2F08A

Crystal structure of a major house dust mite allergen, derf 2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and some properties of a major house dust mite allergen, Derf 2
pubmed doi rcsb
source organism Dermatophagoides farinae
molecule tags Immune system
molecule keywords mite allergen Der f II
total genus 29
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2f08A00
2E56A 1NEPA 3RG1C 5IJBC 3VQ2C 3B2DC 3MU3A 5KWYC 3VQ1C 1AHKA 1AHMA 3FXIC 1XWVA 2F08A 2E59A 5IJDC 3T6QC 3WEAA 5IJCC 2HKAA 2Z65C 1KTJA 2Z64C 3MTXA 3WEBA 4G8AC 3ULAB 3M7OA 1A9VA 1WRFA
chains in the Genus database with same CATH superfamily
2ITDB 4FLOA 1EO5A 2R69L 1QA9A 3ZRCC 3LVEA 4Y16D 3G6JB 1TTRA 1HKLH 3MV7A 1WD9A 5IOPA 4XZUA 3IETB 1AZVA 2IFGA 3P30H 3VWKD 2KZBA 4ODHL 4KROC 5E24E 3IETA 2DYPA 3UBHA 3DRTA 1FSKB 5EBMA 2IMNA 5SWQA 3G6JA 5E0FA 5ANMA 1JJUA 4XNYH 1Q9WB 1FNLA 4RIRB 3FYIB 4AY0A 3SDDC 4C47A 2R0WL 4NZFA 1ZV2A 3C8KB 3L17A 3PWUA 4NENA 3RAJL 1G7PB 5L9DH 2BS71 4KK8D 5IJKA 5J1AA 3O2VH 1KWKA 3MUY1 5E2VL 2DIBA 5D6CB 2QVFB 1OTSC 1G1CA 4X4ZA 3TO2A 1KXQA 2A9ML 5A2LH 4MNQA 2ITFA 2PWFA 4PR5B 1PLGL 2YN5A 1PDKA 5ITBL 4DP0X 3MOBH 4FC3E 2M1KA 1AJ7H 3WCYA 4OLEA 5KSAA 2ICEC 4BZ1H 1QW9A 3E0GA 1WHOA 3LZNA 2OW7A 2HRHA 3GJFK 4H25A 1MUJA 5HDBB 3V4PA 5L2KE 2E7LC 3DETD 3X1FA 5B39G 3SDAD 4HS8L 3HCVA 3BAWA 1NQBA 1ACCA 1WCBA 3ULAB 4G6JL 3SQBA 3BDYL 4OFKA 1WYJA 3G08A 4YSTA 3ARBC 1M2VA 1U3ZA 4JANB 1CU4H 5FUOL 5TQ0H 4ZZKA 1WBYB 5IVOA 5INDA 43C9A 1TUPA 2ZUQC 4UT7H 2Z91A 4DK5A 3Q2LA 1R5IB 1ZLUH 2EDEA 2CHZA 2R29L 4J8RA 1JXFA 4YFLF 3ABGA 1SUJA 2CBPA 1TOXA 2BNRE 3CPLB 5C07D 3T2NL 1QUNA 4GW5A 5INDB 5JDSB 4Z3JA 3TA3C 4AQAA 2XY1A 4JANA 4OCMC 4J3WA 5AVTB 1M57B 4Z7IA 4JO2H 1V3MA 3H85A 1SXAA 1TJGH 4C83B 7PCYA 1E9PA 1RL1A 5GGQH 2EQDA 3E6HB 4KWUA 5DUPL 2E6JA 2B0SH 1V3JA 1MUJB 3HE6A 4YPGA 3B2MA 1NGPH 4L5FE 4JN2B 1G43A 2F7RA 3OB8A 4K0OA 2XWZA 5D5ME 1A2YB 2EDTA 4XXWA 1E4WL 4HIJA 4MMXB 4Y9BA 3U25A 3TNMB 4FN0A 5DYOA 4PGDA 1CDUA 1RP9A 3QG7L 1GYCA 4G7VL 3EOAB 5I24A 3LN9A 4MD0B 3FB7B 1L0PA 2A1WH 1AE6H 4YHIB 5KVDH 2R69A 5JIQA 4U6YB 4N5ED 3KLQA 3O6LL 2CHNA 4Y4HA 5E8NB 2GEEA 1OGTA 1H5BC 4AYMC 3VYPA 3SGKA 5CGMA 3LRSA 3WJJC 1WFUA 4R7XA 4XXCC 4OJFH 5D7IA 3WN6A 5FWQA 3UP6A 4KUZH 2BIMA 4HFWA 4YDJB 3X17A 2E9IA 3K2IA 1X6NA 3LQZB 2G0KA 2BH0A 1O6VA 1I8MB 1BM3H 4XZUB 1RJYA 1QAWA 2VDKH 3NJVA 4LMQE 3KYOA 4CU6A 1NBVL 1Z32X 1ZHNB 3PQYE 1E9QA 2A77L 3O0RH 2VQ4A 2OCJA 1YY9C 1SN5A 4OZFB 3OBAA 1NCIA 1JDAA 2AJXL 3VCLA 1HYSD 1CTOA 4KQ3H 3RY5A 3HA0A 4XMLH 3MCKA 4S1DD 4FG0A 2VDLL 2F1EA 3VFPB 1VGEL 2P44B 2XTJE 1PAMA 3P11L 3QISA 3FHEA 4P5KB 3MPCA 4WWKC 4XPGL 3D69B 4Y4HD 4F8LA 3D0LA 1CDYA 1ZPUA 3KBPA 4BH8B 3CVHL 1N64H 5DMKB 3S88L 5K69A 3COOA 2GI0A 3NPSC 4PJIB 5IBUB 2CIIA 1I8KA 4G3YL 1CGWA 3IFNL 2NRDA 4UT7L 3U1QA 1FNGA 3ZDXE 2X10A 3BH9A 4DN4L 4HUXB 4HGWB 4N6QA 2JKTM 3MRRB 4WSKA 5EOQH 5B7MA 4U1HA 3UO1H 2DIAA 4YFLI 3MRMA 4XVTL 2P24B 2CNYA 3B7RL 2IG2L 2IV8A 4FFWD 5F1NB 5LNEA 3UXFA 3KWWB 1KBGL 1H15A 3MYJA 3BLKA 2BDNL 3L4ZA 3PP4H 1X4YA 3AACA 3LEXB 4FA6A 3SO3C 3EYVA 4OJYA 3V0JA 4F7TB 5DQ9B 4FABH 1FZOA 5AOLA 4ZUUB 1DLFL 3IGAA 1IEAB 4UILH 2BW5A 2AV7B 3OR7A 3OHXA 4JPVL 4X7SL 1UA6L 1N10A 1CI3M 4NPKA 3WMPA 2WBXA 4NPJA 4P46B 3GSQB 3R19A 1BOGB 3AB0B 2FD6L 1MJ8H 5EOTB 1K6QL 1ACZA 1DBBL 1X3DA 1QWHA 3PY9A 2ZCKH 4D9RD 1JHTB 1A6VH 4BRJA 4HJGB 4R96B 1VEPA 1FH5H 3P30L 2DQCH 5FUCE 5DLLA 5KN5A 1MJJB 3IEAA 1IEHA 2CLZB 4GAJH 2CKBB 2FEEL 3QYMA 2Y6SD 2BIQA 5JOPD 3NP3A 4GAAA 3ARRA 3KDMA 4J6IA 5L6YH 3TJPA 4M1GL 3FCUB 1FHGA 2A4ZA 3UTTE 4HXBH 1VZHA 4R9HA 2NCEA 2VABB 5DMIH 2BOCB 1I8IB 4JRYE 4ZXBD 2FWUA 1KGIA 3L1FA 4X2UA 2F8XC 1KNOB 5B1JC 4YHPA 5SWZE 4FQ1L 3HJ0A 3HZYB 3NJNA 1ACYL 5MENE 1DE4A 3K4AA 5F21B 1IILE 4QXVA 5I17B 3OZKA 1WS7A 4HKJB 1L7IL 3BMVA 3W39A 5J0BA 5KYXA 8CGTA 3DC0A 5KVEH 3US0A 4BZ1L 4Z5RB 2KDGA 4FULA 3D25A 4OZHE 1U2YA 2ZWKA 4HUUB 1AXSA 3GK8H 2R2BA 3UAJA 2DKMA 2Z4QA 3HC3L 1UXWB 5A16A 3UEQA 1TO4A 4MS6A 5IW1A 1UZGA 1I9IH 4GB9A 2Q10A 2X1QA 1X4XA 3EW3B 4NRXB 2IJ0C 4HS6A 4K5NA 4NNYB 3T3PF 2NDFA 3L5HA 4DKFH 3UTZB 4AUJA 3MJWA 5EU3B 3OM3B 4LIQE 1A6UH 2HMIC 5DFVD 4MA3B 3PXJA 2KS0A 2JB5L 3W57A 3CDGA 4C4KO 1KIRB 1CD0A 2VDOB 4U1MB 5JHDB 1KIPA 1ADQL 3O3UN 4KOBA 5CP7B 5A2JH 1UJ3C 1AXTL 1DBAH 2EE0A 4LSQH 4X7FC 5FYKL 5T3ZE 2ZCLH 4GW4A 4ZW3A 5GS1C 2CDEA 2D3NA 4NN6B 4ZNEA 3CU7A 3SGKC 2I27N 4IBWA 3QZOA 1MH5A 3UBXI 3UJTH 4X5RA 4MMZB 1P6FA 5AZEH 3A67H 1OGAB 4H8UA 4JO1H 4YE4L 4BZ2L 3KPSA 4Q2ZB 1MI5D 3MBXL 4TPRL 3P4MA 4H13C 3PGFH 2B9BA 4PTTB 3CN2A 4I3RH 1TZOA 5AWNH 4XCNA 2HAZA 1R34A 4PJ5E 1TJMA 1TETL 2NTFB 4DERA 1E2VA 1JNLH 4XPHH 3V95A 4HC1A 3FO1B 1TMQA 5EBLA 5MEND 4BQ8A 3CFEA 5FOBB 2AMUA 3F5WA 4N2OA 4P3DA 3SKOA 3KHOA 4L4TB 1JZDC 3ZR5A 2WMPA 4A7GF 5C1MB 4FF9A 2P80D 5CGTA 4JFEE 4JCLA 2QR0A 5FR3A 4LCWD 4Q7DA 1DVYA 5GZOD 2HRPL 3OXSA 5D1ZA 5TE7H 2AEQL 3NIGE 3BC9A 1CE6A 3N0PB 5KTEH 3L5WA 5HHOB 4POUB 1RZJC 2BNUB 1T7VA 1MRDL 4ELDA 3NN8B 2K9FB 1JUFA 4G7YL 3NEEA 1GTNA 5BRPA 1T0MA 3NQKA 4LFHG 4HMEA 3QULB 4IRSD 3WIHL 4L9LC 1OLLA 2WXNA 3L5WB 3CXHK 1JCKA 2VZTA 3O4LB 5J6HB 3WTXA 1RK7A 3HMXA 4MJHA 3CFBB 4F8TA 1MW0A 4KO6A 2YMOA 5ICZA 2BSSA 3H9SD 4HHGA 1C8PA 3V5KB 4MVBC 2XWXA 3SE4A 1QFWI 5TDNA 3QUMB 3WGUB 3HVDA 2WLHA 3JV6A 4LVOB 4CA4A 5KBKA 1YC8A 1HXYA 2YWZA 2VMCA 3VXUE 1VZIA 4MSWB 1FPTL 5C0AB 2AJSH 1JZ8A 5I6MA 2VMDA 3ZL4H 3SYAA 1FO0L 4MKTA 2LR4A 3B9KB 1OAQL 1BLIA 1KBGH 4H88L 4MYPA 2N3JA 1RHFA 4NQDA 3RGVC 3QZWA 3L4UA 4PRHB 5EORH 1CF8L 3KD4A 3HRZC 5FW7A 1MFBL 4PY7A 2YQ3A 1D7BA 3MGTA 1N3NA 1FAKT 1YMME 4OZHF 1E4JA 1T5WA 2E74C 1KIPB 4XE0A 4NQXA 2WYHA 1S7UB 3CDGB 2XC8A 3VXTB 1A5FL 3HVNA 3NSJA 4AL8L 4UT9L 4XVSH 5I73B 2DH2A 1QR1A 2WGNB 4GO6B 4OGAD 3BH8B 4PRPA 2LLGA 4FKEA 3UTZA 5I8CB 4Y2OA 3RDTB 1BX2A 1NFAA 4L3AA 4MMYB 4YN3A 4GG8B 4HS6B 3EBGA 2C4FU 4XN7A 1QSEE 1U3HB 2DM3A 3X14A 1UACH 1GGBH 1RZGA 4ABQA 2Q0ZX 3S34H 4P23B 3OKMA 3T0AA 1EHXA 4OFDA 1M6UA 1XVSA 2P45B 4KMQA 4HIEB 3K80A 3RIAF 1ZHBA 3X1EA 5CIPB 2HT3C 2VZ3A 5D5MF 2A38A 5DQJA 1ZAGA 1FVEB 3DURA 1RPQA 5ABZA 1BBJB 1HHGB 4WV1A 4ZUTB 1DE4B 2PW2A 3V4LA 1YN6A 3DX8A 1RERA 4IKLA 5AAWC 4P48A 2LFEA 4Q97A 1HSBA 4XOEA 1SHSA 3AG2B 4GP5B 3LIZL 3C2AH 4OD3L 3UAFA 4B0MM 3V7AE 2VSMB 2VXQA 2KI6A 5EEXA 3QI9C 2WUCH 2A6DA 1SFDA 1JZGA 1SEQL 3DMMA 1UADC 1T66C 3VXPB 2AK4E 4V2BA 3NJJA 2WLKA 1M71B 1A9BB 3W9DA 1YECL 3PL6A 4X9GA 3VG9C 1XGYL 5DJ6A 4EOWH 4C54A 5IIEB 5EO1B 2XOTA 3OC5A 1IC5H 3EJTA 2TRYA 4JHAH 1JFQH 2XFGB 4DP4X 25C8L 4KFMA 2NY3B 5FO8A 4B3VA 1BQHB 3D3VB 4NXKA 5AOZA 3N1GC 1BBDH 4L4VB 5EZOH 5TE6L 3MV7E 1OM3H 3MJ8B 5CEXB 3WXVH 3LB6D 2YAHA 3O6FB 3WUWA 4F7EA 4U1JB 3QDGE 1O6SA 3TEYA 4KKNA 3OAYK 1HCZA 5HGGS 3L08A 4UTAA 5I74C 4XMWA 3ORJA 4HK3J 2R0ZH 4BFIB 1MFBH 3ZXAC 2OK0L 3BFOA 1JWMB 2CM5A 3MRJA 4PWFA 5BQDA 1ICTA 3AXLA 4PFEA 5K59F 4EJ1C 4QRRE 5JYLA 1CLOH 2DWEB 4ZUUA 1VCAA 1E4KC 2ARWA 3ILEA 4HS8H 3ALPA 5DS1A 2COVD 1QSFE 1TQBC 3QYCA 3LN4A 3QB7C 5D7JC 2BWDA 4HJTA 3SDXF 1EXUA 5IB2B 4IGBA 1QR4A 2AQ1A 4D7PA 1OCRB 1SJEA 1Z5LA 3GI8H 4DTGL 2OZ4H 2JELH 3WI9A 2VXUH 4FQXD 4MA1C 4FL4B 3PWJA 2EUVA 4Q6IB 1QRNA 1SYVA 4PWKA 4J4PD 4N2EA 1SVBA 4YSPA 3SDCB 3RIKA 4KNQA 4PJIA 1S7XB 5IESL 3IN2A 2JCCB 4PJEB 4N68A 3N42F 1M1XA 3HAEH 1S9VB 1O5DT 1J48A 3TPUB 4WRLA 2HG5A 2BVUA 5CXPA 3FQTB 2Y9RT 4ZW6A 1W72H 1I1AA 2O6FA 2E47A 3MCKB 1WV7T 2CMRL 2FT7A 4I89A 3WFDH 5L4FA 3PHOB 3WY4A 2BCKA 3DOSA 5KYYA 3V5KA 1FRGH 4JRLA 4JUTA 3TZVA 3GTTA 4BCZA 1E4HA 3BWAB 4ZFFB 2WQRA 2Y6SC 4YXHL 4FQLH 2OSWA 1Y7VA 3WKQA 4XRCA 5FYJD 4UWQB 4IDJL 1JNJA 1TG8A 2JK5B 3LHAA 4X6CE 1VFAB 5L2KD 1T0MB 1X5AA 3LZPA 1BCIA 4XAKD 5I1LB 4ZDHB 2CR3A 3LKRB 3VAEA 5JIIA 1OTTC 4IOSD 4DF9A 4GOSA 3UABA 2IC2A 4DGWC 1CC3A 2BOBA 2DWTA 1F1AA 3I6SA 2A9NH 3K7UA 3DXAD 4PCTA 4AZ8A 1PZUB 4MZ2A 4UQEA 1RVFH 5H35A 1RUPH 4PV9B 1NJ9B 1NDTA 4Y4HB 5E8NA 1F45A 3ZIMA 2ZSVA 5HDQH 4U6YA 4XVJL 1JZEA 3CIAA 5IQ9A 4OV5B 4ZO7A 2X1WL 3UDWC 3C5JA 3UROR 1KN2H 5GGSY 1MCWW 3SGDI 3FB6B 2RFXB 3JT2A 2BNQA 5BVPH 2DN7A 5DJAA 2XJLA 2WQVA 1QPPA 4MMXA 4JKKA 3LAFA 4K71B 2OMVB 3T6XA 4UMSA 2FX7L 1NIDA 4NCC2 3TN0A 4F9LA 4UDUA 3QR1A 4GKLA 3STZB 1E9PB 1ASPA 5FWRA 2V5SA 5IV2A 2BXZA 2DBJA 5K5YA 4Y8DC 4NUJA 3RPBA 1ZGLM 5AVSB 2CDEB 1FNFA 4FQPA 2I69A 2NZIA 2CHWA 1ZHLA 4QYOB 4R0LA 1A4KB 2Y07H 3CUPB 4BE5A 2NXYC 3ZKNC 1ZT4B 1W8OA 3O9WC 4LBEB 4IRZL 1JGVL 2B4CC 4PBWD 1FG9C 1MF2L 2P4AB 1GIGH 1WAPA 1M42A 2KZKA 4DUXA 1T7ZA 4Y16C 4QRUA 1SZNA 2YXWA 4GBXC 5D71L 5B38G 4L8SA 3DI2B 3ESVF 1FJ1A 3TBTB 3OMIB 3FT9A 3ZE0B 3NJFA 3EF7A 2FO4A 5E03A 3VGAC 3GDCA 1BV8A 2DKSA 5KSAB 1GVIA 3F84A 1UM4H 4IHOA 3VXQA 3CAFA 1IAII 2HKHH 2OMTA 2CO2A 3C6LA 3SBQA 4RBPH 4HHWA 3WEAA 3ISYA 4NO5B 2BP0B 3KS0J 1BAGA 4KZEL 3MV8E 2BMKB 4N3TA 4FFTA 1KYDA 2J8UB 3GNMH 1YMHA 4EZKA 4X8XA 3AITA 5DHVA 1EDYA 3A23A 5IKCB 1XR8A 2RHEA 4LOFA 5K9OB 1YJDL 5E8DH 2ZSWB 1UASA 4AQ8A 2V5TA 3N44F 2OCFD 4HQQH 4IIQB 1FNSH 1UXMA 1MDAA 2PF6A 3E8UL 3B2DC 3MLYL 2BVQB 1RUMH 1YZZA 3K8LA 4ZTPL 1KIQA 2ZXGA 1GC1H 1N26A 4XNBA 4PG2C 5F1KC 4A37A 5IF0A 2FTAA 4ZPVB 4PS3A 2H3NA 1USQA 1RZKL 5D93B 3MV7B 1H3GA 3ECVA 1OSPL 4XPAH 1XZ0B 3OGCB 3QDHA 2X3AA 3GD1C 4ZQKB 3SJVD 5JNYA 1ZA3B 1VCBC 4KKBC 3IJEB 3RJQB 1A7QH 3QFJE 4Y1AE 5IMOA 3Q6FB 3TBVA 2V7NA 1EHLH 1GZHC 4PLKD 5E6ID 3BAYA 4QNPF 4HMCA 3HC4H 1IJNA 4NP9A 3QXWA 1KCBA 2Q7NA 2YXMA 4ZFQA 3EUUA 1IVLA 4K2UL 3QNYA 2YD2A 3EYSH 1FRGL 4XP5L 3PV6B 3NFSH 4J12A 3GMMA 4K7PL 1FL5B 3NQIA 1G84A 3QEQD 3QQ9C 3I9GL 1XF3A 1X5JA 3UO8B 2AJZA 5E99L 5EC1A 5TPWL 1RZFH 3RVTD 1CIDA 3OJ2C 5GRUL 4DVRH 5AOKA 3U46A 2VLRB 2FR4A 4KH2A 5EIQA 2WSDA 4M7KL 3QDME 3MYJB 2FB4L 4I88A 1T4KA 2BRQA 3ES6B 4F57H 4GQZA 2O5NA 4NFDA 4W9FC 2NQCA 2VLRA 2V2WA 2AJVH 4N0FB 3UGEA 1IX2A 2VO8A 1HZLA 5A43C 2C26A 3FH7A 1RIVL 2M83A 3UAJC 5KUKA 4NKMB 3CZFB 3DROB 3I50L 2V2XA 5IREA 2VE6B 5HHPB 1MREL 2VM9A 4ICXA 4Z7OF 1XFPA 15C8H 2Q6WB 2AVFA 3H9ZA 3VXMD 3HE6C 2P5WE 3D4ZA 1E6OH 4XNXH 4HJJH 1GYWA 5DCCA 1BLNB 4UUJB 4DK3A 4JDVB 5DRWA 1AI1L 2YA1A 4LLUB 2K8QA 3GDBA 1I9RH 2W65A 4PMEA 4BSJA 3KJ4C 1BD2E 1JMZA 4OZFH 4RFOL 2AKRA 1EH9A 4G43A 3Q6FA 3D3VD 2EIDA 3L1OH 1MY7A 2HT4C 4LKXB 3KYAA 1HQ4A 4QAMB 3V7MA 1QSEB 1FNAA 1FYTD 3OC8A 3D18B 4WUUE 5E9DE 4M6OL 1UFUA 1VEMA 3S5LA 5KSVB 4HUMB 1OB1A 2APFA 2O5XL 4X9IA 4BWTA 4O2CB 4LU5H 4HMDA 3P2BA 3VRIB 1PGRB 4F7MA 2CUIA 4UQ3B 4HG4K 5EF1A 5IROC 2R23A 1RIUH 4HPOL 5AVXB 1QO3A 3IWVA 4KMTH 4F91B 2CO4A 1DVFB 4NN6C 1CCZA 5ADOL 4U7SA 4KKPA 5BV7H 2DQ6A 3OAZK 2OTPA 1DSWA 2CDFA 1SXCA 2O4EA 4S2SA 4JRXE 2UVEA 2C9QA 1D2PA 1N2RA 3UBXG 5DHVB 1AR1B 2ENJA 3V6OE 3P0YL 5F7WC 2RACA 4NO5A 4JZJC 1E3ZA 1P9MC 4ZX6A 1NA8A 1TTFA 5B21A 2YPLA 1WBXA 3ZE2F 5D7SH 1GXEA 2B59A 2CO6A 1VLXA 4AIZA 1MI5E 3HKFA 4X5XB 1AE6L 3AU0A 3UC0H 3ZGHA 3P77A 3QZNA 5E6RB 1FV1A 5I8OH 2OULB 1D6EA 5L0QB 1QX1A 4XR8C 2PYFA 5EU7C 1XDTT 3UL4A 3DVGA 3ATDA 4WO4B 3FJTA 1T21A 3K8MA 5DVNA 3A4AA 4B9JA 4ALAL 2YXVA 5DGRA 5AKSA 3M1BA 2WD0A 4PJEF 1XF4B 5EUOB 1ZT4A 4PYGA 3DK2A 1MY5A 4IBYA 2ZAIA 4JPSA 4TOYH 4ZMOA 4JY6A 3LS4H 5DLMH 1UGKA 4NZUL 4NUJB 5KTEL 1CFQA 2XUWA 2ILLA 5KVEE 1X4ZA 4FFZA 4R90H 3NIGB 4HD9A 4I18A 4L1HA 5GGTL 2WZ5A 5D96C 5T1JA 3MLRL 4JO4H 5E2JA 2DZEA 4AVJA 4EO5A 1N0LB 2QQNH 2CCWA 1INEL 5I0XA 1NGXA 2YKLH 1MNUL 4TRPH 4G82A 1P84K 2CE6A 4A68A 4ZTOL 5IMMB 4JQVA 3RUGF 1Z3RA 3BP4B 2C3XA 4HKBB 2DLFL 4Q6KA 1CDCA 5DGQA 3FTXA 4MYWB 1HH9B 4WAFA 1TXKA 3IKCB 1WUNT 1BIIB 1IAIH 1MAKA 1I8LC 1ANUA 2Q2EB 3ULSB 3M86A 5IQ9B 3VXUD 1IBZA 3G9AB 3S97C 2O5ZH 4FQQB 1JYVA 5KBDA 2X2YA 4Z3EA 1A4JB 1NIBA 1XH0A 1SHXA 1OM3L 4QHPA 1PD6A 5DD6B 4XMUA 1XBDA 2AW2A 2BOBB 1GYUA 3MBED 4ELMB 4J1UA 4P46C 1R0AL 4GXVH 2DMHA 4JJOA 1TJHL 2APWA 5F7LB 5CAYB 4OVUA 5BRZE 1RI8A 4ZS7H 5C09E 3W5NA 1CL7I 2KQNA 3T6ZA 1DQQB 2HMID 5G4NA 1AIFB 1F2XK 1JK9A 5D6DC 3FYEB 2ODHA 1MQKL 3DRQA 5C7ZA 4ZQTA 2O26U 4FHJA 1RUAH 4HW6A 5FO9A 5LQBL 4D9QD 2BCMA 4OLVL 2CGRH 1CE1H 1MCPH 1OXYA 1CT8A 1DJSA 1HKLL 1TZHB 3VFRA 3C5SB 3V6ZA 4KV5F 1BAFL 4PY8J 3ULUD 2UWEF 2ED6A 4WI3A 2VUKA 4HWEL 3RG1C 3CFTA 3FFDB 4NQSB 2AXGA 4HALA 1WT5C 2VXSH 3UG5A 5IFHH 1GAFH 1O6TA 3N6YA 2W38A 3HAEA 4W81A 3B9EA 5DD0H 4IDLA 5EU7E 4B3EA 1TSRA 5JZ7C 3IJHB 4KVCL 4F2MB 4NN5C 1U8MB 1UB5A 2H3XC 3WEXB 5LG6A 3IDXL 1AGBA 1UT2A 3U7WL 3R06B 3KXFD 2Q86A 5AVZB 5DRXB 5F3HA 1KPVB 3L7FB 3MR9A 5ERWB 4KAQH 4I5BB 5GZND 4J3VA 3W2DH 5SV3A 1YPZA 5D1XC 3U9WA 4MXVE 4APQB 5DEFB 2MWCA 3UYRH 1KJ2L 3V8OA 1H5BB 3IMUA 1CGSH 4DESA 3ZDZF 2E8ZA 1YEIL 1X5HA 3FT3A 4KI5F 1CG9B 1CYWA 1SLUA 1A9EB 4GRMB 4KPHH 5CEYB 4UU9B 4NBXB 4KXZI 2KUTA 2ADIB 3T9WA 2WY3B 3ABLB 4ZD3L 1IGJB 4KK5D 3Q05A 2KERA 5EBGA 5KG9B 4JO3L 2IF7A 1W72A 1A7NH 1BVNP 2NY5L 4LCWA 4X7EC 3QEQB 3VGAB 4KFZC 2NXZC 1HWWA 2H2SC 5KYWB 4G71B 2N0MA 4KI5D 1QTSA 1WC7B 3MXWH 3BHBA 4Y16B 3VU2A 1PZSA 3C5XA 5D1XE 5ESQA 4AWJC 1BFOB 1H8NA 5I76A 3NGBC 4UINH 5GSRB 4U1NB 1KCVH 4GSQA 3RVWC 2EKSA 1J5DA 4KO5A 2JTDA 3SD5A 4PMFA 2EDXA 5FW8A 3HC0B 3ZZLA 5KVFH 4U31A 3MRHA 1NDMA 4RA3A 1GYVA 2YPKA 3X14B 5ID0B 1FA4A 2GC7C 2EYSA 4P2OB 2ICEB 3P4OB 2QGEA 4ONFH 5GS3A 3QFJB 4LVEA 3BCDA 3DOHA 4M56A 3ZDZE 2ZP0T 1BVKB 3HI1B 1Q38A 4YSAA 1UB6B 3VFOA 3QPQC 3WY3A 1M3JA 3UBXB 1I8LA 3ZYJA 3OPZL 2ZUTA 4I13B 4AV0A 5EN2B 3UC0L 1QASA 3UBGA 3ZHLA 4KNTA 4Y4HC 3PL6D 5F7MC 2XG4B 1FFPB 1QSFA 3KPLB 4JG5A 5FYJE 1SLVA 4KGLA 1P5VB 1HEHC 1W91A 4BRVA 2AK4A 1WAAA 1AG6A 4G5ZL 4WVRA 3WIHA 3NACH 2B1HL 3HPLB 5LQBH 2C8NA 3FN0L 3RVUC 1C12A 1HHIB 4X6DB 4G8GB 3AS3A 4O58L 3EADA 1NFIB 2QSCH 3K2MC 1NC2B 5JQHC 5B3JF 1JPTH 3H7LA 1DANU 1OSPH 4XBEH 1SMDA 5HJGA 2BS9A 2IDQA 4KMTL 3S3PA 2APSA 3RX9A 2B1AL 4QOKA 4PRDB 4HU8A 4K5PA 5I0ZA 1RIUL 4ODWA 3TIDA 4YBLC 1CICD 1NC4A 1WA0X 5E6SB 2Y7MA 4XXDA 2BIPA 3EF4A 3GIVA 5F7HA 2VQUA 1WBZA 2WPGA 2XZAH 4GEJA 5C08D 1QEXA 5DI8A 2EDDA 3FOLB 1JP5A 5DVOA 5HY9B 4DZ8A 3EYFA 1AXTH 2Z8RA 3OKOB 1H0DB 4FQHB 4JHWH 3V5HB 4ZX5A 4AZUA 3RVXC 1B4RA 2IANE 2TSAA 4FL4C 3V4PH 4UINL 4UOQA 4WI9A 1B0WA 3S2AA 1NOFA 1DBJH 2VKWA 4L4TA 3MRNA 3SGEH 4J3OF 5E1IA 3F5WB 1TFPA 1B4JH 5D7JB 1VPOL 2IWGA 3BUPA 3UYRL 3M7OA 1YHPA 3RWIA 3VXSE 3DJ9A 5CJBA 2XCMC 3AREC 1RZ8A 1XR9A 3H4FA 4ZW5A 3GHEH 4DCQB 5E94B 5I16B 1AHKA 4M8RA 3QJSB 3KVPA 3MSPA 3QHTC 4AKOA 1S7VB 1RUQL 2WO3B 4UMGA 3I75B 1MFAL 1YNLL 2B5IC 3LNIA 4JFZH 5C0CE 1Y0LB 2BIIA 4MMZA 1G7LB 3MLVL 4XO8A 1BFSA 3KYKL 1ZPLA 3V9EA 4JQIH 1DFXA 2MOVA 2R1YB 2RTTA 4R5TA 2Y6TE 5AB2A 4D8PA 3L95B 2ZNXA 4AUUA 5I8OL 4MFHA 1YEDA 2KDYA 2L0DA 2MMXA 3SIKA 4FTVE 3VXSB 5I1KH 3DARA 4ABUA 1S7SB 1E4XH 2NXYD 2B1HH 5A2IH 1GA2A 1H3VA 1R3HA 3HG5A 3MLYH 2HX8A 3HIZA 5ISZB 1NWPA 1I7ZB 3ZHFA 3MI6A 4Z7QB 1B9KA 2ZKMX 4NXSA 1J8HD 4MCMA 2NX5B 4LLWB 1VADA 3LKNB 5A6LA 1YYML 4HOZA 3MOAL 4ZAKD 3W0WE 4KJYB 4UQ9A 2FQFA 4ZUWA 4HUNB 4B0MB 2YD5A 3TEUA 1PVHA 4MCNA 3P4NB 3QA3B 4L23A 4PJ6A 4JG1H 5T3XD 1XR9B 5LXVA 3CZLA 4XVUD 5F6HJ 1LO2H 3T09A 4OCSH 4ZS7L 5B3SB 1KBWA 1GAFL 2AZUA 3CSTA 2J4WH 3TURA 4FEIA 4WK0B 5D70H 2AJUL 1PZ2A 3NPZB 5HDRA 1F1DA 5KYXB 5LGYA 4B9YA 4JPVH 2YA2A 4Y5XA 1NAMH 5ALBH 3MNVA 1AG0A 5GGVH 4YAQA 4P23C 4YDVA 1NDGB 3MA9L 3RA7H 1Q94A 3JTTB 4HS3A 4WHCA 4LGRB 5LGJB 2JCCF 1PG7X 5D7EA 2R7EB 1OP5K 5I9QC 5GS2D 2CGRL 4E68A 1XIWA 3D50A 1I75A 2PYEE 1P4UA 1CF1A 3QIWC 4GUPB 4WI0A 2OZ4A 1UQSA 4WLCA 4K7PY 4PJBE 3MROA 1WA2X 5EIIA 1JGDA 2H3KA 3MACL 1RFDL 1ETJA 4XXDB 2A74C 3G5XA 3BW9B 4P2YA 1P7QA 3KPMB 4EDWH 5LN8A 4XE5B 5F7YC 3WTYA 1M9SA 4U3XA 1JHTA 5C6PB 4Z7VA 4WW2F 4TVPL 2X4NB 1RIVH 3FO0H 3WE6A 3RGVB 1CGUA 1AS6A 3GO1L 3I50H 3MBEA 1FGVH 1S3KL 3TGXA 3VFUA 2VM4A 3FBQA 2NT0A 3VXME 1IM9B 3DUHA 1S7TB 2Y06L 3VFMB 3OMAB 3PPEA 4N6RB 3GSNA 3MUHL 4NRZA 1FF5A 2LLLA 1T1YB 2X4PB 4HXAL 3EDJA 3UZVA 5I6XC 2J56A 35C8L 2ZX9A 4GAYB 1BHGA 2OZNA 1KC5L 3OGOE 4L8DA 5CHNB 5K9JH 3K6FA 5FO7A 3IGAB 2WYIA 2WKLA 3IJ9A 4MXQC 1YNKL 3NA9H 4FXKC 5I18H 4R0LC 5DEGB 2XG4A 5T3XE 1RHHA 3TT3L 3PP3H 1NIFA 3EJZC 2HVBA 3FUDA 4PHZA 4TUKL 1MIEH 5DWUH 1RJZB 4PV8B 3EGXB 2R4RL 2N56A 3SJVA 1UYWL 3QQNA 3MHZA 4PJXE 3A0OA 1BVKA 3FN3A 1SM3H 3WNIA 3N9GH 3TBBA 3GLAA 1M7UA 3UZQA 2A9BA 1K2DB 1UGNA 2CXKA 4X6DE 2HLEB 4L8BB 5KVFE 2DKUA 5EEYA 1JYXA 1KWGA 3C6EA 1JWSB 1K5WA 4ZOEA 1TPXC 3PIQA 3MRHB 3D0LB 1KXTA 1P53A 3EYOA 4PTUB 4F58H 2DWDA 4MNHA 4YGVB 3KH3A 1AQDA 3QUKB 3D5OF 4GRLC 3T0EB 5KSUB 1IGTB 5GSRA 2P8PB 4LVHC 2B1OA 2GABA 4WEUD 3KYOB 1ZSHA 1EHNA 2V7HB 5D7SL 3UBFA 2HKFH 4FFYH 3SYPA 3V52L 4Z0XA 3BXNA 1R5VA 3JZYA 3LQZA 1A1OA 4LQFH 4KV5E 4Z23A 4YDJA 2VAAA 1P7KA 3DX6B 1KB5L 5IW6B 5MERB 1G7QA 3O2DA 4PVMA 3EG9A 4MMZC 1J10A 2GTZB 4ONHA 3II2A 5JHAA 4YO0A 4P04A 3FU5A 2JV6A 5JDJA 1LMKA 4HF5H 5FYLD 4PG9A 2OK0H 1YNTA 4B9IA 3OAZH 2WLIA 4KKCC 1IE4A 5FHBL 4UQCA 3HR6A 2BVTA 1XGZA 2VQ1A 4TTGA 2G4EA 1JF1B 1GGIH 3VRJA 5DZ9A 4ZRGA 4CSPA 4AQEB 4CSTA 1X5XA 3TNMA 4PJXA 1LK3L 4IIZA 1W8NA 3UJTL 1NAKL 1QRND 1S46A 2CJUH 1QQDA 3GBLA 5SWZB 4AL8H 1RURH 4L3ED 2E5EA 1OAXH 5F7FA 3OJDA 5T5FA 2CO7B 3L3IB 1IFHL 4XWGL 3GZKA 5IBTH 3V0EA 2B20A 3AMKA 4K7PX 4DNLA 4EN3D 3CZNA 3UC2A 1RK1A 2MCPH 4UQIM 2DS4A 3FRUA 5DA4A 2X7LA 1ZIAA 2E7BA 3RIFF 1QBLH 5D6DA 4AL8C 2Y1VA 5FAAA 4DPRA 5ILTL 2WVSA 4BK5A 3MRGB 4ATTA 3VE0B 4MA7L 5DC9B 1ZEAH 3IJHA 2OQJB 3AUWB 5FIEA 5EULV 2HRPH 3NCMA 1WIUA 1WZAA 2X9ZA 4MA8L 4HV8B 2EVGA 3OZLA 5IQOA 3U7WH 4F27A 1EVTC 1ZGLB 2QHRL 3LH8A 3L3DB 2I60L 5E6UB 5F0MB 3CN3A 4IOSA 4H25B 4Y2DC 3W9EB 1KEML 1TEGA 3IT8D 4O51A 2A5UA 3BE1H 3QHZH 3DV4A 3CMGA 3U9UA 4Z77A 5JUEL 1R24A 2VR3A 1FZMA 1TZHA 5DHVH 4JPWL 4N2AA 4F33B 5AUMB 1UT1A 4H8WH 1G7PA 2Z65C 4I77H 5LNGA 1CDBA 5TF0A 3VI4A 4YC2C 4AYFB 2BIHA 1C16B 2Y24A 5LAPA 3S3SA 5L4JA 1UZ8A 4FQLL 3TBWA 1G0XA 1OM9A 1URIA 1OOWA 2N0KA 2E6PA 4EI6A 3SY0B 4AVKA 3IBEA 3AS1A 1F56A 5JHLL 1MWAB 4M03A 2DDQL 2GY7B 2IAMB 2VWEE 3RWCA 2EVIA 2JIXD 3MFGB 1OCWL 4HAFA 4JLRA 3B56A 1W72L 1JZ7A 4XNAA 3OR6B 2NW2A 4IQHA 1LWHA 4P4KA 4YK4B 4K3GA 4OR1A 2VLJE 2RAMA 3FTYA 3FRPB 4ATWA 2VUYA 1E6OL 4XNXL 2QQLL 2EDWA 1X6LA 2VDKB 1URLA 4YLCA 3TC9A 5GISL 1Z7JA 3SDXB 4MJ2A 2IQAA 2Z1PA 3VW3H 3LQAC 5HBBA 2PXYB 1C1EH 2BNRD 3GI8L 1LK2B 3KPRB 1GS6X 3MJ7A 3D09A 3QWRD 3CN4A 4DTGH 2IOIA 2J21A 2VLME 4G42A 4O02B 1MJUL 1LILA 4NO0B 1M7DB 3VYOA 3T4AB 1J05B 2ETWA 1U30A 3BUTA 1FIEA 3HZVA 1CUOA 1MSPA 4OH2A 5MEQA 3RY4A 1QWNA 5EOQL 2AGJH 1UHVA 5FA4A 2WP3O 3V6OC 2NPLX 2PN5A 1PYWB 2GFBB 1UOKA 3RVVC 1ZJAA 4RMWA 3T0EC 2FCBA 2F0CA 1HL4A 3BSGA 4I1RA 1JV2A 1J8HA 4J4PC 2AQ3A 3GMLA 5D71H 5J12C 4PVBA 1QG3A 4QTHA 1ZY9A 5GS0H 2R27A 1NC2D 1GZPB 4HCFA 2YKKA 3HJEA 3PYCA 2F74B 1FV1B 3DMMD 4CADB 3V9CA 2QADC 1J0YA 5F3BB 2VLKE 4BWWA 1A9VA 3JV5A 4F15C 5FGSA 3L3KB 4PJ8A 1LP9B 4H8WL 4OLYH 3IVKB 2FYYA 3O8XD 3NABL 4Z8FL 1QNIA 3GPEA 4GY4A 1S5HA 3MJ9H 4RFNB 4PJFA 5C08B 3F83A 4J6RL 4N0RA 1VF5C 1G7IB 1I1AD 5H37G 4BH7B 4DGVH 1N70A 3K91A 5GHWL 4GI8A 3IMBA 1FFNB 4MMXC 3Q13A 2CLVB 2ZOWA 4XI5D 2R2EA 1HHJB 3U83A 1J18A 4WFHE 3JUYA 4RAHA 4GAJL 2O61B 1Z0MA 2WBJB 4Q89A 5T1DH 3D0VB 3G5WA 3QS3A 3TFKC 4ONHB 2A2QT 2WIIA 4L1SA 3L3OA 1G7QB 3SZ6A 3U4KA 1LJMA 4MTMA 4DP6X 3FQUA 3FMGL 5IW6A 1TF4A 1R33A 4M7LL 4XVTH 2E27H 5DC4B 1ZT1A 3U9PL 3ARBD 2Z7UA 3T0BA 2QADD 5BQ7B 1HQRB 3BMWA 3MLZL 4X99B 5F9JB 1KGYE 1RZIB 4LEEA 3GM0A 2I9TA 3VSQA 5BOPA 4TSBL 3RPIB 4MQ7B 4R5XA 1HQ4B 1W6LA 2AI0H 4POZD 5AYQA 4PB9L 1IC1A 1D7CA 1P7BA 4X7SH 3DUUB 5K39A 2YQBA 3GIZH 3QCVL 1R3IH 1WHPA 3D85D 5CCHE 4GBXA 5EU6D 1XXFC 4GXFA 5CZVL 3N5AA 4FYQA 4Y2DB 4LXFA 3FHAA 2C1PB 5CILL 4NZRL 5BVJB 4TUUA 1H8SA 2VR6A 5DJZA 4HT1L 3DHMA 4BSWB 2EIEA 4NLAA 1OF2A 1FVCB 1C5BL 4MD5A 1CO1A 2VE6A 3ZTEA 4N28A 3A47A 4NKMA 5EEUA 5DS8A 1JCVA 5T1MA 2AEOA 1A6UL 4DKEH 2Z92A 4MD4B 1B0GB 3O9WD 4LSSL 4JKPL 1W0YT 3ARTA 1T6VN 4QCIB 3QWOA 4U1SA 4UBDD 3Q2WA 5LLIC 3EHBC 1ULVA 2GKIA 1HINH 3F12A 4QXGL 1BW8A 1PG7W 4UZSA 3PAUA 4YNYB 5C0BD 3T65B 1AC0A 2BY1A 1D9KC 4NNPL 3L5XL 2FJGB 2WVVB 2X88A 2R39A 4MQXC 1U2CA 3IDJB 5I1JH 3GSOA 2VDOL 3NJMA 2ESVA 4CC1A 1S8DB 4HBCH 5E7BA 1QLFA 4NRZB 3HUJE 3JT0A 3GXIA 3MJ9L 3CFMA 4O2FB 1RUPL 2WXFA 3PUUA 5D55A 4UBDC 3P3YA 4EUPH 4XPFL 4XNMB 3WE6B 2OJZL 3WXWH 4NAMA 4Z7VB 2QEJA 4L9DA 2EE6A 1OK0A 4DQAA 3P4LA 1F41A 5CN1A 3IJEA 1A6WH 1DN2A 1J9TA 4KHTH 4BFBD 3ARFB 2Y2TA 2OSLB 2H26A 3B2XA 4MXVF 5MP6H 4Y19B 4JW3A 4KJPD 3ZL1A 2CPCA 1QEWA 4MJIE 1QMUA 1RUKH 5AB1A 1KCSH 3KWUA 5B7EA 4V1DD 5HSFA 4K55A 1IC7L 1ZWIB 3HG1B 5CWSA 4PBDA 32C2A 3LY6A 4HGKC 4F7CB 3WKNA 2X70A 4JFFB 4OT1L 3BKCL 3B5HA 2AMGA 3RVXD 4HDIA 5IVXF 5I8KL 4BFJA 1BZ7A 4CC4C 3GPSA 3NVQA 4NN7B 2H9GB 4FTVD 4IBLT 4IRJD 3V6OA 3QHZL 2FT6A 1XR8B 2RIKA 2ZQKA 3M8OH 2NW3B 1SBSH 1F97A 1E9OA 1MPAL 4OZIE 1T0NA 3UFIA 4X8CA 3ESPA 5ISZE 4AMKL 3TH4T 1H9DA 5E2WL 4DETA 4OJEH 2YAMA 5FFLA 1FAIH 3OAUH 4X5WA 3VXQB 1P6AB 3NSDA 3IPEA 3T0WA 4LL9A 4AEIH 3V4VH 1FZKA 1TZGL 4OZIF 5I66A 4L29B 4M6AA 4Z3TA 2G5BB 4CU8A 2ATKA 3DMMC 2ZD0A 4APXB 1DBML 2IDCA 3O2WL 1RPUA 4QRUB 2EXYC 2JNZA 6FABL 4TNWK 4FE9A 1ET7A 1UT9A 4K3JL 1I8UA 4UIKL 5I0VA 4TSCL 2FZ3B 1XF1A 2ALWA 1UWXH 4XB7A 4QYOA 4R0LB 1KGUA 3DVNB 2YPVA 2DMGA 3O4OC 3IF1B 4WFFD 3HKZA 5F7AA 2P8MA 3FUNA 3ULVL 3MRIA 2VDML 1W15A 4L2LA 5FEBA 2EDNA 1Y0LA 2ZJSL 3ZN6A 2A1WL 2IAMD 4G6AD 4PJFF 1C08B 5GRJH 3S5LG 4FNUA 2VDPL 4KX7A 3DX1A 4PJ9B 2MHAA 3DO7A 3WFBL 1ZCRA 2E8YA 4ZODA 2X12A 1FCGA 4P3CL 5DD1L 3ARGA 1ID5I 1CLCA 1HIMH 1N7MH 4PLJC 4XNQB 4R8WH 3D08A 4LRIA 4RNRB 3GLDA 1TIUA 3PS6A 4ONFL 3T8MA 4PJAE 2J1ZA 4IM8A 4YZWA 4GS7C 4H20L 5D7JA 4M93B 4ZUVB 4JGJA 1PQZA 4ZMXA 1NJ9A 2QQKH 3DSFH 4PGBB 5TE7L 1D5XA 4NYLA 2NY6D 4ZS6D 2AXFB 3ETSA 3ZDYF 3ZX1A 3TH3T 5JHBA 3KPSD 1MLCA 4RWHA 3FPYA 2NQDA 5C2UB 1GMIA 1L0YA 1P84J 4P2OC 1F6AB 2OMUB 3MNWA 4XPHL 4F7KA 1YNKH 4YDIH 3TJEH 5DJXA 1I7RB 3HS0B 3MRLB 2WUBH 2X89A 4GMTL 5F1SA 5SWSB 3VA6A 3BIKA 4PJHB 5I6LA 5IY5B 4AXWA 1UD3A 3DSNA 3H8NA 4A2DA 3D4GA 4L8CB 1N8ZA 4BZ2H 1AVAA 2QZQA 4YR6A 1OPGH 3ARZA 1KELL 3L81A 2IH1B 5FM5M 2EE3A 4KKAC 1AOZA 1BAFH 3FQTA 1EFXB 5A7EA 4OGXH 2VLLB 1VACA 4XX5A 1C5CL 1B0IA 3NJXA 2JKJA 2Y7OA 1UWEL 32C2B 3PWNB 1XCXA 3X1NA 4OLZL 2VDNH 1ADQH 2VISA 1IGML 3ARVA 1MCHA 5IB1A 5HP5A 1KLFA 2GIXA 4KJQC 5MENA 1VEOA 3Q01A 5JW4N 4B9ZA 2WTOA 1KJ2H 1SJEB 1Z5LB 3O4OB 3MXWL 2E7HA 4NP4H 1T2QL 3VFVB 3QYNA 4BIKA 3VI4E 2XIDA 1G7HB 5CILH 4OBSA 1E42A 1U3NA 3ZDZB 1U9KA 1MFUA 1GZQA 3FCSB 5GRJL 3T08A 3MJGX 3MYZA 2ZXDA 1MWAL 3S36H 3OAYH 2R2CA 2RH0A 3EJYC 2KKQA 2PUQT 2YSSA 3P69A 1MN4A 2PTVA 3GIZL 2O72A 3D4CA 4FNPA 3ZKMC 4WGWB 2QADB 1O9VA 4W4OA 1XGYH 1S7RB 5D1XB 3PHQA 3V0VB 4IK7A 3IJ8A 5FGBC 1IV8A 1UM5H 3HC0A 4G6FD 4M7LH 3SDCD 4C58B 2WVVA 3U4BH 4AJ0A 2F53D 4NQVA 3QZPA 4HIHB 4YE0A 5FO8B 5FA3B 5AZ2H 2VLRD 2CLRB 1KXVA 4R7NA 1IC7H 2AERT 2V0AA 3CXFA 3AU1A 3C60C 1YUHA 1B0GA 1BFOA 4BCYA 5D2LF 2YPLD 4N2LA 1KJMB 4WSGA 2IVFC 2BSTB 3JQOB 5T1KB 1CDIA 3BHBB 3HNTH 4Y16A 2JJTA 2HXAA 4FRWA 4BSWA 5KYWA 2ZT9C 3IJYB 3FU0A 3EH4B 4HSQA 2WWMD 1MCQA 1THAA 2QGDA 3M8OL 5LB1A 1KTRL 4PJCF 5HI5C 1UD5A 5BO1H 2Y1AA 4YQXH 3SBWA 2E75C 1HOCA 1RVFL 2XQYA 1WZ1H 3C6SA 4RGNB 5F7DA 1MG2C 3AQDA 1BYPA 1UJ3A 4KQ4L 3GMQB 1UURA 1GH7A 2D03L 1CG9A 5C2BH 4FLSA 3HS9A 3LRLA 4JFQB 4HIEA 1WO2A 3BAKA 1ADQA 2GHZA 3REVB 1MCFA 1JZJA 1RZGB 1A7OH 2UZYB 3DVFA 4KTEL 5JW3L 3UADA 5DEFA 3QO1B 2IAMC 3VMNA 4APQA 3FQUB 1I3UA 3MV01 5HYFA 5EN3A 5FX3A 1CURA 2ZOKB 4MDRA 3QRGH 3SKUD 1D9KB 4G8EB 3R06A 1F4YH 1M56B 3O6MH 3K81A 4EZLA 3EHBB 1OCOB 2X6AA 4ZFZA 3PGFL 1T22B 5IQNA 1J12A 2X6UA 3HNSL 2OTWB 2YD9A 1YMMB 5I23A 2EEFA 1N8OE 4P2QD 2WV3A 3O2DL 4NRYA 1MXDA 1SDYA 1NTDA 3DECA 3ESOA 3QZWB 1GIGL 2HRLA 4AQ1C 1BXVA 2ADJB 3B2UD 2Z35A 3LEYH 4N9OB 4KXZH 4NQSA 4P2RB 3Q9PA 2IMMA 3VWKA 5DXWA 4AH2A 4NGHL 4NSKB 2PCPA 4OUUB 3CHSA 4U1KA 3OTTA 2Y7NA 1J0JA 5D96B 3EDDA 1X9RA 4NBYB 5E8PA 4ELME 1Z9PA 3KLAA 1S4IA 4H1LA 5AKVA 1DUYB 1T1ZB 2VLJB 4YHML 5TDNB 2VDNL 1AGFA 1DDHA 3L4YA 3VQ2C 2X89D 4HCGA 3NGBB 4WU5A 1LMIA 2Q8BH 3RKDC 1M3IA 2IIJA 4Z7OE 1JK9B 4A67A 2EDHA 1AIFA 1BQLL 3TCTA 3PLYA 3VXOA 3WO3B 3D2UB 3O4LA 4MBRA 5BO0D 3QULA 4NB7A 3AW5A 2VLKA 1KLGB 1PX8A 3HMXL 1GGCL 4FMFA 4J1UB 3SDAA 5BZDB 4M7ZC 4WKZA 3CDFA 3BEVA 3QUML 3OXSB 4K8RH 4XXWC 2XA3A 5GIRB 4WNSA 1NAMB 4GQ9L 2I25N 3MX0A 1SOXA 5EEWA 3JWOL 5G5DA 1SMAA 2QKIC 4NAJA 5FOBA 4EI5D 1FLRH 5AZUA 5H4YA 3ZSTA 1QFUH 2HPOA 5GGQL 5CEZE 3QG6A 2PP8A 5BRZB 4UOW0 4FFZL 5GGTA 3GHEL 3LXUX 5LWYL 5GIRA 1CR9H 4HPYL 3PGCA 3HC4L 3NTCH 5DUMH 4PJ9D 5C0DA 1GGYA 4HUWA 3BVTA 1OE2A 3MLWH 3TBYA 4U3HA 4ZFGL 2HTLC 4OCRL 3UIZA 3LOWA 1KLGA 5FV2A 5DRNB 4ODVL 4PRNA 4OLUH 2OX5A 3GSVB 3H7BA 3K2KA 2QTVA 3S4SG 4Z8FH 1XQ4A 2ARJQ 4RMUA 4CGTA 2LAAA 2DQFB 1AHWA 3ZTJH 4LVHB 3IXTA 2F58L 4G8FA 4NN5B 1XTLA 4NKOA 4OQTL 1A4AA 4Z7OB 4FD0A 1SXNA 4G8AC 4J3SA 4A38A 4DKDC 1DUYA 1T1ZA 2E4FA 1GGUA 4GI9A 5C07E 2XQYK 3GS0A 1WQVT 1T1XB 1R24B 1F42A 3U9UB 5L88L 3DV4B 2PYFB 3L5XH 1LE5B 1G9NC 5GZOC 3I02B 2XNAA 4J28A 4QHNA 3DTDA 3P0VH 5DZJA 3CC1A 5CMAA 4PRPE 5C0JA 3WNLA 4NO3A 2B3RA 3J07A 1WBXB 1UXSA 3FW6A 1UD6A 1UXWA 5A16B 4OI8A 1Q0YL 2P9RA 3ZMRA 1NGYA 2WKOF 3VGDA 4A7VA 2NQ3A 1CK0L 2OTWA 2FLMA 2L7QA 1U93B 1N2RB 3PABB 4HU2A 2XA8L 4P5TB 5DZOA 3AREA 4FA8A 4IGBD 1ZLEA 4HKJA 2LW3A 2NY7L 2Z0UA 4YK4C 4QUOA 1ZVNA 4YEEA 5TE4H 1CFMA 4O02H 4PWGA 3BVVA 5CZVH 5CEZD 2EAEA 4UV7H 2PPEA 5BZWB 4QLWA 2VW6A 3MJ6A 2KHAA 2JKWA 2P5PA 2ZOKA 4U1IB 2QL1A 1QO3B 5K9KB 1TJXA 4ZOAA 2WQUA 1LNUA 2H2PC 2BOCA 2GSMB 3WHXA 3R4RA 2YD6A 5GS0C 5I1HH 4NO2A 1QSZA 4OCWL 2R59A 4BINA 1MCNA 3NDZE 4XPAL 3RB7A 3ZE0F 3DX7B 1KENL 1JWUA 4G7SB 1MJJA 4NC2B 1S7QB 2D73A 5AYUH 5LAXA 1C5DB 4POZC 3MMEA 3D1MC 3QDJD 4YC2B 3T4YB 4P99A 4IMLB 4L3FA 3U1PA 2FX9H 4FCAA 3WJLC 5IWLC 5T3ZD 2X4QB 2VQ1B 4U4BA 3UPAA 3VXRD 2EO1A 4JAMB 1IEBB 1VGKA 3QEUA 3FXIC 4U3CA 2ODIA 1D7FA 2XPGA 3KGTA 3BAXA 4WTZG 1TNMA 5LCVL 5TH2B 4AYEC 2OI9C 2GTZA 4Z7QF 4LF3B 2P5WB 3EO0B 5I9QB 5LCVA 3MRDB 4XVJH 4BHUA 1NZRA 2BSTA 5TK4A 4AK1A 4DW2H 1MCOH 3NH7H 3ENEA 3OLDA 5DHYB 2O6DA 3CFCL 5EU5A 2IBZX 1N7ML 1XF5B 2P5EB 4IIQC 3BSZA 4R7NB 1GGCH 3LSOB 4YL9A 2HFFA 3Q8FA 4N2NA 3QUXA 2YOCA 3V0WH 2GAZB 4PRBB 4Z3GA 2FR4B 1EEYB 1FGVL 1S3KH 3RL2B 1T2JA 1UH3A 5FCUH 4U1HB 4UTBH 1MHEA 4K94L 5EU4A 2GJ6A 2AQTA 1IIIA 4GQRA 2CG9X 1E4XI 3QR0A 3ULVH 1HL8A 4DP9X 4WHDA 3PV6A 4LLMA 4Z7AA 4OFYA 3D51A 2YPVH 2XN1A 2OMWA 1T66D 4IS6A 4W4NA 2W0KA 4F80A 3WSQL 1GJIA 1PU0A 1T89A 4RFOH 3P40A 3LMJL 4P5KA 4ODXB 2DY2A 1JRHH 3H9SE 3VFPA 2BRRH 4N8PA 4ZFGH 3GWJA 3QDJA 5HYQA 3QDJE 4JK0D 4LCUA 5GGSA 5HD8C 3V0FA 3GM8A 2FSDA 1K5NB 2O6CA 1RHHB 3EUDA 4ZQKA 5DEGA 3QJHB 5KYUA 4A6YA 4YHNB 4XXCA 3N43B 4DIXA 3TYGH 3MLXL 3QIBD 4K15A 1XGUB 1Z2KA 1KLFB 1A64A 2Z6FA 2FHFA 4N26A 1JN6B 1U8NB 1Z1WA 4HHAB 2PO6C 5LXGH 3KPNA 5IF0B 5DSCB 2A77H 3O0RL 3UZVB 2HFGL 5ESVB 4JO5A 3RIAK 1DCEA 3O3DA 4F57L 4TUOB 4YHZL 4LLDB 2ITCA 3RVTC 2GJRA 5I6PA 3L3GB 1B0RA 1UTDA 2JIXA 3VH8A 3KDPB 4YDKL 1TQTA 1YMMD 2G3NA 3HZMA 4TQIA 3RWEA 3EYSL 4XP5H 3U79A 3CH1B 2K1MA 2BMKA 1QLRB 4BFOA 3LH9A 1F3DJ 5GSVB 3MLSH 1A6AA 5I1IL 4EQ3A 1PZCA 5BW7A 1A2YA 3P9LB 1A14L 2Q8BL 1EGJL 1FH5L 4WU7A 4BWUA 4UANA 3UJJL 3AWFA 1A6VL 2EXYD 5JOFB 1CFSB 3QORB 2EVFA 1WICA 2YGQA 2ZX7A 5GPRA 1IBYA 1D5XB 4LFHD 3ZLQC 9CGTA 4YAQB 5FV1L 2A3TA 3BE1L 3CPLA 1AKJB 1NGPL 2ZG2A 3LKPB 1PG7H 5TQ2L 1VFOA 1T1WB 5IG7A 3PREA 4AQ8C 1VA9A 5IHHA 2OMZA 4O2EB 2Z91B 4M62L 4EI5A 1LDPH 1MZYA 4RX4D 4YHKL 2A6JA 3Q7JA 5C0CB 2NUTB 2YFOA 4FKHA 4H8QA 4QWWD 4NLHA 3U7YL 5EA0L 2OMXB 5AOJA 1IC4L 4QT5B 1Q8MA 1LWRA 1RCYA 4KNUA 3Q9QA 1AFVH 4FLRA 4G9FE 3S8WA 3K71B 5GRWA 3M17B 2JKRM 3I6GB 3KPQA 4IBSA 3Q3GB 1C8QA 1VADB 1MQKH 2CJTA 1J9CT 4IRSB 1VHPA 2FDBP 1NGQL 2IBZY 2Y36L 2X5PA 3T3PB 2HZHA 4DKAA 3LKQB 3EDEA 4WNQB 2WXPA 2NYZA 2C7FA 3QFDB 4YDLB 1J1PL 5K33A 4UT6H 1F58H 3C5JB 2V37A 1LEIB 3QUGA 3RURA 4OKVA 3ZL4L 4QHLA 4X80H 3A4FA 15C8L 1U36A 3GC3A 3UMNA 4G6KH 2DLTA 4R90L 4XBPA 5SV4A 3OSVA 4BYHA 5D93C 5FYKD 5HYSA 3G5VB 3GMOB 2VIRA 3QQ4A 3ZY7A 2XTJC 4QY8A 4RDBA 3BLBA 2DQHH 1DBAL 5I66B 5EPMA 4FMKA 4QTFA 4X9FA 2JK5A 4AG4L 2RB8A 2V6HA 3IE9A 2CGYA 3DX4A 3FQNB 3A5VA 2AQNA 4KROD 2YBGA 1F1GA 2HCZX 4D0CB 1XGQB 3Q8EA 4E36A 2PP9A 2PCXA 1PIFA 3AUVA 3BAEL 2QSTA 3VD3A 1HI6B 4KHXH 2Y5TA 3KR3L 5TFSH 4I9WE 4TNFA 4AYID 2DLEA 4LQFL 3Q1EA 2UYLB 3GKZA 3OXRB 3QQDA 4JCWA 1IAOA 3B2UC 3U0WL 2IWKA 3ZL2A 1GSKA 5GRYA 5I30L 3KXFE 2OR9L 3FS9A 1S9VA 1T7YA 3TL5A 3QIWD 3OZ9L 4XODA 1FLRL 4I4WA 1NL0H 1WAEA 2HLAA 3ZHNA 4KO7A 3BAIA 1S9YA 2FX9L 3F7RA 3SDCA 3II1A 1UZ6E 1H0DA 1QRNB 1FFOA 3EYFB 5DFVC 5G4OA 3VD5A 3LZFH 2CJ3A 4F58L 4S1SL 1ZOXA 4TLKA 4FFVD 3DUSA 2OSLA 5A2FA 3VNZA 4XBMA 4Q4EA 1ZLSL 2EDOA 5F6HI 5C8JA 4DPCX 3LN4B 3BEWA 4TVUA 3ZDXF 1MCIA 2OXGB 5BNXD 4UIMA 4XNMA 1A1NB 3ZOAA 2HJFA 2R1WA 4OZGB 1JXDA 4NPYB 3WLBB 5E08L 2LGNA 1NFIA 1RSFA 1DQLL 3ILQC 2JI2A 5B8CC 1QI5A 2BSDA 2JJSC 1S8DA 5FYJU 4M8VA 3CDZB 5CZRA 1V54B 2A9AA 2W9EL 3QHFL 3V4VB 3NFPA 3MKGA 1U0QA 2EO7A 3THML 5DEZA 5L8JB 2FJGA 3ELAT 3CHXA 2LT9A 3IDNB 4YNYA 4HPOH 1EHKB 2VITB 3II3A 5FS5A 3VXRB 4ANUA 4GXVL 4OCWH 5EZLA 1GMEA 3EJRA 1XAUA 1SFHA 1KZQA 2BP3A 2J88L 4MWFA 4MXWL 1SYSB 4MDJB 3F7LA 3F04A 3NCJH 2ZXWB 4UILL 1JGEB 4IRSC 2HYMA 3QIUB 4GW1B 4KX9A 2NY7H 2J1KA 2L3BA 4RFEA 3CFDA 2QPEB 2P48B 4M7JL 5DZVA 1TTUA 3IRCA 2VN7A 3Q0HA 5E5MB 4N2KA 4ZOCA 1KGJA 5FKAA 4MJIB 4OJDH 1DBJL 2WXKA 3GXMA 4P05A 4MCZA 4BUHA 3DUUA 2VWEC 1DVUA 1MCEA 1V55B 2PCFA 3D12B 3KAAA 3PDGA 5DRZA 5C0GA 4ZZFA 5AL0A 3WS3A 2XY2A 5J6GB 3TCXA 1HHKB 2IH9A 3LJ3A 4G6MH 4L4VE 5C0GB 2ADYA 4IBTA 5I76B 2H6PA 4MJIA 1RZIA 3G3LA 1EEUA 2YZ1A 3G6DL 3WTTA 1SN2A 3BP7B 5ACZA 5IMLB 3RTQD 4QWWC 5DUJA 1YNTF 4AQZA 25C8H 3QORC 4E9RA 4R84A 3CFDB 4PAZA 3LQAL 1PG7L 3HC2A 2E86A 3PJSB 3ERXA 3G04A 5TQ2H 2X4SB 4Q6IC 4ZSOE 1KUMA 3MUGB 3NDYE 3UZEC 1NCWL 1ZLSH 3GSXB 3ARGD 1ND0A 1WDAA 3ZRSA 4JPWH 5EMYA 4FQ1H 1J5IA 2GJZA 4D0DA 2CJSA 3SQOH 4ACTA 2JQZA 2FSEA 1F18A 5D1QA 4YHOL 3B7SA 4P9MH 1ZKAA 4PP1D 5C3LD 4FP8H 2K6YA 4GKZB 4R7DB 4JN1H 2NY1D 1UA7A 3C2AL 3KGSA 4OD3H 1TQBB 3UJJH 3L6FB 2EDKA 4C4BA 2VM3A 4PWIA 1CZ8L 3N85L 1OLZA 4LAQL 3K2UL 5I1JL 3NJKA 4LZKA 3ARXA 2Q2LA 1G6RA 3G5YA 5CJOL 3CSYA 3L3HB 1JD9A 5CD3A 3WTUA 4KHXL 3CHRA 2PR4H 2X40A 4MAYB 4W9JC 1IGYA 4OD1L 4IKJA 3OKEA 1A25A 3X11A 2PO6B 4F3FB 3O6FC 5E4EB 4WI5A 4DKEL 3EGSA 4L48A 2RA1A 2YOAA 3LX9A 4Y1TA 3MR9B 3T0XA 2OL3H 3V8CA 3KW7A 4PJBF 4G11A 2I07A 3EIFA 3RUGE 2TAAA 4K8RD 1LEKA 4NX0A 4G1EA 5CLWA 1EZSA 3ZDYB 5GGUA 4D9LH 2EZ0C 2XZCH 4OF0A 5EHFA 2VMJA 3EOTL 5MEPB 3DUSB 4CJ0A 3KLDA 4HWBA 4XC3L 4BDVB 1HXKA 1NLBL 1QI4A 2B7DT 2Y69B 1TLKA 5I1EH 5KVGL 1F4XH 5DR5H 3O3EA 3CGTA 4KJWD 5MEQB 3QI9B 4CILA 3FFDA 3QEQE 2D4DA 5H2BA 1FL3B 3CV5A 3WKYA 1FVDB 2D7OA 4XAKE 2BNUA 1QBAA 1RV6X 4LSUH 2Q7YB 3SYQA 4O02A 3KYNB 5KSAD 4DOHB 2RBLA 1I53A 2V5YA 5CUSH 1JFHA 4Q74A 5JQ6H 4JZJB 5LUMA 1FG2A 1LLAA 2OLDA 4E9TA 3IPFA 3CDYA 3DBXB 3T6QC 4FDWA 2E56A 3IRPX 2BP5M 4TYUA 3VXNA 1F00I 1MHHA 3FO1A 4Z7VF 5EBLB 5CCKH 5CD5D 1U92A 5T1LB 1SQ2N 1JMXA 4ZMPA 1LDPL 4HIPA 4HYTB 4DPBX 1DVFC 3U6RA 1KN2L 4URKA 2IAMA 4APQC 2AF2A 4Q2ZA 5FDYA 2ZE0A 4H2AA 4Y9FA 1CTMA 3T0VA 3TVMC 3RDTC 1NIEA 3CX5J 4GRWF 4N8UA 3VG0L 2CA3A 4NQCB 4OCSL 1U8OB 4RGOH 1URZA 4KJQD 2APTA 2W60B 1Z9NA 5IOKA 3TNNB 4J39A 1TZ8A 1ED3A 3Q5YA 3QNFA 4OLWH 4XWOD 3WFCH 2WZPD 5JXAH 3QRFM 2W59A 3MVSA 4QHLB 3AXIA 3P02A 4OGZA 3OF6A 4HK3N 5AG9A 4IEFA 2MNJB 3HRZB 5CBAB 3PFQA 2HG0A 4XMVA 5T1DL 2Z3FA 3RNKA 4DZBB 4HLZG 4XMTA 1NGWA 1EK3A 2DMCA 3DSFL 4PI0A 4AGNA 4QRPE 4BQBA 2ZOOA 3EFDL 3IK2A 2PPDA 3MTXA 3QNXB 2FUTA 4NO0D 4KK9D 2Y3NA 3CSPA 3K74B 1HCVA 2WXJA 3CVDA 5IW1B 5ICXA 3RIFK 5JA8B 1TDQA 4I18B 4L1BA 2JE8A 1H3TA 3APFA 4JRXD 5DUBB 3QGVA 4X98B 3SY6A 4FTVA 2PETA 5IG7B 3APMA 1L5GA 2VZVA 4KITB 3LKPA 1MVUA 4ISVB 2LE9A 2X7LB 3GUTB 2NY5C 2W88A 3ML8A 4D7BA 4LNVA 2YXFA 3UG3A 4UT9H 1G9NH 1KNOA 5DMGC 4DFIA 4ETQA 3HMWH 3DVGB 1BGXL 2J8HA 1K72A 4PRIB 4YIQA 3K6IA 2VRQA 2QSQA 2Y07L 4CMHC 4LP8A 4PIBA 5DDHB 1OTTD 1YQ2A 2HTLD 2CO7A 3L3IA 4X5XA 5A2CA 5MHSD 5GS0D 3KDMB 3HHRB 3P9LA 5KZCB 4QTIH 1VFUA 4PP2A 3SOBH 1IAKA 4TUJA 4GUCA 2F7OA 3DYMA 2C9PA 3MO1A 3WNJA 4BZYA 2ZYSA 3BUDA 1UVQA 2VGLM 3QUZD 3MFFB 1K8DA 5KSBB 3SOTA 3HZMB 4AENA 1E6JH 4JFTA 4HIXL 4HJ0C 3H3PH 4RAVA 1QZ1A 1SHMA 1KDIA 1PJ9A 1T3FB 3U7YH 1QOKA 1DJYA 4HSCX 1Q90A 1Q1JH 1ML0A 4XNUL 3E38A 5E5LA 4YSOA 4N3UA 2GIYA 5AD0B 4DJMA 3DX6A 1NBZB 2AJUH 1FFQA 5F7UA 1OPOA 3BP6B 3CVHA 4OZGF 2AV7A 1GSMA 4U6VH 4XP4H 1P1ZA 2YUXA 1I3RA 4KDTA 3RWDB 5KS9A 5FKPA 3U36B 4ORGB 3ULVC 2PP7A 3RFRA 4EUPA 1H15B 3GSWB 4NQEB 2A99A 2OMBA 3O9WA 5I1DB 3SGJA 1E5BA 2QKIB 4AEHL 4WUUB 4AGQA 3RHWF 2YD7A 4ZT1A 4PJHF 3R1GL 2JI1A 4LP5A 1EEZB 1SM3L 1AY1L 4B53A 2NDGA 2UX6A 1JERA 4NNXB 3L4WA 4LLUA 4JDVA 2H32A 4GRWE 1JI2A 2VDRL 3CTTA 4M7ZB 4MS8C 4NM8H 1JRHI 4V1DA 4FP8L 5F3FA 5C0NC 4UOW1 5AW1B 3IFOA 1CB4A 3OKLA 1D5MA 1J5CA 2V2XB 1NCNA 3NIDF 3GMRA 1KCRL 4WJ5A 4YJZL 1MFCL 3QO0A 1P4IH 3TA3B 4LEOB 4PV8A 1LXMA 1HN1A 1CQYA 2WBJD 3UTSE 1A66A 3O9WB 3RWHA 3ZYZA 3TTSA 2JTYA 5HHVH 4EUPB 1DYZA 1E90A 3TONA 1OAXL 3JWOC 3B9DA 3TT1L 1J86A 4QXTB 2ZXCA 1NCTA 2F8OA 1A14H 1A3LH 2EICA 3ARBB 1SLXA 2K45A 4P5MB 4XP9L 3RU8L 3VGBA 3WKML 1KT2B 3D48R 2BC4B 5E4EC 1UXLA 2C9SA 4PJ8D 2VSCA 3LNEA 1DFBH 1KV7A 1N9PA 4MAYC 1X9QA 2GJ6D 2G9HB 3CC5A 1ERNA 4NM4L 4X5QA 1UM5L 4J3OG 2A9CA 4K71C 3ARWA 2X2HA 4MX7B 4AQ1B 4ADGA 1VGKB 3BJ91 4JAMA 5E2TL 3D85B 4D0BB 2HKHL 3IDIA 1A6ZA 4QR7A 5IR1B 1OT4A 4GFTB 2DQJH 1IVTA 3VH8G 5EZJB 3NZHL 1TJHH 5INCB 1F5WA 1UD8A 2D0GA 2VW4A 3B5GA 3DYOA 3MMEB 4XO9A 4ILDA 4Z7WE 1S7QA 1H19A 4NZ8A 3DTXB 1FBIL 4QAWA 4BELD 2KL6A 5LBSL 4MAYD 2XETA 2X09A 1NMAH 3EOTH 4JN2A 3HE6B 5DDHA 3HG3A 2EUWA 4X9BA 1N6VA 3OX8A 4DT2A 1LNUB 4MJ5B 2BNRB 4EN2A 2Y2WA 4KC3B 4BXSV 1NDGA 1NCBL 5J1SC 4AQAB 1S5IL 2RGSA 4JEGB 5AVUB 5DJ2B 3O3AB 5ABAA 4IIQA 1H6FA 5FF6A 4LLQA 4CMMA 1F2QA 3T1FB 1FL6B 4HZAA 1K4DB 1M4KA 4KMLB 4DKFL 3L3JA 4WW1B 1LM8V 3GB7B 5BV7C 3EFDH 1C5CH 1MHCA 3ZE2E 1M2VB 4KNSA 4OF3A 3NJHA 3TO4D 1QFUL 3IDGB 4CDGC 3NFNA 1HWHB 5D5MA 3H0TB 3A6BL 3V4PB 3I02A 2H41A 4XN5A 1MFDH 3K3QA 3NFNB 4NJ9L 5D5MB 4FA7B 2XWCA 2YMTA 3SDCC 3QG7H 2ZP8A 3BPOC 3F7YB 1RY7B 2D9QB 1I7ZA 4MA1B 4M8UA 1GOGA 1PZ5B 2D2OA 2W8CA 3UCRA 3NK4A 3AY2A 4XTRD 4J3OC 3QS2A 2V33A 3CMOH 4RGOL 1X5KA 3C60B 3N04A 4TPRH 5HDLA 3QWNA 2XWRA 2CWRA 3B8YA 1S7WB 3RQ3A 4CMMB 1S9KC 4L3EA 1XL4A 1QZNA 2V3EA 2FHBA 2WGXA 2C7UB 3SPHA 4U0QB 2W9LA 3DBSA 4Z7NE 4UB0L 2F54A 4LSVL 3G6DH 4ZO9A 4FQJH 4MJ5A 2ICWB 3CX5K 4I0KA 3OX8B 2G3ZA 4NQCD 4Q8BA 1EEQA 5D72L 4Y5YB 4PLJD 3U4BL 3DIFA 2IGFL 3PQYA 4GG6A 2GT9B 3EBIA 5E94A 3B34A 3DTXA 5T1LA 1Z3GH 1E2ZA 3JTBA 3S36X 2WBKA 2RFXA 1P69B 35C8H 4M00A 4K5MA 5BOZG 1MW3A 2V4LA 4PIRF 1IFHH 2BSRA 4JFPB 5IJKC 1U8HB 1E7UA 5ITBH 2VC2H 1WD8A 2F7IA 1O9WA 3D85A 1ZV9A 4XP6H 2DQTH 3KS0H 4NWTH 4N90E 2Q5BA 1RPKA 2Q76A 5EZPA 1AYRA 4YBQC 3RZCD 4AZ8B 1J9SA 4Z7VE 2FJUB 4V2CB 2G9HA 3CC5B 4H8WC 3LD8C 4EPSA 5EB9A 3H2PA 4XCEB 5E7FA 1FVDA 2NNXA 3GRBA 3NOIA 4K9EH 3GBMH 5HYJB 5I1LA 3DNKA 3PWVA 4H1LG 1FDLH 1KGCE 3B2VL 2GK0B 3CCHA 3HLAB 1XT5A 5EZIH 4GIPD 3D2UA 3ARBA 1PZAA 4YWGH 3AADB 4PJCE 4DW2L 3L16A 4Q6YA 4QXTA 4E9QA 3GIVB 4ZFFA 2WN3A 1CFVL 1S9WB 3FT4A 1DFBL 2EZ0D 1SOKA 2D3JA 2F7PA 3GHBL 2VERN 5AYTA 2APVA 3QO0B 3UPRB 1WIPA 4JJHA 5DUML 4FNQA 4PUBL 1TJIL 4UTBL 1GC1C 4LSTL 2Q1EA 4U1KB 3BGMB 2K0RA 4DO5A 2ZUYA 5HJBA 5DVPA 1WFOA 4OCXH 5HGAA 3Q6GL 1NCAL 4G7VH 1CPUA 2WOBA 5BPPA 3ET9F 1BD2A 5E99H 4K8RL 1IKOP 2QLVB 2ZX8A 4WWPA 1FFPA 1QSFB 4NCDA 2GYSA 5IB2A 4I2XB 4M93C 1EO8L 3NCFB 4N2MA 3V5DB 1MFMA 5ICYB 2DWEA 5T3ZH 1CS6A 4LSQL 5FYKH 4HPYH 5HI3D 3AXLB 3CWGA 1Z9SA 3ARDA 3REWB 1PLAA 1WAAF 1JWMA 2WINA 3CXDL 1NBZA 2WZ6A 1V7MH 3FU7A 3SGEI 1LD9A 1EDQA 2IQ9H 5D7LB 5CGYC 1I9RL 1TYEB 3BSHA 1IL1A 1BZ9A 1DBBH 1JOIA 2LABA 2FJHA 2YPVL 1A8ZA 4LSUL 5C0AD 1BQHA 3D3VA 3VJ6A 3AWGA 3S4SA 2OS7A 4EVNA 1K3ZA 5F88B 3BT0A 3GMNA 5F7DB 1QUPA 5C3IA 4WFGE 5DJ0A 2YD4A 3ULUC 3E8VA 3HE7C 4AMKH 3O4LD 4QRBA 4B9PA 5ESQB 2GG1A 2J25A 3CVIL 1BVLA 3CSGA 1O7DC 5D7KD 5B1CA 3GMPB 3L5JA 3MU3A 1QNZL 3NAAL 2ATAA 4CVXB 5T1KD 3UH8A 1K85A 3LPWA 5FB8B 1CGTA 2ENPA 1MLBB 1JGIA 1HSBB 3FOMA 3NH7L 4R4FH 3FO9A 1D3CA 5D4HA 3D8MA 3F85A 3CLFH 3RJDA 2ADIA 3TCLB 1Q9OA 5F2FA 1J9RA 4UQAA 4W93A 4BFNA 2VR4A 1FVEA 3DPDA 4M5SA 4B9GA 4JE0A 2AJYL 3S48A 1Q72H 3FB8B 2XWTB 1U4FA 1Y6KR 5FYLL 2XI9A 1ITCA 1YRKA 2W0PA 3MCLL 4YXKH 5IEKB 2CD0A 4HIIB 1YYLL 4KRLB 3MBWA 2H0PA 4Z6AT 3OKMB 1AOHA 1GPOH 1IB5A 2DQUH 3FQXA 2FIKA 3MREB 2GUYA 3NFPB 3R0MA 4M4RA 3LPPA 4M8QB 4JKWA 1KXHA 1S7RA 4N0CC 2HJKB 5C0ND 5B4MC 2KYIA 1NGWB 3FZUC 3V0HA 4TMPA 3KNBB 4G2AA 4XOCA 3VA2C 2HJFB 2R1WB 3GEWB 4RAUB 3FCSA 4HULB 1DSFH 1P7QD 3C9NB 1T04A 4OB5L 1AGBB 4O58H 4Q58C 1JYWA 5I1AA 1UWXK 5HYEA 1QATA 1AMYA 1CGVA 1E8WA 3FMGH 1ORSA 4L4JA 4Z7NF 4KXDA 1VIWA 3WTWA 1DP0A 3MGTB 1NCOA 4FNLL 1KYUA 2ATPA 1ED3B 1X5GA 4AVIA 4PRHE 4WFGD 2EUXA 5F96H 3X13B 5C08E 3MKKA 3TV8A 4GP4B 3WXVL 3GSUA 3MLSL 5D2NE 2RD0A 1CE1L 1MCPL 3ZBMA 2WNGA 1T03H 3OHMB 4NIYE 2WLNA 4YVNA 4ELKB 2Z8SA 1H9VA 1XEUA 2FRGP 4XPFH 4K73A 4YDKH 4E41B 3TX4A 4CVWA 2IH1A 3N0AA 3VXNB 4QRPB 4NZRH 3KW8A 1XGPB 5DTFA 2CHXA 1HI6A 1JZFA 3B7UX 1JGLL 5IGXL 5DJCA 5JO5A 4Z76A 5SWSA 3MRLA 3GZQA 3A21A 3MDJA 4Y2NA 1S78D 2WXRA 1HL9A 1MAMH 5TK2A 4QRTB 1KN4L 1OAYL 3EH1A 4I0CC 1MCJA 2CRIA 5EPMB 4DGIL 2H8PB 4UV4H 4LVNC 1IZKA 1C7TA 3L4TA 3B7TA 5JYMA 5J89A 3VWJD 1MFNA 1XIWC 5CEZL 2OI9B 4F7PB 5I73C 4XNYL 1DVTA 4ELMA 2AQPA 4WI7A 4X4YA 3G5VA 3GMOA 3QQ4B 1CLOL 4UIKH 4HEME 1BEYH 3QCUL 3O11B 3N55A 4C56D 4UTAL 5CU5A 2IGFH 1KG0B 4PRIE 2CIKB 1N6QH 3MAWA 3P73B 5GGUB 2GSGA 1MWOA 3SKJL 4QEGA 1JVOA 2D2CC 1UWGH 2A73A 2A0LC 2HFEB 3W3BA 3S35H 3S37L 4AM0B 1ETA1 2DWYA 1NGZB 1MW2A 4QO1A 4RAUA 2EEBA 2EH8L 1IC4H 5KBNC 3HMWL 2R69H 4B9CA 3MA7A 3RLSA 1MWAH 1BBDL 5EZOL 3B9KC 4J3TA 1XIWD 3AB0C 4AV5A 3P9MB 3I6GA 3KPQB 3TEXA 3K71A 5AVYB 4NI6A 4MRCA 1CXEA 2WKGA 3MNZA 3G5YB 3W0WD 1G6RB 3E6FA 3H55A 5CR8A 1QFWH 3JVGA 4P07A 2GIMA 4AV4A 1CXHA 1BXXA 3U4EA 4GG6E 2C3GA 1A21A 2KZWA 1BM3L 3HHSA 5F7EL 5D7JD 2F18A 3DGGA 3S3DB 1MFDL 4AM0A 1N0XL 1YY9D 4RMSA 4HKXB 3CXDH 1KGWA 4P5TC 4V33A 4WWKA 1NCCH 1AZNA 3SGJC 4RFNC 5CD5C 1YUKB 4PJAF 2I24N 3FO9B 2B4CL 3QXTA 4JPKH 4L9LB 3SHSA 5I1IH 4BKLB 5HI4D 1RZPA 2HFTA 4JFYA 1CJYA 4N0UB 1E4XL 4F15B 2BIOA 3OAWA 4M5TA 4NRXA 3TVMD 1WGVA 1EMTH 4OSUL 2BVYA 5A3ID 3MRPA 3T8XA 4LHUA 1V27A 4ANVA 2F1AA 2YPLB 4XO3A 4G6JH 4FJ6A 2HTKD 2UY6A 1NC4D 5J6SA 4YQXL 1FDLL 2R2BB 4DVBA 1JHKL 4WGVB 4CRPA 5JHMA 4K9EL 3D25B 3FHQA 5F9WC 2P5EE 4H0GA 4KTGA 2NW3A 2X53A 4JFDB 1PL3A 1XGPA 5TDOA 3S0PA 1MFAH 1YNLH 4X6FA 2VTFA 2WJ5A 5CINH 1U8KA 2V9TA 4P5TD 4MGXA 2CDFB 3INUH 5H8DA 2FWOB 5D7LA 1M1SA 5K9QI 3ZGIA 4JDTH 4NKIH 4JRYA 3WFHA 3OLGA 1JTTA 4JKNA 4NNPH 1JG9A 4RFEB 1AD0B 4WEBH 3WYRA 4DGYH 5A1AA 2ED8A 2IAAC 7CGTA 5PCYA 4TVPE 1XGUA 3DYPA 3SDYH 1A1MA 4BD4A 3VI3E 4TN9A 5ID1B 4X6EA 2W9DL 5GS1B 3NCXA 4JDZA 4A6YB 1GOHA 5KYUB 1A3QA 2EXWD 2PXYC 1KTCA 4ZX3A 1TVHB 2HTKC 3S37X 4HOMA 1IBBA 2EUZA 2DJ4A 4OM0H 1V7NL 5TDPA 4XWGH 1KTDB 3ESMA 1T04B 2K6WA 2PCYA 5H37H 3ZR6A 3V4VL 3RI5K 4YUEH 2ZUUA 4OGXL 3RU8H 1SEBA 1N64L 4PS7A 3TYGL 4JB9L 2UWEA 3O2DH 3BP5A 4IJ3B 1OANA 4G80A 2X4TA 3V4VA 3KPOA 1J9QA 1I1FA 1QHPA 1LO0H 4TVPH 5T8IA 1MVYA 5I19L 2BK8A 2VT0A 3GBEA 4OF5A 2VDKL 3BUIA 3MBWB 3CZSA 3UCQA 4ZX4A 5F7KC 3ATEA 4NJ9H 4L0ZA 2D3VA 3IJSB 1EEYA 2YLHA 4AYSA 3T0EE 2GAZA 3WJMB 3TLRA 4QRFA 3TBSB 1H3WM 4ZMYA 4QOKD 2DQEH 4X8JB 2JJWA 3PNRB 4FLQA 4DKTA 2FO8A 2ADGB 5HDOA 1JVLA 4LCYB 1XV8A 4F2EA 5DHYA 3MRRA 2HWZH 5AW5B 5IZ7A 2BZCA 2H4EA 3HLAA 1PZ3A 2MQCA 3DETC 4LAQH 1FVCA 2DTMH 4U3SA 5LKNA 1FL5A 2WVTA 2QGBA 2IANA 5PAZA 2XWJA 1ZLDA 3QNYB 3RWJB 1JHKH 2ZWYA 2FNBA 3E1F1 2XPGB 4GT0A 4FQCH 3NIFB 4FZ8H 2WLJA 1E0OB 1YC7A 2C3WA 5KOMC 2R83A 2P28B 4R4BA 1RZKH 4D9QE 4OZIA 5I5MA 2CK2A 3RZCB 1N18A 2G60H 2X4QA 3BVXA 2BSRB 4JFZL 4JFPA 5AVWB 3VB8A 4EEEA 3QAZC 2FUQA 4MLIA 5MEOB 3RPIA 3BCFA 3EJYD 4UDTB 4YPJA 1ZJBA 5L6YL 1NEPA 1J0ZA 5AKTA 2GCYB 2EACA 3DX7A 1OE3A 2R1XB 2E7MA 4OZHA 2GUOB 2NY2D 1PFOA 3DIFB 1FSKC 3G9VA 3T1WA 2FGZA 4L0PB 5I5IA 1ETZB 1T2QH 2AJYH 2QTEA 5AVVB 5GZNA 1ITBB 4QDGA 3FN9A 3GSNL 4MXQD 4N24A 3FSOA 4FJYA 3NMEA 5IVZA 3BH4A 5C6TH 1IGCL 3PWPD 1OALA 4KZEH 2O61A 43CAA 1E28A 2CLVA 3D9AH 3MRKA 1L7TL 3SO3B 1XF2A 5GRXG 4F9PC 4PPTA 2ZSWA 4NUQA 4OGYL 4B96A 1G87A 3WJLA 1D5RA 3BWSA 3DKHA 3E80A 1QKZH 1S5HB 3ME0B 3DK0A 3LKQA 4QMEA 4ZTPH 3ZUNC 4B6ZA 4KK6D 3R18A 2BW4A 3VGHA 3FO0L 5JIKA 1N12A 1YLBB 1OW0A 4X0KA 2YRBA 2Y25A 4W9GC 3GBNL 1UWGL 4UYQA 4GXUN 4Z78A 5KBLA 4HZLB 5H4ZA 1NMBL 4BFKA 5LHDA 2FX8L 3UYPA 1TTAA 3MV8B 5IK3A 3F7VB 2NZ9C 4EDXB 2J2ZB 1AI1H 2UV3A 2YKLL 1ONQB 3HAEG 3PDOB 2WP3T 4H40A 4LE8A 4TRPL 3UGXA 2EVHA 4PJXF 3CUPA 4LLQB 1AKJD 4PBVC 5E08H 3VFWB 1BEXA 2KC0A 4JCMA 2A4CA 3FF7A 5D9SB 1WBYA 43C9B 1CICC 2NLJA 5CJOH 3MV9E 3UAJD 3BWUC 1F4XL 1Q9KB 2G3XA 5I1CL 5F0LB 4R2GB 1AGEA 4Z7WA 2YEQA 3GSVA 3QORA 1TPXB 4PRNB 3IDMA 3VWJB 5DZPA 5EFIA 2J44A 2CU9A 3MRQB 4XCEA 1R6VA 3ZO9A 4S1SH 1VFBA 1J0IA 1PW3A 3LNHA 4G8IA 2KLTA 2DM7A 4X6CB 3GSRB 3GQFA 4N4YB 5IP4A 4PJAB 2NX5E 4FOMA 6PCYA 5EOCL 3LHPH 4TXVB 4Y2LA 4JFOA 3UMTA 3GSRA 1NAMA 3FC8A 4I0PD 2AAAA 4JPIA 1B0RB 4KJWC 3SODB 3PUCA 2GT9A 3P0YH 3BEVB 2R9HC 3UAEA 1MIEL 3ARDC 2DYPB 3SGDH 1FFRA 3MRQA 2NMSA 5HYJE 2BS8A 3ULUL 3W0WB