2EZLA

Solution nmr structure of the ibeta subdomain of the mu end dna binding domain of phage mu transposase, 29 structures
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
b'MIARPTLEAHDYDREALWSKWDNASDSQRRLAEKWLPAVQAADEMLNQGISTKTAFATVAGHYQVSASTLRDKYYQVQKFAKPDWAAALVDGRGASRRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSPOSASE
publication title Solution structure of the Mu end DNA-binding ibeta subdomain of phage Mu transposase: modular DNA recognition by two tethered domains.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1997-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ezlA00
2O7OA 5FLVA 1TWFJ 1JKRC 1BA5A 4D7MA 1JJ8C 1YRNB 2DA3A 3G1LA 2XB0X 4AYBN 2FQ4A 5IP6A 3Q0WA 3BTIA 2CUEA 2FJ1A 4B1RA 2Y0SN 3A01B 2H1KA 5M3FJ 2HQ5A 1QVTA 1IDZA 1ZR2A 1WH5A 1CQTA 4C2MJ 2FD5A 3OSGA 5J1YA 2OPTA 3GTQJ 1JKPC 1LFUP 2PMZN 3G1MA 4DZJA 4A93J 2OF7A 4D5FA 2M0CA 4C3IJ 5FKNA 4Y52J 2DN0A 4FTHA 3HGYA 4UUSB 3OIOA 3B6CA 3CMYA 5JLWA 2QCOA 4DYCA 2QF7A 3SJMA 3JR9A 5IP9J 3HBLA 9ANTA 5F04A 1ITYA 3MVPA 3GTPJ 2XGDA 5F08A 2B63J 2VUMJ 2DA4A 2E1OA 3SFIA 3JRAA 1HCRA 3TW6A 5EF6A 4A3BJ 1ETQA 3BG3A 1LE8A 3HOYJ 2TRTA 4A3EJ 1GV2A 2K9QA 2R5ZB 1JJ6C 2E2IJ 1OFCX 4BKXA 1OCTC 5GP9A 5C4XJ 3BG9A 4BXXJ 1JUMA 3HB9A 2JA5J 1Y1VJ 3DEWA 2R93J 1ETVA 1VI0A 2L7MP 3S1MJ 2Y2ZA 3QQAA 5JLXA 5M5WJ 3BR5A 1SFOJ 4FISA 1TWAJ 2Y9YA 4A3JJ 1JTXA 4D7NA 4GFBA 3M4OJ 2HOSA 1Q1VA 2ID6A 4JX4A 2YS9A 1AKHA 4A3IJ 1X2NA 5IPAA 1MBKA 1ETWA 4M3EA 4XRSA 4I76A 2HXIA 4AUXA 2FX0A 3S1RJ 3BR0A 1POGA 2AHQA 4B3AA 2JK3A 3D1NI 5IYBJ 5F0HA 3ZQHA 4L5EA 3ZQCA 3MN2A 5IOYA 4EEFG 2R7ZJ 4C3HJ 1NK3P 2EZIA 4A3FJ 3S17J 1QVUA 3GTOJ 2TCTA 4A3MJ 3DCFA 2JMWA 2ME0A 2EQRA 1K83J 2E19A 3H3VK 1FEXA 1A6IA 1DU6A 1RETA 1TWGJ 2COBA 2R5YA 5BNGA 2NVYJ 3BR2A 3MKLA 3IH4A 3HOZJ 1PUFA 2W48A 4JP0A 2CQQA 5E3MA 3PO3J 2LLKA 2EBIA 1W0UA 5FKLA 1K61A 3LSRA 5EEAA 4IEJA 3ZQGA 5E3OA 3H0GJ 3IH3A 2ELKA 2L0KA 5M5XJ 1WCMJ 4FCYA 2Y30A 2MSYA 4JYKA 4S0HB 4XRMA 1LE8B 2MG4A 1IGNA 3BTJA 3UKGA 1RESA 3WHBA 5M3MJ 1ZKGA 3OSFA 3CQZJ 2DA6A 2YUSA 2XGEA 5EG0A 2ID3A 1EF4A 4ABZA 1JT0A 3RKQA 5IYCJ 2YU9J 4X6AJ 2XSDC 5E3NA 3Q3SA 5K7HA 2DMTA 2XGCA 1TWCJ 2LY9A 1XS9A 1JUSA 1AU7A 4DYQA 3JRBA 5FKOA 2IBDA 3CDLA 1GV5A 1RKWA 1Z77A 1Y1WJ 1H89C 2G0EA 5C4JJ 1B72A 3O8GA 2ME6A 2L7FP 2CRGA 1H88C 3BR3A 2ECBA 2EZLA 2H8RA 4JX6A 1GT0C 3RZOJ 4BY7J 1FTTA 1WPKA 3JRGA 3BG5A 3NARA 2EZKA 4M3FA 4BBSJ 2IEKA 5EYRA 4DZPA 5IP7J 1VFCA 1W0TA 1VF9A 3LSPA 3ZOBA 1JKOC 3Q0VA 2LTPA 2VI6A 4MIMA 4FE4A 4LOCA 2LFBA 1PUFB 5EGOA 2LD5A 2K9NA 3PM1A 2NOGA 4NDLA 4QTRA 2DA2A 2M8GX 3IH2A 1MNMC 5F27A 3LNQA 4B4CA 1MH3A 2CQXA 1MH4A 2JA8J 2RAEA 2M9HA 4DW6A 5HODA 2JWTA 2HOTA 1MBGA 2E2HJ 3A01A 3HOWJ 2DA7A 1ENHA 4I6ZA 1NK2P 3S15J 1UMQA 2CU7A 1AHDP 3K7AJ 4V2FA 3BQZA 4V2GA 1H8AC 4IHWA 2XPVA 4MFEA 4D5CA 5M5YJ 3CCYA 2JJ7A 1HLVA 3FIWA 3GTLJ 4XICA 1RR7A 2NS8A 3QPSA 4A3LJ 1I3QJ 4XIDA 3S16J 1IG7A 2LVSA 5EG0B 1MSFC 1U78A 5C3EJ 4A3GJ 4RDUA 4MLOA 4A3DJ 5DTDA 4RBOA 3ZQLA 2VKEA 2R92J 5K7ZA 1RKTA 3LSJA 2DA5A 2VPRA 1ETKA 2P81A 1HDDC 5IOZA 3FK7A 5J1RA 1APLC 3B6AA 2NVXJ 3RZDJ 2DMNA 4W97A 1A5JA 3JRFA 1GVDA 2DA1A 1U8BA 2R5ZA 3S1QJ 2HYJA 3HOVJ 5E3LA 1Z0XA 3S2HJ 5IYDJ 1B8IA 3IV5A 1HOMA 1JGGA 1B72B 4W1UA 2IAIA 2O8KA 5EZGA 3HGGA 5EZHA 3TW7A 2GBYA 1IRZA 1ZGWA 2MW8A 4MO7A 4M6VA 5K7FA 1FIAA 4A3CJ 1D5YA 1IJWC 3JREA 5DS9A 2HDDA 3LSGA 4JX5A 4J19A 1WI3A 5F0CA 1ZTRA 1X58A 2KDZA 3HDDA 2X48A 4A3KJ 2JA7J 4IHXA 1F36A 2N8GA 1QPIA 3M3YJ 3LOCA 4G12A 3OOUA 1S7EA 1SANA 1FIPA 2NS7A 1MBJA 5EGOB 1O4XA 5EDNA 4IHYA 3S2DJ 4CYCA 1MBEA 3G1OA 2X6OA 3HOUJ 1IC8A 3BTCA 1WH7A 2X9DA 3QPLA 3FKIJ 4FE7A 1G2HA 1XG1A 3HKZN 4QSHA 1TC3C 3Q0UA 2HXOA 4XK4A 1AKHB 2DMPA 2WV1A 3JRHA 2XB5A 3GTGJ 1ETOA 1BJZA 3GTJJ 1VNDA 2K9SA 2HI3A 3GTKJ 1UG2A 1T56A 3BTLA 1E3OC 3A03A 3C2BA 2XRLA 2L9RA 3WHCA 5FKKA 2L7ZA 1QRYA 2CJJA 2ECCA 5GPAA 3BT9A 5FLMJ 3HOXJ 3ZQFA 1FJLA 2M34A 3ZQIA 2NVQJ 1ORKA 3HEFA 4XRSG 1IUFA 4UUTA 2R5YB 2GLOA 2DJNA 5C44J 1MBHA 2GM4A 1JKQC 1HF0A 2CUFA 4MFDA 1JUPA 3JRCA 1YRNA 4X1EA 3I4NJ 5FKMA 5J3LA 4M3GA 3TP0A 2M2EA 1UHSA 2JN6A 2K40A 3BR1A 2O9LA 1I50J 2HOAA 4C3JJ 1B8IB 2XPUA 5FJ8J 2AO9A 5F1JA 2R0QC 2ZB9A 1ZQ3P 2E2JJ 3RQIA 1BW5A 1MBFA 1R9TJ 1F43A 1IV6A 1OJLA 2JA6J 3F0CA 1BL0A 1ZK8A 2EZHA 3TP3A 4IHVA 1P7JA 3W6VA 2I10A 4UUSA 1P7IA 1XC5A 2VKVA 4HNVA 1IDYA 1DU0A 4DYRA 1U9NA 4AC0A 2LR8A 2KT0A 2LKXA 3GBGA 5F0FA 2NVTJ 1LFBA 3VPRA 2Y9ZA 3L1PA 3S1NJ 3JRDA 2MGQA 4CYCB 3K2AA 1ETXA 1T33A 3GTMJ 3TEDA 3E7LA 1GUUA 4BBRJ 1HDPA 1TWHJ 2EH3A 3BQYA 2LK2A 4M3BA 2XPWA 5GPCA 1WGXA 3BR6A 3FISA 1OCPA 2DMQA 3I4MJ 3NAUA 4A69C 4M3DA 3A02A 5J1UA 4Y7NJ 1BW6A 3FK6A 1GDTA 4BY1J 2DTZA 2D5VA 1JT6A 1RPWA 1FTZA 1U9OA 1ZR4A 3S14J 1I6HJ 3HM5A 2LP0A 1MSEC 2DMUA 2Y31A 3JRIA 1X2MA 3SDGA 1NTCA 3O8HA 4QIWN 3PO2J 2WB1N 2WAQN 1ETYA 1JTYA
chains in the Genus database with same CATH superfamily
1UZCA 2O7OA 3H5NA 1JKRC 2HQRA 1JJ8C 3MZ8A 2ICWG 2PLYA 1IXRC 3OYJA 1DQUA 3SDBA 1BR4A 3CCVI 1N25A 4AU7A 3BDDA 1OYYA 2KLOA 2FJ1A 2Y0SN 1OCZH 1IO2A 3KZYA 2HQ5A 1MJAA 1WH5A 3OV8A 3LSMA 3OL4A 1G3YA 1STZA 4U88A 3EQLF 3OOPA 5J1YA 3GTQJ 2M4KA 1KYWA 4XNFA 5LBQA 4YFNF 2BEOA 3RJPA 4A0XA 3WTYC 1LDKB 3OWTA 2M0CA 3R4KA 2GIVA 2P6SA 3HKZA 4FTHA 3VYUB 3B6CA 4LD5A 4RM2A 2QCOA 1MMNA 2DQLA 5D6EA 3HBLA 3KP2A 2F4IA 4ZDLA 3GTPJ 2RNJA 2BGCA 1S29A 2DBBA 4F52A 3PFIA 3SFIA 3TW6A 4A0YA 5IT3A 1ETQA 3GX4X 4HSRA 2EFWA 2AS5F 2HPMA 2LC2A 2E5ZA 2QZ8A 3VYTB 3J80K 1FC3A 2E1CA 5GADJ 5CQEA 5F6FA 3TMOA 1K4SA 1V54H 1NG6A 4U87A 2DT5A 1G8XA 1SAXA 3HB9A 2JA5J 1Y1VJ 5KAFC 4HNUA 4IQJA 1YTYA 1O3QA 3K2ZA 4O5VA 3JCUC 1EA3A 5D5VB 3HOSA 2CV1A 3H9QA 1S3JA 1VQNI 4A3JJ 1BI2A 1RNLA 1O3SA 4BXUA 3OYIA 4KN4X 5DEQA 1XGMA 1BOBA 4D1QA 1MBKA 3T0YA 4PSXA 2DU9A 4M3EA 5HLIA 1TQMA 1U5TA 2V1XA 3OYGA 3MKWB 2ISZA 1W5CC 4HPQA 1E2XA 1XX5A 2FX0A 3BR0A 3IWZA 4G7OF 5CVRA 4G9YA 2R4GA 4B3AA 4PJLA 1R22A 3WTSC 5IYBJ 4L0ZB 3WU2C 3HHGA 3ZQCA 2HNHA 3CO7C 2JUCA 4BU2A 2E7WA 4EEFG 4AIJA 3CCEI 4ANJA 2HTSA 1EKEA 4A3MJ 3QPTA 3DCFA 2JMWA 3FM3A 2EPFA 3KEYA 3D5SC 1I27A 1K83J 4E70A 1RI7A 2ZSHB 2H8WA 1TWGJ 4AIKA 2D2WA 5FFXA 5B3SH 3BR2A 3MKLA 3IH4A 2W48A 3WG9A 4JP0A 5F1RA 5E3MA 2QSHX 3CCUI 2LDUA 2LLKA 2F5EA 1HSJA 1KQ9A 2XKPA 1U3EM 2HR3A 3V42A 3MZYA 4EVIA 1BC8C 3LSRA 3HTUA 1YI2I 2K02A 1MKMA 2M3AA 5JR3A 3DEEA 3FF5A 4L5JA 1P6RA 2X6XA 2VONA 3IH3A 3IKTA 1S72I 2MC3A 3H3ZA 2VXDA 2L0KA 2F2EA 4M74A 1LJ9A 4PK4A 2Y30A 4XRMA 1MMAA 4Q47A 1FOYA 2BY0A 5E18F 2IS2A 3M07A 2YPRA 1ZKGA 2F48A 4ETSA 4ENNA 2CQNA 2CS3A 1VQPI 1E3PA 1YS7A 1EF4A 5CVJA 4L9TA 1Z91A 2ADUA 4U7DA 2P0WA 2XSDC 3CUQA 5E3NA 1MJBA 2XGCA 5ILUA 3U1DA 2LY9A 3REOA 1UHWA 4KNYA 4CCLA 1W7PB 2GQQA 1JUSA 3DTEA 3I59B 1HKSA 2NYXA 4DYQA 5FKOA 2IBDA 2K3PA 3CDLA 2DDAA 2MH2A 3E0JB 4OINF 5CVIA 1PP8F 1UFMA 4KYWA 1OCCH 4Y3OA 3MFKA 4CCOA 3FMSA 2X0LA 3CCLI 2C6YA 2QKLB 3H35A 1R7JA 2CRGA 2EK5A 2GA1A 2IGNA 3R61A 1VQ4I 4ZDOA 4XRFA 4BL0B 2KKOA 1FTTA 1WPKA 3BG5A 3MQ0A 4P96A 4PJJA 3V7RA 4M3FA 4B8XA 2QSFX 3JAMZ 2GXGA 3GF2A 2A3SA 4PFPA 1FYKA 1M1EB 1WSUA 1JKOC 3LFKA 3LSHA 5E1XA 2EWNA 2VI6A 4XLPF 4F55A 4I2OA 1WJCA 1S8NA 2D1VA 3FXOA 4P5OA 4NC6A 2OV7A 4XLHA 2LBFA 1PUFB 1FOWA 1Y6IA 3OL3A 2PX9A 4NDLA 4QTRA 2NOGA 3QP5A 4ZZLA 1TNSA 4M6XA 3LNQA 2VKDA 1DP7P 3I71A 4CA0A 3O3KA 3BCAA 2W82A 2RKHA 5HODA 2JWTA 5FB2A 2M87A 3E6DA 3G73A 1MDMB 3S15J 1W5SA 3WGHA 4IOCF 4V2FA 2WC2A 4LIUA 2LG4A 1SFKA 4V2GA 1A31A 4IHWA 2XPVA 1FWZA 3CCYA 2JJ7A 2K86A 3GTLJ 3GLLA 2BY1A 1U5TC 1ODDA 3NWTA 3RYPA 2J5PA 3TBIA 4EM2A 3E6CC 3F6VA 3S16J 1QQIA 4HZFA 5EG0B 2PN6A 3QU6A 4LLGF 5C3EJ 1JXSA 2DK8A 3I0TA 2ZXJA 1UCRA 3K4MA 2HS5A 4RBOA 4ZC3A 1EJ9A 5TGTA 2V1DA 4RM3A 2CFXA 2DA5A 2VPRA 2DXIA 1T2KA 4HF2A 3ZR8X 3GFJA 3ZN0A 1K6OA 1FYLA 3AG4H 3RZDJ 1B59A 1D8KA 2DMNA 4HBLA 4ZJZA 2IRFG 2E1MB 4BJTA 1JGGA 3K0LA 4W1UA 2O8KA 1TLHB 2MW8A 1O3RA 2EIMH 3F3XA 4G7ZF 1R1VA 1FIAA 5L3CA 2EFOA 2PI0A 1IJWC 3ECOA 3NWSA 1BBYA 3RPQA 4JX5A 3I56I 3V4GA 2KDZA 1U2WA 1XB4A 2ZKZA 3F23A 1XN7A 3BZCA 1S7EA 4OAYA 1Y8QB 5EGOB 1X19A 3JTHA 1O4XA 4PJNA 1FOKA 2EILH 2DJIA 3S2DJ 1X1AA 3IAS2 3CCSI 2OAZA 3BTCA 3HIFA 1G2HA 3BP8A 3OR1C 4QSHA 1TC3C 1GLNA 3ELKA 1KONA 3RI4A 2OTLI 3K1NA 2OZ6A 3PL8A 4II3A 3VSLA 4B3XA 4CO8A 3I55I 5HS8A 3HOTA 3OY9A 4IHSA 3GTGJ 1QZZA 2VT2A 2PFBA 1BJZA 1R58A 5KAIC 2K9SA 2CUZA 4G7HF 4WCGA 1P4WA 3ABLH 5J40A 3A2KA 4XLAA 1XMXA 3PSIA 3U2RA 1E3OC 2LH9A 2VBYA 3A03A 1OCRH 2VJJA 1PDNC 2GOXB 2L9RA 2IA2A 2FNAA 5AONA 3ZQFA 3ZQIA 1SVLA 2ZBKA 3HEFA 4NBQA 4I0AA 2R7SA 1SVMA 2H6CA 1UAAA 4KN7X 2L4AA 2W84A 2KQRA 2GM4A 2CUFA 4MFDA 4X0GA 2BZTA 1JI8A 5FKMA 3CF2A 5J3LA 2JN6A 2K40A 5ICGA 3BR1A 5CVUA 2KZVA 1RUOA 2VASA 3K4KA 2BVLA 2E2JJ 1W5TA 2JA2A 2EB7A 4E7HA 2W1OA 1BM9A 3Q9VA 2I8DA 2IGOA 1YIOA 3QOPA 1R9TJ 3F72A 3IUOA 1T98A 3TO6A 3F0CA 1BL0A 2YX7A 3IC7A 2EZHA 3TP3A 1W7PA 3JTGA 1P7JA 1WJAA 5HDKA 2I10A 2BVMA 5D4RA 1XC5A 2DFEA 4LJZF 4BJ5C 1DU0A 5D8KB 2A5WA 2W25A 1LB2A 1DGWY 4MTDA 2LKXA 4P9FA 2RGVA 5F0FA 2CV2A 4A6EA 4BACA 1OLTA 1K4TA 1T33A 4EATA 1RRJA 3GTMJ 3T1BA 3SYTA 3J7AY 5E8GA 4BBRJ 4EJUA 2V7FA 1B9MA 3DTKA 1B9NA 3G4SI 1ZH5A 4BAYA 2XPWA 2KRHA 2FMLA 3HPHA 3AG3H 4E7SA 3BR6A 1WGXA 2E60A 1FNNA 2ZJ2A 3FISA 2X1DA 2DMQA 2NAZA 3CMEI 4KDPA 3FXKA 1WJEA 3NAUA 3PNVA 4Y15A 5J1UA 1LPQA 3JSOA 5HS7A 4Y7NJ 2NXNB 3LMMA 4NB5A 4XLFA 3ZCOA 2AXTC 2L7KA 4BY1J 3F8MA 2PJRB 2D5VA 3ZQ7A 3HHHA 2QQBA 2CQKA 2LOOA 4CXFA 2VOPA 1FTZA 4U7BA 3KZZA 2QWWA 3HM5A 1FX7A 4LFUA 4LIVA 3N05A 3KEQA 2V9KA 4DBRA 1GVJA 3JRIA 4N4OB 4QIWN 2O8XA 2O03A 2WAQN 4BDZA 1MDMA 2QQAA 3DFGA 2DYSH 2EFQA 1JTYA 1A36A 4D7MA 4JK1X 2OBPA 1YRNB 2O5RA 4CUGA 1BA5A 2DA3A 2JPCA 3G1LA 3I3LA 4EQQA 4MNUA 4KJZA 3RCOA 4B48A 2FQ4A 1YW7A 2P8TA 1PP7U 4XBFA 3BTIA 1WJDA 1K78A 3A01B 3V7CA 5M3FJ 3DU5A 2RQPA 2KRCA 1CQTA 2VJIA 2WB1A 3OSGA 4M73A 5ERIA 4EV0A 1JKPC 2M45A 3TDZC 1FMVA 3HOXJ 1UB9A 1QA6A 1IF1A 2COMA 2I5UA 4IHTA 4DZJA 4A93J 3BJ6A 4F7ZA 2RV8A 4RB2C 3KFWX 5FKNA 4Y52J 1HKTA 4UVBA 3TL4X 1USSA 3OIOA 4YELA 4AYBA 3M1EA 3LWFA 1LEAA 3BJAA 3K70C 2BW3B 1RUNA 2Q1ZB 3LQRA 3JR9A 5IP9J 9ANTA 2XAUA 4LB6B 1ITYA 4XSZF 3HRSA 2K9MA 2FMYA 4JOMA 3KP4A 1XMKA 3PIOF 1L3LA 3M1CA 2DA4A 2QSGX 3F8FA 1HCRA 3HOYJ 2TRTA 3LA2A 5E20A 3D5RC 4Q5SF 2FE3A 4OIRF 2K9QA 2ZJQF 2R5ZB 3RKXA 1JJ6C 2E2IJ 4PSWA 5FROA 1OFCX 4B44A 4KFCA 3BG9A 4QPQA 2FEZA 1JUMA 4HX4A 2J5OA 2XSJC 3C1DA 4P1WA 3OYBA 3S3NA 1VQLI 2UXNA 3S1MJ 3KP3A 3COAC 3P9IA 3LFUA 1OISA 3BR5A 1SFOJ 1EH8A 4FISA 5DM7F 4BJ6C 4D7NA 3M4OJ 2HOSA 3H5AA 5BOXA 4IOAF 1SAUA 1YQAA 1X4OA 4A3IJ 2OD5A 2O6GE 1TW2A 1TZLA 3H1CA 4BNCA 1AWCA 1IN5A 1QPMA 2AQFA 2PMHA 1FSHA 2KMUA 2HXIA 1TNTA 1YG2A 1MIJA 1D1CA 4A6DA 4AUXA 3S1RJ 1T38A 1J5YA 2AHQA 1F1ZA 1XDSA 2WV0A 3UR3C 3OS1A 2HQAA 2BY2A 2R7TA 1OYWA 2LF7A 5F0HA 3VB2A 2W57A 4LB5A 3BPVA 1HXDA 5IOYA 2STTA 5J4VA 2LY1A 2Y48A 3C3WA 2BV6A 1U6GA 4C3HJ 2TCTA 3L09A 2Y69H 1QNTA 3KYLA 1PYVA 5HLHA 1IN7A 3DPUA 2E19A 4HV6A 4LK1F 1A6IA 3VEPA 1RETA 1DU6A 2X6YA 3LL7A 3U1KA 4PJMA 4XKCA 5BNGA 4E6KG 2DLLA 2NVYJ 3ERMA 2IP2A 1ZYRF 3WU0A 2KPMA 1R1UA 5EEHA 4G6TB 4WK8F 2NOJB 3PNTA 5CLSA 3HSFA 1EH6A 2EBIA 1YW8A 5HDGA 1J2XA 2ZNZA 2OC6A 4Y4RA 1W1WE 2H1LA 3GYHX 4CZZA 2DK5A 5JVGF 2CQ7A 3I58A 1A6QA 1QBJA 2QBYA 2A6EF 2KHMA 3WODF 5J47A 2X4HA 2IVMA 2CFOA 3AL0B 1XD7A 2MSYA 3QP6A 4HW0A 1JHHA 3MEXA 1LE8B 2MG4A 4A5NA 3LAPA 5HDNA 3IRQA 1RESA 2OA4A 4AVPA 2VQLA 2QENA 3CJNA 4OWRB 4N9IA 1XCVA 5H6QA 2GIZA 2A6HF 4E7KA 3GCMA 3BY6A 2ETHA 2ESNA 4UY8I 4R79A 2YU9J 2DFHA 4V19K 2WAQA 4X6AJ 1ZLJA 4UHTA 3Q3SA 4PUSA 1EH7A 2KIFA 3A4CA 3GMEA 2VE9A 1XS9A 1P2FA 1HW1A 1ZARA 4IRHA 4LITA 4HYEA 1USTA 1I1SA 2L5QA 2VPLA 1AU7A 3L2VA 1Z05A 3JRBA 2VC0A 4BEHB 1BI3A 3S2WA 4E7LA 1RKWA 2QGUA 1R49A 5KK1A 2DODA 2CV0A 2V1NA 4C2TA 3J7AO 4M9XA 1N75A 2M8EA 4CH7A 2E71A 3FXUA 3BR3A 2EZLA 1ZLKA 2H8RA 4JX6A 5CQGA 1TT5B 4CCKA 1OPCA 3RZOJ 4BY7J 2E1MC 2LSOA 1RR8C 4HF1A 1R23A 3GZ6A 2IT0A 3ZMVA 3NARA 1X3UA 1I5ZA 2FU4A 3L2QA 2IEKA 3PFYA 4DZPA 2XVCA 2D45A 4B47A 4RAFA 2YX4A 3ZOBA 5EEGA 1N77A 3Q0VA 2K9LA 2KIQA 1UELB 3PIPF 3DF8A 1G4DA 3DBHB 1BI0A 3ZMDA 2R7XA 2LFBA 3WU1B 1LNWA 4FETA 2DA2A 2HDWA 3IH2A 1MW7A 4OAZA 5DCFA 4R1HA 1Z6TA 2HFHA 2OU2A 3DPLC 2V4JC 4F91B 3DPTA 4LK0F 3ZQQA 5D8LB 2JA8J 3GLXA 3FKJA 2HOTA 2WADA 3GUDA 3PUFA 3D5LA 3A01A 4I6ZA 4IQ4A 2XROA 2CW8A 2Z9OA 1SD7A 5TISC 2STWA 1AHDP 1UJ8A 1YJWI 5E79C 2ZFUA 3E3VA 1FBQA 1H8AC 5JVTA 2YU3A 4MFEA 2W00A 3DBRB 5M5YJ 1RR7A 3FZVA 1IN6A 4BHBA 1IXCA 1PJRA 1E17A 3ONQA 3P9KA 2DT6A 2AXLA 1FP2A 4OU0A 5J6XA 3I5UA 1FJLA 1D0ZA 2DOEA 1MSFC 1LVAA 1P4XA 4MLOA 3DKWA 4RA2A 5DTDA 3ZQLA 2VKEA 5TRDA 2VE8A 1V5EA 4EM1A 1WJBA 5K1YA 2P81A 5IOZA 5J1RA 1APLC 1LEBA 3B6AA 4U0YA 3A1YA 3OYFA 1VZ0A 2HWVA 1W36C 3NQOA 1TP4A 1U8BA 4G94A 2R5ZA 4I09A 1P92A 3PQKA 4ESFA 5IYDJ 2QA4I 1HOMA 3IV5A 3L00A 1B72B 3CLQA 4WX9A 3EYIA 5EZGA 1HA8A 3HGGA 3TW7A 2ZXWH 2DOFA 4ASNA 4KIGA 2R7OA 1YX3A 2M30A 4ZYEA 1KU9A 4A3CJ 2JVGA 2Z5UA 2DI3A 3Q9SA 1D1BA 2IS1A 3MCZA 2HGCA 2HDDA 4D0PA 2Z1DA 1ZTRA 1X58A 3HDDA 3HSRA 1RC9A 3T8TA 5L3FA 5HLTA 3OYAA 4IHXA 2TDXA 2N8GA 5FD5A 4BE1A 3CC7I 2HZTA 1QPIA 4G12A 3OOUA 3NEUA 3CTAA 1D0YA 2NS7A 2WY8Q 3QYBA 3RPUD 3VOEA 1ZRFA 4IHYA 4CYCA 1MBEA 2V9PA 3OYNA 3ERED 2KIMA 2MH9A 3CDIA 3G71I 2X9DA 1ZREA 3HOUJ 3FKIJ 1XG1A 3CP2A 1K6YA 1OKRA 4HX7A 5KNLA 2V6EA 3VYRB 4XK4A 3OYEA 4MTEA 4LG0A 4WXDA 1YLFA 3IAM2 3ROUA 4A12A 3QODA 5L3BA 4XKWA 2VODA 1E0EA 1ETOA 3ASNH 3GXOA 4HAMA 3GTJJ 1VNDA 4OOIA 2CSOA 2HVQA 1MNEA 3GTKJ 2L9VA 2QYOA 4DNCA 1UG2A 1ZG3A 1HBXG 3L2WA 2K85A 4I7HA 4RAGA 4ENKA 5FKKA 4EJWA 1QRYA 2M34A 4KMUX 3G2BA 2P7VB 2R5YB 2M7AA 1O57A 2OQGA 3H5RA 3V7SA 1VTNC 5AIPA 3OS0A 3PJRA 5C44J 1KU3A 3K1PA 3EPZA 3GZNB 3HXLA 3JRCA 4EJTA 4FX4A 3KX2A 3KP5A 3BCBA 3I4NJ 2ELHA 1MD0A 2P7CB 3KZIC 1AOYA 3TP0A 4IF4A 2A05A 3RQ4A 1YX5A 2ZJRF 2F4OB 2O9LA 3K4BA 3DWLE 2HOAA 4KICA 3HRTA 3N4MA 1B8IB 4OIOF 2XAQA 4NNJA 5F1JA 2R0QC 3F8CA 2DTRA 3OR2C 4HDVA 2ZB9A 4C2UA 1ZQ3P 1X1BA 5CPRB 5FGMA 2CW0F 3H3UA 5DV5A 3K4JA 1DDNA 1BW5A 4M6YA 2A6TA 2HPIA 3WTVC 2W4SA 2JA6J 1IRXA 1ZK8A 1EV7A 4CDGA 1Z6RA 3DLLF 4IHVA 3W6VA 4BDYA 4HNVA 1R6RA 1WRJA 1FMWA 1YIJI 4BEHA 3W2AA 4IRIA 4CGZA 2A61A 1U9NA 3RDIA 5DDGA 1IRFA 3K69A 3KIOA 3GBGA 4MEYF 4IX7A 1HW5A 4GGGA 3S1NJ 1Y56A 4HQMA 3TKYA 3JRDA 1IRGA 3SZPA 2V1UA 3E7LA 5BPDA 3S3MA 3ZMZA 4RB1A 3IHUA 2IGKA 4M3BA 2LK2A 4J01A 3CO6C 1IV8A 2G7HA 3ESWB 3HUGB 3A0BC 3GFIA 3HRUA 4WXHA 2MABA 3CCMI 1O3TA 1GHCA 2CWEA 4M3DA 3A02A 2Z33A 3DBLB 3FK6A 1SD4A 3SEZA 2DTZA 1Y0NA 4RGUA 3P7NA 4ESJA 3H36A 2M5WA 5HNHA 1RPWA 4IXAA 5FO5A 2ZJPF 1ON2A 1ZR4A 3S14J 2VBXA 1I6HJ 2X51A 2P5LC 4ZYAA 1MJ9A 4WF2A 3CMMA 3R60A 2ELJA 3ABTA 2LP0A 1Y0UA 2XUBA 5KHDA 1JGSA 2M0MA 1V5GA 4NC7A 2Y31A 4FASD 3WGIA 3K4LA 1SEUA 3PO2J 5H20A 1XMAA 2WB1N 1LUJB 1J59A 1X1CA 1ETYA 4C9YA 1TBXA 3QWLA 5FLVA 1TWFJ 3MKYB 2HKXA 4Q48A 4NUBA 3J80Z 3GWZA 3T5XA 2FBKA 2JQ7A 3N97A 2XB0X 3LA7A 4AYBN 1VQ6I 3CZ6A 1G6NA 4YFXF 3BZKA 5JFRA 2QEXI 3Q0WA 2HYGD 2CUEA 4B1RA 5F64A 3ZN1A 1QVTA 2JZYA 3BOQA 2QKMB 5DD8A 3VFZA 1SD5A 3F22A 1U0JA 4C2MJ 1T39A 1HC8A 2OPTA 2JRTA 1LFUP 4RGRA 1XSXA 4I01A 2CH0A 1QZYA 4F93B 3R0JA 4LLNA 4KT5C 2IXSA 3G1MA 2RNGA 2OF7A 1RIOH 2IW5A 4C3IJ 3M8JA 3HTSB 4XOPA 3HGYA 3C7JA 3M7GA 4R8HA 4UUSB 1DGRM 2WWYA 3B02A 3CC4I 2VJ4A 2K3FA 4IJAA 1CF7B 5GTIC 3CMYA 2Q0OA 5JLWA 1ZRDA 3CD6I 3HYIA 4N9HA 1O7FA 4HDUA 1QHHD 2UXXA 3FMQA 3MVPA 4LGWA 4UVCA 2B63J 2P5VA 2X1EA 3DTIA 3DV8A 2E1OA 5A2QK 3JRAA 2VUMJ 4A3BJ 4MHGA 4AD9A 3M9AA 4XL9A 5HS9A 5FD6A 2VOOA 2EV0A 3OYKA 1HW2A 1S9HA 2LKPA 3E5UA 5J4YA 4BKXA 1T8IA 1OR7C 2GA2A 2MYSA 1OCTC 5C4XJ 2DQRA 3VYSB 3AL0C 4XKVA 5EJCA 1CGPA 4BXXJ 4GCVA 5FLXZ 4TV7A 3DEWA 2R93J 1FPQA 4JQFA 1BOAA 2CG4A 2ISYA 2HZDA 4I99C 3CCRI 1VI0A 4XKBA 2L7MP 3QYFA 2Y2ZA 3I54A 3QQAA 3W2VA 4KA4A 3OYHA 2EINH 1YYVA 2XASA 2LREA 2KP6A 4M72A 2HEOA 4DIQA 3BC8A 4I02A 2OTJI 2ID6A 4JX4A 3I59A 1Z3XA 1AA7A 3BLYA 5IPAA 3H9JA 1VQ9I 3FXLA 3HG9A 4KISA 5LLQA 5B66C 1OMIA 2FOKA 3MKZA 2Y75A 3GW2A 2L9SA 3M8FA 3MN2A 5E1ZB 1YJ9I 4YIRX 2Y0MA 2L54A 2QM3A 4I98B 1NK3P 2R7ZJ 2V6CA 2ZXHA 5LEJA 2XHKA 4A3FJ 3LA3A 2RN7A 5J8CA 1V3FA 1QVUA 1Z21A 3K4NA 2Q8KA 4KITB 4NHJA 3EUHA 2ZNYA 2KFDA 4DJAA 2EQRA 4DGWB 2E34A 4BHCA 1F5TA 1FEXA 2BBYA 3BROA 2COBA 2R5YA 3BJOA 3MMYB 1FY7A 3FXJA 5GAHJ 3E5QA 5HNFA 3IKVA 4HA8A 4QPOA 1PUFA 2CQQA 4IL6C 3ECHA 4C30A 2PMUA 1TL8A 5FKLA 2XRNA 1K61A 1N78A 3WE2A 6PAXA 3B73A 4IEJA 3ZQGA 2XKOA 3H0GJ 3FX3A 2W24A 1C0WA 1ZGAA 2ELKA 2EIKH 3OYDA 1FOXA 4FCYA 2P5KA 4NC8A 4YRVA 1E3HA 4JYKA 2VL8A 2DFFA 3BTJA 3LSKA 3F21A 4XSXF 5M3MJ 1GXQA 2M1BA 5BS6A 3CQZJ 4PFOA 3OSFA 3DP7A 2YUSA 2MLKA 5EG0A 2ID3A 3S32A 3ZPLA 4ABZA 4MQVA 3J81Z 2LRDA 2R7DA 1XGOA 4BQAA 5IYCJ 5LFAA 4BQOA 3I9V2 4ZYDA 3L2CA 4BXFA 4U0WA 5K7HA 2DMTA 4WWCA 1TWCJ 4LLLA 2NNYA 4AIHA 4AWXB 2LKSA 4HSTA 2RVCA 5FRMA 3P9CA 1ZN2A 1VQKI 3GVAA 3AG1H 2Z16A 1NG7A 5IT9Z 3Q5FA 2RDPA 1D0XA 1Z77A 2V26A 3WTWC 5GAGJ 2CMPA 1H89C 4OIPF 3R0AA 4G8XA 4CZCA 4IZZA 4ENJA 4ZTJA 5LHIA 4BQQA 1GT0C 1J0RA 2ACJA 2F4MB 1V4RA 1IN4A 4ON0A 4ZDPA 2NNNA 2EZKA 1S7AA 3ML6A 3JSPA 1S5LC 4BBSJ 2X6WA 5EYRA 5IP7J 2F5FA 1R5HA 1VFCA 1W0TA 1VF9A 4FQGA 4M71A 3LSPA 4MIMA 5D6FA 1OQYA 3CUOA 3TQNA 3SXYA 3CCJI 5EGOA 2LD5A 1J75A 2IA0A 4XMYA 2CYYA 3TO7A 4PCQA 5B1AH 3HL2A 3VODA 3J7YJ 2VC1A 1MH3A 2HQNA 2CQXA 3P5JA 1MH4A 2RC4A 1V55H 4O6JA 5DCMB 3BWGA 4CCNA 1ERDA 2M9HA 1W4MA 1ON1A 1ULYA 1ZGJA 2E2HJ 3HOWJ 2MD0A 2W85A 3S93A 3GFMA 1UMQA 3TOAA 2P4WA 4BS9A 4B43A 2VBWA 1K79A 2DO7A 4DBQA 5B5EC 3ABUA 1QO0D 1D1AA 1G3WA 2FSWA 3WTXC 1DPUA 2HYFA 4A3LJ 1I3QJ 4HEA2 2XC7A 2DPDA 4OMYA 3JAMK 4ITVA 1HKQA 4H0EA 4A3DJ 2A07F 3CUQB 2R92J 5D4SA 5K7ZA 1RKTA 2JSCA 1TTYA 3LSJA 1D5VA 4II2A 1Z9CA 5L3GA 3EUHC 3ZMTA 2FQ3A 5K5QA 3SZTA 1ZELA 3VSKA 4XLNF 1HDDC 2ZFWA 4KIFA 2WBMA 4KIBA 3E6BA 3WTZA 3JRFA 2XF5A 2GWRA 3S1QJ 3HOVJ 4OMZA 5E3LA 1Z0XA 3S2HJ 3RKYA 2OZUA 5ED4A 3QYEA 2GBYA 1IRZA 5E1WA 4M6VA 5DUIA 5K7FA 1Z67A 2JSPA 2MFZA 4HOBA 2DDBA 4RGXA 1WQ2A 1D5YA 2EIJH 3JREA 2KIUA 5CKTA 1Y8RB 4ZYHA 4J19A 3W6JB 3ISPA 4N4NB 2JA7J 4GXOA 1U8RA 4EM0B 4XQFA 2B7EA 1SANA 1QU3A 2LBFB 1HSTA 2XDVA 2VBZA 2JRMA 3G1OA 2X6OA 4KUMA 3OS2A 1IC8A 1BR1A 3QPLA 4FE7A 3RTRA 1S6LA 4FT8A 4YEJA 2DW4A 3MAJA 1B1BA 3Q0UA 5ILSA 1AKHB 1ONVA 2HTJA 3CLOA 3F8BA 2FBIA 3AKZA 2WV1A 1S7OA 3JRHA 4OIQF 2XB5A 3EYYA 2QUFA 4HF0A 2FRHA 1B6AA 4FHTA 2CW7A 2WY7Q 3QU3A 2KISA 3F6OA 4NQWB 1SMTA 2A69F 1WVRA 1T56A 2R7WA 2PJRA 3BTLA 2W7NA 3C2BA 2BY3A 2BHYA 2XRLA 3TO9A 3ZP5A 5BPIA 1R36A 2L7ZA 1T0FC 2CJJA 2ECCA 3BT9A 2NVQJ 1IW7F 1ORKA 1D3YA 1A35A 3KE2A 2CUJA 4XRSG 1IUFA 4S04A 3CF5F 3OYMA 3G6EI 4YFKF 2MD5A 2GLOA 3RSNA 2FA5A 1H9GA 2BHZA 1D8JA 1JUPA 1L0OC 4UB6C 4X1EA 4E7ZA 3K6GA 1YRNA 3M8EA 2QLZA 3KETA 3KCCA 2LYCA 1UHSA 3CESA 3E5XA 2X85A 2MLGA 2XAHA 1I50J 4C3JJ 5DD4A 1DPRA 2L3DA 3K70D 1LFPA 5LHHA 2HDCA 2PBIA 3SHFA 2H09A 5LGNA 3QRFF 1MBFA 1IV6A 2M7BA 1OJLA 5DYMA 4L5IA 3F9KA 5HOOA 4XONA 3MWMA 1B4AA 1P7IA 3CDHA 1MZBA 3GEZA 5H6RA 4L9NA 3V8LA 4ESBA 4YIFA 4DYRA 4IO9F 5AIQA 2BW3A 4AC0A 2LR8A 2KT0A 2Z99A 1TQIA 2Y9ZA 3VPRA 1OCOH 1XDUA 1ETXA 4EGZA 2R7QA 4F92B 3FDYA 5JHUA 1GXPA 1HDPA 1TWHJ 4RAYA 3D0SA 3VWBA 2XV4S 2EFPA 3BQYA 3OMYA 3CCQI 1G3TA 3AFHA 5GPCA 2M4GA 5CVVA 2ZMEB 1IAWA 3SZGA 3W6KB 4KT6A 4BUPA 1FP1D 1OCPA 1G59A 3KLOA 1LVKA 3HRMA 3I4MJ 1YS6A 4XORA 2VN2A 3L9FA 1TQPA 2P6TA 4PZJA 1BW6A 1IZ1A 3E1SA 3O6BB 3ULQB 2PEXA 5HLGA 2VQHA 1Z3YA 1W7PD 2IA1A 3MZHA 3K9TA 2JT1A 5FLXK 1JT6A 3FHNA 1X1PA 2H27A 2HU9A 3AG2H 1NHAA 2DCEA 5CYVA 4FX0A 1WFXA 2OUMA 2GOMA 2H94A 5J8FA 3LQQA 5DCMA 1Y39A 1X2MA 1NTCA 3HC7A 4CYDA 2UZKA 2ZO4A 4E7IA 2L01A 1KYZA 1T6SA 3BPXA 1RZ4A 2HVRA 2R7UA 2V9VA 4BYYA 4JBAA 4YIIA 1WKMA 3WE3A 3DEUA 4GYIA 3X2QH 4XLEA 2L2OA 3U21A 5GAEJ 2EJRA 4MGRA 5IP6A 1F4KA 5B1BH 1KZHA 2RQQA 2H1KA 4XOTA 2R3SA 3R6SA 1IDZA 1ZR2A 2FNPA 1SFUA 4O3MA 2FD5A 1VQ7I 1SD6A 2V79A 4A0ZA 1SFEA 2PG4A 3C2HA 3FXRA 4ENMA 1R71A 3CJRB 2PMZN 4HRIA 3FHZA 1YW9A 2KJBA 4D5FA 3IL2A 4A2UA 1SMYF 2FOWA 3K1MA 2DN0A 2HVSA 3L2UA 3T8RA 2G7UA 4DYCA 2QF7A 3SJMA 1UG0A 2Y0SA 1FBUA 2VJ5A 5F04A 2LF8A 2XGDA 1OR7A 5F08A 2F6CA 3KP7A 2L4MA 1J7KA 5EF6A 2WA0A 3SQNA 3BG3A 5ICCA 1LE8A 2DYRH 3LSIA 4A3EJ 1GV2A 1YJNI 4IRGA 3L2RA 5LD2C 3ABMH 2BXZA 1X1DA 3MD2A 1QGPA 1YITI 5GP9A 2DOAA 4ZH4F 2E1NA 3SFZA 3FXQA 2VT3A 1ETVA 2ZSIB 3KEOA 5KVRA 3ZGKA 5JLXA 2EV6A 5M5WJ 3OIQA 3J81K 1REPC 1TWAJ 2Y9YA 1KQ0A 1JTXA 4GFBA 1R4MB 2VXZA 3HJEA 1Q1VA 2OCEA 2YS9A 1AKHA 1X2NA 3I53A 4GDFA 2FUG2 1ETWA 4XRSA 2XAJA 3H92A 1WJ5A 3EDPA 4I76A 5IT9K 1POGA 5CJ9A 1I6XA 2PJPA 1ACIA 2JK3A 3D1NI 4NQWA 1MGTA 3ZQHA 2XIGA 4L5EA 2KDOA 1BN5A 4H4KC 5GTHC 4XLCA 5E8IA 5ICFA 2EZIA 3S17J 3FMRA 3GTOJ 3ASOH 3EUKL 1K78B 2ME0A 1R4NB 2G9WA 2EA2A 2K4BA 4B09A 3H3VK 1QHGA 3FXMA 2MBFA 2UUZA 1WZ2A 2GZWA 2DAOA 2LNBA 3HOZJ 1XGNA 1BIAA 1I1GA 4HV5A 3PO3J 2Q2EB 2VLAA 2B0LA 1MMSA 1W0UA 3ZMSA 1R5ID 1FLIA 5EEAA 1LKXA 2X1CA 3BG7A 5E3OA 4UVAA 5K5RA 1BI1A 2UV1A 4CHUA 4P55A 5TJJA 5M5XJ 1WCMJ 2RREA 3EUAA 3S8PA 3CP8A 4S0HB 3LAJA 4I0BA 2IJLA 1YFHA 1IGNA 2O3FA 4XN0A 3UKGA 1TW3A 2BE5F 3WHBA 1W36D 4J00A 3WTTC 2DA6A 3PNYA 2XGEA 3W2WA 4M9SA 3RKWA 1JT0A 1FBSA 1YE9A 2QQ9A 3RKQA 1H0MA 1KU7A 1YO5C 1WJFA 3HZJA 2E36A 3W3CA 4HNTA 4PJ0C 2OCCH 1OYIA 1FT9A 1X3WB 1WWXA 3OIPA 5ICEA 5L3EA 2ZMEA 3CUQC 1GV5A 4M9ZA 1Y1WJ 2G0EA 5C4JJ 3AAFA 1H9TA 1B72A 1IN8A 3O8GA 1JHFA 2DFIA 2ME6A 3I64A 2L7FP 1SC7A 1H88C 2ECBA 4CCJA 4EJVA 2XGXA 3FM5A 2PMZA 2JPBA 4Y33A 5K5OA 5E17F 2QQ8A 5BMZA 3JRGA 3DKYA 5LRRA 2A5YB 1VQ5I 2XAFA 1PVEA 4G6QA 4HG2A 4QWQA 2VIXA 4Z6YA 1FZPB 3CMAI 1KA8A 4GYGA 2LTPA 2UWMA 4FE4A 1YOVB 4LOCA 1X4PA 2MC4A 4IVNA 2CGPA 2F5CA 2B9SA 1NH3A 2K9NA 3PM1A 4UXNA 3F8NA 2M8GX 3DQVC 4KMFA 3E6MA 2VQGA 4HX8A 1MNMC 5DM6F 5F27A 4RGSA 4B4CA 1JE8A 2CO5A 3GZ5A 1ZG5A 3TGNA 3IRRA 1LDJA 3LSTA 2KL4A 4MQ9F 1HQCA 2K4JA 2RAEA 4DW6A 1MBGA 5JI6A 1Z7UA 5LGTA 2DA7A 2AQEA 2OQRA 1ENHA 2QBYB 1PUEE 4Y17A 1NK2P 2CU7A 1UHMA 3OYCA 3K7AJ 2JVHA 3BQZA 2MA3A 2K7LA 3PUBA 4D5CA 1FYMA 2VQCA 2JTVA 1HLVA 3FIWA 4XICA 4DOZA 2NS8A 3QPSA 4QLCU 1P9QC 4E4HA 4G6DA 4XIDA 2ZC2A 1IG7A 2LVSA 1U78A 3FWEA 4A3GJ 2KZGA 4PDKA 4CCMA 4RDUA 5KCMA 4S05A 1BIBA 2E35A 2XAGA 3JW4A 3O2PE 1BJAA 1F9NA 4BHPA 1ETKA 4PGHA 3RPUA 2Z2SB 1LDDA 3FK7A 3UNGC 4HQEA 2NVXJ 2LY2A 4W97A 1A5JA 1GVDA 2DA1A 2HYJA 1SVOA 1R00A 2EFNA 5LHGA 1B8IA 2VB6A 1IUYA 4BH9A 2IAIA 3ZRGA 2FBHA 5EZHA 3HPGA 1MNDA 1KQ8A 3FBNB 1ZGWA 4MO7A 3IWFA 3GO5A 3ZXSA 4AM3A 3I4PA 4CICA 1KU2A 4L0YB 4AIDA 4BE0A 1ZHFA 5DS9A 3LSGA 4YG2F 1WI3A 5F0CA 2IPQX 2X48A 4A3KJ 1O7LA 1F36A 3M3YJ 3LOCA 1WI9A 2WAFA 4EMSA 5H2FC 2D1HA 1FIPA 1J9IA 1MBJA 3L7WA 4EGYA 2ZCWA 5EDNA 2QVOA 3E97A 2EA4A 1LQ1A 3PSFA 4ZZDA 3KPHA 3CJTB 1WH7A 4XR6A 2EV5A 1VQMI 4XM3A 4BGDA 3HKZN 3OYLA 5D5UB 2IS4A 1V5FA 2HXOA 4A5MA 2A68F 4EJOA 2DMPA 3H0DA 4RS8A 3HUGA 2K27A 3QPHA 1K7AA 4K2EA 3IP4B 5FFZA 3TOBA 1U5TB 1R5GA 5D5XB 4UB8C 1I39A 2E7XA 5LGUA 2XF7A 5D5WB 1T0FA 1Z7LA 1VQOI 3BG6A 2HI3A 4RLQA 3GFLA 2H6BA 3H9GA 2JUGA 2ZMEC 3DLAA 4ZTFA 2Q2EA 2YR2A 3WHCA 4L18B 4HLXA 2OJED 5GPAA 2R7FA 3NRVA 1WHUA 4DQ2A 3RYRA 4GRIA 3WGGA 5IY5H 5FLMJ 4HLYA 1VQ8I 2PQ8A 4UUTA 1T08B 3WG7H 4D9JA 2FF4A 2KRFA 4Q4ZF 5FRNA 2IS6A 4RAZA 2DJNA 1DP3A 3RIRA 1MBHA 1JKQC 1HF0A 4UUVA 4Z2YA 1A04A 1Q1HA 3C2GA 1XGSA 2NVUB 4M3GA 3CJQB 1QZEA 2M2EA 5LRSA 1XCBA 4RB3C 2GXAA 2L02A 3G3ZA 2O61A 3QAHA 2XPUA 1MMGA 5FJ8J 2O0YA 2AO9A 3EETA 4BQNA 2GXBA 3DXJF 2E5NA 1XSDA 2ZXIA 4RMNA 3VDXA 2VKHA 2WTEA 3RQIA 1T95A 4PGGA 1TT0A 3PQJA 3A0HC 1F43A 3BZ6A 1ZG1A 3FBIB 1MMDA 4N0BA 3ABKH 4RLFA 2WAEA 5LEKA 2NRAC 3J7ZI 3DU6A 3U9GA 2L9NA 4UUSA 4IPAA 2VKVA 4U0VA 1IDYA 3CC2I 1CF7A 1P4AA 2ESHA 4LMYA 2XF6A 2BOLA 3WTUC 4CSWA 5ILVA 2NS0A 1XPXA 3V8JA 2NVTJ 5L3DA 1ZRCA 1LFBA 1ZAOA 1BR2A 3K10A 2FXAA 3L1PA 3DKXA 2F5DA 4ZYGA 2MGQA 4L9VA 4CYCB 3K2AA 4MEXF 2R7VA 2BYVE 1J09A 2YSRA 1SFXA 3TEDA 3QOEA 1GUUA 1YHQI 1Z1DA 1R1TA 3KP6A 2EH3A 4LG3A 1G3SA 2BXYA 3TDUC 4LG0B 3S3OA 1BC7C 2KJCA 1XTAA 1IXSB 2HOEA 4L9JA 2HKOA 4IKFA 3C18A 5DUKA 1X3ZB 2GAUA 3V8KA 3KYDB 2Z3YA 1DUXC 3K4CA 4A69C 3SEQA 4XN3A 3HSEA 2LMDA 5JHFA 1GDTA 4RB0A 1FSEA 4UV9A 5BQTA 4E7JA 2F5VA 1KGSA 2IGMA 2DPUA 2DT7B 4UV8A 1U9OA 4GO1A 2K5CA 4P9UA 1I3AA 5HVQC 3KLNA 3KYCB 1MSEC 2DMUA 5A2QZ 2R7RA 3SDGA 3O8HA 4BE2A 4WXCA 4UNOA 3ZMUA 4F3QA 4AVZA 1XSVA 4Y13A
chains in the Genus database with same CATH topology
2O7OA 5FLVA 1TWFJ 1JKRC 1BA5A 4D7MA 1JJ8C 1YRNB 2DA3A 3G1LA 2XB0X 4AYBN 2FQ4A 5IP6A 3Q0WA 3BTIA 2CUEA 2FJ1A 4B1RA 2Y0SN 3A01B 2H1KA 5M3FJ 2HQ5A 1QVTA 1IDZA 1ZR2A 1WH5A 1CQTA 4C2MJ 2FD5A 3OSGA 5J1YA 2OPTA 3GTQJ 1JKPC 1LFUP 2PMZN 3G1MA 4DZJA 4A93J 2OF7A 4D5FA 2M0CA 4C3IJ 5FKNA 4Y52J 2DN0A 4FTHA 3HGYA 4UUSB 3OIOA 3B6CA 3CMYA 5JLWA 2QCOA 4DYCA 2QF7A 3SJMA 3JR9A 5IP9J 3HBLA 9ANTA 5F04A 1ITYA 3MVPA 3GTPJ 2XGDA 5F08A 2B63J 2VUMJ 2DA4A 2E1OA 3SFIA 3JRAA 1HCRA 3TW6A 5EF6A 4A3BJ 1ETQA 3BG3A 1LE8A 3HOYJ 2TRTA 4A3EJ 1GV2A 2K9QA 2R5ZB 1JJ6C 2E2IJ 1OFCX 4BKXA 1OCTC 5GP9A 5C4XJ 3BG9A 4BXXJ 1JUMA 3HB9A 2JA5J 1Y1VJ 3DEWA 2R93J 1ETVA 1VI0A 2L7MP 3S1MJ 2Y2ZA 3QQAA 5JLXA 5M5WJ 3BR5A 1SFOJ 4FISA 1TWAJ 2Y9YA 4A3JJ 1JTXA 4D7NA 4GFBA 3M4OJ 2HOSA 1Q1VA 2ID6A 4JX4A 2YS9A 1AKHA 4A3IJ 1X2NA 5IPAA 1MBKA 1ETWA 4M3EA 4XRSA 4I76A 2HXIA 4AUXA 2FX0A 3S1RJ 3BR0A 1POGA 2AHQA 4B3AA 2JK3A 3D1NI 5IYBJ 5F0HA 3ZQHA 4L5EA 3ZQCA 3MN2A 5IOYA 4EEFG 2R7ZJ 4C3HJ 1NK3P 2EZIA 4A3FJ 3S17J 1QVUA 3GTOJ 2TCTA 4A3MJ 3DCFA 2JMWA 2ME0A 2EQRA 1K83J 2E19A 3H3VK 1FEXA 1A6IA 1DU6A 1RETA 1TWGJ 2COBA 2R5YA 5BNGA 2NVYJ 3BR2A 3MKLA 3IH4A 3HOZJ 1PUFA 2W48A 4JP0A 2CQQA 5E3MA 3PO3J 2LLKA 2EBIA 1W0UA 5FKLA 1K61A 3LSRA 5EEAA 4IEJA 3ZQGA 5E3OA 3H0GJ 3IH3A 2ELKA 2L0KA 5M5XJ 1WCMJ 4FCYA 2Y30A 2MSYA 4JYKA 4S0HB 4XRMA 1LE8B 2MG4A 1IGNA 3BTJA 3UKGA 1RESA 3WHBA 5M3MJ 1ZKGA 3OSFA 3CQZJ 2DA6A 2YUSA 2XGEA 5EG0A 2ID3A 1EF4A 4ABZA 1JT0A 3RKQA 5IYCJ 2YU9J 4X6AJ 2XSDC 5E3NA 3Q3SA 5K7HA 2DMTA 2XGCA 1TWCJ 2LY9A 1XS9A 1JUSA 1AU7A 4DYQA 3JRBA 5FKOA 2IBDA 3CDLA 1GV5A 1RKWA 1Z77A 1Y1WJ 1H89C 2G0EA 5C4JJ 1B72A 3O8GA 2ME6A 2L7FP 2CRGA 1H88C 3BR3A 2ECBA 2EZLA 2H8RA 4JX6A 1GT0C 3RZOJ 4BY7J 1FTTA 1WPKA 3JRGA 3BG5A 3NARA 2EZKA 4M3FA 4BBSJ 2IEKA 5EYRA 4DZPA 5IP7J 1VFCA 1W0TA 1VF9A 3LSPA 3ZOBA 1JKOC 3Q0VA 2LTPA 2VI6A 4MIMA 4FE4A 4LOCA 2LFBA 1PUFB 5EGOA 2LD5A 2K9NA 3PM1A 2NOGA 4NDLA 4QTRA 2DA2A 2M8GX 3IH2A 1MNMC 5F27A 3LNQA 4B4CA 1MH3A 2CQXA 1MH4A 2JA8J 2RAEA 2M9HA 4DW6A 5HODA 2JWTA 2HOTA 1MBGA 2E2HJ 3A01A 3HOWJ 2DA7A 1ENHA 4I6ZA 1NK2P 3S15J 1UMQA 2CU7A 1AHDP 3K7AJ 4V2FA 3BQZA 4V2GA 1H8AC 4IHWA 2XPVA 4MFEA 4D5CA 5M5YJ 3CCYA 2JJ7A 1HLVA 3FIWA 3GTLJ 4XICA 1RR7A 2NS8A 3QPSA 4A3LJ 1I3QJ 4XIDA 3S16J 1IG7A 2LVSA 5EG0B 1MSFC 1U78A 5C3EJ 4A3GJ 4RDUA 4MLOA 4A3DJ 5DTDA 4RBOA 3ZQLA 2VKEA 2R92J 5K7ZA 1RKTA 3LSJA 2DA5A 2VPRA 1ETKA 2P81A 1HDDC 5IOZA 3FK7A 5J1RA 1APLC 3B6AA 2NVXJ 3RZDJ 2DMNA 4W97A 1A5JA 3JRFA 1GVDA 2DA1A 1U8BA 2R5ZA 3S1QJ 2HYJA 3HOVJ 5E3LA 1Z0XA 3S2HJ 5IYDJ 1B8IA 3IV5A 1HOMA 1JGGA 1B72B 4W1UA 2IAIA 2O8KA 5EZGA 3HGGA 5EZHA 3TW7A 2GBYA 1IRZA 1ZGWA 2MW8A 4MO7A 4M6VA 5K7FA 1FIAA 4A3CJ 1D5YA 1IJWC 3JREA 5DS9A 2HDDA 3LSGA 4JX5A 4J19A 1WI3A 5F0CA 1ZTRA 1X58A 2KDZA 3HDDA 2X48A 4A3KJ 2JA7J 4IHXA 1F36A 2N8GA 1QPIA 3M3YJ 3LOCA 4G12A 3OOUA 1S7EA 1SANA 1FIPA 2NS7A 1MBJA 5EGOB 1O4XA 5EDNA 4IHYA 3S2DJ 4CYCA 1MBEA 3G1OA 2X6OA 3HOUJ 1IC8A 3BTCA 1WH7A 2X9DA 3QPLA 3FKIJ 4FE7A 1G2HA 1XG1A 3HKZN 4QSHA 1TC3C 3Q0UA 2HXOA 4XK4A 1AKHB 2DMPA 2WV1A 3JRHA 2XB5A 3GTGJ 1ETOA 1BJZA 3GTJJ 1VNDA 2K9SA 2HI3A 3GTKJ 1UG2A 1T56A 3BTLA 1E3OC 3A03A 3C2BA 2XRLA 2L9RA 3WHCA 5FKKA 2L7ZA 1QRYA 2CJJA 2ECCA 5GPAA 3BT9A 5FLMJ 3HOXJ 3ZQFA 1FJLA 2M34A 3ZQIA 2NVQJ 1ORKA 3HEFA 4XRSG 1IUFA 4UUTA 2R5YB 2GLOA 2DJNA 5C44J 1MBHA 2GM4A 1JKQC 1HF0A 2CUFA 4MFDA 1JUPA 3JRCA 1YRNA 4X1EA 3I4NJ 5FKMA 5J3LA 4M3GA 3TP0A 2M2EA 1UHSA 2JN6A 2K40A 3BR1A 2O9LA 1I50J 2HOAA 4C3JJ 1B8IB 2XPUA 5FJ8J 2AO9A 5F1JA 2R0QC 2ZB9A 1ZQ3P 2E2JJ 3RQIA 1BW5A 1MBFA 1R9TJ 1F43A 1IV6A 1OJLA 2JA6J 3F0CA 1BL0A 1ZK8A 2EZHA 3TP3A 4IHVA 1P7JA 3W6VA 2I10A 4UUSA 1P7IA 1XC5A 2VKVA 4HNVA 1IDYA 1DU0A 4DYRA 1U9NA 4AC0A 2LR8A 2KT0A 2LKXA 3GBGA 5F0FA 2NVTJ 1LFBA 3VPRA 2Y9ZA 3L1PA 3S1NJ 3JRDA 2MGQA 4CYCB 3K2AA 1ETXA 1T33A 3GTMJ 3TEDA 3E7LA 1GUUA 4BBRJ 1HDPA 1TWHJ 2EH3A 3BQYA 2LK2A 4M3BA 2XPWA 5GPCA 1WGXA 3BR6A 3FISA 1OCPA 2DMQA 3I4MJ 3NAUA 4A69C 4M3DA 3A02A 5J1UA 4Y7NJ 1BW6A 3FK6A 1GDTA 4BY1J 2DTZA 2D5VA 1JT6A 1RPWA 1FTZA 1U9OA 1ZR4A 3S14J 1I6HJ 3HM5A 2LP0A 1MSEC 2DMUA 2Y31A 3JRIA 1X2MA 3SDGA 1NTCA 3O8HA 4QIWN 3PO2J 2WB1N 2WAQN 1ETYA 1JTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O7O A;  5FLV A;  1TWF J;  1JKR C;  1BA5 A;  4D7M A;  1JJ8 C;  1YRN B;  2DA3 A;  3G1L A;  2XB0 X;  4AYB N;  2FQ4 A;  5IP6 A;  3Q0W A;  3BTI A;  2CUE A;  2FJ1 A;  4B1R A;  2Y0S N;  3A01 B;  2H1K A;  5M3F J;  2HQ5 A;  1QVT A;  1IDZ A;  1ZR2 A;  1WH5 A;  1CQT A;  4C2M J;  2FD5 A;  3OSG A;  5J1Y A;  2OPT A;  3GTQ J;  1JKP C;  1LFU P;  2PMZ N;  3G1M A;  4DZJ A;  4A93 J;  2OF7 A;  4D5F A;  2M0C A;  4C3I J;  5FKN A;  4Y52 J;  2DN0 A;  4FTH A;  3HGY A;  4UUS B;  3OIO A;  3B6C A;  3CMY A;  5JLW A;  2QCO A;  4DYC A;  2QF7 A;  3SJM A;  3JR9 A;  5IP9 J;  3HBL A;  9ANT A;  5F04 A;  1ITY A;  3MVP A;  3GTP J;  2XGD A;  5F08 A;  2B63 J;  2VUM J;  2DA4 A;  2E1O A;  3SFI A;  3JRA A;  1HCR A;  3TW6 A;  5EF6 A;  4A3B J;  1ETQ A;  3BG3 A;  1LE8 A;  3HOY J;  2TRT A;  4A3E J;  1GV2 A;  2K9Q A;  2R5Z B;  1JJ6 C;  2E2I J;  1OFC X;  4BKX A;  1OCT C;  5GP9 A;  5C4X J;  3BG9 A;  4BXX J;  1JUM A;  3HB9 A;  2JA5 J;  1Y1V J;  3DEW A;  2R93 J;  1ETV A;  1VI0 A;  2L7M P;  3S1M J;  2Y2Z A;  3QQA A;  5JLX A;  5M5W J;  3BR5 A;  1SFO J;  4FIS A;  1TWA J;  2Y9Y A;  4A3J J;  1JTX A;  4D7N A;  4GFB A;  3M4O J;  2HOS A;  1Q1V A;  2ID6 A;  4JX4 A;  2YS9 A;  1AKH A;  4A3I J;  1X2N A;  5IPA A;  1MBK A;  1ETW A;  4M3E A;  4XRS A;  4I76 A;  2HXI A;  4AUX A;  2FX0 A;  3S1R J;  3BR0 A;  1POG A;  2AHQ A;  4B3A A;  2JK3 A;  3D1N I;  5IYB J;  5F0H A;  3ZQH A;  4L5E A;  3ZQC A;  3MN2 A;  5IOY A;  4EEF G;  2R7Z J;  4C3H J;  1NK3 P;  2EZI A;  4A3F J;  3S17 J;  1QVU A;  3GTO J;  2TCT A;  4A3M J;  3DCF A;  2JMW A;  2ME0 A;  2EQR A;  1K83 J;  2E19 A;  3H3V K;  1FEX A;  1A6I A;  1DU6 A;  1RET A;  1TWG J;  2COB A;  2R5Y A;  5BNG A;  2NVY J;  3BR2 A;  3MKL A;  3IH4 A;  3HOZ J;  1PUF A;  2W48 A;  4JP0 A;  2CQQ A;  5E3M A;  3PO3 J;  2LLK A;  2EBI A;  1W0U A;  5FKL A;  1K61 A;  3LSR A;  5EEA A;  4IEJ A;  3ZQG A;  5E3O A;  3H0G J;  3IH3 A;  2ELK A;  2L0K A;  5M5X J;  1WCM J;  4FCY A;  2Y30 A;  2MSY A;  4JYK A;  4S0H B;  4XRM A;  1LE8 B;  2MG4 A;  1IGN A;  3BTJ A;  3UKG A;  1RES A;  3WHB A;  5M3M J;  1ZKG A;  3OSF A;  3CQZ J;  2DA6 A;  2YUS A;  2XGE A;  5EG0 A;  2ID3 A;  1EF4 A;  4ABZ A;  1JT0 A;  3RKQ A;  5IYC J;  2YU9 J;  4X6A J;  2XSD C;  5E3N A;  3Q3S A;  5K7H A;  2DMT A;  2XGC A;  1TWC J;  2LY9 A;  1XS9 A;  1JUS A;  1AU7 A;  4DYQ A;  3JRB A;  5FKO A;  2IBD A;  3CDL A;  1GV5 A;  1RKW A;  1Z77 A;  1Y1W J;  1H89 C;  2G0E A;  5C4J J;  1B72 A;  3O8G A;  2ME6 A;  2L7F P;  2CRG A;  1H88 C;  3BR3 A;  2ECB A;  2EZL A;  2H8R A;  4JX6 A;  1GT0 C;  3RZO J;  4BY7 J;  1FTT A;  1WPK A;  3JRG A;  3BG5 A;  3NAR A;  2EZK A;  4M3F A;  4BBS J;  2IEK A;  5EYR A;  4DZP A;  5IP7 J;  1VFC A;  1W0T A;  1VF9 A;  3LSP A;  3ZOB A;  1JKO C;  3Q0V A;  2LTP A;  2VI6 A;  4MIM A;  4FE4 A;  4LOC A;  2LFB A;  1PUF B;  5EGO A;  2LD5 A;  2K9N A;  3PM1 A;  2NOG A;  4NDL A;  4QTR A;  2DA2 A;  2M8G X;  3IH2 A;  1MNM C;  5F27 A;  3LNQ A;  4B4C A;  1MH3 A;  2CQX A;  1MH4 A;  2JA8 J;  2RAE A;  2M9H A;  4DW6 A;  5HOD A;  2JWT A;  2HOT A;  1MBG A;  2E2H J;  3A01 A;  3HOW J;  2DA7 A;  1ENH A;  4I6Z A;  1NK2 P;  3S15 J;  1UMQ A;  2CU7 A;  1AHD P;  3K7A J;  4V2F A;  3BQZ A;  4V2G A;  1H8A C;  4IHW A;  2XPV A;  4MFE A;  4D5C A;  5M5Y J;  3CCY A;  2JJ7 A;  1HLV A;  3FIW A;  3GTL J;  4XIC A;  1RR7 A;  2NS8 A;  3QPS A;  4A3L J;  1I3Q J;  4XID A;  3S16 J;  1IG7 A;  2LVS A;  5EG0 B;  1MSF C;  1U78 A;  5C3E J;  4A3G J;  4RDU A;  4MLO A;  4A3D J;  5DTD A;  4RBO A;  3ZQL A;  2VKE A;  2R92 J;  5K7Z A;  1RKT A;  3LSJ A;  2DA5 A;  2VPR A;  1ETK A;  2P81 A;  1HDD C;  5IOZ A;  3FK7 A;  5J1R A;  1APL C;  3B6A A;  2NVX J;  3RZD J;  2DMN A;  4W97 A;  1A5J A;  3JRF A;  1GVD A;  2DA1 A;  1U8B A;  2R5Z A;  3S1Q J;  2HYJ A;  3HOV J;  5E3L A;  1Z0X A;  3S2H J;  5IYD J;  1B8I A;  3IV5 A;  1HOM A;  1JGG A;  1B72 B;  4W1U A;  2IAI A;  2O8K A;  5EZG A;  3HGG A;  5EZH A;  3TW7 A;  2GBY A;  1IRZ A;  1ZGW A;  2MW8 A;  4MO7 A;  4M6V A;  5K7F A;  1FIA A;  4A3C J;  1D5Y A;  1IJW C;  3JRE A;  5DS9 A;  2HDD A;  3LSG A;  4JX5 A;  4J19 A;  1WI3 A;  5F0C A;  1ZTR A;  1X58 A;  2KDZ A;  3HDD A;  2X48 A;  4A3K J;  2JA7 J;  4IHX A;  1F36 A;  2N8G A;  1QPI A;  3M3Y J;  3LOC A;  4G12 A;  3OOU A;  1S7E A;  1SAN A;  1FIP A;  2NS7 A;  1MBJ A;  5EGO B;  1O4X A;  5EDN A;  4IHY A;  3S2D J;  4CYC A;  1MBE A;  3G1O A;  2X6O A;  3HOU J;  1IC8 A;  3BTC A;  1WH7 A;  2X9D A;  3QPL A;  3FKI J;  4FE7 A;  1G2H A;  1XG1 A;  3HKZ N;  4QSH A;  1TC3 C;  3Q0U A;  2HXO A;  4XK4 A;  1AKH B;  2DMP A;  2WV1 A;  3JRH A;  2XB5 A;  3GTG J;  1ETO A;  1BJZ A;  3GTJ J;  1VND A;  2K9S A;  2HI3 A;  3GTK J;  1UG2 A;  1T56 A;  3BTL A;  1E3O C;  3A03 A;  3C2B A;  2XRL A;  2L9R A;  3WHC A;  5FKK A;  2L7Z A;  1QRY A;  2CJJ A;  2ECC A;  5GPA A;  3BT9 A;  5FLM J;  3HOX J;  3ZQF A;  1FJL A;  2M34 A;  3ZQI A;  2NVQ J;  1ORK A;  3HEF A;  4XRS G;  1IUF A;  4UUT A;  2R5Y B;  2GLO A;  2DJN A;  5C44 J;  1MBH A;  2GM4 A;  1JKQ C;  1HF0 A;  2CUF A;  4MFD A;  1JUP A;  3JRC A;  1YRN A;  4X1E A;  3I4N J;  5FKM A;  5J3L A;  4M3G A;  3TP0 A;  2M2E A;  1UHS A;  2JN6 A;  2K40 A;  3BR1 A;  2O9L A;  1I50 J;  2HOA A;  4C3J J;  1B8I B;  2XPU A;  5FJ8 J;  2AO9 A;  5F1J A;  2R0Q C;  2ZB9 A;  1ZQ3 P;  2E2J J;  3RQI A;  1BW5 A;  1MBF A;  1R9T J;  1F43 A;  1IV6 A;  1OJL A;  2JA6 J;  3F0C A;  1BL0 A;  1ZK8 A;  2EZH A;  3TP3 A;  4IHV A;  1P7J A;  3W6V A;  2I10 A;  4UUS A;  1P7I A;  1XC5 A;  2VKV A;  4HNV A;  1IDY A;  1DU0 A;  4DYR A;  1U9N A;  4AC0 A;  2LR8 A;  2KT0 A;  2LKX A;  3GBG A;  5F0F A;  2NVT J;  1LFB A;  3VPR A;  2Y9Z A;  3L1P A;  3S1N J;  3JRD A;  2MGQ A;  4CYC B;  3K2A A;  1ETX A;  1T33 A;  3GTM J;  3TED A;  3E7L A;  1GUU A;  4BBR J;  1HDP A;  1TWH J;  2EH3 A;  3BQY A;  2LK2 A;  4M3B A;  2XPW A;  5GPC A;  1WGX A;  3BR6 A;  3FIS A;  1OCP A;  2DMQ A;  3I4M J;  3NAU A;  4A69 C;  4M3D A;  3A02 A;  5J1U A;  4Y7N J;  1BW6 A;  3FK6 A;  1GDT A;  4BY1 J;  2DTZ A;  2D5V A;  1JT6 A;  1RPW A;  1FTZ A;  1U9O A;  1ZR4 A;  3S14 J;  1I6H J;  3HM5 A;  2LP0 A;  1MSE C;  2DMU A;  2Y31 A;  3JRI A;  1X2M A;  3SDG A;  1NTC A;  3O8H A;  4QIW N;  3PO2 J;  2WB1 N;  2WAQ N;  1ETY A;  1JTY A; 
#chains in the Genus database with same CATH topology
 1UZC A;  2O7O A;  3H5N A;  1JKR C;  2HQR A;  1JJ8 C;  3MZ8 A;  2ICW G;  2PLY A;  1IXR C;  3OYJ A;  1DQU A;  3SDB A;  1BR4 A;  3CCV I;  1N25 A;  4AU7 A;  3BDD A;  1OYY A;  2KLO A;  2FJ1 A;  2Y0S N;  1OCZ H;  1IO2 A;  3KZY A;  2HQ5 A;  1MJA A;  1WH5 A;  3OV8 A;  3LSM A;  3OL4 A;  1G3Y A;  1STZ A;  4U88 A;  3EQL F;  3OOP A;  5J1Y A;  3GTQ J;  2M4K A;  1KYW A;  4XNF A;  5LBQ A;  4YFN F;  2BEO A;  3RJP A;  4A0X A;  3WTY C;  1LDK B;  3OWT A;  2M0C A;  3R4K A;  2GIV A;  2P6S A;  3HKZ A;  4FTH A;  3VYU B;  3B6C A;  4LD5 A;  4RM2 A;  2QCO A;  1MMN A;  2DQL A;  5D6E A;  3HBL A;  3KP2 A;  2F4I A;  4ZDL A;  3GTP J;  2RNJ A;  2BGC A;  1S29 A;  2DBB A;  4F52 A;  3PFI A;  3SFI A;  3TW6 A;  4A0Y A;  5IT3 A;  1ETQ A;  3GX4 X;  4HSR A;  2EFW A;  2AS5 F;  2HPM A;  2LC2 A;  2E5Z A;  2QZ8 A;  3VYT B;  3J80 K;  1FC3 A;  2E1C A;  5GAD J;  5CQE A;  5F6F A;  3TMO A;  1K4S A;  1V54 H;  1NG6 A;  4U87 A;  2DT5 A;  1G8X A;  1SAX A;  3HB9 A;  2JA5 J;  1Y1V J;  5KAF C;  4HNU A;  4IQJ A;  1YTY A;  1O3Q A;  3K2Z A;  4O5V A;  3JCU C;  1EA3 A;  5D5V B;  3HOS A;  2CV1 A;  3H9Q A;  1S3J A;  1VQN I;  4A3J J;  1BI2 A;  1RNL A;  1O3S A;  4BXU A;  3OYI A;  4KN4 X;  5DEQ A;  1XGM A;  1BOB A;  4D1Q A;  1MBK A;  3T0Y A;  4PSX A;  2DU9 A;  4M3E A;  5HLI A;  1TQM A;  1U5T A;  2V1X A;  3OYG A;  3MKW B;  2ISZ A;  1W5C C;  4HPQ A;  1E2X A;  1XX5 A;  2FX0 A;  3BR0 A;  3IWZ A;  4G7O F;  5CVR A;  4G9Y A;  2R4G A;  4B3A A;  4PJL A;  1R22 A;  3WTS C;  5IYB J;  4L0Z B;  3WU2 C;  3HHG A;  3ZQC A;  2HNH A;  3CO7 C;  2JUC A;  4BU2 A;  2E7W A;  4EEF G;  4AIJ A;  3CCE I;  4ANJ A;  2HTS A;  1EKE A;  4A3M J;  3QPT A;  3DCF A;  2JMW A;  3FM3 A;  2EPF A;  3KEY A;  3D5S C;  1I27 A;  1K83 J;  4E70 A;  1RI7 A;  2ZSH B;  2H8W A;  1TWG J;  4AIK A;  2D2W A;  5FFX A;  5B3S H;  3BR2 A;  3MKL A;  3IH4 A;  2W48 A;  3WG9 A;  4JP0 A;  5F1R A;  5E3M A;  2QSH X;  3CCU I;  2LDU A;  2LLK A;  2F5E A;  1HSJ A;  1KQ9 A;  2XKP A;  1U3E M;  2HR3 A;  3V42 A;  3MZY A;  4EVI A;  1BC8 C;  3LSR A;  3HTU A;  1YI2 I;  2K02 A;  1MKM A;  2M3A A;  5JR3 A;  3DEE A;  3FF5 A;  4L5J A;  1P6R A;  2X6X A;  2VON A;  3IH3 A;  3IKT A;  1S72 I;  2MC3 A;  3H3Z A;  2VXD A;  2L0K A;  2F2E A;  4M74 A;  1LJ9 A;  4PK4 A;  2Y30 A;  4XRM A;  1MMA A;  4Q47 A;  1FOY A;  2BY0 A;  5E18 F;  2IS2 A;  3M07 A;  2YPR A;  1ZKG A;  2F48 A;  4ETS A;  4ENN A;  2CQN A;  2CS3 A;  1VQP I;  1E3P A;  1YS7 A;  1EF4 A;  5CVJ A;  4L9T A;  1Z91 A;  2ADU A;  4U7D A;  2P0W A;  2XSD C;  3CUQ A;  5E3N A;  1MJB A;  2XGC A;  5ILU A;  3U1D A;  2LY9 A;  3REO A;  1UHW A;  4KNY A;  4CCL A;  1W7P B;  2GQQ A;  1JUS A;  3DTE A;  3I59 B;  1HKS A;  2NYX A;  4DYQ A;  5FKO A;  2IBD A;  2K3P A;  3CDL A;  2DDA A;  2MH2 A;  3E0J B;  4OIN F;  5CVI A;  1PP8 F;  1UFM A;  4KYW A;  1OCC H;  4Y3O A;  3MFK A;  4CCO A;  3FMS A;  2X0L A;  3CCL I;  2C6Y A;  2QKL B;  3H35 A;  1R7J A;  2CRG A;  2EK5 A;  2GA1 A;  2IGN A;  3R61 A;  1VQ4 I;  4ZDO A;  4XRF A;  4BL0 B;  2KKO A;  1FTT A;  1WPK A;  3BG5 A;  3MQ0 A;  4P96 A;  4PJJ A;  3V7R A;  4M3F A;  4B8X A;  2QSF X;  3JAM Z;  2GXG A;  3GF2 A;  2A3S A;  4PFP A;  1FYK A;  1M1E B;  1WSU A;  1JKO C;  3LFK A;  3LSH A;  5E1X A;  2EWN A;  2VI6 A;  4XLP F;  4F55 A;  4I2O A;  1WJC A;  1S8N A;  2D1V A;  3FXO A;  4P5O A;  4NC6 A;  2OV7 A;  4XLH A;  2LBF A;  1PUF B;  1FOW A;  1Y6I A;  3OL3 A;  2PX9 A;  4NDL A;  4QTR A;  2NOG A;  3QP5 A;  4ZZL A;  1TNS A;  4M6X A;  3LNQ A;  2VKD A;  1DP7 P;  3I71 A;  4CA0 A;  3O3K A;  3BCA A;  2W82 A;  2RKH A;  5HOD A;  2JWT A;  5FB2 A;  2M87 A;  3E6D A;  3G73 A;  1MDM B;  3S15 J;  1W5S A;  3WGH A;  4IOC F;  4V2F A;  2WC2 A;  4LIU A;  2LG4 A;  1SFK A;  4V2G A;  1A31 A;  4IHW A;  2XPV A;  1FWZ A;  3CCY A;  2JJ7 A;  2K86 A;  3GTL J;  3GLL A;  2BY1 A;  1U5T C;  1ODD A;  3NWT A;  3RYP A;  2J5P A;  3TBI A;  4EM2 A;  3E6C C;  3F6V A;  3S16 J;  1QQI A;  4HZF A;  5EG0 B;  2PN6 A;  3QU6 A;  4LLG F;  5C3E J;  1JXS A;  2DK8 A;  3I0T A;  2ZXJ A;  1UCR A;  3K4M A;  2HS5 A;  4RBO A;  4ZC3 A;  1EJ9 A;  5TGT A;  2V1D A;  4RM3 A;  2CFX A;  2DA5 A;  2VPR A;  2DXI A;  1T2K A;  4HF2 A;  3ZR8 X;  3GFJ A;  3ZN0 A;  1K6O A;  1FYL A;  3AG4 H;  3RZD J;  1B59 A;  1D8K A;  2DMN A;  4HBL A;  4ZJZ A;  2IRF G;  2E1M B;  4BJT A;  1JGG A;  3K0L A;  4W1U A;  2O8K A;  1TLH B;  2MW8 A;  1O3R A;  2EIM H;  3F3X A;  4G7Z F;  1R1V A;  1FIA A;  5L3C A;  2EFO A;  2PI0 A;  1IJW C;  3ECO A;  3NWS A;  1BBY A;  3RPQ A;  4JX5 A;  3I56 I;  3V4G A;  2KDZ A;  1U2W A;  1XB4 A;  2ZKZ A;  3F23 A;  1XN7 A;  3BZC A;  1S7E A;  4OAY A;  1Y8Q B;  5EGO B;  1X19 A;  3JTH A;  1O4X A;  4PJN A;  1FOK A;  2EIL H;  2DJI A;  3S2D J;  1X1A A;  3IAS 2;  3CCS I;  2OAZ A;  3BTC A;  3HIF A;  1G2H A;  3BP8 A;  3OR1 C;  4QSH A;  1TC3 C;  1GLN A;  3ELK A;  1KON A;  3RI4 A;  2OTL I;  3K1N A;  2OZ6 A;  3PL8 A;  4II3 A;  3VSL A;  4B3X A;  4CO8 A;  3I55 I;  5HS8 A;  3HOT A;  3OY9 A;  4IHS A;  3GTG J;  1QZZ A;  2VT2 A;  2PFB A;  1BJZ A;  1R58 A;  5KAI C;  2K9S A;  2CUZ A;  4G7H F;  4WCG A;  1P4W A;  3ABL H;  5J40 A;  3A2K A;  4XLA A;  1XMX A;  3PSI A;  3U2R A;  1E3O C;  2LH9 A;  2VBY A;  3A03 A;  1OCR H;  2VJJ A;  1PDN C;  2GOX B;  2L9R A;  2IA2 A;  2FNA A;  5AON A;  3ZQF A;  3ZQI A;  1SVL A;  2ZBK A;  3HEF A;  4NBQ A;  4I0A A;  2R7S A;  1SVM A;  2H6C A;  1UAA A;  4KN7 X;  2L4A A;  2W84 A;  2KQR A;  2GM4 A;  2CUF A;  4MFD A;  4X0G A;  2BZT A;  1JI8 A;  5FKM A;  3CF2 A;  5J3L A;  2JN6 A;  2K40 A;  5ICG A;  3BR1 A;  5CVU A;  2KZV A;  1RUO A;  2VAS A;  3K4K A;  2BVL A;  2E2J J;  1W5T A;  2JA2 A;  2EB7 A;  4E7H A;  2W1O A;  1BM9 A;  3Q9V A;  2I8D A;  2IGO A;  1YIO A;  3QOP A;  1R9T J;  3F72 A;  3IUO A;  1T98 A;  3TO6 A;  3F0C A;  1BL0 A;  2YX7 A;  3IC7 A;  2EZH A;  3TP3 A;  1W7P A;  3JTG A;  1P7J A;  1WJA A;  5HDK A;  2I10 A;  2BVM A;  5D4R A;  1XC5 A;  2DFE A;  4LJZ F;  4BJ5 C;  1DU0 A;  5D8K B;  2A5W A;  2W25 A;  1LB2 A;  1DGW Y;  4MTD A;  2LKX A;  4P9F A;  2RGV A;  5F0F A;  2CV2 A;  4A6E A;  4BAC A;  1OLT A;  1K4T A;  1T33 A;  4EAT A;  1RRJ A;  3GTM J;  3T1B A;  3SYT A;  3J7A Y;  5E8G A;  4BBR J;  4EJU A;  2V7F A;  1B9M A;  3DTK A;  1B9N A;  3G4S I;  1ZH5 A;  4BAY A;  2XPW A;  2KRH A;  2FML A;  3HPH A;  3AG3 H;  4E7S A;  3BR6 A;  1WGX A;  2E60 A;  1FNN A;  2ZJ2 A;  3FIS A;  2X1D A;  2DMQ A;  2NAZ A;  3CME I;  4KDP A;  3FXK A;  1WJE A;  3NAU A;  3PNV A;  4Y15 A;  5J1U A;  1LPQ A;  3JSO A;  5HS7 A;  4Y7N J;  2NXN B;  3LMM A;  4NB5 A;  4XLF A;  3ZCO A;  2AXT C;  2L7K A;  4BY1 J;  3F8M A;  2PJR B;  2D5V A;  3ZQ7 A;  3HHH A;  2QQB A;  2CQK A;  2LOO A;  4CXF A;  2VOP A;  1FTZ A;  4U7B A;  3KZZ A;  2QWW A;  3HM5 A;  1FX7 A;  4LFU A;  4LIV A;  3N05 A;  3KEQ A;  2V9K A;  4DBR A;  1GVJ A;  3JRI A;  4N4O B;  4QIW N;  2O8X A;  2O03 A;  2WAQ N;  4BDZ A;  1MDM A;  2QQA A;  3DFG A;  2DYS H;  2EFQ A;  1JTY A;  1A36 A;  4D7M A;  4JK1 X;  2OBP A;  1YRN B;  2O5R A;  4CUG A;  1BA5 A;  2DA3 A;  2JPC A;  3G1L A;  3I3L A;  4EQQ A;  4MNU A;  4KJZ A;  3RCO A;  4B48 A;  2FQ4 A;  1YW7 A;  2P8T A;  1PP7 U;  4XBF A;  3BTI A;  1WJD A;  1K78 A;  3A01 B;  3V7C A;  5M3F J;  3DU5 A;  2RQP A;  2KRC A;  1CQT A;  2VJI A;  2WB1 A;  3OSG A;  4M73 A;  5ERI A;  4EV0 A;  1JKP C;  2M45 A;  3TDZ C;  1FMV A;  3HOX J;  1UB9 A;  1QA6 A;  1IF1 A;  2COM A;  2I5U A;  4IHT A;  4DZJ A;  4A93 J;  3BJ6 A;  4F7Z A;  2RV8 A;  4RB2 C;  3KFW X;  5FKN A;  4Y52 J;  1HKT A;  4UVB A;  3TL4 X;  1USS A;  3OIO A;  4YEL A;  4AYB A;  3M1E A;  3LWF A;  1LEA A;  3BJA A;  3K70 C;  2BW3 B;  1RUN A;  2Q1Z B;  3LQR A;  3JR9 A;  5IP9 J;  9ANT A;  2XAU A;  4LB6 B;  1ITY A;  4XSZ F;  3HRS A;  2K9M A;  2FMY A;  4JOM A;  3KP4 A;  1XMK A;  3PIO F;  1L3L A;  3M1C A;  2DA4 A;  2QSG X;  3F8F A;  1HCR A;  3HOY J;  2TRT A;  3LA2 A;  5E20 A;  3D5R C;  4Q5S F;  2FE3 A;  4OIR F;  2K9Q A;  2ZJQ F;  2R5Z B;  3RKX A;  1JJ6 C;  2E2I J;  4PSW A;  5FRO A;  1OFC X;  4B44 A;  4KFC A;  3BG9 A;  4QPQ A;  2FEZ A;  1JUM A;  4HX4 A;  2J5O A;  2XSJ C;  3C1D A;  4P1W A;  3OYB A;  3S3N A;  1VQL I;  2UXN A;  3S1M J;  3KP3 A;  3COA C;  3P9I A;  3LFU A;  1OIS A;  3BR5 A;  1SFO J;  1EH8 A;  4FIS A;  5DM7 F;  4BJ6 C;  4D7N A;  3M4O J;  2HOS A;  3H5A A;  5BOX A;  4IOA F;  1SAU A;  1YQA A;  1X4O A;  4A3I J;  2OD5 A;  2O6G E;  1TW2 A;  1TZL A;  3H1C A;  4BNC A;  1AWC A;  1IN5 A;  1QPM A;  2AQF A;  2PMH A;  1FSH A;  2KMU A;  2HXI A;  1TNT A;  1YG2 A;  1MIJ A;  1D1C A;  4A6D A;  4AUX A;  3S1R J;  1T38 A;  1J5Y A;  2AHQ A;  1F1Z A;  1XDS A;  2WV0 A;  3UR3 C;  3OS1 A;  2HQA A;  2BY2 A;  2R7T A;  1OYW A;  2LF7 A;  5F0H A;  3VB2 A;  2W57 A;  4LB5 A;  3BPV A;  1HXD A;  5IOY A;  2STT A;  5J4V A;  2LY1 A;  2Y48 A;  3C3W A;  2BV6 A;  1U6G A;  4C3H J;  2TCT A;  3L09 A;  2Y69 H;  1QNT A;  3KYL A;  1PYV A;  5HLH A;  1IN7 A;  3DPU A;  2E19 A;  4HV6 A;  4LK1 F;  1A6I A;  3VEP A;  1RET A;  1DU6 A;  2X6Y A;  3LL7 A;  3U1K A;  4PJM A;  4XKC A;  5BNG A;  4E6K G;  2DLL A;  2NVY J;  3ERM A;  2IP2 A;  1ZYR F;  3WU0 A;  2KPM A;  1R1U A;  5EEH A;  4G6T B;  4WK8 F;  2NOJ B;  3PNT A;  5CLS A;  3HSF A;  1EH6 A;  2EBI A;  1YW8 A;  5HDG A;  1J2X A;  2ZNZ A;  2OC6 A;  4Y4R A;  1W1W E;  2H1L A;  3GYH X;  4CZZ A;  2DK5 A;  5JVG F;  2CQ7 A;  3I58 A;  1A6Q A;  1QBJ A;  2QBY A;  2A6E F;  2KHM A;  3WOD F;  5J47 A;  2X4H A;  2IVM A;  2CFO A;  3AL0 B;  1XD7 A;  2MSY A;  3QP6 A;  4HW0 A;  1JHH A;  3MEX A;  1LE8 B;  2MG4 A;  4A5N A;  3LAP A;  5HDN A;  3IRQ A;  1RES A;  2OA4 A;  4AVP A;  2VQL A;  2QEN A;  3CJN A;  4OWR B;  4N9I A;  1XCV A;  5H6Q A;  2GIZ A;  2A6H F;  4E7K A;  3GCM A;  3BY6 A;  2ETH A;  2ESN A;  4UY8 I;  4R79 A;  2YU9 J;  2DFH A;  4V19 K;  2WAQ A;  4X6A J;  1ZLJ A;  4UHT A;  3Q3S A;  4PUS A;  1EH7 A;  2KIF A;  3A4C A;  3GME A;  2VE9 A;  1XS9 A;  1P2F A;  1HW1 A;  1ZAR A;  4IRH A;  4LIT A;  4HYE A;  1UST A;  1I1S A;  2L5Q A;  2VPL A;  1AU7 A;  3L2V A;  1Z05 A;  3JRB A;  2VC0 A;  4BEH B;  1BI3 A;  3S2W A;  4E7L A;  1RKW A;  2QGU A;  1R49 A;  5KK1 A;  2DOD A;  2CV0 A;  2V1N A;  4C2T A;  3J7A O;  4M9X A;  1N75 A;  2M8E A;  4CH7 A;  2E71 A;  3FXU A;  3BR3 A;  2EZL A;  1ZLK A;  2H8R A;  4JX6 A;  5CQG A;  1TT5 B;  4CCK A;  1OPC A;  3RZO J;  4BY7 J;  2E1M C;  2LSO A;  1RR8 C;  4HF1 A;  1R23 A;  3GZ6 A;  2IT0 A;  3ZMV A;  3NAR A;  1X3U A;  1I5Z A;  2FU4 A;  3L2Q A;  2IEK A;  3PFY A;  4DZP A;  2XVC A;  2D45 A;  4B47 A;  4RAF A;  2YX4 A;  3ZOB A;  5EEG A;  1N77 A;  3Q0V A;  2K9L A;  2KIQ A;  1UEL B;  3PIP F;  3DF8 A;  1G4D A;  3DBH B;  1BI0 A;  3ZMD A;  2R7X A;  2LFB A;  3WU1 B;  1LNW A;  4FET A;  2DA2 A;  2HDW A;  3IH2 A;  1MW7 A;  4OAZ A;  5DCF A;  4R1H A;  1Z6T A;  2HFH A;  2OU2 A;  3DPL C;  2V4J C;  4F91 B;  3DPT A;  4LK0 F;  3ZQQ A;  5D8L B;  2JA8 J;  3GLX A;  3FKJ A;  2HOT A;  2WAD A;  3GUD A;  3PUF A;  3D5L A;  3A01 A;  4I6Z A;  4IQ4 A;  2XRO A;  2CW8 A;  2Z9O A;  1SD7 A;  5TIS C;  2STW A;  1AHD P;  1UJ8 A;  1YJW I;  5E79 C;  2ZFU A;  3E3V A;  1FBQ A;  1H8A C;  5JVT A;  2YU3 A;  4MFE A;  2W00 A;  3DBR B;  5M5Y J;  1RR7 A;  3FZV A;  1IN6 A;  4BHB A;  1IXC A;  1PJR A;  1E17 A;  3ONQ A;  3P9K A;  2DT6 A;  2AXL A;  1FP2 A;  4OU0 A;  5J6X A;  3I5U A;  1FJL A;  1D0Z A;  2DOE A;  1MSF C;  1LVA A;  1P4X A;  4MLO A;  3DKW A;  4RA2 A;  5DTD A;  3ZQL A;  2VKE A;  5TRD A;  2VE8 A;  1V5E A;  4EM1 A;  1WJB A;  5K1Y A;  2P81 A;  5IOZ A;  5J1R A;  1APL C;  1LEB A;  3B6A A;  4U0Y A;  3A1Y A;  3OYF A;  1VZ0 A;  2HWV A;  1W36 C;  3NQO A;  1TP4 A;  1U8B A;  4G94 A;  2R5Z A;  4I09 A;  1P92 A;  3PQK A;  4ESF A;  5IYD J;  2QA4 I;  1HOM A;  3IV5 A;  3L00 A;  1B72 B;  3CLQ A;  4WX9 A;  3EYI A;  5EZG A;  1HA8 A;  3HGG A;  3TW7 A;  2ZXW H;  2DOF A;  4ASN A;  4KIG A;  2R7O A;  1YX3 A;  2M30 A;  4ZYE A;  1KU9 A;  4A3C J;  2JVG A;  2Z5U A;  2DI3 A;  3Q9S A;  1D1B A;  2IS1 A;  3MCZ A;  2HGC A;  2HDD A;  4D0P A;  2Z1D A;  1ZTR A;  1X58 A;  3HDD A;  3HSR A;  1RC9 A;  3T8T A;  5L3F A;  5HLT A;  3OYA A;  4IHX A;  2TDX A;  2N8G A;  5FD5 A;  4BE1 A;  3CC7 I;  2HZT A;  1QPI A;  4G12 A;  3OOU A;  3NEU A;  3CTA A;  1D0Y A;  2NS7 A;  2WY8 Q;  3QYB A;  3RPU D;  3VOE A;  1ZRF A;  4IHY A;  4CYC A;  1MBE A;  2V9P A;  3OYN A;  3ERE D;  2KIM A;  2MH9 A;  3CDI A;  3G71 I;  2X9D A;  1ZRE A;  3HOU J;  3FKI J;  1XG1 A;  3CP2 A;  1K6Y A;  1OKR A;  4HX7 A;  5KNL A;  2V6E A;  3VYR B;  4XK4 A;  3OYE A;  4MTE A;  4LG0 A;  4WXD A;  1YLF A;  3IAM 2;  3ROU A;  4A12 A;  3QOD A;  5L3B A;  4XKW A;  2VOD A;  1E0E A;  1ETO A;  3ASN H;  3GXO A;  4HAM A;  3GTJ J;  1VND A;  4OOI A;  2CSO A;  2HVQ A;  1MNE A;  3GTK J;  2L9V A;  2QYO A;  4DNC A;  1UG2 A;  1ZG3 A;  1HBX G;  3L2W A;  2K85 A;  4I7H A;  4RAG A;  4ENK A;  5FKK A;  4EJW A;  1QRY A;  2M34 A;  4KMU X;  3G2B A;  2P7V B;  2R5Y B;  2M7A A;  1O57 A;  2OQG A;  3H5R A;  3V7S A;  1VTN C;  5AIP A;  3OS0 A;  3PJR A;  5C44 J;  1KU3 A;  3K1P A;  3EPZ A;  3GZN B;  3HXL A;  3JRC A;  4EJT A;  4FX4 A;  3KX2 A;  3KP5 A;  3BCB A;  3I4N J;  2ELH A;  1MD0 A;  2P7C B;  3KZI C;  1AOY A;  3TP0 A;  4IF4 A;  2A05 A;  3RQ4 A;  1YX5 A;  2ZJR F;  2F4O B;  2O9L A;  3K4B A;  3DWL E;  2HOA A;  4KIC A;  3HRT A;  3N4M A;  1B8I B;  4OIO F;  2XAQ A;  4NNJ A;  5F1J A;  2R0Q C;  3F8C A;  2DTR A;  3OR2 C;  4HDV A;  2ZB9 A;  4C2U A;  1ZQ3 P;  1X1B A;  5CPR B;  5FGM A;  2CW0 F;  3H3U A;  5DV5 A;  3K4J A;  1DDN A;  1BW5 A;  4M6Y A;  2A6T A;  2HPI A;  3WTV C;  2W4S A;  2JA6 J;  1IRX A;  1ZK8 A;  1EV7 A;  4CDG A;  1Z6R A;  3DLL F;  4IHV A;  3W6V A;  4BDY A;  4HNV A;  1R6R A;  1WRJ A;  1FMW A;  1YIJ I;  4BEH A;  3W2A A;  4IRI A;  4CGZ A;  2A61 A;  1U9N A;  3RDI A;  5DDG A;  1IRF A;  3K69 A;  3KIO A;  3GBG A;  4MEY F;  4IX7 A;  1HW5 A;  4GGG A;  3S1N J;  1Y56 A;  4HQM A;  3TKY A;  3JRD A;  1IRG A;  3SZP A;  2V1U A;  3E7L A;  5BPD A;  3S3M A;  3ZMZ A;  4RB1 A;  3IHU A;  2IGK A;  4M3B A;  2LK2 A;  4J01 A;  3CO6 C;  1IV8 A;  2G7H A;  3ESW B;  3HUG B;  3A0B C;  3GFI A;  3HRU A;  4WXH A;  2MAB A;  3CCM I;  1O3T A;  1GHC A;  2CWE A;  4M3D A;  3A02 A;  2Z33 A;  3DBL B;  3FK6 A;  1SD4 A;  3SEZ A;  2DTZ A;  1Y0N A;  4RGU A;  3P7N A;  4ESJ A;  3H36 A;  2M5W A;  5HNH A;  1RPW A;  4IXA A;  5FO5 A;  2ZJP F;  1ON2 A;  1ZR4 A;  3S14 J;  2VBX A;  1I6H J;  2X51 A;  2P5L C;  4ZYA A;  1MJ9 A;  4WF2 A;  3CMM A;  3R60 A;  2ELJ A;  3ABT A;  2LP0 A;  1Y0U A;  2XUB A;  5KHD A;  1JGS A;  2M0M A;  1V5G A;  4NC7 A;  2Y31 A;  4FAS D;  3WGI A;  3K4L A;  1SEU A;  3PO2 J;  5H20 A;  1XMA A;  2WB1 N;  1LUJ B;  1J59 A;  1X1C A;  1ETY A;  4C9Y A;  1TBX A;  3QWL A;  5FLV A;  1TWF J;  3MKY B;  2HKX A;  4Q48 A;  4NUB A;  3J80 Z;  3GWZ A;  3T5X A;  2FBK A;  2JQ7 A;  3N97 A;  2XB0 X;  3LA7 A;  4AYB N;  1VQ6 I;  3CZ6 A;  1G6N A;  4YFX F;  3BZK A;  5JFR A;  2QEX I;  3Q0W A;  2HYG D;  2CUE A;  4B1R A;  5F64 A;  3ZN1 A;  1QVT A;  2JZY A;  3BOQ A;  2QKM B;  5DD8 A;  3VFZ A;  1SD5 A;  3F22 A;  1U0J A;  4C2M J;  1T39 A;  1HC8 A;  2OPT A;  2JRT A;  1LFU P;  4RGR A;  1XSX A;  4I01 A;  2CH0 A;  1QZY A;  4F93 B;  3R0J A;  4LLN A;  4KT5 C;  2IXS A;  3G1M A;  2RNG A;  2OF7 A;  1RIO H;  2IW5 A;  4C3I J;  3M8J A;  3HTS B;  4XOP A;  3HGY A;  3C7J A;  3M7G A;  4R8H A;  4UUS B;  1DGR M;  2WWY A;  3B02 A;  3CC4 I;  2VJ4 A;  2K3F A;  4IJA A;  1CF7 B;  5GTI C;  3CMY A;  2Q0O A;  5JLW A;  1ZRD A;  3CD6 I;  3HYI A;  4N9H A;  1O7F A;  4HDU A;  1QHH D;  2UXX A;  3FMQ A;  3MVP A;  4LGW A;  4UVC A;  2B63 J;  2P5V A;  2X1E A;  3DTI A;  3DV8 A;  2E1O A;  5A2Q K;  3JRA A;  2VUM J;  4A3B J;  4MHG A;  4AD9 A;  3M9A A;  4XL9 A;  5HS9 A;  5FD6 A;  2VOO A;  2EV0 A;  3OYK A;  1HW2 A;  1S9H A;  2LKP A;  3E5U A;  5J4Y A;  4BKX A;  1T8I A;  1OR7 C;  2GA2 A;  2MYS A;  1OCT C;  5C4X J;  2DQR A;  3VYS B;  3AL0 C;  4XKV A;  5EJC A;  1CGP A;  4BXX J;  4GCV A;  5FLX Z;  4TV7 A;  3DEW A;  2R93 J;  1FPQ A;  4JQF A;  1BOA A;  2CG4 A;  2ISY A;  2HZD A;  4I99 C;  3CCR I;  1VI0 A;  4XKB A;  2L7M P;  3QYF A;  2Y2Z A;  3I54 A;  3QQA A;  3W2V A;  4KA4 A;  3OYH A;  2EIN H;  1YYV A;  2XAS A;  2LRE A;  2KP6 A;  4M72 A;  2HEO A;  4DIQ A;  3BC8 A;  4I02 A;  2OTJ I;  2ID6 A;  4JX4 A;  3I59 A;  1Z3X A;  1AA7 A;  3BLY A;  5IPA A;  3H9J A;  1VQ9 I;  3FXL A;  3HG9 A;  4KIS A;  5LLQ A;  5B66 C;  1OMI A;  2FOK A;  3MKZ A;  2Y75 A;  3GW2 A;  2L9S A;  3M8F A;  3MN2 A;  5E1Z B;  1YJ9 I;  4YIR X;  2Y0M A;  2L54 A;  2QM3 A;  4I98 B;  1NK3 P;  2R7Z J;  2V6C A;  2ZXH A;  5LEJ A;  2XHK A;  4A3F J;  3LA3 A;  2RN7 A;  5J8C A;  1V3F A;  1QVU A;  1Z21 A;  3K4N A;  2Q8K A;  4KIT B;  4NHJ A;  3EUH A;  2ZNY A;  2KFD A;  4DJA A;  2EQR A;  4DGW B;  2E34 A;  4BHC A;  1F5T A;  1FEX A;  2BBY A;  3BRO A;  2COB A;  2R5Y A;  3BJO A;  3MMY B;  1FY7 A;  3FXJ A;  5GAH J;  3E5Q A;  5HNF A;  3IKV A;  4HA8 A;  4QPO A;  1PUF A;  2CQQ A;  4IL6 C;  3ECH A;  4C30 A;  2PMU A;  1TL8 A;  5FKL A;  2XRN A;  1K61 A;  1N78 A;  3WE2 A;  6PAX A;  3B73 A;  4IEJ A;  3ZQG A;  2XKO A;  3H0G J;  3FX3 A;  2W24 A;  1C0W A;  1ZGA A;  2ELK A;  2EIK H;  3OYD A;  1FOX A;  4FCY A;  2P5K A;  4NC8 A;  4YRV A;  1E3H A;  4JYK A;  2VL8 A;  2DFF A;  3BTJ A;  3LSK A;  3F21 A;  4XSX F;  5M3M J;  1GXQ A;  2M1B A;  5BS6 A;  3CQZ J;  4PFO A;  3OSF A;  3DP7 A;  2YUS A;  2MLK A;  5EG0 A;  2ID3 A;  3S32 A;  3ZPL A;  4ABZ A;  4MQV A;  3J81 Z;  2LRD A;  2R7D A;  1XGO A;  4BQA A;  5IYC J;  5LFA A;  4BQO A;  3I9V 2;  4ZYD A;  3L2C A;  4BXF A;  4U0W A;  5K7H A;  2DMT A;  4WWC A;  1TWC J;  4LLL A;  2NNY A;  4AIH A;  4AWX B;  2LKS A;  4HST A;  2RVC A;  5FRM A;  3P9C A;  1ZN2 A;  1VQK I;  3GVA A;  3AG1 H;  2Z16 A;  1NG7 A;  5IT9 Z;  3Q5F A;  2RDP A;  1D0X A;  1Z77 A;  2V26 A;  3WTW C;  5GAG J;  2CMP A;  1H89 C;  4OIP F;  3R0A A;  4G8X A;  4CZC A;  4IZZ A;  4ENJ A;  4ZTJ A;  5LHI A;  4BQQ A;  1GT0 C;  1J0R A;  2ACJ A;  2F4M B;  1V4R A;  1IN4 A;  4ON0 A;  4ZDP A;  2NNN A;  2EZK A;  1S7A A;  3ML6 A;  3JSP A;  1S5L C;  4BBS J;  2X6W A;  5EYR A;  5IP7 J;  2F5F A;  1R5H A;  1VFC A;  1W0T A;  1VF9 A;  4FQG A;  4M71 A;  3LSP A;  4MIM A;  5D6F A;  1OQY A;  3CUO A;  3TQN A;  3SXY A;  3CCJ I;  5EGO A;  2LD5 A;  1J75 A;  2IA0 A;  4XMY A;  2CYY A;  3TO7 A;  4PCQ A;  5B1A H;  3HL2 A;  3VOD A;  3J7Y J;  2VC1 A;  1MH3 A;  2HQN A;  2CQX A;  3P5J A;  1MH4 A;  2RC4 A;  1V55 H;  4O6J A;  5DCM B;  3BWG A;  4CCN A;  1ERD A;  2M9H A;  1W4M A;  1ON1 A;  1ULY A;  1ZGJ A;  2E2H J;  3HOW J;  2MD0 A;  2W85 A;  3S93 A;  3GFM A;  1UMQ A;  3TOA A;  2P4W A;  4BS9 A;  4B43 A;  2VBW A;  1K79 A;  2DO7 A;  4DBQ A;  5B5E C;  3ABU A;  1QO0 D;  1D1A A;  1G3W A;  2FSW A;  3WTX C;  1DPU A;  2HYF A;  4A3L J;  1I3Q J;  4HEA 2;  2XC7 A;  2DPD A;  4OMY A;  3JAM K;  4ITV A;  1HKQ A;  4H0E A;  4A3D J;  2A07 F;  3CUQ B;  2R92 J;  5D4S A;  5K7Z A;  1RKT A;  2JSC A;  1TTY A;  3LSJ A;  1D5V A;  4II2 A;  1Z9C A;  5L3G A;  3EUH C;  3ZMT A;  2FQ3 A;  5K5Q A;  3SZT A;  1ZEL A;  3VSK A;  4XLN F;  1HDD C;  2ZFW A;  4KIF A;  2WBM A;  4KIB A;  3E6B A;  3WTZ A;  3JRF A;  2XF5 A;  2GWR A;  3S1Q J;  3HOV J;  4OMZ A;  5E3L A;  1Z0X A;  3S2H J;  3RKY A;  2OZU A;  5ED4 A;  3QYE A;  2GBY A;  1IRZ A;  5E1W A;  4M6V A;  5DUI A;  5K7F A;  1Z67 A;  2JSP A;  2MFZ A;  4HOB A;  2DDB A;  4RGX A;  1WQ2 A;  1D5Y A;  2EIJ H;  3JRE A;  2KIU A;  5CKT A;  1Y8R B;  4ZYH A;  4J19 A;  3W6J B;  3ISP A;  4N4N B;  2JA7 J;  4GXO A;  1U8R A;  4EM0 B;  4XQF A;  2B7E A;  1SAN A;  1QU3 A;  2LBF B;  1HST A;  2XDV A;  2VBZ A;  2JRM A;  3G1O A;  2X6O A;  4KUM A;  3OS2 A;  1IC8 A;  1BR1 A;  3QPL A;  4FE7 A;  3RTR A;  1S6L A;  4FT8 A;  4YEJ A;  2DW4 A;  3MAJ A;  1B1B A;  3Q0U A;  5ILS A;  1AKH B;  1ONV A;  2HTJ A;  3CLO A;  3F8B A;  2FBI A;  3AKZ A;  2WV1 A;  1S7O A;  3JRH A;  4OIQ F;  2XB5 A;  3EYY A;  2QUF A;  4HF0 A;  2FRH A;  1B6A A;  4FHT A;  2CW7 A;  2WY7 Q;  3QU3 A;  2KIS A;  3F6O A;  4NQW B;  1SMT A;  2A69 F;  1WVR A;  1T56 A;  2R7W A;  2PJR A;  3BTL A;  2W7N A;  3C2B A;  2BY3 A;  2BHY A;  2XRL A;  3TO9 A;  3ZP5 A;  5BPI A;  1R36 A;  2L7Z A;  1T0F C;  2CJJ A;  2ECC A;  3BT9 A;  2NVQ J;  1IW7 F;  1ORK A;  1D3Y A;  1A35 A;  3KE2 A;  2CUJ A;  4XRS G;  1IUF A;  4S04 A;  3CF5 F;  3OYM A;  3G6E I;  4YFK F;  2MD5 A;  2GLO A;  3RSN A;  2FA5 A;  1H9G A;  2BHZ A;  1D8J A;  1JUP A;  1L0O C;  4UB6 C;  4X1E A;  4E7Z A;  3K6G A;  1YRN A;  3M8E A;  2QLZ A;  3KET A;  3KCC A;  2LYC A;  1UHS A;  3CES A;  3E5X A;  2X85 A;  2MLG A;  2XAH A;  1I50 J;  4C3J J;  5DD4 A;  1DPR A;  2L3D A;  3K70 D;  1LFP A;  5LHH A;  2HDC A;  2PBI A;  3SHF A;  2H09 A;  5LGN A;  3QRF F;  1MBF A;  1IV6 A;  2M7B A;  1OJL A;  5DYM A;  4L5I A;  3F9K A;  5HOO A;  4XON A;  3MWM A;  1B4A A;  1P7I A;  3CDH A;  1MZB A;  3GEZ A;  5H6R A;  4L9N A;  3V8L A;  4ESB A;  4YIF A;  4DYR A;  4IO9 F;  5AIQ A;  2BW3 A;  4AC0 A;  2LR8 A;  2KT0 A;  2Z99 A;  1TQI A;  2Y9Z A;  3VPR A;  1OCO H;  1XDU A;  1ETX A;  4EGZ A;  2R7Q A;  4F92 B;  3FDY A;  5JHU A;  1GXP A;  1HDP A;  1TWH J;  4RAY A;  3D0S A;  3VWB A;  2XV4 S;  2EFP A;  3BQY A;  3OMY A;  3CCQ I;  1G3T A;  3AFH A;  5GPC A;  2M4G A;  5CVV A;  2ZME B;  1IAW A;  3SZG A;  3W6K B;  4KT6 A;  4BUP A;  1FP1 D;  1OCP A;  1G59 A;  3KLO A;  1LVK A;  3HRM A;  3I4M J;  1YS6 A;  4XOR A;  2VN2 A;  3L9F A;  1TQP A;  2P6T A;  4PZJ A;  1BW6 A;  1IZ1 A;  3E1S A;  3O6B B;  3ULQ B;  2PEX A;  5HLG A;  2VQH A;  1Z3Y A;  1W7P D;  2IA1 A;  3MZH A;  3K9T A;  2JT1 A;  5FLX K;  1JT6 A;  3FHN A;  1X1P A;  2H27 A;  2HU9 A;  3AG2 H;  1NHA A;  2DCE A;  5CYV A;  4FX0 A;  1WFX A;  2OUM A;  2GOM A;  2H94 A;  5J8F A;  3LQQ A;  5DCM A;  1Y39 A;  1X2M A;  1NTC A;  3HC7 A;  4CYD A;  2UZK A;  2ZO4 A;  4E7I A;  2L01 A;  1KYZ A;  1T6S A;  3BPX A;  1RZ4 A;  2HVR A;  2R7U A;  2V9V A;  4BYY A;  4JBA A;  4YII A;  1WKM A;  3WE3 A;  3DEU A;  4GYI A;  3X2Q H;  4XLE A;  2L2O A;  3U21 A;  5GAE J;  2EJR A;  4MGR A;  5IP6 A;  1F4K A;  5B1B H;  1KZH A;  2RQQ A;  2H1K A;  4XOT A;  2R3S A;  3R6S A;  1IDZ A;  1ZR2 A;  2FNP A;  1SFU A;  4O3M A;  2FD5 A;  1VQ7 I;  1SD6 A;  2V79 A;  4A0Z A;  1SFE A;  2PG4 A;  3C2H A;  3FXR A;  4ENM A;  1R71 A;  3CJR B;  2PMZ N;  4HRI A;  3FHZ A;  1YW9 A;  2KJB A;  4D5F A;  3IL2 A;  4A2U A;  1SMY F;  2FOW A;  3K1M A;  2DN0 A;  2HVS A;  3L2U A;  3T8R A;  2G7U A;  4DYC A;  2QF7 A;  3SJM A;  1UG0 A;  2Y0S A;  1FBU A;  2VJ5 A;  5F04 A;  2LF8 A;  2XGD A;  1OR7 A;  5F08 A;  2F6C A;  3KP7 A;  2L4M A;  1J7K A;  5EF6 A;  2WA0 A;  3SQN A;  3BG3 A;  5ICC A;  1LE8 A;  2DYR H;  3LSI A;  4A3E J;  1GV2 A;  1YJN I;  4IRG A;  3L2R A;  5LD2 C;  3ABM H;  2BXZ A;  1X1D A;  3MD2 A;  1QGP A;  1YIT I;  5GP9 A;  2DOA A;  4ZH4 F;  2E1N A;  3SFZ A;  3FXQ A;  2VT3 A;  1ETV A;  2ZSI B;  3KEO A;  5KVR A;  3ZGK A;  5JLX A;  2EV6 A;  5M5W J;  3OIQ A;  3J81 K;  1REP C;  1TWA J;  2Y9Y A;  1KQ0 A;  1JTX A;  4GFB A;  1R4M B;  2VXZ A;  3HJE A;  1Q1V A;  2OCE A;  2YS9 A;  1AKH A;  1X2N A;  3I53 A;  4GDF A;  2FUG 2;  1ETW A;  4XRS A;  2XAJ A;  3H92 A;  1WJ5 A;  3EDP A;  4I76 A;  5IT9 K;  1POG A;  5CJ9 A;  1I6X A;  2PJP A;  1ACI A;  2JK3 A;  3D1N I;  4NQW A;  1MGT A;  3ZQH A;  2XIG A;  4L5E A;  2KDO A;  1BN5 A;  4H4K C;  5GTH C;  4XLC A;  5E8I A;  5ICF A;  2EZI A;  3S17 J;  3FMR A;  3GTO J;  3ASO H;  3EUK L;  1K78 B;  2ME0 A;  1R4N B;  2G9W A;  2EA2 A;  2K4B A;  4B09 A;  3H3V K;  1QHG A;  3FXM A;  2MBF A;  2UUZ A;  1WZ2 A;  2GZW A;  2DAO A;  2LNB A;  3HOZ J;  1XGN A;  1BIA A;  1I1G A;  4HV5 A;  3PO3 J;  2Q2E B;  2VLA A;  2B0L A;  1MMS A;  1W0U A;  3ZMS A;  1R5I D;  1FLI A;  5EEA A;  1LKX A;  2X1C A;  3BG7 A;  5E3O A;  4UVA A;  5K5R A;  1BI1 A;  2UV1 A;  4CHU A;  4P55 A;  5TJJ A;  5M5X J;  1WCM J;  2RRE A;  3EUA A;  3S8P A;  3CP8 A;  4S0H B;  3LAJ A;  4I0B A;  2IJL A;  1YFH A;  1IGN A;  2O3F A;  4XN0 A;  3UKG A;  1TW3 A;  2BE5 F;  3WHB A;  1W36 D;  4J00 A;  3WTT C;  2DA6 A;  3PNY A;  2XGE A;  3W2W A;  4M9S A;  3RKW A;  1JT0 A;  1FBS A;  1YE9 A;  2QQ9 A;  3RKQ A;  1H0M A;  1KU7 A;  1YO5 C;  1WJF A;  3HZJ A;  2E36 A;  3W3C A;  4HNT A;  4PJ0 C;  2OCC H;  1OYI A;  1FT9 A;  1X3W B;  1WWX A;  3OIP A;  5ICE A;  5L3E A;  2ZME A;  3CUQ C;  1GV5 A;  4M9Z A;  1Y1W J;  2G0E A;  5C4J J;  3AAF A;  1H9T A;  1B72 A;  1IN8 A;  3O8G A;  1JHF A;  2DFI A;  2ME6 A;  3I64 A;  2L7F P;  1SC7 A;  1H88 C;  2ECB A;  4CCJ A;  4EJV A;  2XGX A;  3FM5 A;  2PMZ A;  2JPB A;  4Y33 A;  5K5O A;  5E17 F;  2QQ8 A;  5BMZ A;  3JRG A;  3DKY A;  5LRR A;  2A5Y B;  1VQ5 I;  2XAF A;  1PVE A;  4G6Q A;  4HG2 A;  4QWQ A;  2VIX A;  4Z6Y A;  1FZP B;  3CMA I;  1KA8 A;  4GYG A;  2LTP A;  2UWM A;  4FE4 A;  1YOV B;  4LOC A;  1X4P A;  2MC4 A;  4IVN A;  2CGP A;  2F5C A;  2B9S A;  1NH3 A;  2K9N A;  3PM1 A;  4UXN A;  3F8N A;  2M8G X;  3DQV C;  4KMF A;  3E6M A;  2VQG A;  4HX8 A;  1MNM C;  5DM6 F;  5F27 A;  4RGS A;  4B4C A;  1JE8 A;  2CO5 A;  3GZ5 A;  1ZG5 A;  3TGN A;  3IRR A;  1LDJ A;  3LST A;  2KL4 A;  4MQ9 F;  1HQC A;  2K4J A;  2RAE A;  4DW6 A;  1MBG A;  5JI6 A;  1Z7U A;  5LGT A;  2DA7 A;  2AQE A;  2OQR A;  1ENH A;  2QBY B;  1PUE E;  4Y17 A;  1NK2 P;  2CU7 A;  1UHM A;  3OYC A;  3K7A J;  2JVH A;  3BQZ A;  2MA3 A;  2K7L A;  3PUB A;  4D5C A;  1FYM A;  2VQC A;  2JTV A;  1HLV A;  3FIW A;  4XIC A;  4DOZ A;  2NS8 A;  3QPS A;  4QLC U;  1P9Q C;  4E4H A;  4G6D A;  4XID A;  2ZC2 A;  1IG7 A;  2LVS A;  1U78 A;  3FWE A;  4A3G J;  2KZG A;  4PDK A;  4CCM A;  4RDU A;  5KCM A;  4S05 A;  1BIB A;  2E35 A;  2XAG A;  3JW4 A;  3O2P E;  1BJA A;  1F9N A;  4BHP A;  1ETK A;  4PGH A;  3RPU A;  2Z2S B;  1LDD A;  3FK7 A;  3UNG C;  4HQE A;  2NVX J;  2LY2 A;  4W97 A;  1A5J A;  1GVD A;  2DA1 A;  2HYJ A;  1SVO A;  1R00 A;  2EFN A;  5LHG A;  1B8I A;  2VB6 A;  1IUY A;  4BH9 A;  2IAI A;  3ZRG A;  2FBH A;  5EZH A;  3HPG A;  1MND A;  1KQ8 A;  3FBN B;  1ZGW A;  4MO7 A;  3IWF A;  3GO5 A;  3ZXS A;  4AM3 A;  3I4P A;  4CIC A;  1KU2 A;  4L0Y B;  4AID A;  4BE0 A;  1ZHF A;  5DS9 A;  3LSG A;  4YG2 F;  1WI3 A;  5F0C A;  2IPQ X;  2X48 A;  4A3K J;  1O7L A;  1F36 A;  3M3Y J;  3LOC A;  1WI9 A;  2WAF A;  4EMS A;  5H2F C;  2D1H A;  1FIP A;  1J9I A;  1MBJ A;  3L7W A;  4EGY A;  2ZCW A;  5EDN A;  2QVO A;  3E97 A;  2EA4 A;  1LQ1 A;  3PSF A;  4ZZD A;  3KPH A;  3CJT B;  1WH7 A;  4XR6 A;  2EV5 A;  1VQM I;  4XM3 A;  4BGD A;  3HKZ N;  3OYL A;  5D5U B;  2IS4 A;  1V5F A;  2HXO A;  4A5M A;  2A68 F;  4EJO A;  2DMP A;  3H0D A;  4RS8 A;  3HUG A;  2K27 A;  3QPH A;  1K7A A;  4K2E A;  3IP4 B;  5FFZ A;  3TOB A;  1U5T B;  1R5G A;  5D5X B;  4UB8 C;  1I39 A;  2E7X A;  5LGU A;  2XF7 A;  5D5W B;  1T0F A;  1Z7L A;  1VQO I;  3BG6 A;  2HI3 A;  4RLQ A;  3GFL A;  2H6B A;  3H9G A;  2JUG A;  2ZME C;  3DLA A;  4ZTF A;  2Q2E A;  2YR2 A;  3WHC A;  4L18 B;  4HLX A;  2OJE D;  5GPA A;  2R7F A;  3NRV A;  1WHU A;  4DQ2 A;  3RYR A;  4GRI A;  3WGG A;  5IY5 H;  5FLM J;  4HLY A;  1VQ8 I;  2PQ8 A;  4UUT A;  1T08 B;  3WG7 H;  4D9J A;  2FF4 A;  2KRF A;  4Q4Z F;  5FRN A;  2IS6 A;  4RAZ A;  2DJN A;  1DP3 A;  3RIR A;  1MBH A;  1JKQ C;  1HF0 A;  4UUV A;  4Z2Y A;  1A04 A;  1Q1H A;  3C2G A;  1XGS A;  2NVU B;  4M3G A;  3CJQ B;  1QZE A;  2M2E A;  5LRS A;  1XCB A;  4RB3 C;  2GXA A;  2L02 A;  3G3Z A;  2O61 A;  3QAH A;  2XPU A;  1MMG A;  5FJ8 J;  2O0Y A;  2AO9 A;  3EET A;  4BQN A;  2GXB A;  3DXJ F;  2E5N A;  1XSD A;  2ZXI A;  4RMN A;  3VDX A;  2VKH A;  2WTE A;  3RQI A;  1T95 A;  4PGG A;  1TT0 A;  3PQJ A;  3A0H C;  1F43 A;  3BZ6 A;  1ZG1 A;  3FBI B;  1MMD A;  4N0B A;  3ABK H;  4RLF A;  2WAE A;  5LEK A;  2NRA C;  3J7Z I;  3DU6 A;  3U9G A;  2L9N A;  4UUS A;  4IPA A;  2VKV A;  4U0V A;  1IDY A;  3CC2 I;  1CF7 A;  1P4A A;  2ESH A;  4LMY A;  2XF6 A;  2BOL A;  3WTU C;  4CSW A;  5ILV A;  2NS0 A;  1XPX A;  3V8J A;  2NVT J;  5L3D A;  1ZRC A;  1LFB A;  1ZAO A;  1BR2 A;  3K10 A;  2FXA A;  3L1P A;  3DKX A;  2F5D A;  4ZYG A;  2MGQ A;  4L9V A;  4CYC B;  3K2A A;  4MEX F;  2R7V A;  2BYV E;  1J09 A;  2YSR A;  1SFX A;  3TED A;  3QOE A;  1GUU A;  1YHQ I;  1Z1D A;  1R1T A;  3KP6 A;  2EH3 A;  4LG3 A;  1G3S A;  2BXY A;  3TDU C;  4LG0 B;  3S3O A;  1BC7 C;  2KJC A;  1XTA A;  1IXS B;  2HOE A;  4L9J A;  2HKO A;  4IKF A;  3C18 A;  5DUK A;  1X3Z B;  2GAU A;  3V8K A;  3KYD B;  2Z3Y A;  1DUX C;  3K4C A;  4A69 C;  3SEQ A;  4XN3 A;  3HSE A;  2LMD A;  5JHF A;  1GDT A;  4RB0 A;  1FSE A;  4UV9 A;  5BQT A;  4E7J A;  2F5V A;  1KGS A;  2IGM A;  2DPU A;  2DT7 B;  4UV8 A;  1U9O A;  4GO1 A;  2K5C A;  4P9U A;  1I3A A;  5HVQ C;  3KLN A;  3KYC B;  1MSE C;  2DMU A;  5A2Q Z;  2R7R A;  3SDG A;  3O8H A;  4BE2 A;  4WXC A;  4UNO A;  3ZMU A;  4F3Q A;  4AVZ A;  1XSV A;  4Y13 A; 
#chains in the Genus database with same CATH homology
 2O7O A;  5FLV A;  1TWF J;  1JKR C;  1BA5 A;  4D7M A;  1JJ8 C;  1YRN B;  2DA3 A;  3G1L A;  2XB0 X;  4AYB N;  2FQ4 A;  5IP6 A;  3Q0W A;  3BTI A;  2CUE A;  2FJ1 A;  4B1R A;  2Y0S N;  3A01 B;  2H1K A;  5M3F J;  2HQ5 A;  1QVT A;  1IDZ A;  1ZR2 A;  1WH5 A;  1CQT A;  4C2M J;  2FD5 A;  3OSG A;  5J1Y A;  2OPT A;  3GTQ J;  1JKP C;  1LFU P;  2PMZ N;  3G1M A;  4DZJ A;  4A93 J;  2OF7 A;  4D5F A;  2M0C A;  4C3I J;  5FKN A;  4Y52 J;  2DN0 A;  4FTH A;  3HGY A;  4UUS B;  3OIO A;  3B6C A;  3CMY A;  5JLW A;  2QCO A;  4DYC A;  2QF7 A;  3SJM A;  3JR9 A;  5IP9 J;  3HBL A;  9ANT A;  5F04 A;  1ITY A;  3MVP A;  3GTP J;  2XGD A;  5F08 A;  2B63 J;  2VUM J;  2DA4 A;  2E1O A;  3SFI A;  3JRA A;  1HCR A;  3TW6 A;  5EF6 A;  4A3B J;  1ETQ A;  3BG3 A;  1LE8 A;  3HOY J;  2TRT A;  4A3E J;  1GV2 A;  2K9Q A;  2R5Z B;  1JJ6 C;  2E2I J;  1OFC X;  4BKX A;  1OCT C;  5GP9 A;  5C4X J;  3BG9 A;  4BXX J;  1JUM A;  3HB9 A;  2JA5 J;  1Y1V J;  3DEW A;  2R93 J;  1ETV A;  1VI0 A;  2L7M P;  3S1M J;  2Y2Z A;  3QQA A;  5JLX A;  5M5W J;  3BR5 A;  1SFO J;  4FIS A;  1TWA J;  2Y9Y A;  4A3J J;  1JTX A;  4D7N A;  4GFB A;  3M4O J;  2HOS A;  1Q1V A;  2ID6 A;  4JX4 A;  2YS9 A;  1AKH A;  4A3I J;  1X2N A;  5IPA A;  1MBK A;  1ETW A;  4M3E A;  4XRS A;  4I76 A;  2HXI A;  4AUX A;  2FX0 A;  3S1R J;  3BR0 A;  1POG A;  2AHQ A;  4B3A A;  2JK3 A;  3D1N I;  5IYB J;  5F0H A;  3ZQH A;  4L5E A;  3ZQC A;  3MN2 A;  5IOY A;  4EEF G;  2R7Z J;  4C3H J;  1NK3 P;  2EZI A;  4A3F J;  3S17 J;  1QVU A;  3GTO J;  2TCT A;  4A3M J;  3DCF A;  2JMW A;  2ME0 A;  2EQR A;  1K83 J;  2E19 A;  3H3V K;  1FEX A;  1A6I A;  1DU6 A;  1RET A;  1TWG J;  2COB A;  2R5Y A;  5BNG A;  2NVY J;  3BR2 A;  3MKL A;  3IH4 A;  3HOZ J;  1PUF A;  2W48 A;  4JP0 A;  2CQQ A;  5E3M A;  3PO3 J;  2LLK A;  2EBI A;  1W0U A;  5FKL A;  1K61 A;  3LSR A;  5EEA A;  4IEJ A;  3ZQG A;  5E3O A;  3H0G J;  3IH3 A;  2ELK A;  2L0K A;  5M5X J;  1WCM J;  4FCY A;  2Y30 A;  2MSY A;  4JYK A;  4S0H B;  4XRM A;  1LE8 B;  2MG4 A;  1IGN A;  3BTJ A;  3UKG A;  1RES A;  3WHB A;  5M3M J;  1ZKG A;  3OSF A;  3CQZ J;  2DA6 A;  2YUS A;  2XGE A;  5EG0 A;  2ID3 A;  1EF4 A;  4ABZ A;  1JT0 A;  3RKQ A;  5IYC J;  2YU9 J;  4X6A J;  2XSD C;  5E3N A;  3Q3S A;  5K7H A;  2DMT A;  2XGC A;  1TWC J;  2LY9 A;  1XS9 A;  1JUS A;  1AU7 A;  4DYQ A;  3JRB A;  5FKO A;  2IBD A;  3CDL A;  1GV5 A;  1RKW A;  1Z77 A;  1Y1W J;  1H89 C;  2G0E A;  5C4J J;  1B72 A;  3O8G A;  2ME6 A;  2L7F P;  2CRG A;  1H88 C;  3BR3 A;  2ECB A;  2EZL A;  2H8R A;  4JX6 A;  1GT0 C;  3RZO J;  4BY7 J;  1FTT A;  1WPK A;  3JRG A;  3BG5 A;  3NAR A;  2EZK A;  4M3F A;  4BBS J;  2IEK A;  5EYR A;  4DZP A;  5IP7 J;  1VFC A;  1W0T A;  1VF9 A;  3LSP A;  3ZOB A;  1JKO C;  3Q0V A;  2LTP A;  2VI6 A;  4MIM A;  4FE4 A;  4LOC A;  2LFB A;  1PUF B;  5EGO A;  2LD5 A;  2K9N A;  3PM1 A;  2NOG A;  4NDL A;  4QTR A;  2DA2 A;  2M8G X;  3IH2 A;  1MNM C;  5F27 A;  3LNQ A;  4B4C A;  1MH3 A;  2CQX A;  1MH4 A;  2JA8 J;  2RAE A;  2M9H A;  4DW6 A;  5HOD A;  2JWT A;  2HOT A;  1MBG A;  2E2H J;  3A01 A;  3HOW J;  2DA7 A;  1ENH A;  4I6Z A;  1NK2 P;  3S15 J;  1UMQ A;  2CU7 A;  1AHD P;  3K7A J;  4V2F A;  3BQZ A;  4V2G A;  1H8A C;  4IHW A;  2XPV A;  4MFE A;  4D5C A;  5M5Y J;  3CCY A;  2JJ7 A;  1HLV A;  3FIW A;  3GTL J;  4XIC A;  1RR7 A;  2NS8 A;  3QPS A;  4A3L J;  1I3Q J;  4XID A;  3S16 J;  1IG7 A;  2LVS A;  5EG0 B;  1MSF C;  1U78 A;  5C3E J;  4A3G J;  4RDU A;  4MLO A;  4A3D J;  5DTD A;  4RBO A;  3ZQL A;  2VKE A;  2R92 J;  5K7Z A;  1RKT A;  3LSJ A;  2DA5 A;  2VPR A;  1ETK A;  2P81 A;  1HDD C;  5IOZ A;  3FK7 A;  5J1R A;  1APL C;  3B6A A;  2NVX J;  3RZD J;  2DMN A;  4W97 A;  1A5J A;  3JRF A;  1GVD A;  2DA1 A;  1U8B A;  2R5Z A;  3S1Q J;  2HYJ A;  3HOV J;  5E3L A;  1Z0X A;  3S2H J;  5IYD J;  1B8I A;  3IV5 A;  1HOM A;  1JGG A;  1B72 B;  4W1U A;  2IAI A;  2O8K A;  5EZG A;  3HGG A;  5EZH A;  3TW7 A;  2GBY A;  1IRZ A;  1ZGW A;  2MW8 A;  4MO7 A;  4M6V A;  5K7F A;  1FIA A;  4A3C J;  1D5Y A;  1IJW C;  3JRE A;  5DS9 A;  2HDD A;  3LSG A;  4JX5 A;  4J19 A;  1WI3 A;  5F0C A;  1ZTR A;  1X58 A;  2KDZ A;  3HDD A;  2X48 A;  4A3K J;  2JA7 J;  4IHX A;  1F36 A;  2N8G A;  1QPI A;  3M3Y J;  3LOC A;  4G12 A;  3OOU A;  1S7E A;  1SAN A;  1FIP A;  2NS7 A;  1MBJ A;  5EGO B;  1O4X A;  5EDN A;  4IHY A;  3S2D J;  4CYC A;  1MBE A;  3G1O A;  2X6O A;  3HOU J;  1IC8 A;  3BTC A;  1WH7 A;  2X9D A;  3QPL A;  3FKI J;  4FE7 A;  1G2H A;  1XG1 A;  3HKZ N;  4QSH A;  1TC3 C;  3Q0U A;  2HXO A;  4XK4 A;  1AKH B;  2DMP A;  2WV1 A;  3JRH A;  2XB5 A;  3GTG J;  1ETO A;  1BJZ A;  3GTJ J;  1VND A;  2K9S A;  2HI3 A;  3GTK J;  1UG2 A;  1T56 A;  3BTL A;  1E3O C;  3A03 A;  3C2B A;  2XRL A;  2L9R A;  3WHC A;  5FKK A;  2L7Z A;  1QRY A;  2CJJ A;  2ECC A;  5GPA A;  3BT9 A;  5FLM J;  3HOX J;  3ZQF A;  1FJL A;  2M34 A;  3ZQI A;  2NVQ J;  1ORK A;  3HEF A;  4XRS G;  1IUF A;  4UUT A;  2R5Y B;  2GLO A;  2DJN A;  5C44 J;  1MBH A;  2GM4 A;  1JKQ C;  1HF0 A;  2CUF A;  4MFD A;  1JUP A;  3JRC A;  1YRN A;  4X1E A;  3I4N J;  5FKM A;  5J3L A;  4M3G A;  3TP0 A;  2M2E A;  1UHS A;  2JN6 A;  2K40 A;  3BR1 A;  2O9L A;  1I50 J;  2HOA A;  4C3J J;  1B8I B;  2XPU A;  5FJ8 J;  2AO9 A;  5F1J A;  2R0Q C;  2ZB9 A;  1ZQ3 P;  2E2J J;  3RQI A;  1BW5 A;  1MBF A;  1R9T J;  1F43 A;  1IV6 A;  1OJL A;  2JA6 J;  3F0C A;  1BL0 A;  1ZK8 A;  2EZH A;  3TP3 A;  4IHV A;  1P7J A;  3W6V A;  2I10 A;  4UUS A;  1P7I A;  1XC5 A;  2VKV A;  4HNV A;  1IDY A;  1DU0 A;  4DYR A;  1U9N A;  4AC0 A;  2LR8 A;  2KT0 A;  2LKX A;  3GBG A;  5F0F A;  2NVT J;  1LFB A;  3VPR A;  2Y9Z A;  3L1P A;  3S1N J;  3JRD A;  2MGQ A;  4CYC B;  3K2A A;  1ETX A;  1T33 A;  3GTM J;  3TED A;  3E7L A;  1GUU A;  4BBR J;  1HDP A;  1TWH J;  2EH3 A;  3BQY A;  2LK2 A;  4M3B A;  2XPW A;  5GPC A;  1WGX A;  3BR6 A;  3FIS A;  1OCP A;  2DMQ A;  3I4M J;  3NAU A;  4A69 C;  4M3D A;  3A02 A;  5J1U A;  4Y7N J;  1BW6 A;  3FK6 A;  1GDT A;  4BY1 J;  2DTZ A;  2D5V A;  1JT6 A;  1RPW A;  1FTZ A;  1U9O A;  1ZR4 A;  3S14 J;  1I6H J;  3HM5 A;  2LP0 A;  1MSE C;  2DMU A;  2Y31 A;  3JRI A;  1X2M A;  3SDG A;  1NTC A;  3O8H A;  4QIW N;  3PO2 J;  2WB1 N;  2WAQ N;  1ETY A;  1JTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...