2F08A

Crystal structure of a major house dust mite allergen, derf 2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
b'DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mite allergen Der f II
publication title Crystal structure and some properties of a major house dust mite allergen, Derf 2
pubmed doi rcsb
source organism Dermatophagoides farinae
molecule tags Immune system
total genus 29
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2f08A00
3VQ2C 3VQ1C 4G8AC 5KWYC 2E59A 1A9VA 3M7OA 1KTJA 2HKAA 2F08A 2E56A 1NEPA 3B2DC 3ULAB 1WRFA 3RG1C 3WEAA 3FXIC 1AHKA 5IJBC 1AHMA 2Z64C 1XWVA 5IJDC 3T6QC 5IJCC 2Z65C 3WEBA 3MTXA 3MU3A
chains in the Genus database with same CATH superfamily
2HLFD 2J3SA 2ZWKA 3ZKSD 3I50L 2F5BH 2F74A 5I0YA 1G7IB 1JVOA 1QLEB 2VIRA 3KXFB 1CS6A 1KPRA 1OSYA 3U4BH 2BXYA 3LRGA 4NT6B 3CIQA 4DKAA 3VFSB 2IAAC 4QXUL 3ULAB 4C58B 5I6KA 2VDPH 2GUOB 4KDWA 2RD0A 4MLSA 1NIAA 2IXQB 5ACZA 2GTZA 4EN2A 5KVDH 5T5NG 4HBCH 5L0QB 2J43A 1WO2A 1T1YA 1R75A 2BK8A 1TJMA 3WNOA 5A43C 1P4BL 1UZGA 5E9NA 5I9QB 1MWAA 5FYKL 3VXMB 4OGYH 1O7DE 1WS7A 4BIKA 5KSVB 5DQJB 1A4JB 2NY0C 3KL0A 1W8EA 4JGNA 1R19A 2YA2A 1NGZA 1G7HB 4A39A 2HFEB 3GSXB 4UT6A 4N2BA 2R83A 5IB5B 1YY9C 1CI3M 2X1OA 3F7VB 2COQA 4XWGL 1CXHA 4KMLB 5DUPH 5F3BA 3O3DA 1NAMH 1P5VB 5AALA 3RZWA 3U9PH 1G4MA 2YKLL 2IQAB 4H25A 3QNZA 1QVOA 4RGMB 1TTCA 1NQBA 1KJVB 4Y4HD 4GXFA 1WWWX 1RURL 4Y2DC 3GI9H 5HHVH 1HEZA 1ZXKA 2OI9C 2IQ9L 3POCA 4MHHI 2H26B 2VZOA 2BMKB 1FLRL 4N90E 1N26A 1YEGL 3OJVC 4ZQKA 1YNKL 4J3WA 3OQ3B 3MRJA 5BZWA 1RUQH 2V5YA 1TO4A 1RMFH 3HI5H 4JY5L 1QEWB 2Y24A 3OKNB 1BZ9A 1KB9J 1F4AA 2WUBL 3NIDB 4JDTH 1U91A 5FYJD 1BVLB 3APCA 4LLAA 3VVVA 1I53A 4PJGB 4AQ1C 3CCHA 3GFUA 5I8EA 1Y07A 3VXPA 2Q7YB 1BBJA 4IOIA 2TAAA 1KUMA 2OMBA 2D9QB 2DRUA 3BPLB 4TLTA 2ZCLH 4AM0B 3SOBL 5LG1A 1HINH 4DQAA 2RJMA 4M4RB 3FF7A 3DURB 4EUPH 3N41B 1XL4A 4A38A 4K94L 1ACCA 4I1PA 2NY5L 1S9VA 1G84A 2Z9TA 5GGUB 5HP5A 4B0MB 1JK9B 2NYKA 5IIEA 1I1AC 2AITA 2QQNL 4ZMOA 4JPIB 4DUWA 3KPNB 1QLFB 1KDJA 3PWUB 3PWJA 2H41A 3MJ7A 4MD4A 1DJYA 2QMJA 5IQ9B 3O3BA 4JM4L 2ESVE 3RP1A 4X9FA 3V7AE 2NTSP 1IC5H 5ILTH 3HR6A 4YX2L 5DD6A 4DHLA 3G6JE 1T2QL 2FHFA 4AMXA 4TKWA 2DN7A 1HXMB 5E5UB 5F0PB 4PLKC 5ESAB 2M8XA 5EC1B 3HW7A 4ONOA 1FVDB 3BKYH 1NLBH 1DBAL 5JW3H 3L08A 2F08A 1XDTT 1B0IA 3PAZA 3EF4A 4PV8B 3E9UA 4NUPA 3UG5A 3G5XB 2YUZA 2NY4D 4RWYL 1YMMD 5I5MA 3EXLA 1UT1A 1UWEL 1WCBA 2IH1B 3QUZA 1RUML 1HXYA 1OM9A 4LASL 2G4EA 2PYFA 3VFPA 2XTJE 4R4ND 2DLTA 3L4TA 3H55A 4DP5X 3V6OA 1Z3RA 4D94A 4XVUC 1E3FA 3NDYE 1E43A 1RIUL 1ASPA 4AXWB 2E9GA 2CLZB 4BKLA 2UYLA 1G9EA 4LLMA 4N0YL 5BOPA 5B38G 1ZV9A 1BM3L 1YC7A 4UOZA 3Q05A 5DA4A 3CN4A 1GJWA 3FQ1A 1NKGA 3LDBC 3RNKA 3GHEL 2F54E 3FQNA 5HI5D 4I88A 3B8SA 2O93L 4Y4KA 3K6DA 3U46B 4MVBC 5J57B 3KXFD 3TO4C 5I1DB 1P4LB 3N9GL 4KOCA 5DF0A 3WN5B 2AANA 3AXHA 1H15B 1JHTA 1F42A 3QDGB 4CC1A 2JJSC 1EXUB 3VJ6B 2KI6A 3EFFA 1MRCL 1JWMB 3HE7A 3N85H 3ZE0E 4NJAH 1U8CA 3RVXD 2CE6A 1QFUL 3ZT7A 1FFQA 4RESB 1UYWH 4N5ED 1B2YA 3EJSA 1DQDH 43CAA 1GTFA 3RDTA 3SYAA 5D1QE 1M05A 3DVFA 1RZIB 3OR7B 3VXMD 4ZQTA 2Y6SD 3BE1L 4C47A 4EO5A 1SXCA 4S1DC 3WS3B 3OG6B 3RKDD 1F2XK 4KXDA 1K6QH 4M6NH 3MPCA 3NABL 3VCLB 1NCNA 3VB9A 4U6XB 2E7MA 3EHBB 4F7CA 1IB5A 5IUSA 1JYWA 5I30H 2XKNA 3STLB 5IHBA 5F93C 3P30L 5IP4A 1PS3A 5L7XL 2M83A 2YAFA 1IBGH 1I1FA 4I3GA 3KLHD 2CDEB 3ASWA 6FABH 2F7RA 4UTCA 3TBWA 2DQTL 4ZDHB 1F3RB 3I2CH 1W72H 3QFJE 4ILDA 4MJHA 5H35A 2AK1L 2OYKA 3S8WA 4Q58C 4XBGB 4J1UA 4N2OA 3IFNH 2XZQH 1BEYL 4RWHA 2FX9L 1J8HA 3VSQA 1LXMA 4A2HA 5CS7A 3C6LB 4YPJA 4AH2A 3PJSA 5J9PB 4A6YL 4MJ6B 2X89A 1LM8V 4WKXA 1X6LA 3IDJB 3MRDA 3RZCC 2C3XA 3LEVH 4QOKA 4ZMTA 2CLVA 1ZS8A 3ZQWA 4XXWA 4P46C 2Y2TA 4J3OG 3SYOA 1U6AH 1FV1A 3WD5H 5I28A 4PJDA 3VFUB 4FYQA 1KGJA 4N22A 2AQPA 5J6HA 1H5BB 2FZ3B 4NO3A 1OQOA 1RHHA 1VEPA 5I6XB 4IKNA 5FA4B 3QW9A 2Z8VC 4OB5L 1MAKA 1A9EA 4JDVB 3UZEC 2DMCA 4ERSL 2P80A 2XOTA 4Y16D 3DX6B 3CE1A 3MA9H 2Z91B 2NMSA 4C59B 3PAYA 5KYUA 3QNXA 4D9RD 3ZO9A 4OM1L 4IU3B 4WHYG 5MEOA 1ZV5A 5FK9A 4DN3H 1SJHB 1E6OL 3HKFA 1L5GA 5EB9A 1OV8A 4APQA 4HJIA 4F2FA 3IS1X 3ULVE 3U7WL 4PN6A 1TFPA 2V9TA 3G5ZA 4LU5H 4TQIA 4OBRA 4QWWC 2I24N 1JL8A 3IDGB 2OM5A 2OXGB 2WJ7A 3ME0B 4K5OA 2DDQL 3NSYA 5IFHL 2KT6A 4XMZA 3M46A 3AU0A 2VLKE 4HGWA 2V5RA 5EC2B 3LS5H 1ZEAH 3CC5A 2ZD0A 3MBED 1ZMYA 5ITFA 2WQSA 4PB0H 1A6WH 5DRXB 4AW7A 4PSPA 2R9HD 1SEQH 1ETA1 4AZ8A 2E6PA 2EIZA 3QXDB 4LLWB 4OR1A 4FABH 1E4XH 2O72A 1JGIA 1L6PA 2DQGL 3ESMA 1D5RA 4KV5F 4U33A 5CKAA 3QUXC 4HG4J 2R2HB 4PYHA 2CGRH 3IE4A 2FIRT 4A2DA 2XQYG 5HHQB 1XAUA 4RSVA 3LZLA 1X5IA 3QJOA 2XXGA 2ROXA 3ABGA 3ARDB 1UJTA 4PJCF 2WKLA 1RZFL 2ITDB 4JPVH 4QHLA 5HYJE 3PABB 2C4XA 2NY6C 2WO4A 4UB0L 4BK8A 3EYVB 1K8IA 2FT8A 1SOQA 1R0AL 4RISH 1NEZG 4PLOB 5E8EA 3VXNA 4G82A 1ZLVK 2X09A 5KBMA 3HG4A 4M93C 5LBSL 2F61A 3LY6A 4G9FB 1MHHA 3E6HB 2BNQA 2H6PB 4P2AA 1I75A 3WNLA 1PFCA 4Z3IA 1RULL 1ZVHA 5EN2B 1NMCC 5JHMA 4AOFA 2ZP8A 1FCCA 4NQUA 1YEWA 5IB3B 4KXZH 1QSEE 2W91A 4I77L 1AZUA 2DLHA 4NP4L 2D4DA 3SCMC 2QKSA 1CGYA 1UXMA 2IBBA 2QVKA 2NNAA 5IEKA 4QRAA 1EEYA 4IGBD 1E4HA 4JQVA 1UZ6F 4AEEA 3EHBD 2IGTA 3E2HC 5JQHC 1I1YB 3QDJA 4I0PD 4TRPL 5I74B 4BBWA 1GAFH 3V8CA 5CM1A 4OCRL 2ZP0T 3PNWB 3K80A 4MRBA 2J4WH 1QUNB 4HKXA 5AKRA 1WAAA 3EGXB 5DT1L 2IGFL 4E9RA 3ZTJH 2FL5A 3PPSA 4JO3H 3WNPA 1ZANH 2XYBA 3VU2A 2H6UA 2UVFA 4BDVA 2DQHH 2Y72A 2A3TA 1OAZH 5DYFA 4GQZA 1JYNA 1XT5A 4NHCL 3T0EA 2OYPA 2ADGA 3FFDB 3MNZB 1W9XA 2XQBH 1CLVA 1S3KH 3C09C 2L7UA 1NANH 2ZX8A 1GGUA 3MRIA 4PJHF 5LAPA 4Y7OC 2HPOA 3MCLH 4GI9A 3HVDA 4L0PB 3MOQA 2D0GA 2C4FU 3FQRB 2GC4C 3FONA 5J8OA 4I87A 5H94A 4M1GL 1I3VA 3REWA 5CWSB 4H8QA 2F53B 3QCVH 5TGBA 1HQ4A 1TKWA 2MH4A 1HEJC 4NQEB 5IHWA 2AS5M 2O6CA 3PQYE 4X6CA 5TQ2L 3THML 1LWRA 2AJUL 5E9AA 4XVTH 5D7LA 3TYFA 1LEGB 1ADQH 1KENL 3BWAA 3DRQA 4HH8A 1FH2A 4MJIA 4RAVB 3VXSA 4GRLC 5I1LB 3L54A 2WD0A 4Z76A 4CU8A 5FM5O 2VUYA 2MNJB 4LVNC 4FQLH 1S7WA 1CE1L 4PS4H 4AL8C 4DGYH 4IYKA 3GSQB 5E4OA 5A7BA 3S4SA 4C83A 5TPWH 1RIHL 1GS7A 1WBXA 3T8MA 2OL3H 4JRXA 4NWTL 3CXHK 5JYMA 5I6LA 2PP8A 1FZMB 3KPQA 1HIMH 3ZIMA 2ADFL 1XTLA 5FWRA 1G9NC 1VCAA 2BIMA 3RUGB 1NFIB 1HHGA 3QQDA 3SJVD 1TENA 5D2LF 1X5XA 4EMZA 1NGYA 2VAAB 4XCEA 1EO8H 4IHOA 1R3KA 5EU6E 1QOKA 3ENEA 3HHSA 2V7NB 2A77L 1BJ1H 1E3XA 2YAOA 3FMGL 3MODH 3FQYA 4UT6L 4K8RD 5AAPA 1JNNL 2GTWB 3QS2A 1KMGA 2G60H 1RZJC 2ZPKL 4ICWA 3S3CB 4ZXBB 4X99B 2E8ZA 1AR1C 4NAJA 1ZA3A 3G08A 4K2UH 4PRPE 4R5XA 1T1XB 1O6TA 3GTVA 3SDDA 3HA0A 4M03A 4HSQA 2JI1A 5FHBH 5MENB 4NO2B 1B3JA 1N8OE 2CO4A 3CDGA 1PBYA 4XTRD 1ZD6A 1PKQA 4ZX5A 4K5LA 4LSTL 3ARDD 1CG9A 4KROB 5IW1A 3VW3L 4LARH 2X4NA 2PTTA 1XX9C 4OZFH 1QZNA 3CDYA 1FG9C 4C56E 3DPDA 5CZXD 4KHXH 1R5WA 3CN0A 1MDAA 2OLDA 4FQIL 3DJ9A 4N2NA 3IVKA 1QATA 1NUNB 3P9MB 1VLXA 2OS7A 2XPGB 4M7JL 5EF1A 4U3SA 4XPFL 1CLYL 1R3HB 2GEEA 3B3IB 4HIHB 2ATKB 3HBZA 3VXQB 3JYBA 1LQSR 1EEUA 3EGSB 3MOAL 1NGQH 1DE4B 3ESNA 2XBDA 3HZVA 4Z78B 1GGTA 1FGVL 3Q8BA 4JHAL 5E24E 2AGJL 1HN1A 2C8NA 1EJ8A 5IQLA 4F92B 3O81A 4GXUN 4YHPA 3F7RA 3QIBD 4WWKA 3W82A 3AAZB 3S88L 4MNQE 4Z7VA 3DUSA 3V6ZA 3LMJH 3LVEA 3TA3C 3H7LA 1Z3GL 4PIRF 4Y5YC 4NN6B 3MVSA 3UBFA 2XA8H 3S36H 3BGFC 4NNXB 5I16A 3QEQA 4N0FA 4AIOA 4K9EL 4LSDA 1A7NH 2Y9RT 2QQLL 4MS8C 3GB7A 3HUJE 4OLUH 3L1FA 1QFPA 3NPZB 5GPRA 1DLFL 4NRXA 1RP9A 2BIPA 3ECBB 4QRPA 4YHLL 4K5PA 3GTTA 2R29L 1J88A 2UY6A 3GXMA 3CXDL 5G5DA 1HTYA 1XIWD 4LSSH 3I85A 5SWZA 1UA6L 4CMMB 3EUDA 2HT4D 3A6CH 4RZKA 5J1AA 4F8NA 2A73B 1KXHA 2TSAA 2L7QA 2RQEA 4F7MA 3OXSA 3L8QA 3QQNA 4UOW0 1D5MB 3QR1A 3IJHA 4JRYE 4L1LA 1UWGL 1YPZB 1WZLA 2J2ZB 3ES6B 3HZMA 4LLQB 4BWTA 1XL6A 2ZG1A 2A4ZA 1D5BB 4HIEA 4XAKD 1OQXA 3ZHDA 1L9SA 3UGEA 4Q6IC 3CMOH 3L6FA 1O7DC 2NT1A 4JFDD 5C70A 5JPMB 2BC4B 25C8L 3GHBH 4YHIA 5A3ID 2JQZA 3M1BB 1USZA 3QJQB 4PTTB 1KELH 1JGVL 2OJ1A 3BD5A 2Y23A 4HULB 5A1AA 1MEXL 5LCVH 4JFPB 3SY0A 4JANA 3IAGC 2QQKL 1ACYL 1A64A 1EFXB 2KS0A 5C92A 3KYNA 1CD1A 2I26N 1H3PL 5DC2A 2AV1A 4LSVH 2B15A 2QL1A 1KWKA 3D06A 4PEEA 5KJ7E 1CFVL 1D6VH 4PWIA 5GGQH 4V1DB 3VWJA 1HHJA 3NRQA 2YA0A 1EV2E 5DD3L 4NENA 5TDPB 1W80A 1NGWA 3FCSA 1CZ8L 2VERA 1KIUB 1YQVL 4HEPA 1NBYA 4IBLT 1RD6A 1X9UA 5FS5A 5E6YA 4JFEE 3KR3H 1AFVH 3X1EA 1MOEA 2Y06L 3DSFH 4FKKA 2X1QA 2ZSVB 1B4JL 4M5YL 5DVNA 1ED3B 1FYTE 3DX8B 3H9SB 2R2BB 4YJZL 3D30A 2XUWA 5KVFE 3QUYC 1MJJB 4QEGA 3W11D 2UWEE 1QBBA 4ONGL 3BZFA 5IROD 4ZNCD 4ZXBD 1SMDA 1AE6L 3GK8H 4JEGB 3IBOA 4XB8A 3PDDA 3FULA 2JCCB 4ZS6D 4IRJD 2AJ3A 2Z64C 3GIVA 4PSRA 1VFBB 3HN3A 3DUUA 1LYQA 4LSQL 2QMKA 3IWUA 1RY7B 2PO6D 1FFNB 5DRNA 5F2FA 1ZLEA 2CA4A 3K4ZA 5LHDA 4DSYA 4N28A 3FTGB 5DFAA 5EU4B 4KVCH 2HVKA 5JXED 4UQBA 4PRHD 4FULA 4WEBH 4H8WC 4N2HA 4MS6A 3MRCA 2FD6H 5IVOA 4LOEA 2NW3A 4M6OL 3R8QA 4KZDL 1UEMA 1OAXH 5GJTL 3SBPA 4BFKA 4RMQA 4P3DA 1MCJA 2CKBH 1GYVA 2ISDA 2XA3A 3SYPA 3VWKD 5FB8B 2R7EA 5J3HC 3FZUD 5F9OH 1XO8A 3S5LG 4L4TE 5DJ0B 4QRTB 1MJUL 4N2GA 1C5CL 1JK8A 5F88A 1N2RA 2H8PA 3CLEH 4JY6B 3ZKMC 3QZWA 3GPSA 5D2NB 3GRGA 3B9KB 5HJDA 3GBLA 8PAZA 2YD5A 4S0SD 5E2UH 5JTWA 1A7QL 2XTJC 1KCBA 1WH0A 4Z6AT 2O5YH 4TTDD 3D39E 3CVHB 3BH9A 4DWHA 1KGXA 4NO0B 3RL2A 3IBEA 3HBQA 4BKTC 1T0NB 2NZ9C 5H2BB 4IU2B 1YEKL 4M7KH 1QP1A 3SKOB 2Z1PA 5EO9A 1DQJA 1ZT1A 3O0RL 2HB0A 2R0LL 3ASOB 3BPOB 3BVNA 1IUZA 1G0XA 2WLIB 2Q3ZA 3ZDXE 5AL8A 4LHUB 4E5XG 4N2KA 1EK3A 1TNNA 5B1AB 7FABH 4U49A 2QBWA 1B0GA 1J1OL 4FZEH 4L18A 4RGNB 4XC3L 3TZVB 5EORH 3F62A 2EYTA 3V9FA 4JG1L 1XF4B 5ITBH 1A3RL 3IKCA 4JO2L 5AVQB 3OG4B 4JLRA 4XNXH 1L6XA 5CIPB 4JR9H 2VYRE 3MDJA 2E6JA 4GBXD 4MZIA 4HD9A 5D1QC 3VXUE 5C6TL 3C2SA 3BI9X 1JXKA 3S3SA 4QJ4B 5HVHC 2PR4L 3NIDE 5L88L 2WHVA 1LDPH 1KY7A 3Q6GH 4PJGE 5EDXA 4YBQC 2A6DB 3RRQA 4D2NA 4ZUSA 2FJGB 5ICXB 4MAYC 5C0AA 3QJZA 1KN2L 5DO2D 4YGAB 3V5HA 2QTEA 4V2BA 2EIBA 1EFXD 4TSBL 1SYVA 1TQTA 2ZOLB 5I5IA 3BN3B 3HG3A 1H6TA 1NCIA 5E6IB 2N01B 3D85B 3DIVA 4TS6A 1IGFH 1H8SA 4B9FA 3KYOA 3KWWA 4PJBA 3TURA 4JN2A 2L3BA 3MLVH 5EUKB 3MRBA 4V1DD 1W91A 1KLUA 1SF5A 3TJHC 1OAUL 1TYEB 3NESA 2BSRA 3QQ9D 1L7TH 1TJIH 1CFQA 2WTPA 1OKEA 1MREH 1WQVT 3F7QA 1YVLA 4NKOA 2C3HA 3NEEA 4U05A 5ID0A 5IM7A 1HNFA 4N8UA 4AL8H 3KPRB 4X6DA 3R06B 1N64H 1WWCA 4XNZB 5LGHH 2XWJB 3KPMA 5CKGA 3MLSL 4KNSA 1N5AB 1SBSH 4FEIA 4X5LA 3CZUB 1EGJH 1K8DA 3PWPB 2EYSA 4KJPD 4OZHA 4FQQA 1CL7L 3RWDB 4WFFE 1HC1A 4FQCL 4YC2B 4OZGF 3DOSA 2ICWI 5IBLD 2K8QA 3QSKB 1FC1A 5EOQH 2ZICA 4IQHA 4XXCC 3WKML 3IRCA 5ICYA 2W5PA 4FS0A 4ANKA 1HSBB 1AD0A 5CJBA 5F9AC 1JZHA 2XPYA 3KEHA 3KNBA 1TSRA 4RZCA 3NAAL 4J3TA 1FA4A 2EIMB 4HLZG 5CEZL 2E56A 1WEJH 1RZJH 3QXTA 2IPKA 3DVNB 4J27A 4M8QB 3RFZC 5D7IA 4QKXB 5E95B 4KTGA 4DCQA 1M3JA 2Z34A 1A4KB 3A21A 2P49B 5DFWH 3UO1L 4F9LC 1LK2A 2IJ0C 4N8CL 4PY7B 3LX9A 4WK0B 5ABAA 4AV0A 4GI8A 4IRSB 4MASA 4Q2ZA 4GUOA 1A2YA 1IVLA 1B3IA 1VA9A 2OX5A 3QARA 1AQDB 5HGGS 1I7UB 4AJYV 4YL9A 1KGCE 3RPIB 2XBZA 1JNJA 1NMAL 2BWQA 3GMMB 3EZJB 1J8KA 4PRBB 2VTFA 2K4AA 4UI2A 5GRZA 2QV4A 4R7XA 4DPCX 4A37A 4F2MA 2E6QA 4JPWL 2WTOA 5C0BA 1UXWB 5K39A 2BRRH 1IGJB 1ZHBB 4JZJB 4HFWA 2DQ6A 4GEJA 4H8UA 2EKSB 4PG2A 3ARGA 4MXVF 1LTXA 4BK5A 4G42B 4QO1B 4J4PC 4D8OA 3PHQB 5GIRA 3W56A 3LN9A 1DFBH 2EXWC 3DIFB 4JM0A 1QFHA 1RP8A 3NCEB 1WF5A 4W68A 2K8MA 2G4GA 4E41A 2COVD 5EEVA 1T1ZA 2VR6A 4UZSA 3RWJB 3IDMA 1MVFA 3MRLA 1IM9A 2CBOA 1KCRH 1XZ0B 3FT4A 5FECB 1UTDA 3TVMA 1U3ZA 3LN4A 2A6KA 4JL2A 2BS9A 3NFPA 1RUAL 1UD4A 3MLYL 4RDQG 4LEBA 3UTPE 2A9ML 1W8OA 2A99A 1IEBB 3VRLE 1DQLH 3DTDA 4I18C 3B6SB 4JM2C 2B0SL 4KKCC 3WMSA 3V9CA 1SOKA 1M7XA 2VDKL 4UDUB 4WV1C 5CEYA 3G04B 3PCYA 2XWCA 5HY9B 4L37B 3VGFA 2ZWZA 2F8XC 3GIZL 4AY0A 1KCKA 1G9MH 2Y0SA 2VC2H 4RFNB 2QSTA 3UPCA 5T3ZL 4ZUWB 3ARFA 4WU7A 2ZKHL 3KWUA 1B9ZA 5GS0D 3EBGA 2VQTA 3BEWB 4OI8A 4PRNB 2XZZA 3EO9H 4PCSA 4HMCA 5DZAA 3UTTA 4B50A 2KLSA 5E6ID 1I1CA 3D85D 4DO4A 5HDBF 1BGXL 3QC6X 2A1WL 3MLPA 2YPLA 1Y0LB 4Z7UF 1GZPA 3RAJH 1DTUA 2W9DL 4N2DA 2JKJA 4I13B 2VRKA 4OJEH 4Z7OF 1ZHKB 4DW2H 3UROR 4WTQA 4LOVA 4BQBA 4NQCA 3CXFA 3RKPA 1LNUB 3WSQL 3BO8A 5IHUH 3E3QC 3MA7A 2JSFA 3DIDA 4PJIB 3BCFA 5D2LA 4JFFB 2AQ2A 1IGMH 2WLNA 1BQHB 1ZT7A 4KRPC 2J8UF 2B1AH 2DYPB 3K2UL 5DVLA 3S8GB 3O8XD 3OJDA 4ZS7L 4UDTB 1K5WA 5EULV 4G72B 1NAKL 2HUEA 3PWPD 4UIMA 3TN0C 4D9LL 4GXVH 4NUGH 2I7SA 5E2TL 4XMKL 1XF2A 2DH3A 2GSIB 4PWFA 3X13A 5SV3A 3NIFB 1EH9A 3RGVC 1ETZA 3LD8B 1NDGA 4FJZA 2HWZH 3X1BA 1CYWA 4Y2LA 2WOYA 4P8QA 4ZO9A 4G43A 4KK5C 3PWNA 4L3CB 5EEYA 1BFTA 4YZWA 3QFJD 1TJGL 4UOW1 1FNSL 5T3XE 1KIQB 4LESA 1EMTH 2WGXA 4YUEL 1SLVA 3US9A 12E8L 2BDNL 4FD0A 4OUUB 1E4KA 3B37A 3I6LD 1KB5A 4R84A 5IT2L 3NSDA 2Q8BL 3MO1A 1IMHC 1CTNA 4OF3A 4KJQD 5TJWK 1CI5A 4Q9RL 4RVBA 3KJ6H 1M6OB 2AXGB 5EZIL 4IRSD 3TBBA 3JTTB 3PXLA 3QI9A 5CZKA 3T65B 5IJVA 1OF2A 4YGVB 1PX3A 2XKUA 4J8RB 5HHOB 1D5IH 3MREA 3NOIA 2EC8A 2WOBA 3IGAB 1XWVA 3NGBB 1F86A 2W0LA 4O2CB 1Y7VA 4NQVB 3I3DA 1YMHA 2FJFB 5DJXB 3VGAB 4R97B 1E6JH 3BDYH 3C8KA 3FB8B 1FGNH 3G9VA 4H8WH 1YRKA 2NQCA 4DP4X 4FFWC 4AQ1A 4P9HC 3OZKA 2F5BL 2ZOKA 3C12A 3N04A 4MZ2A 1PJ9A 3U4BL 2EIDA 1OGAA 3WHE1 3AXLB 2QVIA 5AOIA 3IDXH 2X88A 2VDPL 3C5ZA 2IDUA 1E3ZA 4JL1A 4HHWA 1S9YB 5KVDL 4JKKA 4HBCL 5D1ZI 4X9HA 2B9AA 3Q2CA 4G9DB 4QYAA 5JHBA 2P4AB 5DHYB 2VQ1A 4N6RA 5KSAD 3RIFK 3VI4E 1FL6A 4LO9A 1U36A 5F6HJ 4KKRA 3EYOA 1D5ZA 2VR4A 4OGYL 3NZUA 2OCFD 2MCMA 3WEOA 2Y3NA 2F74B 4RCAA 1B6DA 2VIRB 2FEDD 2VLKD 4FNLH 1CGXA 4AQ8A 4RFOL 5GRVK 3KPOA 1CICB 4DERA 1UXLA 4OI9A 4P5TC 4HCFA 2HLFC 4GKZA 2NR6D 5I0DA 5ACZB 2GTZB 4MQ7A 2LVEA 2AHIA 5DUPL 2VN3A 1THAA 1T1YB 2DEWX 3F83A 2BP3A 1NAML 3U9PL 1AKPA 3IS0X 4UQ3B 1EZUA 3EO0A 1L9OA 5LAXB 1CT8A 1MWAB 2QKIA 4F5CE 4BSJA 5CLYA 2EEBA 3GI9L 4DKTA 3CH1A 5HHVL 1PLGH 3NCXA 3B7YA 1INQB 4WNQA 2ITCA 1GZHA 1RUQL 5HYJD 3HG0A 5F3BB 4OZFA 1RMFL 2X9XA 1ZCRA 3EO1B 3HI5L 3O3DB 1ORQB 2IOOA 4X7CC 3WE6A 2F53E 1T89C 1MCRA 1QVOB 5I5RA 4UM9A 4HGKC 4JDTL 2N7SA 3WO4C 2NY3B 3WFHA 3LPFA 3WKQA 1MW3A 2ZCLL 4ZQKB 4KU1A 3HJ0A 4YIQA 3MRJB 5BZWB 2DBJA 3NCWA 3FJTA 3OKOA 3QEHB 3D51A 2E9IA 4KQ3H 5F1NA 3RJOA 1QSED 2X4UA 3CFNA 5HI3C 3OKMA 1UA7A 3FSAA 3ZKND 3PIQA 1BZ9B 3EJPA 2CALA 3ECVA 1DP0A 4OLEA 1XCTA 3TO4A 3VMOA 1I3RA 1U91B 2WN3A 3G6JF 1UB5A 3CCHB 5I8EB 1KXTA 3UYPA 3VXPB 2JJSA 3VRIB 2IFGA 2R1YA 4WI5A 4A2GA 5LG6A 4GUQA 5AG8A 1IC5L 3PDOA 1T5WA 3PHAA 4ZPVA 5ILTL 1I85C 5DC0A 3L17A 1CXKA 3NTCL 1S9VB 3ZZ1A 1XGPA 4Q4EA 4CJ0A 1QLRA 3VXRA 4QTFA 1G1YA 3ALPA 2Z4TA 2DL2A 1IBHA 3LXCA 3SDXE 3BKYL 3QHFH 1NLBL 3PWJB 4WUUA 5JW3L 1JVLA 4MD4B 5HYIA 1IILE 3O3BB 3ZYIA 5MENE 1TJHH 2J1YA 3I02B 4TTGA 2O6EA 1XR9A 1H8NA 3ESVF 2Z31B 3D4YA 4I9WE 5DD6B 1UJ3B 1VADB 1TLMA 4HV8B 2G2RA 3CBKB 3B34A 5DJYA 5E1QA 5HPOA 4Z5RA 3B2PA 4YDNA 3CZLA 1QFOA 2SEBA 2FNBA 2Z4QA 2ZXBA 5G4MA 4YSPA 5JQIB 5F9JA 5HHOD 4Z7WE 3SDCB 3RFRA 1OP3K 3V52L 4ZSOB 2O5XH 5IBUG 5FEBA 5KVEH 3QUZB 2G75A 3L5XH 3QJHA 1S7TA 1LE9B 1HXYB 1QPKA 5IOKA 5CP7A 2PYFB 3VFPB 5LCVA 2NUPB 4HISA 3ZE0F 2HG0A 2ZJSH 3FFCA 4YK4B 4Y8DC 4EN3D 4W6WB 2A0LD 3BJ91 1FJ1A 5J0BA 5DHVA 4BKLB 2UYLB 2VKXA 3N85L 4LLMB 5DI8A 3WO3B 4NJAL 5JZ7D 4Y5XC 4J3XA 1FN4A 4FMKA 4PJ5A 3VFMB 1UYWL 4F24A 3OB8A 4BZ2A 4CC4C 3DX9A 3UZEA 2OCCB 3FQNB 4K55A 4KXBA 4NRZA 1Q94A 3PFUA 4JJ5A 4XZ4A 5A16A 3O4LA 1MKFA 3D05A 4Y4KB 1MJ8H 1DHKA 2XWEA 1CWVA 2YSSB 5I6PA 1K6QL 4M6NL 4FG6D 4JREC 4NQSA 4APXA 4LSPL 3EFFB 1I8AA 5HGBB 4L3FA 4L0YA 2JMRA 3MV7B 3NIGE 4MZ3A 3GXIA 5I30L 5C7ZA 3S98A 3RDTB 1M05B 3EJTA 1NCWH 1DVFD 1IFHH 1J5DA 1AXSB 1X9QA 5J06A 1IBGL 2DLFH 5IKCA 4P23A 3JT0A 2WLLA 1LP9E 3QUKB 6FABL 4NQDA 2X0WA 1M7UA 3I2CL 5L0QC 1W72L 3VD1A 3LZPA 3G3LA 3VGEA 2XLLA 3V7MA 5I9QC 1RH8A 4F7CB 5ANHA 4AV5A 2X70B 1PLBA 3IFNL 2XZQL 2H3XC 3E7JA 3BVWA 2BJMH 2YOAA 3DOHA 2G9HA 3FU9A 3S8FB 1I1FB 4IMKC 1CFBA 2M26A 3TBWB 1RZQA 3BGAA 2B59A 1UB6B 3LEVL 5FV2A 5FF6A 5IMKA 5H35B 2JKRM 7PCYA 3D69B 1U6AL 1QACA 3CDZA 1Y6KR 3BW9A 2YD4A 4U0QB 3WD5L 2WAQA 1Z5HA 4EIBA 2VDMH 2PPCA 2PW2A 3PE9A 3KLHC 4G8GE 2VZ3A 1KCUH 3OR6A 4KKAD 2L7EA 3SO5A 1KCSH 2YPKA 4JK0D 1U8JB 4ZO6A 3PJSB 4MNQD 1KFGA 3GHPA 1KCWA 3ULVF 4X2UA 5LB1A 1DJIA 1AZVA 1WK0A 2CLVB 3BMWA 2MPVA 3MLRH 2X4SA 1IZKA 4KI5D 1S78C 1FV1B 1ZLUK 4DN3L 2I25N 1A7PL 4PJDB 1P69B 4U1HA 3WTSA 4LCWB 1GCYA 3BXNA 5J6HB 1RHHB 1E9QA 4X9GA 1CIDA 2AP2A 4P2CG 4L8CA 4P59H 4IW4C 1A9EB 1XBRA 3OKYA 3BPLC 4JGJA 4QIRA 4OFYD 4P2OA 2MNWA 3QNXB 1AHWA 3LS5L 4S1QH 5FYKE 1ZEAL 2JCCE 5MEOB 3FB7A 2G3ZA 5FK9B 3ROOB 3CXHJ 4PB0L 1A6WL 2Z31D 4ODVH 2MTPA 1U33A 1L5GB 4APQB 1SEQL 1HL9A 1KBBA 1IC4H 1KXQA 1A22B 3J7HA 5F9WB 4FABL 2EDQA 3KZ8A 5DRWA 1E4XL 1TMQA 2B4CH 3KVQA 5E4AA 1P2CB 3VRJA 4NKDA 2J7LA 4H0IA 2WMPA 3ZLQC 2ICWB 2Z7WA 3FSZA 1FBIH 2CGRL 3BMVA 1OPGL 3AMLA 3CDCA 4GIPD 4H1LG 3JTBA 4I2XE 4CDHA 1U3YA 3SDCD 4G1EA 5ITFB 2ZUWA 1A25A 1C8PA 4AZ8B 4JPVL 3D34A 5HD8D 2YPVA 4DUXA 2P5EA 2EIZB 4OFIA 5I17A 4NPJA 4RISL 4JM2F 3AWEA 4ZMYA 1EAQA 2NDFA 4Z7IA 2QFPA 1M7DA 1NEPA 4W9DC 1OTSD 3V0WH 2J55A 1FFOA 4ABUA 1A65A 4KUCF 3D2UB 3B7UX 4J28A 3T08A 5LQBL 5B38B 2O26U 3I9AA 1SDYA 2P1YA 1TLKA 1CXEA 1K8IB 3DXAE 1XGRA 4P9HH 1LEKB 3ZRCC 4RBPK 2WWNA 3FH7A 4KVNH 4YO0A 4Q9CA 4NI3A 3HZKA 3MQIA 1U8LB 1MCIA 2LR4A 5D1XA 3LQAC 2A2QT 1F90H 2D9CA 1KWGA 2H1LM 4QPEA 5FX3A 2W8CA 3WFBH 1BM7A 2BNQB 2WQWA 4ESKA 3R4DA 5DEJA 2LU4A 1ZAGA 5K9KA 1EGJA 3MV7D 8CGTA 4C4BA 5FKAA 2JXMA 1NLDH 2ICEA 2YD3A 3H7BA 4Q56A 2MCPH 1H9DA 2XRAH 3MRPA 5EUOB 5I5JA 4MQXD 4RGNE 3WN5C 5BS0E 1ECYA 2BCMA 4X5RA 1ZANL 4P4RA 3UAAA 2A38A 3TJPA 4ORZC 3D0LA 2EVIA 2DQHL 1S5HB 4R96A 2NNAB 2VMCA 2EH7H 5DU7A 1EEYB 1OAZL 5ID1A 1W6LA 4XWOC 2XQBL 4CA4A 1S3KL 3QDJB 3BLPX 3V95A 3BVTA 4GPVA 1N4XH 3BKMH 3MNDA 1UCBH 4HCRH 3MCLL 1O6VA 4PW3A 3BKCH 2C3GA 1QWHA 4JO1H 1SJXA 3MR9A 4BDVB 4ZMAT 3RVWD 1DBBH 2P5WE 3MRMB 3GSVA 1NPUA 3T0EB 2ADGB 1M1XA 1SHMA 2OYMA 3QCVL 3CPLA 4ELMA 3D8MA 2C9UA 4ODHH 3MROA 3MRIB 4LFHG 2XXCB 3V6BR 1KJMB 4XVTL 2J8UA 2GI7A 1ADQL 1AI1H 4O2EA 1OTUC 4XBEH 5HHMB 1I9IH 5C3LD 1KLFA 4LVOB 2E86A 4X9IA 5EOCH 3I6GB 2CJTA 3LZFH 4LL4A 4DGYL 3D39D 1KGIA 3FN9A 1P84K 5TPWL 5E1AA 4KK8D 5TGBB 3C6LC 1HQ4B 1TKWB 5EZPA 5C07E 1IFGA 5IQ7L 4NCDA 5EO0A 3HNVH 1CDCA 2F1BA 2OL3L 3WLBB 3HC0B 1YAZA 5D7LB 3BWAB 3TYFB 3VXSB 4NYLA 4JFOA 1HIML 1OP4A 4F3FA 2VO5A 3ZX1A 3RE0A 4B41A 2Z1KA 4X7TA 1S7WB 2BRQA 2QFRA 4FNRA 3MXVH 2XWBB 1EO8L 3CBRA 2BVYA 1H5BC 3S4SB 4BE6A 2B2XH 1MFMA 4O02B 4C83B 5A2AA 3MODL 5I6XC 4AUJA 4PGCA 1KYFA 2DV6A 1ODUA 5D93B 1DQMH 3GO1H 1WBXB 4RNRA 3US1A 4D8PA 2AV7A 2G60L 4Z0BH 3RVUC 1H3TA 3KPQB 5AB0A 3S6CA 4RA0C 2WWMC 2XV0A 3BIKA 5FHBL 5GQBA 1J12A 1QAWA 3VXUD 2RCSH 1LO3H 4MJ2A 3OKEA 5DJ6A 5ABDE 3F12B 1NGYB 4Z7QE 4IHOB 1A8ZA 4NAQA 4HXAH 2CKNA 3HHSB 5B7FA 2YAMA 1TVBB 4R4FL 1TTAA 4PJFF 1JVKA 3W9DB 1YYLH 2X4PA 2OMVB 4FQ2H 2CZNA 1DDHA 3BSGA 4I0KA 1GR7A 3ZRSA 1ZA3B 3IM1A 1BVNP 1IE4A 3SDDB 3O6FB 5TF1H 2PYED 5I0VA 3INOA 4YXLH 4UTBH 1PKQB 2P8PB 5CO1A 3MAWA 1CG9B 4PRDA 3D2UD 3PGCA 1RK7A 3FT2A 2Z93B 3S3DB 2MQ0A 2PTTB 32C2A 3V6FA 3BVVA 2FRGP 4B9JA 1I1RA 4TPRH 3SGDI 3EYQD 3DUHA 3EYUH 1OAJA 1NEZB 3TIEB 2P8MB 3ARDC 3DX0A 5E1IA 5J7CC 1E67A 1RZ8A 1JZ6A 3T3MF 3MRQA 3LMJL 1GH7A 3K1KC 3L48A 5EU3A 5EOCJ 2EABA 4DP8X 1NMBL 2ZUVA 3AACA 2XA8L 4XH2B 3S36L 1J10A 4GLRH 4GG8B 3ZSSA 4WF7A 1A7NL 4EOWH 3HZVB 4E9LA 3RIAF 4UU9A 4OLUL 5B7EA 3BAEH 3QULA 3ATEA 2N3JA 1AGEB 1HEHC 4YHPB 2AF2A 4Y0GA 2VLJA 2FH6A 5D1ZB 3C5XA 3DUSB 4ZX4A 4YXKH 3T09A 3V6ZB 3H1ZA 2C9SA 4LSSL 4X0KA 2DJMA 2BIIA 2X6VA 5DUJA 3N43F 2VJ8A 1T83C 3FPYA 1PZAA 2AAVA 3A6CL 3LNGA 4ANWA 3DTXB 1QLEH 5C2BH 4YZFF 4FYSA 4K3JH 4J6RH 4CAGA 3SBWA 2ZWYA 3ULUD 4DESA 3TNMA 3F5WA 1EA9C 3MNWA 4AVHA 4H44C 3VMPA 2FJSA 5G5DB 2XDHA 1HH6A 4P3CH 3D4ZA 3QG6A 3MUGA 5I74C 3DJTA 4BUGA 3CMOL 5FM8A 5JW5B 4QLWA 4JFTA 4G8IA 1NBZA 3GHBL 3RBGA 3VG0H 2DD8H 1OOWA 2MMXA 2K7PA 3OXSB 4UYPA 2RH0A 1H3WM 3TXAA 3ZHNA 4KRLB 3IJHB 1PYWA 1G7QA 3IMVA 5LCVL 3GSRB 2CM6A 2EDNA 1AIZA 1NIDA 1BQLH 2BSDA 1MG2C 4LSVL 5DEFA 4ES8A 2FWOA 3DYOA 2F1AA 3ETBJ 3KL3A 4JFFE 1U8PA 4FQXB 1D6VL 1UM4H 3TEYA 4J3OD 3T6VA 3CHPA 5GGTA 3TONA 1J1PL 1WWBX 1SQ2N 2ZWLT 4DOHE 2IWKA 1NKOA 3DVGA 3ETBF 4J23A 1TMCB 1AD9A 1BFSA 2HG5A 3HZYA 1TZOA 4JANB 1ACXA 4F37K 3KGSA 3VD3A 1AFVL 3K46A 3DSFL 2ZONA 1CD1B 2AQQA 3KYNB 4HMDA 2ETWA 1JV2B 1HHIA 5A3IC 2FUQA 2IV9A 2OMYA 4JG0H 7CGTA 3VWJB 1HHJB 2Q2LA 5A6LA 1ND0A 5IHLB 3UTPD 1NUFA 1NGWB 5KS9F 2F7OA 3L9YA 1B0RA 1T6BX 4EIZC 4UQIM 1NBYB 4UWQB 5T1JA 2YK1H 3SPCA 3CBJB 3GK8L 3L95B 3CZKA 1CDIA 4GY4A 1JWSA 1KZYA 1SOXA 2VO8A 1ERNA 2E7LC 3IGLA 3GKWH 1UM5L 3HNSH 1KCLA 4M1DL 3IPBA 1MH5A 5AVRB 4XCYA 2YZ1A 3QZMA 2IALA 1XD1A 4ZMVA 3QPXH 4L3EB 2FLRT 3PL6A 4WEUD 5ICZA 1F6FB 3G9AB 4Y19A 3QQ3A 4ZNEE 5HPMA 2UXTA 1NC2D 2DMHA 3BZFB 1BXAA 2F8OA 5I76A 4KVCL 1FNAA 5IV2B 2X40A 2LGNA 1E5YA 4WEBL 1EO7A 1XH1A 4CILA 4O58L 4ETYA 2IH8A 2PPDA 1AYOA 4X0NA 4AQZA 4FQ1H 2FD6L 3UPRA 2AJ3B 1OAXL 3DUUB 4MAYA 2CKBL 2XV6B 1T20B 4ZXBC 2ZTBA 4B53A 3I75B 3MUUA 4PRIA 1FAKT 5F9OL 3PHOA 5C08E 1KFAL 4ZS6C 4WFED 1JYVA 3OC5A 1A3ZA 1DO6A 3CLEL 4LCIH 4WI8A 1LHZA 1U3NA 4KROC 3X11A 4BQ6A 2C3VA 3GINA 4LOUD 3MRCB 6PCYA 2BHZA 5E2UL 3S34H 2NW3B 5C09E 2O5YL 3TBSA 5BZDA 4YN3A 3QDHA 1UCTA 4X4MA 5IMLA 4P3DB 1P7KB 3ILQD 4C4UA 3NRFA 2R7EB 1XFPA 3T0VA 4M7KL 3LAFA 1LO4L 1MY5A 4DAGH 4X9BA 4B7LA 4XN9A 1N2RB 2H8PB 3DBXA 4OSUH 5D1ZD 5F88B 3V4PA 3QZWB 4PS3A 3CZGA 3NP3A 4DQOH 4PJ7A 4KRNA 3UYRH 1IKNA 1GIGH 2X6AA 5DMYA 7FABL 4EE2A 5FA3B 3JWOC 3BH9B 3FZUC 5E00B 4RFEB 3IF1B 5T3XD 1TQSA 3SKNA 4AMKH 1OAKH 3F85A 1ZIBA 1SXZA 3KCWA 5EORL 1IQDA 2NSMA 1QSVA 1MCFA 3O0LA 3NIDF 1DQJB 3R1GH 1ZT1B 4PJGF 4XNXL 2YAQA 1G1OA 2WSPA 5F3FA 4NN6C 3C5JB 4JR9L 3QA3B 4HUXB 4PB9H 3DI3B 1IQWH 2F5AH 1HWGB 2VUKA 2WVVA 5FOBA 1X9LA 1T6VN 3GXTA 4NLHA 3TV8A 3HG2A 2MRYA 1LDPL 2QDWA 1DQTA 3Q6GL 3PREA 3N41F 1B0GB 3ATAA 5F1IA 5AAWC 2NW2B 2CG9X 4GUCA 2EYTB 4NX0A 3UTSB 4PJ6A 3MYJA 5BOJA 5CCJA 5KZCB 3IMSA 3GM0A 3IKCB 4JLRB 1ZE3C 3BP7A 5FDWA 1U42A 4DO6A 4OVVA 4EUPG 1IGFL 4FQXD 3MLVL 2NX5A 3D0VB 3U0TA 2Z6FA 1INEH 5FCUH 3ZOAA 4ZUSB 3H85A 1T7YA 4HOWA 1L7TL 1XB6A 5C0AB 1QR1A 5G55A 4HT1H 4M8RA 3IU3A 1G4RA 1MREL 1Y18A 3SO3B 1AH1A 3GNMH 4GRWB 5JPMC 1UA3A 4AL8L 1YN6B 5DQ9B 4PY8J 1N64L 4DPAX 3LEYH 3CX5K 3KYOB 4MCZB 4N25A 4PJBB 5LGHL 4RRPM 5D7EA 4ZMNA 1SBSL 1KLUB 1BVNT 4OZIB 1EGJL 1HKFA 1JDCA 1E9OA 5HBBA 2BSRB 4J4PA 3AB0B 1YEIH 3WNMA 4NKOB 4BJLA 3ZGIA 1JPSH 4YHKH 5ID0B 4AGNA 1M71A 2C1PA 4IKLA 4X6DB 1S9WA 5D71H 2VWEE 5T5FL 3RBSA 1AG6A 1CGUA 3T2PA 4NN7B 4OGQC 4MCYB 4FJYA 1K8DB 4U1JA 4L3ED 3FUIA 3A5VA 1RK0B 2EYSB 1WEJL 3AWGA 3PP4L 4XX1G 4OZHB 3VGBA 1RZJL 4FQQB 2LU7A 5HYSA 4JM2A 1SEBA 4WV1A 2IH9A 3ARZA 3DOSB 2YXMA 4G8EA 1VRSA 2X6UA 1FZOA 1YEEH 2X4QA 2L0DA 5EF2A 1A6ZA 1TVHA 1AD0B 4NERA 2YBGA 4BSWA 4RZCB 1J0IA 1F0LA 5DS2A 3MFGB 3WG7B 3O11A 3ETSA 4OKVA 4PGDA 5CN2A 2YAEA 1CE6B 4JFHE 2JI2A 1ES0A 5EOTA 3U79A 4N1CA 3CU1A 4MAZA 5FLVA 5FO8B 4RAUA 3GJFA 2H7WA 1LK2B 4KH2A 1XMEB 3EH4B 4LPCA 4Q2ZB 1OW0C 1IKOP 2WN2A 4NBXB 2J71A 2BRRL 2XSKA 4H4NA 1M3IA 5JXAH 1I8KB 3SDAA 3ULSA 1MCBA 1E90A 3K72A 3MLWH 1U58A 4IBYA 5JPNA 1DFBL 1N5YH 2D7MA 2FAUA 1M9SA 4XNDA 5IY5B 2MQ3A 2E76C 4XMTA 4LLUA 4UMSA 4F2MB 2DICA 1AIFA 3GTNA 5C0BB 1X5HA 3NCYP 1KCRL 3ISRA 4ZFFB 3ZHLA 3UBXG 1NSNH 3HE6D 1XAKA 1W15A 4JZNA 4GG6A 4I9WD 5D2NC 1DQLL 3B9KC 3V5KB 2ZYRA 2W0PA 5D7JA 5GIRB 5KSBA 2PWEA 2UUDH 3VFRA 4QUOA 2XX0A 3KPSA 2A83A 4K5NA 3SPGA 1WIUA 4XMVA 3MRLB 1IM9B 5KUKA 1G9ML 1I7ZA 4PJ9D 1ROWA 2AEWA 2A6KB 3NFPB 3H9YA 3BPOC 1C5BH 3AS0A 1SDDA 4QHPA 3B5HA 4XHJC 3UTSD 4DNLA 1JZFA 2Z92A 3ML8A 3QE5A 3QIWA 5FM5M 4DP1X 5KZCD 3NCCB 5CEYB 1XQ4A 4AUUA 2EYRB 1J8HE 4RGNC 3TZVC 1DVTA 3BCDA 3HS9A 3RAJL 1D9KB 5CSZB 1LDSA 1JZ5A 1BZ7B 2AQ1A 3ARFB 1C8QA 4QOKE 4WU7B 4DW2L 1T22A 2EO9A 4JZOA 5T1KD 5C0ND 5IHUL 2BIOA 1Q38A 4PJDE 5TQ0H 4R0LA 2R4SH 4N0CC 3TYGH 3UTTB 1HE7A 1IGML 1S7UA 2E8YA 4RLDA 4N24A 4NZTH 5SX5K 2DJUA 3D3VA 3P54A 3TFBA 2YPLB 5C0CA 1GZPB 2CO1A 1KBWA 1PG7W 2JJTC 4GXVL 3IK2A 4NUGL 3EYSH 2X12A 4ZBJA 2WCSA 4NQCB 5E6IC 3UAFA 3BO8B 3NK4A 4FLRA 2GITA 2DAVA 2HWZL 2EDOA 1SUHA 4OZ4B 3D33A 1W0WA 5JMOC 2FR4B 5IVXB 3KEDA 3AS3A 2WIIA 4IOSD 1M2VB 3RJDA 3UC2A 3MNVA 1CU4H 4P5TA 2WBJD 4BRJA 1EAJA 4GKOA 4GW4A 1HH9B 1EMTL 4UIMB 2C4FT 4L48A 4P2QD 4K3GA 4EQ3A 3JYCA 1N0LB 4R90H 2BP8A 4AQAB 1XF2B 3MJGX 4WGWB 3X13B 4FYTA 4U31A 4WTWA 4F1ZA 1C5DA 1N8ZA 4F7PA 3DETC 1NDGB 4FDWA 4AMWA 3CQPA 1N6VA 3NACH 4R4BA 5JNYB 1XCWA 4HCRA 3JZ7A 5DO8A 3EZ8A 3KJ6L 4G43B 5KJRH 4O4YH 4OGXH 4ZAKD 3WXVH 2IWGA 3REVA 3MSPA 3NJXA 4XHQA 1D5IL 4YC2C 3PV7A 5HGHA 4J12A 4JQIA 3H6JA 1YQ2A 3TIDA 4ODWA 3WTWA 5CJ5A 5ESVA 4URTB 2VH5L 1E6JL 2QZ5A 3BDYL 3ARBD 1FGNL 4H8WL 1GGBL 1KB5B 3IMTA 2ZCZA 3MACH 4ZMPA 3MO1B 5A40E 2WKGA 2CHZA 1BIHA 3BHBB 2Y5EA 5SX4H 2HTLC 3QI9B 5IJVB 1OF2B 3BPCA 1A4BA 4R26H 1RJLA 3IDXL 4UAHA 3UTQA 3QZLA 1DVSA 1YMHB 4Y4HA 2CBTA 2BNQE 4PJEB 3K4AA 4JPKH 3BUDA 1EDYA 4IRSC 4DGIH 3TPUA 5F0JB 2VQ4A 4FFZL 4K7FA 3MV9E 5C97A 2EXYD 2ZOKB 3LQZB 1QRNE 3CFKA 4FNLL 4AVIA 4G83A 1V3LA 5FYKD 4LKCB 4Y1TA 4AE0A 2GPZA 4CVWA 2BNUA 3C5ZB 4HWUA 5G4NA 3H8NA 5E7BA 3L9RA 2WZ0A 1E5BA 3MV8E 4HKJB 1GSKA 4PW9A 5AB2A 1AOHA 2VQ1B 1F5WA 4YSTA 1FL6B 5ECJE 1ETJA 1MZYA 3VI3E 3EYOB 2OR8A 5EN3A 1VFUA 4JZJC 2DQUL 2WVSA 1AGFB 5J6GA 3JWOH 3HKZA 4LP4A 1UWXH 4Q97A 1PLGL 2X1PA 1AZZC 3P4OA 2PPFA 3P3YA 4P2RE 4Y9CA 1HL5A 4RQQB 3KPOB 1HZHH 4GAFB 2Y7NA 4JJHA 4GKZB 1OHQA 3DV4A 3BP5B 3X12A 3HPJA 2CPCA 3IETA 5BCAA 3F7YA 3N1PC 1FZKA 1IKFL 1QPPA 1SUJA 5CEZE 5CAYB 1CT8B 4HS6A 2C26A 2Q3XA 2QKIB 2AXHA 1GY2A 2XN9B 4UUJA 3CH1B 2YGNA 2Z8SA 5JR1H 3WIHH 4UTBA 1DBKH 2VDNH 4AT6A 1CXIA 5FOJA 1UADC 1ZTXE 4WNQB 2Q5BA 2BOLA 3BVXA 5GSRA 3A47A 3LHAA 4LLVA 1ZK9A 3ARSA 2YQGA 1MFDL 4KQ3L 4PJXA 3I3EA 1ZE3H 3LKNB 3TFKC 4M7ZB 1AYRA 2OYLA 2FJHA 1T66D 2OXHB 1F00I 4NM8H 2X4TA 3RUGF 3GD1C 5HYQB 4NKQB 4LF3A 2J72A 4X6CE 1AC0A 3CVDA 1YMMA 1PD6A 1V55B 5CP3H 3JV6A 4MJIE 5PAZA 4XP9H 5I23A 1JG9A 3LTVA 3QPQC 4Y5XA 1DJWA 3AGVA 3NDZE 3QWOA 3BUPA 4YIQB 5BJTA 1J0HA 1T5KA 4CC4A 2DM4A 3OKOB 4FFYH 3N40F 3NPSB 5F1NB 3WHXA 1CL7I 1T7VA 1YA5A 2X4UB 3O9WB 3OKMB 2YC1B 4FEMA 3PIQB 1UH2A 4ISVA 4KX9A 1A1OA 1K2DB 1I3RB 4JRXE 3CH8A 1IEAA 2JV6A 3QHFL 1UB5B 2ZWNA 4X4YA 1KXTB 4WTZG 3UYPB 2GSMB 2AEPH 3NEOA 2R15A 5LXGH 4EZKA 35C8L 2R1YB 1TJHL 1X5ZA 1T5WB 3T3PE 2MQCA 1G7IA 3C2AH 2I07A 3KXFA 4NT6A 2DIAA 4Z7WF 4F8PA 2HZHA 2UZXA 1QLRB 4NAMA 3VXRB 1KOAA 1WD8A 1YHPA 5DVMA 3QXVA 1QNZH 1A1MB 1T2XA 1IM3D 3QT2A 4YQXL 4ODXB 1Y6MR 4PVLA 4WUUB 3FTZA 4XO3A 3VVWA 2P5WD 2WXIA 3LVTA 5GRXG 3V9EA 3H9ZA 3VXMA 3MUZ1 5KG9B 2HX7A 1HYRC 1PKQE 5KSVA 3RI5K 5KVEL 2WXNA 4U6VH 1NFAA 4WGKA 3OX8B 5DJYB 5T3ZE 1DUYB 1BF2A 2YKKA 4WFGE 2ZJSL 4WO4B 5IB5A 3QEGH 4MB3A 5DGRA 3F7VA 4YHZH 5F9JB 4E0RB 4WNSA 1P5VA 2NSQA 4GSXA 3O2WH 1YLBB 4HEME 2N7AA 3BEVA 1W0VA 3U1PA 4EDXA 2G75B 2HVBA 2H2PC 1CD8A 1S7TB 3LZQA 1J5OH 2H26A 1CXLA 2ZQKA 5CP7B 4PD4K 2BMKA 5JIMA 4O2FA 2B77A 2I32A 3NGBC 3Q3GA 2ENPA 1FJ1B 1EFQA 2FIKB 4AYFB 5FC9A 3VGAC 4OD1H 4R97C 4Z7VE 3OKNA 1YNLH 4MA7H 5DHVB 3WY1A 4AKPA 5IWLC 2HUHA 5DI8B 5DS1A 3BP6A 1LP9F 1LQBC 1OP5K 5FUCE 3ATFA 4HBQA 1YPZF 4HLEA 2Q7YA 3DX9B 5I1JH 3CFIC 3QEQE 4O9HH 5HHNA 5K9QG 1NCWL 2FYYB 1IFHL 5A16B 4JJ5B 2DWEA 3O4LB 2DLFL 4FNTA 5B1BB 2PWFA 4KO7A 2QSVA 2B1HH 3H42L 4M4RA 3DX4A 4UOJA 4BUQA 4G8FB 3KDPB 3UBHA 5A6IA 4QRPE 3VYPA 3EJZD 4FE9A 4NQSB 4APXB 4M7LT 3RJQB 1ZSDA 3BZDA 1F1DA 3ESOA 4J3BA 5SWZE 4Y16A 4UANA 3PWUA 3Q8EA 1TQBC 3CVHH 1CFSB 1ZDQA 1JZDC 2BJML 2J6EH 2X44D 4YSAA 4YNYB 5IKCB 3FOLA 1CICC 4FG6C 1A8JH 4OCNC 4P23B 3B7SA 2DOCA 1T0OA 2WLLB 2XN9D 3VM5A 4JQXA 4K0OA 1O6SB 2WIMA 2EDBA 2WKOA 3M45A 3Q0HA 3PDGA 3GRWH 5E6SB 1FP5A 1XSIA 1EDHA 4NUMA 2VDML 1OT2A 1XXDC 2O1AA 4JDZA 4LL9A 4YSEA 2B5IB 2NY7H 1NBVH 1KCUL 2HT2D 2KPWA 2JWYA 3W39A 1GGIH 3JWNC 1KCSL 2GHZA 2G9HB 2Q86A 3MBEA 3G5XA 4U3CA 3U25A 3U2SA 5AD0A 2HXAA 2EE6A 4FHBD 2IH1A 3WJMA 1A47A 2B59B 2BVQA 3U1QA 5FF6B 3NSFA 1EJFA 5IMKB 5IF0B 5CIPH 3MLRL 1L9QA 2W59A 3CDZB 2RALA 3BW9B 1VKXB 1C7TA 4AUYA 4MB5A 2YEVB 3OPZH 1U9KA 4J2QA 2HYMA 2NY3C 3RVTC 3I6KA 3LH2H 3O9WD 2JCCF 4TLKA 2CLZA 2YXFA 2YPKB 2DTSA 4P59L 2XVBA 2WNXA 5AVUB 5KVDE 2ATAA 1P84J 1PPIA 3UAJD 4OKDA 5GS0H 4HJTA 4J3UA 4S1QL 4FXTA 4LKXB 3ZT5A 4AEFA 5JOFB 1RUKH 1MCDA 4PS8A 3VD0A 3EBHA 2X4SB 5JYLA 2GUYA 3N1MC 4XMLH 4ODVL 3U46A 2AJVL 4KKAC 1F1GA 1IC4L 4H20L 2CLRA 3QDGA 3BXNB 1CB4A 1EQWA 5IGXH 5CU5A 5D4QA 1CQYA 1EXUA 3VJ6A 4RMTA 3HC4H 1DVXA 3ARTA 3V0DA 4QNPE 1FBIL 3K2MC 4P2OB 1ICTA 1MNNA 1AHWB 1RZIA 2WXOA 4LPWA 4N4YB 3OR7A 3FB7B 3Q43A 2PCYA 1O7SA 5T1LD 4E68A 1XHHA 2D3LA 2LT9A 2ZXAA 1WE5A 3S48A 5DRWB 1VFAA 3VRJB 1QSFE 1V7MH 4NKDB 4OLVL 4PLJC 1ZLVH 5KSUB 2WMPB 3OZLA 4I0PA 2V5TA 5L8JB 1WZKA 1UJ3C 3L2MA 2NXZB 4ZW3A 3V0WL 5BMFL 3N1GC 1BZQK 4G1EB 3VX0A 4TMPA 5FGSA 3BUQA 5AB1A 2VWEC 1QTSA 2RA1A 4JREB 2P5EB 4P9HL 3K81A 5I17B 3WKYA 5J1TC 4QD2E 3UGUA 5IESH 4BEIA 4KVNL 1E42A 5L8KB 2VGLM 2X3BA 2JFCA 1F90L 4D9QE 3P73B 4TUOA 1T5XA 3QUZC 1M7DB 3CJJA 3T1FA 3WFBL 4LDEB 2LW3A 5C0EA 2P47B 4YDVB 4PWGA 3LNEA 3BFOA 1A9BA 1KGYE 1NLDL 4YK4C 4I1NB 4TVUA 2MCPL 3V6OC 2XRAL 2Z7UA 3R19A 1H8OA 1KB9K 3FBKA 2WZ5A 3ZL4H 1XGRB 1QFWM 3TWCH 2V9RA 3VH8A 1AACA 1QBML 2DLEA 2D03H 4FN0A 4X7SH 1GGYA 5AZ2H 5D1XB 4YEEA 2NNFA 1H5BA 3RTQD 2EH7L 1JPST 3H54A 5K1VA 3TH3T 1J9QA 1P7BA 4MNHB 2J8OA 3NSJA 1NWOA 3DX6A 2JXMB 5FKAB 3TH2T 2Z91A 3QZOA 2ICEB 2LLNA 3H7BB 1HILA 4Y4KC 3C6SA 5CJ8A 3MRPB 1N4XL 3BKML 5DWUH 5J4MA 1UCBL 2PWDA 3IDNA 3GMRB 2D3VA 4HCRL 1UH4A 4KPHL 1QI3A 4QCIA 4AKOA 1SJHA 3BKCL 4XC1H 5CD3B 2J57A 4JO1L 4P4RB 5DEGB 1GYUA 1QQDA 3FS9A 3D0LB 4R96B 1NCGA 1QFWH 1DBBL 2B08A 4XX1E 3ME0A 1OCCB 3RDTC 1OAYH 2VLLA 3UIZA 4HPHA 2EXTA 4EKJA 3SJVA 4WW1B 4ODHL 1ZGLM 5LGYA 4F91B 1D3CA 1F11A 1HJBC 1TCRA 5C08D 5EC2A 4EDWH 5C0AE 2IVFC 1AI1L 4NKMB 4XBEL 3S5YA 3UFIA 4HHAA 1I9IL 2YZ8A 1ET5A 3HB3B 3VD5A 3MR9B 5EOCL 3LZFL 3UO8B 3CFBB 5C09D 2Q6WA 1ZTMA 2VABB 3GSVB 2VKWA 3JT2A 4PJBE 2R2HA 5H37H 3CPLB 4ELMB 1BREA 4ALAC 2DEXX 1WP6A 1MCPH 1K72A 2FTAA 1XSOA 3ARDA 4U1SA 1R34A 2TSBA 4O2EB 3BSZH 4C8XA 3PABA 2AABL 3ZT6A 3MCG1 5C1MB 1FFPA 3EYVA 2HFFB 3MXVL 5B21A 2CO7B 4D7PA 4ZMWA 4GS7B 2B2XL 2X2JA 3CGTA 3G5VB 2Q87A 5E1AB 3BD4A 4I1RA 3VXOA 1MCOH 1MFAL 1XCQB 2FWUA 3GO1L 3D9AH 5EO0B 3H4FA 5I1KH 4CNIA 1N6QH 4Z0BL 3S35X 2H6PA 4OZHE 1M9WA 2ZNWA 4KV5E 5EN2A 4XXWC 2XU9A 3SZKC 2LE9A 4IOFC 5JOPD 5HDLA 1RJCA 4BHUI 1JPEA 1LO3L 2RCSL 4KK8C 1L4IA 1JERA 3K2IA 1T83A 3DROA 2YEZA 1ZIAA 2BXZA 1OANA 2EC9T 3HFFA 1IC7H 4PJCE 5F1SA 3QIBA 1EVTC 1YYLL 3KBFA 4RNRB 3QIUB 4XODA 4FQ2L 4OV6F 3SODB 3TU6A 5HXMA 2AV7B 1M1SA 4LLDB 1E27A 1BG9A 4BSVB 5D7IE 5TF1L 3B1TA 3BIKB 4YXLL 4APQC 2ZSWA 3OKEB 2NXZD 5F9WC 2VC2B 2R56H 2XXMB 4TL5A 5J13B 5FHAH 1FL3B 4PI0A 4U7SA 2X4PB 2CR6A 1XIWA 1DUZB 4TPRL 1DDHB 4GMTH 3EYUL 2ZXCA 4OM0H 1CD9B 3VYNA 2JJWA 5JIPA 5ETUB 2CR0A 5AZEH 1SN0A 3PG2A 1XV8A 5LLIC 2BSED 2FCBA 3X1NA 4DVBA 1FQ9C 1K4DB 2X87A 4PRDB 3V79C 4YFEA 3PGCB 3EKCA 3FT2B 4F2ME 2E27H 3FTVA 5E2WH 2EDYA 2XXFA 4EOWL 3V55A 4U1LA 1PNCA 4BFGA 3FQRA 3BAEL 3RWFA 4PJAA 3HRPA 3MFFB 4JFDA 3IDYB 4CUCA 2NLJB 4N8PA 4AEHH 4AGLA 1RZ8B 4MHHG 3QJRB 4YXKL 3UBXI 4ZMXA 3B9DA 1HZLA 4E9TA 5KYWB 2WXPA 1LEGA 4E41E 1FNEB 3FH8A 1MHEB 4CRPA 2CGYA 2IF7A 1KTKE 5C2BL 1QLEL 4LPUA 3TPKA 1AMXA 2ZWSA 4X7EC 4NFCA 4PJHE 3M1CA 3WUWG 5FFLA 4K3JL 3FHEA 3QULB 4KJWC 4J7RA 1WC7A 1O7VA 2VLJB 2CSPA 1YUHB 5DD0L 3T6ZA 4G7VH 4U3XA 4GB9A 4P3CL 1PZUB 4BQ9A 1NBCA 3LKRA 4PP1D 2YO3A 3NZSA 2EUZA 4GW5A 1P1ZB 3C08H 5B8CA 3L13A 3RUGA 3HS8A 3VG0L 1RU9L 2DD8L 4PJIF 4KNUA 1WVZA 2QHRH 2VAAA 4X4YB 3B2VH 3AW5A 4KTEH 2CHXA 3TNMB 1BQLL 4JQVC 4WI4A 2CJUL 4B5EA 3M8OH 5DD1H 4W9HC 1HH6B 1JZJA 3QG6B 5IROA 3KDMA 2J25A 4R5TA 1UM4L 4MYWB 4AIEA 4ZXBA 1MWAH 1F13A 4X99A 5JDJA 1IL1A 3EGDA 1NBZB 1JN6A 3ZTDC 2ZAHA 3ULUC 1NC4D 1OALA 2VR3A 3JWNH 3BAJA 4IRJA 5DWPA 2EEDA 4K3DH 3ERXA 2WP3T 4CSTA 4HG4K 5FFGA 2IDSA 1VHPA 2PO6A 4XPTL 3T0EC 5FGBA 1LLAA 4YAQB 5DEFB 2ERJB 4BH7A 2FWOB 2L7JA 5D2LE 3K71A 4HOZA 4YSQA 1U8PB 4P3WA 4JG0L 3PGDA 5JXEA 1JPGA 4IDLA 1ECZA 4PRHA 1MCWM 3GS4A 2V7HB 3DVGB 4W9KC 3VQLA 1AD9B 2XN0A 3P9MA 1F18A 2HG5B 3A24A 4LVOC 3HZYB 5FIEA 4YLBA 2YK1L 3CX5J 4QTHA 1BA9A 3A22A 1E4XI 3N50A 3VWKA 3LIZL 4WW2A 1R1CA 4ENEC 4LHJB 1HHIB 5GS1A 1NCCH 2D7NA 3GKWL 3HNSL 3L16A 3DBSA 1OF0A 2LAGB 4K07A 4JNXA 4OIAA 4P05A 1QSZA 3CN3A 3QPXL 3ZDZF 2QGBA 1JNHA 1ND0B 2FQFA 2YBRA 3QIUD 3UZQA 3IDUA 1FVEB 1KXVC 1J0YA 4XPGH 5CD5D 4XCCH 3O41B 5IHZA 4G6KH 4CADB 3V7AG 2Q7AA 1JWSB 5HGAB 3UEQA 1J8HD 4FQ1L 3WIIH 5D93C 1A14H 5A2BA 5AAWA 3VFNA 4Y4FD 4WWNA 3CG8A 2IALB 4A68A 3ECBA 1XH3B 1QWNA 3P2DA 5EWIH 1CO1A 1PY0A 3FUNA 3PL6B 5ICZB 5HPMB 5DLMH 3WKPA 3QAZC 15C8H 4LLYB 4Y89A 1NIBA 3BWZA 2MTAA 4KXZI 4LCIL 2EACA 5SWSE 3CX2A 2VL5A 3UPRB 4M3JA 1ESOA 3S34L 3DX2A 5LJYH 2WYIA 2YRBA 2J2ZA 4GAGH 1OGAE 2GK0B 2JKNA 3SDDC 3O6FC 3ILPA 4GBXA 5GZND 2MCAA 1WRFA 4FFYA 1PQZB 2C9XA 3PHOB 4QXTA 3D6GA 4X8JA 5DQDH 4HYTB 3FU7A 1EHKB 4DAGL 3LRHA 4OSUL 4S10A 2X2IA 4DT2A 4XVOA 5B1CA 3VE0B 4PTTA 2PPAA 4JFQA 4JY4B 4BZ1A 4DQOL 4MXQD 3UYRL 1HCVA 3GSNB 1GIGL 2DMGA 5IMLB 1EFXA 4AMKL 1OAKL 5CR8A 3L4CA 5F7HA 3PXHA 4YVUA 4V1DA 1U93A 3R1GL 4OF6A 4P2YA 5DFVD 1O5DT 1BD2E 3DBXB 5GHWH 3V4PB 2AEIT 5CGBA 4L4VB 5I73C 4PB9L 1IQWL 2F5AL 4G7QB 4FNQA 5CNHA 3SB3A 4TQ8A 3FU0A 3P1VA 2EADA 5L4IA 1G1CA 4M43H 1A6PA 4XI5C 3MBXH 3RY4A 3EOAA 2WSKA 2ZSVA 2NYYD 1OTTC 1AOZA 2CPUA 1JMZA 1MELA 4BCYA 4DEPB 3T9WA 2XKSA 3X2QB 1SM3H 1ZLWH 5FUCC 2PABA 4LVEA 4A66A 4FI6A 3VFVB 3CSPA 2WVVB 5DMIH 2YOCA 3II3A 3DHUA 1CBJA 5EBWB 1INEL 1KIPA 2OJEA 2KQNA 5F1IB 5FCUL 4LCCB 2JB6B 1I4FA 3CHXA 3WN6A 4M6MH 4LFHD 4HT1L 1GY1A 3BN9C 2VSDA 3MLXH 4M62H 4ZUUB 3C9NB 4NGHH 3S0PA 2GIMA 3PNRB 2CK0H 3STBA 5C9JA 3BP7B 2AFNA 5E9DE 1U2CA 1UD5A 4ODSH 3KAAA 4N6QA 1ZPUA 3MV9D 2Y69B 4FYRA 1QEXA 4TNEA 1BX2B 1KGUA 3LEYL 4BYHA 1QRND 3FTGA 5EBLA 2EECA 2NX5B 3SY6A 2WQVA 5HGDB 4ALAH 3VFTB 3AQDA 3MLUH 2EDKA 3L5IA 2HTKD 3ILEA 3MV8D 1E4WH 2CIIB 1YEIL 2G5BB 4OIBA 4PU2A 1JFQH 1KC5H 3K8KA 3NJNA 3SGKA 1AQHA 1JPSL 2XN1A 2YAHA 4YHKL 4R2GB 3ZYZA 5DTFB 3NFSH 1IIIA 1U8NB 3JVGA 5D71L 1B0WA 1QMUA 2K6YA 4PRAA 4FFVC 2HKHH 4QRTA 5DJ0A 5GGRA 2QELA 4P2RD 3TEZA 1Q9KA 1NUGA 1YYCA 4JY6A 2QPSA 3DECA 5D2NA 1E7UA 4C54A 1DQIA 4WUUE 4HS8H 4JFYB 2NXYB 1JJUA 1XGTB 3AT8A 2BIQA 3M7FB 4WQOA 5CEZD 1HCZA 1KJ2B 4V33A 2J6EA 3VWJC 4U1GB 4WWID 3ARED 1MF2H 2GJPA 1WA0X 1S9WB 4PG9A 2WZPD 5HI4D 5BPPA 3SKOA 3FOMB 1LEIB 2H45A 2RIKA 4KUZH 4OBSA 2E9JA 1SQMA 4U1JB 3GRWA 2WLIA 4HFUH 4ZFGH 1GZQB 4LB8A 4HOXA 1SEBB 3MJ9A 4RMVA 1X5LA 1YEDA 2A4EA 4YDKH 2CMRH 1MCEA 4G8EB 3VA6A 2X4QB 3NT0A 4MD0A 1XGZA 3EH5B 4H2AA 1XF4A 3APDA 4BV1A 2EZ0C 4BSWB 4HH9A 3FFCE 3O11B 1U8HA 1ZVNA 2GBAA 2HRPH 3MN8A 1X7QB 3DMMD 5EOTB 3AQYA 1EXGA 3SKMA 2ID5A 1I8IB 1PDKB 3MLWL 5AAMC 4KX8A 1NBQA 4RAUB 3ARUA 3GJFB 1N5YL 4PJ5E 3LV3A 3IJSB 4F7KA 1K9TA 3GGWA 2VM4A 2XETA 4Y1AE 1BWWA 2V37A 4GAAA 3JXAA 3GPEA 2I9TA 2LOEA 3QORB 4QRSB 4DH2A 4I3RH 1NSNL 2ZOLA 5K9QI 2YMTA 5DZLA 3SDAB 5E6IA 3MRHB 3D85A 5F70A 3ULSB 4YH6A 1U58B 5EUKA 1M7IA 1INDH 2QPFA 3WL9B 5JPNB 4L4VD 2V0AA 3OL2A 3V4UH 5CJXA 1GJUA 5D6CA 2I85A 1OHZA 2IAND 4YDMA 4YLQT 2G5UA 4AVKA 1JFHA 1IAIH 2YMXH 1UD3A 2QADD 4AM0Q 3EG9B 4NQDE 2DKSA 2N56A 2V17H 4WLCA 5EIIG 2AXFA 4GG6B 1C5BL 1ZWIB 3FSWA 5GRUH 1QI5A 3KGRA 3O8XA 3UP6A 3RGHA 4E2OA 2B9BA 3FTYA 3APFA 3TBVA 5T3ZD 5JUEH 1N5AA 2X1XR 4J3VA 4ES9A 5KSBB 3VFRB 5DJZB 2AK4B 2CK2A 1BDYA 3PWPA 4H5SB 4IIQA 5FV1L 3G5WA 3KPSB 1DJHA 5ISZD 1KYOK 3LOWA 2AVFA 3UJTH 2IPTH 5I8KH 2JIXD 1G6RH 1T1WA 3P3SA 4PJDF 3PS6A 1YEJH 2OFQA 5EBMB 3FRPG 1BLIA 4TNFA 2RQ8A 1HSBA 4FA6A 1L7IH 1Z1WA 1UZ8A 2FVNA 3QIWB 3QFJA 1BZOA 2AJYH 5MI0B 5TQ0L 1YEHH 2R4SL 3TYGL 2EVGA 4AZUA 4QRRD 1WHOA 3DVNA 3IFLH 4M8QA 1E5ZA 4HETA 2A9AA 4WWKD 3KM1A 1OY3B 4AI7A 3ULUH 1M42A 4JRWA 2XACC 4KK6C 5EHFA 4PY7A 3KPPA 1NINA 2GG1A 3EYSL 4JZOB 2E59A 5FW7A 4IRSA 2OMZB 2X9ZA 1EXHA 1PLCA 3QEQD 1BPVA 4OZGE 1AQDA 5AB9A 2W07B 2G2NA 1F4YH 3TC9A 3K1DA 3EDEA 3RPIA 1S7UB 4U3HA 1EUTA 1B2WL 3D3VB 2FSDA 1MHCA 1P7QB 1CU4L 4QRPD 4EIGB 2NZIA 4HK3N 2RAMA 4LQFH 3O3AA 2HJKA 4MAUH 2AERT 2XWRA 4PRBA 3SO3C 4R90L 3GMPA 2UX7A 1MFEH 5BRZD 2LLLA 2VMFA 2WXFA 2JELH 4J3OH 2FB4H 2GITB 3L2NA 1CTMA 3DHPA 4JZJA 1T21A 3NRPA 1IU1A 3NACL 3ZZLA 1T4KA 2HN7A 2D7OA 2JK5B 2WIIB 2YD8A 4O4YL 5F21B 2WLJA 1E4JA 3AB0C 3L5WB 3WXVL 5KSAA 4GW4B 1IEHA 1I8LC 2FECL 3ZE2B 2BM3A 4HIPA 4N8VA 2BP8B 5EIQA 4Q89A 3K2KA 1N8ZB 2HT3D 2VLKA 4WHYH 4XRCA 4F7PB 5GZOD 2DPKA 1XZ0A 5MP6H 3QVAA 3MACL 4O02H 5K5YA 4ORGB 1RUPH 4DZBA 4R4BB 3KE0A 1ZGLA 1OSPH 2NR6A 5E1HB 3V2AR 4KMTH 4OIFA 4N0UE 1O75A 5C6PB 1U0QA 2GY5A 4LNVA 4R26L 1TQCB 4S0HA 5INCA 1JXGA 4L37A 5EUOF 3SN6N 2H2SD 2OZ4H 2V4LA 4NKIH 4ODWB 3TIDB 4M02A 5H37A 5ESVB 2IMNA 4ZFOB 1PU0A 4QRUA 5J89A 4DGIL 4PGZA 3LRSA 1MCWW 4UQDA 2HMID 4M1CC 4XBPA 4M5ZH 3BSZA 4LDOB 4P04A 3BVDB 3LH8A 4Y9GA 4NOBA 1J5IA 3QORD 3BEWA 1OVZA 4PRNA 1U92A 5IHHA 3OF6D 5D1XE 3K74B 3UCQA 5ADOH 3T0WA 5DK0A 4YSUA 3LN5A 4ZO8A 2PCFA 4MCNA 2JKXA 5BQ7B 1WAAF 2X41A 3D4GA 4FX5A 3SBQA 4LP8A 3GXDA 4E9SA 1AGBA 9PCYA 3CVCA 2XICA 1TOXA 5KOVC 3JWOL 2FDBP 3CFKB 1DSFH 4WJ5B 1QSEA 2GJZA 1HZHL 2DQCL 2BNUB 2ZXDA 1BMWA 2ZUQB 2ZIDA 4GAYB 4TXVB 3AY4C 3TBYB 1WFIA 2J20A 1ADWA 1QSFD 1TEGA 3JBG7 5TE7H 2GSIA 2XBTA 4AGOA 4LPVA 4PG2C 1AVAA 3FKUS 1OCOB 4FQPA 5JR1L 3WIHL 3K6NA 4Z7UE 1DBKL 4BK5C 5BUPA 2VDNL 3F6JA 4P5RA 3DV4B 4CVXA 3X12B 5IR1A 3HPJB 5ESQA 3AM8C 4OT1H 5AVSB 2BNRB 3F7YB 4S1RH 5TE6H 4NM8L 1W0YT 4ELME 4HS6B 2CCLA 2PXYB 3AFLA 1KIRA 3T1WA 4KQ0A 2O4EA 3R7QA 3BYTA 1G9HA 3CSYA 3RB7A 2J8UE 4UUJB 3QBTB 1EIBA 1J05A 3KYKH 4XP9L 3HMXH 2JKLA 4TVPE 2WBXA 1HFUA 4XMPH 4F9PC 4LPYA 1UT2A 4YXHH 4FFYL 1MFVA 3TLRA 4PJXB 4JDEA 5HHOA 5JQ6H 1BAWA 3CC1A 5D72H 2X4TB 4P07A 5I75B 3IGAA 1D9KC 4LF3B 5LDSA 2VDLB 2NY4B 4S0TD 4WI7A 1NGPH 3ARFC 5KYXB 1A3LH 3JV6B 1P7QD 3QCUL 2AEPL 3QDME 5IWLA 3GBMH 1P1VA 5LXGL 4PCYA 2PCPA 4PM1A 4ZUVB 5BJTB 3T8XA 1QHOA 4EN3A 3C2AL 3B2DC 3WHXB 1M4KA 1TR7A 1Y6NR 2KC0A 1AGCB 1AO7B 3AXLA 3LZRA 1FZJA 1A1OB 3BLBA 4LIQH 1QNZL 43C9A 1BAGA 2O30A 2FGZA 5I15H 1L0QA 4G9DA 3EJJX 5DHYA 5FUOL 2VXSH 1BQSA 2VM9A 3B2UD 1MCCA 1DSYA 2YMOA 3L4UA 1D2OA 1R24A 2IDQA 4H0GA 3LRLA 2I07B 1WBYB 2ENYA 4FTVE 4U6VL 1HJCA 2CDGA 2XVKA 3FPXA 4TNGA 3ZL2A 3GBEA 1CICA 4ADGA 2UZXB 1S9KC 4QRQA 5K93A 5BOZG 3RLSA 1WZ1H 1XR8A 3QEGL 4GJTB 3WS6C 4YHZL 3HI6H 5IOPA 1VGEL 1GS8A 2AQTA 3PWLA 3ZQXA 3ZU8A 4UQ3A 5I19H 3O2WL 5LAXA 5JIDA 1DVFA 1AY1H 1BP3B 3EADA 5K1NA 1QTYT 1J5OL 3KS0J 1INQA 4Z7VF 2W38A 5E8OB 5ICUA 5E6UB 1Z5YD 2X05A 3EO1A 1RHFA 1ORQA 4OD1L 3FCBA 4H8HA 1YNLL 1E4KC 3HG1D 4MA7L 3BEVB 1W0VB 3V4VA 3QH3A 4ETQB 1LMKA 4EDXB 3KM2A 3FT3B 4GFTB 4OLXH 4AYEC 3BT2H 3IU4H 4JMXA 4MMYA 1NIFA 3KLLA 5I1JL 4O9HL 3QI9C 4FHJA 4O2FB 4P57A 4PJ8B 3MZGB 3S37X 3S9DB 3FFOA 2B1HL 2P9RA 4ZD3H 1OD9A 1BBDH 4GQQA 4AITA 3QEHA 3Q3GB 3PUUA 4L8DA 3SGEH 3U9UA 4FRWA 5C7XH 2NY0B 4CC0A 2IBGA 3BP6B 4MNQA 3GWJA 4QXWA 1XEUA 2F68X 1V5JA 2Y4SA 3CAFA 4G80A 1FO0H 5C6WH 3VRIA 3CVHL 5IFJB 4MNGB 4PV9B 5HHNB 3TOPA 2J6EL 4BH8A 2G3NA 4OGAD 5AW3B 2DWEB 5E51A 5FO9B 5JHDB 3RYMA 3BWSA 2K9FB 3C5ZC 2NT0A 4ZG1A 1CF8H 1U8IB 4FLHA 4OY9A 2P43B 1TZGH 3QUMB 5LN8A 3GRWL 2VE6A 1ZSDB 4FQJH 3V8OA 4WO0A 4Y16B 1PAMA 4OFYA 3U83A 2VQUA 4XOCA 3T71A 1R5IA 2BNRD 4HJJH 3HC3H 2NY7L 3V0FA 1GGIL 2PXYD 4AQ8C 3I02A 1L3NA 2NCMA 2J1KA 1TT6A 3FOLB 3LB6C 3Q2LA 2Z31A 2GK2A 3LPOA 5F6HI 1UJ3A 2P46B 1VADA 4HV8A 4AJ0A 4QHMB 4NIYE 4DEWA 1E50A 1J9TA 2R0ZH 3MKKA 2A7BA 1JV5B 4HLJA 1B4TA 4KTDH 1YCSA 2QKIC 3OPZL 2EEFA 1BOYA 4JDZB 3CFDB 3LH2L 3UC0H 3U6RB 1JF6A 3SDCA 3W39B 3ARGD 4ZSOA 3MBEB 2Q86B 5AD0B 3FQ4A 2ZG3A 3CNKA 4ICXA 5JIHA 3U2SB 2BS8A 3WJMB 4GQ9H 5KVGH 4BFIA 1GZHC 1LE9A 1BV8A 4MMZA 2GAZB 2BVQB 3FQWB 5GS0L 1HNYA 5B22A 3QDAA 4E41D 1RUKL 2NUPA 4B9KC 4M7ZC 4XMLL 2J6WA 1BYPA 1D7BA 4QNPF 3WIFA 3I9GH 5F7UA 4Y9BA 2YQ3A 4Y5VA 3I6KB 2FGWH 2CO6A 1AO7D 3FQXB 3TVMD 4JMNA 5IGXL 1KT2B 4QF1B 1AS7A 3HC4L 4MWFA 4L8BA 3T2QA 2DEYX 4XNQB 2ZKMX 3VFMA 4ZMZA 3RTLA 2YD9A 4I8DA 5HYEA 2BZCA 5A6MA 3Q48A 5KUMA 3NPSC 5BO1H 4GRWH 1NCOA 5C86A 1UOLA 2K78A 4M8VA 5ECGA 1UATA 2CLRB 2YSSA 1JD9A 4HJ1A 4R3SB 4ADJA 1FC2D 4GOSA 4Y19E 3KWTA 4JKWA 1RZKC 5HGBA 3KBEA 3MUY1 3MV7A 1R5VA 2UWEA 3Q5OA 4PBWD 4Z3FA 2ZG2A 1F4XL 5E4EC 2KBGA 1FE8H 1AXSA 2Y5QA 4LEEA 3QUKA 1TPXB 3QJFB 2R0WH 3P40A 1KYUA 1T7ZA 3FQUA 4XPBH 4OD3H 4BFBD 3IJEB 4XMXA 1VFAB 4IGBB 2SODB 4PRIE 3LDBB 5IESL 4Q6YA 4PBVC 2WYHA 2X70A 4I0PB 1OCWL 2KKQA 5FYLH 4RMBA 4EQ2A 4ZO7A 4LBAA 3VB8A 5FCSH 4WO4C 1OK0A 4I4WA 3V0JA 4C55A 1UB6A 3S7GA 4N26A 4FXLA 4LSRH 3TWCL 5BZXA 4PJ8D 5LNEA 3D69A 1RPUA 5C0IB 4JS7A 1BXXA 4KKLC 1K5NA 2D03L 4X7SL 5AZ2L 3QYCA 5DHXB 3BISA 3CFQA 2A9DA 1T5XB 3LNHA 4TUOB 3T1FB 2NY0D 1U8JA 3Q5YA 5C0EB 3WDHA 4PJ7E 3OB0H 1A9BB 1BMZA 4LRIA 2UZYB 3TO2A 4H26B 3PYCA 5IMMB 1LMIA 3WU1A 1YY9D 5B3JF 3LZOA 2D3NA 2WXJA 3D39A 1X5AA 3LZNA 1OZTG 3VH8B 5JHDD 4XP4H 1V3KA 4JPQA 3APMA 4LCWA 3IPEA 1QFWL 4Y2DD 1TEFA 5IB2A 4KXAA 1HL4A 1OAYL 3KVPA 3LNFA 4IIZA 1WA1X 4BXVA 1HILB 1K85A 3C6SB 4FZ8L 1KJ3H 4GRWF 1RJYB 2DI9A 4P4KB 4EDWL 2VL4A 2GFBB 1MI5B 1C08A 3IDNB 1GGCH 4LVHB 4QCIB 5SWSD 4PJBF 3ROOA 5KVEE 1BFVH 4MA3A 5B7MA 1N59A 2QR0A 3CPUA 1A6VH