2EZYA

Solution structure of human barrier-to-autointegration factor baf, nmr, ensemble of 20 simulated annealing structures
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
89
structure length
89
Chain Sequence
b'MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARRIER-TO-AUTOINTEGRATION FACTOR
publication title Solution structure of the cellular factor BAF responsible for protecting retroviral DNA from autointegration.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 28
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02961 BAF Barrier to autointegration factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.40 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Barrier-to-autointegration factor, BAF 2ezyA00
2EZXA 2EZYA 1CI4A 2EZZA 2ODGA 1QCKA 2BZFA
chains in the Genus database with same CATH superfamily
4C4RA 2XGQA 9ICKA 4OJ6A 4RPXA 2K8BB 2RDIA 2WTFA 2KHQA 2FJ6A 5EE3A 1Q3VA 3QU7A 1TAMA 2R8GA 4IQUA 3EPIA 2EZYA 4Y2UA 3PW4A 1N63A 4C80A 4RQMA 3N28A 1F0MA 1NJZA 5DQGA 2BCSA 4JMUA 1BPDA 1IV8A 3PO5A 5CP2A 4KLUA 2EH9A 4F5NA 3QUBA 2V9WA 3LWMA 4QIWC 1QH9A 4MEXA 2UVWA 3M6KA 5AKYA 5KFUA 4F5QA 2EAPA 3QUTA 1Z1BA 4BWJA 1BNPA 2MA1A 1U45A 5HMLA 2HBKA 3QU2A 2CPRA 3C21A 2J6TA 2ZXHA 2H3ZA 3ONNA 3RJIA 4Q45A 5TZVA 2B21A 2KKPA 8ICOA 3C5GA 1FFVA 3C2KA 2G09A 4ED0A 3RF9A 4J9QA 1WWVA 4M0AA 4UB6U 4P0QA 4AYBC 3BJYA 3V72A 5H2FU 5J0QA 2BCVA 3WU2U 1KRPA 2NRTA 3UXOA 1ZQGA 2G07A 2DF4B 2NRZA 7ICGA 4F4ZA 4DL5A 3SQIA 1QSYA 4BGDA 2W7OA 3NUQA 4P0QB 2LYBA 2Y9UA 5J2IA 1U48A 3PSPA 4R63A 1A77A 1ZOLA 3SR6A 8ICZA 2KZ3A 3WK4A 2F1HA 5EOZA 5KFWA 1TE2A 4US9A 4G9BA 4OO1J 4FBTA 3L3FX 2YN4A 1PK1A 1B4FA 5AM0A 2YMQA 2W11A 3FC4A 5EE9A 3RJJA 4FZMA 2W03A 5IILA 2WF6A 3BQ1A 3N4MB 2Z7JA 1WG8A 3BZKA 5J2DA 1T94A 3QX7A 3IDWA 3PVXA 4RU9A 1Z00A 4UAYA 4DQRA 1PK1B 9ICNA 3O0FA 4QWAA 3RRHA 4YR2A 3VC8A 2XY6A 4QZBA 1X9WA 2W9BB 2I6XA 3HKZF 7ICSA 1XSNA 3PSTA 1ZQVA 1Z00B 4PHEA 5DLFA 1ZQSA 4I2IA 2QKQA 3J81j 4UB5A 4NL9C 8ICIA 2G0AA 5KFOA 4DF8A 1D8BA 4I29A 5KG5A 4RPYA 4UB3A 1KDHA 5HR7A 1JRPA 2YB1A 4I2HA 5DBCA 5KL8B 2V4QA 2HOFA 5EE0A 3NVVA 5ALSA 2HW3A 2JZBB 2W8LA 2Y0SC 1WCLA 4QWDA 5CRXA 1BPBA 4KITB 4NLZA 4O5EA 4JWMA 4M9GA 1NJYA 1LKYA 3F2CA 8ICMA 2HBLA 2BQUA 1DXSA 2BQRA 2E8NA 3GILA 4M9LA 4F91B 4OJLA 5J0UA 1JX4A 4DL6A 3SEIA 3MC1A 1LKYB 5AKZA 1QLNA 4M47A 4I27A 2IOFA 4HYKA 2LMRA 2WB1F 1KSPA 2NRWA 2W04A 3BQ7A 2HDOA 5L1MA 4R66A 3NVZA 2RRDA 5IIMA 4KLTA 2JH7A 1L3VA 2AHOB 3KZIU 4RQ4A 4KLGA 3AL0B 4Z6CA 2DUYA 1Y88A 4DL7A 2PMZC 4J9SA 2KVSA 1KQQA 5ALXA 3OJUA 2ZIVA 4Q43A 4O3QA 1QQ6A 4MFCA 4DSEA 3V6HA 4OD0A 4O5CA 4LZDA 1JMSA 4KMUA 2ZUCA 4PHAA 5ALGA 8ICWA 2XCPA 2JHDA 3BQ2A 3H8SA 3QXGA 3GQCA 3RB6A 2ZIVB 8ICYA 4F5RA 5C0YA 4P4OA 4EBDA 4F5OA 4EX6A 2OH2A 1NJWA 2ATLA 2FMPA 4DWIA 2ISPA 2G06A 1QCKA 4ICAA 1K1QA 1GO3F 3H7IA 5EWEA 3ICXA 4DFKA 5KFVA 5KTQA 2JEGA 1ZQWA 4YQWA 5J0SA 5DDMA 3ZDAA 1XU4A 2HVHA 1ZXIA 4RQ0A 7ICRA 3AUOA 5ALJA 4JUZA 1D9FA 5CHGA 2IHMA 1RYSA 8ICGA 2YMLA 4FE3A 2R8HA 2F3NA 1UT8A 5KFZA 5KT7A 1CUKA 4C8KA 4AP9A 3VCBA 4FZNA 3C5FA 2W9MA 4DOBA 5AI4A 4IL6U 4NLKA 2PI4A 1J2NA 2KZMA 3FDSA 5HNKA 4CCHA 4J9NA 2ZIWB 1TK8A 3MABA 2WAQF 4B9TA 2ZUBA 3RB0A 4F92B 2LHTA 3I76A 1ZJMA 8ICAA 1P7DA 2N1RA 5HP4A 2R8KA 5KFHA 2B6GA 5F3XB 3UPQA 2KE7A 3SENA 1ZQMA 3NRWA 3N7SC 4U7CA 3PX6A 4RQ8A 5D49A 3RJEA 5KFCA 5DQHA 2IHNA 1ZD4A 4QWBA 9ICUA 3Q8SB 3C23A 5KG2A 2WF9A 5T14A 3PY8A 7ICIA 2YMMA 4NLBA 1B0XA 3CYMA 1Q3UA 2KFNA 4TQSA 5AM5A 3FYHA 4QZ9A 1N5XA 3B0XA 3WK8A 4X5VA 2MU2A 2AXTU 5DB8A 3BDPA 5DGBA 2KOBA 4K4IA 3WK5A 4QZAA 1XWLA 1L7MA 3V7JA 3MGHA 2KNJA 7ICOA 2DPIA 3AN1A 4F2RA 4RUAA 1X6JA 1ZQRA 8ICHA 5B5EU 3AEVA 5J2JA 4EZ9A 9ICPA 9ICBA 1KEJA 2M9NA 5J0OA 3SAHA 3QZ8A 5ALIA 1L3UA 4ECWA 3HILA 5DBAA 3JPPA 1Z3EB 1Z4OA 4DF4A 2HHXA 3WK6A 4YMNA 3SI8A 5BOLA 2IOHA 5KT5A 4F4WA 3F53A 5BPCA 1NKBA 4M6WA 5AM1A 1BNOA 3EPGA 2F76X 4PZNA 5EE1A 2PXIA 4ECUA 3OGUA 4JV1A 1RDFA 1KLNA 1LV5A 3IP4B 4CGZA 5KT2A 5GTIU 4UB2A 4J9MA 4M6WB 1SV0A 1U9LA 1L6NA 9ICFA 4ED7A 1N2XA 1SL2A 3D2SA 3IRUA 1X42A 1HIWA 1ECWA 1MQ2A 1KBUA 9ICIA 1LB2B 2DGZA 3RJKA 4GXKA 1T3NA 1ZQKA 4YD2A 3ISDA 4BXOA 3MBYA 3H4BA 2P6UA 3K75D 5AKJA 8ICQA 5AKLA 3QUCA 3DV9A 4ED8A 4DFPA 4CNQA 4Q8EA 4YD1A 5D4BA 9ICGA 2GO7A 2DWQA 4M04A 5AIBA 9ICLA 3L5KA 2KG5A 2Y1JA 2RHFA 4QZIA 7ICLA 4NLNA 1XS9D 5EWFA 3UXPA 1L7NA 3KOOA 8ICLA 2K60A 2KMDA 2J6UA 1ZQUA 2F2AB 1FEZA 4G3IA 4DSJA 3WKEA 2KK0A 2LKYA 4PGXA 1PZNA 4US8A 3AU6A 1CI4A 4BJQA 1M6YA 3D2QA 4B6JA 2PI5A 3Q8LA 1Z4NA 2KEYA 5DGAA 3M7DA 1L5UA 2GWSA 1N62A 2HHWA 1T3QA 4MF2A 2W43A 4Y2VA 3TADC 2E8PA 1RZTA 5F9NA 2G5IB 1L7OA 3V7KA 2VA3A 1QTMA 3H40A 1TAUA 5ALWA 1NK9A 9ICCA 1PUZA 5AK4A 1ZQPA 5L1IA 2F77X 4B9VA 2WFAA 5KFKA 2OHFA 2R18A 4GXJA 2NV3A 2W8KA 5ALMA 5ALPA 1T7PA 8ICTA 1COOA 5DB6A 5DKWA 5AKGA 1ZQQA 5KT4A 1NKCA 4Q8FA 2ZIXA 4OJ5A 4CRXA 1JALA 5B66U 2LPEA 3ISBA 4FZLA 1N60A 4KTQA 2Q0ZX 5KFIA 1ZQHA 2EDUA 1ZQXA 2RP5A 4QZCA 4QW8A 3MR5A 1AROP 3K4GA 3PZPA 4I2CA 4BDPA 2EAMA 3GZFA 1RXWA 1MA7A 3TADA 1V9PA 5DG8A 1ZQTA 4PZOA 2WF7A 1YT3A 1N5WA 5IINA 2WF8A 4EELA 3IG8A 4C4SA 2AGQA 2H3IA 2A1JA 1XSPA 4EBEA 2EANA 2C28A 1K1SA 2ASDA 4F71A 4YG2A 5L9XA 3Q8RB 4F50A 1NZBA 4I2FA 4DOCA 1Q46A 3JPNA 3ZDBA 4QIWF 8ICJA 4YMMA 4BUGA 8ICBA 1NJXA 1SIJA 5AI6A 5JUMA 9ICJA 2GOLA 1T8EA 3OHBA 5HR6A 3TAQA 2MRLA 4DSIA 2AQ0A 4RQ7A 2KVCA 2HOQA 1UA1A 4RQ5A 4UBBA 5AM2A 3MR3A 3M8SA 4JK1A 3C2MA 2NRVA 4DFJA 3TFRA 4Y2QA 1XC9A 5ALEA 3PMNA 3UMBA 5ALZA 2JV3A 4K4GA 5AM4A 3ETRA 1V85A 4AYBF 3UM9A 1EXNA 2KJ9A 5ALRA 1RQLA 4DLGA 1X9XA 1S5LU 2KN7A 4KLFA 1JXLA 5DG9A 4UB1A 1C20A 5ALVA 2J6SA 4JV0A 3UQ0A 2FPLA 3ZDEA 4MF8A 2HSZA 4ELUA 5J2CA 3T3FA 4R65A 2PFOA 5KFBA 3QZ7A 3THVA 3QNMA 2ZJ5A 4DLEA 1ZQBA 5AI8A 3T5LA 5KG1A 3V7LA 2W3SA 2C22A 3N97B 2V4RA 2A1AA 3RFAA 9ICVA 5IIIA 3RAQA 3M8RA 3LVVA 4GLXA 4TQRA 5AIAA 4QW9A 2KFZA 3KZXA 3OSPA 4I2DA 4J9OA 3GFKB 4DS5A 4YFKA 5DG7A 1BPEA 1SZHA 4QNLA 4DEZA 3SV3A 1LVHA 2H3QA 4DL2A 3KHRA 5J2KA 4XA5A 3BZCA 3PNCA 1KFDA 1JI7A 4IRDA 1BVSA 8ICVA 4DSFA 1OUQA 5KFTA 2XICA 3NVWA 1FFUA 1J97A 3HRDD 2BZFA 3EZ5A 4P0PA 1HJPA 1X2IA 2ZG6A 2CN1A 2ZJ8A 1SZPA 4RQ2A 5AHXA 3SAFA 2WAQC 2XIDA 4TUQA 2DQNB 2W9CA 8ICEA 4ECSA 3QU9A 1PVRA 4P0PB 4M9JA 1ZRNA 2XO7A 2Y0SF 5JRTA 3KHGA 1ZQOA 4YR3A 4O3RA 1ZQEA 3GV5B 4A8EA 2ISOA 2E1EA 3RRGA 5BOMA 1DGSA 4RNNA 3SAGA 1ZQZA 3H0MB 2K8CB 1DOQA 3NS1A 2W9CB 4NY8A 4FBUA 1JXEA 1ZD2P 3UMGA 1CEZA 3ORYA 4YVZA 2B0CA 1JIHA 2BR0A 5J2BA 3IG5A 3WK9A 2ZXIA 3E0FA 5J8YA 5DB7A 3MFIA 2HHUA 4NLGA 2RQ5A 3JPTA 1MSWD 4C4TA 3WKDA 4CDGA 2LYAA 4IQTA 3GIKA 2E3TA 2KSOA 5AKXA 4OCZA 1XSLA 2AGOA 2H5XA 2YB4A 3CRXA 2JR5A 4U6PA 2XY7A 2PMZF 3RR8A 4ACOA 4TUSA 2F8LA 4Y2PA 7ICUA 2YY6A 2VKQA 5ALLA 3IM1A 3RB4A 4KX5A 1L8OA 5J0WA 4DCCA 1SGGA 3AQEA 5IIKA 3T5JA 5IIJA 2KIVA 4ELTA 5AI5A 4P4MA 8ICRA 4P2HA 2NO4A 4EX7A 3KHHA 4ECYA 1XO0A 4C7YA 1UT5A 4RQNA 4ELVA 4WJ3B 2Y9TA 2ESEA 2PFQA 4JB3A 2BDUA 5A0LA 3A0BU 2M0NA 3LDAA 1S76D 3GU3A 4M2YA 3GIJA 1ZQLA 2JEIA 1IM4A 2EZZA 1PVQA 1NZPA 3TI0A 2HOIA 2W9AA 1N61A 1UCVA 1U49A 4YXJA 1KFTA 3RBEA 4YN4A 1QSLA 4B9NA 3HWTA 9ICTA 4BWMA 5L1LA 1F44A 1RQNA 1YZ7A 4KLQA 3H0LB 4RT2A 3PW7A 2VJ4A 4RNMA 4UBCA 3DEEA 4O3SA 5ALOA 4C8MA 2AJQA 3NRZA 3HT3A 4F4XA 5KFPA 8ICCA 4KN7A 5KFAA 4O0IA 9ICRA 1SV0C 1S0NA 8ICXA 2H3VA 2MSNA 3MR2A 2H3FA 3LYSA 4I2JA 4Y2YA 4R8UA 5ALQA 1NK5A 5J29A 3H8WA 4KLEA 1Z1VA 5JU5A 1SB3C 1JUDA 3PW5A 1CRXA 2C2DA 2DKZA 3GDXA 1PVPA 3M6ZA 4KLOA 5L1KA 4ED6A 3ED5A 1ED1A 4RUCA 4PH5A 3B0YA 2HHQA 2XCAA 2ES6A 2E1FA 2W55A 3R9KA 2ZTDA 1SV4A 4IS7A 5AK6A 4F4YA 2QB0A 2HHTA 4KLIA 1L3TA 4NLCA 2DBYA 4KMOB 2KJ8A 2YMPA 2KJ5A 3V6JA 5DBBA 3C28A 2K89A 1KTQA 1NNLA 3BS5A 3WKBA 8ICFA 3C29A 2FI1A 2BHNA 4UB8U 1JROA 4UAWA 1U4BA 4F72A 4NV0A 1MQ3A 5DLGA 4F3OA 1RXVA 9ICXA 3QEAZ 3OHAA 3JPOA 3GIMA 4PPXA 2Y1IA 4NM2A 4UAVA 4Q44A 3KHLA 3GV7B 1HUZA 4Y2TA 4ECRA 4KN4A 9ICQA 2VANA 1RM6C 3A0HU 3HX0A 1NKEA 1KL9A 4Y2XA 3SD7A 3UXNA 5KFEA 3BS7A 4OJOA 4DSKA 1DK3A 4RQ1A 4I28A 4OJPA 3CP8A 4Z6DA 2FE9A 4ECVA 4IR1A 1NK7A 2IMWP 5ALNA 4BXOB 9ICAA 4JWNA 3SMVA 2MUTA 3AU2A 3JPSA 5KT6A 4QZEA 4FS2A 3KKAA 2GLEA 1X40A 5KFQA 5KFNA 3NGDA 1X9MA 3PSIA 5KFMA 5CWRA 2VA2A 2F8KA 3KFUF 2QARA 5J2FA 9ICHA 5AM3A 3ZDDA 4DFDA 1ZQDA 9ICMA 2NYVA 2MUTB 2DFLA 4USAA 1D9DA 3MFHA 4J9LA 1WWUA 3PR4A 5J0YA 2QARB 5KG7A 4DQIA 5KFRA 4J9RA 5HHHA 3OSNA 2HBMA 4IQWA 3M9NB 3BQ0A 9ICSA 4F5PA 4CF5A 5ALTA 3KD3A 5KFXA 1ZQAA 1FIQA 2IA6A 3KTQA 2FPKA 3AM9A 2VIXA 1WCNA 1DK2A 1RYUA 2P66A 2C2EA 4DSLA 5CA7A 1HEKA 3TQ1A 2YTUA 4NWIA 2ZIUA 2OEHA 4FFDA 4BX9C 4J03A 4IRCA 2KTQA 5HHIA 5E79U 1WUDA 5CJ7A 4UATA 2F1IA 5F9LA 7ICEA 1VDVA 2CXYA 2FLNA 4Y2JA 4MHVA 3QU5A 2K4HA 4QJFB 1L8LA 2AH5A 4YXMA 4GC6A 2ZTCA 2HVIA 3ZDCA 4KLDA 2F1JA 2ZIUB 3AQFA 2LYHA 4YMOA 3HKZC 2KZZA 2XI9A 1UHUA 4CF4A 1UA0A 2JGAA 1QQ7A 4PJ0U 4ZOHC 1X6IA 4QWEA 3KBBA 2JEJA 8ICSA 4CF3A 3I1YA 2LBOA 3WK7A 1H38A 3SV4A 3M9OB 2BKEA 2P6RA 1V38A 2NO5A 1NK0A 1V97A 2ZIXB 5C5JA 4J9PA 5DB9A 5K4LA 4UASA 2QB1A 4RT3A 8ICNA 1TAQA 4O3MA 3HPOA 1NK8A 5D46A 2PFPA 3SYZA 1MN8A 2OXOA 4ECQA 2DL0A 2KP7A 3LK9A 4O5KA 4LJXA 3Q8PB 5J2HA 3M1YA 3H8MA 4XRHA 5AI0A 1QSSA 7ICFA 1ZQJA 9ICWA 2VA8A 1OXJA 2EAOA 2O6KA 4Y2SA 2LI6A 2VJ5A 5KG0A 5CEHA 1A6SA 5KG6A 4UW9A 3PMLA 2EZXA 4P4PA 2GH1A 2W9BA 3GIIA 3TFSA 1VJ5A 4MEYA 2ODGA 3TACB 2A19A 2A1JB 1SKSA 2WB1C 4EBCA 3RJGA 1URJA 1L3SA 3HJEA 2XGPA 3PX0A 5J0RA 7ICMA 3AMZA 2D8CA 2G08A 3TKAA 1ZYQA 3EWAA 2HHSA 4XUSA 2BCRA 3D2NA 3RH4A 1T4GA 2JEFA 2KD1A 1S0OA 4F4KA 4PHDA 3JPRA 3V6KA 3PR5B 3GV8B 3PX4A 2UVRA 3LVWA 1TK0A 2JZBA 1O03A 5ALUA 5J2GA 2Q4TA 4K4HA 2ZUDA 5J0XA 5KFGA 4QZFA 3RH5A 1NI3A 9ICOA 2DPJA 3L4PA 2XY5A 1S77D 5KFDA 4LVSA 1ZD5A 1L7PA 2K4EA 3F5EA 4M9NA 3G6VA 3C2LA 3PW2A 2WHEA 1JN3A 3ZD9A 2BCUA 2ASLA 2AQ4A 3IHQB 4UAUA 3TARA 1DRGA 7ICTA 1PK3A 4C8NA 5L1JA 4EEYA 3RH6A 3HW8A 3F2DA 4UB4A 3SZ2A 2G5HB 2JH1A 4NJ8A 5IIOA 4QZGA 5ALKA 5ALDA 4DS4A 4HAIA 1RPLA 3EYZA 4KLMA 3B9JA 2IOFK 4NL9A 2BPCA 2HI0A 1Z19A 4ECXA 1ZJNA 2KIWA 3H0RB 1ZQNA 4DL4A 3TANA 2ALZA 4E0DA 1A0PA 7ICPA 1S97A 4IC9A 3C1ZA 1N56A 1TVAA 3IN5A 4NXZA 3NTUA 2FDRA 4DOAA 3RAXA 4O3NA 1NOMA 4QZHA 5J8YC 2OYYA 3OPXA 4KLLA 4ECZA 4IR9A 1YZ6A 2QLTA 2HBJA 3H8JA 2FLPA 5DDYA 1SL1A 4Z6EA 3MDAA 7ICVA 2WF5A 2DKXA 2L5YA 1ZQFA 5HMMA 1RYRA 5TISU 1TK5A 5AKEA 2JRZA 4I2EA 1SKWA 1ZRMA 2R8IA 1ZQ1C 4EYHB 4QWCA 2BQ3A 1WYGA 1SL0A 2KICA 5GTHU 5ALHA 4FO6A 3G6YA 1A76A 1HUOA 2FMQA 2BCQA 3U26A 2RLTA 2AU0A 1ZD3A 1S8OA 3N7PD 2D3DA 3RB3A 2HMXA 1B22A 1KW4A 5KAIU 3RBDA 3T5KA 2XVTA 2W3RA 1S9FA 2E8OA 1C7YA 1SXEA 4EYIB 1VLBA 1ZQYA 4UAZA 2P35A 3QU4A 4DFMA 4GXIA 4O3PA 4I2AA 2BPFA 3MR6A 2MAXA 2NRXA 2ZIWA 3CW2C 1SWWA 3ETLA 2R8JA 4B9LA 4M9HA 4C8LA 4QZ8A 1XO1A 3E58A 4F8RA 2E8MA 5AKHA 4LZGA 4ECTA 1COKA 2KSOB 4C8OA 4MFFA 3I28A 4C0ZA 4PHPA 1O08A 4RPZA 1NK6A 1UQVA 4IQVA 4EEKA 1J2MA 1S0VA 5AI9A 3D6JA 2LM4A 8ICKA 1BPZA 1KN5A 9ICEA 7ICQA 2PKEA 3IV6A 1B43A 4QZDA 2IBKA 4J9KA 1ZQIA 4DO9A 3EUB2 1DGJA 3H4DA 5J2AA 4IRKA 3MGVA 8ICUA 2KV2A 5CB1A 4Z6FA 4ED3A 5KFJA 4O9MA 4PGQA 1IXRA 2KKVA 4YCXA 4KLSA 2JMGA 5KFSA 5J0PA 4ED1A 3BQTA 3HP6A 3RJFA 5DQIA 4ZH4A 2OWOA 7ICHA 1IIPA 2BDPA 4UQGA 4TURA 4B9UA 3NVYA 2I9GA 4JV2A 2AGPA 2YQEA 5AKKA 1BGXT 1RG6A 1ZETA 5EWGA 4DL3A 3DDHA 2LM1A 1S0MA 3E2EA 3FM9A 4DQSA 2UVVA 4MFAA 4B9MA 5ALYA 5JTIA 2ZJAA 4DQPA 3N7RC 3ISCA 3S6JA 1SWVA 1SXDA 3WKAA 1TV9A 4KLJA 4RZRA 1K5OA 3QEBZ 1AQ6A 4Y2RA 8ICPA 3OJSA 3CNHA 3UQ2A 1X66A 4R64A 2XC9A 1IG6A 1TKDA 5KNIA 2W54A 4R8UB 2K8AA 3PSFA 3TAPA 4B9SA 4TUPA 4PGYA 4I2BA 1TFRA 4C7ZA 4FS1A 3Q8MA 2EQYA 5J0TA 2HHVA 3K1RB 5KG4A 3C1YA 4GIBA 3FAHA 3Q8KA 5G5GA 7ICJA 4NM1A 1KFSA 3KKAC 3PV8A 3QYPA 1S10A 2QB0B 2D6FC 2FPMA 7ICKA 2FLLA 3M9MB 2PFNA 4EENA 3ALRA 2ASJA 1D8LA 2I1QA 2I5HA 5KFLA 5KT3A 2W7PA 4RQ6A 5KFYA 3BS5B 2UVUA 1ZQCA 3LWLA 2F44A 3EW9A 2K4PA 3F2BA 2BGWA 4RQ3A 4PL2A 5AK5A 5AICA 5G5HA 4O3OA 1FO4A 3MDCA 2FMSA 3RJHA 2CRXA 2OM6A 3QE9Y 5KFFA 5J2EA 2OCEA 4CE6A 5FP0A 1Q8KA 2RDJA 3ZI4A 4RNOA 4I2GA 1OW5A 3UMCA 2E5SA 2C2RA 1BPYA 5ALFA 4F93B 4KX3A 3Q8QB 3MGIA 3NASA 3JPQA 1N48A 4KLHA 2A3VA 4EZ6A 5AK3A 3WKCA 4ED2A 1U47A 3T79A 3RTVA 2K4IA 4GFJA 4UARA 1X9SA 2YX8A 2HCFA 1NK4A 4YP3A 1F5SA 4PL1A 5AKIA 4XQ8A 1BPXA 3PW0A 1QQ5A 1SKRA 3PO4A 4F2SA 1UPHA 3QUQA 2JXJA 2KHVA 2ZTEA 5CR0A 4GC7A 1KKXA 3G6XA 3OTQA 3RR7A 3K1ZA 3F5AA 5KAFU 1XNSA 5KG3A 2BPGA 1D8YA 3ZD8A 5KL1B 7ICNA 1MC8A 3T5HA 4DQQA 4YR0A
chains in the Genus database with same CATH topology
2EZXA 2EZYA 1CI4A 2EZZA 2ODGA 1QCKA 2BZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZX A;  2EZY A;  1CI4 A;  2EZZ A;  2ODG A;  1QCK A;  2BZF A; 
#chains in the Genus database with same CATH topology
 4C4R A;  2XGQ A;  9ICK A;  4OJ6 A;  4RPX A;  2K8B B;  2RDI A;  2WTF A;  2KHQ A;  2FJ6 A;  5EE3 A;  1Q3V A;  3QU7 A;  1TAM A;  2R8G A;  4IQU A;  3EPI A;  2EZY A;  4Y2U A;  3PW4 A;  1N63 A;  4C80 A;  4RQM A;  3N28 A;  1F0M A;  1NJZ A;  5DQG A;  2BCS A;  4JMU A;  1BPD A;  1IV8 A;  3PO5 A;  5CP2 A;  4KLU A;  2EH9 A;  4F5N A;  3QUB A;  2V9W A;  3LWM A;  4QIW C;  1QH9 A;  4MEX A;  2UVW A;  3M6K A;  5AKY A;  5KFU A;  4F5Q A;  2EAP A;  3QUT A;  1Z1B A;  4BWJ A;  1BNP A;  2MA1 A;  1U45 A;  5HML A;  2HBK A;  3QU2 A;  2CPR A;  3C21 A;  2J6T A;  2ZXH A;  2H3Z A;  3ONN A;  3RJI A;  4Q45 A;  5TZV A;  2B21 A;  2KKP A;  8ICO A;  3C5G A;  1FFV A;  3C2K A;  2G09 A;  4ED0 A;  3RF9 A;  4J9Q A;  1WWV A;  4M0A A;  4UB6 U;  4P0Q A;  4AYB C;  3BJY A;  3V72 A;  5H2F U;  5J0Q A;  2BCV A;  3WU2 U;  1KRP A;  2NRT A;  3UXO A;  1ZQG A;  2G07 A;  2DF4 B;  2NRZ A;  7ICG A;  4F4Z A;  4DL5 A;  3SQI A;  1QSY A;  4BGD A;  2W7O A;  3NUQ A;  4P0Q B;  2LYB A;  2Y9U A;  5J2I A;  1U48 A;  3PSP A;  4R63 A;  1A77 A;  1ZOL A;  3SR6 A;  8ICZ A;  2KZ3 A;  3WK4 A;  2F1H A;  5EOZ A;  5KFW A;  1TE2 A;  4US9 A;  4G9B A;  4OO1 J;  4FBT A;  3L3F X;  2YN4 A;  1PK1 A;  1B4F A;  5AM0 A;  2YMQ A;  2W11 A;  3FC4 A;  5EE9 A;  3RJJ A;  4FZM A;  2W03 A;  5IIL A;  2WF6 A;  3BQ1 A;  3N4M B;  2Z7J A;  1WG8 A;  3BZK A;  5J2D A;  1T94 A;  3QX7 A;  3IDW A;  3PVX A;  4RU9 A;  1Z00 A;  4UAY A;  4DQR A;  1PK1 B;  9ICN A;  3O0F A;  4QWA A;  3RRH A;  4YR2 A;  3VC8 A;  2XY6 A;  4QZB A;  1X9W A;  2W9B B;  2I6X A;  3HKZ F;  7ICS A;  1XSN A;  3PST A;  1ZQV A;  1Z00 B;  4PHE A;  5DLF A;  1ZQS A;  4I2I A;  2QKQ A;  3J81 j;  4UB5 A;  4NL9 C;  8ICI A;  2G0A A;  5KFO A;  4DF8 A;  1D8B A;  4I29 A;  5KG5 A;  4RPY A;  4UB3 A;  1KDH A;  5HR7 A;  1JRP A;  2YB1 A;  4I2H A;  5DBC A;  5KL8 B;  2V4Q A;  2HOF A;  5EE0 A;  3NVV A;  5ALS A;  2HW3 A;  2JZB B;  2W8L A;  2Y0S C;  1WCL A;  4QWD A;  5CRX A;  1BPB A;  4KIT B;  4NLZ A;  4O5E A;  4JWM A;  4M9G A;  1NJY A;  1LKY A;  3F2C A;  8ICM A;  2HBL A;  2BQU A;  1DXS A;  2BQR A;  2E8N A;  3GIL A;  4M9L A;  4F91 B;  4OJL A;  5J0U A;  1JX4 A;  4DL6 A;  3SEI A;  3MC1 A;  1LKY B;  5AKZ A;  1QLN A;  4M47 A;  4I27 A;  2IOF A;  4HYK A;  2LMR A;  2WB1 F;  1KSP A;  2NRW A;  2W04 A;  3BQ7 A;  2HDO A;  5L1M A;  4R66 A;  3NVZ A;  2RRD A;  5IIM A;  4KLT A;  2JH7 A;  1L3V A;  2AHO B;  3KZI U;  4RQ4 A;  4KLG A;  3AL0 B;  4Z6C A;  2DUY A;  1Y88 A;  4DL7 A;  2PMZ C;  4J9S A;  2KVS A;  1KQQ A;  5ALX A;  3OJU A;  2ZIV A;  4Q43 A;  4O3Q A;  1QQ6 A;  4MFC A;  4DSE A;  3V6H A;  4OD0 A;  4O5C A;  4LZD A;  1JMS A;  4KMU A;  2ZUC A;  4PHA A;  5ALG A;  8ICW A;  2XCP A;  2JHD A;  3BQ2 A;  3H8S A;  3QXG A;  3GQC A;  3RB6 A;  2ZIV B;  8ICY A;  4F5R A;  5C0Y A;  4P4O A;  4EBD A;  4F5O A;  4EX6 A;  2OH2 A;  1NJW A;  2ATL A;  2FMP A;  4DWI A;  2ISP A;  2G06 A;  1QCK A;  4ICA A;  1K1Q A;  1GO3 F;  3H7I A;  5EWE A;  3ICX A;  4DFK A;  5KFV A;  5KTQ A;  2JEG A;  1ZQW A;  4YQW A;  5J0S A;  5DDM A;  3ZDA A;  1XU4 A;  2HVH A;  1ZXI A;  4RQ0 A;  7ICR A;  3AUO A;  5ALJ A;  4JUZ A;  1D9F A;  5CHG A;  2IHM A;  1RYS A;  8ICG A;  2YML A;  4FE3 A;  2R8H A;  2F3N A;  1UT8 A;  5KFZ A;  5KT7 A;  1CUK A;  4C8K A;  4AP9 A;  3VCB A;  4FZN A;  3C5F A;  2W9M A;  4DOB A;  5AI4 A;  4IL6 U;  4NLK A;  2PI4 A;  1J2N A;  2KZM A;  3FDS A;  5HNK A;  4CCH A;  4J9N A;  2ZIW B;  1TK8 A;  3MAB A;  2WAQ F;  4B9T A;  2ZUB A;  3RB0 A;  4F92 B;  2LHT A;  3I76 A;  1ZJM A;  8ICA A;  1P7D A;  2N1R A;  5HP4 A;  2R8K A;  5KFH A;  2B6G A;  5F3X B;  3UPQ A;  2KE7 A;  3SEN A;  1ZQM A;  3NRW A;  3N7S C;  4U7C A;  3PX6 A;  4RQ8 A;  5D49 A;  3RJE A;  5KFC A;  5DQH A;  2IHN A;  1ZD4 A;  4QWB A;  9ICU A;  3Q8S B;  3C23 A;  5KG2 A;  2WF9 A;  5T14 A;  3PY8 A;  7ICI A;  2YMM A;  4NLB A;  1B0X A;  3CYM A;  1Q3U A;  2KFN A;  4TQS A;  5AM5 A;  3FYH A;  4QZ9 A;  1N5X A;  3B0X A;  3WK8 A;  4X5V A;  2MU2 A;  2AXT U;  5DB8 A;  3BDP A;  5DGB A;  2KOB A;  4K4I A;  3WK5 A;  4QZA A;  1XWL A;  1L7M A;  3V7J A;  3MGH A;  2KNJ A;  7ICO A;  2DPI A;  3AN1 A;  4F2R A;  4RUA A;  1X6J A;  1ZQR A;  8ICH A;  5B5E U;  3AEV A;  5J2J A;  4EZ9 A;  9ICP A;  9ICB A;  1KEJ A;  2M9N A;  5J0O A;  3SAH A;  3QZ8 A;  5ALI A;  1L3U A;  4ECW A;  3HIL A;  5DBA A;  3JPP A;  1Z3E B;  1Z4O A;  4DF4 A;  2HHX A;  3WK6 A;  4YMN A;  3SI8 A;  5BOL A;  2IOH A;  5KT5 A;  4F4W A;  3F53 A;  5BPC A;  1NKB A;  4M6W A;  5AM1 A;  1BNO A;  3EPG A;  2F76 X;  4PZN A;  5EE1 A;  2PXI A;  4ECU A;  3OGU A;  4JV1 A;  1RDF A;  1KLN A;  1LV5 A;  3IP4 B;  4CGZ A;  5KT2 A;  5GTI U;  4UB2 A;  4J9M A;  4M6W B;  1SV0 A;  1U9L A;  1L6N A;  9ICF A;  4ED7 A;  1N2X A;  1SL2 A;  3D2S A;  3IRU A;  1X42 A;  1HIW A;  1ECW A;  1MQ2 A;  1KBU A;  9ICI A;  1LB2 B;  2DGZ A;  3RJK A;  4GXK A;  1T3N A;  1ZQK A;  4YD2 A;  3ISD A;  4BXO A;  3MBY A;  3H4B A;  2P6U A;  3K75 D;  5AKJ A;  8ICQ A;  5AKL A;  3QUC A;  3DV9 A;  4ED8 A;  4DFP A;  4CNQ A;  4Q8E A;  4YD1 A;  5D4B A;  9ICG A;  2GO7 A;  2DWQ A;  4M04 A;  5AIB A;  9ICL A;  3L5K A;  2KG5 A;  2Y1J A;  2RHF A;  4QZI A;  7ICL A;  4NLN A;  1XS9 D;  5EWF A;  3UXP A;  1L7N A;  3KOO A;  8ICL A;  2K60 A;  2KMD A;  2J6U A;  1ZQU A;  2F2A B;  1FEZ A;  4G3I A;  4DSJ A;  3WKE A;  2KK0 A;  2LKY A;  4PGX A;  1PZN A;  4US8 A;  3AU6 A;  1CI4 A;  4BJQ A;  1M6Y A;  3D2Q A;  4B6J A;  2PI5 A;  3Q8L A;  1Z4N A;  2KEY A;  5DGA A;  3M7D A;  1L5U A;  2GWS A;  1N62 A;  2HHW A;  1T3Q A;  4MF2 A;  2W43 A;  4Y2V A;  3TAD C;  2E8P A;  1RZT A;  5F9N A;  2G5I B;  1L7O A;  3V7K A;  2VA3 A;  1QTM A;  3H40 A;  1TAU A;  5ALW A;  1NK9 A;  9ICC A;  1PUZ A;  5AK4 A;  1ZQP A;  5L1I A;  2F77 X;  4B9V A;  2WFA A;  5KFK A;  2OHF A;  2R18 A;  4GXJ A;  2NV3 A;  2W8K A;  5ALM A;  5ALP A;  1T7P A;  8ICT A;  1COO A;  5DB6 A;  5DKW A;  5AKG A;  1ZQQ A;  5KT4 A;  1NKC A;  4Q8F A;  2ZIX A;  4OJ5 A;  4CRX A;  1JAL A;  5B66 U;  2LPE A;  3ISB A;  4FZL A;  1N60 A;  4KTQ A;  2Q0Z X;  5KFI A;  1ZQH A;  2EDU A;  1ZQX A;  2RP5 A;  4QZC A;  4QW8 A;  3MR5 A;  1ARO P;  3K4G A;  3PZP A;  4I2C A;  4BDP A;  2EAM A;  3GZF A;  1RXW A;  1MA7 A;  3TAD A;  1V9P A;  5DG8 A;  1ZQT A;  4PZO A;  2WF7 A;  1YT3 A;  1N5W A;  5IIN A;  2WF8 A;  4EEL A;  3IG8 A;  4C4S A;  2AGQ A;  2H3I A;  2A1J A;  1XSP A;  4EBE A;  2EAN A;  2C28 A;  1K1S A;  2ASD A;  4F71 A;  4YG2 A;  5L9X A;  3Q8R B;  4F50 A;  1NZB A;  4I2F A;  4DOC A;  1Q46 A;  3JPN A;  3ZDB A;  4QIW F;  8ICJ A;  4YMM A;  4BUG A;  8ICB A;  1NJX A;  1SIJ A;  5AI6 A;  5JUM A;  9ICJ A;  2GOL A;  1T8E A;  3OHB A;  5HR6 A;  3TAQ A;  2MRL A;  4DSI A;  2AQ0 A;  4RQ7 A;  2KVC A;  2HOQ A;  1UA1 A;  4RQ5 A;  4UBB A;  5AM2 A;  3MR3 A;  3M8S A;  4JK1 A;  3C2M A;  2NRV A;  4DFJ A;  3TFR A;  4Y2Q A;  1XC9 A;  5ALE A;  3PMN A;  3UMB A;  5ALZ A;  2JV3 A;  4K4G A;  5AM4 A;  3ETR A;  1V85 A;  4AYB F;  3UM9 A;  1EXN A;  2KJ9 A;  5ALR A;  1RQL A;  4DLG A;  1X9X A;  1S5L U;  2KN7 A;  4KLF A;  1JXL A;  5DG9 A;  4UB1 A;  1C20 A;  5ALV A;  2J6S A;  4JV0 A;  3UQ0 A;  2FPL A;  3ZDE A;  4MF8 A;  2HSZ A;  4ELU A;  5J2C A;  3T3F A;  4R65 A;  2PFO A;  5KFB A;  3QZ7 A;  3THV A;  3QNM A;  2ZJ5 A;  4DLE A;  1ZQB A;  5AI8 A;  3T5L A;  5KG1 A;  3V7L A;  2W3S A;  2C22 A;  3N97 B;  2V4R A;  2A1A A;  3RFA A;  9ICV A;  5III A;  3RAQ A;  3M8R A;  3LVV A;  4GLX A;  4TQR A;  5AIA A;  4QW9 A;  2KFZ A;  3KZX A;  3OSP A;  4I2D A;  4J9O A;  3GFK B;  4DS5 A;  4YFK A;  5DG7 A;  1BPE A;  1SZH A;  4QNL A;  4DEZ A;  3SV3 A;  1LVH A;  2H3Q A;  4DL2 A;  3KHR A;  5J2K A;  4XA5 A;  3BZC A;  3PNC A;  1KFD A;  1JI7 A;  4IRD A;  1BVS A;  8ICV A;  4DSF A;  1OUQ A;  5KFT A;  2XIC A;  3NVW A;  1FFU A;  1J97 A;  3HRD D;  2BZF A;  3EZ5 A;  4P0P A;  1HJP A;  1X2I A;  2ZG6 A;  2CN1 A;  2ZJ8 A;  1SZP A;  4RQ2 A;  5AHX A;  3SAF A;  2WAQ C;  2XID A;  4TUQ A;  2DQN B;  2W9C A;  8ICE A;  4ECS A;  3QU9 A;  1PVR A;  4P0P B;  4M9J A;  1ZRN A;  2XO7 A;  2Y0S F;  5JRT A;  3KHG A;  1ZQO A;  4YR3 A;  4O3R A;  1ZQE A;  3GV5 B;  4A8E A;  2ISO A;  2E1E A;  3RRG A;  5BOM A;  1DGS A;  4RNN A;  3SAG A;  1ZQZ A;  3H0M B;  2K8C B;  1DOQ A;  3NS1 A;  2W9C B;  4NY8 A;  4FBU A;  1JXE A;  1ZD2 P;  3UMG A;  1CEZ A;  3ORY A;  4YVZ A;  2B0C A;  1JIH A;  2BR0 A;  5J2B A;  3IG5 A;  3WK9 A;  2ZXI A;  3E0F A;  5J8Y A;  5DB7 A;  3MFI A;  2HHU A;  4NLG A;  2RQ5 A;  3JPT A;  1MSW D;  4C4T A;  3WKD A;  4CDG A;  2LYA A;  4IQT A;  3GIK A;  2E3T A;  2KSO A;  5AKX A;  4OCZ A;  1XSL A;  2AGO A;  2H5X A;  2YB4 A;  3CRX A;  2JR5 A;  4U6P A;  2XY7 A;  2PMZ F;  3RR8 A;  4ACO A;  4TUS A;  2F8L A;  4Y2P A;  7ICU A;  2YY6 A;  2VKQ A;  5ALL A;  3IM1 A;  3RB4 A;  4KX5 A;  1L8O A;  5J0W A;  4DCC A;  1SGG A;  3AQE A;  5IIK A;  3T5J A;  5IIJ A;  2KIV A;  4ELT A;  5AI5 A;  4P4M A;  8ICR A;  4P2H A;  2NO4 A;  4EX7 A;  3KHH A;  4ECY A;  1XO0 A;  4C7Y A;  1UT5 A;  4RQN A;  4ELV A;  4WJ3 B;  2Y9T A;  2ESE A;  2PFQ A;  4JB3 A;  2BDU A;  5A0L A;  3A0B U;  2M0N A;  3LDA A;  1S76 D;  3GU3 A;  4M2Y A;  3GIJ A;  1ZQL A;  2JEI A;  1IM4 A;  2EZZ A;  1PVQ A;  1NZP A;  3TI0 A;  2HOI A;  2W9A A;  1N61 A;  1UCV A;  1U49 A;  4YXJ A;  1KFT A;  3RBE A;  4YN4 A;  1QSL A;  4B9N A;  3HWT A;  9ICT A;  4BWM A;  5L1L A;  1F44 A;  1RQN A;  1YZ7 A;  4KLQ A;  3H0L B;  4RT2 A;  3PW7 A;  2VJ4 A;  4RNM A;  4UBC A;  3DEE A;  4O3S A;  5ALO A;  4C8M A;  2AJQ A;  3NRZ A;  3HT3 A;  4F4X A;  5KFP A;  8ICC A;  4KN7 A;  5KFA A;  4O0I A;  9ICR A;  1SV0 C;  1S0N A;  8ICX A;  2H3V A;  2MSN A;  3MR2 A;  2H3F A;  3LYS A;  4I2J A;  4Y2Y A;  4R8U A;  5ALQ A;  1NK5 A;  5J29 A;  3H8W A;  4KLE A;  1Z1V A;  5JU5 A;  1SB3 C;  1JUD A;  3PW5 A;  1CRX A;  2C2D A;  2DKZ A;  3GDX A;  1PVP A;  3M6Z A;  4KLO A;  5L1K A;  4ED6 A;  3ED5 A;  1ED1 A;  4RUC A;  4PH5 A;  3B0Y A;  2HHQ A;  2XCA A;  2ES6 A;  2E1F A;  2W55 A;  3R9K A;  2ZTD A;  1SV4 A;  4IS7 A;  5AK6 A;  4F4Y A;  2QB0 A;  2HHT A;  4KLI A;  1L3T A;  4NLC A;  2DBY A;  4KMO B;  2KJ8 A;  2YMP A;  2KJ5 A;  3V6J A;  5DBB A;  3C28 A;  2K89 A;  1KTQ A;  1NNL A;  3BS5 A;  3WKB A;  8ICF A;  3C29 A;  2FI1 A;  2BHN A;  4UB8 U;  1JRO A;  4UAW A;  1U4B A;  4F72 A;  4NV0 A;  1MQ3 A;  5DLG A;  4F3O A;  1RXV A;  9ICX A;  3QEA Z;  3OHA A;  3JPO A;  3GIM A;  4PPX A;  2Y1I A;  4NM2 A;  4UAV A;  4Q44 A;  3KHL A;  3GV7 B;  1HUZ A;  4Y2T A;  4ECR A;  4KN4 A;  9ICQ A;  2VAN A;  1RM6 C;  3A0H U;  3HX0 A;  1NKE A;  1KL9 A;  4Y2X A;  3SD7 A;  3UXN A;  5KFE A;  3BS7 A;  4OJO A;  4DSK A;  1DK3 A;  4RQ1 A;  4I28 A;  4OJP A;  3CP8 A;  4Z6D A;  2FE9 A;  4ECV A;  4IR1 A;  1NK7 A;  2IMW P;  5ALN A;  4BXO B;  9ICA A;  4JWN A;  3SMV A;  2MUT A;  3AU2 A;  3JPS A;  5KT6 A;  4QZE A;  4FS2 A;  3KKA A;  2GLE A;  1X40 A;  5KFQ A;  5KFN A;  3NGD A;  1X9M A;  3PSI A;  5KFM A;  5CWR A;  2VA2 A;  2F8K A;  3KFU F;  2QAR A;  5J2F A;  9ICH A;  5AM3 A;  3ZDD A;  4DFD A;  1ZQD A;  9ICM A;  2NYV A;  2MUT B;  2DFL A;  4USA A;  1D9D A;  3MFH A;  4J9L A;  1WWU A;  3PR4 A;  5J0Y A;  2QAR B;  5KG7 A;  4DQI A;  5KFR A;  4J9R A;  5HHH A;  3OSN A;  2HBM A;  4IQW A;  3M9N B;  3BQ0 A;  9ICS A;  4F5P A;  4CF5 A;  5ALT A;  3KD3 A;  5KFX A;  1ZQA A;  1FIQ A;  2IA6 A;  3KTQ A;  2FPK A;  3AM9 A;  2VIX A;  1WCN A;  1DK2 A;  1RYU A;  2P66 A;  2C2E A;  4DSL A;  5CA7 A;  1HEK A;  3TQ1 A;  2YTU A;  4NWI A;  2ZIU A;  2OEH A;  4FFD A;  4BX9 C;  4J03 A;  4IRC A;  2KTQ A;  5HHI A;  5E79 U;  1WUD A;  5CJ7 A;  4UAT A;  2F1I A;  5F9L A;  7ICE A;  1VDV A;  2CXY A;  2FLN A;  4Y2J A;  4MHV A;  3QU5 A;  2K4H A;  4QJF B;  1L8L A;  2AH5 A;  4YXM A;  4GC6 A;  2ZTC A;  2HVI A;  3ZDC A;  4KLD A;  2F1J A;  2ZIU B;  3AQF A;  2LYH A;  4YMO A;  3HKZ C;  2KZZ A;  2XI9 A;  1UHU A;  4CF4 A;  1UA0 A;  2JGA A;  1QQ7 A;  4PJ0 U;  4ZOH C;  1X6I A;  4QWE A;  3KBB A;  2JEJ A;  8ICS A;  4CF3 A;  3I1Y A;  2LBO A;  3WK7 A;  1H38 A;  3SV4 A;  3M9O B;  2BKE A;  2P6R A;  1V38 A;  2NO5 A;  1NK0 A;  1V97 A;  2ZIX B;  5C5J A;  4J9P A;  5DB9 A;  5K4L A;  4UAS A;  2QB1 A;  4RT3 A;  8ICN A;  1TAQ A;  4O3M A;  3HPO A;  1NK8 A;  5D46 A;  2PFP A;  3SYZ A;  1MN8 A;  2OXO A;  4ECQ A;  2DL0 A;  2KP7 A;  3LK9 A;  4O5K A;  4LJX A;  3Q8P B;  5J2H A;  3M1Y A;  3H8M A;  4XRH A;  5AI0 A;  1QSS A;  7ICF A;  1ZQJ A;  9ICW A;  2VA8 A;  1OXJ A;  2EAO A;  2O6K A;  4Y2S A;  2LI6 A;  2VJ5 A;  5KG0 A;  5CEH A;  1A6S A;  5KG6 A;  4UW9 A;  3PML A;  2EZX A;  4P4P A;  2GH1 A;  2W9B A;  3GII A;  3TFS A;  1VJ5 A;  4MEY A;  2ODG A;  3TAC B;  2A19 A;  2A1J B;  1SKS A;  2WB1 C;  4EBC A;  3RJG A;  1URJ A;  1L3S A;  3HJE A;  2XGP A;  3PX0 A;  5J0R A;  7ICM A;  3AMZ A;  2D8C A;  2G08 A;  3TKA A;  1ZYQ A;  3EWA A;  2HHS A;  4XUS A;  2BCR A;  3D2N A;  3RH4 A;  1T4G A;  2JEF A;  2KD1 A;  1S0O A;  4F4K A;  4PHD A;  3JPR A;  3V6K A;  3PR5 B;  3GV8 B;  3PX4 A;  2UVR A;  3LVW A;  1TK0 A;  2JZB A;  1O03 A;  5ALU A;  5J2G A;  2Q4T A;  4K4H A;  2ZUD A;  5J0X A;  5KFG A;  4QZF A;  3RH5 A;  1NI3 A;  9ICO A;  2DPJ A;  3L4P A;  2XY5 A;  1S77 D;  5KFD A;  4LVS A;  1ZD5 A;  1L7P A;  2K4E A;  3F5E A;  4M9N A;  3G6V A;  3C2L A;  3PW2 A;  2WHE A;  1JN3 A;  3ZD9 A;  2BCU A;  2ASL A;  2AQ4 A;  3IHQ B;  4UAU A;  3TAR A;  1DRG A;  7ICT A;  1PK3 A;  4C8N A;  5L1J A;  4EEY A;  3RH6 A;  3HW8 A;  3F2D A;  4UB4 A;  3SZ2 A;  2G5H B;  2JH1 A;  4NJ8 A;  5IIO A;  4QZG A;  5ALK A;  5ALD A;  4DS4 A;  4HAI A;  1RPL A;  3EYZ A;  4KLM A;  3B9J A;  2IOF K;  4NL9 A;  2BPC A;  2HI0 A;  1Z19 A;  4ECX A;  1ZJN A;  2KIW A;  3H0R B;  1ZQN A;  4DL4 A;  3TAN A;  2ALZ A;  4E0D A;  1A0P A;  7ICP A;  1S97 A;  4IC9 A;  3C1Z A;  1N56 A;  1TVA A;  3IN5 A;  4NXZ A;  3NTU A;  2FDR A;  4DOA A;  3RAX A;  4O3N A;  1NOM A;  4QZH A;  5J8Y C;  2OYY A;  3OPX A;  4KLL A;  4ECZ A;  4IR9 A;  1YZ6 A;  2QLT A;  2HBJ A;  3H8J A;  2FLP A;  5DDY A;  1SL1 A;  4Z6E A;  3MDA A;  7ICV A;  2WF5 A;  2DKX A;  2L5Y A;  1ZQF A;  5HMM A;  1RYR A;  5TIS U;  1TK5 A;  5AKE A;  2JRZ A;  4I2E A;  1SKW A;  1ZRM A;  2R8I A;  1ZQ1 C;  4EYH B;  4QWC A;  2BQ3 A;  1WYG A;  1SL0 A;  2KIC A;  5GTH U;  5ALH A;  4FO6 A;  3G6Y A;  1A76 A;  1HUO A;  2FMQ A;  2BCQ A;  3U26 A;  2RLT A;  2AU0 A;  1ZD3 A;  1S8O A;  3N7P D;  2D3D A;  3RB3 A;  2HMX A;  1B22 A;  1KW4 A;  5KAI U;  3RBD A;  3T5K A;  2XVT A;  2W3R A;  1S9F A;  2E8O A;  1C7Y A;  1SXE A;  4EYI B;  1VLB A;  1ZQY A;  4UAZ A;  2P35 A;  3QU4 A;  4DFM A;  4GXI A;  4O3P A;  4I2A A;  2BPF A;  3MR6 A;  2MAX A;  2NRX A;  2ZIW A;  3CW2 C;  1SWW A;  3ETL A;  2R8J A;  4B9L A;  4M9H A;  4C8L A;  4QZ8 A;  1XO1 A;  3E58 A;  4F8R A;  2E8M A;  5AKH A;  4LZG A;  4ECT A;  1COK A;  2KSO B;  4C8O A;  4MFF A;  3I28 A;  4C0Z A;  4PHP A;  1O08 A;  4RPZ A;  1NK6 A;  1UQV A;  4IQV A;  4EEK A;  1J2M A;  1S0V A;  5AI9 A;  3D6J A;  2LM4 A;  8ICK A;  1BPZ A;  1KN5 A;  9ICE A;  7ICQ A;  2PKE A;  3IV6 A;  1B43 A;  4QZD A;  2IBK A;  4J9K A;  1ZQI A;  4DO9 A;  3EUB 2;  1DGJ A;  3H4D A;  5J2A A;  4IRK A;  3MGV A;  8ICU A;  2KV2 A;  5CB1 A;  4Z6F A;  4ED3 A;  5KFJ A;  4O9M A;  4PGQ A;  1IXR A;  2KKV A;  4YCX A;  4KLS A;  2JMG A;  5KFS A;  5J0P A;  4ED1 A;  3BQT A;  3HP6 A;  3RJF A;  5DQI A;  4ZH4 A;  2OWO A;  7ICH A;  1IIP A;  2BDP A;  4UQG A;  4TUR A;  4B9U A;  3NVY A;  2I9G A;  4JV2 A;  2AGP A;  2YQE A;  5AKK A;  1BGX T;  1RG6 A;  1ZET A;  5EWG A;  4DL3 A;  3DDH A;  2LM1 A;  1S0M A;  3E2E A;  3FM9 A;  4DQS A;  2UVV A;  4MFA A;  4B9M A;  5ALY A;  5JTI A;  2ZJA A;  4DQP A;  3N7R C;  3ISC A;  3S6J A;  1SWV A;  1SXD A;  3WKA A;  1TV9 A;  4KLJ A;  4RZR A;  1K5O A;  3QEB Z;  1AQ6 A;  4Y2R A;  8ICP A;  3OJS A;  3CNH A;  3UQ2 A;  1X66 A;  4R64 A;  2XC9 A;  1IG6 A;  1TKD A;  5KNI A;  2W54 A;  4R8U B;  2K8A A;  3PSF A;  3TAP A;  4B9S A;  4TUP A;  4PGY A;  4I2B A;  1TFR A;  4C7Z A;  4FS1 A;  3Q8M A;  2EQY A;  5J0T A;  2HHV A;  3K1R B;  5KG4 A;  3C1Y A;  4GIB A;  3FAH A;  3Q8K A;  5G5G A;  7ICJ A;  4NM1 A;  1KFS A;  3KKA C;  3PV8 A;  3QYP A;  1S10 A;  2QB0 B;  2D6F C;  2FPM A;  7ICK A;  2FLL A;  3M9M B;  2PFN A;  4EEN A;  3ALR A;  2ASJ A;  1D8L A;  2I1Q A;  2I5H A;  5KFL A;  5KT3 A;  2W7P A;  4RQ6 A;  5KFY A;  3BS5 B;  2UVU A;  1ZQC A;  3LWL A;  2F44 A;  3EW9 A;  2K4P A;  3F2B A;  2BGW A;  4RQ3 A;  4PL2 A;  5AK5 A;  5AIC A;  5G5H A;  4O3O A;  1FO4 A;  3MDC A;  2FMS A;  3RJH A;  2CRX A;  2OM6 A;  3QE9 Y;  5KFF A;  5J2E A;  2OCE A;  4CE6 A;  5FP0 A;  1Q8K A;  2RDJ A;  3ZI4 A;  4RNO A;  4I2G A;  1OW5 A;  3UMC A;  2E5S A;  2C2R A;  1BPY A;  5ALF A;  4F93 B;  4KX3 A;  3Q8Q B;  3MGI A;  3NAS A;  3JPQ A;  1N48 A;  4KLH A;  2A3V A;  4EZ6 A;  5AK3 A;  3WKC A;  4ED2 A;  1U47 A;  3T79 A;  3RTV A;  2K4I A;  4GFJ A;  4UAR A;  1X9S A;  2YX8 A;  2HCF A;  1NK4 A;  4YP3 A;  1F5S A;  4PL1 A;  5AKI A;  4XQ8 A;  1BPX A;  3PW0 A;  1QQ5 A;  1SKR A;  3PO4 A;  4F2S A;  1UPH A;  3QUQ A;  2JXJ A;  2KHV A;  2ZTE A;  5CR0 A;  4GC7 A;  1KKX A;  3G6X A;  3OTQ A;  3RR7 A;  3K1Z A;  3F5A A;  5KAF U;  1XNS A;  5KG3 A;  2BPG A;  1D8Y A;  3ZD8 A;  5KL1 B;  7ICN A;  1MC8 A;  3T5H A;  4DQQ A;  4YR0 A; 
#chains in the Genus database with same CATH homology
 2EZX A;  2EZY A;  1CI4 A;  2EZZ A;  2ODG A;  1QCK A;  2BZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...