2EZLA

Solution nmr structure of the ibeta subdomain of the mu end dna binding domain of phage mu transposase, 29 structures
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
MIARPTLEAHDYDREALWSKWDNASDSQRRLAEKWLPAVQAADEMLNQGISTKTAFATVAGHYQVSASTLRDKYYQVQKFAKPDWAAALVDGRGASRRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSPOSASE
publication title Solution structure of the Mu end DNA-binding ibeta subdomain of phage Mu transposase: modular DNA recognition by two tethered domains.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1997-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ezlA00
2XGCA 1IDYA 2K9QA 2WV1A 1G2HA 1UHSA 3OIOA 4MLOA 2E2IJ 2R92J 1B8IB 3S2DJ 2CUEA 1ZR2A 3GTLJ 5E3MA 1MBEA 2ELKA 3SDGA 3OSFA 1JJ8C 2CRGA 1I50J 3PM1A 3JRHA 3IH2A 4C3JJ 2YU9J 1H8AC 3SJMA 4FCYA 2XSDC 2HI3A 2HXIA 3TEDA 4BKXA 3C2BA 3GBGA 4UUTA 2YS9A 1OJLA 3DEWA 3BG5A 2DMPA 1EF4A 2TCTA 5GPAA 3BQYA 2IEKA 1WH7A 3QQAA 3CMYA 5IYCJ 3GTPJ 3SFIA 1OCPA 3GTKJ 5EEAA 2CQXA 2R5ZB 2CUFA 5M3MJ 1YRNA 4QSHA 1GUUA 1VF9A 2DA4A 2DA2A 1K83J 2KDZA 3G1LA 4ABZA 1LE8B 2E2HJ 2DMQA 5J1RA 3OSGA 2JK3A 1T33A 1JT6A 2N8GA 5IPAA 2DA6A 4BBRJ 2COBA 4D5CA 4MFDA 2NS8A 1GV2A 2LVSA 3BR6A 3JRBA 1UG2A 4FE4A 4A69C 1ITYA 2JN6A 2M2EA 2DA3A 1NK2P 1LFBA 2EZKA 2M34A 2HXOA 4X1EA 3S17J 2XGEA 5HODA 2EZLA 1TWFJ 3FISA 2R7ZJ 1B72A 1ZKGA 5J1UA 1IUFA 2JWTA 5IYBJ 2FJ1A 1FIPA 2JA6J 1K61A 4M6VA 3O8GA 2RAEA 3H0GJ 3DCFA 3IH3A 3BG9A 4FE7A 1AU7A 2E1OA 2B63J 1PUFB 4IHXA 5GP9A 1B8IA 5IOZA 2JA5J 2R5YA 3TP3A 4B4CA 3FIWA 1ENHA 2I10A 5DS9A 3D1NI 1MBJA 1S7EA 2WB1N 3GTOJ 3GTQJ 5K7HA 1XS9A 2WAQN 2M9HA 2IAIA 3BTJA 1HLVA 4DZJA 2L0KA 3CDLA 1LFUP 1JKQC 3GTJJ 1U78A 3LSPA 2LLKA 4MFEA 3HOXJ 1NTCA 3CCYA 2MG4A 2FD5A 2ECCA 3S1NJ 2K40A 3O8HA 2VUMJ 3BR3A 1JKOC 4AC0A 5FKLA 2R5ZA 2PMZN 2LK2A 1ORKA 1SANA 2VPRA 1JKPC 1RKWA 3LSRA 1LE8A 1W0UA 2L7FP 2TRTA 3Q0WA 1AHDP 5C4XJ 4DYCA 5K7ZA 4QIWN 2R0QC 2HOSA 2X9DA 2JJ7A 5EZHA 2MSYA 3BTLA 4XRMA 3Q3SA 3LSGA 4BBSJ 4A3CJ 2ME6A 3HEFA 5C4JJ 5BNGA 2R5YB 3K2AA 2ID6A 1ETYA 3HOUJ 3VPRA 3OOUA 2XGDA 4XRSG 4X6AJ 2DTZA 4FISA 2DJNA 2HOTA 3HOVJ 1I3QJ 3WHCA 1FTZA 2DMTA 4XICA 1JT0A 3JRIA 2QF7A 3TP0A 2OPTA 2EBIA 1I6HJ 4A3FJ 5C3EJ 3RZOJ 4AUXA 1IV6A 1JGGA 1MSEC 2NVXJ 4DYQA 3HBLA 1U9OA 1T56A 4FTHA 2DA1A 1ETKA 4MIMA 4J19A 2R93J 1NK3P 1POGA 2O7OA 2Y2ZA 1ZGWA 3BG3A 1WGXA 1PUFA 5EF6A 3IH4A 1XC5A 2XB0X 3S1MJ 1JUMA 2AO9A 3LOCA 1W0TA 3I4NJ 2Y30A 1GV5A 3A01A 3JREA 2NVTJ 1TWAJ 1RESA 1H88C 2X6OA 1IGNA 4L5EA 4AYBN 3S15J 1X2MA 5E3LA 1X2NA 3HB9A 9ANTA 2MGQA 5C44J 3JRGA 4M3BA 1GT0C 3JR9A 5IYDJ 5J3LA 2HDDA 1WH5A 4DZPA 1DU6A 5FKKA 3S1RJ 5M5WJ 3BR5A 5EGOB 1QVUA 4A93J 1MBHA 1BW5A 4I76A 1TWGJ 4EEFG 2O9LA 2CJJA 3BR1A 3FK7A 2JA7J 1D5YA 1Q1VA 3GTMJ 2EZIA 5FKOA 1IDZA 1ZK8A 5F04A 4A3LJ 4Y52J 1IC8A 5FLVA 3I4MJ 3FKIJ 3ZQHA 2XRLA 4A3KJ 2E2JJ 2H8RA 3MN2A 1ETWA 1WCMJ 4IHWA 2DMUA 1OCTC 2FQ4A 5FLMJ 3JRCA 2LTPA 3A01B 5DTDA 4C2MJ 4W97A 4A3MJ 3JRAA 2OF7A 1QVTA 3RKQA 2NVQJ 4XIDA 1BA5A 2LP0A 4S0HB 1HDDC 3MKLA 5EG0B 4JX4A 3ZQGA 2GM4A 4A3BJ 1A5JA 3K7AJ 2HYJA 3A03A 3TW6A 3QPLA 2NS7A 5M5XJ 2Y0SN 2NOGA 4UUSB 2VKVA 2XB5A 2EH3A 2ID3A 4D5FA 1O4XA 1IJWC 5FKNA 4A3DJ 4A3GJ 1VI0A 1JTXA 2QCOA 2LKXA 4JYKA 2XPUA 2XPWA 1FJLA 2X48A 2K9NA 1JJ6C 4QTRA 2DA5A 4G12A 2Y31A 1MBGA 4M3EA 1HDPA 3HGYA 2O8KA 5M3FJ 1MBFA 3B6AA 3G1MA 1RETA 1JTYA 4JP0A 1FTTA 4MO7A 3Q0UA 4M3DA 1QRYA 1F36A 3LNQA 3NAUA 1UMQA 1Z0XA 2L7ZA 2Y9YA 3BTIA 3M3YJ 4W1UA 3GTGJ 2VKEA 5IP7J 1FEXA 4XK4A 1XG1A 5EGOA 2LY9A 1P7JA 1ETXA 2JMWA 2W48A 1Y1WJ 3S2HJ 4JX5A 1RPWA 1AKHB 1TC3C 5FJ8J 1QPIA 1IRZA 2G0EA 4RDUA 3F0CA 4A3JJ 2IBDA 1ZR4A 5EDNA 4RBOA 1VFCA 3M4OJ 2D5VA 1MH4A 3E7LA 3HKZN 1GDTA 1HCRA 4CYCB 1MBKA 5F0HA 4IEJA 5F27A 1FIAA 4BY1J 2AHQA 5F1JA 3TW7A 2CU7A 5EZGA 3JRFA 4NDLA 5E3NA 5JLWA 3FK6A 2L9RA 5EG0A 1HF0A 4M3FA 3A02A 2EZHA 2M8GX 2XPVA 4V2FA 2MW8A 1R9TJ 3MVPA 3HGGA 2P81A 1JUSA 3ZQIA 4A3IJ 3HOYJ 4B3AA 1ZQ3P 4UUSA 2DMNA 4DYRA 2CQQA 3HM5A 1BW6A 3G1OA 1H89C 3B6CA 1OFCX 3RZDJ 2DN0A 3BTCA 3S1QJ 4BY7J 4D7MA 3ZQLA 1E3OC 2DA7A 4C3HJ 4B1RA 5GPCA 1BL0A 3JRDA 5FKMA 3RQIA 3H3VK 5IP6A 1CQTA 3ZQFA 2GBYA 4M3GA 1VNDA 4Y7NJ 3HOWJ 1BJZA 3S14J 1Y1VJ 1ZTRA 3IV5A 3UKGA 2HQ5A 2GLOA 1RR7A 4DW6A 3S16J 3QPSA 3LSJA 1Z77A 1SFOJ 5IP9J 3PO3J 1U8BA 3PO2J 1F43A 5F0FA 4D7NA 4GFBA 3WHBA 4XRSA 1IG7A 5K7FA 1JKRC 2HOAA 5M5YJ 2ME0A 1YRNB 2LFBA 5F08A 2JA8J 1MH3A 5F0CA 1AKHA 1X58A 4IHYA 4IHVA 4V2GA 1P7IA 2LD5A 1TWCJ 3W6VA 3ZQCA 1MSFC 3ZOBA 3CQZJ 1MNMC 4BXXJ 2E19A 4HNVA 2M0CA 2H1KA 4I6ZA 1U9NA 4A3EJ 2VI6A 3L1PA 1ETOA 1ETVA 3BR2A 5JLXA 4CYCA 4C3IJ 2YUSA 1TWHJ 3Q0VA 1RKTA 1JUPA 2L7MP 1WPKA 1DU0A 1APLC 3BQZA 5J1YA 1ETQA 1GVDA 5IOYA 1WI3A 5EYRA 1A6IA 1B72B 2KT0A 1HOMA 3BR0A 3NARA 3HOZJ 2Y9ZA 2LR8A 4LOCA 2FX0A 2K9SA 2EQRA 2NVYJ 2ZB9A 3HDDA 2ECBA 5E3OA 3BT9A 4JX6A
chains in the Genus database with same CATH superfamily
4WF2A 1IDYA 2P0WA 5KNLA 3GLXA 2DODA 5HDKA 1UHSA 4MLOA 2R92J 4PGGA 4MQ9F 1KU9A 1HC8A 1JJ8C 3OSFA 3AL0C 2PMHA 4UHTA 1SD5A 3PM1A 5D4RA 2WWYA 1R1UA 1K78A 2O61A 4C3JJ 2YU9J 5HS7A 1FYKA 4FCYA 4H4KC 3CCJI 2HXIA 3GCMA 4R79A 3G3ZA 3K4KA 2L9NA 2B7EA 1I1SA 1JI8A 3WTXC 1U8RA 2FNPA 1EH6A 1WI9A 4UUTA 2YS9A 3CC7I 1J59A 5FO5A 3RTRA 3KZIC 3BG5A 4ZZDA 4XLPF 2IP2A 3T0YA 3I54A 4MTEA 1FBQA 1GHCA 2TCTA 3CUQA 1FP1D 2EK5A 4QPQA 1QGPA 1E17A 3QQAA 1WH7A 1IAWA 1W4MA 1F1ZA 5IYCJ 1YITI 3MAJA 2BYVE 2HVRA 5ILUA 2CUFA 1J09A 3VWBA 3H5RA 2BEOA 1VF9A 5AIQA 2DA2A 2DQRA 2V79A 1LE8B 1VQLI 2L4AA 1XN7A 1YJNI 3KP4A 4HYEA 1KQ9A 2JK3A 2YU3A 3BCBA 2LNBA 4CCOA 1FSEA 2K4BA 1XMAA 2DA6A 5ILSA 2VBYA 1OYIA 2NS8A 3TBIA 4EM0B 1GXPA 1MZBA 4E6KG 3JRBA 4A69C 1QA6A 4PGHA 2JN6A 1YO5C 1OISA 2Z1DA 4KICA 3DPTA 2P8TA 1FX7A 3R0JA 3HYIA 1LFBA 1Z05A 2M5WA 4G6DA 2VKHA 5DCMB 3CJNA 4CZCA 5HODA 3FISA 2R7ZJ 3GZ5A 4M9ZA 2R7XA 4I0BA 4CXFA 1ZKGA 1BI2A 1IRGA 2H09A 5EEGA 2VKDA 1KU7A 1IUFA 2F4MB 2JWTA 2Y0SA 1ZARA 1O3SA 3ISPA 3KFWX 4ESFA 2JA6J 3O8GA 3IH3A 3D0SA 4RGUA 3LSMA 3V8JA 2JRMA 3BPVA 1ZG5A 4LLNA 1XB4A 3M9AA 2QUFA 3BWGA 1UJ8A 3TP3A 1B9MA 1O57A 2Y69H 3HHGA 5DM6F 4JK1X 4Z6YA 3D1NI 1X1AA 2DXIA 1J75A 1W7PA 1MBJA 4XN0A 3AG2H 2WB1N 4F3QA 1G3WA 4C30A 4GO1A 2RREA 1V55H 3CZ6A 1HLVA 1JKQC 2L01A 1U78A 2H1LA 1F5TA 1PYVA 1QZZA 4LD5A 5GTHC 2XGXA 4XKVA 2A05A 3F8CA 2W24A 1YIOA 2FD5A 5H6RA 3O8HA 3WU1B 1U5TB 5JHFA 3DF8A 5KHDA 2P7CB 4AC0A 4A12A 1T0FA 1GXQA 2PMZN 1JKPC 4Y13A 1RKWA 3ERMA 3KCCA 2BW3B 3VOEA 3W2WA 3LSRA 3RSNA 2ESNA 1W0UA 2TRTA 1YFHA 4MGRA 2KHMA 1KA8A 3M1EA 1QU3A 1A31A 2JJ7A 5B66C 3F22A 3ZMDA 4ZJZA 4BBSJ 2VJIA 5L3CA 1B9NA 1MDMA 3HEFA 2FMLA 4P55A 5BNGA 3KPHA 2E7XA 5CQGA 1ZAOA 2L9VA 4BGDA 2ID6A 2GOXB 2X6WA 1YQAA 2VBZA 3NRVA 4DGWB 2MD5A 2X1DA 4L9JA 3T1BA 2HOTA 1I3QJ 2JRTA 2DFIA 4B47A 2PMUA 3HSFA 3JRIA 5CYVA 2QF7A 3DKXA 4KN4X 4HF0A 4ENNA 1XD7A 4PJMA 4AIHA 3RZOJ 5IT9Z 1JGGA 5E79C 4C2TA 4DYQA 4BUPA 1L0OC 1T56A 2P7VB 3DU5A 4PFPA 4NBQA 4B3XA 4J19A 3ZP5A 6PAXA 4E7HA 3LAJA 2BOLA 1YJ9I 2UXXA 2YX4A 1WGXA 3GMEA 1W5CC 4A0XA 3MZHA 1FZPB 1ZGAA 2IXSA 4I01A 2W85A 2CYYA 1Z7LA 3S32A 3AAFA 3IKVA 1W0TA 3CLOA 2G7HA 1REPC 5LEKA 2GAUA 1ZN2A 2HZTA 2LSOA 5JI6A 2XDVA 3KZZA 4ZYDA 1VQ9I 1X2NA 2MLKA 4NUBA 3PSIA 3OYMA 1QPMA 1SFKA 1SD4A 3JRGA 2OC6A 2R7OA 4RLFA 4HLYA 2KIQA 2OBPA 2IA1A 1BC7C 5FKKA 4E7ZA 3IAS2 4MTDA 4AVPA 4A93J 2ZMEB 1BW5A 4I76A 1X19A 4JQFA 4AM3A 3OYKA 2JA7J 2RGVA 3HC7A 2V1DA 5DYMA 5HNHA 4YFXF 2KLOA 2FSWA 4PSXA 4XLEA 3BZ6A 5JFRA 1VQKI 1XSXA 3PQKA 2LDUA 3W3CA 5KVRA 3JAMZ 2RNJA 4M73A 1UCRA 5GAEJ 4A3KJ 3OYFA 3MN2A 1T98A 1ETWA 1PJRA 4DQ2A 2DMUA 4F91B 3R0AA 1O3RA 1J7KA 3WTTC 3HRUA 3E6DA 2CGPA 1WJAA 1IXRC 3VYUB 2ZFUA 3BJAA 3C1DA 1J9IA 2Z9OA 1WJCA 4E70A 4S0HB 4JX4A 2OTJI 4ZDLA 3P5JA 2HYJA 1WJEA 1LFPA 1USTA 5TISC 1VQ8I 2NS7A 2Y0SN 3K4BA 2VONA 2VKVA 2HYFA 2ID3A 1O4XA 5F64A 5FKNA 2KIFA 5J8FA 1LJ9A 2KIUA 2RV8A 2F4OB 2CV2A 1VQ5I 3IWZA 2XPUA 1FT9A 1FJLA 4WXHA 2X48A 4PDKA 4RAGA 4Y4RA 5AONA 5FFXA 3OS2A 4A5NA 5ICFA 2FBKA 5L3DA 3OYNA 2Q2EB 2K7LA 4Q5SF 4M3EA 4BJ6C 3HGYA 1LVKA 2V9KA 4BAYA 3N05A 1C0WA 2O6GE 1JTYA 3F9KA 3VFZA 3HXLA 2J5PA 2W82A 3K10A 5CJ9A 2AS5F 2LBFB 4MNUA 3CJRB 2OZ6A 5K5QA 3W6KB 1XSDA 2DTRA 2JSPA 3GF2A 4PZJA 2VKEA 1ZRCA 3OY9A 5F1RA 4XK4A 1XG1A 5D6EA 4G7ZF 1YJWI 1FY7A 1WWXA 4HSRA 3GVAA 2HPMA 1ETXA 3QPTA 4WK8F 4WXDA 1YX5A 1Y6IA 4KIGA 4LGWA 2NS0A 1TQMA 3R6SA 3S2HJ 3U1DA 4RB2C 1TC3C 5FJ8J 2VC0A 2K9MA 4RB3C 3RPUA 3RPUD 3G73A 2FMYA 3G71I 1G3YA 5ICEA 3M7GA 4U0YA 2HU9A 4BDYA 5EDNA 3JW4A 1OCCH 4C9YA 1M1EB 1UELB 5D5VB 3I56I 2FRHA 1ZG3A 2DYSH 3L2VA 1FMWA 1IN8A 1D1BA 5F0HA 1FIAA 4EJOA 4M72A 3TOAA 4F7ZA 1S7AA 2DAOA 4NDLA 2M45A 1FPQA 3DTKA 2A6EF 5HNFA 4M3FA 1EA3A 1LDJA 3A02A 3BDDA 4DBQA 2X1CA 1S7OA 2V1UA 3BOQA 4G7OF 3MVPA 5KK1A 4BACA 3HGGA 3U1KA 1KU2A 4B3AA 4UUSA 1G8XA 3P9KA 2VOPA 1YS7A 2NVUB 3G1OA 1ZRDA 3ZCOA 2IPQX 4KNYA 2WC2A 2DN0A 3BTCA 4N4OB 5TGTA 1JXSA 2OQGA 1Z9CA 4B1RA 2IS6A 2IGMA 2ZKZA 5GTIC 2ZXIA 2V26A 4Y17A 1FOXA 2BVLA 2CUZA 1HW5A 4G6TB 3QOPA 3IAM2 2C6YA 1X1CA 4RGRA 1DPUA 3IV5A 3UKGA 2HQ5A 2JVGA 3DWLE 4IL6C 3BG6A 5HDGA 2EFWA 3SZGA 1BJAA 4PJLA 3I5UA 4DW6A 5CVRA 2F5EA 3LSJA 2OAZA 2HEOA 4DNCA 1R22A 2IW5A 3F8MA 5F0FA 1F43A 4HA8A 4D7NA 1BI1A 4BEHB 1YYVA 3I59B 4XRSA 4KISA 1FLIA 2V9VA 2HOAA 2HQRA 2LY1A 2H94A 5F08A 1K4TA 4UUVA 1SFEA 3HL2A 4IHYA 4GYIA 3PSFA 3SEZA 1MW7A 5KAFC 2XRNA 4XQFA 2NRAC 5ILVA 2Y75A 1MSFC 1TZLA 3OS1A 4KN7X 2ACJA 2E7WA 4CUGA 3GZNB 1WJ5A 1Y8QB 1U9NA 3DU6A 3GWZA 3WTWC 3RKWA 1XX5A 3ZN0A 3WTUC 4CYCA 1FOYA 2R3SA 3FWEA 2YUSA 3OYGA 3LFKA 3BZCA 3OYJA 3A2KA 1T95A 2JZYA 2XROA 3I9V2 4B8XA 2BE5F 2Z3YA 2GA2A 1ZGJA 3UNGC 4ZYEA 4OU0A 1I39A 2HYGD 4LLLA 1KZHA 1DUXC 4GGGA 1K6OA 1BOBA 4MHGA 4GYGA 2K9SA 2VQGA 4FQGA 1KU3A 2NVYJ 2BHYA 2XF6A 3QU6A 4QWQA 3HDDA 4IQJA 5E3OA 2B9SA 2CS3A 4AIJA 5BQTA 5FRNA 2K9QA 1DP3A 4U87A 3K69A 1G2HA 1YLFA 2MD0A 2NYXA 2V9PA 2CG4A 4WX9A 2CUEA 1FP2A 2ZO4A 3F8BA 3GTLJ 3J7AO 5E3MA 1J5YA 3LQRA 3U9GA 3IH2A 1A04A 4J00A 4S04A 4XRFA 1A6QA 5B1BH 2HI3A 4CA0A 3VEPA 3E5UA 3L2UA 2HVQA 4WXCA 3TEDA 1USSA 3CLQA 1X3WB 2ZJQF 3GBGA 3S2WA 3E3VA 5LHIA 2HZDA 2EJRA 3DEWA 3ABLH 2OA4A 4RAZA 3V4GA 1OMIA 2K3FA 2LYCA 2HPIA 3Q9VA 2DMPA 1XCVA 4OMYA 1EF4A 5GPAA 2JUGA 1X3UA 3CMYA 3RKXA 2ZSHB 2ZJ2A 3FXUA 5A2QK 4B48A 3HSEA 4ETSA 5EEAA 1MMGA 1OLTA 2R5ZB 5M3MJ 1YRNA 4NC8A 4QSHA 4O3MA 4BE1A 4UY8I 3G1LA 2CV1A 5DUKA 2DMQA 1WRJA 3X2QH 1J0RA 4G6QA 1T33A 1JT6A 3EQLF 1LEAA 1IXCA 1HSJA 2GA1A 3DPUA 4KMUX 3KEQA 4II3A 2COBA 4F93B 2VE9A 1T8IA 4FETA 1Z1DA 3GW2A 1GV2A 2LVSA 4E7JA 1Y0NA 3BR6A 1K79A 2ZJRF 3CCSI 5FB2A 3EUHA 1ITYA 2R4GA 2M2EA 2DA3A 5E1XA 4D0PA 1NK2P 3OR2C 4HEA2 2ZCWA 3OYAA 1HA8A 1OQYA 2WV0A 1B72A 4HRIA 4LK1F 2M7AA 3O6BB 1MGTA 3KP7A 3CCMI 1Z6TA 4IRIA 1BN5A 2FA5A 2RAEA 5CKTA 4YIIA 4I98B 2E1MB 4RS8A 2KL4A 2PMZA 3L2QA 1RNLA 3K4MA 3ZMSA 2B63J 1PUFB 2K86A 5GP9A 2K5CA 1B8IA 5IOZA 1Y56A 1X1DA 4KUMA 2J5OA 2CMPA 2JPBA 1ENHA 3FIWA 4B4CA 1SFUA 2E71A 2MYSA 5DS9A 2JT1A 2F5CA 3TL4X 2LRDA 4AIKA 1YTYA 1OPCA 1MJAA 3CESA 3RI4A 1LNWA 4MEYF 5K7HA 1XS9A 4XSXF 3WTVC 2GWRA 5J4VA 3OYHA 4IF4A 4XN3A 2L0KA 1W36C 3D5LA 2LLKA 2DJIA 1NTCA 2WBMA 3ZMUA 3CCYA 1GVJA 4I02A 2KMUA 1N78A 2K40A 2CW0F 4CYDA 1B4AA 4LIUA 2E1NA 3BR3A 1JKOC 1MMSA 2P5VA 4P96A 2PBIA 2MA3A 3LSTA 5FKLA 3RKYA 3QYBA 1SC7A 2DLLA 3GYHX 3OWTA 2KZVA 4Z2YA 1TW2A 3AKZA 3HIFA 2XSJC 1S6LA 2E5NA 4LIVA 1AHDP 4DYCA 1V5GA 3CF5F 5A2QZ 3K9TA 3V7RA 3MKWB 3LSGA 2ZXWH 2M0MA 4IRHA 2ME6A 4XKCA 2IS1A 2JQ7A 2X4HA 5C4JJ 4XSZF 1V5FA 2F4IA 2PFBA 1R00A 1UFMA 3I53A 3UR3C 1S9HA 3VPRA 3OOUA 2XGDA 4ZDOA 2DJNA 3K1NA 3CCVI 1D0YA 2M3AA 1FTZA 4YRVA 2DMTA 3TP0A 2OPTA 5HVQC 5C3EJ 4PJ0C 3BJ6A 3HRTA 3PFYA 3QP5A 3WE3A 2NVXJ 3HBLA 1Z91A 1U9OA 1ETKA 3OYLA 2FU4A 1NK3P 1D1CA 1YIJI 1U0JA 3L2CA 2ADUA 2EFOA 2Y2ZA 5FD6A 5LEJA 3BG3A 2BZTA 4IXAA 3DLAA 5KAIC 3IH4A 5EF6A 3ZPLA 4WWCA 1XC5A 3GX4X 2W84A 4NC6A 2MABA 2AO9A 3LOCA 4IHTA 3BCAA 1G3SA 4P9UA 3MKZA 2VE8A 4NQWA 4XBFA 4AYBN 4RM2A 5GAHJ 3HB9A 4A5MA 3HZJA 5E8IA 4G94A 1YW7A 4M3BA 2HDDA 1WH5A 2PEXA 3TKYA 5D8LB 3DXJF 3KYCB 5EGOB 4BQQA 4EEFG 1R49A 2L5QA 3RDIA 2Q2EA 1D5YA 1I6XA 4XKWA 4XL9A 1ZK8A 5F04A 4L0ZB 2W4SA 1ZELA 4A3LJ 4Y52J 4IO9F 1R1VA 3ZQHA 4KMFA 2LREA 2XRLA 2H8RA 2E5ZA 2XAFA 2ZXHA 2LBFA 1OCTC 5FLMJ 2LTPA 2DK5A 1O7FA 5CVIA 2IVMA 3M07A 2OD5A 3G4SI 1QHHD 1FOWA 3M1CA 4A3MJ 1W7PD 2F5FA 3PQJA 2P5LC 2HKOA 1QVTA 2NVQJ 2LP0A 2JPCA 3MKLA 2XHKA 4PCQA 4HDVA 1A5JA 2QWWA 4YEJA 1W5TA 4PUSA 3G2BA 3WGHA 3V7SA 3QPLA 4PFOA 3RYRA 3JSPA 5L3BA 4I0AA 3WG7H 4QLCU 1TL8A 3PIOF 4BU2A 2IJLA 4DOZA 2VQHA 3JSOA 4BHBA 1G6NA 1WHUA 3CCEI 2XPWA 2RQQA 3F8NA 4XORA 3GFLA 2VC1A 4QTRA 2DA5A 1JJ6C 1F9NA 2YPRA 1CF7A 1HXDA 1VTNC 2FNAA 2Y31A 5DV5A 1HDPA 3HOTA 1IUYA 4RGSA 4HBLA 1YE9A 2O8KA 4V19K 2K4JA 3ASOH 1JHFA 4CCLA 4U7DA 5M3FJ 1XGOA 2L2OA 3MEXA 4XLFA 4XR6A 4JP0A 3CCRI 4OIPF 1Z3XA 5JVGF 1VQNI 5L3FA 4MO7A 1SD6A 2LKPA 1QRYA 3Q0UA 4HOBA 2H27A 4ZDPA 1OYWA 2Y9YA 1O7LA 3BTIA 1D8JA 4L9TA 2BHZA 5CVUA 4EM2A 1HSTA 5FROA 4HV5A 1DDNA 2VJJA 4IKFA 3GFJA 5E20A 1I3AA 4HSTA 1B6AA 2BY0A 4HQMA 1P7JA 5BPDA 5KCMA 3OYDA 3CCQI 4PSWA 2DOFA 2R7FA 3K0LA 4NNJA 1IO2A 1TTYA 5J40A 5B5EC 1BR4A 3DKYA 2W48A 2KFDA 3EUKL 4EGZA 4JX5A 2DOEA 5HS9A 4IOCF 1QPIA 1QBJA 1AOYA 4ANJA 3L2RA 4M9XA 3H36A 3ZQQA 4RDUA 3F0CA 3ZMZA 2KISA 1HW1A 2IBDA 2BY3A 1LDKB 5ICCA 1T08B 3K6GA 1VFCA 3M4OJ 2YX7A 2D5VA 3NWSA 1HCRA 1IRXA 1X1PA 1UHWA 1WFXA 1MBKA 2O5RA 3A0BC 4FT8A 1OR7C 3PFIA 4JBAA 1LVAA 4QPOA 1DP7P 4BY1J 1RC9A 3TW7A 3EUAA 4AD9A 4IOAF 1D0XA 3JRFA 2KIMA 4YIRX 1B59A 2B0LA 5BOXA 2ISZA 5EG0A 2GXAA 4KITB 2PJRA 3SHFA 4RLQA 2F5VA 3CUOA 3DBRB 1R9TJ 4UNOA 1MMDA 3E5QA 4F55A 3D5SC 3LWFA 3CDHA 5DD8A 1YS6A 2ZBKA 4Q48A 4LG0B 2BY1A 2VXZA 3C18A 2LY2A 1SAUA 4OIQF 2G7UA 1XCBA 4A0YA 4D7MA 1KQ0A 2OCCH 3OL3A 1E3OC 2R7UA 4C3HJ 3BROA 5GPCA 5J47A 2E36A 5B1AH 5ICGA 3H3VK 4RMNA 1K78B 3HJEA 1CQTA 4XLHA 1T6SA 2NXNB 1MMAA 2JSCA 2GBYA 3S3OA 1P92A 1TW3A 1VNDA 1R36A 4I7HA 4ITVA 3HOWJ 1E2XA 3S14J 1KGSA 4AWXB 5CVJA 1ZTRA 3HHHA 2DPDA 5FGMA 1RR7A 3S16J 1QZEA 3FMQA 2BBYA 4S05A 3CUQB 3LAPA 3PO3J 1U8BA 2VOOA 2CW7A 2XAHA 4GFBA 3MCZA 3CMAI 3WHBA 4Y3OA 2UV1A 2V4JC 5M5YJ 2LFBA 3FX3A 1TP4A 1XDSA 2HKXA 2FEZA 5F0CA 1AKHA 1X58A 4LB5A 1E3HA 4V2GA 2XIGA 2LD5A 1EV7A 2KRCA 3ZQ7A 2R7SA 3OIQA 3ZQCA 4HQEA 2ZSIB 2HGCA 2LOOA 5L3EA 2E19A 4HNVA 5LHHA 5TJJA 3CC2I 2H1KA 2CUJA 3GUDA 5JLXA 2M30A 2IA2A 2GXBA 2GXGA 1TWHJ 1DQUA 2D45A 3K1MA 2V6CA 2Q1ZB 1O3TA 4BL0B 1APLC 2FBHA 1Z21A 1ETQA 1GVDA 5HS8A 2O0YA 5J1YA 3J7YJ 1A6IA 1FBUA 2VIXA 2KT0A 1XSVA 3E6BA 3ZGKA 3MD2A 3O3KA 3BR0A 4BE0A 3F6OA 1IF1A 4LOCA 1D3YA 3IP4B 4HNTA 3BT9A 4BQOA 2L02A 2DW4A 2VLAA 3DBLB 3OYBA 2XGCA 1TNTA 1TQPA 1P6RA 2OU2A 1FWZA 1P2FA 2WV1A 3E5XA 3OIOA 5H6QA 3KP6A 4HF1A 3RYPA 2LC2A 2ELKA 3SDGA 2CRGA 3JRHA 4IVNA 5EEHA 2K3PA 3K4JA 2M4KA 1FNNA 1W7PB 4EMSA 5FFZA 2XSDC 1SVLA 1STZA 4RGXA 4E7LA 3QPHA 1HKQA 3L7WA 1OCOH 2EIKH 4KDPA 2PI0A 4UVCA 3FXLA 1R1TA 3DEEA 2Y0MA 3WE2A 2WAEA 3SFIA 2LF7A 5ERIA 1WJBA 3GTKJ 5D4SA 2CQXA 3BJOA 3H1CA 3W2AA 4CCKA 2DA4A 1A36A 3QODA 2QQ8A 4L18B 1MD0A 4ABZA 5H20A 2DPUA 1QZYA 4MEXF 1I27A 3PNVA 2L4MA 1EH7A 3MWMA 5J1RA 1SEUA 4HLXA 4LMYA 1RIOH 3S3MA 1D1AA 3QU3A 3MKYB 2DO7A 1WSUA 3OR1C 5IPAA 1SVMA 2OUMA 2IGOA 4BBRJ 4LJZF 4Q47A 2Y48A 4D5CA 4MFDA 1U6GA 4HX4A 3RQ4A 4BXFA 1MDMB 4XMYA 5D5WB 3DP7A 3LSHA 4AVZA 2R7QA 2QQAA 1CGPA 1SFXA 5B3SH 4HF2A 5J6XA 4UXNA 2HNHA 3ECOA 3KIOA 1U5TC 3RCOA 5DD4A 2EZKA 2M34A 2HXOA 4L9VA 4UVBA 4X1EA 1MJBA 3VSLA 3WTYC 2DCEA 2EZLA 4HPQA 2MC4A 3KEYA 5CPRB 1HKSA 2HDCA 2HOEA 4P9FA 2EFNA 3AG3H 3CCUI 1FIPA 3VYRB 4IHSA 4M6VA 1BOAA 1FBSA 1MMNA 2DT5A 3LQQA 4RM3A 4AU7A 3H0GJ 3DCFA 4XOPA 3BG9A 4FE7A 1AU7A 1ZREA 5D8KB 2ZJPF 2NOJB 4XKBA 3TDZC 1BBYA 3N97A 4OIOF 1T2KA 3MZ8A 2EINH 1V3FA 2DDBA 3KETA 2ZNZA 2OQRA 1PDNC 1LB2A 3VB2A 3FM5A 3GTOJ 4ZYHA 2HFHA 2W1OA 2WAQN 4YG2F 3T8TA 4GXOA 2IAIA 3L2WA 1LDDA 3HPHA 3MQ0A 4DZJA 1LFUP 5CLSA 5FLXK 4M71A 1IV8A 4D9JA 1B1BA 1YHQI 3JCUC 2K9LA 4EJVA 4MFEA 4EQQA 1QO0D 3R60A 4IRGA 2HR3A 2MG4A 1S72I 3QAHA 2ECCA 3S1NJ 2HTJA 3HSRA 2EWNA 1YW9A 1R5ID 2GIVA 4PJNA 1SANA 2XKOA 3WGIA 1NG6A 2WY8Q 1D8KA 4EVIA 1LE8A 4RAYA 5DEQA 1IXSB 2X6XA 2CQ7A 3AG4H 3WG9A 4II2A 3A4CA 5C4XJ 3QYFA 5K7ZA 5EZHA 1F4KA 2MSYA 3BTLA 4XRMA 4EJTA 2Z99A 4A3CJ 2MH2A 1U3EM 3ASNH 2R5YB 2CWEA 4BS9A 3HKZA 4KA4A 2A69F 2D2WA 1FYLA 1O3QA 3PUFA 1YOVB 3P9IA 4TV7A 4NB5A 4XOTA 2CQNA 4XRSG 2XUBA 1ZG1A 4X6AJ 3HOVJ 2ZMEC 3CJTB 2XF5A 3WHCA 3HRMA 2G9WA 2GOMA 3C3WA 4AYBA 4XICA 1JT0A 2VODA 5DCMA 2NNYA 4HNUA 4RB1A 4K2EA 3V7CA 1H0MA 4A3FJ 4PK4A 5LRRA 4AUXA 5FRMA 1MSEC 3KP5A 4FHTA 2W00A 3PNYA 5BS6A 1WJDA 1EJ9A 3E0JB 4MIMA 2DK8A 1D0ZA 1FMVA 2O7OA 3OYEA 3NQOA 3SXYA 1KYZA 1FYMA 3TGNA 3IHUA 2A5YB 3H3UA 3K4LA 1GLNA 2XB0X 2XKPA 3S1MJ 4D1QA 1JUMA 3FMRA 3I4NJ 3VDXA 4G7HF 1WKMA 5K5RA 1TWAJ 5HLGA 4MQVA 2RC4A 1R7JA 3VYSB 4LK0F 2KRHA 2BGCA 3S15J 3DV8A 1X2MA 1RR8C 5E3LA 2QM3A 4LITA 2CFOA 2OV7A 9ANTA 3FZVA 1IZ1A 3S3NA 2MGQA 5LRSA 3KP2A 1GT0C 1LEBA 3JR9A 3CO6C 5IYDJ 2RDPA 3K2ZA 1HW2A 3S1RJ 4BE2A 3FXOA 1XPXA 1RUOA 1QVUA 2VT3A 4GCVA 1U5TA 4ON0A 2QZ8A 4B09A 5DDGA 3GFIA 2CJJA 3BR1A 5FLXZ 2KJBA 2BW3A 2Z5UA 1OYYA 1X4PA 5K5OA 3NWTA 3P7NA 1R58A 3H9JA 1Q1VA 5TRDA 5HDNA 5FKOA 1IDZA 4CO8A 3MZYA 1UG0A 3B02A 2UZKA 4X0GA 4IJAA 2ICWG 2KQRA 2W57A 1OKRA 3EETA 2A6HF 3S93A 1TLHB 1LKXA 1W5SA 4M6YA 3JRCA 2NNNA 1TNSA 3L00A 3A01B 3GZ6A 4C2MJ 4W97A 3M8JA 2WY7Q 3JRAA 2Z16A 3HTUA 4Q4ZF 2R7VA 1ZHFA 2JA2A 1V5EA 4OWRB 4XIDA 1HDDC 3EDPA 3ZQGA 3ZR8X 2GM4A 2VPLA 2FF4A 2VQLA 3K7AJ 3FXRA 3A03A 2VJ5A 2CFXA 4UV8A 3TW6A 2IT0A 2NOGA 4UUSB 4U0WA 4D5FA 1IJWC 1XGNA 4HZFA 2XV4S 3CD6I 4G9YA 2OCEA 3CMMA 2K9NA 3CCLI 3BLYA 3J80K 5E17F 1JE8A 1ZH5A 4ZTFA 3H92A 5DCFA 4EJWA 1MBFA 3B6AA 3WODF 1LQ1A 4JOMA 1IRFA 2F5DA 1R23A 3DTIA 4XLNF 2EV6A 5IT3A 2F2EA 2EV0A 3ZMVA 3H35A 2RN7A 3IRQA 2AQFA 3NAUA 4N4NB 1Z0XA 2L7ZA 3FF5A 1NG7A 2GIZA 2LH9A 1FOKA 2STTA 3M3YJ 3GTGJ 1BIAA 2K02A 5IP7J 4LFUA 4HW0A 4AIDA 4YELA 5D6FA 1FEXA 3O2PE 2HS5A 4CZZA 2P5KA 4GDFA 2ZMEA 4L5IA 3LFUA 5CVVA 4OIRF 3JTHA 2DU9A 2IA0A 3QWLA 2P4WA 3PJRA 2EA2A 1ULYA 5H2FC 2XAUA 1IRZA 3TOBA 4GRIA 3F3XA 2E1CA 5CQEA 2G0EA 2CQKA 2HWVA 2Q8KA 4A3JJ 1P9QC 1BM9A 1ZR4A 2K27A 1R5HA 3QP6A 1MH4A 3HKZN 3V8KA 1QHGA 4CYCB 3PIPF 4O5VA 2AHQA 2A5WA 4J01A 3H5AA 3ONQA 1K4SA 2CU7A 5EZGA 3T8RA 4BYYA 2I5UA 2WA0A 5E3NA 5JLWA 2XASA 3FK6A 2L9RA 1HF0A 2XPVA 3K4NA 2MW8A 1I5ZA 3U21A 2YR2A 4KFCA 1S5LC 2IS2A 2QYOA 1SD7A 1JUSA 3ZQIA 2O3FA 5J8CA 5LLQA 2R7DA 4C2UA 2V1XA 1ZQ3P 2WADA 4EGYA 3VODA 2H8WA 3H3ZA 2IRFG 3VSKA 1BW6A 3GXOA 3B6CA 2FBIA 3B73A 2HQAA 5DUIA 2VB6A 3M8EA 1MNDA 4B43A 4BY7J 2DA7A 3EYYA 4XM3A 5GADJ 2ELHA 2VBXA 4U0VA 2DI3A 5IT9K 1XGSA 3TDUC 5IP6A 3LSKA 3ZQFA 5LGTA 1L3LA 4M3GA 2CO5A 1VQ7I 2STWA 3J80Z 2DYRH 3LA7A 2GLOA 4BHCA 3FDYA 4UVAA 1VQOI 1VZ0A 3TMOA 1LUJB 5LGUA 3C7JA 2VQCA 2QBYB 1ERDA 2EIJH 4N9IA 3L09A 4CCJA 5E1ZB 2ZC2A 4BHPA 2DOAA 2ETHA 5K7FA 2V6EA 1YRNB 2ME0A 4ZC3A 3PUBA 3U2RA 3I64A 3ZRGA 1W36D 1P7IA 3F6VA 3KE2A 3T5XA 2MLGA 4G8XA 3IWFA 2BVMA 2P6TA 2DBBA 3ZOBA 3CQZJ 1MNMC 4BXXJ 5BMZA 2AQEA 1MKMA 2VN2A 3SFZA 1KONA 1R4NB 5LGNA 3FKJA 4I6ZA 3KLOA 4A3EJ 3HTSB 3L1PA 4I99C 1W1WE 1ETOA 1ETVA 3REOA 4C3IJ 1FSHA 2E60A 3I4PA 4HV6A 1Y0UA 1RKTA 2FOWA 1JUPA 2L7MP 2L7KA 2LF8A 1DU0A 3JAMK 2FQ3A 2OZUA 2XVCA 5EYRA 1B72B 2M87A 2QSHX 1A35A 2QA4I 2VT2A 2KRFA 3BY6A 3OS0A 2Y9ZA 2LR8A 2R7RA 4P1WA 3DFGA 1HQCA 2FX0A 2X6YA 2EQRA 2HDWA 4O6JA 2ZB9A 1RUNA 3GFMA 3E6CC 1R5GA 4XLAA 4BJ5C 1UHMA 3CC4I 4N0BA 5K1YA 5D5UB 1RI7A 2E2IJ 3DBHB 3IL2A 4ENMA 1B8IB 4XNFA 1TBXA 2FXAA 2M1BA 1FC3A 1ZR2A 3S2DJ 2UUZA 1MBEA 1XMXA 2DQLA 1EH8A 1I50J 2BV6A 3MMYB 5LFAA 3HUGB 1H8AC 3SJMA 3QOEA 2M4GA 1S8NA 1R4MB 2ESHA 4EATA 5J4YA 3CP8A 4BKXA 3C2BA 2X51A 4DJAA 3R61A 3J7ZI 3H9GA 1V54H 1OJLA 3BZKA 1ON1A 1WQ2A 4M6XA 1YX3A 2LG4A 3ERED 5GAGJ 4BJTA 4CICA 2E1MC 2W25A 3BQYA 1U2WA 2IEKA 1BI3A 1X4OA 3GTPJ 1BR2A 4BEHA 1OCPA 3WGGA 3I59A 1GUUA 1K83J 2KDZA 3K70C 3HOSA 2FOKA 2DT7B 2E2HJ 3K4CA 2V1NA 3FXQA 3W6JB 2W7NA 4R1HA 3OSGA 2NAZA 1WJFA 2N8GA 4OOIA 2DT6A 3FMSA 3WTZA 2QLZA 4A6EA 3OYIA 3PNTA 4E7IA 1UB9A 2EPFA 4FX0A 1Y8RB 1UG2A 4FE4A 3ABTA 4KT5C 2QGUA 2QKMB 3OL4A 3WU2C 2QENA 3AFHA 4HG2A 3AG1H 2QSFX 1YW8A 5HOOA 3S17J 2D1VA 3M8FA 4E4HA 2WAFA 2WAQA 2XGEA 3CDIA 2MBFA 1TWFJ 3ESWB 3FHNA 2OTLI 2JTVA 2VASA 5J1UA 1YI2I 4YFKF 3DKWA 1BIBA 2A61A 4HX7A 1PP8F 2PN6A 5IYBJ 4BNCA 2FJ1A 4KIFA 1K61A 5F6FA 2EV5A 4H0EA 2CW8A 5EJCA 3CTAA 2E1OA 4UB8C 4ESBA 5DM7F 1KYWA 3ABMH 3SZPA 4IHXA 1TT0A 2P6SA 5FD5A 3KLNA 2JA5J 2R5YA 1WVRA 4KT6A 2I10A 2CH0A 3F21A 2LMDA 1ON2A 4NQWB 1S7EA 2EB7A 3GTQJ 2ISYA 4KIBA 2M9HA 2EIMH 3J81K 3V8LA 2Q0OA 3BTJA 1SMYF 3FHZA 3CDLA 4BQNA 3GTJJ 4RAFA 3LSPA 1Z3YA 3HOXJ 4M74A 5HLHA 2M7BA 3E1SA 2IGKA 1ZLKA 2X0LA 1E3PA 2VJ4A 2VUMJ 2HTSA 4CGZA 3F23A 4ENKA 3GLLA 2R5ZA 2LK2A 1ORKA 2VPRA 1S3JA 4R8HA 1VQMI 1K7AA 4ESJA 1R71A 4YFNF 2L7FP 4ZTJA 1XMKA 2MC3A 3ZN1A 3Q0WA 3W2VA 1E0EA 1ONVA 4QIWN 1ZLJA 2R0QC 2HOSA 4A0ZA 2X9DA 3Q3SA 2FE3A 3EYIA 2VXDA 4E7KA 2BXYA 4L5JA 3E6MA 3K2AA 4BDZA 5D5XB 1G4DA 4IQ4A 1ETYA 4CCMA 5JHUA 3HOUJ 1JGSA 1XTAA 2DTZA 4FISA 3N4MA 2OJED 3SYTA 3FXKA 4CCNA 2XAJA 3V42A 4A6DA 4U88A 2DFEA 2EBIA 1I6HJ 2UWMA 3OOPA 3TO7A 1IV6A 3GO5A 2E35A 2QKLB 3ELKA 1OR7A 4FTHA 2DA1A 2CV0A 4I09A 2R93J 2QVOA 1AWCA 2RKHA 2PQ8A 1POGA 1Z7UA 2WTEA 1ZGWA 1BR1A 3S8PA 1PUFA 5E18F 1CF7B 1VQPI 4UB6C 4Y15A 4A2UA 1PP7U 3LMMA 1H9TA 3H0DA 5E1WA 2M8EA 3K70D 3NEUA 2Y30A 1GV5A 3A01A 3JREA 2NVTJ 1ACIA 2EILH 1RESA 1H9GA 2X6OA 1H88C 2O8XA 1IGNA 4L5EA 1K6YA 3ML6A 2X85A 3KZYA 4F92B 1MNEA 5C44J 5ED4A 2EFPA 1P4AA 1YG2A 5J3LA 1IN7A 3AL0B 4DZPA 3ZXSA 1DU6A 1BI0A 2R7WA 1XGMA 3C2GA 3FXJA 3BR5A 5M5WJ 3ABKH 1TT5B 1MBHA 3A1YA 2A6TA 4ZZLA 1TWGJ 5LHGA 3J81Z 2HVSA 2AXLA 2O9LA 2Z2SB 3BC8A 3CP2A 3FK7A 3HPGA 3ULQB 1N75A 2LKSA 2GZWA 2IGNA 3EUHC 2F48A 4RA2A 2KDOA 4EJUA 3MFKA 3LA3A 3GTMJ 2EZIA 2KP6A 1IW7F 5L3GA 1IC8A 5FLVA 3I4MJ 2DDAA 3FKIJ 2E2JJ 2QEXI 2R7TA 1WCMJ 2PG4A 4IHWA 2KKOA 3KP3A 2FQ4A 1SAXA 1IN6A 2V7FA 4HAMA 3F72A 5E8GA 5DTDA 3DQVC 3KX2A 1T39A 4HX8A 5HLIA 2OF7A 2RQPA 3I0TA 3RKQA 1BA5A 2EFQA 5EG0B 2QSGX 3FXMA 2PJRB 4FX4A 3DTEA 4A3BJ 3FM3A 5LBQA 3C2HA 1T38A 2DFFA 2KZGA 2RVCA 5M5XJ 2PX9A 3BP8A 1UZCA 3QRFF 2F6CA 1NHAA 2XB5A 4ZYGA 4BH9A 1BC8C 2EH3A 1PUEE 3RJPA 3I55I 1N77A 4L9NA 4A3DJ 4A3GJ 1VI0A 3P9CA 2KPMA 3D5RC 1JTXA 2QCOA 3CF2A 3A0HC 4JYKA 2LKXA 2H6CA 5HLTA 1I1GA 4P5OA 3OMYA 1IN4A 4ASNA 2QQ9A 4CHUA 3TO6A 4M9SA 5LD2C 4G12A 3FBNB 4ENJA 1MBGA 3QYEA 2BY2A 3G1MA 3VYTB 4UV9A 1RETA 2PLYA 4XONA 3I71A 3KYDB 3Q5FA 3SEQA 1Z67A 4HDUA 1FTTA 1QQIA 2ZXJA 4F52A 4M3DA 1KQ8A 1J2XA 1F36A 4RB0A 2JVHA 4YIFA 3LNQA 2MFZA 1UMQA 4ZYAA 4IZZA 2QQBA 4PJJA 1PVEA 1VQ4I 4W1UA 3TO9A 3OV8A 3CO7C 3GEZA 3LL7A 3Q9SA 5JR3A 5EGOA 2LY9A 3K1PA 4OMZA 3SZTA 3CMEI 2X1EA 1N25A 2VL8A 1AA7A 5AIPA 2L9SA 1SVOA 2JMWA 4ZH4F 1OCZH 1Y1WJ 2MH9A 4LLGF 1Z6RA 1RPWA 1AKHB 3ROUA 4EV0A 1JHHA 1G3TA 1DGWY 1DGRM 1ODDA 1RZ4A 1IN5A 4RBOA 2O03A 3E7LA 1GDTA 2L54A 3IC7A 3EPZA 3WTSC 3IUOA 4IEJA 5F27A 3CUQC 4IPAA 5F1JA 2UXNA 2DFHA 4IX7A 4OAZA 4NHJA 2BXZA 4N9HA 2QBYA 3HG9A 3SQNA 3RPQA 3COAC 2KJCA 2PJPA 4OAYA 2EZHA 2M8GX 4V2FA 2EA4A 1G59A 4LB6B 4L0YB 4XLCA 3E97A 3OYCA 3JTGA 1S29A 2P81A 4LG3A 4A3IJ 3HOYJ 3WU0A 2GQQA 3ECHA 2DMNA 2RNGA 2TDXA 3L9FA 4Y33A 3RIRA 4DYRA 2CQQA 3HM5A 4DIQA 3BG7A 1MIJA 1H89C 3CJQB 2H6BA 1OFCX 3RZDJ 3S1QJ 1P4WA 3KEOA 3ZQLA 4CH7A 1BL0A 3JRDA 5FKMA 2XAGA 3I3LA 3RQIA 1WZ2A 3IKTA 3ZMTA 4WCGA 3LA2A 3DLLF 1MJ9A 4Y7NJ 1QNTA 1BJZA 2A07F 1LPQA 1D5VA 2WB1A 2Z33A 4EM1A 1VQ6I 4BXUA 3BPXA 1Y1VJ 1ZYRF 2K85A 2D1HA 3H9QA 4FASD 2XC7A 4KYWA 5JVTA 1R6RA 3G6EI 2YSRA 1HKTA 3QPSA 3DPLC 1Z77A 2L3DA 3I58A 4B44A 1SFOJ 5IP9J 3TQNA 3PO2J 1V4RA 2A68F 4KJZA 4BQAA 2ZFWA 2JUCA 4U7BA 2COMA 1IG7A 3SDBA 1JKRC 1X1BA 2FUG2 3OIPA 1EKEA 2JA8J 1MH3A 1TQIA 1HBXG 4IHVA 5IY5H 3J7AY 1Y39A 1TWCJ 2IS4A 3W6VA 3FBIB 3HUGA 3ABUA 3HRSA 2M0CA 2AXTC 2ZNYA 4DBRA 2VI6A 2HQNA 2VBWA 2I8DA 4I2OA 3BR2A 1ZRFA 3LSIA 4CDGA 3R4KA 3Q0VA 1Q1HA 1SMTA 1X3ZB 3F8FA 1WPKA 2CSOA 3DEUA 4OINF 1T0FC 3BQZA 5IOYA 1XDUA 1WI3A 3H5NA 4CSWA 1HOMA 1RRJA 1NH3A 3NARA 3PL8A 3HOZJ 1P4XA 4E7SA 1DPRA 2A3SA 2XAQA 5BPIA 2XF7A 4LG0A 1UAAA 1OCRH 4NC7A 2E34A 2ECBA 2ELJA 3IRRA 3KYLA 4JX6A
chains in the Genus database with same CATH topology
2XGCA 1IDYA 2K9QA 2WV1A 1G2HA 1UHSA 3OIOA 4MLOA 2E2IJ 2R92J 1B8IB 3S2DJ 2CUEA 1ZR2A 3GTLJ 5E3MA 1MBEA 2ELKA 3SDGA 3OSFA 1JJ8C 2CRGA 1I50J 3PM1A 3JRHA 3IH2A 4C3JJ 2YU9J 1H8AC 3SJMA 4FCYA 2XSDC 2HI3A 2HXIA 3TEDA 4BKXA 3C2BA 3GBGA 4UUTA 2YS9A 1OJLA 3DEWA 3BG5A 2DMPA 1EF4A 2TCTA 5GPAA 3BQYA 2IEKA 1WH7A 3QQAA 3CMYA 5IYCJ 3GTPJ 3SFIA 1OCPA 3GTKJ 5EEAA 2CQXA 2R5ZB 2CUFA 5M3MJ 1YRNA 4QSHA 1GUUA 1VF9A 2DA4A 2DA2A 1K83J 2KDZA 3G1LA 4ABZA 1LE8B 2E2HJ 2DMQA 5J1RA 3OSGA 2JK3A 1T33A 1JT6A 2N8GA 5IPAA 2DA6A 4BBRJ 2COBA 4D5CA 4MFDA 2NS8A 1GV2A 2LVSA 3BR6A 3JRBA 1UG2A 4FE4A 4A69C 1ITYA 2JN6A 2M2EA 2DA3A 1NK2P 1LFBA 2EZKA 2M34A 2HXOA 4X1EA 3S17J 2XGEA 5HODA 2EZLA 1TWFJ 3FISA 2R7ZJ 1B72A 1ZKGA 5J1UA 1IUFA 2JWTA 5IYBJ 2FJ1A 1FIPA 2JA6J 1K61A 4M6VA 3O8GA 2RAEA 3H0GJ 3DCFA 3IH3A 3BG9A 4FE7A 1AU7A 2E1OA 2B63J 1PUFB 4IHXA 5GP9A 1B8IA 5IOZA 2JA5J 2R5YA 3TP3A 4B4CA 3FIWA 1ENHA 2I10A 5DS9A 3D1NI 1MBJA 1S7EA 2WB1N 3GTOJ 3GTQJ 5K7HA 1XS9A 2WAQN 2M9HA 2IAIA 3BTJA 1HLVA 4DZJA 2L0KA 3CDLA 1LFUP 1JKQC 3GTJJ 1U78A 3LSPA 2LLKA 4MFEA 3HOXJ 1NTCA 3CCYA 2MG4A 2FD5A 2ECCA 3S1NJ 2K40A 3O8HA 2VUMJ 3BR3A 1JKOC 4AC0A 5FKLA 2R5ZA 2PMZN 2LK2A 1ORKA 1SANA 2VPRA 1JKPC 1RKWA 3LSRA 1LE8A 1W0UA 2L7FP 2TRTA 3Q0WA 1AHDP 5C4XJ 4DYCA 5K7ZA 4QIWN 2R0QC 2HOSA 2X9DA 2JJ7A 5EZHA 2MSYA 3BTLA 4XRMA 3Q3SA 3LSGA 4BBSJ 4A3CJ 2ME6A 3HEFA 5C4JJ 5BNGA 2R5YB 3K2AA 2ID6A 1ETYA 3HOUJ 3VPRA 3OOUA 2XGDA 4XRSG 4X6AJ 2DTZA 4FISA 2DJNA 2HOTA 3HOVJ 1I3QJ 3WHCA 1FTZA 2DMTA 4XICA 1JT0A 3JRIA 2QF7A 3TP0A 2OPTA 2EBIA 1I6HJ 4A3FJ 5C3EJ 3RZOJ 4AUXA 1IV6A 1JGGA 1MSEC 2NVXJ 4DYQA 3HBLA 1U9OA 1T56A 4FTHA 2DA1A 1ETKA 4MIMA 4J19A 2R93J 1NK3P 1POGA 2O7OA 2Y2ZA 1ZGWA 3BG3A 1WGXA 1PUFA 5EF6A 3IH4A 1XC5A 2XB0X 3S1MJ 1JUMA 2AO9A 3LOCA 1W0TA 3I4NJ 2Y30A 1GV5A 3A01A 3JREA 2NVTJ 1TWAJ 1RESA 1H88C 2X6OA 1IGNA 4L5EA 4AYBN 3S15J 1X2MA 5E3LA 1X2NA 3HB9A 9ANTA 2MGQA 5C44J 3JRGA 4M3BA 1GT0C 3JR9A 5IYDJ 5J3LA 2HDDA 1WH5A 4DZPA 1DU6A 5FKKA 3S1RJ 5M5WJ 3BR5A 5EGOB 1QVUA 4A93J 1MBHA 1BW5A 4I76A 1TWGJ 4EEFG 2O9LA 2CJJA 3BR1A 3FK7A 2JA7J 1D5YA 1Q1VA 3GTMJ 2EZIA 5FKOA 1IDZA 1ZK8A 5F04A 4A3LJ 4Y52J 1IC8A 5FLVA 3I4MJ 3FKIJ 3ZQHA 2XRLA 4A3KJ 2E2JJ 2H8RA 3MN2A 1ETWA 1WCMJ 4IHWA 2DMUA 1OCTC 2FQ4A 5FLMJ 3JRCA 2LTPA 3A01B 5DTDA 4C2MJ 4W97A 4A3MJ 3JRAA 2OF7A 1QVTA 3RKQA 2NVQJ 4XIDA 1BA5A 2LP0A 4S0HB 1HDDC 3MKLA 5EG0B 4JX4A 3ZQGA 2GM4A 4A3BJ 1A5JA 3K7AJ 2HYJA 3A03A 3TW6A 3QPLA 2NS7A 5M5XJ 2Y0SN 2NOGA 4UUSB 2VKVA 2XB5A 2EH3A 2ID3A 4D5FA 1O4XA 1IJWC 5FKNA 4A3DJ 4A3GJ 1VI0A 1JTXA 2QCOA 2LKXA 4JYKA 2XPUA 2XPWA 1FJLA 2X48A 2K9NA 1JJ6C 4QTRA 2DA5A 4G12A 2Y31A 1MBGA 4M3EA 1HDPA 3HGYA 2O8KA 5M3FJ 1MBFA 3B6AA 3G1MA 1RETA 1JTYA 4JP0A 1FTTA 4MO7A 3Q0UA 4M3DA 1QRYA 1F36A 3LNQA 3NAUA 1UMQA 1Z0XA 2L7ZA 2Y9YA 3BTIA 3M3YJ 4W1UA 3GTGJ 2VKEA 5IP7J 1FEXA 4XK4A 1XG1A 5EGOA 2LY9A 1P7JA 1ETXA 2JMWA 2W48A 1Y1WJ 3S2HJ 4JX5A 1RPWA 1AKHB 1TC3C 5FJ8J 1QPIA 1IRZA 2G0EA 4RDUA 3F0CA 4A3JJ 2IBDA 1ZR4A 5EDNA 4RBOA 1VFCA 3M4OJ 2D5VA 1MH4A 3E7LA 3HKZN 1GDTA 1HCRA 4CYCB 1MBKA 5F0HA 4IEJA 5F27A 1FIAA 4BY1J 2AHQA 5F1JA 3TW7A 2CU7A 5EZGA 3JRFA 4NDLA 5E3NA 5JLWA 3FK6A 2L9RA 5EG0A 1HF0A 4M3FA 3A02A 2EZHA 2M8GX 2XPVA 4V2FA 2MW8A 1R9TJ 3MVPA 3HGGA 2P81A 1JUSA 3ZQIA 4A3IJ 3HOYJ 4B3AA 1ZQ3P 4UUSA 2DMNA 4DYRA 2CQQA 3HM5A 1BW6A 3G1OA 1H89C 3B6CA 1OFCX 3RZDJ 2DN0A 3BTCA 3S1QJ 4BY7J 4D7MA 3ZQLA 1E3OC 2DA7A 4C3HJ 4B1RA 5GPCA 1BL0A 3JRDA 5FKMA 3RQIA 3H3VK 5IP6A 1CQTA 3ZQFA 2GBYA 4M3GA 1VNDA 4Y7NJ 3HOWJ 1BJZA 3S14J 1Y1VJ 1ZTRA 3IV5A 3UKGA 2HQ5A 2GLOA 1RR7A 4DW6A 3S16J 3QPSA 3LSJA 1Z77A 1SFOJ 5IP9J 3PO3J 1U8BA 3PO2J 1F43A 5F0FA 4D7NA 4GFBA 3WHBA 4XRSA 1IG7A 5K7FA 1JKRC 2HOAA 5M5YJ 2ME0A 1YRNB 2LFBA 5F08A 2JA8J 1MH3A 5F0CA 1AKHA 1X58A 4IHYA 4IHVA 4V2GA 1P7IA 2LD5A 1TWCJ 3W6VA 3ZQCA 1MSFC 3ZOBA 3CQZJ 1MNMC 4BXXJ 2E19A 4HNVA 2M0CA 2H1KA 4I6ZA 1U9NA 4A3EJ 2VI6A 3L1PA 1ETOA 1ETVA 3BR2A 5JLXA 4CYCA 4C3IJ 2YUSA 1TWHJ 3Q0VA 1RKTA 1JUPA 2L7MP 1WPKA 1DU0A 1APLC 3BQZA 5J1YA 1ETQA 1GVDA 5IOYA 1WI3A 5EYRA 1A6IA 1B72B 2KT0A 1HOMA 3BR0A 3NARA 3HOZJ 2Y9ZA 2LR8A 4LOCA 2FX0A 2K9SA 2EQRA 2NVYJ 2ZB9A 3HDDA 2ECBA 5E3OA 3BT9A 4JX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGC A;  1IDY A;  2K9Q A;  2WV1 A;  1G2H A;  1UHS A;  3OIO A;  4MLO A;  2E2I J;  2R92 J;  1B8I B;  3S2D J;  2CUE A;  1ZR2 A;  3GTL J;  5E3M A;  1MBE A;  2ELK A;  3SDG A;  3OSF A;  1JJ8 C;  2CRG A;  1I50 J;  3PM1 A;  3JRH A;  3IH2 A;  4C3J J;  2YU9 J;  1H8A C;  3SJM A;  4FCY A;  2XSD C;  2HI3 A;  2HXI A;  3TED A;  4BKX A;  3C2B A;  3GBG A;  4UUT A;  2YS9 A;  1OJL A;  3DEW A;  3BG5 A;  2DMP A;  1EF4 A;  2TCT A;  5GPA A;  3BQY A;  2IEK A;  1WH7 A;  3QQA A;  3CMY A;  5IYC J;  3GTP J;  3SFI A;  1OCP A;  3GTK J;  5EEA A;  2CQX A;  2R5Z B;  2CUF A;  5M3M J;  1YRN A;  4QSH A;  1GUU A;  1VF9 A;  2DA4 A;  2DA2 A;  1K83 J;  2KDZ A;  3G1L A;  4ABZ A;  1LE8 B;  2E2H J;  2DMQ A;  5J1R A;  3OSG A;  2JK3 A;  1T33 A;  1JT6 A;  2N8G A;  5IPA A;  2DA6 A;  4BBR J;  2COB A;  4D5C A;  4MFD A;  2NS8 A;  1GV2 A;  2LVS A;  3BR6 A;  3JRB A;  1UG2 A;  4FE4 A;  4A69 C;  1ITY A;  2JN6 A;  2M2E A;  2DA3 A;  1NK2 P;  1LFB A;  2EZK A;  2M34 A;  2HXO A;  4X1E A;  3S17 J;  2XGE A;  5HOD A;  2EZL A;  1TWF J;  3FIS A;  2R7Z J;  1B72 A;  1ZKG A;  5J1U A;  1IUF A;  2JWT A;  5IYB J;  2FJ1 A;  1FIP A;  2JA6 J;  1K61 A;  4M6V A;  3O8G A;  2RAE A;  3H0G J;  3DCF A;  3IH3 A;  3BG9 A;  4FE7 A;  1AU7 A;  2E1O A;  2B63 J;  1PUF B;  4IHX A;  5GP9 A;  1B8I A;  5IOZ A;  2JA5 J;  2R5Y A;  3TP3 A;  4B4C A;  3FIW A;  1ENH A;  2I10 A;  5DS9 A;  3D1N I;  1MBJ A;  1S7E A;  2WB1 N;  3GTO J;  3GTQ J;  5K7H A;  1XS9 A;  2WAQ N;  2M9H A;  2IAI A;  3BTJ A;  1HLV A;  4DZJ A;  2L0K A;  3CDL A;  1LFU P;  1JKQ C;  3GTJ J;  1U78 A;  3LSP A;  2LLK A;  4MFE A;  3HOX J;  1NTC A;  3CCY A;  2MG4 A;  2FD5 A;  2ECC A;  3S1N J;  2K40 A;  3O8H A;  2VUM J;  3BR3 A;  1JKO C;  4AC0 A;  5FKL A;  2R5Z A;  2PMZ N;  2LK2 A;  1ORK A;  1SAN A;  2VPR A;  1JKP C;  1RKW A;  3LSR A;  1LE8 A;  1W0U A;  2L7F P;  2TRT A;  3Q0W A;  1AHD P;  5C4X J;  4DYC A;  5K7Z A;  4QIW N;  2R0Q C;  2HOS A;  2X9D A;  2JJ7 A;  5EZH A;  2MSY A;  3BTL A;  4XRM A;  3Q3S A;  3LSG A;  4BBS J;  4A3C J;  2ME6 A;  3HEF A;  5C4J J;  5BNG A;  2R5Y B;  3K2A A;  2ID6 A;  1ETY A;  3HOU J;  3VPR A;  3OOU A;  2XGD A;  4XRS G;  4X6A J;  2DTZ A;  4FIS A;  2DJN A;  2HOT A;  3HOV J;  1I3Q J;  3WHC A;  1FTZ A;  2DMT A;  4XIC A;  1JT0 A;  3JRI A;  2QF7 A;  3TP0 A;  2OPT A;  2EBI A;  1I6H J;  4A3F J;  5C3E J;  3RZO J;  4AUX A;  1IV6 A;  1JGG A;  1MSE C;  2NVX J;  4DYQ A;  3HBL A;  1U9O A;  1T56 A;  4FTH A;  2DA1 A;  1ETK A;  4MIM A;  4J19 A;  2R93 J;  1NK3 P;  1POG A;  2O7O A;  2Y2Z A;  1ZGW A;  3BG3 A;  1WGX A;  1PUF A;  5EF6 A;  3IH4 A;  1XC5 A;  2XB0 X;  3S1M J;  1JUM A;  2AO9 A;  3LOC A;  1W0T A;  3I4N J;  2Y30 A;  1GV5 A;  3A01 A;  3JRE A;  2NVT J;  1TWA J;  1RES A;  1H88 C;  2X6O A;  1IGN A;  4L5E A;  4AYB N;  3S15 J;  1X2M A;  5E3L A;  1X2N A;  3HB9 A;  9ANT A;  2MGQ A;  5C44 J;  3JRG A;  4M3B A;  1GT0 C;  3JR9 A;  5IYD J;  5J3L A;  2HDD A;  1WH5 A;  4DZP A;  1DU6 A;  5FKK A;  3S1R J;  5M5W J;  3BR5 A;  5EGO B;  1QVU A;  4A93 J;  1MBH A;  1BW5 A;  4I76 A;  1TWG J;  4EEF G;  2O9L A;  2CJJ A;  3BR1 A;  3FK7 A;  2JA7 J;  1D5Y A;  1Q1V A;  3GTM J;  2EZI A;  5FKO A;  1IDZ A;  1ZK8 A;  5F04 A;  4A3L J;  4Y52 J;  1IC8 A;  5FLV A;  3I4M J;  3FKI J;  3ZQH A;  2XRL A;  4A3K J;  2E2J J;  2H8R A;  3MN2 A;  1ETW A;  1WCM J;  4IHW A;  2DMU A;  1OCT C;  2FQ4 A;  5FLM J;  3JRC A;  2LTP A;  3A01 B;  5DTD A;  4C2M J;  4W97 A;  4A3M J;  3JRA A;  2OF7 A;  1QVT A;  3RKQ A;  2NVQ J;  4XID A;  1BA5 A;  2LP0 A;  4S0H B;  1HDD C;  3MKL A;  5EG0 B;  4JX4 A;  3ZQG A;  2GM4 A;  4A3B J;  1A5J A;  3K7A J;  2HYJ A;  3A03 A;  3TW6 A;  3QPL A;  2NS7 A;  5M5X J;  2Y0S N;  2NOG A;  4UUS B;  2VKV A;  2XB5 A;  2EH3 A;  2ID3 A;  4D5F A;  1O4X A;  1IJW C;  5FKN A;  4A3D J;  4A3G J;  1VI0 A;  1JTX A;  2QCO A;  2LKX A;  4JYK A;  2XPU A;  2XPW A;  1FJL A;  2X48 A;  2K9N A;  1JJ6 C;  4QTR A;  2DA5 A;  4G12 A;  2Y31 A;  1MBG A;  4M3E A;  1HDP A;  3HGY A;  2O8K A;  5M3F J;  1MBF A;  3B6A A;  3G1M A;  1RET A;  1JTY A;  4JP0 A;  1FTT A;  4MO7 A;  3Q0U A;  4M3D A;  1QRY A;  1F36 A;  3LNQ A;  3NAU A;  1UMQ A;  1Z0X A;  2L7Z A;  2Y9Y A;  3BTI A;  3M3Y J;  4W1U A;  3GTG J;  2VKE A;  5IP7 J;  1FEX A;  4XK4 A;  1XG1 A;  5EGO A;  2LY9 A;  1P7J A;  1ETX A;  2JMW A;  2W48 A;  1Y1W J;  3S2H J;  4JX5 A;  1RPW A;  1AKH B;  1TC3 C;  5FJ8 J;  1QPI A;  1IRZ A;  2G0E A;  4RDU A;  3F0C A;  4A3J J;  2IBD A;  1ZR4 A;  5EDN A;  4RBO A;  1VFC A;  3M4O J;  2D5V A;  1MH4 A;  3E7L A;  3HKZ N;  1GDT A;  1HCR A;  4CYC B;  1MBK A;  5F0H A;  4IEJ A;  5F27 A;  1FIA A;  4BY1 J;  2AHQ A;  5F1J A;  3TW7 A;  2CU7 A;  5EZG A;  3JRF A;  4NDL A;  5E3N A;  5JLW A;  3FK6 A;  2L9R A;  5EG0 A;  1HF0 A;  4M3F A;  3A02 A;  2EZH A;  2M8G X;  2XPV A;  4V2F A;  2MW8 A;  1R9T J;  3MVP A;  3HGG A;  2P81 A;  1JUS A;  3ZQI A;  4A3I J;  3HOY J;  4B3A A;  1ZQ3 P;  4UUS A;  2DMN A;  4DYR A;  2CQQ A;  3HM5 A;  1BW6 A;  3G1O A;  1H89 C;  3B6C A;  1OFC X;  3RZD J;  2DN0 A;  3BTC A;  3S1Q J;  4BY7 J;  4D7M A;  3ZQL A;  1E3O C;  2DA7 A;  4C3H J;  4B1R A;  5GPC A;  1BL0 A;  3JRD A;  5FKM A;  3RQI A;  3H3V K;  5IP6 A;  1CQT A;  3ZQF A;  2GBY A;  4M3G A;  1VND A;  4Y7N J;  3HOW J;  1BJZ A;  3S14 J;  1Y1V J;  1ZTR A;  3IV5 A;  3UKG A;  2HQ5 A;  2GLO A;  1RR7 A;  4DW6 A;  3S16 J;  3QPS A;  3LSJ A;  1Z77 A;  1SFO J;  5IP9 J;  3PO3 J;  1U8B A;  3PO2 J;  1F43 A;  5F0F A;  4D7N A;  4GFB A;  3WHB A;  4XRS A;  1IG7 A;  5K7F A;  1JKR C;  2HOA A;  5M5Y J;  2ME0 A;  1YRN B;  2LFB A;  5F08 A;  2JA8 J;  1MH3 A;  5F0C A;  1AKH A;  1X58 A;  4IHY A;  4IHV A;  4V2G A;  1P7I A;  2LD5 A;  1TWC J;  3W6V A;  3ZQC A;  1MSF C;  3ZOB A;  3CQZ J;  1MNM C;  4BXX J;  2E19 A;  4HNV A;  2M0C A;  2H1K A;  4I6Z A;  1U9N A;  4A3E J;  2VI6 A;  3L1P A;  1ETO A;  1ETV A;  3BR2 A;  5JLX A;  4CYC A;  4C3I J;  2YUS A;  1TWH J;  3Q0V A;  1RKT A;  1JUP A;  2L7M P;  1WPK A;  1DU0 A;  1APL C;  3BQZ A;  5J1Y A;  1ETQ A;  1GVD A;  5IOY A;  1WI3 A;  5EYR A;  1A6I A;  1B72 B;  2KT0 A;  1HOM A;  3BR0 A;  3NAR A;  3HOZ J;  2Y9Z A;  2LR8 A;  4LOC A;  2FX0 A;  2K9S A;  2EQR A;  2NVY J;  2ZB9 A;  3HDD A;  2ECB A;  5E3O A;  3BT9 A;  4JX6 A; 
#chains in the Genus database with same CATH topology
 4WF2 A;  1IDY A;  2P0W A;  5KNL A;  3GLX A;  2DOD A;  5HDK A;  1UHS A;  4MLO A;  2R92 J;  4PGG A;  4MQ9 F;  1KU9 A;  1HC8 A;  1JJ8 C;  3OSF A;  3AL0 C;  2PMH A;  4UHT A;  1SD5 A;  3PM1 A;  5D4R A;  2WWY A;  1R1U A;  1K78 A;  2O61 A;  4C3J J;  2YU9 J;  5HS7 A;  1FYK A;  4FCY A;  4H4K C;  3CCJ I;  2HXI A;  3GCM A;  4R79 A;  3G3Z A;  3K4K A;  2L9N A;  2B7E A;  1I1S A;  1JI8 A;  3WTX C;  1U8R A;  2FNP A;  1EH6 A;  1WI9 A;  4UUT A;  2YS9 A;  3CC7 I;  1J59 A;  5FO5 A;  3RTR A;  3KZI C;  3BG5 A;  4ZZD A;  4XLP F;  2IP2 A;  3T0Y A;  3I54 A;  4MTE A;  1FBQ A;  1GHC A;  2TCT A;  3CUQ A;  1FP1 D;  2EK5 A;  4QPQ A;  1QGP A;  1E17 A;  3QQA A;  1WH7 A;  1IAW A;  1W4M A;  1F1Z A;  5IYC J;  1YIT I;  3MAJ A;  2BYV E;  2HVR A;  5ILU A;  2CUF A;  1J09 A;  3VWB A;  3H5R A;  2BEO A;  1VF9 A;  5AIQ A;  2DA2 A;  2DQR A;  2V79 A;  1LE8 B;  1VQL I;  2L4A A;  1XN7 A;  1YJN I;  3KP4 A;  4HYE A;  1KQ9 A;  2JK3 A;  2YU3 A;  3BCB A;  2LNB A;  4CCO A;  1FSE A;  2K4B A;  1XMA A;  2DA6 A;  5ILS A;  2VBY A;  1OYI A;  2NS8 A;  3TBI A;  4EM0 B;  1GXP A;  1MZB A;  4E6K G;  3JRB A;  4A69 C;  1QA6 A;  4PGH A;  2JN6 A;  1YO5 C;  1OIS A;  2Z1D A;  4KIC A;  3DPT A;  2P8T A;  1FX7 A;  3R0J A;  3HYI A;  1LFB A;  1Z05 A;  2M5W A;  4G6D A;  2VKH A;  5DCM B;  3CJN A;  4CZC A;  5HOD A;  3FIS A;  2R7Z J;  3GZ5 A;  4M9Z A;  2R7X A;  4I0B A;  4CXF A;  1ZKG A;  1BI2 A;  1IRG A;  2H09 A;  5EEG A;  2VKD A;  1KU7 A;  1IUF A;  2F4M B;  2JWT A;  2Y0S A;  1ZAR A;  1O3S A;  3ISP A;  3KFW X;  4ESF A;  2JA6 J;  3O8G A;  3IH3 A;  3D0S A;  4RGU A;  3LSM A;  3V8J A;  2JRM A;  3BPV A;  1ZG5 A;  4LLN A;  1XB4 A;  3M9A A;  2QUF A;  3BWG A;  1UJ8 A;  3TP3 A;  1B9M A;  1O57 A;  2Y69 H;  3HHG A;  5DM6 F;  4JK1 X;  4Z6Y A;  3D1N I;  1X1A A;  2DXI A;  1J75 A;  1W7P A;  1MBJ A;  4XN0 A;  3AG2 H;  2WB1 N;  4F3Q A;  1G3W A;  4C30 A;  4GO1 A;  2RRE A;  1V55 H;  3CZ6 A;  1HLV A;  1JKQ C;  2L01 A;  1U78 A;  2H1L A;  1F5T A;  1PYV A;  1QZZ A;  4LD5 A;  5GTH C;  2XGX A;  4XKV A;  2A05 A;  3F8C A;  2W24 A;  1YIO A;  2FD5 A;  5H6R A;  3O8H A;  3WU1 B;  1U5T B;  5JHF A;  3DF8 A;  5KHD A;  2P7C B;  4AC0 A;  4A12 A;  1T0F A;  1GXQ A;  2PMZ N;  1JKP C;  4Y13 A;  1RKW A;  3ERM A;  3KCC A;  2BW3 B;  3VOE A;  3W2W A;  3LSR A;  3RSN A;  2ESN A;  1W0U A;  2TRT A;  1YFH A;  4MGR A;  2KHM A;  1KA8 A;  3M1E A;  1QU3 A;  1A31 A;  2JJ7 A;  5B66 C;  3F22 A;  3ZMD A;  4ZJZ A;  4BBS J;  2VJI A;  5L3C A;  1B9N A;  1MDM A;  3HEF A;  2FML A;  4P55 A;  5BNG A;  3KPH A;  2E7X A;  5CQG A;  1ZAO A;  2L9V A;  4BGD A;  2ID6 A;  2GOX B;  2X6W A;  1YQA A;  2VBZ A;  3NRV A;  4DGW B;  2MD5 A;  2X1D A;  4L9J A;  3T1B A;  2HOT A;  1I3Q J;  2JRT A;  2DFI A;  4B47 A;  2PMU A;  3HSF A;  3JRI A;  5CYV A;  2QF7 A;  3DKX A;  4KN4 X;  4HF0 A;  4ENN A;  1XD7 A;  4PJM A;  4AIH A;  3RZO J;  5IT9 Z;  1JGG A;  5E79 C;  4C2T A;  4DYQ A;  4BUP A;  1L0O C;  1T56 A;  2P7V B;  3DU5 A;  4PFP A;  4NBQ A;  4B3X A;  4J19 A;  3ZP5 A;  6PAX A;  4E7H A;  3LAJ A;  2BOL A;  1YJ9 I;  2UXX A;  2YX4 A;  1WGX A;  3GME A;  1W5C C;  4A0X A;  3MZH A;  1FZP B;  1ZGA A;  2IXS A;  4I01 A;  2W85 A;  2CYY A;  1Z7L A;  3S32 A;  3AAF A;  3IKV A;  1W0T A;  3CLO A;  2G7H A;  1REP C;  5LEK A;  2GAU A;  1ZN2 A;  2HZT A;  2LSO A;  5JI6 A;  2XDV A;  3KZZ A;  4ZYD A;  1VQ9 I;  1X2N A;  2MLK A;  4NUB A;  3PSI A;  3OYM A;  1QPM A;  1SFK A;  1SD4 A;  3JRG A;  2OC6 A;  2R7O A;  4RLF A;  4HLY A;  2KIQ A;  2OBP A;  2IA1 A;  1BC7 C;  5FKK A;  4E7Z A;  3IAS 2;  4MTD A;  4AVP A;  4A93 J;  2ZME B;  1BW5 A;  4I76 A;  1X19 A;  4JQF A;  4AM3 A;  3OYK A;  2JA7 J;  2RGV A;  3HC7 A;  2V1D A;  5DYM A;  5HNH A;  4YFX F;  2KLO A;  2FSW A;  4PSX A;  4XLE A;  3BZ6 A;  5JFR A;  1VQK I;  1XSX A;  3PQK A;  2LDU A;  3W3C A;  5KVR A;  3JAM Z;  2RNJ A;  4M73 A;  1UCR A;  5GAE J;  4A3K J;  3OYF A;  3MN2 A;  1T98 A;  1ETW A;  1PJR A;  4DQ2 A;  2DMU A;  4F91 B;  3R0A A;  1O3R A;  1J7K A;  3WTT C;  3HRU A;  3E6D A;  2CGP A;  1WJA A;  1IXR C;  3VYU B;  2ZFU A;  3BJA A;  3C1D A;  1J9I A;  2Z9O A;  1WJC A;  4E70 A;  4S0H B;  4JX4 A;  2OTJ I;  4ZDL A;  3P5J A;  2HYJ A;  1WJE A;  1LFP A;  1UST A;  5TIS C;  1VQ8 I;  2NS7 A;  2Y0S N;  3K4B A;  2VON A;  2VKV A;  2HYF A;  2ID3 A;  1O4X A;  5F64 A;  5FKN A;  2KIF A;  5J8F A;  1LJ9 A;  2KIU A;  2RV8 A;  2F4O B;  2CV2 A;  1VQ5 I;  3IWZ A;  2XPU A;  1FT9 A;  1FJL A;  4WXH A;  2X48 A;  4PDK A;  4RAG A;  4Y4R A;  5AON A;  5FFX A;  3OS2 A;  4A5N A;  5ICF A;  2FBK A;  5L3D A;  3OYN A;  2Q2E B;  2K7L A;  4Q5S F;  4M3E A;  4BJ6 C;  3HGY A;  1LVK A;  2V9K A;  4BAY A;  3N05 A;  1C0W A;  2O6G E;  1JTY A;  3F9K A;  3VFZ A;  3HXL A;  2J5P A;  2W82 A;  3K10 A;  5CJ9 A;  2AS5 F;  2LBF B;  4MNU A;  3CJR B;  2OZ6 A;  5K5Q A;  3W6K B;  1XSD A;  2DTR A;  2JSP A;  3GF2 A;  4PZJ A;  2VKE A;  1ZRC A;  3OY9 A;  5F1R A;  4XK4 A;  1XG1 A;  5D6E A;  4G7Z F;  1YJW I;  1FY7 A;  1WWX A;  4HSR A;  3GVA A;  2HPM A;  1ETX A;  3QPT A;  4WK8 F;  4WXD A;  1YX5 A;  1Y6I A;  4KIG A;  4LGW A;  2NS0 A;  1TQM A;  3R6S A;  3S2H J;  3U1D A;  4RB2 C;  1TC3 C;  5FJ8 J;  2VC0 A;  2K9M A;  4RB3 C;  3RPU A;  3RPU D;  3G73 A;  2FMY A;  3G71 I;  1G3Y A;  5ICE A;  3M7G A;  4U0Y A;  2HU9 A;  4BDY A;  5EDN A;  3JW4 A;  1OCC H;  4C9Y A;  1M1E B;  1UEL B;  5D5V B;  3I56 I;  2FRH A;  1ZG3 A;  2DYS H;  3L2V A;  1FMW A;  1IN8 A;  1D1B A;  5F0H A;  1FIA A;  4EJO A;  4M72 A;  3TOA A;  4F7Z A;  1S7A A;  2DAO A;  4NDL A;  2M45 A;  1FPQ A;  3DTK A;  2A6E F;  5HNF A;  4M3F A;  1EA3 A;  1LDJ A;  3A02 A;  3BDD A;  4DBQ A;  2X1C A;  1S7O A;  2V1U A;  3BOQ A;  4G7O F;  3MVP A;  5KK1 A;  4BAC A;  3HGG A;  3U1K A;  1KU2 A;  4B3A A;  4UUS A;  1G8X A;  3P9K A;  2VOP A;  1YS7 A;  2NVU B;  3G1O A;  1ZRD A;  3ZCO A;  2IPQ X;  4KNY A;  2WC2 A;  2DN0 A;  3BTC A;  4N4O B;  5TGT A;  1JXS A;  2OQG A;  1Z9C A;  4B1R A;  2IS6 A;  2IGM A;  2ZKZ A;  5GTI C;  2ZXI A;  2V26 A;  4Y17 A;  1FOX A;  2BVL A;  2CUZ A;  1HW5 A;  4G6T B;  3QOP A;  3IAM 2;  2C6Y A;  1X1C A;  4RGR A;  1DPU A;  3IV5 A;  3UKG A;  2HQ5 A;  2JVG A;  3DWL E;  4IL6 C;  3BG6 A;  5HDG A;  2EFW A;  3SZG A;  1BJA A;  4PJL A;  3I5U A;  4DW6 A;  5CVR A;  2F5E A;  3LSJ A;  2OAZ A;  2HEO A;  4DNC A;  1R22 A;  2IW5 A;  3F8M A;  5F0F A;  1F43 A;  4HA8 A;  4D7N A;  1BI1 A;  4BEH B;  1YYV A;  3I59 B;  4XRS A;  4KIS A;  1FLI A;  2V9V A;  2HOA A;  2HQR A;  2LY1 A;  2H94 A;  5F08 A;  1K4T A;  4UUV A;  1SFE A;  3HL2 A;  4IHY A;  4GYI A;  3PSF A;  3SEZ A;  1MW7 A;  5KAF C;  2XRN A;  4XQF A;  2NRA C;  5ILV A;  2Y75 A;  1MSF C;  1TZL A;  3OS1 A;  4KN7 X;  2ACJ A;  2E7W A;  4CUG A;  3GZN B;  1WJ5 A;  1Y8Q B;  1U9N A;  3DU6 A;  3GWZ A;  3WTW C;  3RKW A;  1XX5 A;  3ZN0 A;  3WTU C;  4CYC A;  1FOY A;  2R3S A;  3FWE A;  2YUS A;  3OYG A;  3LFK A;  3BZC A;  3OYJ A;  3A2K A;  1T95 A;  2JZY A;  2XRO A;  3I9V 2;  4B8X A;  2BE5 F;  2Z3Y A;  2GA2 A;  1ZGJ A;  3UNG C;  4ZYE A;  4OU0 A;  1I39 A;  2HYG D;  4LLL A;  1KZH A;  1DUX C;  4GGG A;  1K6O A;  1BOB A;  4MHG A;  4GYG A;  2K9S A;  2VQG A;  4FQG A;  1KU3 A;  2NVY J;  2BHY A;  2XF6 A;  3QU6 A;  4QWQ A;  3HDD A;  4IQJ A;  5E3O A;  2B9S A;  2CS3 A;  4AIJ A;  5BQT A;  5FRN A;  2K9Q A;  1DP3 A;  4U87 A;  3K69 A;  1G2H A;  1YLF A;  2MD0 A;  2NYX A;  2V9P A;  2CG4 A;  4WX9 A;  2CUE A;  1FP2 A;  2ZO4 A;  3F8B A;  3GTL J;  3J7A O;  5E3M A;  1J5Y A;  3LQR A;  3U9G A;  3IH2 A;  1A04 A;  4J00 A;  4S04 A;  4XRF A;  1A6Q A;  5B1B H;  2HI3 A;  4CA0 A;  3VEP A;  3E5U A;  3L2U A;  2HVQ A;  4WXC A;  3TED A;  1USS A;  3CLQ A;  1X3W B;  2ZJQ F;  3GBG A;  3S2W A;  3E3V A;  5LHI A;  2HZD A;  2EJR A;  3DEW A;  3ABL H;  2OA4 A;  4RAZ A;  3V4G A;  1OMI A;  2K3F A;  2LYC A;  2HPI A;  3Q9V A;  2DMP A;  1XCV A;  4OMY A;  1EF4 A;  5GPA A;  2JUG A;  1X3U A;  3CMY A;  3RKX A;  2ZSH B;  2ZJ2 A;  3FXU A;  5A2Q K;  4B48 A;  3HSE A;  4ETS A;  5EEA A;  1MMG A;  1OLT A;  2R5Z B;  5M3M J;  1YRN A;  4NC8 A;  4QSH A;  4O3M A;  4BE1 A;  4UY8 I;  3G1L A;  2CV1 A;  5DUK A;  2DMQ A;  1WRJ A;  3X2Q H;  1J0R A;  4G6Q A;  1T33 A;  1JT6 A;  3EQL F;  1LEA A;  1IXC A;  1HSJ A;  2GA1 A;  3DPU A;  4KMU X;  3KEQ A;  4II3 A;  2COB A;  4F93 B;  2VE9 A;  1T8I A;  4FET A;  1Z1D A;  3GW2 A;  1GV2 A;  2LVS A;  4E7J A;  1Y0N A;  3BR6 A;  1K79 A;  2ZJR F;  3CCS I;  5FB2 A;  3EUH A;  1ITY A;  2R4G A;  2M2E A;  2DA3 A;  5E1X A;  4D0P A;  1NK2 P;  3OR2 C;  4HEA 2;  2ZCW A;  3OYA A;  1HA8 A;  1OQY A;  2WV0 A;  1B72 A;  4HRI A;  4LK1 F;  2M7A A;  3O6B B;  1MGT A;  3KP7 A;  3CCM I;  1Z6T A;  4IRI A;  1BN5 A;  2FA5 A;  2RAE A;  5CKT A;  4YII A;  4I98 B;  2E1M B;  4RS8 A;  2KL4 A;  2PMZ A;  3L2Q A;  1RNL A;  3K4M A;  3ZMS A;  2B63 J;  1PUF B;  2K86 A;  5GP9 A;  2K5C A;  1B8I A;  5IOZ A;  1Y56 A;  1X1D A;  4KUM A;  2J5O A;  2CMP A;  2JPB A;  1ENH A;  3FIW A;  4B4C A;  1SFU A;  2E71 A;  2MYS A;  5DS9 A;  2JT1 A;  2F5C A;  3TL4 X;  2LRD A;  4AIK A;  1YTY A;  1OPC A;  1MJA A;  3CES A;  3RI4 A;  1LNW A;  4MEY F;  5K7H A;  1XS9 A;  4XSX F;  3WTV C;  2GWR A;  5J4V A;  3OYH A;  4IF4 A;  4XN3 A;  2L0K A;  1W36 C;  3D5L A;  2LLK A;  2DJI A;  1NTC A;  2WBM A;  3ZMU A;  3CCY A;  1GVJ A;  4I02 A;  2KMU A;  1N78 A;  2K40 A;  2CW0 F;  4CYD A;  1B4A A;  4LIU A;  2E1N A;  3BR3 A;  1JKO C;  1MMS A;  2P5V A;  4P96 A;  2PBI A;  2MA3 A;  3LST A;  5FKL A;  3RKY A;  3QYB A;  1SC7 A;  2DLL A;  3GYH X;  3OWT A;  2KZV A;  4Z2Y A;  1TW2 A;  3AKZ A;  3HIF A;  2XSJ C;  1S6L A;  2E5N A;  4LIV A;  1AHD P;  4DYC A;  1V5G A;  3CF5 F;  5A2Q Z;  3K9T A;  3V7R A;  3MKW B;  3LSG A;  2ZXW H;  2M0M A;  4IRH A;  2ME6 A;  4XKC A;  2IS1 A;  2JQ7 A;  2X4H A;  5C4J J;  4XSZ F;  1V5F A;  2F4I A;  2PFB A;  1R00 A;  1UFM A;  3I53 A;  3UR3 C;  1S9H A;  3VPR A;  3OOU A;  2XGD A;  4ZDO A;  2DJN A;  3K1N A;  3CCV I;  1D0Y A;  2M3A A;  1FTZ A;  4YRV A;  2DMT A;  3TP0 A;  2OPT A;  5HVQ C;  5C3E J;  4PJ0 C;  3BJ6 A;  3HRT A;  3PFY A;  3QP5 A;  3WE3 A;  2NVX J;  3HBL A;  1Z91 A;  1U9O A;  1ETK A;  3OYL A;  2FU4 A;  1NK3 P;  1D1C A;  1YIJ I;  1U0J A;  3L2C A;  2ADU A;  2EFO A;  2Y2Z A;  5FD6 A;  5LEJ A;  3BG3 A;  2BZT A;  4IXA A;  3DLA A;  5KAI C;  3IH4 A;  5EF6 A;  3ZPL A;  4WWC A;  1XC5 A;  3GX4 X;  2W84 A;  4NC6 A;  2MAB A;  2AO9 A;  3LOC A;  4IHT A;  3BCA A;  1G3S A;  4P9U A;  3MKZ A;  2VE8 A;  4NQW A;  4XBF A;  4AYB N;  4RM2 A;  5GAH J;  3HB9 A;  4A5M A;  3HZJ A;  5E8I A;  4G94 A;  1YW7 A;  4M3B A;  2HDD A;  1WH5 A;  2PEX A;  3TKY A;  5D8L B;  3DXJ F;  3KYC B;  5EGO B;  4BQQ A;  4EEF G;  1R49 A;  2L5Q A;  3RDI A;  2Q2E A;  1D5Y A;  1I6X A;  4XKW A;  4XL9 A;  1ZK8 A;  5F04 A;  4L0Z B;  2W4S A;  1ZEL A;  4A3L J;  4Y52 J;  4IO9 F;  1R1V A;  3ZQH A;  4KMF A;  2LRE A;  2XRL A;  2H8R A;  2E5Z A;  2XAF A;  2ZXH A;  2LBF A;  1OCT C;  5FLM J;  2LTP A;  2DK5 A;  1O7F A;  5CVI A;  2IVM A;  3M07 A;  2OD5 A;  3G4S I;  1QHH D;  1FOW A;  3M1C A;  4A3M J;  1W7P D;  2F5F A;  3PQJ A;  2P5L C;  2HKO A;  1QVT A;  2NVQ J;  2LP0 A;  2JPC A;  3MKL A;  2XHK A;  4PCQ A;  4HDV A;  1A5J A;  2QWW A;  4YEJ A;  1W5T A;  4PUS A;  3G2B A;  3WGH A;  3V7S A;  3QPL A;  4PFO A;  3RYR A;  3JSP A;  5L3B A;  4I0A A;  3WG7 H;  4QLC U;  1TL8 A;  3PIO F;  4BU2 A;  2IJL A;  4DOZ A;  2VQH A;  3JSO A;  4BHB A;  1G6N A;  1WHU A;  3CCE I;  2XPW A;  2RQQ A;  3F8N A;  4XOR A;  3GFL A;  2VC1 A;  4QTR A;  2DA5 A;  1JJ6 C;  1F9N A;  2YPR A;  1CF7 A;  1HXD A;  1VTN C;  2FNA A;  2Y31 A;  5DV5 A;  1HDP A;  3HOT A;  1IUY A;  4RGS A;  4HBL A;  1YE9 A;  2O8K A;  4V19 K;  2K4J A;  3ASO H;  1JHF A;  4CCL A;  4U7D A;  5M3F J;  1XGO A;  2L2O A;  3MEX A;  4XLF A;  4XR6 A;  4JP0 A;  3CCR I;  4OIP F;  1Z3X A;  5JVG F;  1VQN I;  5L3F A;  4MO7 A;  1SD6 A;  2LKP A;  1QRY A;  3Q0U A;  4HOB A;  2H27 A;  4ZDP A;  1OYW A;  2Y9Y A;  1O7L A;  3BTI A;  1D8J A;  4L9T A;  2BHZ A;  5CVU A;  4EM2 A;  1HST A;  5FRO A;  4HV5 A;  1DDN A;  2VJJ A;  4IKF A;  3GFJ A;  5E20 A;  1I3A A;  4HST A;  1B6A A;  2BY0 A;  4HQM A;  1P7J A;  5BPD A;  5KCM A;  3OYD A;  3CCQ I;  4PSW A;  2DOF A;  2R7F A;  3K0L A;  4NNJ A;  1IO2 A;  1TTY A;  5J40 A;  5B5E C;  1BR4 A;  3DKY A;  2W48 A;  2KFD A;  3EUK L;  4EGZ A;  4JX5 A;  2DOE A;  5HS9 A;  4IOC F;  1QPI A;  1QBJ A;  1AOY A;  4ANJ A;  3L2R A;  4M9X A;  3H36 A;  3ZQQ A;  4RDU A;  3F0C A;  3ZMZ A;  2KIS A;  1HW1 A;  2IBD A;  2BY3 A;  1LDK B;  5ICC A;  1T08 B;  3K6G A;  1VFC A;  3M4O J;  2YX7 A;  2D5V A;  3NWS A;  1HCR A;  1IRX A;  1X1P A;  1UHW A;  1WFX A;  1MBK A;  2O5R A;  3A0B C;  4FT8 A;  1OR7 C;  3PFI A;  4JBA A;  1LVA A;  4QPO A;  1DP7 P;  4BY1 J;  1RC9 A;  3TW7 A;  3EUA A;  4AD9 A;  4IOA F;  1D0X A;  3JRF A;  2KIM A;  4YIR X;  1B59 A;  2B0L A;  5BOX A;  2ISZ A;  5EG0 A;  2GXA A;  4KIT B;  2PJR A;  3SHF A;  4RLQ A;  2F5V A;  3CUO A;  3DBR B;  1R9T J;  4UNO A;  1MMD A;  3E5Q A;  4F55 A;  3D5S C;  3LWF A;  3CDH A;  5DD8 A;  1YS6 A;  2ZBK A;  4Q48 A;  4LG0 B;  2BY1 A;  2VXZ A;  3C18 A;  2LY2 A;  1SAU A;  4OIQ F;  2G7U A;  1XCB A;  4A0Y A;  4D7M A;  1KQ0 A;  2OCC H;  3OL3 A;  1E3O C;  2R7U A;  4C3H J;  3BRO A;  5GPC A;  5J47 A;  2E36 A;  5B1A H;  5ICG A;  3H3V K;  4RMN A;  1K78 B;  3HJE A;  1CQT A;  4XLH A;  1T6S A;  2NXN B;  1MMA A;  2JSC A;  2GBY A;  3S3O A;  1P92 A;  1TW3 A;  1VND A;  1R36 A;  4I7H A;  4ITV A;  3HOW J;  1E2X A;  3S14 J;  1KGS A;  4AWX B;  5CVJ A;  1ZTR A;  3HHH A;  2DPD A;  5FGM A;  1RR7 A;  3S16 J;  1QZE A;  3FMQ A;  2BBY A;  4S05 A;  3CUQ B;  3LAP A;  3PO3 J;  1U8B A;  2VOO A;  2CW7 A;  2XAH A;  4GFB A;  3MCZ A;  3CMA I;  3WHB A;  4Y3O A;  2UV1 A;  2V4J C;  5M5Y J;  2LFB A;  3FX3 A;  1TP4 A;  1XDS A;  2HKX A;  2FEZ A;  5F0C A;  1AKH A;  1X58 A;  4LB5 A;  1E3H A;  4V2G A;  2XIG A;  2LD5 A;  1EV7 A;  2KRC A;  3ZQ7 A;  2R7S A;  3OIQ A;  3ZQC A;  4HQE A;  2ZSI B;  2HGC A;  2LOO A;  5L3E A;  2E19 A;  4HNV A;  5LHH A;  5TJJ A;  3CC2 I;  2H1K A;  2CUJ A;  3GUD A;  5JLX A;  2M30 A;  2IA2 A;  2GXB A;  2GXG A;  1TWH J;  1DQU A;  2D45 A;  3K1M A;  2V6C A;  2Q1Z B;  1O3T A;  4BL0 B;  1APL C;  2FBH A;  1Z21 A;  1ETQ A;  1GVD A;  5HS8 A;  2O0Y A;  5J1Y A;  3J7Y J;  1A6I A;  1FBU A;  2VIX A;  2KT0 A;  1XSV A;  3E6B A;  3ZGK A;  3MD2 A;  3O3K A;  3BR0 A;  4BE0 A;  3F6O A;  1IF1 A;  4LOC A;  1D3Y A;  3IP4 B;  4HNT A;  3BT9 A;  4BQO A;  2L02 A;  2DW4 A;  2VLA A;  3DBL B;  3OYB A;  2XGC A;  1TNT A;  1TQP A;  1P6R A;  2OU2 A;  1FWZ A;  1P2F A;  2WV1 A;  3E5X A;  3OIO A;  5H6Q A;  3KP6 A;  4HF1 A;  3RYP A;  2LC2 A;  2ELK A;  3SDG A;  2CRG A;  3JRH A;  4IVN A;  5EEH A;  2K3P A;  3K4J A;  2M4K A;  1FNN A;  1W7P B;  4EMS A;  5FFZ A;  2XSD C;  1SVL A;  1STZ A;  4RGX A;  4E7L A;  3QPH A;  1HKQ A;  3L7W A;  1OCO H;  2EIK H;  4KDP A;  2PI0 A;  4UVC A;  3FXL A;  1R1T A;  3DEE A;  2Y0M A;  3WE2 A;  2WAE A;  3SFI A;  2LF7 A;  5ERI A;  1WJB A;  3GTK J;  5D4S A;  2CQX A;  3BJO A;  3H1C A;  3W2A A;  4CCK A;  2DA4 A;  1A36 A;  3QOD A;  2QQ8 A;  4L18 B;  1MD0 A;  4ABZ A;  5H20 A;  2DPU A;  1QZY A;  4MEX F;  1I27 A;  3PNV A;  2L4M A;  1EH7 A;  3MWM A;  5J1R A;  1SEU A;  4HLX A;  4LMY A;  1RIO H;  3S3M A;  1D1A A;  3QU3 A;  3MKY B;  2DO7 A;  1WSU A;  3OR1 C;  5IPA A;  1SVM A;  2OUM A;  2IGO A;  4BBR J;  4LJZ F;  4Q47 A;  2Y48 A;  4D5C A;  4MFD A;  1U6G A;  4HX4 A;  3RQ4 A;  4BXF A;  1MDM B;  4XMY A;  5D5W B;  3DP7 A;  3LSH A;  4AVZ A;  2R7Q A;  2QQA A;  1CGP A;  1SFX A;  5B3S H;  4HF2 A;  5J6X A;  4UXN A;  2HNH A;  3ECO A;  3KIO A;  1U5T C;  3RCO A;  5DD4 A;  2EZK A;  2M34 A;  2HXO A;  4L9V A;  4UVB A;  4X1E A;  1MJB A;  3VSL A;  3WTY C;  2DCE A;  2EZL A;  4HPQ A;  2MC4 A;  3KEY A;  5CPR B;  1HKS A;  2HDC A;  2HOE A;  4P9F A;  2EFN A;  3AG3 H;  3CCU I;  1FIP A;  3VYR B;  4IHS A;  4M6V A;  1BOA A;  1FBS A;  1MMN A;  2DT5 A;  3LQQ A;  4RM3 A;  4AU7 A;  3H0G J;  3DCF A;  4XOP A;  3BG9 A;  4FE7 A;  1AU7 A;  1ZRE A;  5D8K B;  2ZJP F;  2NOJ B;  4XKB A;  3TDZ C;  1BBY A;  3N97 A;  4OIO F;  1T2K A;  3MZ8 A;  2EIN H;  1V3F A;  2DDB A;  3KET A;  2ZNZ A;  2OQR A;  1PDN C;  1LB2 A;  3VB2 A;  3FM5 A;  3GTO J;  4ZYH A;  2HFH A;  2W1O A;  2WAQ N;  4YG2 F;  3T8T A;  4GXO A;  2IAI A;  3L2W A;  1LDD A;  3HPH A;  3MQ0 A;  4DZJ A;  1LFU P;  5CLS A;  5FLX K;  4M71 A;  1IV8 A;  4D9J A;  1B1B A;  1YHQ I;  3JCU C;  2K9L A;  4EJV A;  4MFE A;  4EQQ A;  1QO0 D;  3R60 A;  4IRG A;  2HR3 A;  2MG4 A;  1S72 I;  3QAH A;  2ECC A;  3S1N J;  2HTJ A;  3HSR A;  2EWN A;  1YW9 A;  1R5I D;  2GIV A;  4PJN A;  1SAN A;  2XKO A;  3WGI A;  1NG6 A;  2WY8 Q;  1D8K A;  4EVI A;  1LE8 A;  4RAY A;  5DEQ A;  1IXS B;  2X6X A;  2CQ7 A;  3AG4 H;  3WG9 A;  4II2 A;  3A4C A;  5C4X J;  3QYF A;  5K7Z A;  5EZH A;  1F4K A;  2MSY A;  3BTL A;  4XRM A;  4EJT A;  2Z99 A;  4A3C J;  2MH2 A;  1U3E M;  3ASN H;  2R5Y B;  2CWE A;  4BS9 A;  3HKZ A;  4KA4 A;  2A69 F;  2D2W A;  1FYL A;  1O3Q A;  3PUF A;  1YOV B;  3P9I A;  4TV7 A;  4NB5 A;  4XOT A;  2CQN A;  4XRS G;  2XUB A;  1ZG1 A;  4X6A J;  3HOV J;  2ZME C;  3CJT B;  2XF5 A;  3WHC A;  3HRM A;  2G9W A;  2GOM A;  3C3W A;  4AYB A;  4XIC A;  1JT0 A;  2VOD A;  5DCM A;  2NNY A;  4HNU A;  4RB1 A;  4K2E A;  3V7C A;  1H0M A;  4A3F J;  4PK4 A;  5LRR A;  4AUX A;  5FRM A;  1MSE C;  3KP5 A;  4FHT A;  2W00 A;  3PNY A;  5BS6 A;  1WJD A;  1EJ9 A;  3E0J B;  4MIM A;  2DK8 A;  1D0Z A;  1FMV A;  2O7O A;  3OYE A;  3NQO A;  3SXY A;  1KYZ A;  1FYM A;  3TGN A;  3IHU A;  2A5Y B;  3H3U A;  3K4L A;  1GLN A;  2XB0 X;  2XKP A;  3S1M J;  4D1Q A;  1JUM A;  3FMR A;  3I4N J;  3VDX A;  4G7H F;  1WKM A;  5K5R A;  1TWA J;  5HLG A;  4MQV A;  2RC4 A;  1R7J A;  3VYS B;  4LK0 F;  2KRH A;  2BGC A;  3S15 J;  3DV8 A;  1X2M A;  1RR8 C;  5E3L A;  2QM3 A;  4LIT A;  2CFO A;  2OV7 A;  9ANT A;  3FZV A;  1IZ1 A;  3S3N A;  2MGQ A;  5LRS A;  3KP2 A;  1GT0 C;  1LEB A;  3JR9 A;  3CO6 C;  5IYD J;  2RDP A;  3K2Z A;  1HW2 A;  3S1R J;  4BE2 A;  3FXO A;  1XPX A;  1RUO A;  1QVU A;  2VT3 A;  4GCV A;  1U5T A;  4ON0 A;  2QZ8 A;  4B09 A;  5DDG A;  3GFI A;  2CJJ A;  3BR1 A;  5FLX Z;  2KJB A;  2BW3 A;  2Z5U A;  1OYY A;  1X4P A;  5K5O A;  3NWT A;  3P7N A;  1R58 A;  3H9J A;  1Q1V A;  5TRD A;  5HDN A;  5FKO A;  1IDZ A;  4CO8 A;  3MZY A;  1UG0 A;  3B02 A;  2UZK A;  4X0G A;  4IJA A;  2ICW G;  2KQR A;  2W57 A;  1OKR A;  3EET A;  2A6H F;  3S93 A;  1TLH B;  1LKX A;  1W5S A;  4M6Y A;  3JRC A;  2NNN A;  1TNS A;  3L00 A;  3A01 B;  3GZ6 A;  4C2M J;  4W97 A;  3M8J A;  2WY7 Q;  3JRA A;  2Z16 A;  3HTU A;  4Q4Z F;  2R7V A;  1ZHF A;  2JA2 A;  1V5E A;  4OWR B;  4XID A;  1HDD C;  3EDP A;  3ZQG A;  3ZR8 X;  2GM4 A;  2VPL A;  2FF4 A;  2VQL A;  3K7A J;  3FXR A;  3A03 A;  2VJ5 A;  2CFX A;  4UV8 A;  3TW6 A;  2IT0 A;  2NOG A;  4UUS B;  4U0W A;  4D5F A;  1IJW C;  1XGN A;  4HZF A;  2XV4 S;  3CD6 I;  4G9Y A;  2OCE A;  3CMM A;  2K9N A;  3CCL I;  3BLY A;  3J80 K;  5E17 F;  1JE8 A;  1ZH5 A;  4ZTF A;  3H92 A;  5DCF A;  4EJW A;  1MBF A;  3B6A A;  3WOD F;  1LQ1 A;  4JOM A;  1IRF A;  2F5D A;  1R23 A;  3DTI A;  4XLN F;  2EV6 A;  5IT3 A;  2F2E A;  2EV0 A;  3ZMV A;  3H35 A;  2RN7 A;  3IRQ A;  2AQF A;  3NAU A;  4N4N B;  1Z0X A;  2L7Z A;  3FF5 A;  1NG7 A;  2GIZ A;  2LH9 A;  1FOK A;  2STT A;  3M3Y J;  3GTG J;  1BIA A;  2K02 A;  5IP7 J;  4LFU A;  4HW0 A;  4AID A;  4YEL A;  5D6F A;  1FEX A;  3O2P E;  2HS5 A;  4CZZ A;  2P5K A;  4GDF A;  2ZME A;  4L5I A;  3LFU A;  5CVV A;  4OIR F;  3JTH A;  2DU9 A;  2IA0 A;  3QWL A;  2P4W A;  3PJR A;  2EA2 A;  1ULY A;  5H2F C;  2XAU A;  1IRZ A;  3TOB A;  4GRI A;  3F3X A;  2E1C A;  5CQE A;  2G0E A;  2CQK A;  2HWV A;  2Q8K A;  4A3J J;  1P9Q C;  1BM9 A;  1ZR4 A;  2K27 A;  1R5H A;  3QP6 A;  1MH4 A;  3HKZ N;  3V8K A;  1QHG A;  4CYC B;  3PIP F;  4O5V A;  2AHQ A;  2A5W A;  4J01 A;  3H5A A;  3ONQ A;  1K4S A;  2CU7 A;  5EZG A;  3T8R A;  4BYY A;  2I5U A;  2WA0 A;  5E3N A;  5JLW A;  2XAS A;  3FK6 A;  2L9R A;  1HF0 A;  2XPV A;  3K4N A;  2MW8 A;  1I5Z A;  3U21 A;  2YR2 A;  4KFC A;  1S5L C;  2IS2 A;  2QYO A;  1SD7 A;  1JUS A;  3ZQI A;  2O3F A;  5J8C A;  5LLQ A;  2R7D A;  4C2U A;  2V1X A;  1ZQ3 P;  2WAD A;  4EGY A;  3VOD A;  2H8W A;  3H3Z A;  2IRF G;  3VSK A;  1BW6 A;  3GXO A;  3B6C A;  2FBI A;  3B73 A;  2HQA A;  5DUI A;  2VB6 A;  3M8E A;  1MND A;  4B43 A;  4BY7 J;  2DA7 A;  3EYY A;  4XM3 A;  5GAD J;  2ELH A;  2VBX A;  4U0V A;  2DI3 A;  5IT9 K;  1XGS A;  3TDU C;  5IP6 A;  3LSK A;  3ZQF A;  5LGT A;  1L3L A;  4M3G A;  2CO5 A;  1VQ7 I;  2STW A;  3J80 Z;  2DYR H;  3LA7 A;  2GLO A;  4BHC A;  3FDY A;  4UVA A;  1VQO I;  1VZ0 A;  3TMO A;  1LUJ B;  5LGU A;  3C7J A;  2VQC A;  2QBY B;  1ERD A;  2EIJ H;  4N9I A;  3L09 A;  4CCJ A;  5E1Z B;  2ZC2 A;  4BHP A;  2DOA A;  2ETH A;  5K7F A;  2V6E A;  1YRN B;  2ME0 A;  4ZC3 A;  3PUB A;  3U2R A;  3I64 A;  3ZRG A;  1W36 D;  1P7I A;  3F6V A;  3KE2 A;  3T5X A;  2MLG A;  4G8X A;  3IWF A;  2BVM A;  2P6T A;  2DBB A;  3ZOB A;  3CQZ J;  1MNM C;  4BXX J;  5BMZ A;  2AQE A;  1MKM A;  2VN2 A;  3SFZ A;  1KON A;  1R4N B;  5LGN A;  3FKJ A;  4I6Z A;  3KLO A;  4A3E J;  3HTS B;  3L1P A;  4I99 C;  1W1W E;  1ETO A;  1ETV A;  3REO A;  4C3I J;  1FSH A;  2E60 A;  3I4P A;  4HV6 A;  1Y0U A;  1RKT A;  2FOW A;  1JUP A;  2L7M P;  2L7K A;  2LF8 A;  1DU0 A;  3JAM K;  2FQ3 A;  2OZU A;  2XVC A;  5EYR A;  1B72 B;  2M87 A;  2QSH X;  1A35 A;  2QA4 I;  2VT2 A;  2KRF A;  3BY6 A;  3OS0 A;  2Y9Z A;  2LR8 A;  2R7R A;  4P1W A;  3DFG A;  1HQC A;  2FX0 A;  2X6Y A;  2EQR A;  2HDW A;  4O6J A;  2ZB9 A;  1RUN A;  3GFM A;  3E6C C;  1R5G A;  4XLA A;  4BJ5 C;  1UHM A;  3CC4 I;  4N0B A;  5K1Y A;  5D5U B;  1RI7 A;  2E2I J;  3DBH B;  3IL2 A;  4ENM A;  1B8I B;  4XNF A;  1TBX A;  2FXA A;  2M1B A;  1FC3 A;  1ZR2 A;  3S2D J;  2UUZ A;  1MBE A;  1XMX A;  2DQL A;  1EH8 A;  1I50 J;  2BV6 A;  3MMY B;  5LFA A;  3HUG B;  1H8A C;  3SJM A;  3QOE A;  2M4G A;  1S8N A;  1R4M B;  2ESH A;  4EAT A;  5J4Y A;  3CP8 A;  4BKX A;  3C2B A;  2X51 A;  4DJA A;  3R61 A;  3J7Z I;  3H9G A;  1V54 H;  1OJL A;  3BZK A;  1ON1 A;  1WQ2 A;  4M6X A;  1YX3 A;  2LG4 A;  3ERE D;  5GAG J;  4BJT A;  4CIC A;  2E1M C;  2W25 A;  3BQY A;  1U2W A;  2IEK A;  1BI3 A;  1X4O A;  3GTP J;  1BR2 A;  4BEH A;  1OCP A;  3WGG A;  3I59 A;  1GUU A;  1K83 J;  2KDZ A;  3K70 C;  3HOS A;  2FOK A;  2DT7 B;  2E2H J;  3K4C A;  2V1N A;  3FXQ A;  3W6J B;  2W7N A;  4R1H A;  3OSG A;  2NAZ A;  1WJF A;  2N8G A;  4OOI A;  2DT6 A;  3FMS A;  3WTZ A;  2QLZ A;  4A6E A;  3OYI A;  3PNT A;  4E7I A;  1UB9 A;  2EPF A;  4FX0 A;  1Y8R B;  1UG2 A;  4FE4 A;  3ABT A;  4KT5 C;  2QGU A;  2QKM B;  3OL4 A;  3WU2 C;  2QEN A;  3AFH A;  4HG2 A;  3AG1 H;  2QSF X;  1YW8 A;  5HOO A;  3S17 J;  2D1V A;  3M8F A;  4E4H A;  2WAF A;  2WAQ A;  2XGE A;  3CDI A;  2MBF A;  1TWF J;  3ESW B;  3FHN A;  2OTL I;  2JTV A;  2VAS A;  5J1U A;  1YI2 I;  4YFK F;  3DKW A;  1BIB A;  2A61 A;  4HX7 A;  1PP8 F;  2PN6 A;  5IYB J;  4BNC A;  2FJ1 A;  4KIF A;  1K61 A;  5F6F A;  2EV5 A;  4H0E A;  2CW8 A;  5EJC A;  3CTA A;  2E1O A;  4UB8 C;  4ESB A;  5DM7 F;  1KYW A;  3ABM H;  3SZP A;  4IHX A;  1TT0 A;  2P6S A;  5FD5 A;  3KLN A;  2JA5 J;  2R5Y A;  1WVR A;  4KT6 A;  2I10 A;  2CH0 A;  3F21 A;  2LMD A;  1ON2 A;  4NQW B;  1S7E A;  2EB7 A;  3GTQ J;  2ISY A;  4KIB A;  2M9H A;  2EIM H;  3J81 K;  3V8L A;  2Q0O A;  3BTJ A;  1SMY F;  3FHZ A;  3CDL A;  4BQN A;  3GTJ J;  4RAF A;  3LSP A;  1Z3Y A;  3HOX J;  4M74 A;  5HLH A;  2M7B A;  3E1S A;  2IGK A;  1ZLK A;  2X0L A;  1E3P A;  2VJ4 A;  2VUM J;  2HTS A;  4CGZ A;  3F23 A;  4ENK A;  3GLL A;  2R5Z A;  2LK2 A;  1ORK A;  2VPR A;  1S3J A;  4R8H A;  1VQM I;  1K7A A;  4ESJ A;  1R71 A;  4YFN F;  2L7F P;  4ZTJ A;  1XMK A;  2MC3 A;  3ZN1 A;  3Q0W A;  3W2V A;  1E0E A;  1ONV A;  4QIW N;  1ZLJ A;  2R0Q C;  2HOS A;  4A0Z A;  2X9D A;  3Q3S A;  2FE3 A;  3EYI A;  2VXD A;  4E7K A;  2BXY A;  4L5J A;  3E6M A;  3K2A A;  4BDZ A;  5D5X B;  1G4D A;  4IQ4 A;  1ETY A;  4CCM A;  5JHU A;  3HOU J;  1JGS A;  1XTA A;  2DTZ A;  4FIS A;  3N4M A;  2OJE D;  3SYT A;  3FXK A;  4CCN A;  2XAJ A;  3V42 A;  4A6D A;  4U88 A;  2DFE A;  2EBI A;  1I6H J;  2UWM A;  3OOP A;  3TO7 A;  1IV6 A;  3GO5 A;  2E35 A;  2QKL B;  3ELK A;  1OR7 A;  4FTH A;  2DA1 A;  2CV0 A;  4I09 A;  2R93 J;  2QVO A;  1AWC A;  2RKH A;  2PQ8 A;  1POG A;  1Z7U A;  2WTE A;  1ZGW A;  1BR1 A;  3S8P A;  1PUF A;  5E18 F;  1CF7 B;  1VQP I;  4UB6 C;  4Y15 A;  4A2U A;  1PP7 U;  3LMM A;  1H9T A;  3H0D A;  5E1W A;  2M8E A;  3K70 D;  3NEU A;  2Y30 A;  1GV5 A;  3A01 A;  3JRE A;  2NVT J;  1ACI A;  2EIL H;  1RES A;  1H9G A;  2X6O A;  1H88 C;  2O8X A;  1IGN A;  4L5E A;  1K6Y A;  3ML6 A;  2X85 A;  3KZY A;  4F92 B;  1MNE A;  5C44 J;  5ED4 A;  2EFP A;  1P4A A;  1YG2 A;  5J3L A;  1IN7 A;  3AL0 B;  4DZP A;  3ZXS A;  1DU6 A;  1BI0 A;  2R7W A;  1XGM A;  3C2G A;  3FXJ A;  3BR5 A;  5M5W J;  3ABK H;  1TT5 B;  1MBH A;  3A1Y A;  2A6T A;  4ZZL A;  1TWG J;  5LHG A;  3J81 Z;  2HVS A;  2AXL A;  2O9L A;  2Z2S B;  3BC8 A;  3CP2 A;  3FK7 A;  3HPG A;  3ULQ B;  1N75 A;  2LKS A;  2GZW A;  2IGN A;  3EUH C;  2F48 A;  4RA2 A;  2KDO A;  4EJU A;  3MFK A;  3LA3 A;  3GTM J;  2EZI A;  2KP6 A;  1IW7 F;  5L3G A;  1IC8 A;  5FLV A;  3I4M J;  2DDA A;  3FKI J;  2E2J J;  2QEX I;  2R7T A;  1WCM J;  2PG4 A;  4IHW A;  2KKO A;  3KP3 A;  2FQ4 A;  1SAX A;  1IN6 A;  2V7F A;  4HAM A;  3F72 A;  5E8G A;  5DTD A;  3DQV C;  3KX2 A;  1T39 A;  4HX8 A;  5HLI A;  2OF7 A;  2RQP A;  3I0T A;  3RKQ A;  1BA5 A;  2EFQ A;  5EG0 B;  2QSG X;  3FXM A;  2PJR B;  4FX4 A;  3DTE A;  4A3B J;  3FM3 A;  5LBQ A;  3C2H A;  1T38 A;  2DFF A;  2KZG A;  2RVC A;  5M5X J;  2PX9 A;  3BP8 A;  1UZC A;  3QRF F;  2F6C A;  1NHA A;  2XB5 A;  4ZYG A;  4BH9 A;  1BC8 C;  2EH3 A;  1PUE E;  3RJP A;  3I55 I;  1N77 A;  4L9N A;  4A3D J;  4A3G J;  1VI0 A;  3P9C A;  2KPM A;  3D5R C;  1JTX A;  2QCO A;  3CF2 A;  3A0H C;  4JYK A;  2LKX A;  2H6C A;  5HLT A;  1I1G A;  4P5O A;  3OMY A;  1IN4 A;  4ASN A;  2QQ9 A;  4CHU A;  3TO6 A;  4M9S A;  5LD2 C;  4G12 A;  3FBN B;  4ENJ A;  1MBG A;  3QYE A;  2BY2 A;  3G1M A;  3VYT B;  4UV9 A;  1RET A;  2PLY A;  4XON A;  3I71 A;  3KYD B;  3Q5F A;  3SEQ A;  1Z67 A;  4HDU A;  1FTT A;  1QQI A;  2ZXJ A;  4F52 A;  4M3D A;  1KQ8 A;  1J2X A;  1F36 A;  4RB0 A;  2JVH A;  4YIF A;  3LNQ A;  2MFZ A;  1UMQ A;  4ZYA A;  4IZZ A;  2QQB A;  4PJJ A;  1PVE A;  1VQ4 I;  4W1U A;  3TO9 A;  3OV8 A;  3CO7 C;  3GEZ A;  3LL7 A;  3Q9S A;  5JR3 A;  5EGO A;  2LY9 A;  3K1P A;  4OMZ A;  3SZT A;  3CME I;  2X1E A;  1N25 A;  2VL8 A;  1AA7 A;  5AIP A;  2L9S A;  1SVO A;  2JMW A;  4ZH4 F;  1OCZ H;  1Y1W J;  2MH9 A;  4LLG F;  1Z6R A;  1RPW A;  1AKH B;  3ROU A;  4EV0 A;  1JHH A;  1G3T A;  1DGW Y;  1DGR M;  1ODD A;  1RZ4 A;  1IN5 A;  4RBO A;  2O03 A;  3E7L A;  1GDT A;  2L54 A;  3IC7 A;  3EPZ A;  3WTS C;  3IUO A;  4IEJ A;  5F27 A;  3CUQ C;  4IPA A;  5F1J A;  2UXN A;  2DFH A;  4IX7 A;  4OAZ A;  4NHJ A;  2BXZ A;  4N9H A;  2QBY A;  3HG9 A;  3SQN A;  3RPQ A;  3COA C;  2KJC A;  2PJP A;  4OAY A;  2EZH A;  2M8G X;  4V2F A;  2EA4 A;  1G59 A;  4LB6 B;  4L0Y B;  4XLC A;  3E97 A;  3OYC A;  3JTG A;  1S29 A;  2P81 A;  4LG3 A;  4A3I J;  3HOY J;  3WU0 A;  2GQQ A;  3ECH A;  2DMN A;  2RNG A;  2TDX A;  3L9F A;  4Y33 A;  3RIR A;  4DYR A;  2CQQ A;  3HM5 A;  4DIQ A;  3BG7 A;  1MIJ A;  1H89 C;  3CJQ B;  2H6B A;  1OFC X;  3RZD J;  3S1Q J;  1P4W A;  3KEO A;  3ZQL A;  4CH7 A;  1BL0 A;  3JRD A;  5FKM A;  2XAG A;  3I3L A;  3RQI A;  1WZ2 A;  3IKT A;  3ZMT A;  4WCG A;  3LA2 A;  3DLL F;  1MJ9 A;  4Y7N J;  1QNT A;  1BJZ A;  2A07 F;  1LPQ A;  1D5V A;  2WB1 A;  2Z33 A;  4EM1 A;  1VQ6 I;  4BXU A;  3BPX A;  1Y1V J;  1ZYR F;  2K85 A;  2D1H A;  3H9Q A;  4FAS D;  2XC7 A;  4KYW A;  5JVT A;  1R6R A;  3G6E I;  2YSR A;  1HKT A;  3QPS A;  3DPL C;  1Z77 A;  2L3D A;  3I58 A;  4B44 A;  1SFO J;  5IP9 J;  3TQN A;  3PO2 J;  1V4R A;  2A68 F;  4KJZ A;  4BQA A;  2ZFW A;  2JUC A;  4U7B A;  2COM A;  1IG7 A;  3SDB A;  1JKR C;  1X1B A;  2FUG 2;  3OIP A;  1EKE A;  2JA8 J;  1MH3 A;  1TQI A;  1HBX G;  4IHV A;  5IY5 H;  3J7A Y;  1Y39 A;  1TWC J;  2IS4 A;  3W6V A;  3FBI B;  3HUG A;  3ABU A;  3HRS A;  2M0C A;  2AXT C;  2ZNY A;  4DBR A;  2VI6 A;  2HQN A;  2VBW A;  2I8D A;  4I2O A;  3BR2 A;  1ZRF A;  3LSI A;  4CDG A;  3R4K A;  3Q0V A;  1Q1H A;  1SMT A;  1X3Z B;  3F8F A;  1WPK A;  2CSO A;  3DEU A;  4OIN F;  1T0F C;  3BQZ A;  5IOY A;  1XDU A;  1WI3 A;  3H5N A;  4CSW A;  1HOM A;  1RRJ A;  1NH3 A;  3NAR A;  3PL8 A;  3HOZ J;  1P4X A;  4E7S A;  1DPR A;  2A3S A;  2XAQ A;  5BPI A;  2XF7 A;  4LG0 A;  1UAA A;  1OCR H;  4NC7 A;  2E34 A;  2ECB A;  2ELJ A;  3IRR A;  3KYL A;  4JX6 A; 
#chains in the Genus database with same CATH homology
 2XGC A;  1IDY A;  2K9Q A;  2WV1 A;  1G2H A;  1UHS A;  3OIO A;  4MLO A;  2E2I J;  2R92 J;  1B8I B;  3S2D J;  2CUE A;  1ZR2 A;  3GTL J;  5E3M A;  1MBE A;  2ELK A;  3SDG A;  3OSF A;  1JJ8 C;  2CRG A;  1I50 J;  3PM1 A;  3JRH A;  3IH2 A;  4C3J J;  2YU9 J;  1H8A C;  3SJM A;  4FCY A;  2XSD C;  2HI3 A;  2HXI A;  3TED A;  4BKX A;  3C2B A;  3GBG A;  4UUT A;  2YS9 A;  1OJL A;  3DEW A;  3BG5 A;  2DMP A;  1EF4 A;  2TCT A;  5GPA A;  3BQY A;  2IEK A;  1WH7 A;  3QQA A;  3CMY A;  5IYC J;  3GTP J;  3SFI A;  1OCP A;  3GTK J;  5EEA A;  2CQX A;  2R5Z B;  2CUF A;  5M3M J;  1YRN A;  4QSH A;  1GUU A;  1VF9 A;  2DA4 A;  2DA2 A;  1K83 J;  2KDZ A;  3G1L A;  4ABZ A;  1LE8 B;  2E2H J;  2DMQ A;  5J1R A;  3OSG A;  2JK3 A;  1T33 A;  1JT6 A;  2N8G A;  5IPA A;  2DA6 A;  4BBR J;  2COB A;  4D5C A;  4MFD A;  2NS8 A;  1GV2 A;  2LVS A;  3BR6 A;  3JRB A;  1UG2 A;  4FE4 A;  4A69 C;  1ITY A;  2JN6 A;  2M2E A;  2DA3 A;  1NK2 P;  1LFB A;  2EZK A;  2M34 A;  2HXO A;  4X1E A;  3S17 J;  2XGE A;  5HOD A;  2EZL A;  1TWF J;  3FIS A;  2R7Z J;  1B72 A;  1ZKG A;  5J1U A;  1IUF A;  2JWT A;  5IYB J;  2FJ1 A;  1FIP A;  2JA6 J;  1K61 A;  4M6V A;  3O8G A;  2RAE A;  3H0G J;  3DCF A;  3IH3 A;  3BG9 A;  4FE7 A;  1AU7 A;  2E1O A;  2B63 J;  1PUF B;  4IHX A;  5GP9 A;  1B8I A;  5IOZ A;  2JA5 J;  2R5Y A;  3TP3 A;  4B4C A;  3FIW A;  1ENH A;  2I10 A;  5DS9 A;  3D1N I;  1MBJ A;  1S7E A;  2WB1 N;  3GTO J;  3GTQ J;  5K7H A;  1XS9 A;  2WAQ N;  2M9H A;  2IAI A;  3BTJ A;  1HLV A;  4DZJ A;  2L0K A;  3CDL A;  1LFU P;  1JKQ C;  3GTJ J;  1U78 A;  3LSP A;  2LLK A;  4MFE A;  3HOX J;  1NTC A;  3CCY A;  2MG4 A;  2FD5 A;  2ECC A;  3S1N J;  2K40 A;  3O8H A;  2VUM J;  3BR3 A;  1JKO C;  4AC0 A;  5FKL A;  2R5Z A;  2PMZ N;  2LK2 A;  1ORK A;  1SAN A;  2VPR A;  1JKP C;  1RKW A;  3LSR A;  1LE8 A;  1W0U A;  2L7F P;  2TRT A;  3Q0W A;  1AHD P;  5C4X J;  4DYC A;  5K7Z A;  4QIW N;  2R0Q C;  2HOS A;  2X9D A;  2JJ7 A;  5EZH A;  2MSY A;  3BTL A;  4XRM A;  3Q3S A;  3LSG A;  4BBS J;  4A3C J;  2ME6 A;  3HEF A;  5C4J J;  5BNG A;  2R5Y B;  3K2A A;  2ID6 A;  1ETY A;  3HOU J;  3VPR A;  3OOU A;  2XGD A;  4XRS G;  4X6A J;  2DTZ A;  4FIS A;  2DJN A;  2HOT A;  3HOV J;  1I3Q J;  3WHC A;  1FTZ A;  2DMT A;  4XIC A;  1JT0 A;  3JRI A;  2QF7 A;  3TP0 A;  2OPT A;  2EBI A;  1I6H J;  4A3F J;  5C3E J;  3RZO J;  4AUX A;  1IV6 A;  1JGG A;  1MSE C;  2NVX J;  4DYQ A;  3HBL A;  1U9O A;  1T56 A;  4FTH A;  2DA1 A;  1ETK A;  4MIM A;  4J19 A;  2R93 J;  1NK3 P;  1POG A;  2O7O A;  2Y2Z A;  1ZGW A;  3BG3 A;  1WGX A;  1PUF A;  5EF6 A;  3IH4 A;  1XC5 A;  2XB0 X;  3S1M J;  1JUM A;  2AO9 A;  3LOC A;  1W0T A;  3I4N J;  2Y30 A;  1GV5 A;  3A01 A;  3JRE A;  2NVT J;  1TWA J;  1RES A;  1H88 C;  2X6O A;  1IGN A;  4L5E A;  4AYB N;  3S15 J;  1X2M A;  5E3L A;  1X2N A;  3HB9 A;  9ANT A;  2MGQ A;  5C44 J;  3JRG A;  4M3B A;  1GT0 C;  3JR9 A;  5IYD J;  5J3L A;  2HDD A;  1WH5 A;  4DZP A;  1DU6 A;  5FKK A;  3S1R J;  5M5W J;  3BR5 A;  5EGO B;  1QVU A;  4A93 J;  1MBH A;  1BW5 A;  4I76 A;  1TWG J;  4EEF G;  2O9L A;  2CJJ A;  3BR1 A;  3FK7 A;  2JA7 J;  1D5Y A;  1Q1V A;  3GTM J;  2EZI A;  5FKO A;  1IDZ A;  1ZK8 A;  5F04 A;  4A3L J;  4Y52 J;  1IC8 A;  5FLV A;  3I4M J;  3FKI J;  3ZQH A;  2XRL A;  4A3K J;  2E2J J;  2H8R A;  3MN2 A;  1ETW A;  1WCM J;  4IHW A;  2DMU A;  1OCT C;  2FQ4 A;  5FLM J;  3JRC A;  2LTP A;  3A01 B;  5DTD A;  4C2M J;  4W97 A;  4A3M J;  3JRA A;  2OF7 A;  1QVT A;  3RKQ A;  2NVQ J;  4XID A;  1BA5 A;  2LP0 A;  4S0H B;  1HDD C;  3MKL A;  5EG0 B;  4JX4 A;  3ZQG A;  2GM4 A;  4A3B J;  1A5J A;  3K7A J;  2HYJ A;  3A03 A;  3TW6 A;  3QPL A;  2NS7 A;  5M5X J;  2Y0S N;  2NOG A;  4UUS B;  2VKV A;  2XB5 A;  2EH3 A;  2ID3 A;  4D5F A;  1O4X A;  1IJW C;  5FKN A;  4A3D J;  4A3G J;  1VI0 A;  1JTX A;  2QCO A;  2LKX A;  4JYK A;  2XPU A;  2XPW A;  1FJL A;  2X48 A;  2K9N A;  1JJ6 C;  4QTR A;  2DA5 A;  4G12 A;  2Y31 A;  1MBG A;  4M3E A;  1HDP A;  3HGY A;  2O8K A;  5M3F J;  1MBF A;  3B6A A;  3G1M A;  1RET A;  1JTY A;  4JP0 A;  1FTT A;  4MO7 A;  3Q0U A;  4M3D A;  1QRY A;  1F36 A;  3LNQ A;  3NAU A;  1UMQ A;  1Z0X A;  2L7Z A;  2Y9Y A;  3BTI A;  3M3Y J;  4W1U A;  3GTG J;  2VKE A;  5IP7 J;  1FEX A;  4XK4 A;  1XG1 A;  5EGO A;  2LY9 A;  1P7J A;  1ETX A;  2JMW A;  2W48 A;  1Y1W J;  3S2H J;  4JX5 A;  1RPW A;  1AKH B;  1TC3 C;  5FJ8 J;  1QPI A;  1IRZ A;  2G0E A;  4RDU A;  3F0C A;  4A3J J;  2IBD A;  1ZR4 A;  5EDN A;  4RBO A;  1VFC A;  3M4O J;  2D5V A;  1MH4 A;  3E7L A;  3HKZ N;  1GDT A;  1HCR A;  4CYC B;  1MBK A;  5F0H A;  4IEJ A;  5F27 A;  1FIA A;  4BY1 J;  2AHQ A;  5F1J A;  3TW7 A;  2CU7 A;  5EZG A;  3JRF A;  4NDL A;  5E3N A;  5JLW A;  3FK6 A;  2L9R A;  5EG0 A;  1HF0 A;  4M3F A;  3A02 A;  2EZH A;  2M8G X;  2XPV A;  4V2F A;  2MW8 A;  1R9T J;  3MVP A;  3HGG A;  2P81 A;  1JUS A;  3ZQI A;  4A3I J;  3HOY J;  4B3A A;  1ZQ3 P;  4UUS A;  2DMN A;  4DYR A;  2CQQ A;  3HM5 A;  1BW6 A;  3G1O A;  1H89 C;  3B6C A;  1OFC X;  3RZD J;  2DN0 A;  3BTC A;  3S1Q J;  4BY7 J;  4D7M A;  3ZQL A;  1E3O C;  2DA7 A;  4C3H J;  4B1R A;  5GPC A;  1BL0 A;  3JRD A;  5FKM A;  3RQI A;  3H3V K;  5IP6 A;  1CQT A;  3ZQF A;  2GBY A;  4M3G A;  1VND A;  4Y7N J;  3HOW J;  1BJZ A;  3S14 J;  1Y1V J;  1ZTR A;  3IV5 A;  3UKG A;  2HQ5 A;  2GLO A;  1RR7 A;  4DW6 A;  3S16 J;  3QPS A;  3LSJ A;  1Z77 A;  1SFO J;  5IP9 J;  3PO3 J;  1U8B A;  3PO2 J;  1F43 A;  5F0F A;  4D7N A;  4GFB A;  3WHB A;  4XRS A;  1IG7 A;  5K7F A;  1JKR C;  2HOA A;  5M5Y J;  2ME0 A;  1YRN B;  2LFB A;  5F08 A;  2JA8 J;  1MH3 A;  5F0C A;  1AKH A;  1X58 A;  4IHY A;  4IHV A;  4V2G A;  1P7I A;  2LD5 A;  1TWC J;  3W6V A;  3ZQC A;  1MSF C;  3ZOB A;  3CQZ J;  1MNM C;  4BXX J;  2E19 A;  4HNV A;  2M0C A;  2H1K A;  4I6Z A;  1U9N A;  4A3E J;  2VI6 A;  3L1P A;  1ETO A;  1ETV A;  3BR2 A;  5JLX A;  4CYC A;  4C3I J;  2YUS A;  1TWH J;  3Q0V A;  1RKT A;  1JUP A;  2L7M P;  1WPK A;  1DU0 A;  1APL C;  3BQZ A;  5J1Y A;  1ETQ A;  1GVD A;  5IOY A;  1WI3 A;  5EYR A;  1A6I A;  1B72 B;  2KT0 A;  1HOM A;  3BR0 A;  3NAR A;  3HOZ J;  2Y9Z A;  2LR8 A;  4LOC A;  2FX0 A;  2K9S A;  2EQR A;  2NVY J;  2ZB9 A;  3HDD A;  2ECB A;  5E3O A;  3BT9 A;  4JX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...