;  1IGN A;  2JA7 J;  5K7H A;  1LFU P;  2VUM J;  2E1O A;  5FKN A;  3ZQL A;  2HOS A;  4ABZ A;  2KT0 A;  3HOU J;  1POG A;  2Y30 A;  1I50 J;  2LY9 A;  3OSF A;  1HCR A;  4MFE A;  4C3I J;  1MSF C;  4D7M A;  3GTM J;  1E3O C;  3HM5 A;  3BR1 A;  2HYJ A;  5IPA A;  4W1U A;  5J1R A;  2XB0 X;  1P7I A;  2O7O A;  3ZQG A;  2R93 J;  3RZD J;  1MH4 A;  1VI0 A;  2MW8 A;  3ZOB A;  2LVS A;  4DYQ A;  2LTP A;  1T33 A;  1ZGW A;  1QPI A;  3JRC A;  2JK3 A;  4A3G J;  3RZO J;  2NS7 A;  1PUF B;  1JKQ C;  3BG5 A;  4B1R A;  1BJZ A;  2CJJ A;  2FJ1 A;  2HXI A;  5IYD J;  4L5E A;  1TWG J;  3DCF A;  2LKX A;  2L7M P;  1DU0 A;  1JJ6 C;  2E19 A;  1JGG A;  1HOM A;  2M8G X;  4BXX J;  3LSJ A;  2XRL A;  5C4J J;  3G1O A;  3F0C A;  5FKK A;  4RBO A;  2XPU A;  3FKI J;  5EYR A;  5F27 A;  4M3B A;  2G0E A;  4J19 A;  3I4M J;  3LNQ A;  2Y9Z A;  5M5X J;  1FTZ A;  3BR6 A;  1F36 A;  3WHC A;  5FLV A;  1JUS A;  2IAI A;  1SAN A;  5EGO A;  1QVT A;  3JRD A;  2MGQ A;  3WHB A;  5GPA A;  3S14 J;  1MBF A;  4MO7 A;  3CMY A;  3S1Q J;  1ZR2 A;  1IC8 A;  1XS9 A;  3L1P A;  1WH7 A;  2LD5 A;  3S2H J;  2CQQ A;  3IV5 A;  1MH3 A;  2NVY J;  4X1E A;  3JRG A;  2JA8 J;  3SFI A;  2ELK A;  3W6V A;  3PO3 J;  3IH3 A;  5E3M A;  1JT6 A;  3FK6 A;  4G12 A;  2ECC A;  1D5Y A;  2R0Q C;  3GTG J;  2ECB A;  3LSP A;  2DA7 A;  3BR2 A;  4MLO A;  1IJW C;  5F08 A;  1UHS A;  1ETY A;  3D1N I;  2JA6 J;  2OPT A;  1NK3 P;  3K7A J;  1BL0 A;  2R7Z J;  1TWA J;  3C2B A;  1JT0 A;  1MBH A;  2QCO A;  4JYK A;  1OCP A;  3E7L A;  2NVQ J;  1BW5 A;  5K7F A;  1FIP A;  1ETV A;  1WCM J;  3HOZ J;  4A3C J;  1ETO A;  1ETQ A;  4BY7 J;  5GPC A;  1ETX A;  2H1K A;  2DA1 A;  3GTL J;  4XIC A;  1X58 A;  3TW7 A;  1A5J A;  1Z77 A;  2NVX J;  2K9N A;  4DZP A;  3IH2 A;  2R5Z A;  4GFB A;  2Y31 A;  3HOX J;  3BR5 A;  3HGG A;  2FQ4 A;  2MG4 A;  4M3G A;  2IBD A;  3BG3 A;  2DN0 A;  2L7Z A;  2YUS A;  4X6A J;  2DA2 A;  2ME6 A;  3Q0U A;  4BKX A;  2JMW A;  3GTK J;  2XGC A;  2RAE A;  2L0K A;  5EGO B;  1JUP A;  3RQI A;  1ZK8 A;  2YU9 J;  3M4O J;  4A3F J;  2DMN A;  3BR3 A;  4RDU A;  2HOT A;  1LE8 A;  3QPL A;  1XG1 A;  4IHV A;  5FKM A;  3HBL A;  3S1N J;  3FIS A;  2TCT A;  3JRF A;  4A93 J;  2VKE A;  3UKG A;  5IYC J;  1IDZ A;  2CU7 A;  3OSG A;  3PO2 J;  2Y2Z A;  1I6H J;  3A03 A;  5EDN A;  5M3F J;  3ZQC A;  1RES A;  5M5W J;  1TWC J;  1GV5 A;  2X9D A;  1U8B A;  4Y7N J;  2M9H A;  4IHX A;  2DA5 A;  2NOG A;  4MFD A;  4UUS A;  1ZR4 A;  1OJL A;  4MIM A;  1Z0X A;  2W48 A;  1W0U A;  5M3M J;  2WB1 N;  2AHQ A;  3MVP A;  4BBS J;  1JUM A;  1TWF J;  1W0T A;  5IYB J;  3O8G A;  2DTZ A;  4AUX A;  1GV2 A;  1WGX A;  3TW6 A;  2MSY A;  2OF7 A;  1RPW A;  1GT0 C;  1TC3 C;  2X48 A;  5IP9 J;  3BR0 A;  5GP9 A;  5IP6 A;  2R5Z B;  3ZQF A;  5F1J A;  1JJ8 C;  5E3L A;  1NK2 P;  5F04 A;  2PMZ N;  1FIA A;  3B6A A;  1APL C;  3LOC A;  1HDD C;  3BQY A;  3A02 A;  2IEK A;  1K61 A;  1EF4 A;  4DZJ A;  1LE8 B;  1AU7 A;  2LLK A;  2WV1 A;  3TED A;  4BBR J;  4A3J J;  3GTJ J;  2ME0 A;  1ZTR A;  3HDD A;  1DU6 A;  4XRS G;  4FTH A;  1VF9 A;  1ZKG A;  3TP0 A;  1HLV A;  2XPW A;  3HB9 A;  2E2H J;  2FD5 A;  3A01 A;  1S7E A;  3SJM A;  3LSG A;  3GTO J;  3BT9 A;  1ZQ3 P;  2GM4 A;  2NS8 A;  1ENH A;  1TWH J;  2HI3 A;  1VND A;  2JA5 J;  3IH4 A;  1MBE A;  4FE4 A;  1O4X A;  1LFB A;  2M0C A;  4M3D A;  3H0G J;  2EH3 A;  4UUS B;  1X2N A;  4XRS A;  2DA4 A;  3BTI A;  3HGY A;  2DJN A;  3OIO A;  3ZQI A;  2VKV A;  1R9T J;  1B72 A;  5EZG A;  4A3I J;  5FKO A;  5IP7 J;  1AKH A;  3HOV J;  4IEJ A;  3NAU A;  5EG0 A;  2O9L A;  2B63 J;  2N8G A;  5FLM J;  1JTX A;  4CYC A;  2CRG A;  3BTL A;  2ID3 A;  2M2E A;  2EZK A;  2JJ7 A;  4FE7 A;  2GLO A;  2EZI A;  4QIW N;  2LR8 A;  4QSH A;  1H8A C;  3QQA A;  2EQR A;  4S0H B;  2GBY A;  2DA3 A;  2I10 A;  3GBG A;  3S1M J;  3JRA A;  3G1L A;  4JP0 A;  4M3E A;  2M34 A;  4D5C A;  3G1M A;  3B6C A;  3HKZ N;  1FEX A;  1IUF A;  1G2H A;  4M3F A;  5C44 J;  4A3E J;  3S16 J;  5JLX A;  2L7F P;  9ANT A;  3CQZ J;  2HXO A;  3GTQ J;  4C3J J;  3A01 B;  3FIW A;  4IHY A;  5BNG A;  1BW6 A;  2VPR A;  1I3Q J;  5FJ8 J;  4A3L J;  2L9R A;  1MSE C;  2X6O A;  1RKT A;  1ORK A;  1XC5 A;  4JX5 A;  4QTR A;  3NAR A;  3JRE A;  5F0C A;  4BY1 J;  2EZH A;  3PM1 A;  2ID6 A;  4I6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...