2EZYA

Solution structure of human barrier-to-autointegration factor baf, nmr, ensemble of 20 simulated annealing structures
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
89
structure length
89
Chain Sequence
MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the cellular factor BAF responsible for protecting retroviral DNA from autointegration.
pubmed doi rcsb
molecule keywords BARRIER-TO-AUTOINTEGRATION FACTOR
molecule tags Dna binding protein
source organism Homo sapiens
total genus 28
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02961 BAF Barrier to autointegration factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.40 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Barrier-to-autointegration factor, BAF 2ezyA00
2EZYA 1CI4A 1QCKA 2ODGA 2EZXA 2EZZA 2BZFA
chains in the Genus database with same CATH superfamily
5J2EA 2IOHA 2W11A 2AQ4A 3LVVA 3V6JA 3H8MA 8ICLA 3G6YA 1BPDA 2YB1A 1UPHA 4OJOA 2I6XA 4Q8EA 3E58A 4MFCA 5BOMA 1F5SA 1CUKA 5EE1A 3OTQA 3RJKA 2RHFA 4ZOHC 3T5HA 4NL9A 3H8WA 2UVUA 5AKXA 2XCPA 3ZDBA 2KV2A 1Z00A 5T14A 4O3OA 4BDPA 1TFRA 2AHOB 2DFLA 1D8BA 2KZMA 4M2YA 2A19A 4IR1A 2ASJA 1NK9A 1S76D 9ICJA 2E3TA 4YD1A 4FE3A 1ZRMA 3N28A 5AM1A 5J2GA 5HMMA 2KFNA 1K1SA 2ZIWA 3TFSA 2P6UA 1PK1B 4QZGA 4KN7A 3JPRA 7ICMA 4I2EA 4M9LA 1KTQA 5K4LA 3RB6A 1B43A 4PL1A 3GV8B 3MR5A 1OUQA 5AKHA 3QZ7A 2F8KA 3SEIA 4ECTA 4F5NA 2HBJA 2XI9A 3V72A 1ZQUA 1C7YA 9ICCA 2CN1A 3PX0A 1TE2A 2HVHA 4JB3A 4C8KA 4Q45A 1S77D 1IXRA 1N2XA 4CNQA 1X40A 5ALLA 3HX0A 8ICOA 1KEJA 4CCHA 3ICXA 4DFKA 2WF5A 5AM4A 4YD2A 2F1HA 3RJHA 3ZI4A 1WYGA 5KFZA 9ICMA 5J0XA 1L8LA 4UAYA 2NRXA 4BWMA 5JUMA 1UQVA 4PL2A 5KTQA 2BDUA 4IL6U 9ICRA 1IIPA 1N5XA 2HDOA 2JHDA 4OJPA 1KKXA 4US9A 4EEYA 5DG9A 4ECUA 5DB7A 1WCLA 3QYPA 2KN7A 4EBCA 2KHQA 4Y2SA 2E5SA 3UMBA 4J03A 3EZ5A 5AI5A 4TUQA 2VANA 2QLTA 5HP4A 2C22A 9ICQA 2W8KA 2YMPA 3KBBA 1ZQIA 5J0TA 2GWSA 4YP3A 3TANA 2IHNA 9ICHA 4Y2QA 4CF4A 1V38A 3RJJA 1X9MA 5EE0A 3PSTA 4UW9A 2DF4B 5DDMA 1LKYA 4Q43A 4PGYA 3V6KA 3M9NB 2K4PA 2FI1A 4F4XA 4BWJA 3T5KA 3UXOA 2NO5A 3CYMA 1UHUA 1ZD4A 1WWVA 3RJIA 3QEBZ 2VA8A 1S0VA 1U4BA 5J2FA 1MA7A 2KZZA 4GXIA 2IMWP 2P35A 4UBCA 4I2BA 1MN8A 1ZQ1C 4O3SA 4DCCA 3M8SA 1N60A 1OW5A 2BPFA 4QIWC 5KFDA 2W43A 3MDCA 3E2EA 2PXIA 1T3NA 9ICGA 9ICLA 4FZLA 4RT3A 4YQWA 2W9MA 5KL1B 3ED5A 2IA6A 2K89A 3JPOA 4CGZA 4MEYA 1TK8A 4UB8U 1DXSA 3BQ7A 4HAIA 3C21A 9ICIA 4BX9C 3LK9A 2F1IA 4YR0A 2LM1A 3RB4A 1ZQJA 5KFLA 1DGSA 1ZOLA 5IINA 3EWAA 4F71A 4F4YA 4TUSA 5CEHA 2LI6A 2ZTEA 3TADC 1LVHA 3AQEA 2OH2A 1A76A 2A1AA 2AQ0A 5FP0A 4XRHA 1LB2B 4I2DA 3KFUF 4QZEA 1EXNA 4DSIA 1A0PA 4RQ2A 4CDGA 3IM1A 3NRWA 3RJGA 4ELVA 3BZCA 2KD1A 5HR7A 1COKA 4BXOB 3M6ZA 4ECVA 4O0IA 5ALNA 2A1JB 2UVWA 2ZIXB 3QEAZ 2BZFA 1DGJA 7ICVA 4RQ1A 5KT6A 4OJ5A 2B21A 2EANA 3SYZA 3HILA 2YQEA 2HHVA 4NXZA 1XSNA 2EDUA 5J2CA 3HKZC 1UCVA 4WJ3B 4I27A 4QZHA 2JRZA 3OHBA 4E0DA 5DBBA 4XUSA 2NV3A 4B9NA 1SWWA 2G06A 4MF8A 4QZ9A 2FPKA 2W55A 5DLFA 4DSKA 4QWCA 4Q8FA 4DWIA 5CJ7A 1X6JA 1CI4A 3V7KA 4OD0A 1VJ5A 3D2QA 3DDHA 4NLCA 1WCNA 4QZAA 2KJ8A 5DB6A 4PHDA 2YN4A 3IN5A 1ZD2P 2FJ6A 1Q3VA 4YMOA 1RYRA 1SV0A 2KZ3A 3SV3A 3GIMA 2UVRA 9ICBA 1XNSA 7ICHA 3NGDA 8ICGA 2HBKA 4P4MA 3SMVA 4M9HA 2Y0SF 2E8NA 1V97A 4I2IA 3RF9A 4YMNA 5ALMA 7ICGA 5ALSA 5EOZA 2R8KA 2RDJA 5KG1A 2ZTCA 7ICPA 1L3SA 4I2CA 2VA3A 3IDWA 2ZTDA 5J0PA 1DK2A 1QLNA 4P0PB 4KLQA 1N63A 4PGXA 5DGAA 4KN4A 4USAA 2FMSA 5A0LA 2HOIA 4C4TA 3MC1A 5JRTA 2KG5A 2M0NA 1JIHA 3K1RB 2D8CA 2LBOA 8ICCA 2KP7A 1BPZA 4KLEA 3SENA 2KOBA 3QUQA 3RH6A 4IC9A 3G6XA 2PFOA 2IOFA 3NUQA 5CWRA 5DQGA 5KT3A 3RH5A 1PK1A 3HKZF 5J2KA 3TI0A 2FPLA 3TADA 3S6JA 3QX7A 4GIBA 2HSZA 2ZIVA 1L6NA 2R8HA 4JV1A 3D2SA 5L9XA 1MQ2A 4DQQA 3T79A 2FE9A 2YY6A 2Z7JA 1S9FA 3QUBA 4TQSA 3M8RA 5KFAA 3BQ2A 4R65A 4Z6CA 4QW8A 3KHHA 2I9GA 2FDRA 3TQ1A 1V85A 1Z1VA 2KEYA 2K8AA 4EZ9A 5AK4A 3EPIA 5L1KA 4Y2JA 3NS1A 2HVIA 4US8A 4O3NA 2C2EA 4B9SA 1SKWA 2J6UA 2KTQA 1S0MA 2E8OA 4J9SA 7ICSA 1HIWA 3BQTA 5DB9A 3I1YA 1VLBA 3ZD8A 2W7OA 3ISBA 2L5YA 5KT5A 3F5AA 3JPNA 8ICSA 1SL2A 1QQ7A 5KL8B 4QZDA 3ORYA 7ICJA 1Z3EB 4FBTA 2W9AA 2I5HA 1NK7A 3THVA 2VIXA 2WHEA 4C8LA 3KOOA 1O08A 2PFQA 1WG8A 1KBUA 2KVSA 3M6KA 3NRZA 3OGUA 5KG5A 4QNLA 8ICTA 2JEJA 4O3RA 1L7OA 4DQSA 5GTIU 3C29A 3IHQB 4DFDA 4ED2A 2IHMA 3ALRA 2DKZA 4U7CA 2GO7A 3E0FA 2NO4A 3GV7B 5CP2A 5L1JA 1BNPA 1N48A 1HUZA 2E8MA 4F8RA 2H3QA 1S10A 1A6SA 1IV8A 4ECXA 2HHTA 4ED1A 1CRXA 4C4RA 4G3IA 3MBYA 2HBLA 1B4FA 2LPEA 1TAQA 1ZQQA 4B9LA 1NNLA 3VC8A 8ICFA 5KFCA 1PVPA 2GH1A 5CHGA 4ELUA 5KFJA 4KLHA 2KSOB 2HOFA 1QSLA 2CRXA 4KLFA 3PR5B 3UM9A 3SV4A 3OJUA 9ICNA 2BQUA 4MFAA 4RPZA 1MQ3A 3PW7A 4RNNA 4Y2TA 1KLNA 1NK0A 2JR5A 3PW2A 3H4DA 4JWMA 3ONNA 1RXWA 3KHLA 2K4EA 4M04A 1SIJA 2MUTB 1P7DA 2W9CB 4K4GA 5ALKA 2PFNA 2G07A 7ICRA 4KMUA 2OM6A 1QQ5A 3EPGA 2JXJA 3NVZA 2JGAA 4KLMA 4BXOA 2A1JA 1RG6A 2ZIXA 4DLEA 4F4KA 5KFOA 4K4IA 3H7IA 2Y1JA 1Z4OA 3PO5A 3LWLA 5D46A 3Q8KA 3TFRA 3ZDCA 2V4RA 3K75D 3BJYA 3I28A 4DEZA 2BCRA 5ALXA 3J81j 2KHVA 1QCKA 2G0AA 2C2RA 3HT3A 1TVAA 4P0QB 3V7LA 2DBYA 2HMXA 4BJQA 2VKQA 3TACB 2R18A 5DQIA 2NRWA 5G5GA 4RQ4A 8ICKA 2OXOA 4JV0A 5L1LA 1O03A 1F0MA 4UARA 4Y2PA 2MRLA 2OCEA 5KAIU 4KLIA 2MAXA 3L5KA 2V9WA 4KX5A 1PK3A 2DUYA 3KD3A 4R66A 1HJPA 2XGQA 3IP4B 3ZDEA 3CW2C 4IQTA 3FYHA 1ZQRA 3IV6A 5J29A 5ALEA 2BCQA 3QZ8A 2HHSA 3UQ0A 4GC7A 4EBDA 2UVVA 2ODGA 1QH9A 1YZ6A 3CRXA 1SKRA 5C0YA 8ICXA 2JH1A 4Y2VA 4ELTA 2WFAA 4QZBA 3QU9A 1TAMA 4UASA 4DL2A 4DFJA 9ICOA 2EZXA 2EZYA 4C80A 3H8SA 2ZUDA 2G5HB 1KFSA 5DBCA 2QB0A 4YXMA 2EH9A 3C1ZA 1KW4A 4RQ8A 3PZPA 4UB3A 2JZBB 4FZMA 1TK5A 4YN4A 4P0PA 4ZH4A 8ICBA 3LDAA 2C2DA 9ICEA 3WK7A 4UAZA 1A77A 1SV0C 2R8GA 4RQ5A 3F53A 1QQ6A 5B66U 2WF7A 3Q8PB 3HP6A 3C5FA 3F2CA 3C5GA 1S5LU 1ZQKA 2AH5A 1XSLA 2LKYA 5ALQA 1S0NA 1T7PA 5J2HA 2ZJAA 3ETRA 4IQVA 3RBDA 4FS2A 4FBUA 3B0YA 3MGIA 3GFKB 2G5IB 4KLTA 3NVVA 3U26A 4O5EA 3DEEA 1PZNA 2B0CA 1NJXA 4MHVA 9ICPA 1S8OA 2YTUA 5J0OA 2Y9UA 4BGDA 2F2AB 4OJ6A 2J6TA 4EEKA 2XICA 4YMMA 2FLPA 4M9NA 1ZQFA 3O0FA 4NLZA 4QZ8A 4I2HA 3IG8A 1KRPA 2PMZC 5HMLA 4ACOA 3MR6A 1SV4A 4DL3A 5KT7A 3MDAA 1D9DA 3PW0A 4NLNA 8ICVA 4UB2A 2E1FA 3ZDDA 3FC4A 4O5CA 5G5HA 5DQHA 3GIIA 2HHWA 1KFDA 3C28A 1ZYQA 4J9LA 2AU0A 5AKLA 3PO4A 7ICQA 2ISOA 2H3IA 3T5LA 4ECYA 5EWGA 3KKAA 3MFHA 4F4ZA 3KHGA 8ICUA 4RUCA 4CF5A 4RQ6A 2LHTA 4ECZA 5KFUA 3UPQA 4TQRA 1L7NA 2W3SA 1GO3F 2LYAA 5J0SA 4NM1A 3JPTA 3OHAA 3EUB2 3FM9A 5AM0A 4I2AA 2BDPA 2JEFA 1L5UA 1XSPA 4Y2RA 1IM4A 3AMZA 3WKAA 5KT2A 4QWDA 5IIOA 5DLGA 4C8OA 3KZIU 2ZJ5A 2F76X 4QZCA 2DPIA 4DO9A 2HCFA 1H38A 2KKPA 4ECWA 5F3XB 3FAHA 3H0RB 1ZQYA 3AU6A 2BHNA 3FDSA 1BGXT 2ES6A 3MABA 4PHAA 2XO7A 1ZXIA 4CF3A 2KK0A 1ZQEA 5KFXA 5L1MA 1ZQTA 4QIWF 3WKCA 4EELA 3BZKA 2OYYA 2QKQA 2WB1C 2H3ZA 2XVTA 2KSOA 4J9QA 4IRKA 4KITB 1ZQCA 4U6PA 4ED8A 4YR2A 1QTMA 2KNJA 7ICEA 3QE9Y 2NRVA 1T3QA 7ICFA 1ZQHA 8ICAA 4KLUA 2AGQA 5AI8A 3QU2A 2BCVA 5CR0A 5KFYA 3MR2A 5B5EU 2ZUBA 1WUDA 1TK0A 5D49A 3KTQA 5DBAA 2DPJA 4Y2YA 1ZQMA 2MUTA 2W9CA 4F3OA 3BS5B 4UB1A 1OXJA 5KG4A 2WAQC 5ALDA 4EYIB 5IIKA 1ZQSA 1KN5A 5DDYA 4B9VA 4IS7A 2P66A 1URJA 1X42A 2DQNB 4RQMA 1V9PA 3F2BA 4J9RA 4KTQA 2PKEA 3BQ1A 1X9WA 1U47A 4DFMA 3IG5A 4I2GA 1X2IA 2G09A 1KDHA 1Y88A 1BNOA 3PX6A 3VCBA 3Q8LA 3F2DA 3K1ZA 3OSPA 3IRUA 3LYSA 1VDVA 3GZFA 4EX7A 4O3MA 3PSFA 1DOQA 3HPOA 8ICIA 3WK9A 4RT2A 1ZQLA 4I2FA 3MGHA 4P0QA 2PI5A 4MFFA 3AU2A 4I28A 4HYKA 2RP5A 4GXJA 3M7DA 3BQ0A 1Z4NA 4RQNA 4DSLA 3LVWA 2QB1A 4C8MA 4DF4A 5KFBA 1U9LA 2F8LA 4XA5A 4UAVA 5AKZA 3UQ2A 2ATLA 5DG8A 2M9NA 2GOLA 3C2LA 7ICTA 3RJEA 3RAXA 5GTHU 3RRGA 4M9JA 5J0QA 2WB1F 5ALGA 4CE6A 5AKGA 3PR4A 1ZJNA 2QARB 1BVSA 4PZOA 1NKCA 5E79U 1B0XA 1BPXA 3C23A 5HR6A 4J9MA 1BPYA 3JPQA 3RH4A 2KIVA 4C8NA 4IQWA 1JUDA 4DF8A 3H0MB 3AQFA 5KG2A 4YXJA 3KZXA 4F5OA 1SXEA 3GDXA 2BR0A 1SGGA 1QSYA 2FMQA 2JV3A 1ZETA 5BOLA 4TUPA 8ICRA 4FZNA 2MU2A 1YT3A 1K5OA 5ALRA 1F44A 2MA1A 5AK3A 3A0HU 2WAQF 2LYHA 3LWMA 5KFNA 1X6IA 2JZBA 3NVWA 1PVRA 5EWFA 3M9MB 2RLTA 3PY8A 5JTIA 5KFPA 2KE7A 5AKJA 2HBMA 1IG6A 4NLKA 1ZQWA 2EZZA 4M6WB 1SZPA 2GLEA 5AI6A 1RXVA 4ED7A 4DQIA 8ICMA 1JALA 2B6GA 1RQLA 5AI4A 5DG7A 1X9XA 3T5JA 3TAPA 2F77X 4DSEA 5AKIA 2KJ5A 1L3VA 1JN3A 3PX4A 1U49A 4UB6U 4R64A 7ICNA 3MGVA 2K8BB 2W54A 5KG3A 4CRXA 1AROP 4ICAA 1X9SA 3GILA 1NI3A 4RZRA 4EZ6A 2CXYA 8ICPA 1NJYA 2KKVA 2FPMA 2J6SA 8ICYA 1FEZA 4B9MA 1AQ6A 1SB3C 2OHFA 4GC6A 1S97A 1NK8A 2HI0A 5IILA 2G08A 3QXGA 1RDFA 4NLBA 9ICXA 3NASA 2DWQA 1N62A 3GIKA 5AHXA 3N97B 1JROA 4B9TA 3ETLA 5AIAA 5ALHA 5J0YA 4J9OA 4MEXA 3UXPA 1SXDA 2D6FC 3Q8SB 2KMDA 2R8IA 4KLSA 4Q44A 2VJ5A 4KLLA 1JXEA 5KT4A 5D4BA 1ZQAA 1PUZA 1UA0A 1ZQVA 2HHXA 1ZQZA 4BUGA 4EENA 5KFMA 2HHUA 4G9BA 3ZD9A 2OWOA 4PH5A 1J97A 2RRDA 1XO1A 5AK5A 2NRTA 2K8CB 1SWVA 2N1RA 1T8EA 5F9LA 3QUTA 4GLXA 1HEKA 4DQPA 2O6KA 4RNMA 4K4HA 2Q0ZX 1M6YA 4DOAA 1XO0A 1ZQNA 1CEZA 5ALIA 1KQQA 5AI9A 1ZQGA 4Y2UA 4DSFA 5ALWA 4J9NA 3RFAA 3L3FX 5DKWA 2DKXA 1ZQXA 5TZVA 3PNCA 1ZQDA 9ICUA 4IRCA 2P6RA 4Z6FA 5TISU 9ICSA 3AM9A 2HHQA 2R8JA 1RQNA 2EQYA 2AJQA 3KKAC 4KX3A 2FLNA 3WK4A 1T4GA 4JWNA 3PMNA 2ZIVB 4DL6A 5H2FU 2V4QA 5KFFA 3UXNA 3ZDAA 2XC9A 2HW3A 3JPPA 4YR3A 1S0OA 8ICWA 1XC9A 3F5EA 2ZJ8A 2JEGA 2OEHA 1ZRNA 1JI7A 2XGPA 5ALUA 5KFSA 1UA1A 4LZDA 3Q8RB 5KFKA 4KLDA 4QZFA 4EBEA 2EAMA 3CNHA 4M47A 4F92B 4O9MA 3SR6A 4R8UB 2W3RA 2MSNA 1JMSA 3QU4A 4QJFB 1D8YA 5KG6A 3BS5A 2DGZA 4UQGA 1U48A 2W9BB 5CRXA 2BKEA 8ICEA 2YMQA 3V7JA 3RR8A 4DS5A 4YFKA 4Z6DA 4KLGA 4UB5A 4M9GA 1ED1A 3TAQA 5KAFU 4DLGA 3T3FA 5J2BA 4F91B 2DL0A 4FFDA 2KFZA 1KSPA 1SZHA 3MFIA 5AICA 3PSIA 4NV0A 2H3FA 2E1EA 4ED6A 1K1QA 4LZGA 4PGQA 1Z19A 4F93B 2IBKA 1RPLA 5DB8A 3M1YA 1NZBA 2AGPA 3GQCA 4O5KA 4X5VA 4C7YA 3QUCA 3A0BU 1C20A 7ICOA 3NVYA 5J8YC 8ICJA 2KICA 3GU3A 4KMOB 2H5XA 4I2JA 5AI0A 5KFTA 1NJZA 3WKDA 2YB4A 3BS7A 5L1IA 5KNIA 3L4PA 4XQ8A 2LM4A 3WKBA 4QWAA 1T94A 2FMPA 2ZIUB 3B0XA 3K4GA 3N7PD 2AGOA 4PHEA 2QARA 4PZNA 4FS1A 4QWEA 5BPCA 1X66A 5EE3A 2W8LA 2IOFK 3H8JA 1DRGA 2VA2A 4RU9A 5KFEA 1FO4A 4ECSA 3UMCA 9ICWA 2CPRA 1UT8A 5AIBA 3SI8A 2Y1IA 2XY6A 2Y0SC 3PW4A 2E8PA 4JUZA 1NK6A 1N56A 2XY5A 1NJWA 4C0ZA 2F44A 5IIJA 5CA7A 4DL5A 3C2MA 2ALZA 3RBEA 4UB4A 2HOQA 4RPYA 2ZUCA 2PI4A 3MR3A 4YCXA 1L7PA 1Z00B 3PVXA 5KG7A 5HNKA 1TV9A 1KFTA 1NKEA 5EWEA 3G6VA 4RQ3A 4Z6EA 4NY8A 4NJ8A 4AYBC 1L3UA 5AK6A 4RUAA 4RNOA 9ICFA 3SAHA 1JRPA 4M6WA 2NYVA 4UAWA 3SAFA 3PSPA 2Y9TA 4DS4A 2Q4TA 1B22A 5ALVA 4UAUA 5DGBA 3WK5A 4F5QA 3ISDA 1L7MA 1YZ7A 2ZXIA 3AN1A 4GXKA 1BPEA 4C4SA 3R9KA 4DQRA 3EW9A 2ZIWB 2BCSA 9ICAA 9ICTA 1JX4A 3KHRA 2F3NA 2YX8A 2I1QA 4Y2XA 4GFJA 1ZQBA 4JV2A 4LVSA 3PW5A 5KFGA 2C28A 2WF8A 3HJEA 4NM2A 2K4IA 4B6JA 1N5WA 2RQ5A 3HWTA 5ALZA 1D9FA 2ASDA 2ZG6A 4A8EA 2VJ4A 3N4MB 2KVCA 2PMZF 4F5PA 1Q3UA 1FFUA 5IIMA 5HHHA 1LV5A 1ZQOA 3PMLA 3WK8A 5AM3A 1ECWA 3N7RC 2W04A 3ISCA 5AM5A 5KFHA 5J0RA 9ICVA 1FIQA 8ICHA 7ICKA 1SL0A 2A3VA 2BPCA 5J8YA 4I29A 4YVZA 5J2AA 4DL7A 2BCUA 4DOCA 4RQ7A 3QNMA 1NK4A 2XCAA 5ALFA 1FFVA 4OJLA 1HUOA 2EAPA 2QB0B 2LMRA 3M9OB 3BDPA 1KL9A 4LJXA 5J2JA 4P4OA 3AUOA 5J0WA 3H4BA 3QU5A 5ALTA 1NOMA 4IQUA 5J2IA 4B9UA 3WKEA 3B9JA 2ISPA 5KFIA 4AYBF 4JMUA 1RZTA 4NLGA 2K60A 3V6HA 1RM6C 4PHPA 1LKYB 1TKDA 5KFRA 4MF2A 2KIWA 1BPBA 3H0LB 3WK6A 4DFPA 1J2MA 4ED0A 2W03A 4F2RA 8ICNA 1JXLA 1Q8KA 4EX6A 1ZJMA 3RR7A 1SKSA 2LYBA 2YMLA 4O3QA 3C1YA 5ALOA 5ALYA 4ECRA 5AKEA 4OO1J 1L8OA 1J2NA 2ZXHA 4PJ0U 2JMGA 2XY7A 1D8LA 4QW9A 5AKKA 5J0UA 2PFPA 1XS9D 3DV9A 1WWUA 4DSJA 7ICLA 3C2KA 1NK5A 4NL9C 3PV8A 3OJSA 3GV5B 1DK3A 8ICZA 4FO6A 5AKYA 4O3PA 1ZD5A 2NRZA 1UT5A 1N61A 9ICKA 2BQRA 3OSNA 4J9KA 1MC8A 5AM2A 3GIJA 2K4HA 4R63A 5ALPA 4ECQA 2BQ3A 4QWBA 2FLLA 7ICUA 1NKBA 3N7SC 2ASLA 2F1JA 3AEVA 4R8UA 7ICIA 1RYSA 2WF6A 1PVQA 4IRDA 4F5RA 4P4PA 3JPSA 5KFQA 1Z1BA 4KLJA 2W9BA 4AP9A 1SL1A 5ALJA 1U45A 1ZD3A 3SD7A 4NWIA 1L3TA 3HRDD 4F4WA 8ICQA 4F50A 3AL0B 5EE9A 1NZPA 3D2NA 1COOA 3SZ2A 1MSWD 2H3VA 4EYHB 4TURA 2YMMA 5HHIA 1QSSA 3UMGA 4IR9A 1XU4A 2WF9A 5JU5A 3D6JA 4F72A 4YG2A 3NTUA 1Q46A 3Q8QB 4RQ0A 1RYUA 3RJFA 2D3DA 4F2SA 2EAOA 3EYZA 2WTFA 2AXTU 3WU2U 4J9PA 3I76A 4DOBA 4KLOA 3OPXA 5C5JA 1TAUA 3HW8A 2XIDA 2KJ9A 3RRHA 2JH7A 5KFVA 2BPGA 2RDIA 5KFWA 3CP8A 4OCZA 4C7ZA 4UATA 1ZQPA 3RAQA 4M0AA 3TARA 3SAGA 5F9NA 4P2HA 3RB0A 3H40A 3RB3A 5J2DA 2ZIUA 4QZIA 4UBBA 4RPXA 3RTVA 5KG0A 3SQIA 4DL4A 2ESEA 3TKAA 4JK1A 3QU7A 5CB1A 3Q8MA 2JEIA 4ED3A 4PPXA 2W7PA 5IIIA 2BGWA 1XWLA
chains in the Genus database with same CATH topology
2EZYA 1CI4A 1QCKA 2ODGA 2EZXA 2EZZA 2BZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZY A;  1CI4 A;  1QCK A;  2ODG A;  2EZX A;  2EZZ A;  2BZF A; 
#chains in the Genus database with same CATH topology
 5J2E A;  2IOH A;  2W11 A;  2AQ4 A;  3LVV A;  3V6J A;  3H8M A;  8ICL A;  3G6Y A;  1BPD A;  2YB1 A;  1UPH A;  4OJO A;  2I6X A;  4Q8E A;  3E58 A;  4MFC A;  5BOM A;  1F5S A;  1CUK A;  5EE1 A;  3OTQ A;  3RJK A;  2RHF A;  4ZOH C;  3T5H A;  4NL9 A;  3H8W A;  2UVU A;  5AKX A;  2XCP A;  3ZDB A;  2KV2 A;  1Z00 A;  5T14 A;  4O3O A;  4BDP A;  1TFR A;  2AHO B;  2DFL A;  1D8B A;  2KZM A;  4M2Y A;  2A19 A;  4IR1 A;  2ASJ A;  1NK9 A;  1S76 D;  9ICJ A;  2E3T A;  4YD1 A;  4FE3 A;  1ZRM A;  3N28 A;  5AM1 A;  5J2G A;  5HMM A;  2KFN A;  1K1S A;  2ZIW A;  3TFS A;  2P6U A;  1PK1 B;  4QZG A;  4KN7 A;  3JPR A;  7ICM A;  4I2E A;  4M9L A;  1KTQ A;  5K4L A;  3RB6 A;  1B43 A;  4PL1 A;  3GV8 B;  3MR5 A;  1OUQ A;  5AKH A;  3QZ7 A;  2F8K A;  3SEI A;  4ECT A;  4F5N A;  2HBJ A;  2XI9 A;  3V72 A;  1ZQU A;  1C7Y A;  9ICC A;  2CN1 A;  3PX0 A;  1TE2 A;  2HVH A;  4JB3 A;  4C8K A;  4Q45 A;  1S77 D;  1IXR A;  1N2X A;  4CNQ A;  1X40 A;  5ALL A;  3HX0 A;  8ICO A;  1KEJ A;  4CCH A;  3ICX A;  4DFK A;  2WF5 A;  5AM4 A;  4YD2 A;  2F1H A;  3RJH A;  3ZI4 A;  1WYG A;  5KFZ A;  9ICM A;  5J0X A;  1L8L A;  4UAY A;  2NRX A;  4BWM A;  5JUM A;  1UQV A;  4PL2 A;  5KTQ A;  2BDU A;  4IL6 U;  9ICR A;  1IIP A;  1N5X A;  2HDO A;  2JHD A;  4OJP A;  1KKX A;  4US9 A;  4EEY A;  5DG9 A;  4ECU A;  5DB7 A;  1WCL A;  3QYP A;  2KN7 A;  4EBC A;  2KHQ A;  4Y2S A;  2E5S A;  3UMB A;  4J03 A;  3EZ5 A;  5AI5 A;  4TUQ A;  2VAN A;  2QLT A;  5HP4 A;  2C22 A;  9ICQ A;  2W8K A;  2YMP A;  3KBB A;  1ZQI A;  5J0T A;  2GWS A;  4YP3 A;  3TAN A;  2IHN A;  9ICH A;  4Y2Q A;  4CF4 A;  1V38 A;  3RJJ A;  1X9M A;  5EE0 A;  3PST A;  4UW9 A;  2DF4 B;  5DDM A;  1LKY A;  4Q43 A;  4PGY A;  3V6K A;  3M9N B;  2K4P A;  2FI1 A;  4F4X A;  4BWJ A;  3T5K A;  3UXO A;  2NO5 A;  3CYM A;  1UHU A;  1ZD4 A;  1WWV A;  3RJI A;  3QEB Z;  2VA8 A;  1S0V A;  1U4B A;  5J2F A;  1MA7 A;  2KZZ A;  4GXI A;  2IMW P;  2P35 A;  4UBC A;  4I2B A;  1MN8 A;  1ZQ1 C;  4O3S A;  4DCC A;  3M8S A;  1N60 A;  1OW5 A;  2BPF A;  4QIW C;  5KFD A;  2W43 A;  3MDC A;  3E2E A;  2PXI A;  1T3N A;  9ICG A;  9ICL A;  4FZL A;  4RT3 A;  4YQW A;  2W9M A;  5KL1 B;  3ED5 A;  2IA6 A;  2K89 A;  3JPO A;  4CGZ A;  4MEY A;  1TK8 A;  4UB8 U;  1DXS A;  3BQ7 A;  4HAI A;  3C21 A;  9ICI A;  4BX9 C;  3LK9 A;  2F1I A;  4YR0 A;  2LM1 A;  3RB4 A;  1ZQJ A;  5KFL A;  1DGS A;  1ZOL A;  5IIN A;  3EWA A;  4F71 A;  4F4Y A;  4TUS A;  5CEH A;  2LI6 A;  2ZTE A;  3TAD C;  1LVH A;  3AQE A;  2OH2 A;  1A76 A;  2A1A A;  2AQ0 A;  5FP0 A;  4XRH A;  1LB2 B;  4I2D A;  3KFU F;  4QZE A;  1EXN A;  4DSI A;  1A0P A;  4RQ2 A;  4CDG A;  3IM1 A;  3NRW A;  3RJG A;  4ELV A;  3BZC A;  2KD1 A;  5HR7 A;  1COK A;  4BXO B;  3M6Z A;  4ECV A;  4O0I A;  5ALN A;  2A1J B;  2UVW A;  2ZIX B;  3QEA Z;  2BZF A;  1DGJ A;  7ICV A;  4RQ1 A;  5KT6 A;  4OJ5 A;  2B21 A;  2EAN A;  3SYZ A;  3HIL A;  2YQE A;  2HHV A;  4NXZ A;  1XSN A;  2EDU A;  5J2C A;  3HKZ C;  1UCV A;  4WJ3 B;  4I27 A;  4QZH A;  2JRZ A;  3OHB A;  4E0D A;  5DBB A;  4XUS A;  2NV3 A;  4B9N A;  1SWW A;  2G06 A;  4MF8 A;  4QZ9 A;  2FPK A;  2W55 A;  5DLF A;  4DSK A;  4QWC A;  4Q8F A;  4DWI A;  5CJ7 A;  1X6J A;  1CI4 A;  3V7K A;  4OD0 A;  1VJ5 A;  3D2Q A;  3DDH A;  4NLC A;  1WCN A;  4QZA A;  2KJ8 A;  5DB6 A;  4PHD A;  2YN4 A;  3IN5 A;  1ZD2 P;  2FJ6 A;  1Q3V A;  4YMO A;  1RYR A;  1SV0 A;  2KZ3 A;  3SV3 A;  3GIM A;  2UVR A;  9ICB A;  1XNS A;  7ICH A;  3NGD A;  8ICG A;  2HBK A;  4P4M A;  3SMV A;  4M9H A;  2Y0S F;  2E8N A;  1V97 A;  4I2I A;  3RF9 A;  4YMN A;  5ALM A;  7ICG A;  5ALS A;  5EOZ A;  2R8K A;  2RDJ A;  5KG1 A;  2ZTC A;  7ICP A;  1L3S A;  4I2C A;  2VA3 A;  3IDW A;  2ZTD A;  5J0P A;  1DK2 A;  1QLN A;  4P0P B;  4KLQ A;  1N63 A;  4PGX A;  5DGA A;  4KN4 A;  4USA A;  2FMS A;  5A0L A;  2HOI A;  4C4T A;  3MC1 A;  5JRT A;  2KG5 A;  2M0N A;  1JIH A;  3K1R B;  2D8C A;  2LBO A;  8ICC A;  2KP7 A;  1BPZ A;  4KLE A;  3SEN A;  2KOB A;  3QUQ A;  3RH6 A;  4IC9 A;  3G6X A;  2PFO A;  2IOF A;  3NUQ A;  5CWR A;  5DQG A;  5KT3 A;  3RH5 A;  1PK1 A;  3HKZ F;  5J2K A;  3TI0 A;  2FPL A;  3TAD A;  3S6J A;  3QX7 A;  4GIB A;  2HSZ A;  2ZIV A;  1L6N A;  2R8H A;  4JV1 A;  3D2S A;  5L9X A;  1MQ2 A;  4DQQ A;  3T79 A;  2FE9 A;  2YY6 A;  2Z7J A;  1S9F A;  3QUB A;  4TQS A;  3M8R A;  5KFA A;  3BQ2 A;  4R65 A;  4Z6C A;  4QW8 A;  3KHH A;  2I9G A;  2FDR A;  3TQ1 A;  1V85 A;  1Z1V A;  2KEY A;  2K8A A;  4EZ9 A;  5AK4 A;  3EPI A;  5L1K A;  4Y2J A;  3NS1 A;  2HVI A;  4US8 A;  4O3N A;  2C2E A;  4B9S A;  1SKW A;  2J6U A;  2KTQ A;  1S0M A;  2E8O A;  4J9S A;  7ICS A;  1HIW A;  3BQT A;  5DB9 A;  3I1Y A;  1VLB A;  3ZD8 A;  2W7O A;  3ISB A;  2L5Y A;  5KT5 A;  3F5A A;  3JPN A;  8ICS A;  1SL2 A;  1QQ7 A;  5KL8 B;  4QZD A;  3ORY A;  7ICJ A;  1Z3E B;  4FBT A;  2W9A A;  2I5H A;  1NK7 A;  3THV A;  2VIX A;  2WHE A;  4C8L A;  3KOO A;  1O08 A;  2PFQ A;  1WG8 A;  1KBU A;  2KVS A;  3M6K A;  3NRZ A;  3OGU A;  5KG5 A;  4QNL A;  8ICT A;  2JEJ A;  4O3R A;  1L7O A;  4DQS A;  5GTI U;  3C29 A;  3IHQ B;  4DFD A;  4ED2 A;  2IHM A;  3ALR A;  2DKZ A;  4U7C A;  2GO7 A;  3E0F A;  2NO4 A;  3GV7 B;  5CP2 A;  5L1J A;  1BNP A;  1N48 A;  1HUZ A;  2E8M A;  4F8R A;  2H3Q A;  1S10 A;  1A6S A;  1IV8 A;  4ECX A;  2HHT A;  4ED1 A;  1CRX A;  4C4R A;  4G3I A;  3MBY A;  2HBL A;  1B4F A;  2LPE A;  1TAQ A;  1ZQQ A;  4B9L A;  1NNL A;  3VC8 A;  8ICF A;  5KFC A;  1PVP A;  2GH1 A;  5CHG A;  4ELU A;  5KFJ A;  4KLH A;  2KSO B;  2HOF A;  1QSL A;  2CRX A;  4KLF A;  3PR5 B;  3UM9 A;  3SV4 A;  3OJU A;  9ICN A;  2BQU A;  4MFA A;  4RPZ A;  1MQ3 A;  3PW7 A;  4RNN A;  4Y2T A;  1KLN A;  1NK0 A;  2JR5 A;  3PW2 A;  3H4D A;  4JWM A;  3ONN A;  1RXW A;  3KHL A;  2K4E A;  4M04 A;  1SIJ A;  2MUT B;  1P7D A;  2W9C B;  4K4G A;  5ALK A;  2PFN A;  2G07 A;  7ICR A;  4KMU A;  2OM6 A;  1QQ5 A;  3EPG A;  2JXJ A;  3NVZ A;  2JGA A;  4KLM A;  4BXO A;  2A1J A;  1RG6 A;  2ZIX A;  4DLE A;  4F4K A;  5KFO A;  4K4I A;  3H7I A;  2Y1J A;  1Z4O A;  3PO5 A;  3LWL A;  5D46 A;  3Q8K A;  3TFR A;  3ZDC A;  2V4R A;  3K75 D;  3BJY A;  3I28 A;  4DEZ A;  2BCR A;  5ALX A;  3J81 j;  2KHV A;  1QCK A;  2G0A A;  2C2R A;  3HT3 A;  1TVA A;  4P0Q B;  3V7L A;  2DBY A;  2HMX A;  4BJQ A;  2VKQ A;  3TAC B;  2R18 A;  5DQI A;  2NRW A;  5G5G A;  4RQ4 A;  8ICK A;  2OXO A;  4JV0 A;  5L1L A;  1O03 A;  1F0M A;  4UAR A;  4Y2P A;  2MRL A;  2OCE A;  5KAI U;  4KLI A;  2MAX A;  3L5K A;  2V9W A;  4KX5 A;  1PK3 A;  2DUY A;  3KD3 A;  4R66 A;  1HJP A;  2XGQ A;  3IP4 B;  3ZDE A;  3CW2 C;  4IQT A;  3FYH A;  1ZQR A;  3IV6 A;  5J29 A;  5ALE A;  2BCQ A;  3QZ8 A;  2HHS A;  3UQ0 A;  4GC7 A;  4EBD A;  2UVV A;  2ODG A;  1QH9 A;  1YZ6 A;  3CRX A;  1SKR A;  5C0Y A;  8ICX A;  2JH1 A;  4Y2V A;  4ELT A;  2WFA A;  4QZB A;  3QU9 A;  1TAM A;  4UAS A;  4DL2 A;  4DFJ A;  9ICO A;  2EZX A;  2EZY A;  4C80 A;  3H8S A;  2ZUD A;  2G5H B;  1KFS A;  5DBC A;  2QB0 A;  4YXM A;  2EH9 A;  3C1Z A;  1KW4 A;  4RQ8 A;  3PZP A;  4UB3 A;  2JZB B;  4FZM A;  1TK5 A;  4YN4 A;  4P0P A;  4ZH4 A;  8ICB A;  3LDA A;  2C2D A;  9ICE A;  3WK7 A;  4UAZ A;  1A77 A;  1SV0 C;  2R8G A;  4RQ5 A;  3F53 A;  1QQ6 A;  5B66 U;  2WF7 A;  3Q8P B;  3HP6 A;  3C5F A;  3F2C A;  3C5G A;  1S5L U;  1ZQK A;  2AH5 A;  1XSL A;  2LKY A;  5ALQ A;  1S0N A;  1T7P A;  5J2H A;  2ZJA A;  3ETR A;  4IQV A;  3RBD A;  4FS2 A;  4FBU A;  3B0Y A;  3MGI A;  3GFK B;  2G5I B;  4KLT A;  3NVV A;  3U26 A;  4O5E A;  3DEE A;  1PZN A;  2B0C A;  1NJX A;  4MHV A;  9ICP A;  1S8O A;  2YTU A;  5J0O A;  2Y9U A;  4BGD A;  2F2A B;  4OJ6 A;  2J6T A;  4EEK A;  2XIC A;  4YMM A;  2FLP A;  4M9N A;  1ZQF A;  3O0F A;  4NLZ A;  4QZ8 A;  4I2H A;  3IG8 A;  1KRP A;  2PMZ C;  5HML A;  4ACO A;  3MR6 A;  1SV4 A;  4DL3 A;  5KT7 A;  3MDA A;  1D9D A;  3PW0 A;  4NLN A;  8ICV A;  4UB2 A;  2E1F A;  3ZDD A;  3FC4 A;  4O5C A;  5G5H A;  5DQH A;  3GII A;  2HHW A;  1KFD A;  3C28 A;  1ZYQ A;  4J9L A;  2AU0 A;  5AKL A;  3PO4 A;  7ICQ A;  2ISO A;  2H3I A;  3T5L A;  4ECY A;  5EWG A;  3KKA A;  3MFH A;  4F4Z A;  3KHG A;  8ICU A;  4RUC A;  4CF5 A;  4RQ6 A;  2LHT A;  4ECZ A;  5KFU A;  3UPQ A;  4TQR A;  1L7N A;  2W3S A;  1GO3 F;  2LYA A;  5J0S A;  4NM1 A;  3JPT A;  3OHA A;  3EUB 2;  3FM9 A;  5AM0 A;  4I2A A;  2BDP A;  2JEF A;  1L5U A;  1XSP A;  4Y2R A;  1IM4 A;  3AMZ A;  3WKA A;  5KT2 A;  4QWD A;  5IIO A;  5DLG A;  4C8O A;  3KZI U;  2ZJ5 A;  2F76 X;  4QZC A;  2DPI A;  4DO9 A;  2HCF A;  1H38 A;  2KKP A;  4ECW A;  5F3X B;  3FAH A;  3H0R B;  1ZQY A;  3AU6 A;  2BHN A;  3FDS A;  1BGX T;  2ES6 A;  3MAB A;  4PHA A;  2XO7 A;  1ZXI A;  4CF3 A;  2KK0 A;  1ZQE A;  5KFX A;  5L1M A;  1ZQT A;  4QIW F;  3WKC A;  4EEL A;  3BZK A;  2OYY A;  2QKQ A;  2WB1 C;  2H3Z A;  2XVT A;  2KSO A;  4J9Q A;  4IRK A;  4KIT B;  1ZQC A;  4U6P A;  4ED8 A;  4YR2 A;  1QTM A;  2KNJ A;  7ICE A;  3QE9 Y;  2NRV A;  1T3Q A;  7ICF A;  1ZQH A;  8ICA A;  4KLU A;  2AGQ A;  5AI8 A;  3QU2 A;  2BCV A;  5CR0 A;  5KFY A;  3MR2 A;  5B5E U;  2ZUB A;  1WUD A;  1TK0 A;  5D49 A;  3KTQ A;  5DBA A;  2DPJ A;  4Y2Y A;  1ZQM A;  2MUT A;  2W9C A;  4F3O A;  3BS5 B;  4UB1 A;  1OXJ A;  5KG4 A;  2WAQ C;  5ALD A;  4EYI B;  5IIK A;  1ZQS A;  1KN5 A;  5DDY A;  4B9V A;  4IS7 A;  2P66 A;  1URJ A;  1X42 A;  2DQN B;  4RQM A;  1V9P A;  3F2B A;  4J9R A;  4KTQ A;  2PKE A;  3BQ1 A;  1X9W A;  1U47 A;  4DFM A;  3IG5 A;  4I2G A;  1X2I A;  2G09 A;  1KDH A;  1Y88 A;  1BNO A;  3PX6 A;  3VCB A;  3Q8L A;  3F2D A;  3K1Z A;  3OSP A;  3IRU A;  3LYS A;  1VDV A;  3GZF A;  4EX7 A;  4O3M A;  3PSF A;  1DOQ A;  3HPO A;  8ICI A;  3WK9 A;  4RT2 A;  1ZQL A;  4I2F A;  3MGH A;  4P0Q A;  2PI5 A;  4MFF A;  3AU2 A;  4I28 A;  4HYK A;  2RP5 A;  4GXJ A;  3M7D A;  3BQ0 A;  1Z4N A;  4RQN A;  4DSL A;  3LVW A;  2QB1 A;  4C8M A;  4DF4 A;  5KFB A;  1U9L A;  2F8L A;  4XA5 A;  4UAV A;  5AKZ A;  3UQ2 A;  2ATL A;  5DG8 A;  2M9N A;  2GOL A;  3C2L A;  7ICT A;  3RJE A;  3RAX A;  5GTH U;  3RRG A;  4M9J A;  5J0Q A;  2WB1 F;  5ALG A;  4CE6 A;  5AKG A;  3PR4 A;  1ZJN A;  2QAR B;  1BVS A;  4PZO A;  1NKC A;  5E79 U;  1B0X A;  1BPX A;  3C23 A;  5HR6 A;  4J9M A;  1BPY A;  3JPQ A;  3RH4 A;  2KIV A;  4C8N A;  4IQW A;  1JUD A;  4DF8 A;  3H0M B;  3AQF A;  5KG2 A;  4YXJ A;  3KZX A;  4F5O A;  1SXE A;  3GDX A;  2BR0 A;  1SGG A;  1QSY A;  2FMQ A;  2JV3 A;  1ZET A;  5BOL A;  4TUP A;  8ICR A;  4FZN A;  2MU2 A;  1YT3 A;  1K5O A;  5ALR A;  1F44 A;  2MA1 A;  5AK3 A;  3A0H U;  2WAQ F;  2LYH A;  3LWM A;  5KFN A;  1X6I A;  2JZB A;  3NVW A;  1PVR A;  5EWF A;  3M9M B;  2RLT A;  3PY8 A;  5JTI A;  5KFP A;  2KE7 A;  5AKJ A;  2HBM A;  1IG6 A;  4NLK A;  1ZQW A;  2EZZ A;  4M6W B;  1SZP A;  2GLE A;  5AI6 A;  1RXV A;  4ED7 A;  4DQI A;  8ICM A;  1JAL A;  2B6G A;  1RQL A;  5AI4 A;  5DG7 A;  1X9X A;  3T5J A;  3TAP A;  2F77 X;  4DSE A;  5AKI A;  2KJ5 A;  1L3V A;  1JN3 A;  3PX4 A;  1U49 A;  4UB6 U;  4R64 A;  7ICN A;  3MGV A;  2K8B B;  2W54 A;  5KG3 A;  4CRX A;  1ARO P;  4ICA A;  1X9S A;  3GIL A;  1NI3 A;  4RZR A;  4EZ6 A;  2CXY A;  8ICP A;  1NJY A;  2KKV A;  2FPM A;  2J6S A;  8ICY A;  1FEZ A;  4B9M A;  1AQ6 A;  1SB3 C;  2OHF A;  4GC6 A;  1S97 A;  1NK8 A;  2HI0 A;  5IIL A;  2G08 A;  3QXG A;  1RDF A;  4NLB A;  9ICX A;  3NAS A;  2DWQ A;  1N62 A;  3GIK A;  5AHX A;  3N97 B;  1JRO A;  4B9T A;  3ETL A;  5AIA A;  5ALH A;  5J0Y A;  4J9O A;  4MEX A;  3UXP A;  1SXD A;  2D6F C;  3Q8S B;  2KMD A;  2R8I A;  4KLS A;  4Q44 A;  2VJ5 A;  4KLL A;  1JXE A;  5KT4 A;  5D4B A;  1ZQA A;  1PUZ A;  1UA0 A;  1ZQV A;  2HHX A;  1ZQZ A;  4BUG A;  4EEN A;  5KFM A;  2HHU A;  4G9B A;  3ZD9 A;  2OWO A;  4PH5 A;  1J97 A;  2RRD A;  1XO1 A;  5AK5 A;  2NRT A;  2K8C B;  1SWV A;  2N1R A;  1T8E A;  5F9L A;  3QUT A;  4GLX A;  1HEK A;  4DQP A;  2O6K A;  4RNM A;  4K4H A;  2Q0Z X;  1M6Y A;  4DOA A;  1XO0 A;  1ZQN A;  1CEZ A;  5ALI A;  1KQQ A;  5AI9 A;  1ZQG A;  4Y2U A;  4DSF A;  5ALW A;  4J9N A;  3RFA A;  3L3F X;  5DKW A;  2DKX A;  1ZQX A;  5TZV A;  3PNC A;  1ZQD A;  9ICU A;  4IRC A;  2P6R A;  4Z6F A;  5TIS U;  9ICS A;  3AM9 A;  2HHQ A;  2R8J A;  1RQN A;  2EQY A;  2AJQ A;  3KKA C;  4KX3 A;  2FLN A;  3WK4 A;  1T4G A;  4JWN A;  3PMN A;  2ZIV B;  4DL6 A;  5H2F U;  2V4Q A;  5KFF A;  3UXN A;  3ZDA A;  2XC9 A;  2HW3 A;  3JPP A;  4YR3 A;  1S0O A;  8ICW A;  1XC9 A;  3F5E A;  2ZJ8 A;  2JEG A;  2OEH A;  1ZRN A;  1JI7 A;  2XGP A;  5ALU A;  5KFS A;  1UA1 A;  4LZD A;  3Q8R B;  5KFK A;  4KLD A;  4QZF A;  4EBE A;  2EAM A;  3CNH A;  4M47 A;  4F92 B;  4O9M A;  3SR6 A;  4R8U B;  2W3R A;  2MSN A;  1JMS A;  3QU4 A;  4QJF B;  1D8Y A;  5KG6 A;  3BS5 A;  2DGZ A;  4UQG A;  1U48 A;  2W9B B;  5CRX A;  2BKE A;  8ICE A;  2YMQ A;  3V7J A;  3RR8 A;  4DS5 A;  4YFK A;  4Z6D A;  4KLG A;  4UB5 A;  4M9G A;  1ED1 A;  3TAQ A;  5KAF U;  4DLG A;  3T3F A;  5J2B A;  4F91 B;  2DL0 A;  4FFD A;  2KFZ A;  1KSP A;  1SZH A;  3MFI A;  5AIC A;  3PSI A;  4NV0 A;  2H3F A;  2E1E A;  4ED6 A;  1K1Q A;  4LZG A;  4PGQ A;  1Z19 A;  4F93 B;  2IBK A;  1RPL A;  5DB8 A;  3M1Y A;  1NZB A;  2AGP A;  3GQC A;  4O5K A;  4X5V A;  4C7Y A;  3QUC A;  3A0B U;  1C20 A;  7ICO A;  3NVY A;  5J8Y C;  8ICJ A;  2KIC A;  3GU3 A;  4KMO B;  2H5X A;  4I2J A;  5AI0 A;  5KFT A;  1NJZ A;  3WKD A;  2YB4 A;  3BS7 A;  5L1I A;  5KNI A;  3L4P A;  4XQ8 A;  2LM4 A;  3WKB A;  4QWA A;  1T94 A;  2FMP A;  2ZIU B;  3B0X A;  3K4G A;  3N7P D;  2AGO A;  4PHE A;  2QAR A;  4PZN A;  4FS1 A;  4QWE A;  5BPC A;  1X66 A;  5EE3 A;  2W8L A;  2IOF K;  3H8J A;  1DRG A;  2VA2 A;  4RU9 A;  5KFE A;  1FO4 A;  4ECS A;  3UMC A;  9ICW A;  2CPR A;  1UT8 A;  5AIB A;  3SI8 A;  2Y1I A;  2XY6 A;  2Y0S C;  3PW4 A;  2E8P A;  4JUZ A;  1NK6 A;  1N56 A;  2XY5 A;  1NJW A;  4C0Z A;  2F44 A;  5IIJ A;  5CA7 A;  4DL5 A;  3C2M A;  2ALZ A;  3RBE A;  4UB4 A;  2HOQ A;  4RPY A;  2ZUC A;  2PI4 A;  3MR3 A;  4YCX A;  1L7P A;  1Z00 B;  3PVX A;  5KG7 A;  5HNK A;  1TV9 A;  1KFT A;  1NKE A;  5EWE A;  3G6V A;  4RQ3 A;  4Z6E A;  4NY8 A;  4NJ8 A;  4AYB C;  1L3U A;  5AK6 A;  4RUA A;  4RNO A;  9ICF A;  3SAH A;  1JRP A;  4M6W A;  2NYV A;  4UAW A;  3SAF A;  3PSP A;  2Y9T A;  4DS4 A;  2Q4T A;  1B22 A;  5ALV A;  4UAU A;  5DGB A;  3WK5 A;  4F5Q A;  3ISD A;  1L7M A;  1YZ7 A;  2ZXI A;  3AN1 A;  4GXK A;  1BPE A;  4C4S A;  3R9K A;  4DQR A;  3EW9 A;  2ZIW B;  2BCS A;  9ICA A;  9ICT A;  1JX4 A;  3KHR A;  2F3N A;  2YX8 A;  2I1Q A;  4Y2X A;  4GFJ A;  1ZQB A;  4JV2 A;  4LVS A;  3PW5 A;  5KFG A;  2C28 A;  2WF8 A;  3HJE A;  4NM2 A;  2K4I A;  4B6J A;  1N5W A;  2RQ5 A;  3HWT A;  5ALZ A;  1D9F A;  2ASD A;  2ZG6 A;  4A8E A;  2VJ4 A;  3N4M B;  2KVC A;  2PMZ F;  4F5P A;  1Q3U A;  1FFU A;  5IIM A;  5HHH A;  1LV5 A;  1ZQO A;  3PML A;  3WK8 A;  5AM3 A;  1ECW A;  3N7R C;  2W04 A;  3ISC A;  5AM5 A;  5KFH A;  5J0R A;  9ICV A;  1FIQ A;  8ICH A;  7ICK A;  1SL0 A;  2A3V A;  2BPC A;  5J8Y A;  4I29 A;  4YVZ A;  5J2A A;  4DL7 A;  2BCU A;  4DOC A;  4RQ7 A;  3QNM A;  1NK4 A;  2XCA A;  5ALF A;  1FFV A;  4OJL A;  1HUO A;  2EAP A;  2QB0 B;  2LMR A;  3M9O B;  3BDP A;  1KL9 A;  4LJX A;  5J2J A;  4P4O A;  3AUO A;  5J0W A;  3H4B A;  3QU5 A;  5ALT A;  1NOM A;  4IQU A;  5J2I A;  4B9U A;  3WKE A;  3B9J A;  2ISP A;  5KFI A;  4AYB F;  4JMU A;  1RZT A;  4NLG A;  2K60 A;  3V6H A;  1RM6 C;  4PHP A;  1LKY B;  1TKD A;  5KFR A;  4MF2 A;  2KIW A;  1BPB A;  3H0L B;  3WK6 A;  4DFP A;  1J2M A;  4ED0 A;  2W03 A;  4F2R A;  8ICN A;  1JXL A;  1Q8K A;  4EX6 A;  1ZJM A;  3RR7 A;  1SKS A;  2LYB A;  2YML A;  4O3Q A;  3C1Y A;  5ALO A;  5ALY A;  4ECR A;  5AKE A;  4OO1 J;  1L8O A;  1J2N A;  2ZXH A;  4PJ0 U;  2JMG A;  2XY7 A;  1D8L A;  4QW9 A;  5AKK A;  5J0U A;  2PFP A;  1XS9 D;  3DV9 A;  1WWU A;  4DSJ A;  7ICL A;  3C2K A;  1NK5 A;  4NL9 C;  3PV8 A;  3OJS A;  3GV5 B;  1DK3 A;  8ICZ A;  4FO6 A;  5AKY A;  4O3P A;  1ZD5 A;  2NRZ A;  1UT5 A;  1N61 A;  9ICK A;  2BQR A;  3OSN A;  4J9K A;  1MC8 A;  5AM2 A;  3GIJ A;  2K4H A;  4R63 A;  5ALP A;  4ECQ A;  2BQ3 A;  4QWB A;  2FLL A;  7ICU A;  1NKB A;  3N7S C;  2ASL A;  2F1J A;  3AEV A;  4R8U A;  7ICI A;  1RYS A;  2WF6 A;  1PVQ A;  4IRD A;  4F5R A;  4P4P A;  3JPS A;  5KFQ A;  1Z1B A;  4KLJ A;  2W9B A;  4AP9 A;  1SL1 A;  5ALJ A;  1U45 A;  1ZD3 A;  3SD7 A;  4NWI A;  1L3T A;  3HRD D;  4F4W A;  8ICQ A;  4F50 A;  3AL0 B;  5EE9 A;  1NZP A;  3D2N A;  1COO A;  3SZ2 A;  1MSW D;  2H3V A;  4EYH B;  4TUR A;  2YMM A;  5HHI A;  1QSS A;  3UMG A;  4IR9 A;  1XU4 A;  2WF9 A;  5JU5 A;  3D6J A;  4F72 A;  4YG2 A;  3NTU A;  1Q46 A;  3Q8Q B;  4RQ0 A;  1RYU A;  3RJF A;  2D3D A;  4F2S A;  2EAO A;  3EYZ A;  2WTF A;  2AXT U;  3WU2 U;  4J9P A;  3I76 A;  4DOB A;  4KLO A;  3OPX A;  5C5J A;  1TAU A;  3HW8 A;  2XID A;  2KJ9 A;  3RRH A;  2JH7 A;  5KFV A;  2BPG A;  2RDI A;  5KFW A;  3CP8 A;  4OCZ A;  4C7Z A;  4UAT A;  1ZQP A;  3RAQ A;  4M0A A;  3TAR A;  3SAG A;  5F9N A;  4P2H A;  3RB0 A;  3H40 A;  3RB3 A;  5J2D A;  2ZIU A;  4QZI A;  4UBB A;  4RPX A;  3RTV A;  5KG0 A;  3SQI A;  4DL4 A;  2ESE A;  3TKA A;  4JK1 A;  3QU7 A;  5CB1 A;  3Q8M A;  2JEI A;  4ED3 A;  4PPX A;  2W7P A;  5III A;  2BGW A;  1XWL A; 
#chains in the Genus database with same CATH homology
 2EZY A;  1CI4 A;  1QCK A;  2ODG A;  2EZX A;  2EZZ A;  2BZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...