2F08A

Crystal structure of a major house dust mite allergen, derf 2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
129
structure length
129
Chain Sequence
DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and some properties of a major house dust mite allergen, Derf 2
pubmed doi rcsb
source organism Dermatophagoides farinae
molecule tags Immune system
molecule keywords mite allergen Der f II
total genus 29
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2f08A00
1AHKA 1A9VA 2HKAA 2E56A 2E59A 1XWVA 1WRFA 1NEPA 3MU3A 1AHMA 2Z64C 3T6QC 2F08A 5IJBC 3FXIC 3RG1C 5IJDC 3B2DC 1KTJA 3ULAB 3WEBA 2Z65C 5KWYC 3VQ1C 4G8AC 3M7OA 5IJCC 3WEAA 3VQ2C 3MTXA
chains in the Genus database with same CATH superfamily
2FDBP 4NQCA 5SWSD 5AWNL 3ZOAA 3AGWA 2XICA 2YRPA 2EDLA 2A9MH 3ASWA 3BSZH 3D85A 4FCHA 1I8AA 4PJXF 1TKWB 5EO1A 3I6SA 3L5HA 4HPOL 4LF3A 1KIPA 3R18A 3WEMA 1LO4L 5C07B 4N0FB 1HHGA 4PV8A 1DQLL 1Z66A 4K5LA 5HYSA 4GG6B 3FAXA 4GIOA 1AKJA 3HR6A 4B6ZA 4KAQH 1UM6H 2GK0B 3WDJA 3VDCA 1BYOA 3ESUF 3VA2C 1X9RA 1RP8A 3ABKB 4EN3D 1CGUA 2VDRH 3J7HA 4P2QB 2E7LC 4OQTH 3I75B 5FUZH 2JKNA 3JV6A 1KJ3L 2UZIH 5CD3A 4CJ0A 3BLPX 3SPCA 4GEJA 5FUCE 1OPGL 3DXAD 1CDUA 3G5ZA 4WFFE 2MKLC 3LAFA 2YOCA 5JXED 1P4IL 1HH6B 3QXAB 1BBJB 3HMXL 2BP8A 3US0A 3GBLA 1FL5A 1D7BA 2XNAB 43CAB 4DP1X 5BMFL 2IGFH 4OTXL 2WW8A 2IH3B 1OWWA 4FNLH 3OZ9H 1FCCA 2Y72A 3EDEA 4JHAL 2VXQA 2K0RA 4GH7B 4NKQB 2BY3A 1ZGLB 3KPNA 5H37H 1JMZA 3OB0H 3KXFB 1B4TA 4UIMB 2DIJA 3RPBA 2WUCH 4Y4HA 4IRJA 3KEHA 2AZAA 1TJMA 5F9JB 2APVA 1RZ7H 4HX1B 4QYOB 3GMNB 1OGTB 1L9NA 2QKIB 1MCSA 3QUXB 3MUGA 5C0EA 3D25B 2EECA 4JFEA 2EVGA 1LQSR 4IDJL 4IBWA 3D34A 1R5WA 2DYPB 2NY1B 4AYID 1G1CA 4YPGB 1F11B 3SCMB 2GTZA 2VABA 2HJLB 3MRNA 3AG3B 2AJUH 3WSQL 4Y8DC 3U7WH 1WITA 1PZDA 1TYJA 1Q9KB 3F00A 2ZKXA 4M3KB 1N12A 4UZUA 1MJUH 3LKOA 5FLUA 5I26A 2H6PB 2KMWA 1B9KA 3JVGC 2DLTA 4ZAKD 4P9MH 3FU9A 1LEGA 3BT2H 2NT1A 5HY9A 4MDIB 5EF3A 2CO1A 3R1GL 4QOKE 5HI3D 3QUXA 4NRYA 2XWXA 4L4VE 4LEXH 1A5FL 1T5KA 2WTRB 4AMKH 4DP2X 5CLWA 3O9WC 2CO3A 1OAQH 2ICWI 4KXZH 4U31A 4DESA 2EYRB 2IQAB 4NOBA 3IF1B 4YHNB 5DJYB 3FTUA 2BIIA 5AW9B 5FWRA 3MR9A 2DS4A 3RVUC 4C56E 3HG0A 5F7UA 2NY0C 5DHDA 3MXVL 5AD0A 1MWAH 4FNSA 4JFFB 4XC1H 4NRXB 2DJMA 4TQ8A 1FIGH 4ZUWA 5C08A 3D05A 2Q86A 3PDOB 2XG4A 4NXSA 2QL1A 4H88L 2J4WL 4JKPL 5KBLA 2YC1A 3GBDA 3S34H 1T21B 4WUUA 2OL3A 4ACTA 2ZUQB 3PQYE 5JW3H 2PTTB 2F54D 1IM9A 1TNNA 3VI3F 1M7IB 4N3UA 2FL5A 2YUWA 5AW1B 2XY2A 2YK1L 4ZW8A 1I9EA 2BOBB 1CLYH 5E8DH 1JBJA 3AG4B 3L4TA 4GG8B 5E5MA 2CKBB 4IK7A 5LDSA 1TTAA 4WW2A 1WA0X 5FA4A 3WFDL 2JWYA 1T22B 2E9IA 1WUZA 1IC7L 4I13B 4Z7UE 1NGQH 2ZYRA 1G9MH 3RWDB 4NI3A 3K46A 4N3TA 4KKAD 4P3WA 2RB8A 3T0AA 1RJLB 1W80A 3EYOB 1ZVNA 4AC2A 2C7UB 1BHGA 3N40P 3X12B 2XTJD 3HN5A 2CH8A 3GJEA 4LF3B 5DDHA 35C8H 1YQ2A 4NT6B 1W6WA 1JWMA 4W4OA 2WIMA 2ADJB 2A2QT 5E5MB 1JNHB 3B9VA 2CALA 4AEHL 5C0IA 2VITB 1NGQL 2HT3D 4YHIA 3KYMA 4JO3L 2RBLA 1IQDA 4P3DA 4B9YA 1KCUH 2KL6A 5DJDB 2H47C 2IQ9H 4QO1A 1RIHH 1CIDA 2EDNA 4R4NC 2ATKB 3S35L 3C5SA 1UA7A 5DWUL 3WV0A 4F5CA 4TL5A 4OD1H 1YEFL 3TZVD 4TNWF 1AO7B 2ATPB 4W4NA 1P6WA 5MENE 4PLKC 3AJ7A 1XTLA 5BQ7B 1O9WA 1ILUA 3Q1SL 1DN2A 3L4VA 3PNRB 1II4E 3DPBB 1CGXA 4AYBA 1OSEA 2OX5A 3O2VL 1GGIL 4JFXB 4GY4A 5C09D 4L8CB 3IDNA 2CNZA 2WB1A 3RWCA 4U1KB 3TBVA 4D8OA 2IGFL 4OTXH 1OM3L 3AT9A 3MNZB 3M88A 5I74C 2G2RA 1IBGH 1HNFA 3BGFC 1BFVL 1MLBA 3BXNB 1KXVA 3KPNB 1MUJA 1R34A 2ESVB 4UQIM 4IOIB 3LSOB 4PJBB 1XGRB 5FO9B 2FX7H 4NIYE 3ELAT 2GJ6A 3FK3A 4KX9A 5HDBF 2WZPA 3DECA 1BXXA 3GQFA 4I0PB 1NBQA 4MX7B 2BVQB 1R3KA 2IDUA 4QKXB 4F7TA 1A22B 2FEEI 2IAMC 3E3QE 5F9AC 3F6JA 3VX0A 1OTUD 2O4EA 1NLBL 3CZEA 3LB6D 1C5BH 3QHFL 2XACC 1UT1A 2CUAA 5SWSB 4CGTA 4HS6B 2WN2A 5TQ0H 3FRUA 5EOCH 3EYOA 5FOJA 4W9CC 2NOYA 1S5HA 3L3JB 4S11A 5A6LA 3TCXA 4JFDB 1HEZA 4OGAD 5F88A 3NSDA 3T71A 3W0WB 1MJUL 2ZG1A 2BVTA 2Y1AA 4JFYB 3ZLQC 2YRLA 1S7WA 4UNIA 4M7KH 4GBXB 5TJWK 3GLZA 5DTFA 2Z31D 2J5WA 2WM0A 4P23A 3PP4H 3DX7A 4KJQD 4NKIL 1Y18A 2IV8A 2DQCL 4QHNB 2NCEA 3Q6GL 3GGWA 5GSVA 1HCYA 2WWOA 2Z1KA 4P2OD 4DEUA 1EUTA 3O3BA 1R19A 1DEEB 2YD9A 2FEEL 5ICYB 4XXWA 4UYQA 3DUUA 3IMUA 3GS0A 1MCEA 2C5DC 3SBWC 2WLIA 1WZMA 3EDKA 4PP1D 3JT0A 3I9PA 1TZ8A 1DQMH 3LJ3A 2JFCA 3X14B 3MRFB 4NJ9H 4JANA 3JYBA 3MJ8B 4RIRA 2MMXA 3G6JF 4PJEE 4R26H 5C09E 3VRJB 4XCNB 5T1LD 5CD5C 1OPGH 5CZVH 4YSQA 2Q8AH 4HIIB 3HUJF 4Y5VC 2DH3A 2ZCHH 3G5YB 4MWFB 3WY3A 3C75A 2ITCA 2ETWA 2WXNA 4GQZA 3A6BL 5CZRA 4OJDH 1GHFL 5TFSL 2AEPL 1RK1B 4A7GF 4FFVC 1UH4A 4N0YL 4XP1H 3WIFA 1OB0A 6FABL 3SDCB 1MCOL 5EO0B 4OM1H 4BD4A 4FQ1H 4H8UA 3WAKA 4C4KO 1SF5A 3VFGH 3DSFL 3NZ8A 2FSEB 4DW2H 4PJ5E 3UYPA 2F1BA 2J21A 4YO0A 4ZXBC 3AG2B 3I50L 3BW9A 3X1FA 4HPOH 4K07A 3CH8A 5AZEL 2C7UA 2RA1A 1IGFL 2WSDA 5DU7A 2IGLA 3I9GH 1AKPA 4X7DC 4ZOAA 1BZQK 4LSVH 4EMZA 4IEFB 4QF1B 4TKWA 5KVFE 3WE6B 3PJNA 2PYEA 3FHAA 4NKMA 4NWTH 1HU8A 1PZAA 3D25A 3IMTA 1CD9B 2C1OA 3SDAD 4ZQKA 3BZ5A 1XGTA 5K9KB 1T03L 3UPAA 4OLEA 4QRFA 1HIMH 2X4TB 3KHQA 2Z91B 1JL8A 3AT0A 4S1DD 4FXKB 4YBLC 3H1ZA 1IAMA 4GS7B 4AYMC 4V1DE 2VQ1B 5JQ6L 5D8JL 4UILH 5C0IB 2JB6B 2F15A 3CFNA 3Q48A 4UT6H 4NUJB 5D4HA 3TPUB 1GKEA 4HIXL 4UQ3A 1OLLA 3X13B 4G82A 2J8UE 1U2HA 3L9YA 2ZUVA 2JK5A 1CYXA 1X5GA 3FSAA 4OF8A 3FQNB 2R27A 5FKAA 4C56D 3O6FC 2AS5M 3EJSA 3IF1A 1ZY9A 3A6BH 2ZX7A 3MNZA 3U30B 1I1AD 2W38A 1CXLA 3OX8A 1RZ8A 5E7FA 5I76A 4GP8B 2XG5A 2AMGA 4GXUM 1XF2A 4M8QB 5DZLA 2WLNA 4PRIB 4R26L 1XH2A 5I1AB 2ZKWA 4TLTA 5EBMB 1DBBL 4LPUA 3QEQA 4B9ZA 4C58B 5DFVC 2MHAA 4ODWA 1DQML 1A8JH 2IAND 1FPTH 3P9LA 1JWSA 3QORD 1A6AB 2J72A 1CE1L 4G9FB 3BRGC 4APQD 2IEPA 2OMTA 2W07A 3IBEA 3QUKB 1OT1A 2BSTA 4JVWA 1GJIA 3FONA 3F7KA 3RWGA 1M57B 3F85A 1XEUA 2Y7OA 1BG9A 1GL4B 2HUEA 4TVPH 1JN6A 2WPGA 3KW8A 3JV0A 2X05A 2PCFA 3LSOA 4JR9H 3PFUA 5HVHC 1P5UC 4E42B 4C4KT 3S88H 3UXFA 5D7LE 2HRHA 3ARSA 2J5LC 5ESVB 1ZDSA 2ENPA 4P5TD 4B9GA 1NOLA 3L45A 1PEWA 3D3VE 2NY6C 3VRLE 2VLKD 3ATAA 2IAMB 4JHZA 4LPYA 4B9CA 4BUQA 4E41D 1GCFA 2WB7A 2V4LA 4GAJL 4QHLA 3V6FA 3FFCE 2NY2B 1C08B 3HOGA 1TYRA 5EA0L 1NFDA 1NIDA 2CKBH 4ZTPH 3RWFB 4LCCA 3C8HA 1TZIB 5AKSA 1BQLH 3VQ1C 2IBZY 1JAEA 2YC1B 1NWPA 2CE6A 3SD2A 1VENA 2Q9OA 5B7MA 4PP2B 3O4LE 2OMBA 4ERSL 2OYKA 1HAWA 2DJ4A 4QWWD 3VXRB 2HT2D 4NJAL 4OZFH 4TNFA 3G5ZB 2DQEL 3HFMH 4X6CF 4DKEL 5IGXL 1F02I 4NFBA 1L6ZA 3LS4L 2HJFA 4I77H 1DJWA 1RZFH 5LDUA 2EACA 1A4KB 4AGQA 2KQMA 3GHBL 3ZHFA 4EUPG 1EV2E 4YK4C 3CXDL 2X0UA 3FO0H 4I18A 5EF1A 4L9LA 1I3RB 2PUQT 1SLXA 1ZHLA 4BK8A 4FP8L 3B1TA 3QWQB 2UV3A 2VMDA 2VMCA 2ZD0A 5D1XB 1F18A 2EYRA 4J5VA 2O5ZH 4QJ3B 1I1FB 3MLYL 3ZHKA 4HOMA 2R1WB 3NAAH 3HE6C 3WEXA 4YQXL 4PB9H 1DVZA 12E8L 2M8XA 3DOSA 4NO5B 1Q9OA 1MEXH 2Y0SA 1WVZA 3DVFA 1JDAA 1FVCB 4XPGL 5E51A 3O0LA 4AMWA 3D18A 1HL9A 3GHBH 4KKCC 4JPWH 1BQRA 2IDFA 4P9HC 3DGCR 5DYOB 4R7LA 1LMKA 2X89A 4M62H 3QRFM 5C86A 5E03A 1SOQA 4N8VG 3ULUL 5D1ZB 4YDVB 1UWEH 3EYQC 3HJEA 2KI6A 2D7OA 3IPBA 3B2VH 4FEMA 3OKDB 2NPLX 3AFLA 2EUWA 1R3JA 3HI1A 3BUDA 4RFNC 4PRAA 5IQ9A 4JRYA 2VRAA 3QXDB 3TN0C 3WIIH 5EZLB 3T1FB 3QDMA 3ZZSA 4G8GB 2X4NA 2YD8A 3NIFB 1A7OL 1RPUA 1MCLA 4JCLA 3DK2A 1KB3A 5CJQL 4AC4A 1KIQB 1C12A 4LLDB 2VISB 5JW4R 3VWJA 4G70B 4I0PC 5DJ2A 2VR8A 5A2FA 4Y4HD 4IRJD 3QR2A 4OJAA 4HWEL 2QQLL 2ZZUT 2XN9A 4FYSA 2YD0A 1IM3B 4ZO7A 5D7SL 3JSSA 4X98B 1RL1A 5L9DH 1E8XA 5CKGA 3CHSA 3PWPB 1DSYA 5T3ZL 1AGEB 5IOKA 4MD0B 2PCPB 4GAGH 3AWFA 5JW4Q 4FQJH 3HUJB 3E8UH 4PWHA 1SN0A 3EO1B 1X5YA 1MHCA 2OW7A 1HI6A 4G8IB 4NHUB 3BT0A 4XHJC 3FT4B 3NCCB 5GS1B 3A67H 3T3MB 3RGVB 1KULA 4OZFB 4W4OC 4L8SA 4BQBA 2OMNA 3NCJH 2JIXB 5EBMA 3E0GA 1P4LA 4LQFH 4FZEH 5JHLL 4RETB 3OKNA 3NCFB 3ATEA 3NJIA 2XVLA 1FHGA 4LBEA 3SGJA 4JANB 3PNWA 3MX0A 4O2CA 3FB7A 4MJ6A 5BXFB 3Q05A 5IVXF 1S7SB 4W6WB 5GS1C 4PJHF 5HYJA 3LKRA 3PL6A 1ZT1A 2VR5A 3KYOB 4CSSA 4C4BA 2Q76A 5C9KA 1F6AA 1QR4A 3BQVA 5FIEA 1TUPA 2NY5C 5K39B 1B4LA 1IUZA 3EUDA 3NEOA 1BD2B 1HCFX 4PJFE 3BDYH 4Q6YA 1EERB 3CSPA 5ECGA 5CFHA 4V33A 5K9OB 25C8L 3HI5L 1KWKA 5HDRA 3LKSB 5H4ZA 2CRYA 1N8OE 3CSTA 4K71B 2X1QA 2BHFA 3SGKA 1FNEB 4R3SB 1BM3H 2WZAA 4FTDA 4I3RH 5ID0A 2HVJA 4UBDC 4QNPF 2E8YA 1GY1A 3RVWC 2VZSA 3ZT5A 2HFEB 1S7TB 2NLJA 4Z1PA 1HOCB 4K7FA 3QDMB 5I1EL 3ULVD 2X3CA 1WBYB 4R5VA 4ZRGA 5G5DB 4LVNB 1SY6H 4QF1A 3RIAF 4QT5B 5DC2A 3F8UB 5JQ6H 3CSYA 3QNZA 5EOTA 3FU3A 1IM9D 1SXAA 2ZWNA 3TPKA 4G6MH 4G43B 4L0YA 3RZCD 2EDQA 5TH2B 5A6IA 1A1OA 1TLMA 4PI2A 4AIXA 1XCQA 4GFXA 1WFUA 2Z7UA 3SD5A 5BRPA 4NWTL 3KWWB 2J8UF 4HUVA 4LL1A 1VPOL 3GXMA 1Y6KR 2H26B 2VDLL 3AG1B 1IAOA 3V0DA 2EKJA 3ABZA 4PCTA 4QHKI 1IM3D 3QFDA 4LSQH 5J56B 3CFKB 1GIGL 1IGML 1X5XA 2XZCL 1FAIH 2G75B 3G5XA 3I6LE 4V1DD 4Y2DB 5FK9B 5IWLC 3TEZA 3L3DA 3LEYL 4AY0A 1T66D 2Y5QA 1OM9A 1SXBA 3W11C 3ULVF 1SBSH 3MLTA 4WENB 3FOLA 5IVNA 3MUZ1 2EVIA 5GJTL 1DUYB 4FQLL 3RJQB 4ENEC 1QFWM 2RACA 2R29L 4LARL 4ES8A 3BRFA 1QRND 1I9RH 3JZ7A 3RKDD 1AZBA 3DETC 2GSIA 4A2HA 5IJDC 5FUOL 1FORL 1E9OA 2P5WE 3HS0B 5DK2B 2BWQA 3IMWA 2WNWA 1AANA 3QNYA 1H8OA 3H6JA 2VDKH 5LAPA 3IWVA 4GW4B 5IB1B 2ZOLB 3D3VB 4Z8FH 4NBYB 4A2FA 1V5JA 3PPSA 3MYJA 3B37A 5HYSG 1L7IL 2OMZB 4ZO9A 2HJKA 3RDTC 1J0HA 4NX0A 3ZPDA 5JMOC 3FO2B 2JKSA 4LCCC 5BV7H 5ABDE 1E9PB 3QFJD 2QMKA 4JGNA 5GGRY 3OLGA 2XV0A 3C9NA 1V05A 1TEYA 1LO5B 5GS0L 3NGBC 3L16A 3MBEC 1DFBL 4WI0A 1PD6A 1VLXA 3GK8H 4FLHA 4UT6A 1JZHA 4MNQE 4R0LA 1QSEA 1RPQA 3LB6C 4JKNA 4X4YB 1NMAL 3K4AA 4ELMF 1E43A 3PV7A 3GTTA 1A3RH 1QPPA 1SVZA 1E40A 1U8OA 3WD5L 3ARFA 4E42A 3WTVA 3HZYB 3QULA 4GMSL 2FO8A 5DK3A 1PYWA 5DLLA 4G9FE 1OSPL 4M5ZH 4YK4B 1R5VB 5IQ7H 4I5BA 4PY7A 3S36X 4GKOA 5AB0A 1A7BA 1ZT7A 4E9QA 2WLLB 2AK4E 4M7KL 4CC4A 2E6QA 4E9SA 4RMQA 2QZQA 3SDXE 2X9WA 3VI3B 3Q2NA 3D3VD 4OH2A 4EOWH 1PKQB 3NJMA 4OZIB 2CLRA 4N2GA 2PMZA 3ASOB 3BPNC 3GMOB 3BCFA 1D9KB 2GABA 4NO0B 1F4AA 2Z4QB 1KV3A 4OI7A 4HKXA 2F8IA 1IAIM 1LVEA 5IB3B 3ES6B 4CN4A 5I8EB 2LVCA 5I8OH 1JHLH 2CJSA 3OWRA 2FR4B 1CDBA 4WI7A 2QJDA 2GSIB 4LDLB 4NP4L 4ODHL 5MEQA 1KJ2H 1Z9SA 1IVTA 5SWZA 4NNXA 1QVOA 3CFUA 3ROOB 1H5BA 5I1LA 3O8XA 5ERWA 5HI5C 1PKQA 4Z0BH 4JFPA 3OTTA 3VRIA 1YMMD 3KNBA 1U41A 4L29B 1KPUB 2WVUA 5DO8A 5DMGC 4QRPD 4E5XA 4FQXD 2NY4C 4N2FA 1BFVH 2MCPL 4TSCH 2VIRB 4HZLB 2CMRH 3KGTA 1O6SB 2YAOA 1PGRB 4X4ZA 1DO5A 3UJTL 5H4YA 4MLIA 5C0CE 3CN1A 3V0VA 2MCMA 5KG9B 1FJ1B 3E6HA 5J0BA 4W9ZA 2J20A 3PWNA 3OGCB 5A2JH 3VQ2C 2F7RA 2HTLC 2WNKA 5FGRA 1A3RL 1J8RA 5JDJA 5KVFL 3MV8A 3MRJB 4ZS6C 3S35H 3HZYA 1E6JH 1ET5A 4KQ4L 4MQTB 3ARUA 4WUUE 1H6UA 1WWWX 1F11A 3FZUC 1WV7T 4Y4FB 5AENA 3GS7A 3IKCA 1HX0A 4OD3L 2XN0A 1HHKB 4RFEA 4HBQA 3H3BC 2ZF8A 1NTDA 4RAVB 3UAEA 1WF5A 1J1XH 4WJ5B 5DVMA 4NQUA 4M7ZC 4YJZL 1N0LA 3WY2A 1BXUA 1BX2B 3W2DH 3O2WL 1QG3A 3TBTA 2DM7A 4G9FD 2HVKA 3DMMC 1ZHKB 4X0KB 5IT2L 1P1ZA 1B4JH 4F58L 3OHMB 3G5XB 1Y1UA 3PDGA 5F7DB 4MJIE 3TESA 1DJXA 1AI1L 3ARQA 4KDWA 4LOUD 4FQCL 2ICWJ 4WLCA 4KVNH 4MD0A 3EYFB 1E42A 1FE8H 1FNGB 1DUYA 3P54A 2XWTB 4GUOA 3WTWA 4TUJA 4CRPA 5B38A 3HNVH 4IRZH 5AYUL 4FQHB 3L3DB 3NIFE 1GOHA 4UV4L 5CP7B 2YMXL 4UQBA 1NAKH 5IMOB 4WHYG 5IMKA 4AJYV 2GBVA 1UZGA 4XMWA 3ZZ1A 3ETTA 4I48B 4N20A 4YC2B 4POYA 4JKPH 4LRNH 5AVQB 3UBGA 1A3ZA 1S7RA 1RZGB 2X2YA 3HKFA 1FIGL 3NPZB 4IU3B 3S5LA 3ZKNC 4C56A 1CG9A 2WCPA 4O2EB 3H0TB 4D2NA 2H1PL 5AOMA 1BVNT 4PIBA 3T4YB 3ZIYA 2CU9A 2V9TA 1HSAA 2EC9U 4YS4A 4NO3A 1YNLH 2V2XA 4PJIB 4UQ2B 3QDGB 3T3ME 1EZSA 2BFVL 4Z7OB 4ZMNA 4UI2A 4JHWL 3GT6A 4WO4C 4HIJA 5E2WL 2YRZA 1GC1L 3C5JB 4ZQTA 4O5LL 5BRZE 1F41A 2G0LA 1H6FA 3OAYH 1VGKA 4CJ1A 1KCVL 4Q9QL 1LLAA 3LPGA 4HF5H 1RZGA 1F13A 2NUTB 3QORA 4HS3B 4MXVE 2GQHA 4P5TB 3MLVL 5AAWA 2XA3A 4N2HA 4PJDB 1AG0A 1BWWA 2PP9A 4N8VB 3GZOA 3IDIB 5J5EA 1A64A 1R24B 2Y06L 2GG1A 4PS4L 2LU5A 1F6AB 4RA3A 1OTTC 3TA3A 3RTQB 1W15A 5EG6C 4M6OL 2OMXA 4AQAA 3WMSA 3K6NA 1A4AA 1P5UA 2P8MA 3APMA 5LXGL 4QXWA 5LQBH 3BP5B 4WU5A 5E9DE 3QDME 5ESQB 4AM0Q 5DMKB 1F1DA 4JPSA 4S0SD 4WEBL 4AUJA 5CCGE 2BSSA 4MA3A 2O6DA 2H1PH 5TDOB 5HHOA 4RAUB 4GQ9L 2FJSA 4TV3A 1RVFL 2EYTA 3RWCB 2OMWB 1MPAL 3A4AA 1EUUA 3EYSL 4K5NA 4GQQA 1AGEA 4JHAH 3ULVH 1W16A 3VFUB 4F7PB 4FNLL 3V5HB 3CSFA 1PFOA 4JFVA 2GTQA 2BZCA 5GZNC 3L4CA 2P5WA 5IKCB 1OAZH 2QZ5A 2WBJB 5D7KE 4YDVA 1SUHA 1HNYA 1DBJH 3QBTB 1G6RA 2BC4B 3INOA 2R56H 4XAKE 2FH8A 5IBTL 3CX5J 2IFFH 1YY8B 4GW5B 2J6WA 5E8NA 3SE9H 3QZMA 1VFBA 4YHLL 4JRYB 1XGYL 3EG9A 2MOGA 4P59L 4RMVA 3D08A 2JJTC 3F7LA 5I2IA 3CQQA 3NEXA 3FOMB 4FFZL 3QJQB 1TPXC 4DETA 1CK0L 1YHPA 1LNUA 4EUPA 3JWNE 3GMMB 3LY6A 5CMAA 1B2YA 5HHPB 4PJHE 2P5WB 1FYTA 3UP1A 4IRSC 5ALCH 2FX9L 2XTJB 4JHWH 3HS0C 4PJGB 4YSTA 4J2QA 1UH2A 3TNNB 1JTTA 1T0MA 4AEFA 3KHOA 4XCYB 3UJJH 1SM3H 2BS71 2VRKA 4IKKA 2DQJH 4Y2DC 1QABA 4AQ8A 3PWVB 5SV4A 2G30A 1Z5YD 1A4CA 2AI0L 1DBKL 2DWTA 2Y6TE 1YJDL 6PAZA 2QHLA 1QW9A 4HKJA 4QRQA 4AIEA 4CVUA 4E68A 5DMYA 2V5YA 3GSXB 3GXTA 4JJ5A 1VGEL 2HH0H 4WWKB 2ZWZA 3RL2A 5KJ4A 5ADPH 4UB0H 1E2WA 3NAAL 1E65A 5EZIH 4W9HC 1L3WA 2GTWB 4POZD 1AC6A 2VM9A 3QDMD 3NJLA 1I3VA 4OSUH 4U0RB 4DOHB 2WY3B 4G6KL 5AVUB 2BSEA 2AANA 2F53A 2OI9C 1QPKA 3OAWA 3BFQG 3LNGA 1XBDA 4S1QH 1SVBA 4K8RD 1DBAH 4JGMA 2XBDA 3X1EA 3S2CA 3VXOA 2EVFA 3ESMA 4S1SL 3HPLA 3BKYL 3QJVB 2YMOA 5ABAA 1D6EB 4ZYKA 4ETQB 2BERA 2YFNA 4LCUA 4LGRB 3QDGA 1GVIA 3K7UA 3U2SA 1FFOB 5TQ2L 5A6MA 4BZ1H 1Q0YL 3UMTA 1JGDB 3WFHA 2J5LB 1CC3A 4XNAA 1W72A 4P46B 3NN8B 3CFEB 1QPXA 5L88H 1ET8A 3HI6H 1D7FA 4LVOB 3QEUA 1ODAA 5I30L 3CFBA 1H3GA 4DN3L 4GAJH 4C8XA 3C5ZC 4P5KB 4RWYL 1JPFA 1FJ1A 1AXSA 4N68A 4XNZB 4KXDA 1KB5L 3O11B 2JQAA 3QIBB 4F7EB 4EOWL 3D39E 4JRXA 5DMGD 1DQVA 2QQKH 3SCMA 4YX2H 2GK2A 1E4HA 3D87B 5FCUH 2NNAB 2CUHA 2OMVA 2PYEB 3G04B 3B2DC 3OC8A 3QVAA 2NUTA 4GRLD 4IJ3C 2YRBA 3CZFA 1BZOA 2QVMA 4TQIA 3L3OA 3CUPA 4MA1B 3QDJE 2X1PA 5EH1A 5K1NA 2AJZB 2I69A 1E3ZA 1I1YB 2FJHB 5F1IA 2QT6A 4E41E 1HINL 3U1QA 2MQCA 1KPVA 3P9WB 2QBWA 5F7BA 4IOSA 5LWYL 2H0EA 4U49A 5GRUH 5IB5B 4ZTOH 2HTKC 1UWFA 5ICUA 5CSGA 1WS7A 2XRAL 3N0PB 4MB3A 4S0TD 5FX3A 5L88L 4ODBD 5DJYA 1DBBH 1I7TA 3RP1A 4Z7QF 2B2XH 5C6WH 1MXDA 4JFDE 1HJBC 2WMPB 4KQ0A 2ARJB 1NWOA 4MMZA 4WW1A 5KBPA 2NY3C 4L9LB 3RZCA 1SHWA 4YFEA 1VFUA 4NM4H 3HE7B 1T2JA 2OMWA 2XQYA 4L3EA 5F9DC 4U3SA 2MQGA 1QA9B 4GUCA 1R0AH 4MJIB 4UIKL 1S5HB 4YHOH 3VG0H 3FSOA 1XT5A 4U05A 2AJXL 1FZMB 1KTJA 1BPLB 2F54E 2BDNL 1CDCA 2X4QA 1HOCA 1KN2H 4JO1H 1NA8A 2OTWB 4K7FB 3U1SH 1JZ7A 3VD1A 1OSPH 3MLZL 4M5ZL 4BCXA 1KWGA 3FN0L 4IRSD 2R69H 3VFNA 3U9PL 4PJBE 5B3JE 3ZTEA 2V17H 1F90H 4FKEA 4P57B 1OT4A 1PAMA 4LL4A 4X7SL 1XQ4A 5D2NB 4MSWB 3Q5OA 2RR3A 3GGWB 3GXFA 5E23A 1JZEA 1QRNA 2SEBA 4IMKA 4KKQA 1IC5L 4AGLA 5CEZH 4YVNA 2W1NA 1XF1A 3GK8L 1HDMB 3EHBC 3IXAA 3DURB 4P8QA 3T4AB 1LO2L 3I9GL 1SY6A 4LO9A 4UZSA 2QV4A 2XZAL 5ALCL 3B5GA 4JCMA 2EEXA 1EXUA 3HZVB 4G5ZL 4J27A 3VNZA 1HAUA 3N0AA 5TDNA 1D9KA 3WYRA 4XVOA 3EOTL 3QJXA 1DBML 1LWJA 3C2AL 3KYNA 4X4MA 1WWCA 5HGAA 1JUFA 4P5MA 5TGBA 1CR9L 3LHAA 4U1HA 5GGSB 3UBFA 1WDAA 3DGGB 3CVHH 1CFSB 3QG6B 1KCRH 4XAWL 4FL4B 3QJFA 2DM2A 2H1XA 5C3IA 5HHQB 5EFIA 2P24A 1VACA 1JERA 4ZOEA 4S1RH 4Y19E 5HHMB 4OCWL 4KTYA 5T1JA 1GGBH 1VZGA 2ZICA 5T8IA 1RI8A 4HPYL 3MVSA 1OOAA 5IP4A 2DTSA 3CFDB 3BVNB 3M7OA 5T5FA 2QADB 2A4ZA 4WCYL 2DL9A 1KGXA 4H5SA 3KPSE 3E6FB 3L5XH 2YJQA 2YWZA 1GKOA 2R4SL 1DVFD 5HHOE 3V2AR 3WMQA 3IGUA 1WICA 1ETJA 3OMIB 5ECJE 4AQ8C 4WWNA 2R51A 3BFOA 4G8EA 1KEMH 1CFQA 3VTTA 3ZKMC 3DGGA 4IGBC 1ZSDB 3HFFA 1FGVL 4PSPA 5C07D 4YDLB 1S7QB 4YL4A 3G3LA 5I17A 1ZPLA 3QEQE 4K9EL 4LRIC 5SWSA 1I8MA 2Z93A 5BZXA 4IS6A 4WW2B 1IJNA 2R4RH 3IJEA 3Q9PA 4PMFA 3Q8BA 5FW8A 5KTEL 4APXA 4AOFA 1KIUB 3BZ4B 3K8MA 3QCTH 2EDHA 4KZDH 4D0CB 2FHFA 1MCIA 5HYJE 1MFUA 2OZ4L 4O9HH 4P5KA 5F6HI 4UAOB 3NK4A 5IY5B 4LSTL 4WFGE 3ZMRA 1SM3L 4KUCF 2VL5A 2QFRA 5C0AD 1ZGLP 5FM5O 3X12A 5DEZA 1BAFL 3VFVA 3ASNB 1JRHH 3SEPA 4PLJD 2FX9H 1IAII 1QZ1A 2FK9A 3T8VA 3UMNA 2B1HL 3DVIA 3ZDXE 5D4IA 1J05B 2DWYA 1WD8A 2VUOA 3NSYA 1L9OA 2VXQH 4GPVA 4HCRH 2GIYA 4HCRL 3DXAA 1DCLA 5I1HH 4Q89A 4RZKA 4NUGL 3R19A 1CYGA 1ZKAA 5KANI 4F33B 1HZHH 1RERA 5SWQA 3RRQA 4XHJD 3MBED 5LJYH 4F7MB 1H15B 1RZIA 3J2PA 2TSBA 1RZJH 1E3XA 4XP5H 4YUEH 3VRJA 4HW6A 1WCQA 1CI3M 4LSSH 5LO7A 3CHXA 2ZP0T 4D0DB 2EDJA 4BM7A 4R4FL 3UEZA 3HR5A 1AHWC 1AMXA 3SCMC 4JRXE 1KPUA 2JIXA 3QUMA 2Q5BA 4I0PD 5F9WC 1J8HE 1J1PL 1WFOA 5HYEA 4WTXA 4MCYA 3LRGA 3SZKC 5HVWA 1T7XA 1UB5B 4JFED 1BMGA 4PLJC 3K6SA 2QADD 3B1UA 2HA1A 1L7TL 2ENYA 4HUUA 3BGMA 4RGNE 1D5RA 3W5MA 2Y7QB 3IU4L 1DJZA 1R3HB 1S7XA 3PIQA 2E27L 4Y5YB 3SKJH 1I9JL 3HC3H 4CKVX 3V0HA 3WY1A 3P30H 3NJNA 3ZKSD 2DQDL 2EO1A 5K9OA 3D0LA 3WN5A 3JWDL 5LGYA 4PWGA 3ZIMA 4DQOL 5GGSY 3QUZC 3TV3H 4M6OH 1MFCH 3L1OH 4N26A 4BK5C 5DYFA 3NG5A 2JKTM 5E1AA 5IBUB 2NR6D 1AXSB 4PS4H 5DI8B 3UAFA 2XVGA 1Y6NR 3KCPB 3TFBA 2HTLD 3C5ZB 4TSAH 3ZTNL 4HLZH 1OLZA 5CJXC 8FABA 4NO5A 1E7VA 2WXQA 4DGWC 4UDUB 2OYLA 3LQMA 3KJ4C 3PHOA 4G6JL 1TTBA 1FL6A 3ZYIA 1EBPA 2ZP8A 1RSYA 3I02B 1ZIAA 2K45A 1A3QA 4ONGL 4Z23A 2APTA 3G5VB 4FA8A 4ANXA 5C08D 1LTXA 2OJZH 3OX8B 4W9LC 4LCUB 2UVEA 3QQ9D 1SJEA 1GZPA 4MQSB 4XN2A 1WPCA 3SY6A 5F9OL 2ERJB 1EZUA 4X6DE 1CD1B 2F54A 3SKUD 3SYOA 5EZOH 3IS1X 3QFDB 4KO9A 3WS3B 4EIBA 5JPNB 4NB7A 3QJSB 3FT3B 4NZDA 4KDTA 3N42B 5IQMA 2CMRL 4QMEA 4NZUH 3OJVC 1UUNA 3H9SD 5A1AA 5K59F 4KKAC 2HPTA 4N2EA 2XN9B 2WC7A 3MXVH 3BJ91 4HKJB 4QRQB 4HCFA 3MLZH 3O3AA 4LT7A 1NGXB 1EEZA 4P2OB 4UM8B 5BZWB 5CGMA 4WCYH 3TO4B 1FPTL 1U8CA 3QGVA 4AV4A 3GDCA 2B5IC 4WZ9A 1FVDB 2YMXH 5KVEH 1TVDA 2N01B 3FAWA 3L7EA 3RWEA 5I9QB 1N5YH 2HYMA 1IT9L 3IU3B 2I60L 4HSQA 4KKRA 4YZWA 5IMMB 4EI5A 4L8SB 4R5XA 4RGND 4X5WA 4N8PA 1MG3C 1YEHH 2HG5A 4RRPM 1BJ1J 4R90L 1YLBB 5J6SA 1OP4A 4TVPE 1JOIA 3OR7A 2PTUA 4P9ML 4JM4L 4ELKA 1N8ZA 5DUBB 1KEGH 4OIBA 3REVA 1SYSB 5I0VA 1B4JL 4F58H 2CJUL 1R5WB 2DYPA 1GYUA 1RK7A 4ZYKB 4APQC 2WJ7A 2XZAH 5TE6H 4NQVA 4YDLC 4PGZA 1FN4B 2C3HA 2B59B 3N04A 3NIDE 3OMNB 5DZVA 4AJ0A 2C4FU 5JZ7D 1HHIB 5D7LD 3DUSA 3I02A 3IDYC 1KT2B 2X9XA 3D4ZA 4XB7A 4MXQC 4NFDA 1DANU 3S8FB 1XIWC 2JJWA 1HINH 1OAXH 3MYZA 4AIZA 4YWGH 3HE7A 4PWKA 4UT9A 4OGYH 4PBVC 3UTTE 2FGWH 3FHEA 1RXLA 1YEGH 5IFHL 5KVGL 3ZYZA 2KUTA 3IKKA 5FHBH 2G9KA 2B9AA 4ZX3A 2Y07H 4FL4C 3VH8B 3GEWB 5D2NE 4NRXA 3RA7H 1EO5A 1RQ5A 2ZWLT 4XB8A 3Q2VA 4NLAA 5DJ6B 3BLKA 2HLAA 3NIGB 3WN6A 4TUJB 2YPVA 1IAKB 4P4RB 2VERN 3HLKA 3HPJB 2WWNA 1Y7VA 2LGNA 2VDKB 3LRHA 4A7TA 1NH6A 5FHAH 1MJJA 3BO8B 3MLXL 4OZHB 4M5TA 3VO0A 3P1VA 4JM4H 4NIKB 4N2KA 2V2TB 1BBJA 2GT9A 3E38A 3MSPA 1KPVB 3VUAA 4JM2D 3SKOB 5C07E 4K3JH 5J3HC 3OR6A 1ZHLB 2Y2TA 5GZOD 2EYSA 2X87A 2CBMA 4WO4A 2I60H 3STZA 1BZ7A 4JN2A 5HYQA 4GRMA 1M1XA 1KBGL 2W65B 5EEWA 4OBSA 4AWJC 1VB9A 1DQTA 3G6DL 3MLPA 1KGIA 2LQRA 5DRNA 4U1MA 2R23A 5FF6B 3B9KD 3BKYH 2EZ0D 4P23D 1ZVSB 2CK2A 5LUMA 5EEVA 1I7RB 4LHUA 1WYJA 1E2ZA 3DX9A 5FFLA 3MV7B 1WBZA 3LNDA 5GGUA 1HYSD 4Z77A 3AREC 3PHQB 2R1YB 5B38G 3WNPA 4HIJB 4I1PA 2J8UA 3EYVA 5LCVL 4OSUL 2ROXA 5DA4A 4ZMXA 1J5OL 3KH3A 1EZVX 4XX1E 4XXCC 3DUSB 5D7IB 2CO6A 3AABA 1Q9KA 1N0XL 3C6SA 1KTKE 3GPSA 3K4ZA 4PJ8B 4IBZA 3DX1A 4DP6X 1BF2A 3OHXB 2QMJA 3ZTJH 5BRZD 5LGHL 1VKXA 2X4NB 3UYPB 3ZL1A 3ILPB 1OW0C 3J07A 5ILTL 1NGPH 2X09A 2RCSH 5ACZA 3HLAB 1XR8B 2ZF9A 2DMBA 3L48A 3P02A 3I74A 5FO8B 3I84A 4AH2A 4OAWA 2CGZA 3NUKA 1XF3B 4HISA 5FO7A 2HLAB 4WGKA 4X4XB 2F53B 2VR3A 5KSBB 1LL1A 1NDTA 4RRPA 5T1KA 1IARB 3H2WA 4JFQA 4TSAL 3L1FA 4JRXD 1UWXH 2E86A 2ITFA 4HWUA 1TSHA 2Y1VA 2QV2A 5K33A 5K9JL 3BDYL 1EEUA 4XVSH 1I82A 4NGHL 3HJ0A 2NX5A 1ZE3C 4FQHA 4F3FA 3LD8B 3L6FB 5CFAA 1DBAL 3QP3A 3VXUB 2WLIB 3DTXA 1YMME 4OAWB 2NW3B 4O58L 2R29H 4LARH 3L81A 5E99H 1N5AA 1HJCA 4H8HA 1R4XA 1MVFA 2BH0A 2D3JA 4BQ9A 3SQBB 1JV5A 1UCTA 2LT9A 1RZ8B 4DCQA 5JHLH 5KS9F 3LEYH 4YDNA 1J05A 1KELL 32C2A 3KEDA 2Z8SA 3K72A 5DVLA 3H85A 1FNLA 4B5ZA 4OKDA 1SYSA 3QSKB 2E6JA 2OTUA 4KHXH 4S2SA 5HXMA 1FA4A 1MHHB 3U4AA 4ODTL 4WUKL 3DO7B 5FV2A 4HEME 3T4YA 4PBWD 4YSCA 2UWEF 1QSFA 4JFFE 1JZ5A 2MQ0A 4GBXA 3O6FD 1FN4A 1PSKL 1P69B 1R6VA 1W72L 5HHMD 4WI3A 4M61B 2VKXA 1L5GA 1J8HB 5IJBC 4HWNA 3SDCA 3UEQA 1NFDF 3VXQB 4NPKA 4N6QA 2JI2A 2X9YA 4R7VA 1HL5A 4JO3H 1AIFA 4RRPG 1G7JA 4ANVA 2P26A 1RLBA 2MEJB 2XQYG 4DP4X 4HFUL 4Z7QE 5K69A 2OMYB 1I3GL 2W9EH 1LP9A 3HC2A 5DZJA 4ODXB 3H9HA 1SY6L 3ALWA 5HGAB 1G9NC 2CKNA 2BZ7A 2HKFH 3IJ7A 4IHBA 3VJ6B 2L4OA 2J3SA 5C7ZA 1UACH 2H3KA 3BI9X 3Q8AA 4YXHL 4PJXE 3U2JA 3KLKA 4DGYL 2FUQA 2HVBA 3MRFA 4X80L 2R29A 2BHYA 1U8PB 4M8VA 1D5ZB 2WKLA 4NNYB 4QAWA 3MLTB 5BQ7A 3BP7A 4OCLC 3EO9L 3I6GA 1PPIA 1FBIH 1Y0LB 4APQA 4K94H 4Y2DA 3BP5A 3TBVB 1IKFH 4KZDL 1BOGA 4YOKA 2YD6A 1PDKB 4NXKA 1PFCA 4L3CA 1CD1A 5F6IC 1GGIH 5HJ3B 4F7KA 4EDWL 5BW7A 3EYSH 4PN6A 4G7QB 3NDZE 3KDMA 4QTIH 1INDL 1SDAB 4JDZA 4M48H 3I3DA 4K9EH 5AVRB 3WHE1 5I0YA 4G71B 3S5ZA 3GKZA 3H9SE 5DK0B 3QJRB 1HS6A 2ZJSH 3A21A 3D4CA 4LQFL 2X7LB 5I76B 4HH9A 1SJHB 3L95A 4X7TA 3DX9B 4FABH 4JREC 4WSGA 1F3JA 2NXZB 1RH8A 4KJYA 3UBXA 1EJOL 1QYGH 2DQEH 5K9QG 4E41A 2XI9A 3HIZA 4B9JA 3C60A 4I88A 1YN6A 1DSWA 2V2WB 4OGQC 3T4AA 2Y06H 4KZEH 3UTTB 2AVFA 5IEKB 4H7VA 3BWAA 2KPWA 5A43C 2JQZA 4BHUI 2VLJE 4K3DL 1TTUA 5CSZA 2VDPL 2EIKB 1TXKA 3NJFA 4HWEH 4FXKA 5BZDB 4ISVB 5LBSA 2AV7B 4ELKB 5CGYC 3GSQA 4R0LB 1T89C 3VYNA 4WKZB 3QH3B 4GSRA 1B0RB 3DX7B 3OB8A 4LNVA 4FHKA 2EDMA 5FA4B 3O2DH 2PXYA 3D0LB 1QSVA 3N85H 1M42A 1T7YA 4NO2B 1AOHA 4P5MB 4BZYA 1PNCA 4X5RA 2DW5A 5KJRL 4N9GB 1HH9A 4G5ZH 3RJDA 3GSVB 3AXLB 2EDOA 2GW5A 2XA8H 5KYWB 2QQNH 3RVUD 3L9BA 4N0CD 4TRPH 4XPHH 5CD3B 2YMTA 3GXNA 1U91B 2C8NA 5FO8A 1EZVY 4Y16D 2UYLB 3CN0A 4GKSB 4JG1H 1INEH 2WTOA 4FA7B 4Y9CA 1N64L 5F7LB 3GMLA 4WY7H 4FYQA 1X9LA 4OQ1A 3CN4A 1MFAL 1EAPA 1TDQA 1FH5L 1MEXL 2JKIS 3MKKA 1PD0A 4FNUA 3SKNA 2KZKA 1INDH 4XNBA 1AQ8A 2V6HA 1GGCH 1VFAB 1MIMH 4YBQD 1S9YA 2BVOA 1FO0B 5T3ZE 4JW3A 1W0WA 4WWPA 4A2GA 2A6DB 4DERA 3QHZH 4JFEE 4XCNA 1FI8C 3WXVL 1Q8MA 4HUWB 2UYLA 2AJSL 5D2NC 3H2PA 2APXA 4K8RL 3F7RA 3G6JA 4UT9H 7FABH 3V4PL 5L7XH 5KW9L 2CIIA 5EIQA 2WVTA 1A7RL 5LCVA 5ITFA 3CFTA 4TTDD 1TETL 3V4VL 3FMGL 1QA9A 5A7BA 3KYAA 2Q7YA 2V9UA 4NQTA 3NT0A 1RURL 3C12A 3HPLB 3T3PB 2AABH 1T20B 2Z4TA 2W9DL 1CU4H 3FYIB 2IOOA 4KXAA 3CMOH 4TULH 1FZJA 2VTFA 5EBLA 4M7JL 3W2DL 4ZTPL 1YQVH 3U4BL 1ZS8A 2UZXA 4GXFA 4UILL 3CDZA 1X4XA 3GYRA 3TIDA 3LKNA 2EH7H 5FGBC 5L4JA 1YEIL 1M6OA 3F04A 4F8QA 3FUKA 2QSCH 3ABMB 2JF1A 2PPAA 3MA7B 4K3GA 4ZZKA 4UOW0 1SJVA 3K6OA 5F93C 4FXKC 4YBLB 4JY5H 1HEZB 2H3NA 4B0MB 5DD5H 3NCYS 5JIKA 3V4UL 3ME0A 2VN4A 4PGDA 1LE9A 1UOLA 4HSCX 4HALA 4YNYA 2AJZA 2X2JA 4AL8C 2C4XA 1TFHA 2OA9A 1EMTL 4D8PA 3RB7A 3NABH 3S7GA 1NICA 4PB0H 3UZVA 2GK0A 2NY6D 4DW2L 2EQDA 4IGBA 1GYAA 4FERA 2NQCA 3AROA 2PTVA 1HXYA 4HJJH 3MLSL 5TH2A 3LNHA 2ATKA 4A7GA 4TL4A 2ZX8A 4CU8A 1J9CT 1KJ3H 5EFIB 4UNVA 5FM4A 2VM4A 5EU6D 4J6RL 2JB5L 2BVUA 2VYRE 3KLSA 2X44D 1F86A 1LEGB 2Q1EA 3CVHA 3OXSB 5AZUA 3JT2A 5ENWB 5CZVL 3QUML 4UM9D 1QMUA 1L7IH 5D1QA 1MWOA 1JHLL 3HHSB 4KMLB 3SGEH 2JXMB 4YDJA 5F21B 2BMKA 1G1YA 1FSKB 3K2IA 1OB1A 2VSMB 3LRMA 3MC0A 3MLUL 1LE5B 2QHRL 1A65A 2Z35B 1NIFA 4PWIA 4ZUSB 1I8LC 4P46D 3GIVA 4BGLA 5IQ9B 4BWWA 2GT9B 4JDTL 3CFJA 4PRNB 3ZQWA 2ZOTA 4AITA 2H5UA 2LFEA 3ETBF 4HOZA 4HC1L 1UHVA 4OD2B 4G11A 2D9QB 4B7IA 2O72A 3D69B 4I2XA 4LCVA 1CFVL 3PUCA 1N6UA 3FF7A 4EI6A 1WT5C 3QCUL 4U1SB 2BO0A 3D1MC 4UT6L 4B7LA 4PJEF 4DO5A 4EZLA 4Y4HC 1PG7X 5T1LB 1K8IA 2VLME 3FSVA 4KRPB 1W6LA 4TOYL 3OGOE 4D0CA 5E6UB 3DROB 4IOFC 3DVNB 4G3YH 1FAIL 1ZDQA 3F01A 4XWGL 2AAVA 1YAZA 4KNSA 1YEEH 4AT6A 2CDGA 4V1DA 4FQXB 4NKIH 5FDWA 1IBDA 3NN8A 1B88A 3RL2B 4BHUA 2NSMA 3CZUB 4HUXA 3W39A 3LRKA 4QHKJ 3T9WA 4UTCA 2DQJL 2EXYC 2E76C 4KJWC 4XTRC 3ZY7A 1OF0A 1G5GA 3B2UC 2WXFA 4RMSA 4ZMZA 4JKKA 4LASH 3ETBJ 5HYSB 4U1LA 4GG6A 4D9QD 4ZX6A 5CCKH 4P3CH 2P80D 1A1NB 4R0LC 1U0QA 2D73A 1JYXA 2FYVA 3CCHB 1V7MH 1NGYB 2VR6A 5I18H 2KYIA 1MVUB 2PABA 4R97B 2F1AA 2ZWYA 2HRGA 3F5WB 4QD2E 1FF5A 3G08B 1VACB 5J89A 2NQ3A 5D7LA 4L5FH 4PRHD 4LIQL 1OF2A 1A6PA 2XG4B 3CHRA 5EUOA 2GJ6D 3TF7C 5GGSA 1FL5B 2Q8AL 43CAA 4HWBH 4XN1A 3HE7D 3AM8C 4DFIA 1TJIH 4KKZA 3DLQR 25C8H 3PCYA 5CEXB 1HYSC 1R3LB 3Q8EA 4PG2C 3LZNA 3ZMNA 1IE5A 4PW4A 1EMTH 2JSFA 4X9HA 4AYEC 1F6LL 4C4UA 3TIEB 4FTVB 5IKCA 1T20A 2E75C 2WVVB 1GIGH 3OKMB 4JQVA 2K9FB 4BELD 5I1CH 5DYOA 1NMBL 5I74B 3WIHH 1QLRB 2NNAA 3TBYB 3K2UL 1IC0A 2BVEA 2NX5E 4Y1TA 2I9TA 5TD4A 2GITB 3M8OH 4WV1A 3OXRB 5IV2A 5LGJA 4ABVA 2BNQB 3B9AA 4IRJB 1OAUL 1P4BL 5F9JA 3SYCA 3TYFA 5BVJB 3GSNB 4DUVA 4WO4D 4WHTB 2X1WL 1GS6X 1MFBL 3LV3B 4QEGA 3VXNB 2QVIA 3P69A 4XBMA 3BZFA 4I18C 1MI5A 1IGJA 4KJWD 2XN2A 4XTRD 2JJSA 2BNRA 1JF1A 3HBQA 3Q5YA 1V10A 1ET7A 1I8UA 3B9KA 5KS9E 2YFOA 1GPOH 1U8KB 2R7EB 1FH2A 1KXTA 4LVHB 4DGUA 3SDDD 5C0CA 4K3HA 1R24A 3IYLW 1NJ9B 5E8OA 1TCMA 2JJUA 3LIZA 2XDHA 1EA9C 3IFNH 3WFBL 4AL8H 4CMHC 4EZKA 5D5MF 5DJAB 1MRFL 1M56B 2D03H 3KS0J 3LKPA 3VFOA 3GIZL 5IOPA 2XQYK 5EU4B 5ISZB 2Y1YA 4NDMB 4FULA 2AJYH 5JOPD 1RZIB 2MOQA 4MJ2A 2AXGB 3LQAC 5EUOE 3ZE1E 1QQDA 4P9HL 1GOFA 1AKJB 1TJGL 2NY0D 2R59A 4G8IA 4HDIA 1FFNB 3GUFA 2E59A 4N0FA 4PV8B 4Q7DA 4RH4A 3HB3D 1M1XB 2ZNXA 4FRWA 5I73B 3DYPA 1H6EA 2N1TE 4JFHE 4OGZA 3T3PE 1J1OH 1W0YT 1NKRA 3WBDA 3UFIA 2KQNA 1T04A 4Z7UF 4YN3A 4M62L 1C16B 3MV01 1M3IA 5DMJB 5D1ZI 3MROA 2BSDA 1S46A 5CJBA 2GJ6E 4WY7L 4A38A 4ZXBA 3DX3A 3UG3A 2A6IB 3QIUD 4X6EB 2WZ6A 3QUYB 4XPTH 2BIPA 1I1AC 3K5RA 4H26B 3UAJA 1U8MA 3UJIH 3QZOA 3SDDC 3MOBH 4H2AA 2CD0A 1A21A 1G9HA 2VC2H 4L8DB 1M2VA 3PIQB 4Y5YA 3GD1C 2F2HA 4Z3JA 4NQDB 5E1IA 5JPNC 3TEYA 4N1HB 4UTBH 1G43A 4GW5A 1CIUA 3CU7A 3UAJC 1PZ2A 1LK2A 3UIZA 2H2SD 4RX4D 4G9FA 3JV4A 1DANT 4IHOA 4Y5XA 4TN9A 2NX5D 2WKOA 3SDAA 4EUPH 3HCVB 4K4KA 4FLRA 4FADA 4DEWA 4FQ2L 3O11A 2Y7SA 4BV1A 2LOEA 5IVZB 3NFNB 4ODSL 4Z9KB 3U48A 2CA3A 1H8NA 1J88A 1T80A 3ZZLA 2NNXA 3V0VB 3MRCA 4LL9A 2XXGA 1UACL 2Q0ZX 2H0JA 2J7LA 1HXMA 1MIEH 4F9LC 4JB9H 4ICWA 5EA0H 3MU3A 4PGCA 1A7QH 4G9DB 2F18A 4U6YB 2H3NB 4XPFH 5DEGA 2DYRB 2AK4D 4PRIA 3G5VA 4KKLC 4W81A 5BS0B 2WKOF 5I75B 5HHXL 1GYWA 1NCBH 3H56A 4HIEB 5TK2A 3IFLH 4HJEA 1ZWIB 4OLWH 2Q87A 4YHML 5MHSD 1NDGB 1EWHA 2QPFA 3A4DA 3MRIB 4KH9A 5B3SB 5DCCA 2VCOA 4RQQB 2HFFA 5LBSH 3P4NA 4TF4A 1AXTH 4X42A 5HHNB 1BZDA 3L5WB 4J3XA 3MLYH 4PP2A 3S34L 5JW3L 2MTPA 3UJTH 1YPZE 3A6CH 1OCRB 5F8RC 1JK8B 3RI5K 2EE2A 4HETA 1NFIB 4LCWA 4PV9B 3TO2A 3VGDA 4ADIA 4HAKA 5JHDA 5AL0A 1I31A 1VAHA 1JFQH 4F7MA 1U92B 2UUDH 5EIVA 5I1DB 1UM5L 1KIUA 3BZ4A 3DX8A 3VQLA 1HL4A 1YEKH 4FZ8L 4YDIH 3U6RB 2HJKB 4OVUA 2NW2A 1PD1A 2GBUA 4OZGB 1WAAE 3ALXA 3PWLB 4P9HH 3EAKA 4KAQL 4WQOA 4HG4K 1ZLSL 4A66A 3RNKB 3K80A 5C2BL 4M00A 1ZV5A 3LRSB 4FNPA 3DX6B 2PO6B 1N0LB 1T7WA 1WA2X 3TA3D 3K6DA 2OSLB 2L7EA 1TJXA 3DX8B 3NA9L 2ZXWB 4IBYA 3W56A 2R2BA 1CGYA 2IMNA 3K0YA 5CCJA 3FUMA 1S3KH 3KPRE 5E2VH 4EBQL 1P6FA 2ZSWA 3RTLA 3BUTA 4Z7VF 1JVKA 3B8SA 1JPEA 3MNMA 2WINA 4R7DA 5IQ7L 4O02A 1YYMH 1XCXA 4PG2A 1FNHA 5L6YL 1UXWB 4Y89A 2WANA 4X9GA 2VDQB 5AW8B 3IFPB 1WHOA 2L8AA 4X8GA 3LHPH 3L54A 4MZRA 3QARA 4TVUA 4X4XA 3VSUA 3AITA 4A2EA 1DL7H 1MAML 4QRRB 1NIBA 2W60A 4EO5A 4EDXB 3UO1L 4L3EE 3LH2L 1ITCA 1RUQH 4XCYA 2C1PB 3ZDXB 1GYVA 1QSFE 1SNRA 2X1XR 3IAQA 3EDJA 4B27A 5JUEH 4LCIL 3KWTA 4CNIA 4D9QE 2R39A 3ATDA 4ZUVB 3MPCA 1MRDL 1ZLEA 4V11A 5LBGA 2IF7A 1SMDA 5D1QE 4Z78B 1QVOB 4LPXA 2Y23A 3K74B 5F7YC 1JD7A 1B9ZA 4QXUH 4D7BA 4JFXA 4ELME 3DJSA 4HHWA 3I3EA 4JY6B 2YHGA 4YHYC 1KBGH 3QUMH 4FD0A 3CTTA 3Q43A 1WC7A 4QRSA 4TYUA 1IE4A 3CGTA 1QTSA 4LKXB 2FEDD 2HN7A 3PNWB 1AQDA 2FECI 1RAMA 1DVTA 43C9B 2VDRB 3A4EA 2ZKHL 2D0GA 3WJLA 3KAAA 4ABUA 5A2CA 4HLZG 4M5YH 4XO9A 4B3EA 4XP4H 3NCXA 3VNYA 4CU6A 4FFWC 3NACL 4XVJL 2H1LM 1T89A 3HHRB 1D6EA 4XC3H 4TQHA 5D8JH 1G87A 4F2FA 1AZRA 5KSAD 3F12A 5C0BE 5CHNA 2W65A 2WUBL 4OF6A 1UWGH 4AENB 3B2MA 4TM9A 4OI9A 2FWSA 3GXUB 2WXMA 3U1PA 1IEBB 1TVHA 2K6YA 3QC5X 1MRCL 5H94B 3BSZL 5JUEL 3VWJD 4GXVH 1G7MA 4LBAA 5J6HB 4PRDA 4MYPA 5EN3A 3U36A 1QLFB 3EO1A 4GXVL 4PEEA 5C0AE 4QNPE 5E6ID 4Y1AE 2ZAIA 5C97A 1QHOA 3P2DA 3WKNA 4ZJ9A 1UWGL 1G1KA 2MFNA 2VERA 3RTQA 2ADIA 2DQCH 1RJYB 3WHXB 1NDGA 1QNZH 4OLYH 2YA2A 1Y07A 5IB4B 2H8PA 1KIRB 1X5MA 4P2QA 4XP1L 4JX0A 1QWUA 3V52H 4CMHB 3SKMB 3RTQC 1ADWA 5DVKA 4L23A 3MV11 1QLRA 4EIGB 1WGOA 2GSGA 4CILA 5TF1L 5CN3A 1QLEL 4A6YB 4FDWA 5EU5A 3VFWA 3PJLA 1H6TA 4NM4L 3FN3A 3AC0A 3FMGH 3PL6D 5ACMA 1EZLA 1MCWW 3CFKA 2YBGA 2VDOL 3PXHA 1DQJA 4HJ0D 3GRGA 3BHBA 2EABA 3C08H 5F2FA 2KHAA 4M6NL 3WTSA 4TQPA 3CBRA 1TMCB 4M7ZB 1WO2A 2Q3XA 5L0QB 3WXVH 4PJFF 5BOJA 5KVEL 1FO0H 3VI4E 4NC2B 3PWLA 4J6RH 2WQRA 4N22A 3WNKA 1I8KA 3QWOB 4IRJC 5C2UB 3RU8L 3LEVL 2FX7L 5DMIH 1NBYB 2CR6A 2D31B 3M17B 3HVNA 4JO4H 4P4KC 5FYLE 4AKQA 5LN8A 1S9KC 5L4IA 5MENA 3C60B 3K71B 4YLBA 2G5RA 1XMWA 2EUZA 4IBUA 1B3IA 1CXHA 1RUAH 4G8FA 3RWDA 2AV1A 1N70A 3TTSA 3QI9B 5AZ2H 1M05A 3A6CL 5HI3C 3FUJA 4NQEE 1KBKA 4PJ9A 4F8PA 4L9DA 4GRWB 3VXTA 3DX0A 2H6OA 5C0BD 3EBGA 5ALBH 5I16A 1LK2B 2EDXA 4GQPH 2OJZL 1WWAX 3FU8A 3Q1EA 3X3FH 1HHHB 3TS8A 5DEFA 4U6XA 5DRNB 3QZWA 5DQDL 1XF5B 3MCKA 1XD1A 2BVQA 3K2KA 1EO7A 1PX3A 1SOSA 1PLAA 3EFDL 3W5NA 1KJVA 5D5MA 4UQEA 1U33A 3NOIA 1WQVT 1YPZB 2ZX5A 1MCFA 1KSRA 3FUDA 4TLKA 5JORA 1IM3A 2YZ1A 4DN3H 3FB5B 3H2QA 5ID0B 1CICB 5I1IL 2P4AB 4FJYA 4FAAB 2V2TA 3LDBB 1RJZB 4R7NB 1AD0B 4KTGA 4J2XA 2RQ8A 4K71C 1F2QA 3CUPB 1PNDA 1ZHNB 2I32A 3OKNB 4Q9RH 3DRQB 3B2VL 3REWA 3K2MC 1X5ZA 3KL3A 3S3PA 2KDGA 4J1UB 5EC1B 4A2LA 2WQVA 3NVQA 3MODH 4OB5H 1XCTA 2QKSA 2JCCA 3BWSA 3V7MA 4NKDA 2QDVA 2W80C 1I7UA 2NY1C 3RDTA 3UPRA 1I8KB 3B7SA 1BVKB 4O51B 4JREB 4WK2B 2EIDA 3KPLB 4PJGE 5D1ZD 5E8EA 4GEIA 5E8PB 3CPUA 1QFHA 4N90D 5TPWL 3V5HA 4QRSB 4UOW1 1OD7A 2VZTA 4GSQA 1N8ZB 2AGJH 4G80B 4JZJB 4NQDD 5M94B 3H53A 2VZ3A 4MXWL 2E5EA 2GITA 1YEFH 3N44F 2CK0L 1YEJL 3LEXA 4L1TA 3NYKA 1DVUA 3WN5B 1U8OB 4KOCA 1N3NA 3GSUB 3JWNC 5K1JA 7PAZA 2Z7WA 4HK3N 3TONA 3MROB 1MKFA 1QSED 1WBYA 1FLRH 2A6KB 2G60L 4PJ8C 5DUBA 1I7UB 2OR9L 3ARFD 2DPKA 4N2AA 3X13A 4YMPA 2IV9A 2WVSA 3HRZC 4HX1A 4J3BA 4PR5B 4Y9GA 4Z7VA 4R4BB 5GS3A 3G04A 4UU9A 4KO6A 3II1A 4Y4KB 3FKUS 3AW5A 4X8CA 4C55A 4TPRH 5JO5B 3WLBB 1FYTE 2P8LB 3CXFA 3D3VA 3K1DA 3X11A 3LKPB 1B2WH 1KIRA 3QXVA 1JVLA 4HK3J 4GXUN 5F7MC 5AQ0A 1VADB 1OKEA 1QUPA 3K8LA 5TE7L 1PTZA 4EIZC 1DBJL 2ZTBA 4PJ7B 1EJ8A 2P9RA 5E8DL 1OF2B 4KROB 4MBOA 4ZSOA 3N43F 5C07A 4LHQB 1LILA 3R0NA 3FOLB 5JOPE 4J3UA 5KYYA 3BYYA 4NCDA 4OJCA 1N67A 3HS9A 4OBRA 5SWZD 4CVXA 3OAUH 3DA0A 3ULVL 2R4RL 1AHMA 3TVMC 3RNKA 2FX8H 2UVFA 4PGCB 1BD2D 3WELA 4OUUB 3OKKA 5J11C 1NGWB 2UZYB 3FUHA 1MHCB 3D30A 3KPRB 1WP6A 4XNMB 1SYVB 1YMMA 4TUUA 3QE5A 5AEAA 3FTZA 1Q9WB 3ARWA 5CF3A 1NUDA 4O4YH 4WU5B 4PREB 7PCYA 5GS2H 3NBNA 3GMRB 2EIZB 2WXJA 3WIHL 2F19L 3CVHB 3OXSA 3HG1A 3T2LA 1A1MB 5T3XH 1RUMH 2OPCA 2WZ5A 2ICWB 3PHQA 4RA0C 4HT1L 1I8IA 3EH1A 3QDJB 3T6ZA 3WNOA 4DK3A 2R0ZL 5F0LB 1U8NB 3NZUA 2ICEB 2DD8L 1TJHL 1ZPUA 4G7RB 2RHEA 1CT8B 4PJ9B 2DLFL 2A6JB 4NWUL 3U0WL 1M53A 4XHQA 1F42A 5J6GA 4XNZC 3F64A 1IJ9A 4OF5A 5HDBE 1C08A 3FTGA 1NMCC 1DZBA 3D4YA 2V33A 3O6LL 1B0GB 5DT1L 2F68X 5KSUB 1CBVL 3S96B 1KCRL 4XAWH 3T2OA 4HSAC 2MNJB 2V5SA 3MLVH 3SJVB 2V9QA 4OCYL 3OJDB 1Z3RA 1E4WL 5F7DA 4ZXBD 1TTGA 3J8F7 5D7JC 3G6AA 2BIQA 2E46A 1CYWA 3KGRA 4L29A 3ZE0B 2RCSL 3DSNB 1I3GH 5MEOA 2A9BA 5AOZA 1VEMA 2XWTA 3QEHA 3FSZA 5B1AB 1A4KA 3EJJX 5ICYA 4UQ3B 2P24B 3X17A 4NN7C 4QHMB 5JW5B 4G7YL 4KJPC 1J8SA 1QFUH 5GGQH 5HVFB 5JIMA 1Z5HA 3KVPA 5TGBB 2DWXA 2BVYA 5CEZD 5C0GA 2E7DA 4JHVA 3FFDB 2YXFA 4KV5F 3IBOA 4MXVF 1ID2A 2Z0BA 3IN0A 5AW2B 1A1NA 2AQ2A 2X70B 5FPIA 2GUYA 2JCCB 4K5PA 1Q72H 1L6PA 1EEQA 3ME0B 4PGDB 2CLVB 4G8GE 2GI0A 2FLRT 3LTVA 5EU3B 2NY3B 4L9LC 5CLZA 4QHLB 3RX9A 3V79C 1CQYA 2PCPA 1CFVH 1U93A 3VXRE 3B8YA 4HWBL 4N6RA 5IMLB 2NR6A 2GUOB 1EFXA 5ID1B 5ADOL 4OCSH 3WLWD 2SODB 3MJ7A 2YPLD 4KTEH 2FO4B 5DC0A 2DQMA 3L3OC 5J7CC 5F7NC 2ADGB 2FIKB 1U4EA 5F1NA 4NENA 4X6DF 3QNFA 3HUJE 2H32A 3AS0A 1NANH 1YYCA 3VTAA 4NN6C 3O6KH 3AB0C 3BD4A 3RILA 3CFJB 2A73B 1PJWA 4NZFA 3VG9B 1PCXA 2XRAH 4Y4FA 4R7XA 5ES4B 3K71A 5AW6B 1EX0A 4HXBL 1J1XL 4N4YB 1QX1A 1BEYL 2P28B 2VDNL 2IDSA 4HS6A 2WYZA 4LQ1A 4UOJA 5HHME 4MHHG 4WFGD 2C3WA 4Y9FA 5GRUL 1CD8A 3WKQA 5LWYH 3HZKA 1PL3A 3D0VA 5AKRA 3UO1H 4UWQB 5ANME 5DXWA 1GMIA 3RB5A 3P4OB 1AE6H 5AAMC 1A9BA 3MFGB 4YIQB 2OCCB 3LHPL 3EFFA 3R06B 4XWGH 3RIFF 4PG9B 2VDMH 3GI9L 3SODB 4QKTA 4AGOA 2FATH 1QR1A 3APNA 4MB1A 5DLML 5AG8A 4MA7H 4X5PA 3VDBA 3HMWL 2O61A 1MXGA 4ZMWA 1A2YB 2JQMA 1D6VL 2IBZX 3DRTA 1T6WA 4NQQA 4GSDL 2VITA 4LMQI 5JR1L 4CNIB 2XQBL 1FO0A 2EDRA 4F91B 1XFPA 2NY5L 4NCC2 1MHPL 3ARBD 5C0ND 1RPKA 4AQ1A 4KRPD 2TRYA 2I5YH 2Y25A 4OJEH 2X0WA 3MACL 2HJFB 4Q4IA 4B9KC 1UZ8A 5IMOA 4EI5D 4PJAE 3IDGA 3GXPA 3SDYH 1XIWA 1AIZA 1JDCA 4RMBA 5D71H 1ZLWK 3STLB 3MRPB 1N2RB 2LU3A 3U4KA 4HH9B 3ES6A 3U46A 4RIRB 1OGSA 1J0KA 4H4NA 2DYPD 2HFGL 3U6XS 3ZRFC 5F1NB 4KU1A 3WOVA 4LNRA 3UGEA 2EO9A 3D0AA 3SDYL 1KBPA 4EXPX 1TITA 2GIXA 1YEKL 1KDIA 5ANHA 1ZS8B 2UZXB 2V3FA 3QCVL 4LEBA 5DJ0A 4F2MA 4U1GC 4K8RH 2E8ZA 1JFQL 2WLYA 3NH7H 4NM8L 4L4TB 4PJAA 3T4AC 3VFRA 3BPLB 2BCKB 2O30A 3C6LC 1BXAA 1C5DA 3V5KA 1YY9C 3BUPA 3ISRA 3BXNA 1FFOA 4MVBC 1RFDH 4BSWB 4P2RB 5FHBL 2VLMD 3TVMA 3MOAH 2G4GA 1S7SA 1DJIA 3MRJA 5DD5L 1E4XL 3B5HA 3ML8A 3RURA 3QQDA 4WFED 1MREL 1FNAA 1RUKL 4MJHA 5EZJA 4WI0B 3CLWA 4RAVA 2QSCL 1OAXL 3IFPA 3C9NB 2AQPA 1OZUA 1XVSA 2FQFA 1CPUA 1DSFH 2EH7L 1LP9B 1VCBC 2FJFB 3HZMB 2AQQA 1TQUA 3UJJL 2B4CL 1BA9A 2W0LA 1J48A 4QY8B 1A7QL 4TRPL 3ARDD 1KLFA 4XPHL 4JLRB 3U4BH 3RYMA 2COVD 4PMEA 4Q56A 3SOBL 3FQTA 5IREA 3UPCA 3ILQD 4JG0L 3LV3A 3GM0A 5GZOA 3MV7D 2P5EB 5E8OB 1XHHA 1X5AA 1JPGA 5FKPB 4NZRL 3UZQA 1LP9F 1O7VA 4Y2OB 2D3VA 3ZKXB 1R5VA 2C9VA 5EHFA 3LS5L 3S9DB 1JMXA 1TZAA 3ZQXA 3JTBA 2W92A 4FI7A 3V4PH 4KMQA 3QXTA 5L7XL 4JKWA 4N0CC 1BM7A 2A6KA 4BFRA 1M3JA 3QUYD 5E6IA 5I8EA 4K7PH 1KCWA 3KCWA 4IBQA 2YEZA 3CX2A 5KWYC 2R1XA 4PH8A 1VSCA 4LPWA 5K39A 3TXAA 2VN6A 4F2MB 4LLWB 2H26A 4JHUA 2RFXA 1G7PB 1PZSA 2FR4A 2LV4A 1F3DJ 3WFCH 1A6WH 2ORBL 3NQKA 3TH4T 4JO5A 3UC2A 5EBLB 2AZUA 2EIZA 5F97E 3IMVA 3SBPA 3CX5K 4B9IA 3MBWA 2VDLH 1C16A 1ZVHA 5E2TL 3SBRA 5I0DA 2ICEA 2JVUA 2FT8A 2DQIH 4BQ6A 1I8IB 4ZXBB 3W0WA 3CC1A 5HDLA 3V8OA 5B1JA 4TSBL 2WXIA 2IWEA 2VJ8A 3QI9D 1T83C 2JTYA 4DCQB 4WNJA 1UXSB 4YO0B 2GFBB 3KPTA 3DX6A 4PTTA 3ETSA 3BN3B 4P2RD 3ULUC 5FB8B 4BDVA 4OGXL 4XBEL 4XE5B 1A5FH 4XXWC 4OUUA 3DJ9A 3AB0B 2HLEB 4G6JH 1HKLL 4IOSD 4CL7A 3BAXA 4ZW6A 2I9LB 2V7HA 4DGYH 1AGDB 3ULAB 2XU9A 4U6VH 5JYMA 2CRMA 4PG9A 1CLVA 1BZEA 2QFPA 2Y1ZA 4KOBA 1LO5A 3RVVD 1JK9B 1E6OH 5KVDH 3CFMA 3FQWA 4YR6B 4KTDL 1ZOXA 2ALAA 5GGRB 4WHTA 4PGJA 4G8GD 4MAUL 2P5ED 1O9ZA 2ED8A 4LZKA 3CC5B 5E00B 1I9JH 2CSPA 3I6KA 3WNMA 5JOFB 5CEZE 2CM5A 4L3ED 1LO0H 1E5AA 2WBJD 1QSFD 1NCJA 3QFGA 5KJ7E 1LO0L 3LZQA 4JY4A 1XGPA 3MHZA 1MFMA 1TQCC 4JZOB 2MIZA 3SJVA 5EULV 4R2GB 5J1TC 5MENB 2J6EH 1IBYA 3HG5A 4Q52A 3RVWD 1A6WL 2ORBH 5F70A 3SDXF 1U8CB 1D5IH 1C5CH 4MSWA 1Z3GH 3GUTB 3APCA 4L3FA 1VDGA 4X6DB 5B7EA 3OVUB 2XKUA 5IWLA 4IRSA 1JZJA 1YNKL 2DQGH 1DJYA 2VXVH 4H8WH 2WV3A 4JM0A 4QRUA 5EDXA 1DQKA 2HXAA 5LHDA 5D2LA 2BXZA 1CFTA 1N5AB 3PAZA 3SE3C 3S37L 3H0TA 1QFOA 5L4FA 5FWQA 1XF4B 4I0KA 3AQZA 4X80H 4FG6D 4Q0XH 4JY4B 5MEPB 4LDCA 2HX8A 3ABLB 1AP2B 4HCGA 3NIGE 1QO3B 4X7TB 1CDYA 1U58B 3F83A 3VYOA 1T22A 4LOEA 4TPRL 1UYWL 1GAFH 4ZPTB 5EC2B 4PVLA 4Z76B 2A4CA 3IDJB 5D1ZA 4N85A 2DIEA 2GTZB 2VABB 1HILB 3MRNB 4HEMA 3V4LA 5B39A 1KTCA 2AJ3B 4Y2DD 1KB5A 1L4IA 4NQDA 2XZQL 3MA9H 5D7EA 4JE4B 1PQZA 3HE6B 4M8UA 2Q2LA 2VLKE 4H8WC 3QR0A 1D5BA 2GJPA 4ZSOB 2ZYSA 4AH2B 5IFAH 4WW2C 3L9EA 1OARL 5BCAA 5IESH 3S5YA 2QPEB 4WKZA 5BS0D 3EH3B 5ESVA 3H4HA 5E08H 2CDFA 3OLDA 2FWOB 4NQCB 4LRNL 3IDJA 2CUIA 4N8VA 3GBEA 2NY3D 4LAQL 2XFXB 4M4RA 2MNWA 2GI7A 4TMPA 4DF9A 2BS8A 3EJZD 3FT2B 3QXWA 4JO1L 4RSYA 5PAZA 3TN0D 5CLYA 2XBTA 1EFQA 1MNUL 4YHOL 3VG0L 2PW2B 4IIQC 5I71C 4FQIH 5GS1A 3ZE2F 4ZMOA 2WOYA 3KM2A 2CNYA 4XGZA 3AUWB 3WNJA 2VMFA 2QHRH 2O5XH 3ET9F 4Z7NF 2WK2A 1CDHA 3II3A 2YSTA 2FSEA 3HHMA 4POUB 4ZS6D 1OGPA 4ZUSA 3OZLA 2PXYD 3B9EA 2ARWA 5T5NF 2WBJC 4MGXA 4ONFL 3L7FA 3CIAA 4L4TA 4PJAB 3RVXD 1HTYA 1YC8A 1I7RA 4LHUB 5I8OL 4N8CL 2M1KA 4M43L 1HYRC 4HUWA 4XBPA 3V95A 3GSRA 5DRWA 1AMYA 5C0AA 1AH1A 3MRKB 1P9MC 1DSFL 2BOCB 1NFDE 3HBGA 4Y16A 1YNTF 3MLXH 3EFDH 1X7SA 1TEGA 1P5UB 2P8MB 4N0UE 4ZOCA 2B1AH 5FCSH 1M71B 3WJJC 2LTQB 4QCIA 4KK9C 3LH8A 3FQWB 5DFTA 4ZUTA 2BP5M 3FQNA 3VI4F 4AQOA 4UTAH 4OGYL 3UP6A 2Q8BL 2E4TA 1EAOA 1M7UA 3MV8E 3A3YB 3BQUC 3UTPE 1S78C 3VSQA 2JKRM 1ND0B 4PJCA 3RVTD 3DYMA 2V8LA 2EIEA 3CN2A 1GRWA 4YR6A 3CCHA 3RPKA 1OCOB 4CBZA 1OWRM 2D0FA 3G6DH 4XNDA 1BV8A 5INDA 2IG2H 5L8LB 5D7LB 4QXTA 1T6BX 2J25A 3LZRA 5CUSL 3VFMB 2AVGA 3NEEA 4ZMQA 1OW0A 2CUMA 3NGBB 3TV8A 3B2XA 4FQQB 4KXBA 3ZKND 4JFHD 4F8NA 5IEHA 1G7HB 3NZHH 1K4DB 3FOMA 3UADA 2F53E 3NCBB 3RL1B 3MRHA 4GNKB 4JQVC 1CG9B 4O2EA 3N44B 1B0WA 3F05A 4A6YH 4MWFA 4QXVA 3TYGH 4EPSA 3KPLA 2E0PA 3APFA 4WFHE 4CN1A 4KNQA 1FV1B 1W0WB 2VWEC 4H25A 5I6XB 4OIIH 1DLFL 1T1WB 2IH9A 3N1PC 3O4LB 2OYPA 1OZTG 1D6VH 4JLRA 4N90E 5IHHA 2EEAA 3CWGA 2WXHA 3Q8FA 5DLMH 5IBLD 1QASA 5FO9A 4DH2A 2WGXA 1ECYA 1UATA 3PDOA 5KZCB 3IEAA 4TTGA 4B3VA 4LOUC 2BHZA 1HQ4B 5C9JB 1K3IA 3BAKA 4NZUL 4UDTB 4F5CE 2KZWA 1DBKH 1VPOH 4G1MA 5IROC 3VCLA 4GIPD 3ZDYF 4LP4A 4F2ME 3QPXH 1EIBA 4KKBC 3BZEA 4A7SA 1WEJL 4KH2A 3K81A 5D4QA 3SN6N 5E6IB 1MHEA 1THCA 2XV6B 3GSVA 1PZUB 1P84J 5FCUL 2Q6WA 4ODXA 1MF2L 2XPYA 1V3JA 4Z7IA 3KGUA 5EBWB 1U91A 1HESA 3UTQA 2JLLA 4I2XE 3KJ4B 3ZDYB 3MCKB 1QI5A 3US1A 1H15A 5CN1A 5I1JH 5TFSH 4DZ8A 4AVHA 4PUBL 5A16A 4ZPVA 4EIUA 4KQ3H 1QHQA 1M6UA 2Z4QA 2DBJA 1UA6H 3OSVA 4OCSL 5HHVL 2C26A 5MHSE 5IVXA 3NFSL 5TQ2H 1ZLVH 4U6HB 4ECNA 4NWUH 4X6BB 3U0WH 1AGFB 5D6DA 1U9KA 1YUHB 4X6FB 1TQVA 1FG2B 1O9VA 3VMNA 4IMKC 2HT4D 4ERSH 4DQOH 1QLEB 3VFSA 3MLRH 4PTTB 2QR0B 4MCZB 4M8RA 4NAMA 1OQXA 3UCRA 1CICD 1RK0B 5KS9A 1Q9LB 1W2KT 3RUGF 3QWRD 1S8DB 4FQIL 1XGUA 1R3HA 1S7XB 2BNRE 5DD1H 1EO8H 3ARBA 1HEHC 2RJMA 3ULVC 4J6IA 3RG1C 1FC1A 1GOGA 1A6VL 1LDPL 4HUMB 5AKVA 1I1CA 5BVPH 2XXCB 2QQQA 1UKTA 1O6SA 1DQJB 2AJVH 5EZIL 4IKNA 3UZEA 3MO1A 3TWYA 1K2DA 2VAAA 3B7YA 4LSPL 3RWHB 4FLSA 5JW4N 2X4QB 2MWCA 2UY7A 1QWNA 1E4JA 1U8QB 1RZKC 3BN9D 3PP4L 1IC1A 3ZDZE 2AI0H 4XBGB 3FCSA 4UT7H 2ITEA 5IESL 4N25A 4Y4KC 2QSVA 3KS0H 4AQEA 5F89B 5KZCD 3MYJB 2KZ1B 4QO1B 2PPCA 5IB4A 4OJYA 2ZOWA 3EOYG 5HSFA 4DGIH 3AXLA 4IBVA 4PRBA 1AZVA 2XX0A 2OMUA 1PY9A 4NC1C 4NRZB 4NO2A 2N0KA 4FG4A 4I3RL 5JW4M 4KROD 2HKFL 1XZ0B 3RWHA 1ZEAH 1A7OH 1AFVH 1HI6B 4NHUA 5AW0B 3WKYA 1GAFL 1UZ8B 1FRGL 1AFVL 5EU7C 4NAJA 2D7TH 1JPTL 3QIBA 2JTDA 4F7EA 3LPOA 3ZRCC 3TVMD 1GZPB 1RZKL 3GMLB 2VXTH 5JTWA 1J0ZA 3DGDA 4DGIL 4UTBA 1ZHKA 1LO3H 4F7CB 3KYNB 5EOCJ 2R9HC 4CSTA 3ORJA 2E27H 2R56L 3T0XA 2F7QA 3WS6C 3WUWG 1XSKA 2YQ3A 1X7TA 2N7BA 5AAWC 4XP6L 3ATBA 2NY2D 4PJAF 5MI0B 3FQUA 3T65B 5KN5A 4G6FD 4PJ5A 1X9QA 2DTML 4OM0L 2H3XC 1P7QB 3FU0A 3V0IA 4EVNB 2CK0H 4AQ1C 5DR5L 3ARDA 1MCCA 4GG6E 1C7SA 3TH2T 4MQXD 3H7LA 2PLTA 3KGSA 3VXRD 3EGDB 1OAYH 3U6RA 4LHUD 4Z7NB 2ATAA 1A6VH 4R4FH 3V0FA 1BVOA 3MI6A 3KDMB 1MFNA 3BSZA 4JZJC 5CJOH 1MI5D 2X3AA 3NJJA 2YPLE 5DWUH 3SBQA 3CU1A 3ZE2B 1VIWA 2BNRD 1I7TB 3RBSA 3SOTA 3PGCA 3W11D 1ZGLA 3SQBA 3DIFA 3GMRA 1FVCA 2B4CC 4JFZH 2R4SH 4KNTA 3BISA 5F7FA 5C0CD 1JPTH 1CF8L 4MAUH 3QUYA 4MRCA 2DIAA 1WAAA 4J8RB 3LIZH 4YAQB 1YUKB 4NBZB 4A2MA 3TL5A 2Y2WA 3BKML 4NP9A 5GSVB 2XKNA 2AQ3A 2VXQL 1P2CB 3EGDA 5CIPA 3TURA 2B1HH 3ZDXF 3MRQB 4KY2A 2VSDA 3L3OB 1G9MC 2NTFB 2ISDA 1CR9H 4HCRA 3P0YL 5TDPA 2DLGA 5HDWA 2CGYA 1ECZA 2KLRA 2LU4A 1FLRL 3BUIA 5EBGA 3DBXB 1BWMA 2X6VA 3I3BA 4UT7L 4YHZH 4O9HL 1OTTD 3BEVA 3MV9B 5DS8B 3FF8A 3WMPA 1G6RH 3CLFL 1ADQL 5I0ZA 5AB2A 3QIUA 4YDZA 2WXLA 1CLOH 2VXSL 4FE9A 1TZOA 1J86A 1X9UA 3BH9A 4O2FB 4OR1A 1U8KA 2R7EA 1DLHA 1LQBC 3LD8C 3V6FB 2UX6A 2B3RA 4GAFB 4QHMA 5C92A 5CEZL 1FGVH 2WQUA 2OX5B 3S6CA 1RP9A 4X5QA 1F90L 5FGSA 1NCAL 2BOCA 1IGCL 1CE1H 4GKZA 1ACYL 3HLAA 3RKPA 1RKRA 4ETQA 1FFRA 1LM8V 5BW7C 3QI9C 3N9GL 5I6LA 3D9AL 2H0PA 1UURA 3PV6B 5DO2C 3L7EB 2BM3A 2LABA 3FCTB 1LE5A 3VGAB 5FYJH 3QR1A 3FTSA 4X99B 2IO5A 5DJ0B 2JXMA 4G83A 4KI5E 2HG5B 1UVQB 2FZ3A 4GBXD 1M05B 4U1MB 5FF6A 5BUPA 3C08L 5DF0A 4LVNC 3ZHDA 3DI3B 3MV9D 4PJ7E 3CVHL 1IM9B 4QGYA 3RWEB 2Y69B 4QIRA 4WHYH 3WFBH 3SDCD 4AL8L 2R1YA 5JYLA 2PPFA 3LS5H 3UX9B 3DWTA 4Q14A 3WLBA 5E24E 2WBJA 2AK4A 4PJXA 1T1WA 1E4KA 3O4LA 2FIKA 4X4KA 1SGKA 1JHKH 1YZZA 2ZXEB 5DC9B 3SJVD 3BIBX 1EBAA 1XH3A 4XP9L 5KUMA 1RULH 4YGAB 5T1DH 1MVYA 3LQZA 3QJHA 2DI8A 4PTUA 1LEKB 3I2CL 4MD5A 1SJXA 2CJ3A 4RAHA 4EE2A 2FATL 3GMNA 5DFVD 4QJ5B 3H54A 3QPXL 1CQKA 1TT6A 1TQSA 4K5MA 1RJZA 4PJGA 2DYSB 4LHUG 4XMLL 5FYJD 3K72B 1F3RB 1K4CB 3GSNH 3GSRB 2PYFA 1U3JA 1NC2A 1JZ3A 4GYBA 3B34A 3F6IA 4LCWD 5JORB 4JFWA 3S0PA 1NPUA 4GBXC 1A6TB 1QUNA 4XOBA 5DJAA 1MREH 3VFOB 1VGKB 5LNDA 5DEJA 3U9PH 3QJFB 1ZHBA 3OD3A 1HKFA 5EEZA 1G7LA 4L4VB 2X88A 5B22A 1Z1WA 4BKTC 3ARPA 3D85B 4W9FC 2H6PA 3TA3B 1PW3A 2NY7L 2VUYA 3OZ9L 4XMKH 1UJ3C 2OL3H 3GXIA 3NH7L 4NM8H 5F7EL 4XGZB 4M6NH 4X5XA 1F97A 4YDKL 4AGNA 3BQUD 4E9XA 1I4FA 1GZHA 3PV6A 3MREA 2FUTA 4IRSB 2ZKHH 4LCCB 5BUAA 5EWIL 3BMWA 2EXWC 3SYQA 5DFWH 1IL1A 5I30H 2IIJA 3HMXA 3QQ9C 3E9TA 5CN2A 5C0DA 1KJMB 3RGHA 3ZDZB 3WENA 4GUQA 2R2HA 1JPST 2OAAA 1KJ2L 2CBQA 4C59B 1KUMA 1JYVA