2EZYA

Solution structure of human barrier-to-autointegration factor baf, nmr, ensemble of 20 simulated annealing structures
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
89
structure length
89
Chain Sequence
MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARRIER-TO-AUTOINTEGRATION FACTOR
publication title Solution structure of the cellular factor BAF responsible for protecting retroviral DNA from autointegration.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 28
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02961 BAF Barrier to autointegration factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.40 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Barrier-to-autointegration factor, BAF 2ezyA00
2EZZA 2EZXA 1CI4A 2BZFA 2ODGA 1QCKA 2EZYA
chains in the Genus database with same CATH superfamily
4DSKA 1BPZA 4IRDA 4PZNA 2D3DA 2W9CB 3HKZF 4YR3A 4DS5A 3BQ7A 1DOQA 4J9RA 4JUZA 4US9A 1BGXT 1HEKA 1S10A 1ZQKA 4FFDA 5AI5A 3OSNA 5AM5A 1SGGA 3RH4A 1JX4A 2ZJ8A 3PW4A 1L5UA 4ED0A 2XICA 3F53A 2JEFA 3FAHA 3RAQA 5IIKA 1KTQA 2Y1IA 2JRZA 9ICVA 3L5KA 3QUBA 3WKBA 2F3NA 1XSLA 4C80A 4NY8A 9ICKA 3KZIU 3NASA 4TQRA 4EZ6A 2G06A 1RZTA 2H3QA 1T3NA 3NVYA 3EPIA 1JXLA 1N61A 4GC6A 3GV8B 3IG5A 4QNLA 5ALVA 1N2XA 3GU3A 3THVA 7ICMA 2ISOA 1LKYB 3H4BA 2EANA 1MN8A 2H3IA 4RQ6A 4YP3A 5J0QA 4FBUA 5EWEA 3PW0A 5J2DA 4QWDA 2FMPA 5CB1A 4F2SA 4NXZA 1TVAA 3V72A 3NVZA 2KZZA 1ZQZA 2AJQA 2JZBA 5ALFA 3KHLA 1PVRA 2W9MA 4DLEA 4EZ9A 2LYBA 3HW8A 4XA5A 8ICJA 1NJZA 3BZKA 1NOMA 3L3FX 3SAGA 5IILA 1L8OA 5CHGA 3IRUA 5BOLA 4OJLA 1XNSA 4IL6U 1F5SA 1V85A 4ACOA 4I2IA 2F8LA 7ICLA 2FDRA 4ECVA 5CP2A 2B21A 5CEHA 4R63A 2ZIXA 2H5XA 3JPOA 4AYBF 4DSLA 9ICMA 3Q8RB 4GXIA 5KG6A 3JPPA 3TAQA 1HIWA 1AROP 2BPFA 2AXTU 4IQVA 3TARA 2P6RA 2ZXHA 4RQ7A 2Q4TA 4YMNA 3RBDA 5CWRA 1ZQNA 2E8MA 3C2MA 4PZOA 4US8A 4O3MA 4KLUA 4NLKA 4C8NA 9ICTA 4UBBA 4MF2A 4F4KA 1B43A 5AKEA 2JEIA 2KJ8A 3H0LB 9ICUA 1ZQXA 2E8NA 2DKXA 1L6NA 3OHAA 2R18A 1TK5A 3H8JA 5TISU 3SQIA 2K8CB 5KTQA 3LDAA 3UQ2A 2KOBA 1COOA 1Q46A 2K4IA 4O3SA 3OHBA 4QWBA 2WF8A 4UB4A 1YT3A 4BWMA 5BPCA 3RF9A 1T7PA 1Q8KA 1Z19A 1KL9A 4CNQA 2XCPA 4ECQA 5EE1A 2C2DA 2NRXA 2YMLA 1DK2A 5AIBA 2RHFA 4YN4A 2PFQA 3MGIA 4Q45A 2MSNA 2E5SA 3T5LA 4QZDA 2JH1A 5ALWA 5JTIA 3TQ1A 3V7LA 2C28A 1X2IA 5ALDA 2BQUA 5ALOA 4PL2A 7ICTA 3O0FA 2FLLA 2WB1F 4DFMA 1U45A 3RJEA 2LI6A 3C23A 1D9DA 3MGVA 1DXSA 4ED3A 2YX8A 3N7PD 1UT8A 3BDPA 2JHDA 5BOMA 2VJ4A 1BPYA 1KDHA 2G07A 3UPQA 4M04A 4Y2PA 2AGQA 1Z3EB 2XIDA 1Y88A 3GZFA 3MR3A 1JXEA 2XVTA 4DOBA 3DEEA 4TUSA 2K4EA 5KFRA 4DL6A 2VANA 7ICNA 1UA1A 3CYMA 4G9BA 1RYRA 4K4HA 3EYZA 5FP0A 1YZ7A 5D4BA 2MUTA 2F1JA 4QZCA 1V9PA 1WG8A 2ZIVA 4ZOHC 2GO7A 4QZ9A 1SXEA 3PZPA 1KN5A 5AK5A 4UAUA 2C2EA 3WK6A 3A0HU 2AGPA 3B9JA 8ICYA 4O3PA 2BQ3A 4QZEA 2EAPA 4YD2A 3V7JA 3QUTA 3M9NB 1NZPA 5AK3A 1ZETA 5AI8A 1Z4NA 5KG3A 4U7CA 4M9JA 1PK1A 4Y2VA 2ZIVB 3OSPA 1SKWA 2H3FA 5KFZA 2VA8A 3N4MB 7ICEA 5KFPA 3J81j 1T3QA 4CF4A 2FLNA 4FZLA 2YY6A 1ZQGA 3BQTA 2YMPA 3HJEA 1UPHA 2BDPA 2PMZF 2A1JB 4JV0A 3KOOA 4R65A 4Z6FA 4DOCA 3V6JA 3HP6A 5KFQA 2UVUA 1ZQAA 4QZ8A 4GC7A 2Y9TA 4MFFA 4DL5A 8ICCA 2R8IA 1PVQA 2DGZA 2ASJA 3E58A 2OM6A 1XWLA 1L3VA 4FS1A 2HOFA 3SD7A 4Z6EA 4F91B 3H8MA 3OJUA 4JMUA 2MU2A 5J2IA 1RYUA 7ICIA 4M6WA 3H4DA 2R8JA 3CRXA 4P2HA 2W8LA 3AN1A 5F3XB 4JV1A 2K4HA 3GIKA 4FBTA 8ICEA 1CI4A 3ORYA 2VKQA 2IMWP 4DLGA 4F92B 4ECZA 1SZPA 3MDCA 5J2CA 3SV3A 5HHHA 1NZBA 3WKDA 3PY8A 1L7OA 4P0QB 4F4WA 3D2QA 3GDXA 1U49A 4J9NA 2MA1A 2LM4A 4ECWA 2ATLA 1RPLA 4RNMA 4ED8A 4LZGA 2D6FC 2EAMA 1JUDA 1NKBA 4NV0A 4BUGA 2CN1A 1KKXA 5D49A 3Q8MA 1JI7A 3TFSA 5KT7A 3IN5A 1J2NA 7ICOA 5KNIA 5KFAA 2VA2A 4YD1A 2ZUDA 2JV3A 5DBCA 3RJFA 4DSFA 4CRXA 1CUKA 1SWVA 1CRXA 3N97B 1HJPA 2YB4A 3QU5A 5KG1A 8ICBA 1SB3C 1Z00A 2HSZA 4Y2RA 4ELUA 2LPEA 3E0FA 5J2FA 2I1QA 5GTIU 1WCLA 1L3TA 4RNOA 2AGOA 3M7DA 1SWWA 7ICFA 2KSOB 4PGQA 4UATA 2W55A 2RDIA 3MR6A 3NS1A 3PSFA 5J2HA 4B9MA 5KFIA 3Q8PB 5KFUA 3N7RC 4M2YA 1MC8A 5DB8A 2XO7A 4Z6DA 4DFJA 3RB4A 1NI3A 2ASLA 1T8EA 4R64A 4QWEA 4C8OA 2L5YA 2JMGA 1DK3A 7ICVA 4NLBA 4M9GA 4KLIA 3PSIA 3TKAA 4BXOB 2K89A 3LYSA 3PVXA 3QU4A 3QX7A 4F5OA 3QU7A 2BCUA 2RRDA 4DFKA 8ICGA 1SL0A 1F0MA 2PKEA 2I9GA 2NRZA 4I2JA 3VC8A 2ZXIA 4DQPA 4YXJA 2C22A 3G6XA 1X40A 1ZQ1C 5DGBA 1L7NA 1K1SA 7ICGA 2G09A 3IDWA 4I2FA 2XY7A 4XRHA 4EENA 3IG8A 3QZ8A 3AU2A 2OYYA 5HR6A 3TADA 4NJ8A 1KLNA 3ZDEA 4RZRA 9ICWA 2GH1A 9ICCA 1D9FA 1QQ5A 5DBBA 8ICRA 2IOFK 4PHDA 3QE9Y 3IV6A 2EZYA 5KFKA 4J9KA 2VJ5A 4KLTA 2H3VA 4UAYA 9ICIA 3TACB 2W9CA 5L1JA 5AKIA 3RRHA 4JWMA 4DSJA 1FFUA 4F93B 5ALNA 1ZQBA 3FDSA 5CA7A 5ALKA 1JALA 4GIBA 2DKZA 4ED2A 3HKZC 1PUZA 2W3RA 3DV9A 2F1IA 1B4FA 3M6KA 1NK4A 3G6VA 4P0PB 2NO4A 3SZ2A 5DQGA 4OJ5A 4C8LA 5EE3A 5DQHA 4QWCA 1U9LA 2BZFA 4PHAA 3EPGA 1P7DA 4DL4A 4FZNA 1Z1BA 1ZJNA 1CEZA 2PFNA 2PXIA 5L9XA 5KAFU 2NRTA 2HDOA 2R8KA 5KFJA 3MFHA 1UQVA 3RFAA 2HBMA 3RR8A 3ZDDA 3NTUA 3BS5B 5ALIA 4FZMA 2W9BB 1NJWA 4FS2A 3G6YA 5KFHA 4M9HA 4F72A 4B9TA 1BNPA 2W54A 1LKYA 2AU0A 2K8AA 3MABA 2WF5A 4O5EA 2G08A 2BGWA 4Z6CA 4KMOB 4QW8A 2W7OA 3BJYA 1FFVA 1TKDA 3TADC 1EXNA 3PO4A 4DCCA 2J6SA 2ZTDA 4KX5A 5EE0A 2J6UA 3AQFA 3MC1A 4YG2A 3QZ7A 1J97A 4RQ1A 5J0SA 3C5FA 2XGQA 8ICWA 1S0MA 4UBCA 3QU9A 2F8KA 1T94A 1RQNA 3BQ1A 3GIMA 3EWAA 3S6JA 4JV2A 4UAZA 3ZDBA 4IQTA 4MF8A 3ETRA 9ICRA 2UVVA 2E1EA 2I6XA 5JU5A 2V4QA 1LVHA 5KFLA 4Y2SA 1NKEA 1NK5A 2QARA 4C0ZA 4PH5A 2JR5A 1U47A 4I2HA 1KSPA 2Y0SF 1BPEA 9ICEA 3H8SA 4R66A 2F44A 4AYBC 5C5JA 3HWTA 3GV7B 2HBKA 1S0OA 4IS7A 2ZG6A 4O9MA 4NL9A 3UXOA 5AM4A 5F9NA 4IQWA 1LB2B 4LVSA 4FO6A 3K4GA 5HP4A 3AUOA 1V38A 5AM1A 2HHXA 1B22A 4NWIA 2KN7A 2HOIA 2QARB 3M6ZA 5KT6A 2W04A 2KHQA 4UW9A 4DWIA 4UB5A 2VIXA 5L1IA 1A6SA 1RDFA 4GLXA 4PPXA 5J0OA 1NKCA 4M0AA 4Y2UA 5IIMA 2ZJAA 4MFCA 2YN4A 4UASA 2NRWA 2KFZA 4MEXA 3N28A 5KL8B 5AKHA 1QSYA 4KLJA 3H0MB 2Y9UA 1M6YA 3PX0A 5J2BA 5KFYA 5IIJA 1JN3A 3D2NA 4F71A 2ASDA 9ICLA 8ICAA 4P4MA 8ICVA 2BQRA 2OH2A 2YTUA 1KRPA 2QB1A 4UB6U 5L1MA 2B0CA 2FI1A 3CP8A 3EUB2 2W7PA 1SZHA 5KFOA 2V4RA 2HBJA 3C2KA 5KG7A 1L7MA 8ICIA 2KVCA 3IHQB 9ICFA 1J2MA 4CGZA 5J2KA 4KMUA 1ZQJA 2FPKA 4ECRA 2AQ4A 1S77D 1FEZA 2YQEA 3LVVA 5KG2A 1SV4A 4UB8U 2CXYA 3V7KA 4KLGA 3H8WA 4DQRA 4O5CA 1ZQMA 2WB1C 2BKEA 2BDUA 2DL0A 1D8BA 2IBKA 5ALLA 4PHPA 2K60A 1U48A 3RJIA 4NL9C 2EZXA 5KFMA 4RPZA 1KEJA 1UA0A 4EEYA 4OJ6A 2EZZA 1VJ5A 4C7ZA 9ICNA 2DPIA 7ICJA 4QWAA 3M8SA 1JIHA 3RR7A 2FLPA 9ICJA 4AP9A 5KT2A 1ZXIA 1B0XA 4I2DA 1NJYA 4I2BA 1ZD5A 4KX3A 2BPCA 3PW2A 3MR2A 3QU2A 3FM9A 8ICTA 1SV0A 3JPNA 5J2JA 4I28A 4DQSA 1XS9D 4BX9C 3M8RA 3RTVA 1RYSA 1NK0A 4QIWF 5KFBA 4EX7A 2IHNA 3PSTA 4C8KA 4F8RA 4RQ4A 1QCKA 2ISPA 2A1JA 3F5EA 4YFKA 2MRLA 5AIAA 1RQLA 4F5NA 2KKPA 3WKCA 4QZIA 1BPBA 2ZTEA 3EW9A 2PMZC 2IA6A 5J0PA 2WTFA 4U6PA 2KZMA 4G3IA 4BDPA 1TAMA 9ICBA 3KHRA 4ED6A 4GXKA 2HHTA 3BQ0A 2BR0A 4J9SA 4NLNA 2WHEA 4ECYA 2W9AA 4ZH4A 5DG7A 2EH9A 1AQ6A 1L8LA 3FC4A 1IIPA 4O3OA 7ICSA 4A8EA 4B9SA 4R8UB 4C4TA 4DEZA 1A0PA 2XY6A 3WK4A 3M9OB 4P0QA 2F2AB 4EEKA 4RQ3A 4F4ZA 5AKGA 3SV4A 1TK0A 1DGJA 1OXJA 3AMZA 3TANA 3NUQA 1S97A 4DL3A 4FE3A 4DOAA 4F2RA 4J9LA 4RPXA 3KZXA 2I5HA 1BVSA 5B5EU 4HYKA 1ZQWA 4B6JA 1ZQCA 4RUCA 5HHIA 3PW7A 1ZQSA 1LV5A 5DDMA 5DB9A 1SV0C 3M1YA 3QYPA 2YMQA 4RQ0A 3KHGA 2KMDA 3UQ0A 4CF5A 3LWMA 1ZQFA 4TURA 5AI6A 1SIJA 3JPRA 3PR4A 3LWLA 3HPOA 2HMXA 4PL1A 2XGPA 4I2AA 1ZYQA 1NK8A 1WYGA 4KLMA 2KSOA 3ZDCA 5ALGA 2LM1A 5ALMA 3PX6A 1UT5A 4F5RA 4J9OA 3AM9A 3V6HA 2QB0B 3L4PA 4DF8A 3KFUF 2RDJA 4C4RA 2CPRA 1ZQPA 4HAIA 1X66A 2KTQA 4Q44A 1ZQRA 1U4BA 3B0YA 4IRKA 5JUMA 3RRGA 2HHUA 1ZJMA 2N1RA 1Q3UA 2HI0A 2IOHA 1QQ7A 4ECTA 4NLGA 2KV2A 2YMMA 4BXOA 4I27A 2BCSA 3T5KA 3QXGA 4ECXA 5ALTA 8ICKA 2HVIA 3QUQA 2XY5A 4IR1A 2RQ5A 1RXWA 1D8YA 2DQNB 2QKQA 3OGUA 5DQIA 5ALSA 1S9FA 1COKA 2P35A 4UB3A 1X9SA 1X9MA 3RAXA 5KT4A 1WWUA 5AK4A 4NLZA 2KVSA 2KZ3A 3PO5A 4C4SA 1BNOA 2W43A 3N7SC 5AHXA 2BCVA 2W3SA 2A3VA 1KFDA 3NVWA 3UXNA 8ICHA 4PGXA 9ICOA 7ICRA 5J0RA 1QSSA 2GLEA 4RT2A 1JRPA 3RB0A 1KFSA 5H2FU 1A76A 2A19A 2XI9A 4IC9A 4B9UA 3RB6A 3PW5A 5DB6A 1TAUA 4Y2TA 4GFJA 2G5HB 5ALHA 4QZGA 9ICXA 1KQQA 1BPDA 4J9PA 4KN4A 5AM3A 1SL2A 4EBCA 3T3FA 3WKAA 3T5HA 3C1ZA 5AI0A 4RNNA 1QSLA 8ICQA 2A1AA 2EAOA 1X42A 3RJHA 4P0PA 3ZD8A 8ICLA 1X6JA 4DL2A 5CRXA 2DPJA 2LYAA 2AHOB 1V97A 2LYHA 1ZQHA 3QEBZ 4RQMA 3CNHA 2EQYA 3I1YA 2BCRA 3F2DA 2HVHA 4IR9A 3BS5A 3NRZA 2W9BA 2LHTA 2KHVA 2M9NA 3UMBA 3RH5A 4M9LA 5G5HA 3I28A 2WF9A 5J0UA 2PFOA 4YR0A 3PV8A 1SKSA 1RXVA 9ICSA 1ZRNA 1DGSA 8ICPA 4B9NA 4OCZA 1ZQQA 3E2EA 4OO1J 1Z1VA 3AU6A 4KITB 5AKYA 7ICHA 3PNCA 1OW5A 2OWOA 5KFGA 2IHMA 4QZFA 3OTQA 3MBYA 3MDAA 2J6TA 3ZDAA 3AQEA 4YMMA 1XO0A 5AI9A 3WK7A 4KLQA 4DSIA 3MFIA 3ICXA 1ECWA 2NYVA 5KFWA 3IP4B 2KJ5A 3RJJA 2JH7A 1X9WA 1OUQA 4WJ3B 3C21A 3ONNA 5ALYA 2HHVA 3HT3A 4EBDA 3V6KA 3AL0B 2CRXA 3NGDA 4C8MA 5AKJA 4K4IA 2LMRA 2FE9A 3GIJA 5KFFA 1N56A 1VDVA 4MFAA 5AICA 3SYZA 1S0NA 7ICQA 1TAQA 5HMMA 5AKZA 1K1QA 1D8LA 5EE9A 4NLCA 3JPTA 2ZIWA 3DDHA 3HRDD 5HR7A 4O0IA 2KNJA 5ALPA 4UARA 3SENA 2FPLA 2HOQA 2OXOA 1N5WA 2Y0SC 1FO4A 4F5PA 5KG5A 5ALUA 5G5GA 2KKVA 4JK1A 4YCXA 4EBEA 4NM2A 8ICMA 2G5IB 2KD1A 4F3OA 5KFSA 1GO3F 2HHQA 3EZ5A 1PZNA 1QLNA 2ZIWB 3OJSA 2KICA 4YQWA 4P4PA 4UB1A 4QW9A 1XSNA 4EYIB 1L3UA 1O03A 2B6GA 2V9WA 2NRVA 3TFRA 2W03A 5J8YA 1MA7A 4DS4A 3OPXA 5ALRA 5KFCA 8ICFA 4P4OA 2K4PA 3WK8A 8ICUA 1ZRMA 1UCVA 5EWGA 4M47A 3F5AA 4KLLA 4EYHB 2Q0ZX 2JZBB 3F2BA 2ZUCA 2P66A 2WAQC 4Q8EA 1T4GA 3ZI4A 4XQ8A 1RM6C 1ZQIA 4CF3A 1ZOLA 3SMVA 5CR0A 1TFRA 1XU4A 1JROA 2O6KA 3ED5A 2WAQF 3GILA 1MSWD 4I2GA 1WUDA 1NK7A 1ED1A 5IIIA 4EELA 3TAPA 5HMLA 1NK6A 2E3TA 5L1LA 2ZIXB 4KLSA 3KTQA 3BS7A 3H7IA 1S8OA 5TZVA 3UMGA 4Y2JA 3HX0A 5C0YA 2DF4B 3GFKB 1IM4A 4RUAA 1YZ6A 3PMNA 4KLEA 4MEYA 1ZQOA 2EDUA 9ICAA 3SAFA 4ED1A 5KFTA 2MAXA 5KFNA 5J2AA 2DFLA 3C1YA 1HUZA 5E79U 5AM2A 3ALRA 3NRWA 1RG6A 4J9MA 1PK3A 3RJKA 2KIVA 5KL1B 3ZD9A 1SL1A 2OEHA 1XC9A 3K1RB 5EWFA 3PSPA 5J0TA 2PI5A 1S0VA 2HHSA 2FMSA 2BPGA 4O5KA 2ESEA 2AH5A 1S5LU 5KFXA 5J8YC 3MR5A 5EOZA 5ALQA 3KKAA 2E8OA 5DLGA 2NV3A 4I29A 3ETLA 1SXDA 3VCBA 4RQNA 3ISCA 1PVPA 2FJ6A 3A0BU 4O3NA 5AK6A 4RT3A 1FIQA 1X6IA 5IINA 1S76D 4MHVA 8ICNA 2ZJ5A 5L1KA 4QIWC 2HHWA 3WK9A 2W11A 4Y2XA 2FMQA 4DL7A 2GOLA 1TK8A 1ZQVA 2KE7A 2UVRA 2UVWA 3B0XA 2ODGA 2WF7A 2JEGA 5ALJA 3UM9A 3C29A 2JXJA 1DRGA 4UAWA 1QQ6A 3SR6A 5B66U 4F4XA 2FPMA 2BCQA 5KG0A 3U26A 1QTMA 1TV9A 3ISBA 2DWQA 4LZDA 3WK5A 5DBAA 3MGHA 2JGAA 3RBEA 4O3QA 5A0LA 2Z7JA 5DKWA 2PI4A 4PGYA 4YXMA 4DFDA 4R8UA 3T5JA 3Q8SB 4XUSA 2JEJA 1L7PA 1MQ3A 4I2CA 8ICSA 4BGDA 2MUTB 5KG4A 4LJXA 3WKEA 3KBBA 3FYHA 5J0XA 4Q8FA 3HILA 4KN7A 7ICPA 1N5XA 2D8CA 1KBUA 5ALEA 4KLHA 3Q8QB 4OJPA 3UMCA 4F4YA 3D2SA 3Q8KA 4DSEA 2HW3A 5DG9A 2DUYA 2H3ZA 3RJGA 2F1HA 1QH9A 2G0AA 1X9XA 5KT5A 3QEAZ 4PHEA 8ICXA 4UAVA 3SI8A 1PK1B 1O08A 1C20A 5DDYA 3KKAC 2HCFA 3T79A 1MQ2A 4O3RA 4YR2A 4TUPA 4KLDA 9ICGA 5JRTA 1IXRA 5DLFA 1JMSA 1H38A 4ECSA 3KD3A 4B9LA 2RP5A 3JPSA 4PJ0U 4DFPA 3LK9A 4M9NA 2KEYA 2ZUBA 5AKKA 3PMLA 2AQ0A 2R8GA 4OJOA 2E1FA 5J0WA 3GV5B 4F50A 2M0NA 2QB0A 3H40A 1ZQLA 4NM1A 4ELVA 2KK0A 4JB3A 3C28A 3F2CA 2W8KA 2Y1JA 1ZD4A 2VA3A 2IOFA 2ZTCA 4F5QA 7ICUA 4ECUA 4M6WB 4Y2QA 4UB2A 5F9LA 5DG8A 3SAHA 4DQIA 2KG5A 2WFAA 1A77A 4TUQA 1HUOA 1UHUA 1WWVA 4B9VA 4EX6A 4Q43A 3C5GA 1ZD2P 4RQ2A 5J2EA 5AI4A 2WF6A 3K75D 2ALZA 2XCAA 1F44A 4UQGA 4KLOA 4CE6A 9ICPA 2RLTA 4ED7A 5DB7A 1KFTA 4DQQA 1NK9A 1ZD3A 1Z4OA 1BPXA 1ZQYA 2BHNA 2XC9A 2KFNA 4QZAA 4RQ8A 4USAA 1N62A 3CW2C 3K1ZA 2E8PA 3LVWA 4GXJA 1K5OA 5KFEA 5ALXA 4TQSA 3R9KA 4KTQA 4C7YA 4DO9A 1N48A 2NO5A 4CCHA 4X5VA 2P6UA 1Z00B 1Q3VA 1URJA 5DGAA 1KW4A 3UXPA 4Y2YA 4CDGA 3D6JA 2C2RA 4KLFA 1L3SA 5AM0A 1N63A 5GTHU 4JWNA 5AKXA 1TE2A 3IM1A 1NNLA 5KAIU 5J29A 3H0RB 4YMOA 5J2GA 4RU9A 2KP7A 1ZQEA 3BQ2A 4E0DA 4IQUA 2OHFA 1IG6A 4QZHA 4DF4A 2ES6A 5K4LA 8ICOA 3AEVA 1N60A 1IV8A 4RQ5A 3QUCA 1ZQTA 5HNKA 5CJ7A 4K4GA 1SKRA 1ZQDA 2ZIUA 5IIOA 4BJQA 1XO1A 2LBOA 3JPQA 2K8BB 2DBYA 1VLBA 3KHHA 4BWJA 1NJXA 5T14A 4J03A 4QJFB 3PX4A 5ALZA 2QLTA 9ICQA 5KFVA 3GIIA 3QNMA 2HBLA 2GWSA 2YB1A 3M9MB 2F77X 5AKLA 3BZCA 8ICZA 2ZIUB 3RH6A 3I76A 4ELTA 1C7YA 2OCEA 5KT3A 3SEIA 4IRCA 2LKYA 2KJ9A 4RPYA 1WCNA 2R8HA 5KFDA 4OD0A 4YVZA 3NVVA 4J9QA 7ICKA 3WU2U 9ICHA 4I2EA 3RB3A 4QZBA 3PR5B 3C2LA 2KIWA 5D46A 5J0YA 2PFPA 3ISDA 4ICAA 3Q8LA 3TI0A 1ZQUA 2F76X 3GQCA 1XSPA
chains in the Genus database with same CATH topology
2EZZA 2EZXA 1CI4A 2BZFA 2ODGA 1QCKA 2EZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZZ A;  2EZX A;  1CI4 A;  2BZF A;  2ODG A;  1QCK A;  2EZY A; 
#chains in the Genus database with same CATH topology
 4DSK A;  1BPZ A;  4IRD A;  4PZN A;  2D3D A;  2W9C B;  3HKZ F;  4YR3 A;  4DS5 A;  3BQ7 A;  1DOQ A;  4J9R A;  4JUZ A;  4US9 A;  1BGX T;  1HEK A;  1S10 A;  1ZQK A;  4FFD A;  5AI5 A;  3OSN A;  5AM5 A;  1SGG A;  3RH4 A;  1JX4 A;  2ZJ8 A;  3PW4 A;  1L5U A;  4ED0 A;  2XIC A;  3F53 A;  2JEF A;  3FAH A;  3RAQ A;  5IIK A;  1KTQ A;  2Y1I A;  2JRZ A;  9ICV A;  3L5K A;  3QUB A;  3WKB A;  2F3N A;  1XSL A;  4C80 A;  4NY8 A;  9ICK A;  3KZI U;  3NAS A;  4TQR A;  4EZ6 A;  2G06 A;  1RZT A;  2H3Q A;  1T3N A;  3NVY A;  3EPI A;  1JXL A;  1N61 A;  4GC6 A;  3GV8 B;  3IG5 A;  4QNL A;  5ALV A;  1N2X A;  3GU3 A;  3THV A;  7ICM A;  2ISO A;  1LKY B;  3H4B A;  2EAN A;  1MN8 A;  2H3I A;  4RQ6 A;  4YP3 A;  5J0Q A;  4FBU A;  5EWE A;  3PW0 A;  5J2D A;  4QWD A;  2FMP A;  5CB1 A;  4F2S A;  4NXZ A;  1TVA A;  3V72 A;  3NVZ A;  2KZZ A;  1ZQZ A;  2AJQ A;  2JZB A;  5ALF A;  3KHL A;  1PVR A;  2W9M A;  4DLE A;  4EZ9 A;  2LYB A;  3HW8 A;  4XA5 A;  8ICJ A;  1NJZ A;  3BZK A;  1NOM A;  3L3F X;  3SAG A;  5IIL A;  1L8O A;  5CHG A;  3IRU A;  5BOL A;  4OJL A;  1XNS A;  4IL6 U;  1F5S A;  1V85 A;  4ACO A;  4I2I A;  2F8L A;  7ICL A;  2FDR A;  4ECV A;  5CP2 A;  2B21 A;  5CEH A;  4R63 A;  2ZIX A;  2H5X A;  3JPO A;  4AYB F;  4DSL A;  9ICM A;  3Q8R B;  4GXI A;  5KG6 A;  3JPP A;  3TAQ A;  1HIW A;  1ARO P;  2BPF A;  2AXT U;  4IQV A;  3TAR A;  2P6R A;  2ZXH A;  4RQ7 A;  2Q4T A;  4YMN A;  3RBD A;  5CWR A;  1ZQN A;  2E8M A;  3C2M A;  4PZO A;  4US8 A;  4O3M A;  4KLU A;  4NLK A;  4C8N A;  9ICT A;  4UBB A;  4MF2 A;  4F4K A;  1B43 A;  5AKE A;  2JEI A;  2KJ8 A;  3H0L B;  9ICU A;  1ZQX A;  2E8N A;  2DKX A;  1L6N A;  3OHA A;  2R18 A;  1TK5 A;  3H8J A;  5TIS U;  3SQI A;  2K8C B;  5KTQ A;  3LDA A;  3UQ2 A;  2KOB A;  1COO A;  1Q46 A;  2K4I A;  4O3S A;  3OHB A;  4QWB A;  2WF8 A;  4UB4 A;  1YT3 A;  4BWM A;  5BPC A;  3RF9 A;  1T7P A;  1Q8K A;  1Z19 A;  1KL9 A;  4CNQ A;  2XCP A;  4ECQ A;  5EE1 A;  2C2D A;  2NRX A;  2YML A;  1DK2 A;  5AIB A;  2RHF A;  4YN4 A;  2PFQ A;  3MGI A;  4Q45 A;  2MSN A;  2E5S A;  3T5L A;  4QZD A;  2JH1 A;  5ALW A;  5JTI A;  3TQ1 A;  3V7L A;  2C28 A;  1X2I A;  5ALD A;  2BQU A;  5ALO A;  4PL2 A;  7ICT A;  3O0F A;  2FLL A;  2WB1 F;  4DFM A;  1U45 A;  3RJE A;  2LI6 A;  3C23 A;  1D9D A;  3MGV A;  1DXS A;  4ED3 A;  2YX8 A;  3N7P D;  1UT8 A;  3BDP A;  2JHD A;  5BOM A;  2VJ4 A;  1BPY A;  1KDH A;  2G07 A;  3UPQ A;  4M04 A;  4Y2P A;  2AGQ A;  1Z3E B;  2XID A;  1Y88 A;  3GZF A;  3MR3 A;  1JXE A;  2XVT A;  4DOB A;  3DEE A;  4TUS A;  2K4E A;  5KFR A;  4DL6 A;  2VAN A;  7ICN A;  1UA1 A;  3CYM A;  4G9B A;  1RYR A;  4K4H A;  3EYZ A;  5FP0 A;  1YZ7 A;  5D4B A;  2MUT A;  2F1J A;  4QZC A;  1V9P A;  1WG8 A;  2ZIV A;  4ZOH C;  2GO7 A;  4QZ9 A;  1SXE A;  3PZP A;  1KN5 A;  5AK5 A;  4UAU A;  2C2E A;  3WK6 A;  3A0H U;  2AGP A;  3B9J A;  8ICY A;  4O3P A;  2BQ3 A;  4QZE A;  2EAP A;  4YD2 A;  3V7J A;  3QUT A;  3M9N B;  1NZP A;  5AK3 A;  1ZET A;  5AI8 A;  1Z4N A;  5KG3 A;  4U7C A;  4M9J A;  1PK1 A;  4Y2V A;  2ZIV B;  3OSP A;  1SKW A;  2H3F A;  5KFZ A;  2VA8 A;  3N4M B;  7ICE A;  5KFP A;  3J81 j;  1T3Q A;  4CF4 A;  2FLN A;  4FZL A;  2YY6 A;  1ZQG A;  3BQT A;  2YMP A;  3HJE A;  1UPH A;  2BDP A;  2PMZ F;  2A1J B;  4JV0 A;  3KOO A;  4R65 A;  4Z6F A;  4DOC A;  3V6J A;  3HP6 A;  5KFQ A;  2UVU A;  1ZQA A;  4QZ8 A;  4GC7 A;  2Y9T A;  4MFF A;  4DL5 A;  8ICC A;  2R8I A;  1PVQ A;  2DGZ A;  2ASJ A;  3E58 A;  2OM6 A;  1XWL A;  1L3V A;  4FS1 A;  2HOF A;  3SD7 A;  4Z6E A;  4F91 B;  3H8M A;  3OJU A;  4JMU A;  2MU2 A;  5J2I A;  1RYU A;  7ICI A;  4M6W A;  3H4D A;  2R8J A;  3CRX A;  4P2H A;  2W8L A;  3AN1 A;  5F3X B;  4JV1 A;  2K4H A;  3GIK A;  4FBT A;  8ICE A;  1CI4 A;  3ORY A;  2VKQ A;  2IMW P;  4DLG A;  4F92 B;  4ECZ A;  1SZP A;  3MDC A;  5J2C A;  3SV3 A;  5HHH A;  1NZB A;  3WKD A;  3PY8 A;  1L7O A;  4P0Q B;  4F4W A;  3D2Q A;  3GDX A;  1U49 A;  4J9N A;  2MA1 A;  2LM4 A;  4ECW A;  2ATL A;  1RPL A;  4RNM A;  4ED8 A;  4LZG A;  2D6F C;  2EAM A;  1JUD A;  1NKB A;  4NV0 A;  4BUG A;  2CN1 A;  1KKX A;  5D49 A;  3Q8M A;  1JI7 A;  3TFS A;  5KT7 A;  3IN5 A;  1J2N A;  7ICO A;  5KNI A;  5KFA A;  2VA2 A;  4YD1 A;  2ZUD A;  2JV3 A;  5DBC A;  3RJF A;  4DSF A;  4CRX A;  1CUK A;  1SWV A;  1CRX A;  3N97 B;  1HJP A;  2YB4 A;  3QU5 A;  5KG1 A;  8ICB A;  1SB3 C;  1Z00 A;  2HSZ A;  4Y2R A;  4ELU A;  2LPE A;  3E0F A;  5J2F A;  2I1Q A;  5GTI U;  1WCL A;  1L3T A;  4RNO A;  2AGO A;  3M7D A;  1SWW A;  7ICF A;  2KSO B;  4PGQ A;  4UAT A;  2W55 A;  2RDI A;  3MR6 A;  3NS1 A;  3PSF A;  5J2H A;  4B9M A;  5KFI A;  3Q8P B;  5KFU A;  3N7R C;  4M2Y A;  1MC8 A;  5DB8 A;  2XO7 A;  4Z6D A;  4DFJ A;  3RB4 A;  1NI3 A;  2ASL A;  1T8E A;  4R64 A;  4QWE A;  4C8O A;  2L5Y A;  2JMG A;  1DK3 A;  7ICV A;  4NLB A;  4M9G A;  4KLI A;  3PSI A;  3TKA A;  4BXO B;  2K89 A;  3LYS A;  3PVX A;  3QU4 A;  3QX7 A;  4F5O A;  3QU7 A;  2BCU A;  2RRD A;  4DFK A;  8ICG A;  1SL0 A;  1F0M A;  2PKE A;  2I9G A;  2NRZ A;  4I2J A;  3VC8 A;  2ZXI A;  4DQP A;  4YXJ A;  2C22 A;  3G6X A;  1X40 A;  1ZQ1 C;  5DGB A;  1L7N A;  1K1S A;  7ICG A;  2G09 A;  3IDW A;  4I2F A;  2XY7 A;  4XRH A;  4EEN A;  3IG8 A;  3QZ8 A;  3AU2 A;  2OYY A;  5HR6 A;  3TAD A;  4NJ8 A;  1KLN A;  3ZDE A;  4RZR A;  9ICW A;  2GH1 A;  9ICC A;  1D9F A;  1QQ5 A;  5DBB A;  8ICR A;  2IOF K;  4PHD A;  3QE9 Y;  3IV6 A;  2EZY A;  5KFK A;  4J9K A;  2VJ5 A;  4KLT A;  2H3V A;  4UAY A;  9ICI A;  3TAC B;  2W9C A;  5L1J A;  5AKI A;  3RRH A;  4JWM A;  4DSJ A;  1FFU A;  4F93 B;  5ALN A;  1ZQB A;  3FDS A;  5CA7 A;  5ALK A;  1JAL A;  4GIB A;  2DKZ A;  4ED2 A;  3HKZ C;  1PUZ A;  2W3R A;  3DV9 A;  2F1I A;  1B4F A;  3M6K A;  1NK4 A;  3G6V A;  4P0P B;  2NO4 A;  3SZ2 A;  5DQG A;  4OJ5 A;  4C8L A;  5EE3 A;  5DQH A;  4QWC A;  1U9L A;  2BZF A;  4PHA A;  3EPG A;  1P7D A;  4DL4 A;  4FZN A;  1Z1B A;  1ZJN A;  1CEZ A;  2PFN A;  2PXI A;  5L9X A;  5KAF U;  2NRT A;  2HDO A;  2R8K A;  5KFJ A;  3MFH A;  1UQV A;  3RFA A;  2HBM A;  3RR8 A;  3ZDD A;  3NTU A;  3BS5 B;  5ALI A;  4FZM A;  2W9B B;  1NJW A;  4FS2 A;  3G6Y A;  5KFH A;  4M9H A;  4F72 A;  4B9T A;  1BNP A;  2W54 A;  1LKY A;  2AU0 A;  2K8A A;  3MAB A;  2WF5 A;  4O5E A;  2G08 A;  2BGW A;  4Z6C A;  4KMO B;  4QW8 A;  2W7O A;  3BJY A;  1FFV A;  1TKD A;  3TAD C;  1EXN A;  3PO4 A;  4DCC A;  2J6S A;  2ZTD A;  4KX5 A;  5EE0 A;  2J6U A;  3AQF A;  3MC1 A;  4YG2 A;  3QZ7 A;  1J97 A;  4RQ1 A;  5J0S A;  3C5F A;  2XGQ A;  8ICW A;  1S0M A;  4UBC A;  3QU9 A;  2F8K A;  1T94 A;  1RQN A;  3BQ1 A;  3GIM A;  3EWA A;  3S6J A;  4JV2 A;  4UAZ A;  3ZDB A;  4IQT A;  4MF8 A;  3ETR A;  9ICR A;  2UVV A;  2E1E A;  2I6X A;  5JU5 A;  2V4Q A;  1LVH A;  5KFL A;  4Y2S A;  1NKE A;  1NK5 A;  2QAR A;  4C0Z A;  4PH5 A;  2JR5 A;  1U47 A;  4I2H A;  1KSP A;  2Y0S F;  1BPE A;  9ICE A;  3H8S A;  4R66 A;  2F44 A;  4AYB C;  5C5J A;  3HWT A;  3GV7 B;  2HBK A;  1S0O A;  4IS7 A;  2ZG6 A;  4O9M A;  4NL9 A;  3UXO A;  5AM4 A;  5F9N A;  4IQW A;  1LB2 B;  4LVS A;  4FO6 A;  3K4G A;  5HP4 A;  3AUO A;  1V38 A;  5AM1 A;  2HHX A;  1B22 A;  4NWI A;  2KN7 A;  2HOI A;  2QAR B;  3M6Z A;  5KT6 A;  2W04 A;  2KHQ A;  4UW9 A;  4DWI A;  4UB5 A;  2VIX A;  5L1I A;  1A6S A;  1RDF A;  4GLX A;  4PPX A;  5J0O A;  1NKC A;  4M0A A;  4Y2U A;  5IIM A;  2ZJA A;  4MFC A;  2YN4 A;  4UAS A;  2NRW A;  2KFZ A;  4MEX A;  3N28 A;  5KL8 B;  5AKH A;  1QSY A;  4KLJ A;  3H0M B;  2Y9U A;  1M6Y A;  3PX0 A;  5J2B A;  5KFY A;  5IIJ A;  1JN3 A;  3D2N A;  4F71 A;  2ASD A;  9ICL A;  8ICA A;  4P4M A;  8ICV A;  2BQR A;  2OH2 A;  2YTU A;  1KRP A;  2QB1 A;  4UB6 U;  5L1M A;  2B0C A;  2FI1 A;  3CP8 A;  3EUB 2;  2W7P A;  1SZH A;  5KFO A;  2V4R A;  2HBJ A;  3C2K A;  5KG7 A;  1L7M A;  8ICI A;  2KVC A;  3IHQ B;  9ICF A;  1J2M A;  4CGZ A;  5J2K A;  4KMU A;  1ZQJ A;  2FPK A;  4ECR A;  2AQ4 A;  1S77 D;  1FEZ A;  2YQE A;  3LVV A;  5KG2 A;  1SV4 A;  4UB8 U;  2CXY A;  3V7K A;  4KLG A;  3H8W A;  4DQR A;  4O5C A;  1ZQM A;  2WB1 C;  2BKE A;  2BDU A;  2DL0 A;  1D8B A;  2IBK A;  5ALL A;  4PHP A;  2K60 A;  1U48 A;  3RJI A;  4NL9 C;  2EZX A;  5KFM A;  4RPZ A;  1KEJ A;  1UA0 A;  4EEY A;  4OJ6 A;  2EZZ A;  1VJ5 A;  4C7Z A;  9ICN A;  2DPI A;  7ICJ A;  4QWA A;  3M8S A;  1JIH A;  3RR7 A;  2FLP A;  9ICJ A;  4AP9 A;  5KT2 A;  1ZXI A;  1B0X A;  4I2D A;  1NJY A;  4I2B A;  1ZD5 A;  4KX3 A;  2BPC A;  3PW2 A;  3MR2 A;  3QU2 A;  3FM9 A;  8ICT A;  1SV0 A;  3JPN A;  5J2J A;  4I28 A;  4DQS A;  1XS9 D;  4BX9 C;  3M8R A;  3RTV A;  1RYS A;  1NK0 A;  4QIW F;  5KFB A;  4EX7 A;  2IHN A;  3PST A;  4C8K A;  4F8R A;  4RQ4 A;  1QCK A;  2ISP A;  2A1J A;  3F5E A;  4YFK A;  2MRL A;  5AIA A;  1RQL A;  4F5N A;  2KKP A;  3WKC A;  4QZI A;  1BPB A;  2ZTE A;  3EW9 A;  2PMZ C;  2IA6 A;  5J0P A;  2WTF A;  4U6P A;  2KZM A;  4G3I A;  4BDP A;  1TAM A;  9ICB A;  3KHR A;  4ED6 A;  4GXK A;  2HHT A;  3BQ0 A;  2BR0 A;  4J9S A;  4NLN A;  2WHE A;  4ECY A;  2W9A A;  4ZH4 A;  5DG7 A;  2EH9 A;  1AQ6 A;  1L8L A;  3FC4 A;  1IIP A;  4O3O A;  7ICS A;  4A8E A;  4B9S A;  4R8U B;  4C4T A;  4DEZ A;  1A0P A;  2XY6 A;  3WK4 A;  3M9O B;  4P0Q A;  2F2A B;  4EEK A;  4RQ3 A;  4F4Z A;  5AKG A;  3SV4 A;  1TK0 A;  1DGJ A;  1OXJ A;  3AMZ A;  3TAN A;  3NUQ A;  1S97 A;  4DL3 A;  4FE3 A;  4DOA A;  4F2R A;  4J9L A;  4RPX A;  3KZX A;  2I5H A;  1BVS A;  5B5E U;  4HYK A;  1ZQW A;  4B6J A;  1ZQC A;  4RUC A;  5HHI A;  3PW7 A;  1ZQS A;  1LV5 A;  5DDM A;  5DB9 A;  1SV0 C;  3M1Y A;  3QYP A;  2YMQ A;  4RQ0 A;  3KHG A;  2KMD A;  3UQ0 A;  4CF5 A;  3LWM A;  1ZQF A;  4TUR A;  5AI6 A;  1SIJ A;  3JPR A;  3PR4 A;  3LWL A;  3HPO A;  2HMX A;  4PL1 A;  2XGP A;  4I2A A;  1ZYQ A;  1NK8 A;  1WYG A;  4KLM A;  2KSO A;  3ZDC A;  5ALG A;  2LM1 A;  5ALM A;  3PX6 A;  1UT5 A;  4F5R A;  4J9O A;  3AM9 A;  3V6H A;  2QB0 B;  3L4P A;  4DF8 A;  3KFU F;  2RDJ A;  4C4R A;  2CPR A;  1ZQP A;  4HAI A;  1X66 A;  2KTQ A;  4Q44 A;  1ZQR A;  1U4B A;  3B0Y A;  4IRK A;  5JUM A;  3RRG A;  2HHU A;  1ZJM A;  2N1R A;  1Q3U A;  2HI0 A;  2IOH A;  1QQ7 A;  4ECT A;  4NLG A;  2KV2 A;  2YMM A;  4BXO A;  4I27 A;  2BCS A;  3T5K A;  3QXG A;  4ECX A;  5ALT A;  8ICK A;  2HVI A;  3QUQ A;  2XY5 A;  4IR1 A;  2RQ5 A;  1RXW A;  1D8Y A;  2DQN B;  2QKQ A;  3OGU A;  5DQI A;  5ALS A;  1S9F A;  1COK A;  2P35 A;  4UB3 A;  1X9S A;  1X9M A;  3RAX A;  5KT4 A;  1WWU A;  5AK4 A;  4NLZ A;  2KVS A;  2KZ3 A;  3PO5 A;  4C4S A;  1BNO A;  2W43 A;  3N7S C;  5AHX A;  2BCV A;  2W3S A;  2A3V A;  1KFD A;  3NVW A;  3UXN A;  8ICH A;  4PGX A;  9ICO A;  7ICR A;  5J0R A;  1QSS A;  2GLE A;  4RT2 A;  1JRP A;  3RB0 A;  1KFS A;  5H2F U;  1A76 A;  2A19 A;  2XI9 A;  4IC9 A;  4B9U A;  3RB6 A;  3PW5 A;  5DB6 A;  1TAU A;  4Y2T A;  4GFJ A;  2G5H B;  5ALH A;  4QZG A;  9ICX A;  1KQQ A;  1BPD A;  4J9P A;  4KN4 A;  5AM3 A;  1SL2 A;  4EBC A;  3T3F A;  3WKA A;  3T5H A;  3C1Z A;  5AI0 A;  4RNN A;  1QSL A;  8ICQ A;  2A1A A;  2EAO A;  1X42 A;  3RJH A;  4P0P A;  3ZD8 A;  8ICL A;  1X6J A;  4DL2 A;  5CRX A;  2DPJ A;  2LYA A;  2AHO B;  1V97 A;  2LYH A;  1ZQH A;  3QEB Z;  4RQM A;  3CNH A;  2EQY A;  3I1Y A;  2BCR A;  3F2D A;  2HVH A;  4IR9 A;  3BS5 A;  3NRZ A;  2W9B A;  2LHT A;  2KHV A;  2M9N A;  3UMB A;  3RH5 A;  4M9L A;  5G5H A;  3I28 A;  2WF9 A;  5J0U A;  2PFO A;  4YR0 A;  3PV8 A;  1SKS A;  1RXV A;  9ICS A;  1ZRN A;  1DGS A;  8ICP A;  4B9N A;  4OCZ A;  1ZQQ A;  3E2E A;  4OO1 J;  1Z1V A;  3AU6 A;  4KIT B;  5AKY A;  7ICH A;  3PNC A;  1OW5 A;  2OWO A;  5KFG A;  2IHM A;  4QZF A;  3OTQ A;  3MBY A;  3MDA A;  2J6T A;  3ZDA A;  3AQE A;  4YMM A;  1XO0 A;  5AI9 A;  3WK7 A;  4KLQ A;  4DSI A;  3MFI A;  3ICX A;  1ECW A;  2NYV A;  5KFW A;  3IP4 B;  2KJ5 A;  3RJJ A;  2JH7 A;  1X9W A;  1OUQ A;  4WJ3 B;  3C21 A;  3ONN A;  5ALY A;  2HHV A;  3HT3 A;  4EBD A;  3V6K A;  3AL0 B;  2CRX A;  3NGD A;  4C8M A;  5AKJ A;  4K4I A;  2LMR A;  2FE9 A;  3GIJ A;  5KFF A;  1N56 A;  1VDV A;  4MFA A;  5AIC A;  3SYZ A;  1S0N A;  7ICQ A;  1TAQ A;  5HMM A;  5AKZ A;  1K1Q A;  1D8L A;  5EE9 A;  4NLC A;  3JPT A;  2ZIW A;  3DDH A;  3HRD D;  5HR7 A;  4O0I A;  2KNJ A;  5ALP A;  4UAR A;  3SEN A;  2FPL A;  2HOQ A;  2OXO A;  1N5W A;  2Y0S C;  1FO4 A;  4F5P A;  5KG5 A;  5ALU A;  5G5G A;  2KKV A;  4JK1 A;  4YCX A;  4EBE A;  4NM2 A;  8ICM A;  2G5I B;  2KD1 A;  4F3O A;  5KFS A;  1GO3 F;  2HHQ A;  3EZ5 A;  1PZN A;  1QLN A;  2ZIW B;  3OJS A;  2KIC A;  4YQW A;  4P4P A;  4UB1 A;  4QW9 A;  1XSN A;  4EYI B;  1L3U A;  1O03 A;  2B6G A;  2V9W A;  2NRV A;  3TFR A;  2W03 A;  5J8Y A;  1MA7 A;  4DS4 A;  3OPX A;  5ALR A;  5KFC A;  8ICF A;  4P4O A;  2K4P A;  3WK8 A;  8ICU A;  1ZRM A;  1UCV A;  5EWG A;  4M47 A;  3F5A A;  4KLL A;  4EYH B;  2Q0Z X;  2JZB B;  3F2B A;  2ZUC A;  2P66 A;  2WAQ C;  4Q8E A;  1T4G A;  3ZI4 A;  4XQ8 A;  1RM6 C;  1ZQI A;  4CF3 A;  1ZOL A;  3SMV A;  5CR0 A;  1TFR A;  1XU4 A;  1JRO A;  2O6K A;  3ED5 A;  2WAQ F;  3GIL A;  1MSW D;  4I2G A;  1WUD A;  1NK7 A;  1ED1 A;  5III A;  4EEL A;  3TAP A;  5HML A;  1NK6 A;  2E3T A;  5L1L A;  2ZIX B;  4KLS A;  3KTQ A;  3BS7 A;  3H7I A;  1S8O A;  5TZV A;  3UMG A;  4Y2J A;  3HX0 A;  5C0Y A;  2DF4 B;  3GFK B;  1IM4 A;  4RUA A;  1YZ6 A;  3PMN A;  4KLE A;  4MEY A;  1ZQO A;  2EDU A;  9ICA A;  3SAF A;  4ED1 A;  5KFT A;  2MAX A;  5KFN A;  5J2A A;  2DFL A;  3C1Y A;  1HUZ A;  5E79 U;  5AM2 A;  3ALR A;  3NRW A;  1RG6 A;  4J9M A;  1PK3 A;  3RJK A;  2KIV A;  5KL1 B;  3ZD9 A;  1SL1 A;  2OEH A;  1XC9 A;  3K1R B;  5EWF A;  3PSP A;  5J0T A;  2PI5 A;  1S0V A;  2HHS A;  2FMS A;  2BPG A;  4O5K A;  2ESE A;  2AH5 A;  1S5L U;  5KFX A;  5J8Y C;  3MR5 A;  5EOZ A;  5ALQ A;  3KKA A;  2E8O A;  5DLG A;  2NV3 A;  4I29 A;  3ETL A;  1SXD A;  3VCB A;  4RQN A;  3ISC A;  1PVP A;  2FJ6 A;  3A0B U;  4O3N A;  5AK6 A;  4RT3 A;  1FIQ A;  1X6I A;  5IIN A;  1S76 D;  4MHV A;  8ICN A;  2ZJ5 A;  5L1K A;  4QIW C;  2HHW A;  3WK9 A;  2W11 A;  4Y2X A;  2FMQ A;  4DL7 A;  2GOL A;  1TK8 A;  1ZQV A;  2KE7 A;  2UVR A;  2UVW A;  3B0X A;  2ODG A;  2WF7 A;  2JEG A;  5ALJ A;  3UM9 A;  3C29 A;  2JXJ A;  1DRG A;  4UAW A;  1QQ6 A;  3SR6 A;  5B66 U;  4F4X A;  2FPM A;  2BCQ A;  5KG0 A;  3U26 A;  1QTM A;  1TV9 A;  3ISB A;  2DWQ A;  4LZD A;  3WK5 A;  5DBA A;  3MGH A;  2JGA A;  3RBE A;  4O3Q A;  5A0L A;  2Z7J A;  5DKW A;  2PI4 A;  4PGY A;  4YXM A;  4DFD A;  4R8U A;  3T5J A;  3Q8S B;  4XUS A;  2JEJ A;  1L7P A;  1MQ3 A;  4I2C A;  8ICS A;  4BGD A;  2MUT B;  5KG4 A;  4LJX A;  3WKE A;  3KBB A;  3FYH A;  5J0X A;  4Q8F A;  3HIL A;  4KN7 A;  7ICP A;  1N5X A;  2D8C A;  1KBU A;  5ALE A;  4KLH A;  3Q8Q B;  4OJP A;  3UMC A;  4F4Y A;  3D2S A;  3Q8K A;  4DSE A;  2HW3 A;  5DG9 A;  2DUY A;  2H3Z A;  3RJG A;  2F1H A;  1QH9 A;  2G0A A;  1X9X A;  5KT5 A;  3QEA Z;  4PHE A;  8ICX A;  4UAV A;  3SI8 A;  1PK1 B;  1O08 A;  1C20 A;  5DDY A;  3KKA C;  2HCF A;  3T79 A;  1MQ2 A;  4O3R A;  4YR2 A;  4TUP A;  4KLD A;  9ICG A;  5JRT A;  1IXR A;  5DLF A;  1JMS A;  1H38 A;  4ECS A;  3KD3 A;  4B9L A;  2RP5 A;  3JPS A;  4PJ0 U;  4DFP A;  3LK9 A;  4M9N A;  2KEY A;  2ZUB A;  5AKK A;  3PML A;  2AQ0 A;  2R8G A;  4OJO A;  2E1F A;  5J0W A;  3GV5 B;  4F50 A;  2M0N A;  2QB0 A;  3H40 A;  1ZQL A;  4NM1 A;  4ELV A;  2KK0 A;  4JB3 A;  3C28 A;  3F2C A;  2W8K A;  2Y1J A;  1ZD4 A;  2VA3 A;  2IOF A;  2ZTC A;  4F5Q A;  7ICU A;  4ECU A;  4M6W B;  4Y2Q A;  4UB2 A;  5F9L A;  5DG8 A;  3SAH A;  4DQI A;  2KG5 A;  2WFA A;  1A77 A;  4TUQ A;  1HUO A;  1UHU A;  1WWV A;  4B9V A;  4EX6 A;  4Q43 A;  3C5G A;  1ZD2 P;  4RQ2 A;  5J2E A;  5AI4 A;  2WF6 A;  3K75 D;  2ALZ A;  2XCA A;  1F44 A;  4UQG A;  4KLO A;  4CE6 A;  9ICP A;  2RLT A;  4ED7 A;  5DB7 A;  1KFT A;  4DQQ A;  1NK9 A;  1ZD3 A;  1Z4O A;  1BPX A;  1ZQY A;  2BHN A;  2XC9 A;  2KFN A;  4QZA A;  4RQ8 A;  4USA A;  1N62 A;  3CW2 C;  3K1Z A;  2E8P A;  3LVW A;  4GXJ A;  1K5O A;  5KFE A;  5ALX A;  4TQS A;  3R9K A;  4KTQ A;  4C7Y A;  4DO9 A;  1N48 A;  2NO5 A;  4CCH A;  4X5V A;  2P6U A;  1Z00 B;  1Q3V A;  1URJ A;  5DGA A;  1KW4 A;  3UXP A;  4Y2Y A;  4CDG A;  3D6J A;  2C2R A;  4KLF A;  1L3S A;  5AM0 A;  1N63 A;  5GTH U;  4JWN A;  5AKX A;  1TE2 A;  3IM1 A;  1NNL A;  5KAI U;  5J29 A;  3H0R B;  4YMO A;  5J2G A;  4RU9 A;  2KP7 A;  1ZQE A;  3BQ2 A;  4E0D A;  4IQU A;  2OHF A;  1IG6 A;  4QZH A;  4DF4 A;  2ES6 A;  5K4L A;  8ICO A;  3AEV A;  1N60 A;  1IV8 A;  4RQ5 A;  3QUC A;  1ZQT A;  5HNK A;  5CJ7 A;  4K4G A;  1SKR A;  1ZQD A;  2ZIU A;  5IIO A;  4BJQ A;  1XO1 A;  2LBO A;  3JPQ A;  2K8B B;  2DBY A;  1VLB A;  3KHH A;  4BWJ A;  1NJX A;  5T14 A;  4J03 A;  4QJF B;  3PX4 A;  5ALZ A;  2QLT A;  9ICQ A;  5KFV A;  3GII A;  3QNM A;  2HBL A;  2GWS A;  2YB1 A;  3M9M B;  2F77 X;  5AKL A;  3BZC A;  8ICZ A;  2ZIU B;  3RH6 A;  3I76 A;  4ELT A;  1C7Y A;  2OCE A;  5KT3 A;  3SEI A;  4IRC A;  2LKY A;  2KJ9 A;  4RPY A;  1WCN A;  2R8H A;  5KFD A;  4OD0 A;  4YVZ A;  3NVV A;  4J9Q A;  7ICK A;  3WU2 U;  9ICH A;  4I2E A;  3RB3 A;  4QZB A;  3PR5 B;  3C2L A;  2KIW A;  5D46 A;  5J0Y A;  2PFP A;  3ISD A;  4ICA A;  3Q8L A;  3TI0 A;  1ZQU A;  2F76 X;  3GQC A;  1XSP A; 
#chains in the Genus database with same CATH homology
 2EZZ A;  2EZX A;  1CI4 A;  2BZF A;  2ODG A;  1QCK A;  2EZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...