2EZLA

Solution nmr structure of the ibeta subdomain of the mu end dna binding domain of phage mu transposase, 29 structures
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
MIARPTLEAHDYDREALWSKWDNASDSQRRLAEKWLPAVQAADEMLNQGISTKTAFATVAGHYQVSASTLRDKYYQVQKFAKPDWAAALVDGRGASRRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Mu end DNA-binding ibeta subdomain of phage Mu transposase: modular DNA recognition by two tethered domains.
pubmed doi rcsb
molecule tags Dna binding protein
molecule keywords TRANSPOSASE
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1997-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ezlA00
1QRYA 3SDGA 4C3IJ 1ZKGA 1R9TJ 3ZQGA 3I4NJ 2KT0A 4A3LJ 5E3NA 2LD5A 3BG3A 4C2MJ 5FKLA 5C44J 2XPWA 1B8IA 3HOXJ 3QPSA 2OF7A 2E19A 5JLXA 4NDLA 2DN0A 3O8HA 2HOSA 4XRSA 3HDDA 3OSFA 2CUFA 3S15J 2DMPA 5F0HA 3BR5A 2JMWA 4JX4A 1GUUA 1QPIA 4QIWN 4AYBN 3Q0UA 4FE7A 3S1RJ 2GLOA 2O8KA 4BBSJ 2Y9ZA 1TWCJ 1B72B 5DS9A 5K7HA 1DU0A 1TC3C 2ELKA 1WPKA 4S0HB 2XB0X 1YRNB 2VKEA 5DTDA 1X2NA 2N8GA 4RBOA 5F08A 3HKZN 1RETA 3BG5A 5F04A 2JN6A 2JWTA 1ETKA 2KDZA 3HGYA 4RDUA 1IDZA 5GPAA 3DCFA 2HI3A 1B8IB 2EZLA 3BQYA 3FISA 5IOYA 4GFBA 4A3KJ 3HOUJ 3CDLA 2DA7A 1HLVA 1ITYA 2NS7A 2R0QC 1UMQA 4ABZA 1I50J 2IBDA 2K40A 4IHXA 2Y0SN 1Z77A 5M5XJ 1IG7A 2XRLA 4FISA 5IP6A 2Y31A 3CQZJ 1LFBA 2DTZA 1FTTA 2E1OA 5J1RA 3JRDA 3BR3A 5K7FA 2TCTA 5IP9J 1MBFA 4J19A 1MSEC 2ZB9A 3ZQLA 3GTKJ 2CJJA 1NTCA 5EZHA 2Y9YA 1IRZA 2GBYA 4MFDA 3E7LA 3LSGA 1TWGJ 2M8GX 1W0UA 1I6HJ 2EZHA 4A3FJ 2WV1A 3TP3A 1MBHA 3TP0A 4DW6A 3W6VA 1HOMA 4HNVA 4CYCA 3WHCA 2CQQA 1AKHB 1T33A 4MLOA 4B3AA 1UHSA 4DZJA 3Q0VA 3NARA 2JA5J 4D5FA 3DEWA 3LSJA 1U9NA 1WGXA 3JR9A 4JYKA 1JTXA 3TEDA 5J1YA 2NVTJ 1RR7A 1JKOC 3BT9A 3S1NJ 2OPTA 2LR8A 1GV5A 2HXIA 4JP0A 5EGOB 2JJ7A 3S14J 4DYQA 4FCYA 1H89C 2JA7J 5C3EJ 2DMUA 1TWAJ 5FLMJ 2MW8A 1Y1WJ 3WHBA 1CQTA 1T56A 5HODA 2ID6A 2XPUA 4QSHA 2E2IJ 2JA6J 1WI3A 3OIOA 3S16J 3TW6A 1ZR2A 2P81A 2FD5A 1GV2A 3ZQIA 3G1LA 1YRNA 2R5YA 2EZIA 2L9RA 2M2EA 3G1MA 2K9SA 2PMZN 3ZQHA 4BY7J 5J1UA 2EZKA 2Y2ZA 1GVDA 3BR6A 1JJ6C 2O9LA 3GTLJ 1IDYA 4AC0A 3FK6A 2NVQJ 2AO9A 2E2HJ 3HGGA 1U78A 2LLKA 3UKGA 2HXOA 2HOTA 1AKHA 2VPRA 5IPAA 2DA2A 5M5YJ 2LTPA 2DA3A 2IAIA 2L7ZA 3MVPA 2DJNA 3RZDJ 4L5EA 2IEKA 3BG9A 3HM5A 3GTGJ 2K9NA 2R7ZJ 1ENHA 5F0CA 1LE8A 3LOCA 3CMYA 5IYCJ 1D5YA 2L0KA 1ZQ3P 1MBKA 1ZK8A 2HQ5A 2JK3A 5GP9A 3JRGA 1ETOA 1Y1VJ 1OJLA 2EH3A 3B6AA 2Y30A 4XICA 3HB9A 1FJLA 5EF6A 1NK3P 5IYDJ 3GBGA 1I3QJ 4M3EA 4BKXA 2COBA 1APLC 3C2BA 5J3LA 4MFEA 3ZQCA 2M0CA 3K7AJ 4D5CA 2LY9A 1Z0XA 1F36A 1Q1VA 1WCMJ 2LVSA 1U8BA 2QF7A 4UUTA 3VPRA 1AU7A 3HBLA 1E3OC 1U9OA 1PUFA 1ETYA 1MH4A 3BTCA 3S2HJ 4DYRA 1A6IA 5F1JA 3RKQA 2NS8A 2ID3A 1JT6A 1FEXA 4AUXA 3IH2A 1W0TA 2EQRA 4IHVA 4M3FA 2I10A 2XSDC 4CYCB 3SFIA 4M3DA 4LOCA 2CU7A 2DA5A 4I76A 1MNMC 2XB5A 1IGNA 3HEFA 4A3BJ 4BBRJ 3JRHA 3BTJA 1OCPA 5FKKA 3QPLA 2QCOA 2GM4A 2M9HA 3BTIA 3RQIA 3BR1A 2H8RA 2HYJA 2DMNA 1RESA 2WAQN 4XRMA 5FJ8J 2MSYA 5FLVA 1P7IA 2W48A 1POGA 2D5VA 2XGEA 4XIDA 3Q0WA 5M5WJ 3JREA 1BJZA 3A01B 3LNQA 3M3YJ 5EYRA 3QQAA 3HOZJ 2XPVA 4IEJA 3M4OJ 1ORKA 5E3LA 1ETXA 4UUSA 1MSFC 1JGGA 2FQ4A 3A03A 2LK2A 2JA8J 5EGOA 1GT0C 5JLWA 4B1RA 5FKMA 1BL0A 1WH5A 4G12A 2NOGA 2YU9J 3H3VK 1PUFB 4A3DJ 1VFCA 1G2HA 3A02A 4W97A 1X2MA 3TW7A 2K9QA 3S17J 3GTPJ 1JKPC 1BA5A 1SFOJ 1TWFJ 5BNGA 3D1NI 4DYCA 4A3IJ 2CQXA 1TWHJ 1JJ8C 1JKQC 3GTMJ 3RZOJ 5M3MJ 3NAUA 4UUSB 1DU6A 1XG1A 2YS9A 2R92J 1S7EA 4A3JJ 5IOZA 4M6VA 2FX0A 4Y7NJ 1H8AC 1IC8A 5IP7J 1QVUA 2MG4A 1JT0A 2VKVA 3JRCA 5GPCA 1IJWC 1LFUP 1XS9A 3I4MJ 1JTYA 1ZTRA 4W1UA 1VI0A 2B63J 3GTQJ 1SANA 4XRSG 1VF9A 1X58A 2CRGA 2H1KA 3HOYJ 3GTOJ 2DA1A 2XGDA 3BQZA 4V2FA 3S2DJ 1LE8B 1A5JA 1HDPA 3PM1A 1HF0A 4IHYA 2TRTA 1ZGWA 4A3CJ 5M3FJ 5K7ZA 3JRIA 3PO2J 3F0CA 3L1PA 1B72A 1HCRA 2VI6A 2MGQA 3BR0A 1ZR4A 2AHQA 2DA6A 2NVXJ 2O7OA 1P7JA 3IH4A 1AHDP 2XGCA 3OSGA 2L7MP 5FKOA 2DMTA 2G0EA 1ETWA 2FJ1A 2LP0A 4A3MJ 3PO3J 4C3HJ 2LFBA 2YUSA 4MO7A 4A3EJ 5EEAA 5F0FA 4M3GA 2R5ZB 4XK4A 5C4JJ 2ECBA 1EF4A 1QVTA 1MH3A 1WH7A 1MBEA 3H0GJ 1MBJA 3G1OA 1IUFA 1FIAA 1JUMA 5EG0B 4JX6A 4Y52J 3O8GA 3BR2A 2DMQA 3BTLA 1ETVA 4A93J 2ECCA 3ZOBA 3HOWJ 1BW5A 3MN2A 4D7MA 2WB1N 4D7NA 4M3BA 4A69C 3FK7A 3MKLA 2X48A 1RKTA 2R5YB 5C4XJ 4IHWA 1ETQA 1RPWA 5E3MA 3CCYA 2DA4A 2VUMJ 3FIWA 1K83J 1F43A 4FTHA 4EEFG 1JUSA 2NVYJ 1HDDC 1XC5A 1BW6A 2R5ZA 1MBGA 4BXXJ 3S1MJ 1O4XA 3LSRA 3ZQFA 5E3OA 1VNDA 4DZPA 3JRFA 1OCTC 3A01A 5EG0A 2HDDA 2M34A 5F27A 1NK2P 5FKNA 1IV6A 5IYBJ 1FIPA 2HOAA 4MIMA 4BY1J 4QTRA 5EDNA 3S1QJ 3Q3SA 4X6AJ 3IH3A 1GDTA 3HOVJ 4JX5A 4X1EA 3GTJJ 3FKIJ 1OFCX 9ANTA 1RKWA 1UG2A 1K61A 3SJMA 2RAEA 2X9DA 4I6ZA 4C3JJ 3JRAA 2LKXA 2E2JJ 3IV5A 3K2AA 4A3GJ 1JKRC 2L7FP 3B6CA 2X6OA 5EZGA 1JUPA 3OOUA 2R93J 4B4CA 2CUEA 3LSPA 4V2GA 2EBIA 2ME0A 3JRBA 1H88C 1FTZA 4FE4A 2ME6A
chains in the Genus database with same CATH superfamily
2XAHA 1TL8A 3K4CA 4XN0A 4HF2A 1ZKGA 5CVJA 1GHCA 4Z2YA 3I4NJ 4CZCA 4M9ZA 2DYSH 5E8GA 2OBPA 5E3NA 2DYRH 4QPOA 5FKLA 2G9WA 3HOXJ 3GEZA 2OF7A 5CVIA 1JE8A 2DN0A 3K1NA 3I54A 1KU2A 3HDDA 1FPQA 2IA0A 1QZZA 1R22A 2WWYA 1TNTA 2GLOA 2NVUB 2O8KA 1QA6A 2AS5F 2BZTA 2Y9ZA 1FNNA 4XLCA 1VQOI 1DU0A 1MMAA 3TO9A 2JRTA 3HTSB 5FROA 4YELA 2ZKZA 4G6DA 2WAQA 1KU9A 1IZ1A 4A6EA 2VBWA 4LLGF 1YS7A 3HKZN 3HRSA 4BYYA 1RETA 4ZH4F 3KEOA 2Y69H 1Y6IA 5F04A 4LGWA 1HBXG 2DO7A 5D6FA 1T2KA 3ZN1A 3DKYA 3I3LA 3M1EA 2K9LA 1JGSA 1W1WE 5D5WB 2OUMA 5DUIA 3AG2H 5CVVA 2KISA 5BS6A 2BY1A 2DA7A 2H8WA 1FYKA 4D0PA 5E1XA 2V6EA 3R0AA 1J9IA 2IBDA 4F52A 2K40A 4RS8A 5D4RA 1O7LA 4EJOA 2EV0A 4ZYDA 1IG7A 2KZVA 5IP6A 4L5JA 3JAMK 3CDHA 2LSOA 1LFBA 2RGVA 4OAZA 3DPLC 1EV7A 2DTZA 2PEXA 2O5RA 3I64A 3P5JA 1PVEA 4RAFA 5K7FA 3HHHA 2TCTA 1I39A 3OY9A 3F8MA 2CQKA 2HPMA 4MQVA 1MSEC 1EH8A 3AG1H 1Q1HA 1NTCA 2Y9YA 5D8KB 1IRZA 3LAJA 3GO5A 1SD6A 2OTJI 4MFDA 3E7LA 4XMYA 3AKZA 2W4SA 2W82A 3CESA 3TP3A 1VQLI 2B7EA 3HTUA 4UHTA 1HOMA 4HV6A 4E7SA 4XL9A 4QWQA 1OYIA 3OWTA 4CCNA 3NWSA 2LH9A 3JW4A 2VBYA 3QP6A 3Q0VA 5KVRA 2KKOA 2F2EA 3RDIA 3C2HA 3DV8A 3DEWA 3ZQQA 2ESHA 1TBXA 1J75A 3JR9A 3TEDA 2IT0A 2NVTJ 1B9NA 1R1TA 3A1YA 2CFXA 1DUXC 3KP6A 3MKYB 1JKOC 5HVQC 3BT9A 2LR8A 4P1WA 3HPGA 3KZYA 2GXBA 4JP0A 2HTSA 4WK8F 3HUGA 4DBQA 5E79C 3V7RA 2V26A 1X4PA 2JA7J 2R7OA 1H9GA 5FLMJ 4E70A 3WHBA 5GADJ 1CQTA 1T56A 2X85A 4KT5C 3WTYC 4L0YB 2E2IJ 3F6OA 5IT9K 1QHHD 2P4WA 3CO7C 2A5YB 2XF7A 3OIOA 2P81A 2FD5A 1GV2A 5IY5H 3ZQIA 4PUSA 2VPLA 3H9GA 3BJ6A 3TDUC 5BMZA 2L9RA 2A6EF 4AIHA 1E17A 4XSXF 2K9SA 2KP6A 3ZQHA 1EH6A 4XN3A 2FSWA 2LF8A 2VC1A 4LIUA 1GVDA 3H35A 3OIPA 3CMEI 2KRCA 3KX2A 1KYZA 2OZUA 5JVGF 2LG4A 1VTNC 3DPUA 2CW0F 4GXOA 3VB2A 1U78A 3CC2I 2QBYA 5HDKA 1AKHA 4GCVA 4RMNA 4ZYHA 1UZCA 4OU0A 4WXCA 3LAPA 2EINH 4L5EA 3P7NA 1SVLA 1Y8RB 2R7ZJ 4XKCA 4CCOA 1CF7B 1LE8A 2JPCA 4BE2A 1G4DA 1TTYA 4KFCA 2PLYA 3MCZA 1X3UA 2EH3A 2HKOA 2NOJB 2Z3YA 4C2UA 4LK1F 1XX5A 4G7ZF 3B6AA 3CC4I 4L9TA 3ZN0A 3N97A 5H20A 5EF6A 5HLHA 4ZTFA 1I3QJ 4M3EA 1FC3A 3GLXA 3HHGA 3C2BA 2OAZA 1GLNA 4A0YA 2M0CA 3K7AJ 1OQYA 3SZTA 2LY9A 2AXTC 2YX7A 3L2VA 1IO2A 1F36A 2CW8A 3F8BA 3IKVA 4UUTA 3VPRA 3T8TA 1O57A 1U9OA 4U7DA 2P0WA 2F4IA 1XDUA 1MH4A 2QQAA 1BR4A 2IS2A 5CVUA 4F3QA 3B73A 3RKQA 2NS8A 3DLAA 5F6FA 4BHPA 3IH2A 1FP2A 5HNFA 2EQRA 3KP3A 2FBKA 2IJLA 4ZJZA 1XMKA 3FZVA 1YIOA 4UV9A 3G73A 1ON2A 2I10A 3QOPA 4FX0A 2DA5A 4I76A 3CJQB 2XB5A 5J8FA 2W24A 4BBRJ 1W7PB 3QOEA 3BTIA 2M9HA 5L3CA 2VQHA 2HVQA 2F5DA 3T0YA 3CLQA 3PQJA 4XRMA 2GQQA 2MSYA 2VT3A 3V4GA 3I59A 4Y17A 5DV5A 4Y3OA 2P5LC 2JUCA 4N4OB 1USTA 4BL0B 4XIDA 3Q0WA 4ZTJA 1XPXA 2PMHA 5ERIA 2XPVA 3HOZJ 4KIFA 4F92B 4IEJA 2KIQA 5E3LA 4UUSA 1O7FA 4CO8A 1R7JA 3HSEA 1IF1A 2YU9J 4CYDA 3H3VK 1VFCA 1YO5C 3A02A 4MGRA 2JTVA 5J8CA 1R23A 3OYLA 1BA5A 1F5TA 4CCLA 1I1SA 3K70C 3WTTC 2E5NA 2JQ7A 1CF7A 1Z3XA 4G6QA 3Q5FA 1JKQC 1ZARA 2GOXB 3QAHA 4CCKA 4BQQA 2E7XA 5FRNA 2R92J 2DAOA 3FXKA 1SFEA 3X2QH 2O0YA 3F23A 5HDGA 2FX0A 1L3LA 4Y7NJ 3J7AY 3ZRGA 2O61A 3E5XA 4LIVA 2CV2A 2CQ7A 2MG4A 3CD6I 2E1CA 1SD5A 3NWTA 4AVZA 3IHUA 1K7AA 4Q47A 4F7ZA 3LA7A 2A68F 2IA2A 4CICA 3I4MJ 1KQ0A 1TW2A 4GYIA 3OYCA 1JTYA 2G7HA 4XLAA 3G71I 2EFWA 3HOTA 1IRFA 4A5MA 4HZFA 1XCBA 2QUFA 1SANA 2A3SA 1X58A 4CZZA 1T8IA 4II3A 3GTOJ 2XGDA 4EQQA 2K02A 1HDPA 3PM1A 2CH0A 1REPC 1D5VA 3JRIA 5LGNA 2KJCA 3DKXA 1W36C 2HS5A 1B72A 4PJ0C 2JA2A 1PDNC 3RCOA 1QGPA 2X6XA 3FXLA 2DA6A 2AQFA 1P2FA 3TO6A 2YR2A 3QYFA 1I27A 3OSGA 5DCMB 1B59A 2G0EA 3TO7A 3AG3H 4M6XA 1W36D 2M1BA 4XLPF 2LP0A 2PX9A 1FLIA 2LFBA 1PYVA 3N05A 4IRIA 2L4MA 4AVPA 5HLIA 1D0XA 1YHQI 4UNOA 3OL4A 1Z21A 2CG4A 5ILSA 2ZSIB 3LQRA 1MH3A 4AIDA 4BEHB 2CFOA 3QYEA 3DWLE 1YW9A 1U5TA 2QM3A 5CJ9A 3DTIA 1FIAA 2OA4A 3CJNA 5EG0B 2RC4A 3F22A 3H9JA 1JHHA 4C9YA 3S2WA 3COAC 3BTLA 3ABKH 2HPIA 2VBXA 1TT0A 2ECCA 4I98B 3ZOBA 4HQEA 1S7OA 1BW5A 1WJAA 2DTRA 1IRXA 1D3YA 4RAZA 3H1CA 4XKBA 1Y0UA 1R6RA 2LF7A 3MKLA 3CJTB 5GAGJ 2UUZA 4JK1X 4N4NB 3H5AA 1J09A 1RKTA 2ZJQF 4AM3A 3VYRB 2R5YB 3I59B 1ETQA 1BBYA 3BG6A 4Y4RA 4BHCA 5E3MA 2Z33A 1X1CA 5HNHA 3HXLA 1D8KA 1JUSA 4ITVA 2F4MB 2NXNB 2NVYJ 2D2WA 4F55A 2EV5A 2FA5A 3FXUA 3RYRA 2BHZA 1ZLJA 3QU6A 2V6CA 4JQFA 3WG7H 2VJ5A 1OYYA 2NYXA 3GXOA 3LSRA 5E18F 4DZPA 1XCVA 1T0FC 3WE2A 1WRJA 2RQQA 5EEGA 5F27A 2ELJA 1NK2P 4D9JA 2LC2A 1ZELA 3PL8A 5CVRA 1FIPA 2RDPA 2HOAA 2RN7A 1Y0NA 3VYUB 4BY1J 4QTRA 4X6AJ 1LVAA 1ZHFA 3HOVJ 4X0GA 3TL4X 5ILVA 2V9PA 2BEOA 4XOTA 5FD5A 3MD2A 2Z9OA 2OJED 5BPIA 2H1LA 3SJMA 1S6LA 4EM2A 3OR1C 4M74A 3SXYA 2DODA 5JHUA 4MTDA 1GVJA 2MABA 2E1MB 1JKRC 4A5NA 3ASOH 3IWZA 3GF2A 3K4NA 3OOUA 1Z7UA 4YIRX 4HV5A 1XSDA 4OIQF 2EBIA 4FE4A 3C3WA 1QRYA 4M6YA 2Y75A 3FM3A 2NRAC 5CKTA 1I1GA 2R7SA 4BJ5C 1P4WA 1E0EA 1QHGA 1YX5A 3QPTA 4LG3A 4IXAA 3VYTB 2LD5A 4A3LJ 2M4GA 3BG3A 5FD6A 2QSGX 4KICA 5L3EA 1IUYA 3HRMA 2FUG2 1F4KA 4PK4A 4HA8A 2VQCA 2PN6A 3G3ZA 5JLXA 3MFKA 3JCUC 3F8FA 4QLCU 3BY6A 3E6MA 1LDDA 3V8JA 4NBQA 2HOSA 4XRSA 4CHUA 2EB7A 1X3WB 3OSFA 2DMPA 3S15J 3PFIA 4BEHA 2ELHA 2BHYA 1QPIA 3S1RJ 4BBSJ 2QGUA 4XSZF 1R71A 2LNBA 3R6SA 1B72B 1UG0A 5DS9A 2ELKA 1WPKA 4L9JA 4S0HB 1ZG1A 2JT1A 2XB0X 3DEEA 2QYOA 3G2BA 1YRNB 3ZPLA 1O3TA 1RR8C 2BY2A 2E5ZA 2XF6A 2RV8A 5FGMA 2MLKA 4LITA 4RBOA 1IXRC 4XRFA 1E3PA 2HDWA 3KPHA 2R7XA 1ON1A 3BG5A 2LBFA 1UCRA 2OCCH 2JN6A 2JWTA 3ZGKA 3PNVA 2DT5A 3RPUA 2KDZA 1D8JA 2Z1DA 4RDUA 4L9VA 2ZXJA 3E97A 3KYLA 3BQYA 3FISA 4GFBA 4UVAA 5ICCA 2XGXA 2ZFWA 2JUGA 3CUQC 3AG4H 3HJEA 4DJAA 4YIIA 1HLVA 2KIUA 2O3FA 2R7QA 2R0QC 3C18A 4RB3C 3ELKA 1I50J 3M07A 4HF0A 5IT9Z 3W3CA 1Z77A 4L9NA 5DEQA 1XN7A 4FISA 5HS9A 2QEXI 2PMUA 3K1MA 2Y31A 3VFZA 3CQZJ 4KDPA 2A61A 2OCEA 2VN2A 2HEOA 3JRDA 3BR3A 5JHFA 4IKFA 3IP4B 3E5UA 2BW3B 1G6NA 3WTXC 3ZQLA 3GTKJ 3E1SA 2JZYA 2Q2EB 3MQ0A 1BR1A 1HXDA 1WQ2A 1FBUA 2FMYA 1RC9A 3CLOA 4A0ZA 1R5HA 3CCRI 4HRIA 1TQMA 1X1PA 3HUGB 2EZHA 4A3FJ 3L2RA 1MBHA 2K86A 3OS2A 4HNVA 3WG9A 1XTAA 3RI4A 3GCMA 1AKHB 1T33A 4MLOA 1A04A 4B3AA 1HQCA 4DZJA 4D5FA 4BE0A 3V7SA 3BJOA 3LSJA 3OYIA 1RIOH 3FMSA 1MGTA 4D1QA 2MH9A 1UHWA 3ZMDA 3LSMA 2WV0A 1OMIA 1XGOA 1B9MA 3DLLF 1MMSA 1TW3A 2DOEA 3KP7A 4KUMA 2K4JA 3ZR8X 3IAM2 1AWCA 4DYQA 1H89C 1YJNI 3RKWA 5FLXZ 2DMUA 1BOAA 1AA7A 2MW8A 1Y1WJ 1PJRA 4KMFA 3CJRB 4FHTA 4IQ4A 1O3SA 1BC7C 4RGXA 1RNLA 3WGIA 2CUJA 1QBJA 2VOOA 3ASNH 4GDFA 3P9KA 2BXYA 1ZR2A 1UJ8A 5KK1A 1YRNA 3H36A 2RVCA 1HSJA 1S3JA 2DT7B 4NC7A 4AU7A 2A6TA 3CCSI 2O8XA 2W1OA 4BY7J 3I55I 2EZKA 3DTKA 2Y2ZA 3JSPA 1X1DA 2HOEA 2VJ4A 1FOYA 3RQ4A 4ENMA 3M9AA 2DK5A 3FK6A 1LEBA 2L2OA 3HGGA 2OQGA 3EPZA 1VQMI 1R1UA 3ZCOA 3T5XA 5D5UB 1GXQA 5IPAA 3F8NA 5DM6F 2LTPA 4PJMA 2VE8A 3MVPA 1YQAA 2ZMEB 3K4BA 4FT8A 2VODA 3HM5A 2RKHA 3FXJA 2K9NA 3OYHA 4P9UA 4IHTA 2ZXHA 4KIGA 2Z2SB 3CMYA 4CSWA 5IYCJ 1DQUA 1ZK8A 2JK3A 2OQRA 1FWZA 3PSIA 2J5OA 1W5SA 1U2WA 2V9KA 4IOCF 1WJDA 1UFMA 2Y30A 1OR7C 1MKMA 2HFHA 3HB9A 1EA3A 5IYDJ 4BKXA 4E6KG 1EH7A 1Z67A 2EK5A 3K9TA 2VC0A 1YYVA 4D5CA 1ZG5A 1Q1VA 1TQIA 1WCMJ 1XDSA 2LVSA 4HPQA 1U8BA 3FM5A 2DQLA 2VKHA 2PJPA 3HBLA 2AXLA 3FXMA 3KEYA 3KLOA 5ILUA 2HQNA 3RIRA 1OKRA 3S93A 2BW3A 2IGNA 3OYEA 2DDAA 3K4MA 4DYRA 4IF4A 4CXFA 3S3OA 5F1JA 4IQJA 2ID3A 1SAUA 2D1VA 4AUXA 1X1BA 3QODA 5H6RA 5A2QK 4YG2F 4OMZA 1AOYA 4PZJA 3I9V2 4WWCA 1IXCA 4N9HA 3IUOA 2ZMEC 4U0YA 4KIBA 4M3FA 2XSDC 4CYCB 3SFIA 1LDKB 3KP4A 3CF2A 1MD0A 4IPAA 4RB0A 2QSHX 2X6YA 4XQFA 1R00A 3HEFA 4A3BJ 4J01A 1OCPA 4XNFA 4EJUA 1S9HA 2PJRA 2QCOA 3HKZA 5K1YA 3BG7A 2PFBA 5LRSA 4UVCA 3FBIB 1S29A 1SMTA 1WKMA 2Q1ZB 5FLVA 3RYPA 1W4MA 3BZKA 2A07F 4BACA 3M7GA 1Z6TA 3ULQB 1YITI 3VSLA 2W57A 5CQEA 3FMQA 2D5VA 5GAHJ 2XGEA 3ECHA 1T0FA 5M5WJ 3JREA 3LMMA 1LKXA 4U88A 2XRNA 2H6BA 1FP1D 3MWMA 4B43A 5BPDA 2CWEA 5HLTA 3L7WA 3K4JA 1ORKA 4AYBA 1ETXA 3L2WA 1B1BA 2L9VA 1MSFC 1DPUA 1JGGA 2Q8KA 2TDXA 1SD4A 2LK2A 3WU0A 4E7ZA 5JLWA 1WJEA 3KYCB 4G12A 2NOGA 1PUFB 2VE9A 3LSIA 1ZAOA 1O3RA 5IT3A 2K9QA 4H4KC 1WSUA 1R5GA 2EJRA 1WHUA 1XMXA 2GOMA 2P8TA 3H5NA 3S17J 3GTPJ 4I7HA 2H94A 1MMNA 4YFNF 1T38A 2P5KA 1BI3A 3D1NI 4IRHA 1UHMA 2LDUA 2DFHA 4QPQA 2ISZA 1WFXA 3JTHA 1ZYRF 3K4LA 3WTVC 3T8RA 2DK8A 3G4SI 1TP4A 5LFAA 3C2GA 1FYMA 3M8FA 1R36A 4LG0B 4ENJA 3MMYB 1S7EA 2XVCA 4HYEA 2BVMA 2B9SA 3CCJI 2LY1A 1H8AC 3GYHX 2X6WA 3KCCA 3IAS2 1IC8A 1ZLKA 2QQ9A 2ZJPF 5DUKA 3OYDA 1U3EM 2J5PA 2VKVA 1XGMA 3O3KA 5CPRB 1FMVA 4EM0B 4RB1A 2CQNA 1ZTRA 1Z3YA 2K85A 5D8LB 4BHBA 2M30A 4L18B 6PAXA 3L2CA 3GTQJ 2HYFA 1YS6A 2H1KA 2K4BA 3BQZA 1ZH5A 3S2DJ 1LE8B 1A5JA 3WGGA 4WCGA 4S05A 1ZGWA 4A3CJ 1DGRM 3SEZA 4EGYA 1FBQA 3CTAA 3TBIA 1HCRA 2VI6A 1ZR4A 2AHQA 4BJTA 2ZO4A 1P7JA 1LEAA 1V5EA 3IH4A 1YW7A 2XGCA 3FF5A 2L7MP 2DMTA 4C2TA 2Y48A 3PUBA 3CP8A 3EYYA 3M8JA 4YRVA 1I6XA 2F4OB 2DW4A 4A3MJ 2QWWA 1LNWA 5EEHA 5EEAA 5F0FA 3FXOA 1B6AA 4XORA 3CUOA 4M71A 5C4JJ 5AIQA 3MZYA 3E0JB 5DDGA 1SAXA 3L2UA 1WH7A 3QPHA 2ZXWH 1G3SA 5B1BH 1MMGA 5A2QZ 4Y52J 1S8NA 3O8GA 3BR2A 2WB1A 2DMQA 5H2FC 3UNGC 3SDBA 4A93J 1U8RA 1R4NB 2ZXIA 4E7JA 5LHGA 4YEJA 2NNYA 1IN8A 1WJFA 2WB1N 4A69C 2X0LA 1YJ9I 2IXSA 5F64A 3HSFA 1K78A 2EFQA 2KPMA 2GAUA 4EM1A 3KETA 4U7BA 4HW0A 1RPWA 1YI2I 1E3HA 1H9TA 4XKWA 3BP8A 4IOAF 2P5VA 1UAAA 3SFZA 2ISYA 1TLHB 1YE9A 2K7LA 3FIWA 1K83J 4ZYGA 4EEFG 2XSJC 2PJRB 4OMYA 1J59A 4XONA 2EIJH 2VQGA 1BM9A 5AIPA 1MJ9A 2HYGD 3R61A 1HDDC 1JI8A 2FEZA 1MBGA 4KISA 1KA8A 4UVBA 3HOSA 2ZJRF 3WE3A 3CCMI 2BY0A 1HC8A 2GIZA 2FNPA 4KT6A 1OCTC 2EFOA 2QZ8A 1J0RA 4WXHA 1J5YA 1IRGA 2Q2EA 1ZRDA 2ZJ2A 3F21A 1IV6A 2CGPA 2EA4A 1DGWY 4M9SA 4MIMA 2W7NA 2L4AA 3S1QJ 3Q3SA 1MNDA 2VXDA 3IH3A 1OISA 1FSEA 2KIMA 4PSXA 1KU3A 2IGMA 4X1EA 5KAFC 3GTJJ 4EVIA 1P9QC 1LVKA 2K27A 4U87A 2P7CB 2E1MC 2VLAA 5F1RA 4C3JJ 3JRAA 2XC7A 3OYAA 3IV5A 2W25A 4IZZA 3C1DA 4A3GJ 3B6CA 2X6OA 2R7FA 3J7YJ 2K9MA 1T95A 4BH9A 5D5XB 1ZGAA 3LSPA 1QNTA 4B8XA 3LSHA 1X3ZB 3H9QA 4ZYEA 3JRBA 5TISC 3VODA 3Q9SA 2ME6A 2QENA 3S32A 3SDGA 1IW7F 4C3IJ 1P6RA 1S72I 1ACIA 1R9TJ 1S7AA 3BC8A 3U2RA 1IN5A 3M1CA 2ETHA 1W7PA 3BLYA 3KZIC 1B8IA 3QPSA 3ROUA 1J2XA 2IPQX 2MBFA 3T1BA 4NDLA 3E6BA 3WU2C 4B48A 2UXXA 3A4CA 2CUZA 4TV7A 1P92A 3EUHC 4HNUA 3ABUA 1I5ZA 1R1VA 3N4MA 4BQNA 2JMWA 4JX4A 1GUUA 4QIWN 4AYBN 2OC6A 4FE7A 3V8LA 5H6QA 3KIOA 4WX9A 1K6OA 4FASD 1BI0A 2JPBA 2Z16A 1TWCJ 1VQ5I 2LRDA 1TC3C 4S04A 4ZDLA 4AIJA 4CGZA 2YX4A 2PI0A 3L00A 4A6DA 3DXJF 4IJAA 3CCVI 5DTDA 2WADA 4A0XA 3R0JA 3TMOA 2OV7A 1A31A 4U0VA 2FE3A 1N75A 2STWA 1XSVA 2NS0A 3OOPA 5JR3A 3OYBA 2BY3A 4UY8I 1ETKA 2AQEA 3H3ZA 5K5RA 1ZG3A 1IDZA 2HI3A 1B8IB 2EZLA 2HGCA 1TZLA 3CP2A 1WJBA 4CUGA 1IN7A 3HOUJ 3CDLA 4OINF 2IGOA 1D0ZA 2UZKA 2IVMA 2HWVA 2NS7A 1UELB 1UMQA 4ABZA 2ZFUA 3OL3A 4HOBA 5FFXA 4BXUA 4IHXA 2DFFA 3WTZA 1QZEA 2HVRA 1RZ4A 1WVRA 2L01A 2XRLA 4RAYA 3U1DA 4DGWB 2WC2A 1FSHA 1IN6A 1V54H 5J1RA 3J81Z 1WZ2A 2IS6A 5LRRA 3I56I 1PP8F 2MLGA 5IP9J 1MBFA 4PDKA 3DEUA 3GZNB 4J19A 5E1ZB 2JVHA 2GBYA 4MEXF 1A36A 3LSGA 1TWGJ 5HS7A 3GW2A 1G8XA 1W0UA 3NQOA 4LB6B 1I6HJ 2UXNA 2XIGA 3RKXA 4CCJA 5ICEA 4L0ZB 1S5LC 4HF1A 4DW6A 3W6VA 4Q5SF 2LREA 4LLNA 4CYCA 1KONA 4MTEA 2DT6A 2EFNA 2DOAA 2E7WA 1XGNA 4OIOF 5HLGA 5LHHA 2STTA 3J80Z 2OD5A 3TOAA 4JYKA 3BOQA 2BOLA 3EQLF 1A6QA 3E6CC 4GYGA 2XV4S 1HW2A 4ZDOA 4GRIA 1GV5A 2HXIA 1N25A 1IAWA 2V1NA 2JJ7A 5DYMA 3S14J 4FCYA 2WBMA 2EA2A 3OR2C 3ABTA 2HTJA 5C3EJ 4V19K 3DBRB 4M73A 1TWAJ 4ON0A 3VSKA 1R4MB 2ZMEA 5B66C 3EUAA 2DU9A 2MD0A 2V4JC 4P9FA 5HOOA 3J7AO 4ZZDA 4G9YA 2ID6A 2XPUA 4BXFA 3I58A 4Q48A 4BDZA 1WI3A 4RAGA 4XLEA 3NEUA 3S16J 3AFHA 3TW6A 3BCAA 2M3AA 4BDYA 1HW5A 3G1LA 4HNTA 2XROA 3OYFA 3C7JA 2CV1A 2NAZA 1IV8A 3KP2A 4BE1A 3VEPA 1PUEE 2M2EA 3G1MA 1VQ6I 1MDMA 1VQKI 3R4KA 2PMZN 4UXNA 2ESNA 3CCEI 2UWMA 5J1UA 2YSRA 2V1UA 1HSTA 2WA0A 1FX7A 3BR6A 2VIXA 2O9LA 3GTLJ 2VQLA 3CMMA 2L9SA 2LKPA 2R7WA 2NVQJ 2E2HJ 1DP3A 4NUBA 2LLKA 4RGSA 4E7KA 2HXOA 3UKGA 4BQAA 2DI3A 2VOPA 2VPRA 1X4OA 4KYWA 2DA2A 1SFUA 4MEYF 2DA3A 1HKQA 3RZDJ 1FT9A 1X19A 3BG9A 2KZGA 2P6TA 3GTGJ 3RKYA 1ENHA 4Y33A 5AONA 2CMPA 5F0CA 4PJJA 3HPHA 3LOCA 2H09A 3EETA 2M45A 2L0KA 1ZQ3P 5GP9A 2HQ5A 4IVNA 4B44A 3JRGA 1Z05A 4CH7A 2PQ8A 3O6BB 3ZQ7A 4FX4A 4PCQA 5D4SA 3GFLA 4XICA 4RGRA 3U9GA 2RNJA 2M7BA 4HBLA 1D0YA 2F48A 3SQNA 1YFHA 1ERDA 3ZQCA 4XLFA 2OTLI 3K0LA 2GZWA 3W6JB 2DPUA 5FO5A 3RTRA 2L3DA 2L7KA 2QLZA 3DP7A 4B3XA 3QRFF 2NNNA 3CF5F 1AU7A 1Y39A 2ICWG 5B1AH 4DBRA 4HDUA 4WXDA 3KFWX 5BQTA 1MIJA 2CW7A 3BTCA 4I99C 4DQ2A 2VB6A 1JT6A 2VL8A 4H0EA 3CUQB 2V1DA 2VT2A 1ZGJA 2Y0SA 4YIFA 4BJ6C 5KNLA 3GZ6A 2K3PA 2R7VA 3CZ6A 3LFKA 2G7UA 1N77A 4AWXB 2FF4A 2R7TA 1MMDA 1OCZH 3E6DA 1DP7P 4PFOA 2KIFA 3W2WA 1Z9CA 3HL2A 3JRHA 3LA2A 3ESWB 3QPLA 1TT5B 4ZDPA 2I8DA 3RQIA 5DD8A 3BR1A 2GIVA 2R4GA 2HYJA 4HX8A 2H8RA 1K78B 2OZ6A 2ZCWA 1ODDA 2CS3A 1Z1DA 4AD9A 2A69F 2HDCA 3ABLH 2FOWA 3BDDA 2P7VB 4E7HA 1N78A 2LBFB 3LNQA 5JFRA 5EYRA 2HQAA 5D6EA 3QQAA 3TKYA 4HG2A 1MDMB 2FQ3A 1L0OC 2EIMH 3RPUD 1ZREA 3ERED 3A03A 3GZ5A 2GXGA 2JA8J 3SZPA 1GT0C 4B1RA 5FKMA 4RA2A 4Q4ZF 4UB6C 1BL0A 1WH5A 1ZN2A 2FOKA 2E60A 2Y0MA 1QO0D 4W97A 1X2MA 1DDNA 4G94A 3LA3A 2XAFA 5FB2A 3BPXA 4O6JA 1QPMA 4A2UA 4HQMA 3TDZC 1TWFJ 1XD7A 4I0BA 4P55A 5BNGA 4FETA 2IA1A 3GUDA 4DYCA 4A3IJ 2CQXA 3H3UA 3H92A 2ZNYA 1JJ8C 2CV0A 3RZOJ 4PGHA 5M3MJ 3I0TA 1BIAA 1DU6A 1XG1A 2YS9A 5EJCA 3U1KA 4L5IA 3WU1B 5LEKA 5CYVA 3BCBA 3ML6A 3IRRA 4OWRB 5IP7J 1QVUA 2COMA 3RJPA 4DIQA 1OCOH 3JRCA 2E34A 1TQPA 1LFUP 2EIKH 3SYTA 3OS1A 3ZMSA 3AL0C 3KLNA 1G3YA 3CCLI 3J81K 3DBHB 3HOYJ 4E4HA 4LB5A 2F5VA 2E1NA 2L9NA 3D5LA 1HF0A 4IHYA 2TRTA 3E3VA 5ICFA 5M3FJ 5K7ZA 1T08B 4LMYA 1U5TB 1PP7U 3L1PA 3CUQA 3GFJA 2GWRA 2V79A 3HYIA 4XLNF 3BR0A 4BAYA 4MNUA 2V1XA 2NVXJ 2O7OA 1AHDP 2KJBA 4KA4A 3MEXA 2VASA 4XOPA 1ETWA 3GMEA 4C3HJ 5DM7F 2YUSA 4PJLA 4A3EJ 5J6XA 4NB5A 3F9KA 2V9VA 5L3BA 4ZYAA 3D5RC 3CC7I 4BU2A 2RNGA 2X1EA 3DU5A 4XK4A 3FKJA 2ECBA 1EF4A 3VDXA 4HSTA 2EPFA 1MBEA 3H0GJ 4NC8A 1YW8A 4UB8C 3CO6C 4JX6A 2DJIA 3FHZA 3OYJA 1ETVA 2XF5A 4M72A 3MKWB 4HDVA 3M8EA 5LGTA 3CCQI 2M7AA 3BROA 3MN2A 2WAFA 3P9IA 1X1AA 4ZZLA 4IHSA 4M3BA 1YIJI 4BNCA 4EJVA 2X48A 1E2XA 3BPVA 1LJ9A 2QVOA 3QYBA 1YTYA 5C4XJ 4IRGA 1G3TA 3HZJA 5KAIC 1HW1A 3CCYA 3J7ZI 2PG4A 2QKLB 4HX7A 2E71A 2MYSA 1F43A 4FTHA 4HEA2 3VWBA 3F6VA 4IX7A 1XC5A 3S3MA 2R5ZA 2B0LA 4KITB 2XDVA 3S1MJ 5E1WA 2IRFG 4EV0A 3MZHA 2RREA 5E3OA 2PBIA 4N0BA 1VNDA 3JRFA 3DU6A 1HKTA 3JSOA 2HDDA 2LYCA 2M34A 3FXQA 2HNHA 1XGSA 4ETSA 2D1HA 5IYBJ 4WF2A 1G59A 5EDNA 2LMDA 4XKVA 2W84A 3FKIJ 1OFCX 9ANTA 4IL6C 4I09A 1FBSA 2XHKA 1T39A 1B4AA 3GX4X 1USSA 3ABMH 4UUVA 1RI7A 5KCMA 5K5OA 2LKXA 2MC3A 1A35A 3HSRA 3OV8A 3FX3A 4E7IA 1DPRA 3PNYA 2R93J 1FOXA 2CUEA 4O5VA 3PJRA 3DF8A 4CCMA 2VBZA 3EDPA 2F5CA 1VQ9I 2ME0A 3A2KA 3IL2A 1APLC 1YOVB 3PSFA 2EV6A 1FZPB 4ENNA 4C30A 2A6HF 1CGPA 3ZQGA 2DCEA 2KT0A 3F8CA 1TNSA 4C2MJ 5C44J 2XPWA 5B3SH 4G7OF 4ENKA 3OYKA 3QWLA 2MD5A 3AAFA 2E19A 3O8HA 1U0JA 1V3FA 2KMUA 4IO9F 2YPRA 4DOZA 1BOBA 2CUFA 2A05A 3BR5A 5F0HA 5LEJA 2XKOA 5HS8A 2E36A 2R7RA 2ZC2A 3Q0UA 4GO1A 4R8HA 3OYNA 1U5TC 1V5GA 3PQKA 5K7HA 4Y15A 1MNEA 1D1AA 1Y8QB 2KL4A 1RUNA 2D45A 2DPDA 2XAQA 4RLQA 2VKEA 3GLLA 1X2NA 2N8GA 4RB2C 4MHGA 1LFPA 5F08A 3J80K 3AL0B 1FOKA 3W2AA 5J47A 4E7LA 3HGYA 3DCFA 1U6GA 5GPAA 1YJWI 4B47A 5IOYA 4RM2A 1OCRH 2KDOA 1BIBA 3LSTA 4A3KJ 3FXRA 4XM3A 1ITYA 2BV6A 1KQ8A 1J7KA 2F6CA 2X4HA 4GGGA 1LPQA 2VJIA 3GWZA 1K79A 3ZMZA 3B02A 1VQPI 2M4KA 4F91B 2Y0SN 5DCFA 1D1CA 2L54A 1NG6A 4OAYA 1ONVA 5M5XJ 5JVTA 3ECOA 3BJAA 2KRHA 4CDGA 4RLFA 4K2EA 1V5FA 4II2A 3GFMA 3ZXSA 4EMSA 4F93B 3S3NA 3LL7A 1FTTA 1BI2A 2E1OA 4PJNA 4JBAA 1MW7A 3S8PA 1LQ1A 2QSFX 1HKSA 4A12A 3PNTA 2ZB9A 1UB9A 2CJJA 2UV1A 5EZHA 1JXSA 2BYVE 3WTUC 4NHJA 1BN5A 3OIQA 2M8GX 2HR3A 5FRMA 3JTGA 1SFXA 2HQRA 2WTEA 2LOOA 2WV1A 3TP0A 1Z91A 3MKZA 1VQ4I 2QA4I 4R79A 3K10A 3WHCA 3SEQA 2CQQA 3GVAA 3FHNA 4P5OA 1OYWA 1LUJB 2C6YA 1UHSA 3O2PE 3NARA 2JA5J 3V42A 4NC6A 3DFGA 3I5UA 1U9NA 4J00A 1WGXA 1JTXA 3K2ZA 5J1YA 2X1DA 2L02A 3G6EI 1RR7A 2OU2A 3BZCA 1P4XA 2OPTA 4PGGA 3S1NJ 3Q9VA 2BE5F 3P9CA 4G7HF 3WGHA 1BR2A 1FOWA 4RM3A 4LFUA 3LSKA 1P4AA 5TJJA 1OR7A 5EGOB 3PIOF 1Y56A 2R7UA 2X1CA 3RSNA 2QQBA 3BZ6A 3HRUA 1STZA 2JRMA 5HODA 2PMZA 4QSHA 2M0MA 3KE2A 2JA6J 2CSOA 3REOA 3VOEA 1OPCA 1JHFA 2FBIA 2GA1A 4KNYA 3FMRA 3ZMUA 3JAMZ 3D5SC 3OS0A 1D1BA 3QP5A 2R5YA 2ADUA 5D5VB 3EUKL 2EZIA 5J4YA 4KN7X 3CCUI 4I0AA 4ESJA 3MAJA 2Z5UA 1JJ6C 3D0SA 1IDYA 1KYWA 4AC0A 2AO9A 3CMAI 2HOTA 5M5YJ 2M87A 2E35A 4I02A 2F5FA 2WY7Q 1T98A 2IAIA 2L7ZA 2DJNA 1OLTA 2IS4A 4LLLA 2IEKA 1F1ZA 3ZMTA 2P6SA 2BGCA 3DPTA 1WJ5A 4OIRF 5L3FA 2V7FA 3LQQA 2X51A 2DQRA 3KP5A 2MFZA 3OYMA 1D5YA 3DTEA 1SMYF 2XUBA 1MBKA 3I71A 4LD5A 1KZHA 1ZRFA 2H6CA 2XAUA 1XSXA 1ETOA 1Y1VJ 4G6TB 2DOFA 1OJLA 5GTHC 4EJTA 1LB2A 1R58A 2QBYB 1ULYA 1FJLA 1O3QA 3MZ8A 1NK3P 3GBGA 2COBA 4FQGA 4JOMA 3EUHA 3QU3A 3KZZA 1V55H 1BC8C 5J3LA 4MFEA 1VQNI 3L9FA 1Z0XA 4YFXF 4ESBA 4DNCA 1WWXA 3DKWA 2QF7A 1V4RA 5DD4A 5K5QA 1E3OC 2DFEA 2YU3A 2W85A 2I5UA 4PFPA 1PUFA 2FRHA 1ETYA 4I2OA 3S2HJ 1A6IA 3ZMVA 1NH3A 3ONQA 2K5CA 1IN4A 2A5WA 1FEXA 2Q0OA 1W0TA 2XASA 1W7PD 3IKTA 3IC7A 2DLLA 1FY7A 2O03A 1EKEA 4IHVA 3LFUA 2ACJA 4B09A 2LY2A 4M3DA 4LOCA 2CU7A 2DFIA 1MNMC 4MQ9F 5J4VA 1IGNA 2FBHA 2FXAA 3BTJA 5FKKA 3BWGA 1MJAA 2GM4A 2EFPA 1BI1A 4R1HA 2XAGA 2QKMB 5HDNA 2IP2A 2EILH 2VJJA 1K4TA 2DMNA 1RESA 2WAQN 5FJ8J 1K4SA 1P7IA 2F5EA 2ZBKA 1VZ0A 2W48A 2BXZA 4N9IA 3W2VA 1POGA 1H0MA 2BBYA 4LJZF 2DDBA 2MC4A 1BJZA 3A01B 3M3YJ 3OMYA 3NRVA 3WTSC 3H5RA 1MZBA 5BOXA 3M4OJ 5B5EC 4UV8A 1IXSB 1K6YA 3A0HC 2FQ4A 5J40A 4I01A 5EGOA 3R60A 4EGZA 3CDIA 4A3DJ 1G2HA 1W5TA 2GXAA 3TW7A 3PIPF 3OYGA 2RQPA 2ZSHB 1HA8A 4EATA 3I53A 3U21A 1JKPC 5GAEJ 1SFOJ 5GTIC 4HAMA 1KQ9A 3HG9A 5E8IA 2BVLA 5CLSA 4NNJA 1TWHJ 5JI6A 4BS9A 1ZRCA 3TGNA 3GTMJ 3KEQA 3F3XA 3F72A 3NAUA 4UUSB 4HLYA 4A3JJ 2H27A 5IOZA 1MJBA 4M6VA 1Z6RA 3FBNB 2MH2A 3GFIA 5KHDA 1WI9A 4Z6YA 3KYDB 1JT0A 1QU3A 5ICGA 4U0WA 1NHAA 3H0DA 2KLOA 5GPCA 1IJWC 2HU9A 2KHMA 2FNAA 1RRJA 2MA3A 1XS9A 3K6GA 1SFKA 4NQWA 2KFDA 3K70D 4W1UA 1VI0A 2XKPA 3DBLB 5FFZA 2B63J 3SHFA 3E5QA 4XRSG 1VF9A 2CRGA 5LD2C 4HX4A 2DA1A 4KMUX 1XB4A 3HIFA 4V2FA 3HC7A 1RUOA 2VXZA 1C0WA 1R49A 3TQNA 3PO2J 3UR3C 3F0CA 4RGUA 5TGTA 2MGQA 1QQIA 2DBBA 2JSCA 1SEUA 4M9XA 3IRQA 4XLHA 5FKOA 1SD7A 1VQ8I 2VONA 1NG7A 1SC7A 4HSRA 3ERMA 3W6KB 2FJ1A 3V7CA 5LHIA 3PO3J 3TOBA 3RPQA 4MO7A 3WODF 1SVOA 3K69A 4M3GA 2R5ZB 3SZGA 1QVTA 4OIPF 2HVSA 4NQWB 1MBJA 3G1OA 3ISPA 1OCCH 4LG0A 1IUFA 3ZP5A 1VQ7I 5TRDA 1YX3A 2XAJA 1JUMA 2VKDA 5L3DA 2WAEA 1XMAA 3EYIA 3PUFA 2FU4A 3L2QA 2JVGA 1YG2A 3PFYA 5DCMA 1YLFA 4XR6A 2LKSA 3HOWJ 2FMLA 3K1PA 3FWEA 4BUPA 3V8KA 4D7MA 5LGUA 1FMWA 4LK0F 4KJZA 4D7NA 1KGSA 2IGKA 3FK7A 2CYYA 1GXPA 3DQVC 1FYLA 2CO5A 2QQ8A 4IHWA 2R7DA 3HRTA 2KQRA 5E17F 2DA4A 2VUMJ 4YFKF 5LBQA 2HZTA 2L5QA 3L09A 3K4KA 1BW6A 5CQGA 4ZC3A 4BXXJ 3I4PA 2DXIA 1O4XA 3ZQFA 1QZYA 4CA0A 4O3MA 5E20A 1Z7LA 3A01A 5EG0A 2M5WA 2GA2A 4EJWA 2JSPA 5FKNA 2Z99A 4AIKA 3A0BC 4ASNA 2HZDA 2WY8Q 2KRFA 1R5ID 1W5CC 1GDTA 4JX5A 4PSWA 1RKWA 1UG2A 1K61A 1SVMA 2O6GE 2RAEA 2X9DA 4P96A 3IWFA 4I6ZA 4HLXA 4ANJA 4BQOA 5L3GA 1G3WA 4OOIA 3VYSB 2E2JJ 3LWFA 1LDJA 3K2AA 2HKXA 4G8XA 5LLQA 3FDYA 2IW5A 4BGDA 1I3AA 2L7FP 2M8EA 1T6SA 5EZGA 1JUPA 2EWNA 3WTWC 1WJCA 2K3FA 1KU7A 4B4CA 2W00A 1M1EB 2ZNZA 4KN4X 4ESFA 4Y13A 2IS1A 5ED4A 4V2GA 5FLXK 1EJ9A 1FTZA 1BJAA 1H88C 4XBFA 2R3SA 1F9NA
chains in the Genus database with same CATH topology
1QRYA 3SDGA 4C3IJ 1ZKGA 1R9TJ 3ZQGA 3I4NJ 2KT0A 4A3LJ 5E3NA 2LD5A 3BG3A 4C2MJ 5FKLA 5C44J 2XPWA 1B8IA 3HOXJ 3QPSA 2OF7A 2E19A 5JLXA 4NDLA 2DN0A 3O8HA 2HOSA 4XRSA 3HDDA 3OSFA 2CUFA 3S15J 2DMPA 5F0HA 3BR5A 2JMWA 4JX4A 1GUUA 1QPIA 4QIWN 4AYBN 3Q0UA 4FE7A 3S1RJ 2GLOA 2O8KA 4BBSJ 2Y9ZA 1TWCJ 1B72B 5DS9A 5K7HA 1DU0A 1TC3C 2ELKA 1WPKA 4S0HB 2XB0X 1YRNB 2VKEA 5DTDA 1X2NA 2N8GA 4RBOA 5F08A 3HKZN 1RETA 3BG5A 5F04A 2JN6A 2JWTA 1ETKA 2KDZA 3HGYA 4RDUA 1IDZA 5GPAA 3DCFA 2HI3A 1B8IB 2EZLA 3BQYA 3FISA 5IOYA 4GFBA 4A3KJ 3HOUJ 3CDLA 2DA7A 1HLVA 1ITYA 2NS7A 2R0QC 1UMQA 4ABZA 1I50J 2IBDA 2K40A 4IHXA 2Y0SN 1Z77A 5M5XJ 1IG7A 2XRLA 4FISA 5IP6A 2Y31A 3CQZJ 1LFBA 2DTZA 1FTTA 2E1OA 5J1RA 3JRDA 3BR3A 5K7FA 2TCTA 5IP9J 1MBFA 4J19A 1MSEC 2ZB9A 3ZQLA 3GTKJ 2CJJA 1NTCA 5EZHA 2Y9YA 1IRZA 2GBYA 4MFDA 3E7LA 3LSGA 1TWGJ 2M8GX 1W0UA 1I6HJ 2EZHA 4A3FJ 2WV1A 3TP3A 1MBHA 3TP0A 4DW6A 3W6VA 1HOMA 4HNVA 4CYCA 3WHCA 2CQQA 1AKHB 1T33A 4MLOA 4B3AA 1UHSA 4DZJA 3Q0VA 3NARA 2JA5J 4D5FA 3DEWA 3LSJA 1U9NA 1WGXA 3JR9A 4JYKA 1JTXA 3TEDA 5J1YA 2NVTJ 1RR7A 1JKOC 3BT9A 3S1NJ 2OPTA 2LR8A 1GV5A 2HXIA 4JP0A 5EGOB 2JJ7A 3S14J 4DYQA 4FCYA 1H89C 2JA7J 5C3EJ 2DMUA 1TWAJ 5FLMJ 2MW8A 1Y1WJ 3WHBA 1CQTA 1T56A 5HODA 2ID6A 2XPUA 4QSHA 2E2IJ 2JA6J 1WI3A 3OIOA 3S16J 3TW6A 1ZR2A 2P81A 2FD5A 1GV2A 3ZQIA 3G1LA 1YRNA 2R5YA 2EZIA 2L9RA 2M2EA 3G1MA 2K9SA 2PMZN 3ZQHA 4BY7J 5J1UA 2EZKA 2Y2ZA 1GVDA 3BR6A 1JJ6C 2O9LA 3GTLJ 1IDYA 4AC0A 3FK6A 2NVQJ 2AO9A 2E2HJ 3HGGA 1U78A 2LLKA 3UKGA 2HXOA 2HOTA 1AKHA 2VPRA 5IPAA 2DA2A 5M5YJ 2LTPA 2DA3A 2IAIA 2L7ZA 3MVPA 2DJNA 3RZDJ 4L5EA 2IEKA 3BG9A 3HM5A 3GTGJ 2K9NA 2R7ZJ 1ENHA 5F0CA 1LE8A 3LOCA 3CMYA 5IYCJ 1D5YA 2L0KA 1ZQ3P 1MBKA 1ZK8A 2HQ5A 2JK3A 5GP9A 3JRGA 1ETOA 1Y1VJ 1OJLA 2EH3A 3B6AA 2Y30A 4XICA 3HB9A 1FJLA 5EF6A 1NK3P 5IYDJ 3GBGA 1I3QJ 4M3EA 4BKXA 2COBA 1APLC 3C2BA 5J3LA 4MFEA 3ZQCA 2M0CA 3K7AJ 4D5CA 2LY9A 1Z0XA 1F36A 1Q1VA 1WCMJ 2LVSA 1U8BA 2QF7A 4UUTA 3VPRA 1AU7A 3HBLA 1E3OC 1U9OA 1PUFA 1ETYA 1MH4A 3BTCA 3S2HJ 4DYRA 1A6IA 5F1JA 3RKQA 2NS8A 2ID3A 1JT6A 1FEXA 4AUXA 3IH2A 1W0TA 2EQRA 4IHVA 4M3FA 2I10A 2XSDC 4CYCB 3SFIA 4M3DA 4LOCA 2CU7A 2DA5A 4I76A 1MNMC 2XB5A 1IGNA 3HEFA 4A3BJ 4BBRJ 3JRHA 3BTJA 1OCPA 5FKKA 3QPLA 2QCOA 2GM4A 2M9HA 3BTIA 3RQIA 3BR1A 2H8RA 2HYJA 2DMNA 1RESA 2WAQN 4XRMA 5FJ8J 2MSYA 5FLVA 1P7IA 2W48A 1POGA 2D5VA 2XGEA 4XIDA 3Q0WA 5M5WJ 3JREA 1BJZA 3A01B 3LNQA 3M3YJ 5EYRA 3QQAA 3HOZJ 2XPVA 4IEJA 3M4OJ 1ORKA 5E3LA 1ETXA 4UUSA 1MSFC 1JGGA 2FQ4A 3A03A 2LK2A 2JA8J 5EGOA 1GT0C 5JLWA 4B1RA 5FKMA 1BL0A 1WH5A 4G12A 2NOGA 2YU9J 3H3VK 1PUFB 4A3DJ 1VFCA 1G2HA 3A02A 4W97A 1X2MA 3TW7A 2K9QA 3S17J 3GTPJ 1JKPC 1BA5A 1SFOJ 1TWFJ 5BNGA 3D1NI 4DYCA 4A3IJ 2CQXA 1TWHJ 1JJ8C 1JKQC 3GTMJ 3RZOJ 5M3MJ 3NAUA 4UUSB 1DU6A 1XG1A 2YS9A 2R92J 1S7EA 4A3JJ 5IOZA 4M6VA 2FX0A 4Y7NJ 1H8AC 1IC8A 5IP7J 1QVUA 2MG4A 1JT0A 2VKVA 3JRCA 5GPCA 1IJWC 1LFUP 1XS9A 3I4MJ 1JTYA 1ZTRA 4W1UA 1VI0A 2B63J 3GTQJ 1SANA 4XRSG 1VF9A 1X58A 2CRGA 2H1KA 3HOYJ 3GTOJ 2DA1A 2XGDA 3BQZA 4V2FA 3S2DJ 1LE8B 1A5JA 1HDPA 3PM1A 1HF0A 4IHYA 2TRTA 1ZGWA 4A3CJ 5M3FJ 5K7ZA 3JRIA 3PO2J 3F0CA 3L1PA 1B72A 1HCRA 2VI6A 2MGQA 3BR0A 1ZR4A 2AHQA 2DA6A 2NVXJ 2O7OA 1P7JA 3IH4A 1AHDP 2XGCA 3OSGA 2L7MP 5FKOA 2DMTA 2G0EA 1ETWA 2FJ1A 2LP0A 4A3MJ 3PO3J 4C3HJ 2LFBA 2YUSA 4MO7A 4A3EJ 5EEAA 5F0FA 4M3GA 2R5ZB 4XK4A 5C4JJ 2ECBA 1EF4A 1QVTA 1MH3A 1WH7A 1MBEA 3H0GJ 1MBJA 3G1OA 1IUFA 1FIAA 1JUMA 5EG0B 4JX6A 4Y52J 3O8GA 3BR2A 2DMQA 3BTLA 1ETVA 4A93J 2ECCA 3ZOBA 3HOWJ 1BW5A 3MN2A 4D7MA 2WB1N 4D7NA 4M3BA 4A69C 3FK7A 3MKLA 2X48A 1RKTA 2R5YB 5C4XJ 4IHWA 1ETQA 1RPWA 5E3MA 3CCYA 2DA4A 2VUMJ 3FIWA 1K83J 1F43A 4FTHA 4EEFG 1JUSA 2NVYJ 1HDDC 1XC5A 1BW6A 2R5ZA 1MBGA 4BXXJ 3S1MJ 1O4XA 3LSRA 3ZQFA 5E3OA 1VNDA 4DZPA 3JRFA 1OCTC 3A01A 5EG0A 2HDDA 2M34A 5F27A 1NK2P 5FKNA 1IV6A 5IYBJ 1FIPA 2HOAA 4MIMA 4BY1J 4QTRA 5EDNA 3S1QJ 3Q3SA 4X6AJ 3IH3A 1GDTA 3HOVJ 4JX5A 4X1EA 3GTJJ 3FKIJ 1OFCX 9ANTA 1RKWA 1UG2A 1K61A 3SJMA 2RAEA 2X9DA 4I6ZA 4C3JJ 3JRAA 2LKXA 2E2JJ 3IV5A 3K2AA 4A3GJ 1JKRC 2L7FP 3B6CA 2X6OA 5EZGA 1JUPA 3OOUA 2R93J 4B4CA 2CUEA 3LSPA 4V2GA 2EBIA 2ME0A 3JRBA 1H88C 1FTZA 4FE4A 2ME6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QRY A;  3SDG A;  4C3I J;  1ZKG A;  1R9T J;  3ZQG A;  3I4N J;  2KT0 A;  4A3L J;  5E3N A;  2LD5 A;  3BG3 A;  4C2M J;  5FKL A;  5C44 J;  2XPW A;  1B8I A;  3HOX J;  3QPS A;  2OF7 A;  2E19 A;  5JLX A;  4NDL A;  2DN0 A;  3O8H A;  2HOS A;  4XRS A;  3HDD A;  3OSF A;  2CUF A;  3S15 J;  2DMP A;  5F0H A;  3BR5 A;  2JMW A;  4JX4 A;  1GUU A;  1QPI A;  4QIW N;  4AYB N;  3Q0U A;  4FE7 A;  3S1R J;  2GLO A;  2O8K A;  4BBS J;  2Y9Z A;  1TWC J;  1B72 B;  5DS9 A;  5K7H A;  1DU0 A;  1TC3 C;  2ELK A;  1WPK A;  4S0H B;  2XB0 X;  1YRN B;  2VKE A;  5DTD A;  1X2N A;  2N8G A;  4RBO A;  5F08 A;  3HKZ N;  1RET A;  3BG5 A;  5F04 A;  2JN6 A;  2JWT A;  1ETK A;  2KDZ A;  3HGY A;  4RDU A;  1IDZ A;  5GPA A;  3DCF A;  2HI3 A;  1B8I B;  2EZL A;  3BQY A;  3FIS A;  5IOY A;  4GFB A;  4A3K J;  3HOU J;  3CDL A;  2DA7 A;  1HLV A;  1ITY A;  2NS7 A;  2R0Q C;  1UMQ A;  4ABZ A;  1I50 J;  2IBD A;  2K40 A;  4IHX A;  2Y0S N;  1Z77 A;  5M5X J;  1IG7 A;  2XRL A;  4FIS A;  5IP6 A;  2Y31 A;  3CQZ J;  1LFB A;  2DTZ A;  1FTT A;  2E1O A;  5J1R A;  3JRD A;  3BR3 A;  5K7F A;  2TCT A;  5IP9 J;  1MBF A;  4J19 A;  1MSE C;  2ZB9 A;  3ZQL A;  3GTK J;  2CJJ A;  1NTC A;  5EZH A;  2Y9Y A;  1IRZ A;  2GBY A;  4MFD A;  3E7L A;  3LSG A;  1TWG J;  2M8G X;  1W0U A;  1I6H J;  2EZH A;  4A3F J;  2WV1 A;  3TP3 A;  1MBH A;  3TP0 A;  4DW6 A;  3W6V A;  1HOM A;  4HNV A;  4CYC A;  3WHC A;  2CQQ A;  1AKH B;  1T33 A;  4MLO A;  4B3A A;  1UHS A;  4DZJ A;  3Q0V A;  3NAR A;  2JA5 J;  4D5F A;  3DEW A;  3LSJ A;  1U9N A;  1WGX A;  3JR9 A;  4JYK A;  1JTX A;  3TED A;  5J1Y A;  2NVT J;  1RR7 A;  1JKO C;  3BT9 A;  3S1N J;  2OPT A;  2LR8 A;  1GV5 A;  2HXI A;  4JP0 A;  5EGO B;  2JJ7 A;  3S14 J;  4DYQ A;  4FCY A;  1H89 C;  2JA7 J;  5C3E J;  2DMU A;  1TWA J;  5FLM J;  2MW8 A;  1Y1W J;  3WHB A;  1CQT A;  1T56 A;  5HOD A;  2ID6 A;  2XPU A;  4QSH A;  2E2I J;  2JA6 J;  1WI3 A;  3OIO A;  3S16 J;  3TW6 A;  1ZR2 A;  2P81 A;  2FD5 A;  1GV2 A;  3ZQI A;  3G1L A;  1YRN A;  2R5Y A;  2EZI A;  2L9R A;  2M2E A;  3G1M A;  2K9S A;  2PMZ N;  3ZQH A;  4BY7 J;  5J1U A;  2EZK A;  2Y2Z A;  1GVD A;  3BR6 A;  1JJ6 C;  2O9L A;  3GTL J;  1IDY A;  4AC0 A;  3FK6 A;  2NVQ J;  2AO9 A;  2E2H J;  3HGG A;  1U78 A;  2LLK A;  3UKG A;  2HXO A;  2HOT A;  1AKH A;  2VPR A;  5IPA A;  2DA2 A;  5M5Y J;  2LTP A;  2DA3 A;  2IAI A;  2L7Z A;  3MVP A;  2DJN A;  3RZD J;  4L5E A;  2IEK A;  3BG9 A;  3HM5 A;  3GTG J;  2K9N A;  2R7Z J;  1ENH A;  5F0C A;  1LE8 A;  3LOC A;  3CMY A;  5IYC J;  1D5Y A;  2L0K A;  1ZQ3 P;  1MBK A;  1ZK8 A;  2HQ5 A;  2JK3 A;  5GP9 A;  3JRG A;  1ETO A;  1Y1V J;  1OJL A;  2EH3 A;  3B6A A;  2Y30 A;  4XIC A;  3HB9 A;  1FJL A;  5EF6 A;  1NK3 P;  5IYD J;  3GBG A;  1I3Q J;  4M3E A;  4BKX A;  2COB A;  1APL C;  3C2B A;  5J3L A;  4MFE A;  3ZQC A;  2M0C A;  3K7A J;  4D5C A;  2LY9 A;  1Z0X A;  1F36 A;  1Q1V A;  1WCM J;  2LVS A;  1U8B A;  2QF7 A;  4UUT A;  3VPR A;  1AU7 A;  3HBL A;  1E3O C;  1U9O A;  1PUF A;  1ETY A;  1MH4 A;  3BTC A;  3S2H J;  4DYR A;  1A6I A;  5F1J A;  3RKQ A;  2NS8 A;  2ID3 A;  1JT6 A;  1FEX A;  4AUX A;  3IH2 A;  1W0T A;  2EQR A;  4IHV A;  4M3F A;  2I10 A;  2XSD C;  4CYC B;  3SFI A;  4M3D A;  4LOC A;  2CU7 A;  2DA5 A;  4I76 A;  1MNM C;  2XB5 A;  1IGN A;  3HEF A;  4A3B J;  4BBR J;  3JRH A;  3BTJ A;  1OCP A;  5FKK A;  3QPL A;  2QCO A;  2GM4 A;  2M9H A;  3BTI A;  3RQI A;  3BR1 A;  2H8R A;  2HYJ A;  2DMN A;  1RES A;  2WAQ N;  4XRM A;  5FJ8 J;  2MSY A;  5FLV A;  1P7I A;  2W48 A;  1POG A;  2D5V A;  2XGE A;  4XID A;  3Q0W A;  5M5W J;  3JRE A;  1BJZ A;  3A01 B;  3LNQ A;  3M3Y J;  5EYR A;  3QQA A;  3HOZ J;  2XPV A;  4IEJ A;  3M4O J;  1ORK A;  5E3L A;  1ETX A;  4UUS A;  1MSF C;  1JGG A;  2FQ4 A;  3A03 A;  2LK2 A;  2JA8 J;  5EGO A;  1GT0 C;  5JLW A;  4B1R A;  5FKM A;  1BL0 A;  1WH5 A;  4G12 A;  2NOG A;  2YU9 J;  3H3V K;  1PUF B;  4A3D J;  1VFC A;  1G2H A;  3A02 A;  4W97 A;  1X2M A;  3TW7 A;  2K9Q A;  3S17 J;  3GTP J;  1JKP C;  1BA5 A;  1SFO J;  1TWF J;  5BNG A;  3D1N I;  4DYC A;  4A3I J;  2CQX A;  1TWH J;  1JJ8 C;  1JKQ C;  3GTM J;  3RZO J;  5M3M J;  3NAU A;  4UUS B;  1DU6 A;  1XG1 A;  2YS9 A;  2R92 J;  1S7E A;  4A3J J;  5IOZ A;  4M6V A;  2FX0 A;  4Y7N J;  1H8A C;  1IC8 A;  5IP7 J;  1QVU A;  2MG4 A;  1JT0 A;  2VKV A;  3JRC A;  5GPC A;  1IJW C;  1LFU P;  1XS9 A;  3I4M J;  1JTY A;  1ZTR A;  4W1U A;  1VI0 A;  2B63 J;  3GTQ J;  1SAN A;  4XRS G;  1VF9 A;  1X58 A;  2CRG A;  2H1K A;  3HOY J;  3GTO J;  2DA1 A;  2XGD A;  3BQZ A;  4V2F A;  3S2D J;  1LE8 B;  1A5J A;  1HDP A;  3PM1 A;  1HF0 A;  4IHY A;  2TRT A;  1ZGW A;  4A3C J;  5M3F J;  5K7Z A;  3JRI A;  3PO2 J;  3F0C A;  3L1P A;  1B72 A;  1HCR A;  2VI6 A;  2MGQ A;  3BR0 A;  1ZR4 A;  2AHQ A;  2DA6 A;  2NVX J;  2O7O A;  1P7J A;  3IH4 A;  1AHD P;  2XGC A;  3OSG A;  2L7M P;  5FKO A;  2DMT A;  2G0E A;  1ETW A;  2FJ1 A;  2LP0 A;  4A3M J;  3PO3 J;  4C3H J;  2LFB A;  2YUS A;  4MO7 A;  4A3E J;  5EEA A;  5F0F A;  4M3G A;  2R5Z B;  4XK4 A;  5C4J J;  2ECB A;  1EF4 A;  1QVT A;  1MH3 A;  1WH7 A;  1MBE A;  3H0G J;  1MBJ A;  3G1O A;  1IUF A;  1FIA A;  1JUM A;  5EG0 B;  4JX6 A;  4Y52 J;  3O8G A;  3BR2 A;  2DMQ A;  3BTL A;  1ETV A;  4A93 J;  2ECC A;  3ZOB A;  3HOW J;  1BW5 A;  3MN2 A;  4D7M A;  2WB1 N;  4D7N A;  4M3B A;  4A69 C;  3FK7 A;  3MKL A;  2X48 A;  1RKT A;  2R5Y B;  5C4X J;  4IHW A;  1ETQ A;  1RPW A;  5E3M A;  3CCY A;  2DA4 A;  2VUM J;  3FIW A;  1K83 J;  1F43 A;  4FTH A;  4EEF G;  1JUS A;  2NVY J;  1HDD C;  1XC5 A;  1BW6 A;  2R5Z A;  1MBG A;  4BXX J;  3S1M J;  1O4X A;  3LSR A;  3ZQF A;  5E3O A;  1VND A;  4DZP A;  3JRF A;  1OCT C;  3A01 A;  5EG0 A;  2HDD A;  2M34 A;  5F27 A;  1NK2 P;  5FKN A;  1IV6 A;  5IYB J;  1FIP A;  2HOA A;  4MIM A;  4BY1 J;  4QTR A;  5EDN A;  3S1Q J;  3Q3S A;  4X6A J;  3IH3 A;  1GDT A;  3HOV J;  4JX5 A;  4X1E A;  3GTJ J;  3FKI J;  1OFC X;  9ANT A;  1RKW A;  1UG2 A;  1K61 A;  3SJM A;  2RAE A;  2X9D A;  4I6Z A;  4C3J J;  3JRA A;  2LKX A;  2E2J J;  3IV5 A;  3K2A A;  4A3G J;  1JKR C;  2L7F P;  3B6C A;  2X6O A;  5EZG A;  1JUP A;  3OOU A;  2R93 J;  4B4C A;  2CUE A;  3LSP A;  4V2G A;  2EBI A;  2ME0 A;  3JRB A;  1H88 C;  1FTZ A;  4FE4 A;  2ME6 A; 
#chains in the Genus database with same CATH topology
 2XAH A;  1TL8 A;  3K4C A;  4XN0 A;  4HF2 A;  1ZKG A;  5CVJ A;  1GHC A;  4Z2Y A;  3I4N J;  4CZC A;  4M9Z A;  2DYS H;  5E8G A;  2OBP A;  5E3N A;  2DYR H;  4QPO A;  5FKL A;  2G9W A;  3HOX J;  3GEZ A;  2OF7 A;  5CVI A;  1JE8 A;  2DN0 A;  3K1N A;  3I54 A;  1KU2 A;  3HDD A;  1FPQ A;  2IA0 A;  1QZZ A;  1R22 A;  2WWY A;  1TNT A;  2GLO A;  2NVU B;  2O8K A;  1QA6 A;  2AS5 F;  2BZT A;  2Y9Z A;  1FNN A;  4XLC A;  1VQO I;  1DU0 A;  1MMA A;  3TO9 A;  2JRT A;  3HTS B;  5FRO A;  4YEL A;  2ZKZ A;  4G6D A;  2WAQ A;  1KU9 A;  1IZ1 A;  4A6E A;  2VBW A;  4LLG F;  1YS7 A;  3HKZ N;  3HRS A;  4BYY A;  1RET A;  4ZH4 F;  3KEO A;  2Y69 H;  1Y6I A;  5F04 A;  4LGW A;  1HBX G;  2DO7 A;  5D6F A;  1T2K A;  3ZN1 A;  3DKY A;  3I3L A;  3M1E A;  2K9L A;  1JGS A;  1W1W E;  5D5W B;  2OUM A;  5DUI A;  3AG2 H;  5CVV A;  2KIS A;  5BS6 A;  2BY1 A;  2DA7 A;  2H8W A;  1FYK A;  4D0P A;  5E1X A;  2V6E A;  3R0A A;  1J9I A;  2IBD A;  4F52 A;  2K40 A;  4RS8 A;  5D4R A;  1O7L A;  4EJO A;  2EV0 A;  4ZYD A;  1IG7 A;  2KZV A;  5IP6 A;  4L5J A;  3JAM K;  3CDH A;  2LSO A;  1LFB A;  2RGV A;  4OAZ A;  3DPL C;  1EV7 A;  2DTZ A;  2PEX A;  2O5R A;  3I64 A;  3P5J A;  1PVE A;  4RAF A;  5K7F A;  3HHH A;  2TCT A;  1I39 A;  3OY9 A;  3F8M A;  2CQK A;  2HPM A;  4MQV A;  1MSE C;  1EH8 A;  3AG1 H;  1Q1H A;  1NTC A;  2Y9Y A;  5D8K B;  1IRZ A;  3LAJ A;  3GO5 A;  1SD6 A;  2OTJ I;  4MFD A;  3E7L A;  4XMY A;  3AKZ A;  2W4S A;  2W82 A;  3CES A;  3TP3 A;  1VQL I;  2B7E A;  3HTU A;  4UHT A;  1HOM A;  4HV6 A;  4E7S A;  4XL9 A;  4QWQ A;  1OYI A;  3OWT A;  4CCN A;  3NWS A;  2LH9 A;  3JW4 A;  2VBY A;  3QP6 A;  3Q0V A;  5KVR A;  2KKO A;  2F2E A;  3RDI A;  3C2H A;  3DV8 A;  3DEW A;  3ZQQ A;  2ESH A;  1TBX A;  1J75 A;  3JR9 A;  3TED A;  2IT0 A;  2NVT J;  1B9N A;  1R1T A;  3A1Y A;  2CFX A;  1DUX C;  3KP6 A;  3MKY B;  1JKO C;  5HVQ C;  3BT9 A;  2LR8 A;  4P1W A;  3HPG A;  3KZY A;  2GXB A;  4JP0 A;  2HTS A;  4WK8 F;  3HUG A;  4DBQ A;  5E79 C;  3V7R A;  2V26 A;  1X4P A;  2JA7 J;  2R7O A;  1H9G A;  5FLM J;  4E70 A;  3WHB A;  5GAD J;  1CQT A;  1T56 A;  2X85 A;  4KT5 C;  3WTY C;  4L0Y B;  2E2I J;  3F6O A;  5IT9 K;  1QHH D;  2P4W A;  3CO7 C;  2A5Y B;  2XF7 A;  3OIO A;  2P81 A;  2FD5 A;  1GV2 A;  5IY5 H;  3ZQI A;  4PUS A;  2VPL A;  3H9G A;  3BJ6 A;  3TDU C;  5BMZ A;  2L9R A;  2A6E F;  4AIH A;  1E17 A;  4XSX F;  2K9S A;  2KP6 A;  3ZQH A;  1EH6 A;  4XN3 A;  2FSW A;  2LF8 A;  2VC1 A;  4LIU A;  1GVD A;  3H35 A;  3OIP A;  3CME I;  2KRC A;  3KX2 A;  1KYZ A;  2OZU A;  5JVG F;  2LG4 A;  1VTN C;  3DPU A;  2CW0 F;  4GXO A;  3VB2 A;  1U78 A;  3CC2 I;  2QBY A;  5HDK A;  1AKH A;  4GCV A;  4RMN A;  4ZYH A;  1UZC A;  4OU0 A;  4WXC A;  3LAP A;  2EIN H;  4L5E A;  3P7N A;  1SVL A;  1Y8R B;  2R7Z J;  4XKC A;  4CCO A;  1CF7 B;  1LE8 A;  2JPC A;  4BE2 A;  1G4D A;  1TTY A;  4KFC A;  2PLY A;  3MCZ A;  1X3U A;  2EH3 A;  2HKO A;  2NOJ B;  2Z3Y A;  4C2U A;  4LK1 F;  1XX5 A;  4G7Z F;  3B6A A;  3CC4 I;  4L9T A;  3ZN0 A;  3N97 A;  5H20 A;  5EF6 A;  5HLH A;  4ZTF A;  1I3Q J;  4M3E A;  1FC3 A;  3GLX A;  3HHG A;  3C2B A;  2OAZ A;  1GLN A;  4A0Y A;  2M0C A;  3K7A J;  1OQY A;  3SZT A;  2LY9 A;  2AXT C;  2YX7 A;  3L2V A;  1IO2 A;  1F36 A;  2CW8 A;  3F8B A;  3IKV A;  4UUT A;  3VPR A;  3T8T A;  1O57 A;  1U9O A;  4U7D A;  2P0W A;  2F4I A;  1XDU A;  1MH4 A;  2QQA A;  1BR4 A;  2IS2 A;  5CVU A;  4F3Q A;  3B73 A;  3RKQ A;  2NS8 A;  3DLA A;  5F6F A;  4BHP A;  3IH2 A;  1FP2 A;  5HNF A;  2EQR A;  3KP3 A;  2FBK A;  2IJL A;  4ZJZ A;  1XMK A;  3FZV A;  1YIO A;  4UV9 A;  3G73 A;  1ON2 A;  2I10 A;  3QOP A;  4FX0 A;  2DA5 A;  4I76 A;  3CJQ B;  2XB5 A;  5J8F A;  2W24 A;  4BBR J;  1W7P B;  3QOE A;  3BTI A;  2M9H A;  5L3C A;  2VQH A;  2HVQ A;  2F5D A;  3T0Y A;  3CLQ A;  3PQJ A;  4XRM A;  2GQQ A;  2MSY A;  2VT3 A;  3V4G A;  3I59 A;  4Y17 A;  5DV5 A;  4Y3O A;  2P5L C;  2JUC A;  4N4O B;  1UST A;  4BL0 B;  4XID A;  3Q0W A;  4ZTJ A;  1XPX A;  2PMH A;  5ERI A;  2XPV A;  3HOZ J;  4KIF A;  4F92 B;  4IEJ A;  2KIQ A;  5E3L A;  4UUS A;  1O7F A;  4CO8 A;  1R7J A;  3HSE A;  1IF1 A;  2YU9 J;  4CYD A;  3H3V K;  1VFC A;  1YO5 C;  3A02 A;  4MGR A;  2JTV A;  5J8C A;  1R23 A;  3OYL A;  1BA5 A;  1F5T A;  4CCL A;  1I1S A;  3K70 C;  3WTT C;  2E5N A;  2JQ7 A;  1CF7 A;  1Z3X A;  4G6Q A;  3Q5F A;  1JKQ C;  1ZAR A;  2GOX B;  3QAH A;  4CCK A;  4BQQ A;  2E7X A;  5FRN A;  2R92 J;  2DAO A;  3FXK A;  1SFE A;  3X2Q H;  2O0Y A;  3F23 A;  5HDG A;  2FX0 A;  1L3L A;  4Y7N J;  3J7A Y;  3ZRG A;  2O61 A;  3E5X A;  4LIV A;  2CV2 A;  2CQ7 A;  2MG4 A;  3CD6 I;  2E1C A;  1SD5 A;  3NWT A;  4AVZ A;  3IHU A;  1K7A A;  4Q47 A;  4F7Z A;  3LA7 A;  2A68 F;  2IA2 A;  4CIC A;  3I4M J;  1KQ0 A;  1TW2 A;  4GYI A;  3OYC A;  1JTY A;  2G7H A;  4XLA A;  3G71 I;  2EFW A;  3HOT A;  1IRF A;  4A5M A;  4HZF A;  1XCB A;  2QUF A;  1SAN A;  2A3S A;  1X58 A;  4CZZ A;  1T8I A;  4II3 A;  3GTO J;  2XGD A;  4EQQ A;  2K02 A;  1HDP A;  3PM1 A;  2CH0 A;  1REP C;  1D5V A;  3JRI A;  5LGN A;  2KJC A;  3DKX A;  1W36 C;  2HS5 A;  1B72 A;  4PJ0 C;  2JA2 A;  1PDN C;  3RCO A;  1QGP A;  2X6X A;  3FXL A;  2DA6 A;  2AQF A;  1P2F A;  3TO6 A;  2YR2 A;  3QYF A;  1I27 A;  3OSG A;  5DCM B;  1B59 A;  2G0E A;  3TO7 A;  3AG3 H;  4M6X A;  1W36 D;  2M1B A;  4XLP F;  2LP0 A;  2PX9 A;  1FLI A;  2LFB A;  1PYV A;  3N05 A;  4IRI A;  2L4M A;  4AVP A;  5HLI A;  1D0X A;  1YHQ I;  4UNO A;  3OL4 A;  1Z21 A;  2CG4 A;  5ILS A;  2ZSI B;  3LQR A;  1MH3 A;  4AID A;  4BEH B;  2CFO A;  3QYE A;  3DWL E;  1YW9 A;  1U5T A;  2QM3 A;  5CJ9 A;  3DTI A;  1FIA A;  2OA4 A;  3CJN A;  5EG0 B;  2RC4 A;  3F22 A;  3H9J A;  1JHH A;  4C9Y A;  3S2W A;  3COA C;  3BTL A;  3ABK H;  2HPI A;  2VBX A;  1TT0 A;  2ECC A;  4I98 B;  3ZOB A;  4HQE A;  1S7O A;  1BW5 A;  1WJA A;  2DTR A;  1IRX A;  1D3Y A;  4RAZ A;  3H1C A;  4XKB A;  1Y0U A;  1R6R A;  2LF7 A;  3MKL A;  3CJT B;  5GAG J;  2UUZ A;  4JK1 X;  4N4N B;  3H5A A;  1J09 A;  1RKT A;  2ZJQ F;  4AM3 A;  3VYR B;  2R5Y B;  3I59 B;  1ETQ A;  1BBY A;  3BG6 A;  4Y4R A;  4BHC A;  5E3M A;  2Z33 A;  1X1C A;  5HNH A;  3HXL A;  1D8K A;  1JUS A;  4ITV A;  2F4M B;  2NXN B;  2NVY J;  2D2W A;  4F55 A;  2EV5 A;  2FA5 A;  3FXU A;  3RYR A;  2BHZ A;  1ZLJ A;  3QU6 A;  2V6C A;  4JQF A;  3WG7 H;  2VJ5 A;  1OYY A;  2NYX A;  3GXO A;  3LSR A;  5E18 F;  4DZP A;  1XCV A;  1T0F C;  3WE2 A;  1WRJ A;  2RQQ A;  5EEG A;  5F27 A;  2ELJ A;  1NK2 P;  4D9J A;  2LC2 A;  1ZEL A;  3PL8 A;  5CVR A;  1FIP A;  2RDP A;  2HOA A;  2RN7 A;  1Y0N A;  3VYU B;  4BY1 J;  4QTR A;  4X6A J;  1LVA A;  1ZHF A;  3HOV J;  4X0G A;  3TL4 X;  5ILV A;  2V9P A;  2BEO A;  4XOT A;  5FD5 A;  3MD2 A;  2Z9O A;  2OJE D;  5BPI A;  2H1L A;  3SJM A;  1S6L A;  4EM2 A;  3OR1 C;  4M74 A;  3SXY A;  2DOD A;  5JHU A;  4MTD A;  1GVJ A;  2MAB A;  2E1M B;  1JKR C;  4A5N A;  3ASO H;  3IWZ A;  3GF2 A;  3K4N A;  3OOU A;  1Z7U A;  4YIR X;  4HV5 A;  1XSD A;  4OIQ F;  2EBI A;  4FE4 A;  3C3W A;  1QRY A;  4M6Y A;  2Y75 A;  3FM3 A;  2NRA C;  5CKT A;  1I1G A;  2R7S A;  4BJ5 C;  1P4W A;  1E0E A;  1QHG A;  1YX5 A;  3QPT A;  4LG3 A;  4IXA A;  3VYT B;  2LD5 A;  4A3L J;  2M4G A;  3BG3 A;  5FD6 A;  2QSG X;  4KIC A;  5L3E A;  1IUY A;  3HRM A;  2FUG 2;  1F4K A;  4PK4 A;  4HA8 A;  2VQC A;  2PN6 A;  3G3Z A;  5JLX A;  3MFK A;  3JCU C;  3F8F A;  4QLC U;  3BY6 A;  3E6M A;  1LDD A;  3V8J A;  4NBQ A;  2HOS A;  4XRS A;  4CHU A;  2EB7 A;  1X3W B;  3OSF A;  2DMP A;  3S15 J;  3PFI A;  4BEH A;  2ELH A;  2BHY A;  1QPI A;  3S1R J;  4BBS J;  2QGU A;  4XSZ F;  1R71 A;  2LNB A;  3R6S A;  1B72 B;  1UG0 A;  5DS9 A;  2ELK A;  1WPK A;  4L9J A;  4S0H B;  1ZG1 A;  2JT1 A;  2XB0 X;  3DEE A;  2QYO A;  3G2B A;  1YRN B;  3ZPL A;  1O3T A;  1RR8 C;  2BY2 A;  2E5Z A;  2XF6 A;  2RV8 A;  5FGM A;  2MLK A;  4LIT A;  4RBO A;  1IXR C;  4XRF A;  1E3P A;  2HDW A;  3KPH A;  2R7X A;  1ON1 A;  3BG5 A;  2LBF A;  1UCR A;  2OCC H;  2JN6 A;  2JWT A;  3ZGK A;  3PNV A;  2DT5 A;  3RPU A;  2KDZ A;  1D8J A;  2Z1D A;  4RDU A;  4L9V A;  2ZXJ A;  3E97 A;  3KYL A;  3BQY A;  3FIS A;  4GFB A;  4UVA A;  5ICC A;  2XGX A;  2ZFW A;  2JUG A;  3CUQ C;  3AG4 H;  3HJE A;  4DJA A;  4YII A;  1HLV A;  2KIU A;  2O3F A;  2R7Q A;  2R0Q C;  3C18 A;  4RB3 C;  3ELK A;  1I50 J;  3M07 A;  4HF0 A;  5IT9 Z;  3W3C A;  1Z77 A;  4L9N A;  5DEQ A;  1XN7 A;  4FIS A;  5HS9 A;  2QEX I;  2PMU A;  3K1M A;  2Y31 A;  3VFZ A;  3CQZ J;  4KDP A;  2A61 A;  2OCE A;  2VN2 A;  2HEO A;  3JRD A;  3BR3 A;  5JHF A;  4IKF A;  3IP4 B;  3E5U A;  2BW3 B;  1G6N A;  3WTX C;  3ZQL A;  3GTK J;  3E1S A;  2JZY A;  2Q2E B;  3MQ0 A;  1BR1 A;  1HXD A;  1WQ2 A;  1FBU A;  2FMY A;  1RC9 A;  3CLO A;  4A0Z A;  1R5H A;  3CCR I;  4HRI A;  1TQM A;  1X1P A;  3HUG B;  2EZH A;  4A3F J;  3L2R A;  1MBH A;  2K86 A;  3OS2 A;  4HNV A;  3WG9 A;  1XTA A;  3RI4 A;  3GCM A;  1AKH B;  1T33 A;  4MLO A;  1A04 A;  4B3A A;  1HQC A;  4DZJ A;  4D5F A;  4BE0 A;  3V7S A;  3BJO A;  3LSJ A;  3OYI A;  1RIO H;  3FMS A;  1MGT A;  4D1Q A;  2MH9 A;  1UHW A;  3ZMD A;  3LSM A;  2WV0 A;  1OMI A;  1XGO A;  1B9M A;  3DLL F;  1MMS A;  1TW3 A;  2DOE A;  3KP7 A;  4KUM A;  2K4J A;  3ZR8 X;  3IAM 2;  1AWC A;  4DYQ A;  1H89 C;  1YJN I;  3RKW A;  5FLX Z;  2DMU A;  1BOA A;  1AA7 A;  2MW8 A;  1Y1W J;  1PJR A;  4KMF A;  3CJR B;  4FHT A;  4IQ4 A;  1O3S A;  1BC7 C;  4RGX A;  1RNL A;  3WGI A;  2CUJ A;  1QBJ A;  2VOO A;  3ASN H;  4GDF A;  3P9K A;  2BXY A;  1ZR2 A;  1UJ8 A;  5KK1 A;  1YRN A;  3H36 A;  2RVC A;  1HSJ A;  1S3J A;  2DT7 B;  4NC7 A;  4AU7 A;  2A6T A;  3CCS I;  2O8X A;  2W1O A;  4BY7 J;  3I55 I;  2EZK A;  3DTK A;  2Y2Z A;  3JSP A;  1X1D A;  2HOE A;  2VJ4 A;  1FOY A;  3RQ4 A;  4ENM A;  3M9A A;  2DK5 A;  3FK6 A;  1LEB A;  2L2O A;  3HGG A;  2OQG A;  3EPZ A;  1VQM I;  1R1U A;  3ZCO A;  3T5X A;  5D5U B;  1GXQ A;  5IPA A;  3F8N A;  5DM6 F;  2LTP A;  4PJM A;  2VE8 A;  3MVP A;  1YQA A;  2ZME B;  3K4B A;  4FT8 A;  2VOD A;  3HM5 A;  2RKH A;  3FXJ A;  2K9N A;  3OYH A;  4P9U A;  4IHT A;  2ZXH A;  4KIG A;  2Z2S B;  3CMY A;  4CSW A;  5IYC J;  1DQU A;  1ZK8 A;  2JK3 A;  2OQR A;  1FWZ A;  3PSI A;  2J5O A;  1W5S A;  1U2W A;  2V9K A;  4IOC F;  1WJD A;  1UFM A;  2Y30 A;  1OR7 C;  1MKM A;  2HFH A;  3HB9 A;  1EA3 A;  5IYD J;  4BKX A;  4E6K G;  1EH7 A;  1Z67 A;  2EK5 A;  3K9T A;  2VC0 A;  1YYV A;  4D5C A;  1ZG5 A;  1Q1V A;  1TQI A;  1WCM J;  1XDS A;  2LVS A;  4HPQ A;  1U8B A;  3FM5 A;  2DQL A;  2VKH A;  2PJP A;  3HBL A;  2AXL A;  3FXM A;  3KEY A;  3KLO A;  5ILU A;  2HQN A;  3RIR A;  1OKR A;  3S93 A;  2BW3 A;  2IGN A;  3OYE A;  2DDA A;  3K4M A;  4DYR A;  4IF4 A;  4CXF A;  3S3O A;  5F1J A;  4IQJ A;  2ID3 A;  1SAU A;  2D1V A;  4AUX A;  1X1B A;  3QOD A;  5H6R A;  5A2Q K;  4YG2 F;  4OMZ A;  1AOY A;  4PZJ A;  3I9V 2;  4WWC A;  1IXC A;  4N9H A;  3IUO A;  2ZME C;  4U0Y A;  4KIB A;  4M3F A;  2XSD C;  4CYC B;  3SFI A;  1LDK B;  3KP4 A;  3CF2 A;  1MD0 A;  4IPA A;  4RB0 A;  2QSH X;  2X6Y A;  4XQF A;  1R00 A;  3HEF A;  4A3B J;  4J01 A;  1OCP A;  4XNF A;  4EJU A;  1S9H A;  2PJR A;  2QCO A;  3HKZ A;  5K1Y A;  3BG7 A;  2PFB A;  5LRS A;  4UVC A;  3FBI B;  1S29 A;  1SMT A;  1WKM A;  2Q1Z B;  5FLV A;  3RYP A;  1W4M A;  3BZK A;  2A07 F;  4BAC A;  3M7G A;  1Z6T A;  3ULQ B;  1YIT I;  3VSL A;  2W57 A;  5CQE A;  3FMQ A;  2D5V A;  5GAH J;  2XGE A;  3ECH A;  1T0F A;  5M5W J;  3JRE A;  3LMM A;  1LKX A;  4U88 A;  2XRN A;  2H6B A;  1FP1 D;  3MWM A;  4B43 A;  5BPD A;  2CWE A;  5HLT A;  3L7W A;  3K4J A;  1ORK A;  4AYB A;  1ETX A;  3L2W A;  1B1B A;  2L9V A;  1MSF C;  1DPU A;  1JGG A;  2Q8K A;  2TDX A;  1SD4 A;  2LK2 A;  3WU0 A;  4E7Z A;  5JLW A;  1WJE A;  3KYC B;  4G12 A;  2NOG A;  1PUF B;  2VE9 A;  3LSI A;  1ZAO A;  1O3R A;  5IT3 A;  2K9Q A;  4H4K C;  1WSU A;  1R5G A;  2EJR A;  1WHU A;  1XMX A;  2GOM A;  2P8T A;  3H5N A;  3S17 J;  3GTP J;  4I7H A;  2H94 A;  1MMN A;  4YFN F;  1T38 A;  2P5K A;  1BI3 A;  3D1N I;  4IRH A;  1UHM A;  2LDU A;  2DFH A;  4QPQ A;  2ISZ A;  1WFX A;  3JTH A;  1ZYR F;  3K4L A;  3WTV C;  3T8R A;  2DK8 A;  3G4S I;  1TP4 A;  5LFA A;  3C2G A;  1FYM A;  3M8F A;  1R36 A;  4LG0 B;  4ENJ A;  3MMY B;  1S7E A;  2XVC A;  4HYE A;  2BVM A;  2B9S A;  3CCJ I;  2LY1 A;  1H8A C;  3GYH X;  2X6W A;  3KCC A;  3IAS 2;  1IC8 A;  1ZLK A;  2QQ9 A;  2ZJP F;  5DUK A;  3OYD A;  1U3E M;  2J5P A;  2VKV A;  1XGM A;  3O3K A;  5CPR B;  1FMV A;  4EM0 B;  4RB1 A;  2CQN A;  1ZTR A;  1Z3Y A;  2K85 A;  5D8L B;  4BHB A;  2M30 A;  4L18 B;  6PAX A;  3L2C A;  3GTQ J;  2HYF A;  1YS6 A;  2H1K A;  2K4B A;  3BQZ A;  1ZH5 A;  3S2D J;  1LE8 B;  1A5J A;  3WGG A;  4WCG A;  4S05 A;  1ZGW A;  4A3C J;  1DGR M;  3SEZ A;  4EGY A;  1FBQ A;  3CTA A;  3TBI A;  1HCR A;  2VI6 A;  1ZR4 A;  2AHQ A;  4BJT A;  2ZO4 A;  1P7J A;  1LEA A;  1V5E A;  3IH4 A;  1YW7 A;  2XGC A;  3FF5 A;  2L7M P;  2DMT A;  4C2T A;  2Y48 A;  3PUB A;  3CP8 A;  3EYY A;  3M8J A;  4YRV A;  1I6X A;  2F4O B;  2DW4 A;  4A3M J;  2QWW A;  1LNW A;  5EEH A;  5EEA A;  5F0F A;  3FXO A;  1B6A A;  4XOR A;  3CUO A;  4M71 A;  5C4J J;  5AIQ A;  3MZY A;  3E0J B;  5DDG A;  1SAX A;  3L2U A;  1WH7 A;  3QPH A;  2ZXW H;  1G3S A;  5B1B H;  1MMG A;  5A2Q Z;  4Y52 J;  1S8N A;  3O8G A;  3BR2 A;  2WB1 A;  2DMQ A;  5H2F C;  3UNG C;  3SDB A;  4A93 J;  1U8R A;  1R4N B;  2ZXI A;  4E7J A;  5LHG A;  4YEJ A;  2NNY A;  1IN8 A;  1WJF A;  2WB1 N;  4A69 C;  2X0L A;  1YJ9 I;  2IXS A;  5F64 A;  3HSF A;  1K78 A;  2EFQ A;  2KPM A;  2GAU A;  4EM1 A;  3KET A;  4U7B A;  4HW0 A;  1RPW A;  1YI2 I;  1E3H A;  1H9T A;  4XKW A;  3BP8 A;  4IOA F;  2P5V A;  1UAA A;  3SFZ A;  2ISY A;  1TLH B;  1YE9 A;  2K7L A;  3FIW A;  1K83 J;  4ZYG A;  4EEF G;  2XSJ C;  2PJR B;  4OMY A;  1J59 A;  4XON A;  2EIJ H;  2VQG A;  1BM9 A;  5AIP A;  1MJ9 A;  2HYG D;  3R61 A;  1HDD C;  1JI8 A;  2FEZ A;  1MBG A;  4KIS A;  1KA8 A;  4UVB A;  3HOS A;  2ZJR F;  3WE3 A;  3CCM I;  2BY0 A;  1HC8 A;  2GIZ A;  2FNP A;  4KT6 A;  1OCT C;  2EFO A;  2QZ8 A;  1J0R A;  4WXH A;  1J5Y A;  1IRG A;  2Q2E A;  1ZRD A;  2ZJ2 A;  3F21 A;  1IV6 A;  2CGP A;  2EA4 A;  1DGW Y;  4M9S A;  4MIM A;  2W7N A;  2L4A A;  3S1Q J;  3Q3S A;  1MND A;  2VXD A;  3IH3 A;  1OIS A;  1FSE A;  2KIM A;  4PSX A;  1KU3 A;  2IGM A;  4X1E A;  5KAF C;  3GTJ J;  4EVI A;  1P9Q C;  1LVK A;  2K27 A;  4U87 A;  2P7C B;  2E1M C;  2VLA A;  5F1R A;  4C3J J;  3JRA A;  2XC7 A;  3OYA A;  3IV5 A;  2W25 A;  4IZZ A;  3C1D A;  4A3G J;  3B6C A;  2X6O A;  2R7F A;  3J7Y J;  2K9M A;  1T95 A;  4BH9 A;  5D5X B;  1ZGA A;  3LSP A;  1QNT A;  4B8X A;  3LSH A;  1X3Z B;  3H9Q A;  4ZYE A;  3JRB A;  5TIS C;  3VOD A;  3Q9S A;  2ME6 A;  2QEN A;  3S32 A;  3SDG A;  1IW7 F;  4C3I J;  1P6R A;  1S72 I;  1ACI A;  1R9T J;  1S7A A;  3BC8 A;  3U2R A;  1IN5 A;  3M1C A;  2ETH A;  1W7P A;  3BLY A;  3KZI C;  1B8I A;  3QPS A;  3ROU A;  1J2X A;  2IPQ X;  2MBF A;  3T1B A;  4NDL A;  3E6B A;  3WU2 C;  4B48 A;  2UXX A;  3A4C A;  2CUZ A;  4TV7 A;  1P92 A;  3EUH C;  4HNU A;  3ABU A;  1I5Z A;  1R1V A;  3N4M A;  4BQN A;  2JMW A;  4JX4 A;  1GUU A;  4QIW N;  4AYB N;  2OC6 A;  4FE7 A;  3V8L A;  5H6Q A;  3KIO A;  4WX9 A;  1K6O A;  4FAS D;  1BI0 A;  2JPB A;  2Z16 A;  1TWC J;  1VQ5 I;  2LRD A;  1TC3 C;  4S04 A;  4ZDL A;  4AIJ A;  4CGZ A;  2YX4 A;  2PI0 A;  3L00 A;  4A6D A;  3DXJ F;  4IJA A;  3CCV I;  5DTD A;  2WAD A;  4A0X A;  3R0J A;  3TMO A;  2OV7 A;  1A31 A;  4U0V A;  2FE3 A;  1N75 A;  2STW A;  1XSV A;  2NS0 A;  3OOP A;  5JR3 A;  3OYB A;  2BY3 A;  4UY8 I;  1ETK A;  2AQE A;  3H3Z A;  5K5R A;  1ZG3 A;  1IDZ A;  2HI3 A;  1B8I B;  2EZL A;  2HGC A;  1TZL A;  3CP2 A;  1WJB A;  4CUG A;  1IN7 A;  3HOU J;  3CDL A;  4OIN F;  2IGO A;  1D0Z A;  2UZK A;  2IVM A;  2HWV A;  2NS7 A;  1UEL B;  1UMQ A;  4ABZ A;  2ZFU A;  3OL3 A;  4HOB A;  5FFX A;  4BXU A;  4IHX A;  2DFF A;  3WTZ A;  1QZE A;  2HVR A;  1RZ4 A;  1WVR A;  2L01 A;  2XRL A;  4RAY A;  3U1D A;  4DGW B;  2WC2 A;  1FSH A;  1IN6 A;  1V54 H;  5J1R A;  3J81 Z;  1WZ2 A;  2IS6 A;  5LRR A;  3I56 I;  1PP8 F;  2MLG A;  5IP9 J;  1MBF A;  4PDK A;  3DEU A;  3GZN B;  4J19 A;  5E1Z B;  2JVH A;  2GBY A;  4MEX F;  1A36 A;  3LSG A;  1TWG J;  5HS7 A;  3GW2 A;  1G8X A;  1W0U A;  3NQO A;  4LB6 B;  1I6H J;  2UXN A;  2XIG A;  3RKX A;  4CCJ A;  5ICE A;  4L0Z B;  1S5L C;  4HF1 A;  4DW6 A;  3W6V A;  4Q5S F;  2LRE A;  4LLN A;  4CYC A;  1KON A;  4MTE A;  2DT6 A;  2EFN A;  2DOA A;  2E7W A;  1XGN A;  4OIO F;  5HLG A;  5LHH A;  2STT A;  3J80 Z;  2OD5 A;  3TOA A;  4JYK A;  3BOQ A;  2BOL A;  3EQL F;  1A6Q A;  3E6C C;  4GYG A;  2XV4 S;  1HW2 A;  4ZDO A;  4GRI A;  1GV5 A;  2HXI A;  1N25 A;  1IAW A;  2V1N A;  2JJ7 A;  5DYM A;  3S14 J;  4FCY A;  2WBM A;  2EA2 A;  3OR2 C;  3ABT A;  2HTJ A;  5C3E J;  4V19 K;  3DBR B;  4M73 A;  1TWA J;  4ON0 A;  3VSK A;  1R4M B;  2ZME A;  5B66 C;  3EUA A;  2DU9 A;  2MD0 A;  2V4J C;  4P9F A;  5HOO A;  3J7A O;  4ZZD A;  4G9Y A;  2ID6 A;  2XPU A;  4BXF A;  3I58 A;  4Q48 A;  4BDZ A;  1WI3 A;  4RAG A;  4XLE A;  3NEU A;  3S16 J;  3AFH A;  3TW6 A;  3BCA A;  2M3A A;  4BDY A;  1HW5 A;  3G1L A;  4HNT A;  2XRO A;  3OYF A;  3C7J A;  2CV1 A;  2NAZ A;  1IV8 A;  3KP2 A;  4BE1 A;  3VEP A;  1PUE E;  2M2E A;  3G1M A;  1VQ6 I;  1MDM A;  1VQK I;  3R4K A;  2PMZ N;  4UXN A;  2ESN A;  3CCE I;  2UWM A;  5J1U A;  2YSR A;  2V1U A;  1HST A;  2WA0 A;  1FX7 A;  3BR6 A;  2VIX A;  2O9L A;  3GTL J;  2VQL A;  3CMM A;  2L9S A;  2LKP A;  2R7W A;  2NVQ J;  2E2H J;  1DP3 A;  4NUB A;  2LLK A;  4RGS A;  4E7K A;  2HXO A;  3UKG A;  4BQA A;  2DI3 A;  2VOP A;  2VPR A;  1X4O A;  4KYW A;  2DA2 A;  1SFU A;  4MEY F;  2DA3 A;  1HKQ A;  3RZD J;  1FT9 A;  1X19 A;  3BG9 A;  2KZG A;  2P6T A;  3GTG J;  3RKY A;  1ENH A;  4Y33 A;  5AON A;  2CMP A;  5F0C A;  4PJJ A;  3HPH A;  3LOC A;  2H09 A;  3EET A;  2M45 A;  2L0K A;  1ZQ3 P;  5GP9 A;  2HQ5 A;  4IVN A;  4B44 A;  3JRG A;  1Z05 A;  4CH7 A;  2PQ8 A;  3O6B B;  3ZQ7 A;  4FX4 A;  4PCQ A;  5D4S A;  3GFL A;  4XIC A;  4RGR A;  3U9G A;  2RNJ A;  2M7B A;  4HBL A;  1D0Y A;  2F48 A;  3SQN A;  1YFH A;  1ERD A;  3ZQC A;  4XLF A;  2OTL I;  3K0L A;  2GZW A;  3W6J B;  2DPU A;  5FO5 A;  3RTR A;  2L3D A;  2L7K A;  2QLZ A;  3DP7 A;  4B3X A;  3QRF F;  2NNN A;  3CF5 F;  1AU7 A;  1Y39 A;  2ICW G;  5B1A H;  4DBR A;  4HDU A;  4WXD A;  3KFW X;  5BQT A;  1MIJ A;  2CW7 A;  3BTC A;  4I99 C;  4DQ2 A;  2VB6 A;  1JT6 A;  2VL8 A;  4H0E A;  3CUQ B;  2V1D A;  2VT2 A;  1ZGJ A;  2Y0S A;  4YIF A;  4BJ6 C;  5KNL A;  3GZ6 A;  2K3P A;  2R7V A;  3CZ6 A;  3LFK A;  2G7U A;  1N77 A;  4AWX B;  2FF4 A;  2R7T A;  1MMD A;  1OCZ H;  3E6D A;  1DP7 P;  4PFO A;  2KIF A;  3W2W A;  1Z9C A;  3HL2 A;  3JRH A;  3LA2 A;  3ESW B;  3QPL A;  1TT5 B;  4ZDP A;  2I8D A;  3RQI A;  5DD8 A;  3BR1 A;  2GIV A;  2R4G A;  2HYJ A;  4HX8 A;  2H8R A;  1K78 B;  2OZ6 A;  2ZCW A;  1ODD A;  2CS3 A;  1Z1D A;  4AD9 A;  2A69 F;  2HDC A;  3ABL H;  2FOW A;  3BDD A;  2P7V B;  4E7H A;  1N78 A;  2LBF B;  3LNQ A;  5JFR A;  5EYR A;  2HQA A;  5D6E A;  3QQA A;  3TKY A;  4HG2 A;  1MDM B;  2FQ3 A;  1L0O C;  2EIM H;  3RPU D;  1ZRE A;  3ERE D;  3A03 A;  3GZ5 A;  2GXG A;  2JA8 J;  3SZP A;  1GT0 C;  4B1R A;  5FKM A;  4RA2 A;  4Q4Z F;  4UB6 C;  1BL0 A;  1WH5 A;  1ZN2 A;  2FOK A;  2E60 A;  2Y0M A;  1QO0 D;  4W97 A;  1X2M A;  1DDN A;  4G94 A;  3LA3 A;  2XAF A;  5FB2 A;  3BPX A;  4O6J A;  1QPM A;  4A2U A;  4HQM A;  3TDZ C;  1TWF J;  1XD7 A;  4I0B A;  4P55 A;  5BNG A;  4FET A;  2IA1 A;  3GUD A;  4DYC A;  4A3I J;  2CQX A;  3H3U A;  3H92 A;  2ZNY A;  1JJ8 C;  2CV0 A;  3RZO J;  4PGH A;  5M3M J;  3I0T A;  1BIA A;  1DU6 A;  1XG1 A;  2YS9 A;  5EJC A;  3U1K A;  4L5I A;  3WU1 B;  5LEK A;  5CYV A;  3BCB A;  3ML6 A;  3IRR A;  4OWR B;  5IP7 J;  1QVU A;  2COM A;  3RJP A;  4DIQ A;  1OCO H;  3JRC A;  2E34 A;  1TQP A;  1LFU P;  2EIK H;  3SYT A;  3OS1 A;  3ZMS A;  3AL0 C;  3KLN A;  1G3Y A;  3CCL I;  3J81 K;  3DBH B;  3HOY J;  4E4H A;  4LB5 A;  2F5V A;  2E1N A;  2L9N A;  3D5L A;  1HF0 A;  4IHY A;  2TRT A;  3E3V A;  5ICF A;  5M3F J;  5K7Z A;  1T08 B;  4LMY A;  1U5T B;  1PP7 U;  3L1P A;  3CUQ A;  3GFJ A;  2GWR A;  2V79 A;  3HYI A;  4XLN F;  3BR0 A;  4BAY A;  4MNU A;  2V1X A;  2NVX J;  2O7O A;  1AHD P;  2KJB A;  4KA4 A;  3MEX A;  2VAS A;  4XOP A;  1ETW A;  3GME A;  4C3H J;  5DM7 F;  2YUS A;  4PJL A;  4A3E J;  5J6X A;  4NB5 A;  3F9K A;  2V9V A;  5L3B A;  4ZYA A;  3D5R C;  3CC7 I;  4BU2 A;  2RNG A;  2X1E A;  3DU5 A;  4XK4 A;  3FKJ A;  2ECB A;  1EF4 A;  3VDX A;  4HST A;  2EPF A;  1MBE A;  3H0G J;  4NC8 A;  1YW8 A;  4UB8 C;  3CO6 C;  4JX6 A;  2DJI A;  3FHZ A;  3OYJ A;  1ETV A;  2XF5 A;  4M72 A;  3MKW B;  4HDV A;  3M8E A;  5LGT A;  3CCQ I;  2M7A A;  3BRO A;  3MN2 A;  2WAF A;  3P9I A;  1X1A A;  4ZZL A;  4IHS A;  4M3B A;  1YIJ I;  4BNC A;  4EJV A;  2X48 A;  1E2X A;  3BPV A;  1LJ9 A;  2QVO A;  3QYB A;  1YTY A;  5C4X J;  4IRG A;  1G3T A;  3HZJ A;  5KAI C;  1HW1 A;  3CCY A;  3J7Z I;  2PG4 A;  2QKL B;  4HX7 A;  2E71 A;  2MYS A;  1F43 A;  4FTH A;  4HEA 2;  3VWB A;  3F6V A;  4IX7 A;  1XC5 A;  3S3M A;  2R5Z A;  2B0L A;  4KIT B;  2XDV A;  3S1M J;  5E1W A;  2IRF G;  4EV0 A;  3MZH A;  2RRE A;  5E3O A;  2PBI A;  4N0B A;  1VND A;  3JRF A;  3DU6 A;  1HKT A;  3JSO A;  2HDD A;  2LYC A;  2M34 A;  3FXQ A;  2HNH A;  1XGS A;  4ETS A;  2D1H A;  5IYB J;  4WF2 A;  1G59 A;  5EDN A;  2LMD A;  4XKV A;  2W84 A;  3FKI J;  1OFC X;  9ANT A;  4IL6 C;  4I09 A;  1FBS A;  2XHK A;  1T39 A;  1B4A A;  3GX4 X;  1USS A;  3ABM H;  4UUV A;  1RI7 A;  5KCM A;  5K5O A;  2LKX A;  2MC3 A;  1A35 A;  3HSR A;  3OV8 A;  3FX3 A;  4E7I A;  1DPR A;  3PNY A;  2R93 J;  1FOX A;  2CUE A;  4O5V A;  3PJR A;  3DF8 A;  4CCM A;  2VBZ A;  3EDP A;  2F5C A;  1VQ9 I;  2ME0 A;  3A2K A;  3IL2 A;  1APL C;  1YOV B;  3PSF A;  2EV6 A;  1FZP B;  4ENN A;  4C30 A;  2A6H F;  1CGP A;  3ZQG A;  2DCE A;  2KT0 A;  3F8C A;  1TNS A;  4C2M J;  5C44 J;  2XPW A;  5B3S H;  4G7O F;  4ENK A;  3OYK A;  3QWL A;  2MD5 A;  3AAF A;  2E19 A;  3O8H A;  1U0J A;  1V3F A;  2KMU A;  4IO9 F;  2YPR A;  4DOZ A;  1BOB A;  2CUF A;  2A05 A;  3BR5 A;  5F0H A;  5LEJ A;  2XKO A;  5HS8 A;  2E36 A;  2R7R A;  2ZC2 A;  3Q0U A;  4GO1 A;  4R8H A;  3OYN A;  1U5T C;  1V5G A;  3PQK A;  5K7H A;  4Y15 A;  1MNE A;  1D1A A;  1Y8Q B;  2KL4 A;  1RUN A;  2D45 A;  2DPD A;  2XAQ A;  4RLQ A;  2VKE A;  3GLL A;  1X2N A;  2N8G A;  4RB2 C;  4MHG A;  1LFP A;  5F08 A;  3J80 K;  3AL0 B;  1FOK A;  3W2A A;  5J47 A;  4E7L A;  3HGY A;  3DCF A;  1U6G A;  5GPA A;  1YJW I;  4B47 A;  5IOY A;  4RM2 A;  1OCR H;  2KDO A;  1BIB A;  3LST A;  4A3K J;  3FXR A;  4XM3 A;  1ITY A;  2BV6 A;  1KQ8 A;  1J7K A;  2F6C A;  2X4H A;  4GGG A;  1LPQ A;  2VJI A;  3GWZ A;  1K79 A;  3ZMZ A;  3B02 A;  1VQP I;  2M4K A;  4F91 B;  2Y0S N;  5DCF A;  1D1C A;  2L54 A;  1NG6 A;  4OAY A;  1ONV A;  5M5X J;  5JVT A;  3ECO A;  3BJA A;  2KRH A;  4CDG A;  4RLF A;  4K2E A;  1V5F A;  4II2 A;  3GFM A;  3ZXS A;  4EMS A;  4F93 B;  3S3N A;  3LL7 A;  1FTT A;  1BI2 A;  2E1O A;  4PJN A;  4JBA A;  1MW7 A;  3S8P A;  1LQ1 A;  2QSF X;  1HKS A;  4A12 A;  3PNT A;  2ZB9 A;  1UB9 A;  2CJJ A;  2UV1 A;  5EZH A;  1JXS A;  2BYV E;  3WTU C;  4NHJ A;  1BN5 A;  3OIQ A;  2M8G X;  2HR3 A;  5FRM A;  3JTG A;  1SFX A;  2HQR A;  2WTE A;  2LOO A;  2WV1 A;  3TP0 A;  1Z91 A;  3MKZ A;  1VQ4 I;  2QA4 I;  4R79 A;  3K10 A;  3WHC A;  3SEQ A;  2CQQ A;  3GVA A;  3FHN A;  4P5O A;  1OYW A;  1LUJ B;  2C6Y A;  1UHS A;  3O2P E;  3NAR A;  2JA5 J;  3V42 A;  4NC6 A;  3DFG A;  3I5U A;  1U9N A;  4J00 A;  1WGX A;  1JTX A;  3K2Z A;  5J1Y A;  2X1D A;  2L02 A;  3G6E I;  1RR7 A;  2OU2 A;  3BZC A;  1P4X A;  2OPT A;  4PGG A;  3S1N J;  3Q9V A;  2BE5 F;  3P9C A;  4G7H F;  3WGH A;  1BR2 A;  1FOW A;  4RM3 A;  4LFU A;  3LSK A;  1P4A A;  5TJJ A;  1OR7 A;  5EGO B;  3PIO F;  1Y56 A;  2R7U A;  2X1C A;  3RSN A;  2QQB A;  3BZ6 A;  3HRU A;  1STZ A;  2JRM A;  5HOD A;  2PMZ A;  4QSH A;  2M0M A;  3KE2 A;  2JA6 J;  2CSO A;  3REO A;  3VOE A;  1OPC A;  1JHF A;  2FBI A;  2GA1 A;  4KNY A;  3FMR A;  3ZMU A;  3JAM Z;  3D5S C;  3OS0 A;  1D1B A;  3QP5 A;  2R5Y A;  2ADU A;  5D5V B;  3EUK L;  2EZI A;  5J4Y A;  4KN7 X;  3CCU I;  4I0A A;  4ESJ A;  3MAJ A;  2Z5U A;  1JJ6 C;  3D0S A;  1IDY A;  1KYW A;  4AC0 A;  2AO9 A;  3CMA I;  2HOT A;  5M5Y J;  2M87 A;  2E35 A;  4I02 A;  2F5F A;  2WY7 Q;  1T98 A;  2IAI A;  2L7Z A;  2DJN A;  1OLT A;  2IS4 A;  4LLL A;  2IEK A;  1F1Z A;  3ZMT A;  2P6S A;  2BGC A;  3DPT A;  1WJ5 A;  4OIR F;  5L3F A;  2V7F A;  3LQQ A;  2X51 A;  2DQR A;  3KP5 A;  2MFZ A;  3OYM A;  1D5Y A;  3DTE A;  1SMY F;  2XUB A;  1MBK A;  3I71 A;  4LD5 A;  1KZH A;  1ZRF A;  2H6C A;  2XAU A;  1XSX A;  1ETO A;  1Y1V J;  4G6T B;  2DOF A;  1OJL A;  5GTH C;  4EJT A;  1LB2 A;  1R58 A;  2QBY B;  1ULY A;  1FJL A;  1O3Q A;  3MZ8 A;  1NK3 P;  3GBG A;  2COB A;  4FQG A;  4JOM A;  3EUH A;  3QU3 A;  3KZZ A;  1V55 H;  1BC8 C;  5J3L A;  4MFE A;  1VQN I;  3L9F A;  1Z0X A;  4YFX F;  4ESB A;  4DNC A;  1WWX A;  3DKW A;  2QF7 A;  1V4R A;  5DD4 A;  5K5Q A;  1E3O C;  2DFE A;  2YU3 A;  2W85 A;  2I5U A;  4PFP A;  1PUF A;  2FRH A;  1ETY A;  4I2O A;  3S2H J;  1A6I A;  3ZMV A;  1NH3 A;  3ONQ A;  2K5C A;  1IN4 A;  2A5W A;  1FEX A;  2Q0O A;  1W0T A;  2XAS A;  1W7P D;  3IKT A;  3IC7 A;  2DLL A;  1FY7 A;  2O03 A;  1EKE A;  4IHV A;  3LFU A;  2ACJ A;  4B09 A;  2LY2 A;  4M3D A;  4LOC A;  2CU7 A;  2DFI A;  1MNM C;  4MQ9 F;  5J4V A;  1IGN A;  2FBH A;  2FXA A;  3BTJ A;  5FKK A;  3BWG A;  1MJA A;  2GM4 A;  2EFP A;  1BI1 A;  4R1H A;  2XAG A;  2QKM B;  5HDN A;  2IP2 A;  2EIL H;  2VJJ A;  1K4T A;  2DMN A;  1RES A;  2WAQ N;  5FJ8 J;  1K4S A;  1P7I A;  2F5E A;  2ZBK A;  1VZ0 A;  2W48 A;  2BXZ A;  4N9I A;  3W2V A;  1POG A;  1H0M A;  2BBY A;  4LJZ F;  2DDB A;  2MC4 A;  1BJZ A;  3A01 B;  3M3Y J;  3OMY A;  3NRV A;  3WTS C;  3H5R A;  1MZB A;  5BOX A;  3M4O J;  5B5E C;  4UV8 A;  1IXS B;  1K6Y A;  3A0H C;  2FQ4 A;  5J40 A;  4I01 A;  5EGO A;  3R60 A;  4EGZ A;  3CDI A;  4A3D J;  1G2H A;  1W5T A;  2GXA A;  3TW7 A;  3PIP F;  3OYG A;  2RQP A;  2ZSH B;  1HA8 A;  4EAT A;  3I53 A;  3U21 A;  1JKP C;  5GAE J;  1SFO J;  5GTI C;  4HAM A;  1KQ9 A;  3HG9 A;  5E8I A;  2BVL A;  5CLS A;  4NNJ A;  1TWH J;  5JI6 A;  4BS9 A;  1ZRC A;  3TGN A;  3GTM J;  3KEQ A;  3F3X A;  3F72 A;  3NAU A;  4UUS B;  4HLY A;  4A3J J;  2H27 A;  5IOZ A;  1MJB A;  4M6V A;  1Z6R A;  3FBN B;  2MH2 A;  3GFI A;  5KHD A;  1WI9 A;  4Z6Y A;  3KYD B;  1JT0 A;  1QU3 A;  5ICG A;  4U0W A;  1NHA A;  3H0D A;  2KLO A;  5GPC A;  1IJW C;  2HU9 A;  2KHM A;  2FNA A;  1RRJ A;  2MA3 A;  1XS9 A;  3K6G A;  1SFK A;  4NQW A;  2KFD A;  3K70 D;  4W1U A;  1VI0 A;  2XKP A;  3DBL B;  5FFZ A;  2B63 J;  3SHF A;  3E5Q A;  4XRS G;  1VF9 A;  2CRG A;  5LD2 C;  4HX4 A;  2DA1 A;  4KMU X;  1XB4 A;  3HIF A;  4V2F A;  3HC7 A;  1RUO A;  2VXZ A;  1C0W A;  1R49 A;  3TQN A;  3PO2 J;  3UR3 C;  3F0C A;  4RGU A;  5TGT A;  2MGQ A;  1QQI A;  2DBB A;  2JSC A;  1SEU A;  4M9X A;  3IRQ A;  4XLH A;  5FKO A;  1SD7 A;  1VQ8 I;  2VON A;  1NG7 A;  1SC7 A;  4HSR A;  3ERM A;  3W6K B;  2FJ1 A;  3V7C A;  5LHI A;  3PO3 J;  3TOB A;  3RPQ A;  4MO7 A;  3WOD F;  1SVO A;  3K69 A;  4M3G A;  2R5Z B;  3SZG A;  1QVT A;  4OIP F;  2HVS A;  4NQW B;  1MBJ A;  3G1O A;  3ISP A;  1OCC H;  4LG0 A;  1IUF A;  3ZP5 A;  1VQ7 I;  5TRD A;  1YX3 A;  2XAJ A;  1JUM A;  2VKD A;  5L3D A;  2WAE A;  1XMA A;  3EYI A;  3PUF A;  2FU4 A;  3L2Q A;  2JVG A;  1YG2 A;  3PFY A;  5DCM A;  1YLF A;  4XR6 A;  2LKS A;  3HOW J;  2FML A;  3K1P A;  3FWE A;  4BUP A;  3V8K A;  4D7M A;  5LGU A;  1FMW A;  4LK0 F;  4KJZ A;  4D7N A;  1KGS A;  2IGK A;  3FK7 A;  2CYY A;  1GXP A;  3DQV C;  1FYL A;  2CO5 A;  2QQ8 A;  4IHW A;  2R7D A;  3HRT A;  2KQR A;  5E17 F;  2DA4 A;  2VUM J;  4YFK F;  5LBQ A;  2HZT A;  2L5Q A;  3L09 A;  3K4K A;  1BW6 A;  5CQG A;  4ZC3 A;  4BXX J;  3I4P A;  2DXI A;  1O4X A;  3ZQF A;  1QZY A;  4CA0 A;  4O3M A;  5E20 A;  1Z7L A;  3A01 A;  5EG0 A;  2M5W A;  2GA2 A;  4EJW A;  2JSP A;  5FKN A;  2Z99 A;  4AIK A;  3A0B C;  4ASN A;  2HZD A;  2WY8 Q;  2KRF A;  1R5I D;  1W5C C;  1GDT A;  4JX5 A;  4PSW A;  1RKW A;  1UG2 A;  1K61 A;  1SVM A;  2O6G E;  2RAE A;  2X9D A;  4P96 A;  3IWF A;  4I6Z A;  4HLX A;  4ANJ A;  4BQO A;  5L3G A;  1G3W A;  4OOI A;  3VYS B;  2E2J J;  3LWF A;  1LDJ A;  3K2A A;  2HKX A;  4G8X A;  5LLQ A;  3FDY A;  2IW5 A;  4BGD A;  1I3A A;  2L7F P;  2M8E A;  1T6S A;  5EZG A;  1JUP A;  2EWN A;  3WTW C;  1WJC A;  2K3F A;  1KU7 A;  4B4C A;  2W00 A;  1M1E B;  2ZNZ A;  4KN4 X;  4ESF A;  4Y13 A;  2IS1 A;  5ED4 A;  4V2G A;  5FLX K;  1EJ9 A;  1FTZ A;  1BJA A;  1H88 C;  4XBF A;  2R3S A;  1F9N A; 
#chains in the Genus database with same CATH homology
 1QRY A;  3SDG A;  4C3I J;  1ZKG A;  1R9T J;  3ZQG A;  3I4N J;  2KT0 A;  4A3L J;  5E3N A;  2LD5 A;  3BG3 A;  4C2M J;  5FKL A;  5C44 J;  2XPW A;  1B8I A;  3HOX J;  3QPS A;  2OF7 A;  2E19 A;  5JLX A;  4NDL A;  2DN0 A;  3O8H A;  2HOS A;  4XRS A;  3HDD A;  3OSF A;  2CUF A;  3S15 J;  2DMP A;  5F0H A;  3BR5 A;  2JMW A;  4JX4 A;  1GUU A;  1QPI A;  4QIW N;  4AYB N;  3Q0U A;  4FE7 A;  3S1R J;  2GLO A;  2O8K A;  4BBS J;  2Y9Z A;  1TWC J;  1B72 B;  5DS9 A;  5K7H A;  1DU0 A;  1TC3 C;  2ELK A;  1WPK A;  4S0H B;  2XB0 X;  1YRN B;  2VKE A;  5DTD A;  1X2N A;  2N8G A;  4RBO A;  5F08 A;  3HKZ N;  1RET A;  3BG5 A;  5F04 A;  2JN6 A;  2JWT A;  1ETK A;  2KDZ A;  3HGY A;  4RDU A;  1IDZ A;  5GPA A;  3DCF A;  2HI3 A;  1B8I B;  2EZL A;  3BQY A;  3FIS A;  5IOY A;  4GFB A;  4A3K J;  3HOU J;  3CDL A;  2DA7 A;  1HLV A;  1ITY A;  2NS7 A;  2R0Q C;  1UMQ A;  4ABZ A;  1I50 J;  2IBD A;  2K40 A;  4IHX A;  2Y0S N;  1Z77 A;  5M5X J;  1IG7 A;  2XRL A;  4FIS A;  5IP6 A;  2Y31 A;  3CQZ J;  1LFB A;  2DTZ A;  1FTT A;  2E1O A;  5J1R A;  3JRD A;  3BR3 A;  5K7F A;  2TCT A;  5IP9 J;  1MBF A;  4J19 A;  1MSE C;  2ZB9 A;  3ZQL A;  3GTK J;  2CJJ A;  1NTC A;  5EZH A;  2Y9Y A;  1IRZ A;  2GBY A;  4MFD A;  3E7L A;  3LSG A;  1TWG J;  2M8G X;  1W0U A;  1I6H J;  2EZH A;  4A3F J;  2WV1 A;  3TP3 A;  1MBH A;  3TP0 A;  4DW6 A;  3W6V A;  1HOM A;  4HNV A;  4CYC A;  3WHC A;  2CQQ A;  1AKH B;  1T33 A;  4MLO A;  4B3A A;  1UHS A;  4DZJ A;  3Q0V A;  3NAR A;  2JA5 J;  4D5F A;  3DEW A;  3LSJ A;  1U9N A;  1WGX A;  3JR9 A;  4JYK A;  1JTX A;  3TED A;  5J1Y A;  2NVT J;  1RR7 A;  1JKO C;  3BT9 A;  3S1N J;  2OPT A;  2LR8 A;  1GV5 A;  2HXI A;  4JP0 A;  5EGO B;  2JJ7 A;  3S14 J;  4DYQ A;  4FCY A;  1H89 C;  2JA7 J;  5C3E J;  2DMU A;  1TWA J;  5FLM J;  2MW8 A;  1Y1W J;  3WHB A;  1CQT A;  1T56 A;  5HOD A;  2ID6 A;  2XPU A;  4QSH A;  2E2I J;  2JA6 J;  1WI3 A;  3OIO A;  3S16 J;  3TW6 A;  1ZR2 A;  2P81 A;  2FD5 A;  1GV2 A;  3ZQI A;  3G1L A;  1YRN A;  2R5Y A;  2EZI A;  2L9R A;  2M2E A;  3G1M A;  2K9S A;  2PMZ N;  3ZQH A;  4BY7 J;  5J1U A;  2EZK A;  2Y2Z A;  1GVD A;  3BR6 A;  1JJ6 C;  2O9L A;  3GTL J;  1IDY A;  4AC0 A;  3FK6 A;  2NVQ J;  2AO9 A;  2E2H J;  3HGG A;  1U78 A;  2LLK A;  3UKG A;  2HXO A;  2HOT A;  1AKH A;  2VPR A;  5IPA A;  2DA2 A;  5M5Y J;  2LTP A;  2DA3 A;  2IAI A;  2L7Z A;  3MVP A;  2DJN A;  3RZD J;  4L5E A;  2IEK A;  3BG9 A;  3HM5 A;  3GTG J;  2K9N A;  2R7Z J;  1ENH A;  5F0C A;  1LE8 A;  3LOC A;  3CMY A;  5IYC J;  1D5Y A;  2L0K A;  1ZQ3 P;  1MBK A;  1ZK8 A;  2HQ5 A;  2JK3 A;  5GP9 A;  3JRG A;  1ETO A;  1Y1V J;  1OJL A;  2EH3 A;  3B6A A;  2Y30 A;  4XIC A;  3HB9 A;  1FJL A;  5EF6 A;  1NK3 P;  5IYD J;  3GBG A;  1I3Q J;  4M3E A;  4BKX A;  2COB A;  1APL C;  3C2B A;  5J3L A;  4MFE A;  3ZQC A;  2M0C A;  3K7A J;  4D5C A;  2LY9 A;  1Z0X A;  1F36 A;  1Q1V A;  1WCM J;  2LVS A;  1U8B A;  2QF7 A;  4UUT A;  3VPR A;  1AU7 A;  3HBL A;  1E3O C;  1U9O A;  1PUF A;  1ETY A;  1MH4 A;  3BTC A;  3S2H J;  4DYR A;  1A6I A;  5F1J A;  3RKQ A;  2NS8 A;  2ID3 A;  1JT6 A;  1FEX A;  4AUX A;  3IH2 A;  1W0T A;  2EQR A;  4IHV A;  4M3F A;  2I10 A;  2XSD C;  4CYC B;  3SFI A;  4M3D A;  4LOC A;  2CU7 A;  2DA5 A;  4I76 A;  1MNM C;  2XB5 A;  1IGN A;  3HEF A;  4A3B J;  4BBR J;  3JRH A;  3BTJ A;  1OCP A;  5FKK A;  3QPL A;  2QCO A;  2GM4 A;  2M9H A;  3BTI A;  3RQI A;  3BR1 A;  2H8R A;  2HYJ A;  2DMN A;  1RES A;  2WAQ N;  4XRM A;  5FJ8 J;  2MSY A;  5FLV A;  1P7I A;  2W48 A;  1POG A;  2D5V A;  2XGE A;  4XID A;  3Q0W A;  5M5W J;  3JRE A;  1BJZ A;  3A01 B;  3LNQ A;  3M3Y J;  5EYR A;  3QQA A;  3HOZ J;  2XPV A;  4IEJ A;  3M4O J;  1ORK A;  5E3L A;  1ETX A;  4UUS A;  1MSF C;  1JGG A;  2FQ4 A;  3A03 A;  2LK2 A;  2JA8 J;  5EGO A;  1GT0 C;  5JLW A;  4B1R A;  5FKM A;  1BL0 A;  1WH5 A;  4G12 A;  2NOG A;  2YU9 J;  3H3V K;  1PUF B;  4A3D J;  1VFC A;  1G2H A;  3A02 A;  4W97 A;  1X2M A;  3TW7 A;  2K9Q A;  3S17 J;  3GTP J;  1JKP C;  1BA5 A;  1SFO J;  1TWF J;  5BNG A;  3D1N I;  4DYC A;  4A3I J;  2CQX A;  1TWH J;  1JJ8 C;  1JKQ C;  3GTM J;  3RZO J;  5M3M J;  3NAU A;  4UUS B;  1DU6 A;  1XG1 A;  2YS9 A;  2R92 J;  1S7E A;  4A3J J;  5IOZ A;  4M6V A;  2FX0 A;  4Y7N J;  1H8A C;  1IC8 A;  5IP7 J;  1QVU A;  2MG4 A;  1JT0 A;  2VKV A;  3JRC A;  5GPC A;  1IJW C;  1LFU P;  1XS9 A;  3I4M J;  1JTY A;  1ZTR A;  4W1U A;  1VI0 A;  2B63 J;  3GTQ J;  1SAN A;  4XRS G;  1VF9 A;  1X58 A;  2CRG A;  2H1K A;  3HOY J;  3GTO J;  2DA1 A;  2XGD A;  3BQZ A;  4V2F A;  3S2D J;  1LE8 B;  1A5J A;  1HDP A;  3PM1 A;  1HF0 A;  4IHY A;  2TRT A;  1ZGW A;  4A3C J;  5M3F J;  5K7Z A;  3JRI A;  3PO2 J;  3F0C A;  3L1P A;  1B72 A;  1HCR A;  2VI6 A;  2MGQ A;  3BR0 A;  1ZR4 A;  2AHQ A;  2DA6 A;  2NVX J;  2O7O A;  1P7J A;  3IH4 A;  1AHD P;  2XGC A;  3OSG A;  2L7M P;  5FKO A;  2DMT A;  2G0E A;  1ETW A;  2FJ1 A;  2LP0 A;  4A3M J;  3PO3 J;  4C3H J;  2LFB A;  2YUS A;  4MO7 A;  4A3E J;  5EEA A;  5F0F A;  4M3G A;  2R5Z B;  4XK4 A;  5C4J J;  2ECB A;  1EF4 A;  1QVT A;  1MH3 A;  1WH7 A;  1MBE A;  3H0G J;  1MBJ A;  3G1O A;  1IUF A;  1FIA A;  1JUM A;  5EG0 B;  4JX6 A;  4Y52 J;  3O8G A;  3BR2 A;  2DMQ A;  3BTL A;  1ETV A;  4A93 J;  2ECC A;  3ZOB A;  3HOW J;  1BW5 A;  3MN2 A;  4D7M A;  2WB1 N;  4D7N A;  4M3B A;  4A69 C;  3FK7 A;  3MKL A;  2X48 A;  1RKT A;  2R5Y B;  5C4X J;  4IHW A;  1ETQ A;  1RPW A;  5E3M A;  3CCY A;  2DA4 A;  2VUM J;  3FIW A;  1K83 J;  1F43 A;  4FTH A;  4EEF G;  1JUS A;  2NVY J;  1HDD C;  1XC5 A;  1BW6 A;  2R5Z A;  1MBG A;  4BXX J;  3S1M J;  1O4X A;  3LSR A;  3ZQF A;  5E3O A;  1VND A;  4DZP A;  3JRF A;  1OCT C;  3A01 A;  5EG0 A;  2HDD A;  2M34 A;  5F27 A;  1NK2 P;  5FKN A;  1IV6 A;  5IYB J;  1FIP A;  2HOA A;  4MIM A;  4BY1 J;  4QTR A;  5EDN A;  3S1Q J;  3Q3S A;  4X6A J;  3IH3 A;  1GDT A;  3HOV J;  4JX5 A;  4X1E A;  3GTJ J;  3FKI J;  1OFC X;  9ANT A;  1RKW A;  1UG2 A;  1K61 A;  3SJM A;  2RAE A;  2X9D A;  4I6Z A;  4C3J J;  3JRA A;  2LKX A;  2E2J J;  3IV5 A;  3K2A A;  4A3G J;  1JKR C;  2L7F P;  3B6C A;  2X6O A;  5EZG A;  1JUP A;  3OOU A;  2R93 J;  4B4C A;  2CUE A;  3LSP A;  4V2G A;  2EBI A;  2ME0 A;  3JRB A;  1H88 C;  1FTZ A;  4FE4 A;  2ME6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...