2F09A

Solution structure of the gene product of e. coli gene ydha
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
82
structure length
82
Chain Sequence
b'MQTDTLEYQCDEKPLTVKLNNPRQEVSFVYDNQLLHLKQGISASGARYTDGIYVFWSKGDEATVYKRDRIVLNNCQLQNPQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein ydhA
publication title The solution structure of the Escherichia coli gene product ydhA.
rcsb
source organism Escherichia coli k12
molecule tags Structural genomics, unknown function
total genus 12
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2005-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09864 MliC Membrane-bound lysozyme-inhibitor of c-type lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.200 Mainly Beta Beta Barrel Lipocalin Lipocalin 2f09A00
4ML7B 4MIRA 3OE3A 4MISA 2F09A 3F6ZB
chains in the Genus database with same CATH superfamily
4TKJA 1HQQA 1RAVA 4BVMA 2KW1A 4INNA 1OPBA 4CPFA 4KH8A 1K3BA 4DCBA 4YGHA 3WZNA 2JU3A 3SZHA 3VU1A 1PM1X 1BSYA 1QWDA 2RCTA 3GAQA 4MVEA 3WOVA 1VYFA 4GGRA 1KL4A 1E02A 2RTFB 3FMZA 3UEUA 2G5LA 4CDCA 2QCBA 3CBSA 4BX5A 3QQ2A 1TOWA 4BX6B 1SRHA 4CDFA 1ERBA 1SWEA 3FELA 3RDSA 3X00A 1KT7A 4EKVA 1ERXA 2LKKA 4OELA 3EMMA 1CJ5A 3NBXX 1JZUA 3VG6A 1E00A 1GXAA 1NP1A 2IZJA 4QGVA 2IZKA 4MVIA 4Z27A 4ZR2A 2CZUA 2L9CA 1HY2A 4BX7B 1SLGB 1N7YA 3WJCA 1MM9A 4HFOA 2A3FX 2X4MA 4IB8A 2GJ5A 2M4LA 2RQ0A 3VHHA 1ZNHA 2LA7A 2MF6A 2NNEA 1GM6A 5LJDA 4EEJA 1KGLA 4O3XB 4ZHHA 4EXZA 1GX3A 1ZNGA 5F1EA 3FW5A 1AVEA 3FA9A 4OMXA 5D48A 4TQ2A 1NGLA 1VWMB 1K24A 1IFCA 1UZ2X 4YDBA 2RA6A 2QO6A 2VFCA 4MVKA 3CKFA 1X8PA 1TW4A 4TKBA 3FYFA 3BDRA 4TNNA 3ZUIA 2JGSA 4QYNA 5F6ZA 3HPEA 4OEMA 2OY7A 2A8GA 1VWHB 1MOYA 2R56A 2RCQA 3T2WA 3O19A 3STNA 2RTMA 5FENA 1SLEB 3BS2A 3S5VA 4RUUA 1BBPA 1LCWA 1GT5A 1FTPA 1EW3A 4MVLA 1AQBA 3O2YA 3ZW0A 2JN3A 3Q6LA 4BCSA 2FR2A 2I5ZO 1ICMA 1U18A 3ELXA 2N93A 1IJ8A 1OBUA 1I06A 1QG5A 2KTDA 3OJYC 4O49A 4YGGA 1A57A 4A1YA 5H9LA 1WBIA 1CBRA 1YUPA 2NP1A 1ICNA 2OFAA 2YG2A 4WBKA 2QO5A 1QFVA 1W5RA 1LDQA 3HWGA 2CM4A 4ORYA 2VFBA 1OSPO 4QZTA 1HXZA 1LF7A 2LB6A 4O4SA 4KIIA 1GT1A 4WFUA 5B27A 2K23A 3ZW2A 1BSOA 5DPQA 1X8UA 4ORXA 4ID2A 2A13A 3JQOA 3ZZVA 4YVBA 4ALBA 2OFRX 1STPA 1HQPA 2WPUA 3NP1A 5FAZA 1SWUA 2FGSA 3VGWA 4EFGA 4O3ZA 4GDZA 4TLJA 3U0DA 4HPDA 1VYOA 1SRFA 3EYCA 5JD2A 2FKJA 2HNXA 1SLDB 4A8ZA 1GGLA 1BLRA 1OEKA 1FE3A 3LHNA 2Y3EA 4EDEA 3U9PC 1YWCA 2ALLX 4NV8A 5LJEA 1BM5A 1KL5A 3FLLA 4Y0RA 2ASNX 5F2BA 4ZHFA 4FQBB 1BJ7A 1XCAA 5HCCC 1QFTA 1SY2A 2IFBA 1T68X 3KFGA 4NLJA 1SXWA 3ZW0B 5CE4A 2RTEB 2ACPX 3P24A 5H8TA 1SY0A 1SY3A 3MX7A 4M7MA 3T6LA 4BX6A 4ZHCA 3HWFA 4GJSA 2AH7X 3CQNA 2MO5A 5D8JA 1B8EA 2A2GA 2ZAGA 3HK1A 3BX8A 4Z28A 1SRIA 2G79A 3NR3A 4XMDA 1MK5A 4DQ4A 3T2XA 2OF9A 1QQSA 3MVFA 5IO7A 4HPBA 2GTFX 4I6SA 5HA1A 1E06A 3PPTA 4LQZA 5B2AO 1HXLA 5AQ6A 1LIBA 4Y5DA 1JJUA 1IFBA 3G7XA 2C1SA 2C4IA 4PSQA 4QRLA 4UU2A 3WJEA 5EEDA 1NC9A 1YIVA 4OMWA 4GE1A 4BOEA 4UU3A 4ZFXA 2A2UA 2KTSA 3ZUOA 1VWOB 4NNSA 5LJGA 3RY1A 1E5PA 1FENA 2P8GA 1Y0GA 1KQWA 2ANSA 2RTGB 4ZH9A 2R74A 3NQ3A 3ZWEA 1SWSA 3FENA 3WVMA 3GE2A 3RE6A 2AT5X 4ON1A 2UZ2A 1UYOX 5HZ9A 1FEMA 4NP1A 3I17A 1OBQA 2AT6X 3C77X 2NNQA 2X46A 4N7CA 1GKAA 1UREA 4WHIA 1SWRA 5B5FA 3APWA 1SWAA 1TXLA 4B55A 2RTQB 5LJKA 1P6PA 4GGZA 3TZSA 4MISA 4KCAA 2IZAA 1DZMA 2LFOA 3CKGA 3NQKA 4LZUA 2GTLM 1SWHA 2E4JA 3BU1A 4QYPA 2IZGB 2OFBA 3APUA 1SWQA 4U8UM 1QABE 2Z4HA 4QNIA 3RDOA 1G85A 1SWCA 3OE3A 5CHKA 1KT6A 3HWDA 5K67A 3HWEA 3PK2A 4I9RA 1N9MA 4O9SA 3P02A 3ZI8A 2OVEA 2AL0X 3D96A 3FIDA 1HN2A 4M6SA 2F01A 3DSZA 3N91A 2WR6A 1VWNB 4PJ2A 4BQUA 4CDEA 4QGWA 4TJZA 2BC3A 2RTDB 4AZQA 2L68A 2MHDA 3B2KA 1SWPA 3JS1A 4Z6JA 3D4RA 3SLJA 3NX1A 1VWJB 3EBKA 4NNTA 3VG4A 1EIIA 4JO6A 4GK9A 4Z2VA 3F6ZB 3RDMA 3P6FA 3CMPA 1ZNLA 4A60A 4CK4A 1SWLA 4XMHA 5JR8A 4XMCA 3VPJE 1B4MA 2IZDB 3WZOA 1MUPA 1G5WA 1N0SA 3NQ9A 1RXJA 3NPOA 5B29A 3KFHA 1VWAB 3VE2A 1OBPA 3TGBA 3FDCA 2L67A 1GKAB 3PQSA 3FA6A 1TOUA 5HTEA 1KZWA 2X8TA 4AZPA 1YWAA 2X8SA 4ZH6A 4LKPA 4ORRA 5C0NA 1BSQA 5L3YA 1JJXA 1YP6A 3PDFA 4U8UN 3PECA 1X71A 3TF6A 2AT8X 1SXUA 3QKGA 2XSTA 5H9AA 1GT3A 2CM9A 2IZLB 4HPCA 4NYQA 4QGXA 2VDFA 3S5XA 1S44A 1B56A 2L5PA 2AF5A 3VHMA 3O22A 2Q39A 4IAWA 4JNJA 1Z24A 4ZHDA 1LKEA 5HZ5A 5F6BA 3APVA 4JHQA 5F58A 4ZGFA 3PQUA 1EALA 2HLVA 4GGTA 1OEEA 1S2PA 4IMOA 2DM5A 5D47A 3C78X 4JGLA 1SREA 1LPJA 2IZIA 2JOZA 2GC9A 2OVAA 4YKOA 1HMRA 2WEWA 4IBAA 3KFFA 3SLTA 3PH5A 3CWKA 4AZRA 1ALBA 1LDOA 1AVGI 1JV4A 3FW4A 2QOSC 1HMSA 4O3WA 2MJIA 2F73A 2Y3FA 2AT0X 2OF8A 4IB6A 1ML7A 1ZNEA 4Y0QA 4KT5A 1SWFA 4L1NA 4RUNA 1KT4A 2JW1A 3P6EA 1NBXA 2RD7C 4GU8A 4XMGA 3AEHA 3B2IA 1O1UA 1OEJA 2R73A 2BLGA 3SZJA 4DQ3A 3F9DA 3BLGA 5EDBA 1EPAA 3WZQA 2FS6A 4YFQA 4I95A 5B5GA 1B0OA 2X55A 3RZYA 2OY8A 1MEPA 5EPQA 1A2DA 1T8VA 1VWQB 2OYBO 1Y9LA 4CPIA 1IKJA 1MX8A 1SWKA 5AEOA 2Q9SA 5EEEA 1BWYA 1RBPA 2FLJA 2HKDA 4IMNA 1IKEA 5EZ2A 3UEWA 2ZSCA 1VWKB 1N43A 1KT5A 2JU8A 3UEVA 1SXXA 5HCDC 5HTDA 1VWEB 3EC5A 4ARHA 2WEXA 4OKAA 4QZUA 5CSEA 1JQPA 1KFFA 1SWBA 1X8NA 3E3CA 2W2FA 4HWMA 3ZW1A 1CBSA 3FR5A 3HOLA 4GH7A 1D3SA 3D95A 2Q4NA 3WBGA 4A1HA 1I78A 4CDDA 2OL7A 2RTIB 1LIDA 2Q2MA 1R0UA 5HZQA 4YFRA 3RDQA 2QMIA 1FDQA 2RTCB 4Z2PA 4AYHA 4GUZA 5K06A 1SXYA 4ML7B 1DFVA 1BRPA 3SLOA 3WJGA 2HZQA 1RXKA 3RY2A 1LCVA 2BHVA 4BBOA 5LJBA 2F09A 5B3MO 1JYJA 3KFIA 1NP4A 1DF8A 3WJBA 4D6BA 2MM3A 4EQAC 3MBTA 1DZJA 1E2TA 1KL3A 1SLFB 2A5BA 3CBCA 3SAOA 3SZIA 1Y55X 3VG7A 1SWDA 5HA0A 5K68A 1KZXA 1QY0A 2W2AA 4D6AA 1VWFB 1SA8A 2CAMA 3FR2A 2RTJA 2G8CO 3FEKA 1X8QA 4ALOA 1SWNA 3SOTA 2AT3X 1OPAA 1A18A 2FT9A 1VWGB 3B2HA 2IZHB 4FBRA 1DF3A 1HMTA 2DJGA 4ODDA 1XKIA 4U3QA 4ES7A 1IW2A 2WWPA 1VWPB 2IZEB 2RTLA 1NQMA 1VWDB 3FEPA 1T0VA 4Y59A 4CPHA 1MVGA 4I3BA 1FELA 5FQ7E 5BVQA 1VPRA 3ZW1B 1VWCB 2C1QA 3KQ0A 2Z4IA 2RTAA 5BVTA 1ZNDA 2K62A 4BJ8A 3CQRA 1NQNA 1ZRYA 1X89A 4XMEA 2GTLO 3OBLA 1DZPA 1JYDA 4U8UO 3APXA 3UEXA 3WYQA 1GX9A 5BVSA 5IRWA 2CZTA 4OS0A 5FQ8E 5HCEC 2WSJA 2YMSA 3AKNA 4NW4A 1EPBA 4YGZA 3C76X 5EDCA 3RE5A 5BYPA 1CRBA 4AZOA 1EI5A 2OY1O 4IABA 5LKEA 1EIOA 2UYWA 3B2LA 3NX2A 2KD2A 2QO4A 2FHLA 4WFVA 3D9WA 5HZ6A 4R0BA 4ZJ0A 4K19A 4OS8A 3RKGA 5KICA 1GT4A 1IIUA 3JSQA 1JJJA 1WUBA 1LUQA 1SY1A 2RTRB 2XKLA 3K3LA 4I3DA 5HBSA 3WXQA 3ZQ3A 3BRNA 1DC9A 4QQ1A 1TVQA 4FBVA 3RSWA 1KQXA 4L3RA 4XMFA 5HAEA 4NLIA 1JIWI 1LIFA 2RTKA 4ORUA 3WJFA 2KT4B 2HMBA 3H3IA 4YH0A 1HBPA 1STRB 4ZGUA 1QY2A 2FR3A 4ORWA 1RSUB 4ZHGA 5IO5A 3WZPA 1H91A 2GTLN 4I60A 2W2BA 3WYPA 2A0AA 4CPHB 3U03A 4YDAA 5HZ8A 1DZKA 1SRGA 4O4UA 3VHIA 1I04A 2CBSA 5AJBA 4CPEA 2WQAE 3WJDA 5IO6A 1MDCA 4YBPA 3L4RA 2G7BA 3MM0A 5KHPA 3HTYA 3NADA 4GD9A 4Z2OA 1BRQA 1CBQA 3VG3A 1ADLA 4YMYA 2HYSA 4Y0SA 4YCEA 5LJHA 1PEEA 1QY1A 1O8VA 1VWRB 4I9SA 1S7DA 2LBVA 2FS7A 4LKTA 3BY0A 3I0AA 2RN4A 1PBYA 3PP6A 5D45A 2IZBA 2OFMX 3CR6A 1VWBB 3LTWA 5H9NA 1SWGA 2RTPB 1KOIA 3EW2A 1G74A 4KC7A 5IXGA 1ZNKA 2WUTA 1Y53X 1U17A 2BT9A 5LKFA 4BX5B 1UYNX 1KXOA 1O1VA 1PMPA 3AKMA 4YFPA 4CSBA 5L8NA 1RLBE 1JMXA 4MIRA 1BEBA 1W4TA 1YWDA 3B2JA 1I05A 1I9HA 2OZQA 4U46A 5HWZA 4IRWA 4GKCA 4ORSA 2X34A 3MG5A 4IB7A 3PEDA 3AUMO 1LFOA 3F8AA 3PH6A 4MEEA 3T1DA 3TGAA 3VG5A 1NDJA 4YCHA 2FTBA 5B11O 4QAEA 4YBUA 3RWXA 3D97A 1X8OA 3IFBA 4DNEA 3P6HA 3LV4A 2AKQA 3FR4A 2EU7X 5CYBA 1JBHA 4GNYA 1EXSA 2BSZA 3Q34A 5DG4A 1W6FA 1YP7A 2ACOA 4U9CA 4AW8A 1DV9A 3ELZA 2OL8O 2WQ9A 2FHNX 2BS6A 2PI3O 2O62A 4HPAA 3V8UA 4CV7A 3EW1A 2FWVA 1EQDA 3HOEA 4FGIB 4COTA 5L8OA 1HBQA 2X32A 4O3YA 2OY5O 4BGFA 4FBOA 3FA7A 1STSB 3S60A 2IZCB 2Y32A 4Y0PA 5IRAA 1VYGA 3P6DA 4AZMA 1EUOA 1SWJA 2I5VO 3KZAA 1LELA 1I4UA 5H9KA 2NNDA 3T6FA 5KIDA 1PBOA 3IA8A 1Y52X 1VWLB 2FKGA 2MWHA 4GJVA 3RDUA 1AVDA 3STMX 1SWTA 4YKMA 4GZVA 1RXHA 1MX7A 4C5PA 2RTHB 1LIEA 3FA8A 5B10O 3STKA 1Y9TA 1AB0A 1LICA 2JMBA 3OD9A 2PY1A 1PTSA 2IZFB 3VE1A 2HZRA 3BU9A 4NV7A 4AZNA 5L8IA 2ZAIA 4IB9A 3P6GA 1GX8A 1A3YA 3S26A 1RSTB 1CBIA 2AVIA 5AJCA 4GRJA 2X8FA 4GDAA 2OVSA 4IAXA 1LNMA 4NYRA 2AMMX 3DTQA 4TKHA 4KC8A 5D4AA 4OS3A 5F7GA 4GETA 2RTNB 3RDXA 2CBRA 1SWOA 1VWIB 1U0XA 2RTOB 1SMPI 1ACDA 4BX7A 4ZCBA 1FJ1E 3UAQA 1JMZA 2G78A 2GH7A 1N9YA 2LBAA 2A5CA 3TGCA 1KT3A 5FFHA 2X56A 2RTBB 3RBYA 2Q2PA 3BSZE 3FIQA 5FQ6E 2JU7A 2OVDA 4O4OA 1L6MA 4I3CA 3BX7A 4N7DA 2BS5A 3KVNA 1YWBA 4LZVA 1LCZA 1N4JA 2FRSA 2POAA 1D2UA 1G7NA 3EBWA 3EM0A 2QOMA 3P6CA 1SRJA 2OL6O 3VG2A 4O4XA 2X45A 5LJCA 5IRUA 4GNWA 2DJFA 2QM9A 1AELA
chains in the Genus database with same CATH topology
4TKJA 4BVMA 2KW1A 4INNA 1OPBA 4KH8A 4YGHA 2JU3A 3VU1A 1PM1X 1BSYA 1QWDA 2RCTA 3GAQA 4MVEA 3WOVA 1VYFA 3UEUA 1E02A 3FMZA 3CBSA 1TOWA 1ERBA 3FELA 1KT7A 1ERXA 2LKKA 3EMMA 1CJ5A 3NBXX 1JZUA 3VG6A 1E00A 1GXAA 1NP1A 4QGVA 4MVIA 4ZR2A 2CZUA 2L9CA 3WJCA 4HFOA 2A3FX 4IB8A 2GJ5A 2M4LA 2RQ0A 1ZNHA 2LA7A 2NNEA 1GM6A 5LJDA 4EEJA 1KGLA 4O3XB 4ZHHA 4EXZA 1ZNGA 5F1EA 3FW5A 3FA9A 4OMXA 5D48A 4TQ2A 1NGLA 1IFCA 1UZ2X 4YDBA 2RA6A 2QO6A 4MVKA 1X8PA 1TW4A 4TKBA 3FYFA 3BDRA 4TNNA 3ZUIA 4QYNA 5F6ZA 2R56A 2RCQA 3O19A 3STNA 5FENA 3BS2A 3S5VA 4RUUA 1BBPA 1GT5A 1FTPA 1EW3A 4MVLA 1AQBA 3O2YA 3ZW0A 2JN3A 3Q6LA 2FR2A 1ICMA 1U18A 3ELXA 2N93A 1OBUA 1I06A 1QG5A 2KTDA 3OJYC 4O49A 4YGGA 1A57A 4A1YA 5H9LA 1CBRA 1YUPA 2NP1A 1ICNA 2YG2A 4WBKA 2QO5A 1QFVA 3HWGA 2CM4A 4ORYA 4QZTA 1LF7A 2LB6A 4O4SA 4KIIA 1GT1A 4WFUA 5B27A 2K23A 3ZW2A 1BSOA 5DPQA 1X8UA 4ORXA 4ID2A 2A13A 3JQOA 3ZZVA 4ALBA 2OFRX 3NP1A 1HQPA 5FAZA 4EFGA 4O3ZA 4GDZA 4TLJA 3U0DA 4HPDA 3EYCA 2HNXA 4A8ZA 1GGLA 1BLRA 1OEKA 1FE3A 3LHNA 4EDEA 3U9PC 1YWCA 2ALLX 1BM5A 5LJEA 3FLLA 4Y0RA 2ASNX 4ZHFA 4FQBB 1BJ7A 1XCAA 5HCCC 1QFTA 1SY2A 2IFBA 1T68X 3KFGA 4NLJA 1SXWA 3ZW0B 5CE4A 2ACPX 3P24A 5H8TA 1SY0A 1SY3A 3MX7A 4M7MA 4ZHCA 3HWFA 2AH7X 3CQNA 2MO5A 5D8JA 1B8EA 2A2GA 2ZAGA 3HK1A 3BX8A 2G79A 3NR3A 4XMDA 4DQ4A 1QQSA 3MVFA 5IO7A 4HPBA 2GTFX 4I6SA 5HA1A 1E06A 3PPTA 4LQZA 5AQ6A 1LIBA 4PSQA 1IFBA 3G7XA 4QRLA 3WJEA 4UU2A 5EEDA 1YIVA 4OMWA 4GE1A 4BOEA 4UU3A 4ZFXA 2A2UA 2KTSA 3ZUOA 5LJGA 4NNSA 1E5PA 1FENA 2P8GA 1KQWA 2ANSA 4ZH9A 2R74A 3NQ3A 3ZWEA 3FENA 3WVMA 3GE2A 2AT5X 4ON1A 5HZ9A 1FEMA 4NP1A 3I17A 1OBQA 2AT6X 3C77X 2NNQA 2X46A 4N7CA 1GKAA 1UREA 4WHIA 3APWA 1TXLA 5LJKA 1P6PA 3TZSA 4MISA 4KCAA 1DZMA 2LFOA 3NQKA 4LZUA 2GTLM 2E4JA 3BU1A 4QYPA 4U8UM 3APUA 1QABE 2Z4HA 4QNIA 1G85A 3OE3A 1KT6A 3HWDA 3HWEA 4I9RA 4O9SA 3P02A 3ZI8A 2OVEA 2AL0X 3D96A 1HN2A 4M6SA 4PJ2A 3DSZA 3N91A 2WR6A 4BQUA 4QGWA 4TJZA 4AZQA 2L68A 2MHDA 3B2KA 3JS1A 3D4RA 3NX1A 3EBKA 4NNTA 3VG4A 1EIIA 4GK9A 3F6ZB 3P6FA 3CMPA 1ZNLA 4A60A 4CK4A 4XMHA 5JR8A 4XMCA 3VPJE 1B4MA 1MUPA 1G5WA 1N0SA 3NQ9A 3NPOA 5B29A 3KFHA 3VE2A 1OBPA 3TGBA 2L67A 1GKAB 3PQSA 3FA6A 1TOUA 5HTEA 1KZWA 2X8TA 4AZPA 1YWAA 2X8SA 4ZH6A 4LKPA 4ORRA 5C0NA 1BSQA 1JJXA 1YP6A 4U8UN 3PECA 1X71A 3TF6A 2AT8X 1SXUA 3QKGA 2XSTA 5H9AA 1GT3A 2CM9A 4HPCA 4NYQA 4QGXA 3S5XA 1S44A 1B56A 2L5PA 3O22A 2Q39A 4IAWA 4ZHDA 1Z24A 1EALA 1LKEA 5F6BA 3APVA 5F58A 4ZGFA 3PQUA 2HLVA 1OEEA 1S2PA 4IMOA 2DM5A 5D47A 3C78X 4JGLA 1LPJA 2JOZA 2GC9A 2OVAA 4YKOA 1HMRA 2WEWA 4IBAA 3KFFA 3PH5A 3CWKA 4AZRA 1ALBA 1AVGI 1JV4A 3FW4A 2QOSC 1HMSA 4O3WA 2MJIA 2F73A 4IB6A 2AT0X 4Y0QA 1ML7A 1ZNEA 4KT5A 4RUNA 4L1NA 2JW1A 1KT4A 3P6EA 2RD7C 4GU8A 4XMGA 3B2IA 1O1UA 1OEJA 2R73A 2BLGA 4DQ3A 3F9DA 3BLGA 5EDBA 1EPAA 2FS6A 4YFQA 4I95A 1B0OA 3RZYA 5EPQA 1A2DA 1T8VA 1Y9LA 5AEOA 1IKJA 1MX8A 2Q9SA 5EEEA 1BWYA 1RBPA 2FLJA 5EZ2A 4IMNA 1IKEA 3UEWA 1KT5A 2JU8A 3UEVA 1SXXA 5HCDC 5HTDA 4ARHA 2WEXA 4QZUA 1X8NA 3E3CA 3ZW1A 4HWMA 2W2FA 1CBSA 3FR5A 3HOLA 4GH7A 1D3SA 3D95A 2Q4NA 3WBGA 4A1HA 1LIDA 2Q2MA 1R0UA 5HZQA 4YFRA 2QMIA 1FDQA 4AYHA 5K06A 1SXYA 4ML7B 1DFVA 1BRPA 3WJGA 2HZQA 2BHVA 5LJBA 2F09A 1JYJA 3KFIA 1NP4A 3WJBA 4D6BA 2MM3A 4EQAC 3MBTA 1DZJA 3CBCA 3SAOA 3VG7A 5HA0A 1KZXA 1QY0A 2W2AA 4D6AA 1SA8A 3FR2A 3FEKA 4ALOA 1X8QA 3SOTA 2AT3X 1OPAA 1A18A 2FT9A 3B2HA 4FBRA 1DF3A 1HMTA 4ODDA 1XKIA 4U3QA 4ES7A 1IW2A 2WWPA 3FEPA 1T0VA 1MVGA 4I3BA 1FELA 5FQ7E 5BVQA 1VPRA 3ZW1B 3KQ0A 2Z4IA 5BVTA 1ZNDA 2K62A 3CQRA 1ZRYA 1X89A 4XMEA 2GTLO 3OBLA 1DZPA 1JYDA 4U8UO 3APXA 3UEXA 1GX9A 5BVSA 2CZTA 4OS0A 5FQ8E 5HCEC 2WSJA 2YMSA 3AKNA 4NW4A 1EPBA 4YGZA 3C76X 5EDCA 5BYPA 5LKEA 1CRBA 4AZOA 1EI5A 4IABA 1EIOA 3B2LA 3NX2A 2KD2A 2QO4A 4WFVA 5HZ6A 4R0BA 4ZJ0A 4K19A 4OS8A 3RKGA 5KICA 1GT4A 1IIUA 3JSQA 1JJJA 1SY1A 2XKLA 3K3LA 4I3DA 5HBSA 3WXQA 3ZQ3A 3BRNA 1DC9A 4QQ1A 1TVQA 4FBVA 3RSWA 1KQXA 4L3RA 4XMFA 5HAEA 1JIWI 1LIFA 4ORUA 3WJFA 2KT4B 2HMBA 3H3IA 4YH0A 1HBPA 4ZGUA 1QY2A 2FR3A 4ORWA 4ZHGA 5IO5A 1H91A 2GTLN 2W2BA 2A0AA 3U03A 4YDAA 5HZ8A 1DZKA 4O4UA 1I04A 2CBSA 5AJBA 2WQAE 3WJDA 5IO6A 1MDCA 4YBPA 3L4RA 2G7BA 5KHPA 3HTYA 3NADA 1BRQA 1CBQA 3VG3A 1ADLA 4YMYA 2HYSA 4Y0SA 4YCEA 5LJHA 1PEEA 1QY1A 1O8VA 4I9SA 2LBVA 1S7DA 2FS7A 4LKTA 3BY0A 3I0AA 2RN4A 3PP6A 5D45A 2OFMX 3CR6A 5H9NA 1KOIA 1G74A 4KC7A 1ZNKA 2WUTA 1U17A 2BT9A 5LKFA 1KXOA 1O1VA 1PMPA 3AKMA 4YFPA 4CSBA 5L8NA 1RLBE 4MIRA 1BEBA 1YWDA 3B2JA 1I05A 2OZQA 5HWZA 4GKCA 4ORSA 4IB7A 3PEDA 3T1DA 1LFOA 3F8AA 3PH6A 3TGAA 3VG5A 4YCHA 2FTBA 4QAEA 4YBUA 3RWXA 3D97A 1X8OA 3IFBA 3P6HA 3LV4A 2AKQA 3FR4A 2EU7X 5CYBA 1JBHA 4GNYA 1EXSA 5DG4A 1YP7A 2ACOA 4U9CA 4AW8A 1DV9A 3ELZA 2WQ9A 4HPAA 2BS6A 4CV7A 2O62A 3V8UA 4COTA 2FWVA 1EQDA 3HOEA 4FGIB 5L8OA 1HBQA 4O3YA 4FBOA 3FA7A 3S60A 4Y0PA 4AZMA 1VYGA 3P6DA 1EUOA 3KZAA 5H9KA 1I4UA 2NNDA 5KIDA 1PBOA 3IA8A 2MWHA 3STMX 4YKMA 4GZVA 1MX7A 1LIEA 3FA8A 3STKA 1Y9TA 1AB0A 1LICA 2JMBA 3OD9A 2PY1A 3VE1A 2HZRA 3BU9A 4AZNA 5L8IA 2ZAIA 4IB9A 3P6GA 1GX8A 1A3YA 3S26A 1CBIA 5AJCA 4GRJA 2X8FA 2OVSA 4IAXA 1LNMA 4NYRA 2AMMX 3DTQA 4TKHA 4KC8A 5D4AA 4OS3A 5F7GA 4GETA 2CBRA 1U0XA 1SMPI 1ACDA 4ZCBA 3UAQA 2G78A 2LBAA 3TGCA 1KT3A 5FFHA 3RBYA 2Q2PA 3BSZE 3FIQA 5FQ6E 2JU7A 2OVDA 4O4OA 1L6MA 4I3CA 3BX7A 4N7DA 2BS5A 1YWBA 4LZVA 2POAA 3P6CA 2FRSA 3EBWA 1D2UA 1G7NA 3EM0A 4NLIA 5HZ5A 3VG2A 4O4XA 2X45A 5LJCA 4GNWA 2QM9A 1AELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ML7 B;  4MIR A;  3OE3 A;  4MIS A;  2F09 A;  3F6Z B; 
#chains in the Genus database with same CATH topology
 4TKJ A;  1HQQ A;  1RAV A;  4BVM A;  2KW1 A;  4INN A;  1OPB A;  4CPF A;  4KH8 A;  1K3B A;  4DCB A;  4YGH A;  3WZN A;  2JU3 A;  3SZH A;  3VU1 A;  1PM1 X;  1BSY A;  1QWD A;  2RCT A;  3GAQ A;  4MVE A;  3WOV A;  1VYF A;  4GGR A;  1KL4 A;  1E02 A;  2RTF B;  3FMZ A;  3UEU A;  2G5L A;  4CDC A;  2QCB A;  3CBS A;  4BX5 A;  3QQ2 A;  1TOW A;  4BX6 B;  1SRH A;  4CDF A;  1ERB A;  1SWE A;  3FEL A;  3RDS A;  3X00 A;  1KT7 A;  4EKV A;  1ERX A;  2LKK A;  4OEL A;  3EMM A;  1CJ5 A;  3NBX X;  1JZU A;  3VG6 A;  1E00 A;  1GXA A;  1NP1 A;  2IZJ A;  4QGV A;  2IZK A;  4MVI A;  4Z27 A;  4ZR2 A;  2CZU A;  2L9C A;  1HY2 A;  4BX7 B;  1SLG B;  1N7Y A;  3WJC A;  1MM9 A;  4HFO A;  2A3F X;  2X4M A;  4IB8 A;  2GJ5 A;  2M4L A;  2RQ0 A;  3VHH A;  1ZNH A;  2LA7 A;  2MF6 A;  2NNE A;  1GM6 A;  5LJD A;  4EEJ A;  1KGL A;  4O3X B;  4ZHH A;  4EXZ A;  1GX3 A;  1ZNG A;  5F1E A;  3FW5 A;  1AVE A;  3FA9 A;  4OMX A;  5D48 A;  4TQ2 A;  1NGL A;  1VWM B;  1K24 A;  1IFC A;  1UZ2 X;  4YDB A;  2RA6 A;  2QO6 A;  2VFC A;  4MVK A;  3CKF A;  1X8P A;  1TW4 A;  4TKB A;  3FYF A;  3BDR A;  4TNN A;  3ZUI A;  2JGS A;  4QYN A;  5F6Z A;  3HPE A;  4OEM A;  2OY7 A;  2A8G A;  1VWH B;  1MOY A;  2R56 A;  2RCQ A;  3T2W A;  3O19 A;  3STN A;  2RTM A;  5FEN A;  1SLE B;  3BS2 A;  3S5V A;  4RUU A;  1BBP A;  1LCW A;  1GT5 A;  1FTP A;  1EW3 A;  4MVL A;  1AQB A;  3O2Y A;  3ZW0 A;  2JN3 A;  3Q6L A;  4BCS A;  2FR2 A;  2I5Z O;  1ICM A;  1U18 A;  3ELX A;  2N93 A;  1IJ8 A;  1OBU A;  1I06 A;  1QG5 A;  2KTD A;  3OJY C;  4O49 A;  4YGG A;  1A57 A;  4A1Y A;  5H9L A;  1WBI A;  1CBR A;  1YUP A;  2NP1 A;  1ICN A;  2OFA A;  2YG2 A;  4WBK A;  2QO5 A;  1QFV A;  1W5R A;  1LDQ A;  3HWG A;  2CM4 A;  4ORY A;  2VFB A;  1OSP O;  4QZT A;  1HXZ A;  1LF7 A;  2LB6 A;  4O4S A;  4KII A;  1GT1 A;  4WFU A;  5B27 A;  2K23 A;  3ZW2 A;  1BSO A;  5DPQ A;  1X8U A;  4ORX A;  4ID2 A;  2A13 A;  3JQO A;  3ZZV A;  4YVB A;  4ALB A;  2OFR X;  1STP A;  1HQP A;  2WPU A;  3NP1 A;  5FAZ A;  1SWU A;  2FGS A;  3VGW A;  4EFG A;  4O3Z A;  4GDZ A;  4TLJ A;  3U0D A;  4HPD A;  1VYO A;  1SRF A;  3EYC A;  5JD2 A;  2FKJ A;  2HNX A;  1SLD B;  4A8Z A;  1GGL A;  1BLR A;  1OEK A;  1FE3 A;  3LHN A;  2Y3E A;  4EDE A;  3U9P C;  1YWC A;  2ALL X;  4NV8 A;  5LJE A;  1BM5 A;  1KL5 A;  3FLL A;  4Y0R A;  2ASN X;  5F2B A;  4ZHF A;  4FQB B;  1BJ7 A;  1XCA A;  5HCC C;  1QFT A;  1SY2 A;  2IFB A;  1T68 X;  3KFG A;  4NLJ A;  1SXW A;  3ZW0 B;  5CE4 A;  2RTE B;  2ACP X;  3P24 A;  5H8T A;  1SY0 A;  1SY3 A;  3MX7 A;  4M7M A;  3T6L A;  4BX6 A;  4ZHC A;  3HWF A;  4GJS A;  2AH7 X;  3CQN A;  2MO5 A;  5D8J A;  1B8E A;  2A2G A;  2ZAG A;  3HK1 A;  3BX8 A;  4Z28 A;  1SRI A;  2G79 A;  3NR3 A;  4XMD A;  1MK5 A;  4DQ4 A;  3T2X A;  2OF9 A;  1QQS A;  3MVF A;  5IO7 A;  4HPB A;  2GTF X;  4I6S A;  5HA1 A;  1E06 A;  3PPT A;  4LQZ A;  5B2A O;  1HXL A;  5AQ6 A;  1LIB A;  4Y5D A;  1JJU A;  1IFB A;  3G7X A;  2C1S A;  2C4I A;  4PSQ A;  4QRL A;  4UU2 A;  3WJE A;  5EED A;  1NC9 A;  1YIV A;  4OMW A;  4GE1 A;  4BOE A;  4UU3 A;  4ZFX A;  2A2U A;  2KTS A;  3ZUO A;  1VWO B;  4NNS A;  5LJG A;  3RY1 A;  1E5P A;  1FEN A;  2P8G A;  1Y0G A;  1KQW A;  2ANS A;  2RTG B;  4ZH9 A;  2R74 A;  3NQ3 A;  3ZWE A;  1SWS A;  3FEN A;  3WVM A;  3GE2 A;  3RE6 A;  2AT5 X;  4ON1 A;  2UZ2 A;  1UYO X;  5HZ9 A;  1FEM A;  4NP1 A;  3I17 A;  1OBQ A;  2AT6 X;  3C77 X;  2NNQ A;  2X46 A;  4N7C A;  1GKA A;  1URE A;  4WHI A;  1SWR A;  5B5F A;  3APW A;  1SWA A;  1TXL A;  4B55 A;  2RTQ B;  5LJK A;  1P6P A;  4GGZ A;  3TZS A;  4MIS A;  4KCA A;  2IZA A;  1DZM A;  2LFO A;  3CKG A;  3NQK A;  4LZU A;  2GTL M;  1SWH A;  2E4J A;  3BU1 A;  4QYP A;  2IZG B;  2OFB A;  3APU A;  1SWQ A;  4U8U M;  1QAB E;  2Z4H A;  4QNI A;  3RDO A;  1G85 A;  1SWC A;  3OE3 A;  5CHK A;  1KT6 A;  3HWD A;  5K67 A;  3HWE A;  3PK2 A;  4I9R A;  1N9M A;  4O9S A;  3P02 A;  3ZI8 A;  2OVE A;  2AL0 X;  3D96 A;  3FID A;  1HN2 A;  4M6S A;  2F01 A;  3DSZ A;  3N91 A;  2WR6 A;  1VWN B;  4PJ2 A;  4BQU A;  4CDE A;  4QGW A;  4TJZ A;  2BC3 A;  2RTD B;  4AZQ A;  2L68 A;  2MHD A;  3B2K A;  1SWP A;  3JS1 A;  4Z6J A;  3D4R A;  3SLJ A;  3NX1 A;  1VWJ B;  3EBK A;  4NNT A;  3VG4 A;  1EII A;  4JO6 A;  4GK9 A;  4Z2V A;  3F6Z B;  3RDM A;  3P6F A;  3CMP A;  1ZNL A;  4A60 A;  4CK4 A;  1SWL A;  4XMH A;  5JR8 A;  4XMC A;  3VPJ E;  1B4M A;  2IZD B;  3WZO A;  1MUP A;  1G5W A;  1N0S A;  3NQ9 A;  1RXJ A;  3NPO A;  5B29 A;  3KFH A;  1VWA B;  3VE2 A;  1OBP A;  3TGB A;  3FDC A;  2L67 A;  1GKA B;  3PQS A;  3FA6 A;  1TOU A;  5HTE A;  1KZW A;  2X8T A;  4AZP A;  1YWA A;  2X8S A;  4ZH6 A;  4LKP A;  4ORR A;  5C0N A;  1BSQ A;  5L3Y A;  1JJX A;  1YP6 A;  3PDF A;  4U8U N;  3PEC A;  1X71 A;  3TF6 A;  2AT8 X;  1SXU A;  3QKG A;  2XST A;  5H9A A;  1GT3 A;  2CM9 A;  2IZL B;  4HPC A;  4NYQ A;  4QGX A;  2VDF A;  3S5X A;  1S44 A;  1B56 A;  2L5P A;  2AF5 A;  3VHM A;  3O22 A;  2Q39 A;  4IAW A;  4JNJ A;  1Z24 A;  4ZHD A;  1LKE A;  5HZ5 A;  5F6B A;  3APV A;  4JHQ A;  5F58 A;  4ZGF A;  3PQU A;  1EAL A;  2HLV A;  4GGT A;  1OEE A;  1S2P A;  4IMO A;  2DM5 A;  5D47 A;  3C78 X;  4JGL A;  1SRE A;  1LPJ A;  2IZI A;  2JOZ A;  2GC9 A;  2OVA A;  4YKO A;  1HMR A;  2WEW A;  4IBA A;  3KFF A;  3SLT A;  3PH5 A;  3CWK A;  4AZR A;  1ALB A;  1LDO A;  1AVG I;  1JV4 A;  3FW4 A;  2QOS C;  1HMS A;  4O3W A;  2MJI A;  2F73 A;  2Y3F A;  2AT0 X;  2OF8 A;  4IB6 A;  1ML7 A;  1ZNE A;  4Y0Q A;  4KT5 A;  1SWF A;  4L1N A;  4RUN A;  1KT4 A;  2JW1 A;  3P6E A;  1NBX A;  2RD7 C;  4GU8 A;  4XMG A;  3AEH A;  3B2I A;  1O1U A;  1OEJ A;  2R73 A;  2BLG A;  3SZJ A;  4DQ3 A;  3F9D A;  3BLG A;  5EDB A;  1EPA A;  3WZQ A;  2FS6 A;  4YFQ A;  4I95 A;  5B5G A;  1B0O A;  2X55 A;  3RZY A;  2OY8 A;  1MEP A;  5EPQ A;  1A2D A;  1T8V A;  1VWQ B;  2OYB O;  1Y9L A;  4CPI A;  1IKJ A;  1MX8 A;  1SWK A;  5AEO A;  2Q9S A;  5EEE A;  1BWY A;  1RBP A;  2FLJ A;  2HKD A;  4IMN A;  1IKE A;  5EZ2 A;  3UEW A;  2ZSC A;  1VWK B;  1N43 A;  1KT5 A;  2JU8 A;  3UEV A;  1SXX A;  5HCD C;  5HTD A;  1VWE B;  3EC5 A;  4ARH A;  2WEX A;  4OKA A;  4QZU A;  5CSE A;  1JQP A;  1KFF A;  1SWB A;  1X8N A;  3E3C A;  2W2F A;  4HWM A;  3ZW1 A;  1CBS A;  3FR5 A;  3HOL A;  4GH7 A;  1D3S A;  3D95 A;  2Q4N A;  3WBG A;  4A1H A;  1I78 A;  4CDD A;  2OL7 A;  2RTI B;  1LID A;  2Q2M A;  1R0U A;  5HZQ A;  4YFR A;  3RDQ A;  2QMI A;  1FDQ A;  2RTC B;  4Z2P A;  4AYH A;  4GUZ A;  5K06 A;  1SXY A;  4ML7 B;  1DFV A;  1BRP A;  3SLO A;  3WJG A;  2HZQ A;  1RXK A;  3RY2 A;  1LCV A;  2BHV A;  4BBO A;  5LJB A;  2F09 A;  5B3M O;  1JYJ A;  3KFI A;  1NP4 A;  1DF8 A;  3WJB A;  4D6B A;  2MM3 A;  4EQA C;  3MBT A;  1DZJ A;  1E2T A;  1KL3 A;  1SLF B;  2A5B A;  3CBC A;  3SAO A;  3SZI A;  1Y55 X;  3VG7 A;  1SWD A;  5HA0 A;  5K68 A;  1KZX A;  1QY0 A;  2W2A A;  4D6A A;  1VWF B;  1SA8 A;  2CAM A;  3FR2 A;  2RTJ A;  2G8C O;  3FEK A;  1X8Q A;  4ALO A;  1SWN A;  3SOT A;  2AT3 X;  1OPA A;  1A18 A;  2FT9 A;  1VWG B;  3B2H A;  2IZH B;  4FBR A;  1DF3 A;  1HMT A;  2DJG A;  4ODD A;  1XKI A;  4U3Q A;  4ES7 A;  1IW2 A;  2WWP A;  1VWP B;  2IZE B;  2RTL A;  1NQM A;  1VWD B;  3FEP A;  1T0V A;  4Y59 A;  4CPH A;  1MVG A;  4I3B A;  1FEL A;  5FQ7 E;  5BVQ A;  1VPR A;  3ZW1 B;  1VWC B;  2C1Q A;  3KQ0 A;  2Z4I A;  2RTA A;  5BVT A;  1ZND A;  2K62 A;  4BJ8 A;  3CQR A;  1NQN A;  1ZRY A;  1X89 A;  4XME A;  2GTL O;  3OBL A;  1DZP A;  1JYD A;  4U8U O;  3APX A;  3UEX A;  3WYQ A;  1GX9 A;  5BVS A;  5IRW A;  2CZT A;  4OS0 A;  5FQ8 E;  5HCE C;  2WSJ A;  2YMS A;  3AKN A;  4NW4 A;  1EPB A;  4YGZ A;  3C76 X;  5EDC A;  3RE5 A;  5BYP A;  1CRB A;  4AZO A;  1EI5 A;  2OY1 O;  4IAB A;  5LKE A;  1EIO A;  2UYW A;  3B2L A;  3NX2 A;  2KD2 A;  2QO4 A;  2FHL A;  4WFV A;  3D9W A;  5HZ6 A;  4R0B A;  4ZJ0 A;  4K19 A;  4OS8 A;  3RKG A;  5KIC A;  1GT4 A;  1IIU A;  3JSQ A;  1JJJ A;  1WUB A;  1LUQ A;  1SY1 A;  2RTR B;  2XKL A;  3K3L A;  4I3D A;  5HBS A;  3WXQ A;  3ZQ3 A;  3BRN A;  1DC9 A;  4QQ1 A;  1TVQ A;  4FBV A;  3RSW A;  1KQX A;  4L3R A;  4XMF A;  5HAE A;  4NLI A;  1JIW I;  1LIF A;  2RTK A;  4ORU A;  3WJF A;  2KT4 B;  2HMB A;  3H3I A;  4YH0 A;  1HBP A;  1STR B;  4ZGU A;  1QY2 A;  2FR3 A;  4ORW A;  1RSU B;  4ZHG A;  5IO5 A;  3WZP A;  1H91 A;  2GTL N;  4I60 A;  2W2B A;  3WYP A;  2A0A A;  4CPH B;  3U03 A;  4YDA A;  5HZ8 A;  1DZK A;  1SRG A;  4O4U A;  3VHI A;  1I04 A;  2CBS A;  5AJB A;  4CPE A;  2WQA E;  3WJD A;  5IO6 A;  1MDC A;  4YBP A;  3L4R A;  2G7B A;  3MM0 A;  5KHP A;  3HTY A;  3NAD A;  4GD9 A;  4Z2O A;  1BRQ A;  1CBQ A;  3VG3 A;  1ADL A;  4YMY A;  2HYS A;  4Y0S A;  4YCE A;  5LJH A;  1PEE A;  1QY1 A;  1O8V A;  1VWR B;  4I9S A;  1S7D A;  2LBV A;  2FS7 A;  4LKT A;  3BY0 A;  3I0A A;  2RN4 A;  1PBY A;  3PP6 A;  5D45 A;  2IZB A;  2OFM X;  3CR6 A;  1VWB B;  3LTW A;  5H9N A;  1SWG A;  2RTP B;  1KOI A;  3EW2 A;  1G74 A;  4KC7 A;  5IXG A;  1ZNK A;  2WUT A;  1Y53 X;  1U17 A;  2BT9 A;  5LKF A;  4BX5 B;  1UYN X;  1KXO A;  1O1V A;  1PMP A;  3AKM A;  4YFP A;  4CSB A;  5L8N A;  1RLB E;  1JMX A;  4MIR A;  1BEB A;  1W4T A;  1YWD A;  3B2J A;  1I05 A;  1I9H A;  2OZQ A;  4U46 A;  5HWZ A;  4IRW A;  4GKC A;  4ORS A;  2X34 A;  3MG5 A;  4IB7 A;  3PED A;  3AUM O;  1LFO A;  3F8A A;  3PH6 A;  4MEE A;  3T1D A;  3TGA A;  3VG5 A;  1NDJ A;  4YCH A;  2FTB A;  5B11 O;  4QAE A;  4YBU A;  3RWX A;  3D97 A;  1X8O A;  3IFB A;  4DNE A;  3P6H A;  3LV4 A;  2AKQ A;  3FR4 A;  2EU7 X;  5CYB A;  1JBH A;  4GNY A;  1EXS A;  2BSZ A;  3Q34 A;  5DG4 A;  1W6F A;  1YP7 A;  2ACO A;  4U9C A;  4AW8 A;  1DV9 A;  3ELZ A;  2OL8 O;  2WQ9 A;  2FHN X;  2BS6 A;  2PI3 O;  2O62 A;  4HPA A;  3V8U A;  4CV7 A;  3EW1 A;  2FWV A;  1EQD A;  3HOE A;  4FGI B;  4COT A;  5L8O A;  1HBQ A;  2X32 A;  4O3Y A;  2OY5 O;  4BGF A;  4FBO A;  3FA7 A;  1STS B;  3S60 A;  2IZC B;  2Y32 A;  4Y0P A;  5IRA A;  1VYG A;  3P6D A;  4AZM A;  1EUO A;  1SWJ A;  2I5V O;  3KZA A;  1LEL A;  1I4U A;  5H9K A;  2NND A;  3T6F A;  5KID A;  1PBO A;  3IA8 A;  1Y52 X;  1VWL B;  2FKG A;  2MWH A;  4GJV A;  3RDU A;  1AVD A;  3STM X;  1SWT A;  4YKM A;  4GZV A;  1RXH A;  1MX7 A;  4C5P A;  2RTH B;  1LIE A;  3FA8 A;  5B10 O;  3STK A;  1Y9T A;  1AB0 A;  1LIC A;  2JMB A;  3OD9 A;  2PY1 A;  1PTS A;  2IZF B;  3VE1 A;  2HZR A;  3BU9 A;  4NV7 A;  4AZN A;  5L8I A;  2ZAI A;  4IB9 A;  3P6G A;  1GX8 A;  1A3Y A;  3S26 A;  1RST B;  1CBI A;  2AVI A;  5AJC A;  4GRJ A;  2X8F A;  4GDA A;  2OVS A;  4IAX A;  1LNM A;  4NYR A;  2AMM X;  3DTQ A;  4TKH A;  4KC8 A;  5D4A A;  4OS3 A;  5F7G A;  4GET A;  2RTN B;  3RDX A;  2CBR A;  1SWO A;  1VWI B;  1U0X A;  2RTO B;  1SMP I;  1ACD A;  4BX7 A;  4ZCB A;  1FJ1 E;  3UAQ A;  1JMZ A;  2G78 A;  2GH7 A;  1N9Y A;  2LBA A;  2A5C A;  3TGC A;  1KT3 A;  5FFH A;  2X56 A;  2RTB B;  3RBY A;  2Q2P A;  3BSZ E;  3FIQ A;  5FQ6 E;  2JU7 A;  2OVD A;  4O4O A;  1L6M A;  4I3C A;  3BX7 A;  4N7D A;  2BS5 A;  3KVN A;  1YWB A;  4LZV A;  1LCZ A;  1N4J A;  2FRS A;  2POA A;  1D2U A;  1G7N A;  3EBW A;  3EM0 A;  2QOM A;  3P6C A;  1SRJ A;  2OL6 O;  3VG2 A;  4O4X A;  2X45 A;  5LJC A;  5IRU A;  4GNW A;  2DJF A;  2QM9 A;  1AEL A; 
#chains in the Genus database with same CATH homology
 4TKJ A;  4BVM A;  2KW1 A;  4INN A;  1OPB A;  4KH8 A;  4YGH A;  2JU3 A;  3VU1 A;  1PM1 X;  1BSY A;  1QWD A;  2RCT A;  3GAQ A;  4MVE A;  3WOV A;  1VYF A;  3UEU A;  1E02 A;  3FMZ A;  3CBS A;  1TOW A;  1ERB A;  3FEL A;  1KT7 A;  1ERX A;  2LKK A;  3EMM A;  1CJ5 A;  3NBX X;  1JZU A;  3VG6 A;  1E00 A;  1GXA A;  1NP1 A;  4QGV A;  4MVI A;  4ZR2 A;  2CZU A;  2L9C A;  3WJC A;  4HFO A;  2A3F X;  4IB8 A;  2GJ5 A;  2M4L A;  2RQ0 A;  1ZNH A;  2LA7 A;  2NNE A;  1GM6 A;  5LJD A;  4EEJ A;  1KGL A;  4O3X B;  4ZHH A;  4EXZ A;  1ZNG A;  5F1E A;  3FW5 A;  3FA9 A;  4OMX A;  5D48 A;  4TQ2 A;  1NGL A;  1IFC A;  1UZ2 X;  4YDB A;  2RA6 A;  2QO6 A;  4MVK A;  1X8P A;  1TW4 A;  4TKB A;  3FYF A;  3BDR A;  4TNN A;  3ZUI A;  4QYN A;  5F6Z A;  2R56 A;  2RCQ A;  3O19 A;  3STN A;  5FEN A;  3BS2 A;  3S5V A;  4RUU A;  1BBP A;  1GT5 A;  1FTP A;  1EW3 A;  4MVL A;  1AQB A;  3O2Y A;  3ZW0 A;  2JN3 A;  3Q6L A;  2FR2 A;  1ICM A;  1U18 A;  3ELX A;  2N93 A;  1OBU A;  1I06 A;  1QG5 A;  2KTD A;  3OJY C;  4O49 A;  4YGG A;  1A57 A;  4A1Y A;  5H9L A;  1CBR A;  1YUP A;  2NP1 A;  1ICN A;  2YG2 A;  4WBK A;  2QO5 A;  1QFV A;  3HWG A;  2CM4 A;  4ORY A;  4QZT A;  1LF7 A;  2LB6 A;  4O4S A;  4KII A;  1GT1 A;  4WFU A;  5B27 A;  2K23 A;  3ZW2 A;  1BSO A;  5DPQ A;  1X8U A;  4ORX A;  4ID2 A;  2A13 A;  3JQO A;  3ZZV A;  4ALB A;  2OFR X;  3NP1 A;  1HQP A;  5FAZ A;  4EFG A;  4O3Z A;  4GDZ A;  4TLJ A;  3U0D A;  4HPD A;  3EYC A;  2HNX A;  4A8Z A;  1GGL A;  1BLR A;  1OEK A;  1FE3 A;  3LHN A;  4EDE A;  3U9P C;  1YWC A;  2ALL X;  1BM5 A;  5LJE A;  3FLL A;  4Y0R A;  2ASN X;  4ZHF A;  4FQB B;  1BJ7 A;  1XCA A;  5HCC C;  1QFT A;  1SY2 A;  2IFB A;  1T68 X;  3KFG A;  4NLJ A;  1SXW A;  3ZW0 B;  5CE4 A;  2ACP X;  3P24 A;  5H8T A;  1SY0 A;  1SY3 A;  3MX7 A;  4M7M A;  4ZHC A;  3HWF A;  2AH7 X;  3CQN A;  2MO5 A;  5D8J A;  1B8E A;  2A2G A;  2ZAG A;  3HK1 A;  3BX8 A;  2G79 A;  3NR3 A;  4XMD A;  4DQ4 A;  1QQS A;  3MVF A;  5IO7 A;  4HPB A;  2GTF X;  4I6S A;  5HA1 A;  1E06 A;  3PPT A;  4LQZ A;  5AQ6 A;  1LIB A;  4PSQ A;  1IFB A;  3G7X A;  4QRL A;  3WJE A;  4UU2 A;  5EED A;  1YIV A;  4OMW A;  4GE1 A;  4BOE A;  4UU3 A;  4ZFX A;  2A2U A;  2KTS A;  3ZUO A;  5LJG A;  4NNS A;  1E5P A;  1FEN A;  2P8G A;  1KQW A;  2ANS A;  4ZH9 A;  2R74 A;  3NQ3 A;  3ZWE A;  3FEN A;  3WVM A;  3GE2 A;  2AT5 X;  4ON1 A;  5HZ9 A;  1FEM A;  4NP1 A;  3I17 A;  1OBQ A;  2AT6 X;  3C77 X;  2NNQ A;  2X46 A;  4N7C A;  1GKA A;  1URE A;  4WHI A;  3APW A;  1TXL A;  5LJK A;  1P6P A;  3TZS A;  4MIS A;  4KCA A;  1DZM A;  2LFO A;  3NQK A;  4LZU A;  2GTL M;  2E4J A;  3BU1 A;  4QYP A;  4U8U M;  3APU A;  1QAB E;  2Z4H A;  4QNI A;  1G85 A;  3OE3 A;  1KT6 A;  3HWD A;  3HWE A;  4I9R A;  4O9S A;  3P02 A;  3ZI8 A;  2OVE A;  2AL0 X;  3D96 A;  1HN2 A;  4M6S A;  4PJ2 A;  3DSZ A;  3N91 A;  2WR6 A;  4BQU A;  4QGW A;  4TJZ A;  4AZQ A;  2L68 A;  2MHD A;  3B2K A;  3JS1 A;  3D4R A;  3NX1 A;  3EBK A;  4NNT A;  3VG4 A;  1EII A;  4GK9 A;  3F6Z B;  3P6F A;  3CMP A;  1ZNL A;  4A60 A;  4CK4 A;  4XMH A;  5JR8 A;  4XMC A;  3VPJ E;  1B4M A;  1MUP A;  1G5W A;  1N0S A;  3NQ9 A;  3NPO A;  5B29 A;  3KFH A;  3VE2 A;  1OBP A;  3TGB A;  2L67 A;  1GKA B;  3PQS A;  3FA6 A;  1TOU A;  5HTE A;  1KZW A;  2X8T A;  4AZP A;  1YWA A;  2X8S A;  4ZH6 A;  4LKP A;  4ORR A;  5C0N A;  1BSQ A;  1JJX A;  1YP6 A;  4U8U N;  3PEC A;  1X71 A;  3TF6 A;  2AT8 X;  1SXU A;  3QKG A;  2XST A;  5H9A A;  1GT3 A;  2CM9 A;  4HPC A;  4NYQ A;  4QGX A;  3S5X A;  1S44 A;  1B56 A;  2L5P A;  3O22 A;  2Q39 A;  4IAW A;  4ZHD A;  1Z24 A;  1EAL A;  1LKE A;  5F6B A;  3APV A;  5F58 A;  4ZGF A;  3PQU A;  2HLV A;  1OEE A;  1S2P A;  4IMO A;  2DM5 A;  5D47 A;  3C78 X;  4JGL A;  1LPJ A;  2JOZ A;  2GC9 A;  2OVA A;  4YKO A;  1HMR A;  2WEW A;  4IBA A;  3KFF A;  3PH5 A;  3CWK A;  4AZR A;  1ALB A;  1AVG I;  1JV4 A;  3FW4 A;  2QOS C;  1HMS A;  4O3W A;  2MJI A;  2F73 A;  4IB6 A;  2AT0 X;  4Y0Q A;  1ML7 A;  1ZNE A;  4KT5 A;  4RUN A;  4L1N A;  2JW1 A;  1KT4 A;  3P6E A;  2RD7 C;  4GU8 A;  4XMG A;  3B2I A;  1O1U A;  1OEJ A;  2R73 A;  2BLG A;  4DQ3 A;  3F9D A;  3BLG A;  5EDB A;  1EPA A;  2FS6 A;  4YFQ A;  4I95 A;  1B0O A;  3RZY A;  5EPQ A;  1A2D A;  1T8V A;  1Y9L A;  5AEO A;  1IKJ A;  1MX8 A;  2Q9S A;  5EEE A;  1BWY A;  1RBP A;  2FLJ A;  5EZ2 A;  4IMN A;  1IKE A;  3UEW A;  1KT5 A;  2JU8 A;  3UEV A;  1SXX A;  5HCD C;  5HTD A;  4ARH A;  2WEX A;  4QZU A;  1X8N A;  3E3C A;  3ZW1 A;  4HWM A;  2W2F A;  1CBS A;  3FR5 A;  3HOL A;  4GH7 A;  1D3S A;  3D95 A;  2Q4N A;  3WBG A;  4A1H A;  1LID A;  2Q2M A;  1R0U A;  5HZQ A;  4YFR A;  2QMI A;  1FDQ A;  4AYH A;  5K06 A;  1SXY A;  4ML7 B;  1DFV A;  1BRP A;  3WJG A;  2HZQ A;  2BHV A;  5LJB A;  2F09 A;  1JYJ A;  3KFI A;  1NP4 A;  3WJB A;  4D6B A;  2MM3 A;  4EQA C;  3MBT A;  1DZJ A;  3CBC A;  3SAO A;  3VG7 A;  5HA0 A;  1KZX A;  1QY0 A;  2W2A A;  4D6A A;  1SA8 A;  3FR2 A;  3FEK A;  4ALO A;  1X8Q A;  3SOT A;  2AT3 X;  1OPA A;  1A18 A;  2FT9 A;  3B2H A;  4FBR A;  1DF3 A;  1HMT A;  4ODD A;  1XKI A;  4U3Q A;  4ES7 A;  1IW2 A;  2WWP A;  3FEP A;  1T0V A;  1MVG A;  4I3B A;  1FEL A;  5FQ7 E;  5BVQ A;  1VPR A;  3ZW1 B;  3KQ0 A;  2Z4I A;  5BVT A;  1ZND A;  2K62 A;  3CQR A;  1ZRY A;  1X89 A;  4XME A;  2GTL O;  3OBL A;  1DZP A;  1JYD A;  4U8U O;  3APX A;  3UEX A;  1GX9 A;  5BVS A;  2CZT A;  4OS0 A;  5FQ8 E;  5HCE C;  2WSJ A;  2YMS A;  3AKN A;  4NW4 A;  1EPB A;  4YGZ A;  3C76 X;  5EDC A;  5BYP A;  5LKE A;  1CRB A;  4AZO A;  1EI5 A;  4IAB A;  1EIO A;  3B2L A;  3NX2 A;  2KD2 A;  2QO4 A;  4WFV A;  5HZ6 A;  4R0B A;  4ZJ0 A;  4K19 A;  4OS8 A;  3RKG A;  5KIC A;  1GT4 A;  1IIU A;  3JSQ A;  1JJJ A;  1SY1 A;  2XKL A;  3K3L A;  4I3D A;  5HBS A;  3WXQ A;  3ZQ3 A;  3BRN A;  1DC9 A;  4QQ1 A;  1TVQ A;  4FBV A;  3RSW A;  1KQX A;  4L3R A;  4XMF A;  5HAE A;  1JIW I;  1LIF A;  4ORU A;  3WJF A;  2KT4 B;  2HMB A;  3H3I A;  4YH0 A;  1HBP A;  4ZGU A;  1QY2 A;  2FR3 A;  4ORW A;  4ZHG A;  5IO5 A;  1H91 A;  2GTL N;  2W2B A;  2A0A A;  3U03 A;  4YDA A;  5HZ8 A;  1DZK A;  4O4U A;  1I04 A;  2CBS A;  5AJB A;  2WQA E;  3WJD A;  5IO6 A;  1MDC A;  4YBP A;  3L4R A;  2G7B A;  5KHP A;  3HTY A;  3NAD A;  1BRQ A;  1CBQ A;  3VG3 A;  1ADL A;  4YMY A;  2HYS A;  4Y0S A;  4YCE A;  5LJH A;  1PEE A;  1QY1 A;  1O8V A;  4I9S A;  2LBV A;  1S7D A;  2FS7 A;  4LKT A;  3BY0 A;  3I0A A;  2RN4 A;  3PP6 A;  5D45 A;  2OFM X;  3CR6 A;  5H9N A;  1KOI A;  1G74 A;  4KC7 A;  1ZNK A;  2WUT A;  1U17 A;  2BT9 A;  5LKF A;  1KXO A;  1O1V A;  1PMP A;  3AKM A;  4YFP A;  4CSB A;  5L8N A;  1RLB E;  4MIR A;  1BEB A;  1YWD A;  3B2J A;  1I05 A;  2OZQ A;  5HWZ A;  4GKC A;  4ORS A;  4IB7 A;  3PED A;  3T1D A;  1LFO A;  3F8A A;  3PH6 A;  3TGA A;  3VG5 A;  4YCH A;  2FTB A;  4QAE A;  4YBU A;  3RWX A;  3D97 A;  1X8O A;  3IFB A;  3P6H A;  3LV4 A;  2AKQ A;  3FR4 A;  2EU7 X;  5CYB A;  1JBH A;  4GNY A;  1EXS A;  5DG4 A;  1YP7 A;  2ACO A;  4U9C A;  4AW8 A;  1DV9 A;  3ELZ A;  2WQ9 A;  4HPA A;  2BS6 A;  4CV7 A;  2O62 A;  3V8U A;  4COT A;  2FWV A;  1EQD A;  3HOE A;  4FGI B;  5L8O A;  1HBQ A;  4O3Y A;  4FBO A;  3FA7 A;  3S60 A;  4Y0P A;  4AZM A;  1VYG A;  3P6D A;  1EUO A;  3KZA A;  5H9K A;  1I4U A;  2NND A;  5KID A;  1PBO A;  3IA8 A;  2MWH A;  3STM X;  4YKM A;  4GZV A;  1MX7 A;  1LIE A;  3FA8 A;  3STK A;  1Y9T A;  1AB0 A;  1LIC A;  2JMB A;  3OD9 A;  2PY1 A;  3VE1 A;  2HZR A;  3BU9 A;  4AZN A;  5L8I A;  2ZAI A;  4IB9 A;  3P6G A;  1GX8 A;  1A3Y A;  3S26 A;  1CBI A;  5AJC A;  4GRJ A;  2X8F A;  2OVS A;  4IAX A;  1LNM A;  4NYR A;  2AMM X;  3DTQ A;  4TKH A;  4KC8 A;  5D4A A;  4OS3 A;  5F7G A;  4GET A;  2CBR A;  1U0X A;  1SMP I;  1ACD A;  4ZCB A;  3UAQ A;  2G78 A;  2LBA A;  3TGC A;  1KT3 A;  5FFH A;  3RBY A;  2Q2P A;  3BSZ E;  3FIQ A;  5FQ6 E;  2JU7 A;  2OVD A;  4O4O A;  1L6M A;  4I3C A;  3BX7 A;  4N7D A;  2BS5 A;  1YWB A;  4LZV A;  2POA A;  3P6C A;  2FRS A;  3EBW A;  1D2U A;  1G7N A;  3EM0 A;  4NLI A;  5HZ5 A;  3VG2 A;  4O4X A;  2X45 A;  5LJC A;  4GNW A;  2QM9 A;  1AEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...