2F0HA

Crystal structure of staphylococcal nuclease mutant v66l
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 39
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0hA00
5CV6A 3NXWA 4KY7A 1SNQA 3MXPA 5JOBA 2EY5A 2EYOA 3TMEA 1JOQA 2PZTA 2RDFA 5IIFA 2OXPA 3HZXA 4NKLA 3D4DA 4HMJA 4EQPA 1KDCA 3EJIA 1SNCA 1EY0A 4IZ8A 2F0WA 4NDXA 2KQ3A 1RKNA 4KTAA 1F2MA 3DMUA 2KHSA 4J6HA 4RKBA 5NUCA 4KV6A 1NSNS 4K5VA 4KD3A 1EY6A 2F3WA 3EROA 5J1ZA 4S3SA 5I6WA 1TR5A 4K8IA 1SNOA 5DAUA 5IGBA 1JORA 2ENBA 3VA5A 1EYDA 5ISRA 2HQEA 5IGFA 4ZQ3A 4ODGA 3NK9A 4KY5A 4IUNA 4HMIA 3TP5A 1A2TA 1EY5A 4B9XA 2EYMA 2EY1A 4K2KA 5IGCA 2SOBA 3TP7A 1SNMA 1STBA 1KDAA 1EYCA 4G57A 5CGKA 1U9RA 4R8NA 3OMCA 3QOLA 4I65A 1KABA 4K8JA 4K5WA 3DHQA 4TRDA 5E3FA 5HURA 4KJOA 3OMGA 4ID6A 3P75A 3U9OA 2F0KA 2EYFA 2SNSA 3MEHA 5DEHA 4B9WA 2OEOA 1SYFA 4EQNA 5KEEA 3H6MA 4E6IA 5EKLA 3D4WA 1JOKA 3P1HA 4ZUJA 3E5SA 4HTHA 5CC4A 3V2TA 3MZ5A 1A3UA 4PNYA 3OSOA 3S9WA 1EY7A 4QMGA 3SHLA 3T16A 2F0NA 2F0GA 2F0OA 4ME5A 5CV5A 4ZUIA 4DF7A 3R3OA 2F0FA 3SK5A 2EXZA 1STGA 2EYHA 3NHHA 5I9OA 2F0JA 4N9PA 3D6CA 2EY2A 4K2LA 2F3VA 3SXHA 2RKSA 5KRUA 2RBMA 3NUCA 4PMBA 4KY6A 3EVQA 1JOOA 1STNA 5EKKA 2SNMA 2F0UA 5C3XA 1ENAA 2PYKA 2M00A 1A3TA 1SYCA 2F0LA 3ITPA 1SYBA 1F2YA 2PW5A 4DFAA 3MVVA 4F7XA 1EQVA 5C4ZA 2EYPA 2F0MA 2PW7A 4QF4A 5IOCA 5I6YA 1AEXA 2F0SA 5IODA 2EY6A 4WRDA 3SR1A 1II3A 1SNPA 2F0DA 3BDCA 3LX0A 4K6DA 5IGGA 4KJNA 3T13A 4EQOA 4F8MA 1A3VA 3ERQA 4DU9A 5C6AA 2F0VA 1IHZA 1KAAA 2O4XA 2WACA 1SYEA 3MHBA 3OWFA 1STYA 1EY9A 1EY4A 2EYJA 1SNDA 2PZUA 2F0EA 5KYIA 4LAAA 1ENCA 3NQTA 4N9TA 5C3WA 1STHA 3HEJA 4IALA 4KD4A 5CV8A 4NMZA 3SK4A 4KHVA 4EVOA 1TQOA 1SYDA 4MIUA 4K5XA 3PMFA 5CR3A 3SK8A 4DGZA 4J1MA 4RKLA 5K5PA 5E1FA 5KIXA 3D8GA 1EY8A 5J39A 3C1EA 3NP8A 5CV4A 5F2DA 5C5LA 3SK6A 1EYAA 4K14A 5JAVA 2QDBA 2F0QA 1A2UA 1EZ8A 2F0HA 2NUCA 4WORA 3TP8A 4OL7A 5J22A 1STAA 1F2ZA 5CV7A 2PZWA 1KDBA 3RUZA 5KGUA 2PQEA 3QOJA 4NP5A 2OF1A 5CV9A 5I9PA 1NUCA 5IGDA 1EZ6A 4YIJA 5C5MA 1SYGA 2EYLA 3BDLA 3QB3A 4PMCA 4QB4A 5EGTA 3TP6A 5IGEA 5KYLA 5C4HA 2F0IA 2F0PA 5M9OA 1TT2A 2F0TA 4H7BA 2LKVA 3C1FA 5HGTA
chains in the Genus database with same CATH superfamily
4IOAA 1SNQA 3J81i 2A73B 2ZM6L 2OXPA 1WFQA 3K5LA 3S16H 4A3IH 2XSCA 3G48A 4KTAA 1RKNA 1X32A 5J1ZA 3TEHB 1PH7A 4CDDC 2JSOA 5IGBA 3NEMA 4ZQ3A 4B9XA 2CH4W 2QILA 1X65A 1H9JA 4ZCKA 2CVRA 3I4NH 3TZDA 1G91A 1BCPB 5EKIA 1KDAA 3NSWA 3MFGA 2NZOA 5IP9G 2VW9A 4B3RL 1TU2B 1A63A 4JOIA 2R7ZB 3U9OA 1E2WA 3W3AA 1WCMB 2HD3A 3QJYA 3NELA 1K83B 4L5QA 4AYBE 1JOKA 2PI2E 2F3IA 4K6LA 5CBEE 3T56B 3LWUA 4RWSC 3D4RA 5AJ3Q 1VQCA 1NAPA 2F0OA 4C1NI 3C3LA 3IAYA 4X3TA 1VQ4A 4BXXH 4HEDA 2RQXA 5JVG3 4QJFA 2J0TD 1VQ6A 3P20A 4FYDA 2SNMA 4A3GH 5IY0A 3GTJH 1V1PB 1J5EL 4A3JG 3ZJYC 3SEBA 2EJMA 2PW5A 2N55A 2EYPA 5C4JH 5I4DA 5HY6A 1X3QA 3URYA 1BBXC 1S5DD 1VS0A 1SLJA 4R4TA 5IYBG 2K50A 2RSOA 4Y7NB 3T13A 2VB2X 1ESFA 2CWPA 3HS0C 2JEAI 1PFSA 1SYEA 2L4NA 4IJHA 4QIWB 1ENCA 1WVLA 4KKTA 1RD9D 3T51B 3KF8A 4DXGA 1PH5A 1N8RC 1B3AA 1UEAB 5JJLA 1EQTA 1R4QB 2I5MX 2IHEA 1DJRD 1AFPA 4B3MQ 3A5ZB 3C1EA 3A8JE 3OIQA 4C3HG 3G71A 1KDBA 1YEZA 4BY7H 4DK1A 1Y14B 4C3JG 1SR3A 2KEEA 4YIJA 1SYGA 3BDLA 1K8MA 2B29A 4L8JA 4RA8A 1NY4A 5ELBA 2F0IA 1LTLA 1JJCB 1QUQB 4P73A 1G6PA 4X65L 4A3MB 4XQNA 4LFAL 3CMAA 3KF8B 2JE6I 4JYAQ 1L1OC 2JA6G 3M9BA 3FPPA 1D1KA 5M3MB 1M90C 3GTQH 1O7IA 3RN5A 1PA6A 4DR4Q 2XGTA 4A3JH 4JOIC 3TREA 2Q2HA 2H1EA 4RGTA 2G5DA 4JBJA 1TR5A 3K7AB 4IPGA 4TVAB 4IUNA 3HFZB 5M3FG 1ENFA 4CDCC 4K5WA 2JA8H 3PCOB 4NPSA 3FMCA 2B2UC 2IL8A 3KLWA 5C44B 1LM0A 1YIJA 3NQIA 3JAMi 1PVOA 4A3BB 3OYYA 2D9UA 2YV5A 4IPDA 3PIPA 1XMOL 2AQ1B 2GVAA 3CC2A 2WINB 4YWLA 2BE5D 1D5MC 2EOTA 4GKJQ 2PYKA 1W2BA 3CW2C 4LF8L 5FLXE 5FO7B 1EQVA 1RODA 4V190 2F0SA 2N49A 1LTTD 2B2UA 1N32Q 1EIYB 2WB1B 4EGVA 4DUZQ 4IPCA 1HZCA 3KBXA 1M4VA 2BDNA 3C2PA 2ATWA 3WWVA 5KYIA 3T4AC 2JXMB 4LWCA 4CKCA 1WJJA 1NR2A 3SK4A 4NMZA 3PF5A 1SFOB 5M3FH 3GQBA 1XPUA 3A5UA 1DOLA 3K6OA 1HR0Q 3SE0A 4DR5Q 2XRQD 3F2BA 1HNXQ 4K14A 4U68A 3RN2A 1EZ8A 4JYAL 2AWOA 1QUQA 2PZWA 1H9MA 3KLSA 2KCNA 4RHRA 2Y0SG 4DV5L 2JA7B 4B3TL 5IWAQ 1TWGH 1RHPA 1ZYRC 1C8CA 4BBSB 3BYYB 4CHTB 4K0KL 2EYLA 4QB4A 3TP6A 1QVGA 4DR6L 2K5HA 3A56A 3S17B 3HOZB 2HQLA 3K7AH 4JBMA 1I5FA 2J4XA 1JE4A 3H0GG 5CV6A 5JOBA 3TMEA 2EY5A 1EWHA 4LFCL 3GTGH 1Q8KA 1LT3D 5AJ3L 3H3VI 3FRPB 3S1NB 4KKSA 1VQ7A 1PH1A 1NSNS 3GTKH 1HQRD 1K9MC 2ID0A 3MWYW 3NBHB 2R93H 3EBEA 2MNAA 3KLSX 3HOWH 1EWCA 2BOSA 5ISRA 5M5WB 2XIWA 4XXEA 3G7LA 1FVIA 3LNNA 5M5YH 1E1OA 3S15B 1PYBA 1A62A 1TS4A 1SYFA 3TRZA 4UP8A 5C3EG 3D4WA 4OO1G 1PYWD 1IBMQ 3KJPA 4HTHA 2NB0A 1EOTA 4QMGA 4N8X1 5GQOA 2K6AA 1NTGA 4KLKA 2FXQA 4JW0A 3SK5A 1DYQA 2F52A 2J7ZA 2V1CC 3W2DA 3OTOQ 4GLAC 1J9OA 2K28A 3RNUA 3QIAA 1CSQA 2K75A 5EKKA 1YNJD 1YHAA 2AMCB 1CA6A 3H0GH 3M4QA 2AUKA 1S5CD 3BZDB 3M4OH 3M7NA 4LK1C 1J6QA 4A3LH 1AEXA 1SSOA 1HZBA 1KRSA 2EY6A 4OHJA 4X3SA 2ZJPA 1U4PA 4B3RQ 1DM0B 5C44G 1U5KA 1VDZA 1XNQL 4KJNA 4BY1B 1MSGA 4JI7L 1SMYC 1YNNC 2WAQB 3WOFA 2E2IH 4OONA 4XT1B 3MA2B 5EAYA 4DV3Q 3HOWG 2R93G 3S24A 3UE1A 4FXKC 3U4ZA 1U4LA 5H1SE 5KNDA 2VY3A 4EVOA 1KIXA 5I2YA 3OPOA 4CKEA 2HIXA 2B8GA 1PRTB 1TWAH 2B63G 4KMUC 1GUSA 3SK6A 5F2DA 4LF7Q 3T1HL 4HIMA 2R3ZA 5C3EH 5EBCA 2PI2A 4LF4Q 3GTMH 2XWJB 2JK8A 4RH6A 3JC66 3PGZA 2I5HA 3T1HQ 2L9HA 3HZXA 1I3QH 3K8AA 5M5YB 4AYBB 1OXVA 4L5SA 1ICFB 1KXLA 1JICA 2K5NA 2ASBA 1AW7A 1PH2A 1C0AA 2BH2A 3TS2A 1D1IA 1KL9A 4K8IA 1TY2A 1S4ZA 4B3SL 3PIOA 2QCPX 5GAEC 4C56C 4DV0Q 4GOPA 4YWKA 2FFKB 1RCVD 5HURA 3NTKA 3J7ZC 1SXTA 2EYFA 3A7AB 3MEHA 5KEEA 4DNTB 3SVMA 2CQOA 3I70A 3K81C 4JC0A 1CM9A 3ZYYX 2B63H 1A6XA 2E2JH 4GNXA 4ZUJA 5M3MH 3GTQB 4X6AH 4A3JB 4JI3L 1A3UA 4A3DH 4DKAC 3I8ZA 1N34Q 3S9WA 1D7QA 1EY7A 3SHLA 5CV5A 2F0GA 1VQPA 3CPFA 5FK9C 3I73A 3R3OA 3U9SA 5LMNW 2JA9A 1TVXA 3PV0A 5EBDA 2F3VA 2R61A 3A55A 1YI2A 4DV1L 4TKOB 1LTRD 1ET6A 2IX0A 4YWMA 4DR1L 4ZYSA 1BQQT 4G4KA 4A3EH 2NZHA 2VS1A 4Z9CB 3AEVA 4FF3A 3S1MH 1QZHA 1HR0W 3CCQA 3H09A 5GAGC 4QIWE 3S1RH 4GZYC 1HJPA 2LMCB 5GAHC 4J1MA 1PH6A 3U58A 1AP0A 4BA1I 1KLGD 2QW7A 2YYZA 5JAVA 2QDBA 3Q22A 2VUMG 4WORA 3CAMA 5EPKA 2BH8A 1QWYA 5J22A 2R7ZG 3FKIB 3ND8A 3OW2A 2B2TC 5M3MG 3VYRA 2OF1A 5KNBA 2E2HB 1NUCA 2G9HD 4G7ZC 5D3IB 4NXMQ 4FVMA 4K0KQ 1DCZA 2FMMA 1Y8OB 2NVTB 2K4KA 2F0TA 4AH6A 4ALPA 2EYOA 2RDFA 2PPBC 2RVLA 1BCPD 2HHHL 2JJQA 3FP9A 4IUTA 1SFOH 4GN3B 1XMQQ 2KQ3A 1BF4A 3I90A 3A0JA 5FO8B 4A75A 2UXCL 2KHSA 1HR0L 1BUVT 3Q24A 2XN9C 1GKHA 4JI5Q 2B63B 4RAUC 4KD3A 1V43A 2K5WA 1WYDA 3NWSA 1GVPA 3D6WA 3O13A 2JYOA 4A3BG 1HA6A 1WCMH 4CDFC 1EOVA 3PUWA 2EYMA 4K2KA 3X3MA 4JBWA 4ZKCB 4JI1Q 5CGKA 1JQYD 1U9RA 2NTTA 3QOLA 1KABA 4K8JA 2CFMA 2HCCA 5GROA 4DR7Q 1DGSA 3STBC 2K03A 4JI5L 2IY5B 3NENA 2VUMH 2R7ZH 2WKDA 1XJVA 1I4PA 4IFDH 1X3GA 1STGA 2Q2TA 2EDGA 4HR7B 2NVQH 5C4JB 3D31A 1VQNA 2N3SA 2YTXA 1AZPA 1A3TA 4J8QA 5J3BA 1HNWL 4A93B 2PW7A 5JJIA 3PUXA 3PUYA 4XQJA 3GV3A 4DV6Q 1JCKB 3V96A 3GTGB 2MFIA 3AFPA 3J7A5 3EA6A 1A3VA 4HSVA 1KHIA 3PQIA 1X9NA 4ZKBB 1IW7D 3E9IA 4OWTB 3VYUA 2KOLA 4YHHQ 2JQOA 1SNDA 2Y0SB 4NXNL 1IBLQ 2R92B 1AE2A 1WCMG 4BY1G 4HIOA 3KUPA 2F1MA 3BZKA 3HEJA 4KD4A 3ONAB 5COYA 1E1TA 4K5XA 4GS3A 4BY7B 4DK6C 1K8OA 1EY8A 3LGJA 2Z6BA 1C48A 1VQIA 4RMFA 3GTOH 2F0HA 1LT6D 3TP8A 2Z6KC 3N52A 2OWOA 1VQBA 1KD1C 2IT1A 1E2ZA 1FYCA 5LL6S 2XTIA 3FEWX 4XYOA 1Q46A 4O42A 3RZDH 1YJ9A 2K05A 5C0XH 1SMXA 1L1OB 5C4HA 1MSHA 3CCVA 1GO3E 4QUCA 3ULPA 4X3UA 1ICWA 3EFXD 3FHWA 1OO9B 1V1OA 2K5QA 1VQEA 5LMNL 3QO2A 1JWMD 4NDXA 4R4IA 4JI3Q 4DNRB 2Z1CA 1K3RA 2X6LA 5EPLA 3KF6A 1HTLD 1EY6A 1XX8A 1VQJA 2JA8B 1RDPD 3SGIA 2KUMA 4P74A 1ET9A 1O78A 3GTPB 5IGFA 1GHJA 1VQ9A 1PFMA 1SJHD 2B2YA 4EQ5A 2OCEA 2NBFA 4LF9Q 4BA2I 1GOZA 2Q8IB 4BY1H 1K0RA 2PNHA 1YHBA 4MTNA 1AN8A 2MGSA 3HOYB 2Z4IA 1Y8PB 3VYSA 1E2VA 1J5EQ 1PH9A 1N9WA 2VL6A 5CC4A 1VQGA 3MZ5A 3V2TA 4PNYA 3OSOA 2X6GA 2A68D 4PQXA 2PMZB 4DR7L 1Y1VB 1QB5D 3NHHA 1ZYRD 1XTDA 2AUJD 3L7ZC 3HKSA 5C0XG 3A8KE 3FVQA 1WTXA 1JOOA 1STNA 3K58A 5IGEA 1SYBA 1GUOA 2A19A 5GADC 3K80C 4Q5VA 5JJZA 3CCUA 4I7AA 1TS3A 3J80L 4DUYL 3A7LA 4LUZA 4POFA 3DLLA 1VQLA 2WAQE 1PTOH 1EY4A 1JB7A 2ALYB 1B3QA 1I6HH 3AMUA 1FGBD 1SYDA 1B1ZA 2HDLA 2ZXRA 1WOCA 1AZQA 4TQUS 1A8VA 2VXWA 1R9TB 2I07B 4C1NK 3HOZH 3M7GA 5CV7A 4B08A 1Y1WG 2A74C 2A5HA 2PQAA 1EFID 3BVGA 4AYBG 1K8GA 4B3ML 4A3GB 1CKOA 5KYLA 1JC7A 1Q90A 4BBRG 2DY7A 4DA2A 1UWVA 2EE1A 1TT2A 3G6EA 3OTOL 1TWCH 1UUPA 2GVBA 3S1QH 5FLXc 1B53A 4H13C 1D2BA 4PZ7A 5E4XA 1SNCA 4LF5L 1XPRA 4FF1A 4RKBA 1IBKL 2A1AA 2EZVA 2L11A 1CK1A 1W6JA 1CZGA 1BBUA 4PZ8A 5ELCA 3VYTA 2AWNA 3QWNA 4A3MG 3S15H 2NYZD 3VA5A 4QUFA 3N6RA 5IT9E 3S1NH 3K5OA 4XYQA 4HMIA 1QE6A 1A2TA 3KDFB 3CF5A 1LLRD 3TP7A 1STBA 1EYCA 2WAQG 3OOCA 3OMCA 1OXXK 3CU7A 2D5DA 4GN4B 5FLMG 4DV7Q 2SNSA 2OEOA 1NNXA 2FINB 3FPUB 2JA7G 1IYJB 1EFWA 4ZLTF 4DAVA 1DXMA 3HOZG 1WD1A 1WTRA 1HZAA 2F0NA 4AQYQ 5C4XG 3M4PA 4A3FH 4BBRH 2A8VA 4O0AA 2RBMA 2UXDQ 2TSSA 3VR6A 3UE0A 2A6EC 4LNQA 1HFNA 1S5BD 1J8IA 1EUJA 1LUZA 5C4ZA 5EJWA 4QF4A 2Z8LA 2E2IB 4RGOS 5I6YA 1BKBA 2Q2IA 1HNXL 4DR5L 4K6DA 2OTLA 2ZJRA 5L37A 3MHBA 4A3MH 1QVFA 3EIVA 1MHWC 4DV5Q 1BOSA 1N33L 5BR8L 2QKIC 4A3IG 1IKLA 4DAMA 4MTKA 1BCPF 2NTSA 1LTID 3NP8A 3GTMB 4KN4C 4UY8C 2KCCA 2OTJA 1SE3A 4HCEA 5D14A 4OWWB 2QEJC 3STBD 1P16A 5A35A 5ELOA 3JAME 3CXCA 5FLXL 1SROA 2B2WC 3DWPA 3R2IA 5C4XH 4A3CH 1QCBD 1V1PA 5IP9H 1I94L 4OX9Q 1QG7A 4A3FG 4A3KB 5IIFA 1NCVA 4M8AA 2MJ8A 3EJIA 2I5LX 3TSSA 2A6HC 2ZXPA 1MBYA 3A54A 4JI0L 4FF2A 4ZK9B 1PH4A 1TY0A 4FNFA 4R4CA 3G4SA 3GP7A 4BWGB 2VZAA 5G3LD 2D0OA 4BXXG 1EYDA 3DWQA 1OTCA 2QDLA 3T1YL 2Q8RE 5JPMC 3S16B 4A3GG 1SAPA 2K1BA 4DV2Q 2MP1A 4R8NA 1UEBA 4XQQA 4DUYQ 4A3DB 3R93A 4GLXA 2IW3A 3MAQA 1UE1A 5DEHA 4EQNA 2CW0D 3MTSA 4JI4Q 2R92H 1WD0A 5IYBH 3NBHA 4MN3A 1Q86C 2K04A 2KECA 3BVZA 4EX5A 4IPHA 1UE7A 1A15A 2EJGC 2B2YC 2RHQB 2AKWB 4JI1L 3T16A 5FJ8H 4C3IG 1WI5A 4WJ3M 2ZTCA 4X66Q 3CC4A 2EYHA 1VF5C 5CBAE 3DUZA 3GTOB 3SXHA 5CYUA 2H5XA 3S1MB 4A3CG 1IXRA 4O2DA 4GOPB 3VA7A 3S2DB 1RF2D 4QY7A 1GD7A 4C3HH 2HHHQ 3B6YA 4BY7G 2RA4A 1OXUA 1VCIA 4J15A 4F8MA 2K14A 1KAAA 4OEMB 2K33A 3WDNA 2F4VQ 2K32A 3VR5A 2CHBD 2KCTA 1UNSA 2WIIB 1KRTA 2YTVA 3UI2A 1BR9A 2JA6H 2MQHA 2E2DC 5CR3A 3KYHC 1HQMC 2RCNA 1EIHA 1G8ZD 4HAEA 4R4OA 4HJ8A 1FJGL 1VMCA 1F2ZA 5LMUL 1LT4D 5BR8Q 5M5WH 3TBIB 1HTPA 3GTLB 3QOJA 3HRZC 1RTNA 5A2QL 4C3IH 2KA7A 1B50A 1GUGA 2LKVA 2JA8G 5HGTA 1CKNA 3NXWA 2B8FA 2PZTA 2D2CC 2IPKD 4NB3A 4DXFA 4KHZA 1F77A 1KDCA 2E5LL 1D6EC 4JV5Q 3IL8A 4H44C 2DN8A 1XNRQ 2NZ1D 4DR2L 4GKKL 3HKZB 4JVZA 4S3SA 4LF8Q 3OW7A 2F4VL 4LFBQ 1LYLA 3BJUA 3CHBD 1U0LA 1STEA 4XIGS 3V05A 1KQSA 3NWTA 3MFYA 1CKNB 5DLQE 3DEPA 2AHOB 3P75A 3W5OA 3RLNA 1YHQA 4IFDI 3IFDA 2NWGA 3KBGA 3MXNB 4HJ9A 2NVQB 4IJLA 1MGSA 3CPWA 2R7FA 3UDXA 1CHQD 4FXDA 1XWEA 2UU9Q 3J81E 2PMZE 2TMPA 5I9OA 4X62L 1Z7TA 2L12A 1B44D 1XYIA 5ELDA 5E7NA 1KLUD 4PMBA 4I7ZC 1EU3A 4KY6A 1BNZA 2UUCL 4MZ9A 3I3CA 4JI8L 2M00A 1GUTA 3ITPA 5JEAH 2K5VA 3K5NA 3I4MG 3AQQA 4L5RC 2UXCQ 2F0DA 4H0LC 4LMQD 3I55A 3RMHA 4DU9A 4A4IA 1E22A 5FKAC 1EQQA 1STYA 2PQAB 1HRJA 2HDMA 1HZ9A 1C7YA 2R7DA 4MIUA 4LF6Q 2RCFA 4NXML 4U673 3J7AV 1PFBA 4JI0Q 1F2LA 3H3VC 4P71A 1YJWA 1I4QA 1A0IA 4LF7L 3CRLC 4HIKA 3DM3A 5CORA 4Q0FA 3HOYG 3C46A 5DNFA 2C5CA 3QR8A 1Y69U 1LV9A 1TWHB 5DM73 1HA5A 2E74C 2JEBI 5IGDA 1KNAA 1HCZA 1SJED 3M4YA 2C9OA 4JI7Q 3CCMA 4XTCS 2KCMA 1XNQQ 4X64L 1I50H 4IURA 1OXSC 1F9QA 4OO1H 3HOUH 4JBKA 2ZXOA 1BBWA 4IUUA 4KHPL 3J7AF 1Z9FA 3PO2G 3PO3B 1CUKA 2FHTA 3S1RB 4DAPA 1SNOA 1PRTC 1PYSB 2ENBA 3S2HB 3AYHB 3CCLA 4ODGA 1DOMA 4DK0A 2BE5C 1HH2P 3VR4A 3MXNA 4O1NA 1GHKA 3TZUA 2YTYA 1IBML 3KK7A 5EPJA 1LTSD 4V0BA 4A3LG 2E2HH 4UPAA 3GTJB 1DD2A 1IBKQ 5K36H 4BS9A 4JI6Q 1V8QA 4LF9L 3E9HA 3ER0A 1CHPD 4ME5A 3DWAA 1HFGA 3GDEA 4X64Q 2NN6I 4RHSA 2LS01 2M9VA 1G6ZA 1G291 4FXGC 3I4NG 2R6GA 3IFTA 1D8LA 2RDHA 4DN4M 5LHY1 2KHIA 1PDQA 3MVVA 4JI2Q 2F0MA 3X3NA 5LMNQ 2L5TA 3BVMA 1PTOC 1CQVA 2KJXA 2NN6G 2O2LD 3PO2H 4YY3L 4OWXB 2NVTH 2DUDA 1R9TH 1WTPA 1K28A 1B7YB 5IT9c 5IWAL 1H9SA 5IYCG 1B9MA 5HGQA 2VUMB 1S40A 3HG9A 1I4GA 1CTMA 4PMWA 2UXBQ 1VMPA 1RL2A 3CCJA 5K36G 3I4LA 3S1QB 2SDFA 2CCZA 5I9PA 1HPCA 1ILQA 3PO3H 1LT5D 1K73C 2Z0SA 4KN7C 4PMCA 1NMGA 5CMDA 1HNZQ 4XDXA 4JG2A 4ABNA 1JMCA 4JK1C 4POGA 1CT1D 4DAYA 1JOQA 3CCEA 4DV6L 2DJGC 3Q0AA 1VQAA 1HXYD 5IT9L 4GN5A 3TS0A 4AIMA 4IZ8A 2F0WA 2DJFC 3HOVB 4A3DG 4PG3A 1MI2A 2IJ0A 3GD7A 3H3VH 2NN6H 2F3WA 5DAUA 2IHFA 4DK3C 1EL0A 5ELEA 4C3JH 1XMOQ 1LABA 1EY5A 3H94A 3HKZG 5ELNA 3CC7A 2EY1A 5IGCA 1V9PA 1TIID 1QNKA 4CJ0B 5IYCH 1O80A 4HJAA 3Q6SA 5DM63 3RZDB 2YU9B 1MKHA 1F9SA 2MPMA 2JA6B 2E5LQ 1SMYD 2L0CA 2A69D 2WV6D 4KK7A 1X56A 4X62Q 4RCNA 1S5ED 1VQ8A 1W3SA 1YNXA 2EPBA 1LTAD 2Y0SE 3PO3G 2XVSA 3D6CA 2EY2A 2B3GA 3OWEB 3JAMc 2L1BA 1GUWA 1CFMA 1M1KC 3H91A 2VQEQ 1VQKA 1CI3M 2JA5H 2F0UA 4APVA 3MC0B 2AQ2B 1GXDC 2VQFL 2E2JB 4RGNA 4FDBA 2MHVA 4DV4Q 4A3FB 2E76C 1LO5D 5D3DA 3NPPA 2QGQA 1II3A 1CSPA 1VF7A 3LX0A 1ASYA 1PH3A 4X65Q 3LWEA 3ERQA 1FR3A 2A6ED 1PTOD 4IN3A 2Z4HA 5A2QE 2EYJA 3Q23A 2C35B 1L2FA 2F0EA 4L63B 1H9RA 1JWSD 4NXNQ 5C3WA 1STHA 4YHHL 3E6ZX 5AFWA 2GA4B 4A76A 1QOHA 4P2CB 4DGZA 1XNRL 1PHJA 3BZCA 5E1FA 2A69C 3JAML 1SBBB 4IUQA 5J39A 2GN5A 5CV4A 5C5LA 5T1IA 5M9OA 3GO5A 1BXTA 3I4NB 1A2UA 2NUCA 4OL7A 2QA4A 5C4XB 4ILWA 3GTPH 1HNWQ 3TN2A 1NJIC 1QJOA 1I6VC 1UAPA 1FGUA 1EZ6A 5C5MA 2VQEL 1Q81C 2G9DA 3HOXG 2LSSA 4TSSA 3PUVA 1Q12A 4B3TQ 4H7BA 1WTVA 4X66L 5G3LF 1CKMA 3KOJA 1B9NA 2XNAC 3D4DA 1Y1WB 2JA5G 5IYDG 4DUZL 1UE5A 3ULLA 4DR1Q 1JWUD 2H4OA 2KVMA 3MXGA 1U4RA 1VQMA 2EJFC 3HKZE 4P75A 3J81L 4R1JA 2HQEA 1JJ2A 3TP5A 1TWHH 1WTHA 2QEXA 1SE8A 1SNMA 2PNRC 1N34L 4Y7NH 1X3FA 1N32L 2LY7A 4TRDA 3TQYA 4YCVA 3U4VA 2ZTEA 3AB9A 2LXJA 1P8LA 5EKLA 2PCFB 3M4OB 4HSPA 1N36L 4IOCA 3E5SA 3M3YH 2ZTDA 2OQKA 4DR3Q 3I4MB 2OQ0A 2F03A 2HCIA 1NE3A 3F2UA 4CGYB 4ME3A 1PZKD 2EXZA 4R8IA 1O7ZA 1ZXTA 2PO4A 2Q8TA 1I6HB 1ZKOA 4K2LA 3CP0A 3RZOH 2RKSA 4HJ5A 2NVXH 2ZJQA 3RLFA 3NUCA 3HOXH 1T5EA 5C0XI 3Q8DA 4F7XA 3F2DA 4JCVE 3FDTA 4UDUC 5IYDH 3PIO3 3BS1A 4QL5A 2EXDA 1CZWA 5JPNC 4QGUA 1I50B 4C2MH 2HUGA 1RIPA 1T9HA 5C3EB 4GOPC 3G6JB 4QCLA 2WACA 1HUNA 2EVBA 1TWCB 4C3HB 1XTCD 1PFNA 4N9TA 1K8AC 2AQ3B 2CH4A 4UP7A 1BVSA 1NMFA 2OT2A 3GTLH 2BA1A 1IL2A 4G7OC 4WJ4A 5D65A 2RSNA 4RG1A 4DAYB 1EYAA 1I3QB 1X3EA 1BO0A 1VQHA 1PH8A 1UE6A 4OIJA 1FNVA 4CBVA 5KGUA 4LW1A 4NP5A 5C44H 3J80c 5EGTA 2UXDL 1FD7D 3M85A 1O7YA 4H02A 4RKLA 4MNOA 1SE2A 3S14B 4BBSG 3A8IE 3MXPA 3KDFA 4F87A 3E0JA 3PSIA 1F2MA 1Q3LA 1EWIA 4YCUA 2E8GA 4HJ7A 1N33Q 2MO0A 1PTOF 4L6TB 2KBNA 3K5MA 3NK9A 4KY5A 3U50C 4DV1Q 4ZAIA 2CW0C 2NVYB 3KF6B 2DY8A 4LUVA 1B4OA 3PF4A 2I46A 2KENA 3ND9A 2V4DA 2K01A 1RTOA 3K57A 4JI6L 4XT3B 3P7JA 1U4MA 3H6MA 4KI0A 3P1HA 1C4QA 1X55A 2JN4A 1PZJD 1QVCA 2IX3A 1TWFB 2HIVA 3KLRA 4UHVA 4A3KH 4DF7A 3UDIA 3MXUA 3A74A 1X3PA 3W1BA 1JJGA 2BCOA 2E75C 1Q82C 4B3SQ 3EVQA 4CKBA 1Q8IA 1ENAA 1Z6HA 4BBSH 1JORA 1KNEA 5KNCA 2K7VA 1ONLA 3DEOA 2WFWA 1EEID 1BDOA 5IOCA 1MJCA 3J81j 3NBIA 4DV7L 5BN4A 4WRDA 4HIDA 1K0SA 1MJEA 2MO1A 1SDFA 4EQOA 3AFQA 1ILPA 4MHEA 2ICIA 3KJOA 1Q7YC 5M5XH 3CD6A 3I72A 3PMFA 3I4OA 5KIXA 2RDGA 5TSSA 3ICEA 1DOKA 1SE4A 2DNCA 1TS5A 4NW2A 2KHJA 2WP8J 4A3EG 5LL6X 3PUZA 3J81c 3RUZA 1L0WA 1D5XC 4GNXB 5C0XJ 4A3KG 3BDOA 4LF4L 3HOUB 2F0PA 2F4IA 2N8NA 1B8AA 1YVCA 3R2TA 4KY7A 4OO1I 5FLMH 1ZEQX 2B2WA 4UP9A 3F2CA 4HMJA 3I7FA 1EY0A 4GLVB 3S2HH 1IZ6A 2LFNA 1N36Q 4J6HA 2WKCA 4RFBA 4OXPA 1JE5A 3D3RA 2JA5B 2KEDA 1X54A 1CA5A 4P72A 3K0XA 4LJZC 4Y52H 1IYVA 3S2DH 2EQSA 2SOBA 3F8TA 4G57A 1GUNA 2N88A 3QG1A 4I65A 4LFBL 5E3FA 1IL8A 2P5ZX 3K7UC 4KJOA 4ZRZA 3OMGA 4ID6A 2F0KA 1PLFA 2DGYA 3D0FA 5BN3A 4C3IB 4JI8Q 2UUBL 1I4HA 1PMRA 1L0YB 1TWAB 4FF4A 4N8FA 4ZUIA 2F0FA 1D5ZC 1S3OA 4A3IB 3I2ZA 4A3BH 1XPOA 1YNJC 1NBWA 2B2TA 2UU9L 1E24A 4DR2Q 4GKKQ 4DR6Q 1FNUA 5C3XA 4UAIA 3K59A 1SYCA 2F0LA 4DFAA 1F2YA 1TS2A 3J80i 4M1UB 3H15A 1OXTA 1X6OA 1FJGQ 1EQRA 3SR1A 1YNND 2ZT9C 3BDCA 5IGGA 5JJKA 1QNUA 3SDZA 1WTQA 1B2TA 3M3YB 2F0VA 4X3KA 1SRUA 3CRKC 3HOVG 1E7ZA 4IUPA 4IFDG 1G2TA 1O7LA 1EY9A 1KTKA 5I2XA 1SEBD 4OELB 3ERSX 1K83H 3NQTA 1IBLL 3CKIB 2UUAQ 1QILA 2B2VC 2CKZB 2FJ2A 4WFN3 3VDYA 2JP1A 3HOXB 3L2PA 4JV5L 3D8GA 1HUMA 3CCRA 2QF7A 3HP3A 1G2SA 4LFCQ 2Q2UA 2XRSD 4HCSA 1IW7C 4C2MB 1PXUA 3OIPA 4R9WA 1JT8A 2SEBD 3KFUA 1ASZA 1V1QA 2IWHA 1C9OA 2R92G 2Z6KA 1VQDA 4DV4L 3CCSA 3S17H 4C3JB 1EIGA 3CMEA 3DMUA 3VR3A 2VQFQ 5NUCA 3K0YA 3RR5A 2LXKA 5FJ8G 1L1OA 2I0QA 4IQZA 4QQBX 3FKIH 2UUCQ 2CQAA 1G51A 3HOVH 1XXGA 5JEAJ 1Y1VH 3MEFA 4OIKA 1QZGA 2ES2A 1PZID 2A6HD 3IRBA 3DHQA 2R93B 4G7HC 3I91A 2K52A 4DR3L 2K5DA 3NTHA 1RJTA 2N78A 3W1GA 4GKJL 1XMQL 1GM5A 4IUVA 2EIFA 5JVH3 3T1YQ 1AH9A 3VR2A 1VQ5A 1SN8A 1Q1BA 1I4XA 5KRUA 1PTOB 3HGBA 4RGMA 1EIFA 4L5TA 1TKWB 1EYGA 1W6KA 3CQZH 4JI4L 1M8AA 2WB1E 3PIP3 3BG3A 2BDOA 4FO2A 5C6AA 1TWFH 1HNZL 1IHZA 2O4XA 4LFAQ 4CJ1B 1E3PA 3OWFA 3FKIG 4CDEC 1PV4A 1I4RA 3ULJA 1KAWA 1H9KA 4IFDJ 1Y1VG 4KHVA 1TQOA 2FMCA 3SK8A 3WOEA 4F88A 1YJNA 4DR4L 2D0PA 5LMUQ 2NVYH 1ML0D 5IE8A 1LACA 3RLOA 1STAA 4A93H 4JI2L 2PQEA 1E0BA 1I94Q 1WTWA 4OX9L 2BA0A 1T5XD 4OGQC 3QB3A 4LUOA 2B2VA 3RD4A 2RF4A 5T1GA 4YY3Q 1EEFD 1PRTD 3C1FA 1ESRA 1FNWA 3DM1A 2Z9HA 2O5IC 1MIUA 4NKLA 3PO2B 3GV6A 2X69A 3BU2A 4EQPA 3L0OA 1B70B 2B39A 3EN2A 1LTBD 1FL0A 4KV6A 5BN5A 4JPBW 4K5VA 5I6WA 3EROA 2UUAL 4CJ2C 5M3FB 1CQFA 3UDFA 1Y1WH 3DXJC 1EU4A 3L3OC 3E3XA 1PRTF 4FP5D 5IP7G 2IX1A 3EQLC 1MD2D 1VQFA 1KC8C 4BBRB 5JEAG 3NE5B 4RCOA 3I4MH 1YZ6A 3TDQA 4B9WA 1DZ1A 1R4PB 2ICEC 1BCPC 5M5XB 2UUBQ 4E6IA 4KHPQ 1F9RA 3CQZB 5FOBB 3AU7A 4A93G 1F9PA 1LTGD 1WTOA 3R8BA 4DV2L 1VQOA 2F0JA 1Z47A 4N9PA 3I56A 4AQYL 3F1ZA 3J80E 4HN7A 4PZ6A 1IYUA 5FO9B 4ULLA 2M2LA 3GTKB 2O5JC 3BYTB 1H9SB 2HT1A 1GJXA 4GNXC 2MUYA 2WB1G 2VNUD 3RZOB 3IKJA 2NVXB 5IODA 3HOYH 2JA7H 1TXYA 1TWGB 1SNPA 3OHXC 5E4WC 3T53B 1JB3A 4PV1C 1S5FD 1YITA 4DV0L 1JR0D 5ELFA 1S72A 3L9AX 2CWAA 4LF6L 4WJWA 4A3EB 4IO9A 2PZUA 1Y8NB 4LAAA 2YU9H 3E0EA 1NR4A 2RHSB 4IALA 5CV8A 5IP7H 4DPGA 4DV3L 2D62A 2L15A 1HHVA 1L0XB 3UDGA 4DNIA 5K5PA 3HOUG 2A68C 4LF5Q 3NTIA 2F0QA 3J7YW 4YCWA 4KKUA 2ZM6Q 2L55A 4R4QA 2UXBL 3HOWB 3S14H 5EQ0A 2XWBB 1H95A 5CV9A 1Q1EA 3H0GB 1AE3A 2VB3X 1IKMA 1YBYA 1K3BC 2DNEA 1DONA
chains in the Genus database with same CATH topology
1SNQA 2A73B 2OXPA 3K5LA 2XSCA 4KTAA 1RKNA 1X32A 5J1ZA 2JSOA 5IGBA 4ZQ3A 4B9XA 2QILA 1H9JA 2CVRA 3TZDA 1G91A 1BCPB 5EKIA 1KDAA 3NSWA 3MFGA 1TU2B 2R7ZB 3U9OA 1E2WA 3W3AA 1WCMB 3QJYA 1K83B 1JOKA 4K6LA 5CBEE 3T56B 3LWUA 4RWSC 3D4RA 1NAPA 2F0OA 4C1NI 3C3LA 3IAYA 4X3TA 4HEDA 2RQXA 5JVG3 2J0TD 3P20A 4FYDA 2SNMA 1V1PB 3SEBA 2EJMA 2PW5A 2N55A 2EYPA 5I4DA 1X3QA 3URYA 1BBXC 1S5DD 2RSOA 4Y7NB 3T13A 2VB2X 1ESFA 3HS0C 2JEAI 1SYEA 2L4NA 4QIWB 1ENCA 1WVLA 4KKTA 1RD9D 3T51B 3KF8A 4DXGA 1B3AA 1UEAB 1EQTA 1R4QB 1DJRD 1AFPA 3C1EA 3A8JE 3OIQA 4C3HG 1KDBA 4DK1A 4C3JG 2KEEA 4YIJA 1SYGA 3BDLA 1K8MA 4L8JA 4RA8A 5ELBA 2F0IA 4A3MB 4XQNA 2JE6I 3FPPA 1D1KA 5M3MB 2H1EA 4RGTA 1TR5A 3K7AB 4IUNA 1ENFA 4K5WA 3FMCA 2B2UC 2IL8A 5C44B 3NQIA 4A3BB 2D9UA 2AQ1B 2WINB 2BE5D 1D5MC 2EOTA 2PYKA 5FLXE 5FO7B 1EQVA 1RODA 4V190 2F0SA 1LTTD 2B2UA 2WB1B 4EGVA 3KBXA 1M4VA 2BDNA 3C2PA 5KYIA 3T4AC 2JXMB 4CKCA 1NR2A 3SK4A 4NMZA 1SFOB 3GQBA 1DOLA 3K6OA 3SE0A 2XRQD 4K14A 4U68A 1EZ8A 2AWOA 2PZWA 1H9MA 3KLSA 2KCNA 4RHRA 2JA7B 1RHPA 1ZYRC 1C8CA 4BBSB 3BYYB 4CHTB 2EYLA 4QB4A 3TP6A 3A56A 3S17B 3HOZB 2J4XA 1JE4A 5CV6A 5JOBA 3TMEA 2EY5A 1EWHA 1LT3D 3FRPB 3S1NB 4KKSA 1NSNS 1HQRD 2ID0A 3MWYW 3KLSX 1EWCA 2BOSA 5ISRA 5M5WB 2XIWA 4XXEA 3G7LA 3LNNA 3S15B 1TS4A 1SYFA 3D4WA 4OO1G 1PYWD 4HTHA 2NB0A 1EOTA 4QMGA 2K6AA 3SK5A 1DYQA 2J7ZA 3W2DA 1J9OA 2K28A 3QIAA 5EKKA 1YNJD 1CA6A 2AUKA 1S5CD 3BZDB 3M7NA 4LK1C 1AEXA 1SSOA 2EY6A 4OHJA 4X3SA 1U4PA 1DM0B 1VDZA 4KJNA 4BY1B 1MSGA 1SMYC 1YNNC 2WAQB 3WOFA 4XT1B 3MA2B 4FXKC 1U4LA 5KNDA 4EVOA 5I2YA 3OPOA 4CKEA 2B8GA 1PRTB 4KMUC 1GUSA 3SK6A 5F2DA 2R3ZA 5EBCA 2XWJB 4RH6A 2L9HA 3HZXA 5M5YB 4AYBB 1OXVA 1JICA 1AW7A 1D1IA 4K8IA 1TY2A 1S4ZA 2QCPX 4C56C 2FFKB 1RCVD 5HURA 3NTKA 1SXTA 2EYFA 5KEEA 3A7AB 3SVMA 4DNTB 3MEHA 3I70A 3ZYYX 1CM9A 1A6XA 4ZUJA 3GTQB 4A3JB 1A3UA 3I8ZA 3S9WA 1EY7A 3SHLA 5CV5A 2F0GA 5FK9C 3I73A 3R3OA 3U9SA 1TVXA 3PV0A 5EBDA 2F3VA 2R61A 3A55A 4TKOB 1LTRD 1ET6A 2IX0A 4ZYSA 1BQQT 4G4KA 4Z9CB 4FF3A 3H09A 4GZYC 2LMCB 1AP0A 4J1MA 4BA1I 1KLGD 2YYZA 3Q22A 5JAVA 2QDBA 4WORA 5EPKA 1QWYA 5J22A 3FKIB 3ND8A 2B2TC 3VYRA 2OF1A 5KNBA 2E2HB 1NUCA 2G9HD 4G7ZC 5D3IB 4FVMA 1DCZA 2FMMA 1Y8OB 2NVTB 2F0TA 2EYOA 2RDFA 2PPBC 2RVLA 1BCPD 4IUTA 2KQ3A 1BF4A 3I90A 5FO8B 2KHSA 1BUVT 3Q24A 2XN9C 2B63B 4RAUC 4KD3A 1V43A 2K5WA 3NWSA 3O13A 3D6WA 2JYOA 1HA6A 3PUWA 2EYMA 4K2KA 3X3MA 4JBWA 4ZKCB 5CGKA 1JQYD 1U9RA 2NTTA 3QOLA 1KABA 4K8JA 2HCCA 2K03A 2WKDA 1I4PA 4IFDH 1STGA 2EDGA 4HR7B 5C4JB 3D31A 1AZPA 1A3TA 4J8QA 4A93B 2PW7A 3PUXA 3PUYA 4XQJA 3GV3A 1JCKB 3V96A 3GTGB 3EA6A 1A3VA 4HSVA 4ZKBB 1IW7D 3VYUA 2KOLA 2R92B 1SNDA 2Y0SB 3KUPA 2F1MA 3HEJA 4KD4A 3ONAB 5COYA 4K5XA 4BY7B 1K8OA 1EY8A 1C48A 2F0HA 1LT6D 3TP8A 3N52A 2IT1A 1E2ZA 1FYCA 5LL6S 3FEWX 4XYOA 4O42A 2K05A 5C0XH 5C4HA 1MSHA 4QUCA 4X3UA 1ICWA 3EFXD 1OO9B 1V1OA 2K5QA 3QO2A 1JWMD 4NDXA 4DNRB 2Z1CA 2X6LA 5EPLA 1HTLD 1EY6A 1XX8A 2JA8B 1RDPD 2KUMA 1ET9A 1O78A 3GTPB 5IGFA 1GHJA 1PFMA 1SJHD 2B2YA 2NBFA 4BA2I 1GOZA 2Q8IB 1AN8A 2MGSA 3HOYB 2Z4IA 1Y8PB 3VYSA 1E2VA 5CC4A 3V2TA 3MZ5A 4PNYA 3OSOA 2X6GA 2A68D 4PQXA 2PMZB 1Y1VB 1QB5D 3NHHA 1ZYRD 2AUJD 3L7ZC 5C0XG 3A8KE 3FVQA 1WTXA 1JOOA 1STNA 3K58A 5IGEA 1SYBA 1GUOA 4Q5VA 5JJZA 1TS3A 3J80L 3A7LA 1PTOH 1EY4A 3AMUA 1FGBD 1SYDA 1B1ZA 2HDLA 2ZXRA 1AZQA 4TQUS 2VXWA 1R9TB 2I07B 4C1NK 3M7GA 5CV7A 4B08A 2A74C 2A5HA 3BVGA 1EFID 4A3GB 5KYLA 1JC7A 1Q90A 2DY7A 4DA2A 2EE1A 1TT2A 1UUPA 1B53A 4H13C 1D2BA 5E4XA 1SNCA 4FF1A 4RKBA 2EZVA 2L11A 1CK1A 1W6JA 1CZGA 5ELCA 3VYTA 2AWNA 3QWNA 2NYZD 3VA5A 4QUFA 3N6RA 5IT9E 3K5OA 4XYQA 4HMIA 1QE6A 1A2TA 1LLRD 3TP7A 1STBA 1EYCA 3OOCA 3OMCA 1OXXK 3CU7A 2D5DA 2SNSA 2OEOA 2FINB 3FPUB 4ZLTF 4DAVA 1DXMA 1WD1A 1WTRA 2F0NA 2RBMA 2TSSA 3VR6A 2A6EC 1HFNA 1S5BD 1J8IA 5C4ZA 5EJWA 4QF4A 2Z8LA 2E2IB 4RGOS 5I6YA 4K6DA 3MHBA 1BOSA 2QKIC 1IKLA 1BCPF 2NTSA 1LTID 3NP8A 3GTMB 4KN4C 2KCCA 1SE3A 4HCEA 5D14A 2QEJC 5A35A 3JAME 5FLXL 2B2WC 3DWPA 3R2IA 1QCBD 1V1PA 1QG7A 4A3KB 5IIFA 1NCVA 4M8AA 2MJ8A 3EJIA 3TSSA 2A6HC 2ZXPA 1MBYA 3A54A 4FF2A 4ZK9B 1TY0A 4FNFA 3GP7A 4BWGB 5G3LD 1EYDA 3DWQA 2Q8RE 5JPMC 3S16B 1SAPA 2K1BA 2MP1A 4R8NA 4XQQA 4A3DB 3R93A 2IW3A 3MAQA 4EQNA 5DEHA 2CW0D 3MTSA 1WD0A 3NBHA 4MN3A 2K04A 2KECA 3BVZA 2EJGC 1A15A 2B2YC 3T16A 4C3IG 2EYHA 5CBAE 3GTOB 1VF5C 3DUZA 3SXHA 5CYUA 3S1MB 3S2DB 3VA7A 1RF2D 2RA4A 1OXUA 1VCIA 4F8MA 1KAAA 2K33A 3WDNA 2K32A 3VR5A 2CHBD 1UNSA 2WIIB 3UI2A 1BR9A 2E2DC 5CR3A 1HQMC 1EIHA 1G8ZD 4HAEA 1VMCA 1F2ZA 1LT4D 3TBIB 1HTPA 3GTLB 3QOJA 3HRZC 1RTNA 5A2QL 2KA7A 1B50A 1GUGA 2LKVA 5HGTA 3NXWA 2B8FA 2PZTA 2D2CC 2IPKD 4DXFA 4KHZA 1F77A 1KDCA 1D6EC 3IL8A 4H44C 2DN8A 2NZ1D 3HKZB 4S3SA 3OW7A 3CHBD 1STEA 4XIGS 3V05A 3NWTA 3MFYA 3DEPA 3P75A 4IFDI 3IFDA 2NWGA 3KBGA 2NVQB 1MGSA 1CHQD 4FXDA 1XWEA 3J81E 2TMPA 5I9OA 1Z7TA 2L12A 1B44D 1XYIA 5ELDA 1KLUD 4PMBA 4I7ZC 1EU3A 4KY6A 1BNZA 3I3CA 2M00A 1GUTA 3ITPA 5JEAH 3K5NA 2F0DA 4H0LC 4LMQD 3RMHA 4DU9A 5FKAC 1STYA 1HRJA 2HDMA 4MIUA 4U673 3J7AV 1PFBA 1F2LA 3H3VC 1I4QA 3CRLC 5CORA 4Q0FA 3C46A 5DNFA 2C5CA 1Y69U 1TWHB 1LV9A 5DM73 1HA5A 2E74C 2JEBI 5IGDA 1KNAA 1HCZA 1SJED 3M4YA 2C9OA 4XTCS 4IURA 1OXSC 1F9QA 4OO1H 2ZXOA 4IUUA 3J7AF 3PO3B 2FHTA 3S1RB 4DAPA 1SNOA 1PRTC 2ENBA 3S2HB 4ODGA 1DOMA 4DK0A 2BE5C 3VR4A 3MXNA 4O1NA 1GHKA 3TZUA 3KK7A 5EPJA 1LTSD 4V0BA 3GTJB 1DD2A 5K36H 4BS9A 1V8QA 1CHPD 4ME5A 3DWAA 1HFGA 2NN6I 4RHSA 2LS01 2M9VA 1G6ZA 1G291 4FXGC 2R6GA 3IFTA 2RDHA 4DN4M 5LHY1 1PDQA 3MVVA 2F0MA 3X3NA 2L5TA 3BVMA 1PTOC 1CQVA 2KJXA 2NN6G 2O2LD 1WTPA 1H9SA 1B9MA 2VUMB 3HG9A 1I4GA 1CTMA 4PMWA 1VMPA 5K36G 3I4LA 3S1QB 2SDFA 5I9PA 1HPCA 1ILQA 1LT5D 4KN7C 4PMCA 5CMDA 4XDXA 4ABNA 4JK1C 1CT1D 4DAYA 1JOQA 3Q0AA 1HXYD 5IT9L 4IZ8A 2F0WA 3HOVB 1MI2A 2IJ0A 3GD7A 2NN6H 2F3WA 5DAUA 1EL0A 5ELEA 1LABA 1EY5A 3H94A 2EY1A 5IGCA 1TIID 1QNKA 4CJ0B 1O80A 3Q6SA 5DM63 3RZDB 2YU9B 2MPMA 1F9SA 2JA6B 1SMYD 2L0CA 2A69D 2WV6D 4KK7A 4RCNA 1S5ED 2EPBA 1LTAD 2XVSA 3D6CA 2EY2A 3OWEB 1GUWA 2L1BA 1CFMA 3H91A 1CI3M 2F0UA 3MC0B 2AQ2B 1GXDC 2E2JB 4RGNA 2MHVA 4A3FB 2E76C 1LO5D 5D3DA 3NPPA 1II3A 1VF7A 3LX0A 3LWEA 3ERQA 1FR3A 2A6ED 1PTOD 4IN3A 2Z4HA 5A2QE 2EYJA 3Q23A 2F0EA 4L63B 1H9RA 1JWSD 5C3WA 1STHA 3E6ZX 5AFWA 2GA4B 1QOHA 4P2CB 4DGZA 5E1FA 2A69C 3JAML 1SBBB 4IUQA 5J39A 5C5LA 5M9OA 5CV4A 5T1IA 3GO5A 1BXTA 3I4NB 1A2UA 2NUCA 4OL7A 5C4XB 4ILWA 3TN2A 1QJOA 1I6VC 1UAPA 1EZ6A 5C5MA 2G9DA 4TSSA 3PUVA 1Q12A 4H7BA 1WTVA 5G3LF 1B9NA 2XNAC 3D4DA 1Y1WB 1JWUD 2H4OA 2KVMA 3MXGA 1U4RA 2EJFC 3J81L 2HQEA 3TP5A 1SNMA 2PNRC 2LY7A 4TRDA 3AB9A 5EKLA 2PCFB 3M4OB 4HSPA 3E5SA 3I4MB 2F03A 2HCIA 3F2UA 4CGYB 4R8IA 1PZKD 2EXZA 1O7ZA 1ZXTA 2PO4A 2Q8TA 1I6HB 1ZKOA 4K2LA 2RKSA 3RLFA 3NUCA 1T5EA 5C0XI 4F7XA 3FDTA 4UDUC 3PIO3 3BS1A 1CZWA 5JPNC 1I50B 2HUGA 5C3EB 3G6JB 4QCLA 2WACA 1HUNA 2EVBA 1TWCB 4C3HB 1XTCD 1PFNA 4N9TA 2AQ3B 2OT2A 2BA1A 4G7OC 5D65A 2RSNA 1EYAA 1I3QB 1BO0A 4OIJA 1FNVA 4CBVA 5KGUA 4NP5A 5EGTA 1FD7D 3M85A 1O7YA 4RKLA 1SE2A 3S14B 3A8IE 3MXPA 4F87A 3E0JA 1F2MA 1Q3LA 1PTOF 4L6TB 3K5MA 3NK9A 4KY5A 4ZAIA 2CW0C 2NVYB 2DY8A 1B4OA 2I46A 3ND9A 2V4DA 2K01A 1RTOA 3K57A 4XT3B 3P7JA 1U4MA 3H6MA 4KI0A 3P1HA 1C4QA 1PZJD 2IX3A 1TWFB 3KLRA 4DF7A 3MXUA 1X3PA 2BCOA 2E75C 3EVQA 4CKBA 1Q8IA 1ENAA 1Z6HA 1JORA 1KNEA 5KNCA 2K7VA 1ONLA 3DEOA 1EEID 1BDOA 5IOCA 3NBIA 5BN4A 4WRDA 1SDFA 4EQOA 1ILPA 4MHEA 2ICIA 3I72A 3PMFA 5KIXA 2RDGA 5TSSA 1DOKA 1SE4A 2DNCA 1TS5A 4NW2A 2WP8J 5LL6X 3PUZA 3RUZA 1D5XC 5C0XJ 3BDOA 3HOUB 2F0PA 2F4IA 3R2TA 4OO1I 4KY7A 1ZEQX 2B2WA 4HMJA 1EY0A 2LFNA 4J6HA 2WKCA 4RFBA 3D3RA 2JA5B 2KEDA 1CA5A 4LJZC 1IYVA 2SOBA 4G57A 1GUNA 2N88A 3QG1A 4I65A 5E3FA 1IL8A 4KJOA 4ZRZA 3OMGA 4ID6A 2F0KA 1PLFA 5BN3A 4C3IB 1I4HA 1PMRA 1L0YB 1TWAB 4FF4A 4ZUIA 2F0FA 1D5ZC 4A3IB 1YNJC 2B2TA 1FNUA 5C3XA 4UAIA 3K59A 1SYCA 2F0LA 4DFAA 1F2YA 1TS2A 4M1UB 1OXTA 3SR1A 1YNND 2ZT9C 3BDCA 5IGGA 1QNUA 3SDZA 1WTQA 1B2TA 3M3YB 2F0VA 4X3KA 3CRKC 4IUPA 4IFDG 1G2TA 1O7LA 1EY9A 1KTKA 5I2XA 1SEBD 3NQTA 3CKIB 1QILA 2B2VC 2FJ2A 4WFN3 2JP1A 3HOXB 3D8GA 1HUMA 2QF7A 3HP3A 1G2SA 2XRSD 4HCSA 1IW7C 4C2MB 1PXUA 3OIPA 4R9WA 2SEBD 2IWHA 4C3JB 1EIGA 3DMUA 3VR3A 5NUCA 3K0YA 4IQZA 2CQAA 1XXGA 5JEAJ 4OIKA 1PZID 2A6HD 3DHQA 2R93B 4G7HC 3I91A 2K5DA 3NTHA 1RJTA 4IUVA 5JVH3 3VR2A 1Q1BA 1I4XA 5KRUA 1PTOB 3HGBA 4RGMA 1TKWB 1W6KA 1M8AA 3PIP3 3BG3A 2BDOA 4FO2A 5C6AA 1IHZA 2O4XA 4CJ1B 3OWFA 1I4RA 1H9KA 4IFDJ 4KHVA 1TQOA 2FMCA 3SK8A 3WOEA 4F88A 1ML0D 1LACA 1STAA 2PQEA 1E0BA 1WTWA 2BA0A 1T5XD 4OGQC 3QB3A 3RD4A 2B2VA 5T1GA 1EEFD 1PRTD 3C1FA 1ESRA 1FNWA 3DM1A 3PO2B 2O5IC 4NKLA 3GV6A 2X69A 4EQPA 2B39A 1LTBD 4KV6A 5BN5A 4K5VA 5I6WA 3EROA 4CJ2C 5M3FB 1CQFA 3DXJC 1EU4A 3L3OC 1PRTF 4FP5D 2IX1A 3EQLC 1MD2D 4BBRB 5JEAG 3NE5B 4RCOA 3TDQA 4B9WA 1DZ1A 1R4PB 2ICEC 1BCPC 5M5XB 4E6IA 1F9RA 3CQZB 5FOBB 3AU7A 1F9PA 1LTGD 1WTOA 3R8BA 2F0JA 1Z47A 4N9PA 3J80E 4HN7A 1IYUA 5FO9B 4ULLA 2M2LA 3GTKB 2O5JC 3BYTB 1H9SB 1GJXA 2MUYA 2VNUD 3RZOB 3IKJA 2NVXB 5IODA 1TWGB 1SNPA 3OHXC 5E4WC 3T53B 1JB3A 4PV1C 1S5FD 1JR0D 5ELFA 3L9AX 4WJWA 4A3EB 2PZUA 1Y8NB 4LAAA 1NR4A 4IALA 5CV8A 2D62A 1HHVA 1L0XB 5K5PA 2A68C 3NTIA 2F0QA 3J7YW 4KKUA 2L55A 3HOWB 5EQ0A 2XWBB 5CV9A 1Q1EA 3H0GB 2VB3X 1IKMA 2DNEA 1DONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CV6 A;  3NXW A;  4KY7 A;  1SNQ A;  3MXP A;  5JOB A;  2EY5 A;  2EYO A;  3TME A;  1JOQ A;  2PZT A;  2RDF A;  5IIF A;  2OXP A;  3HZX A;  4NKL A;  3D4D A;  4HMJ A;  4EQP A;  1KDC A;  3EJI A;  1SNC A;  1EY0 A;  4IZ8 A;  2F0W A;  4NDX A;  2KQ3 A;  1RKN A;  4KTA A;  1F2M A;  3DMU A;  2KHS A;  4J6H A;  4RKB A;  5NUC A;  4KV6 A;  1NSN S;  4K5V A;  4KD3 A;  1EY6 A;  2F3W A;  3ERO A;  5J1Z A;  4S3S A;  5I6W A;  1TR5 A;  4K8I A;  1SNO A;  5DAU A;  5IGB A;  1JOR A;  2ENB A;  3VA5 A;  1EYD A;  5ISR A;  2HQE A;  5IGF A;  4ZQ3 A;  4ODG A;  3NK9 A;  4KY5 A;  4IUN A;  4HMI A;  3TP5 A;  1A2T A;  1EY5 A;  4B9X A;  2EYM A;  2EY1 A;  4K2K A;  5IGC A;  2SOB A;  3TP7 A;  1SNM A;  1STB A;  1KDA A;  1EYC A;  4G57 A;  5CGK A;  1U9R A;  4R8N A;  3OMC A;  3QOL A;  4I65 A;  1KAB A;  4K8J A;  4K5W A;  3DHQ A;  4TRD A;  5E3F A;  5HUR A;  4KJO A;  3OMG A;  4ID6 A;  3P75 A;  3U9O A;  2F0K A;  2EYF A;  2SNS A;  3MEH A;  5DEH A;  4B9W A;  2OEO A;  1SYF A;  4EQN A;  5KEE A;  3H6M A;  4E6I A;  5EKL A;  3D4W A;  1JOK A;  3P1H A;  4ZUJ A;  3E5S A;  4HTH A;  5CC4 A;  3V2T A;  3MZ5 A;  1A3U A;  4PNY A;  3OSO A;  3S9W A;  1EY7 A;  4QMG A;  3SHL A;  3T16 A;  2F0N A;  2F0G A;  2F0O A;  4ME5 A;  5CV5 A;  4ZUI A;  4DF7 A;  3R3O A;  2F0F A;  3SK5 A;  2EXZ A;  1STG A;  2EYH A;  3NHH A;  5I9O A;  2F0J A;  4N9P A;  3D6C A;  2EY2 A;  4K2L A;  2F3V A;  3SXH A;  2RKS A;  5KRU A;  2RBM A;  3NUC A;  4PMB A;  4KY6 A;  3EVQ A;  1JOO A;  1STN A;  5EKK A;  2SNM A;  2F0U A;  5C3X A;  1ENA A;  2PYK A;  2M00 A;  1A3T A;  1SYC A;  2F0L A;  3ITP A;  1SYB A;  1F2Y A;  2PW5 A;  4DFA A;  3MVV A;  4F7X A;  1EQV A;  5C4Z A;  2EYP A;  2F0M A;  2PW7 A;  4QF4 A;  5IOC A;  5I6Y A;  1AEX A;  2F0S A;  5IOD A;  2EY6 A;  4WRD A;  3SR1 A;  1II3 A;  1SNP A;  2F0D A;  3BDC A;  3LX0 A;  4K6D A;  5IGG A;  4KJN A;  3T13 A;  4EQO A;  4F8M A;  1A3V A;  3ERQ A;  4DU9 A;  5C6A A;  2F0V A;  1IHZ A;  1KAA A;  2O4X A;  2WAC A;  1SYE A;  3MHB A;  3OWF A;  1STY A;  1EY9 A;  1EY4 A;  2EYJ A;  1SND A;  2PZU A;  2F0E A;  5KYI A;  4LAA A;  1ENC A;  3NQT A;  4N9T A;  5C3W A;  1STH A;  3HEJ A;  4IAL A;  4KD4 A;  5CV8 A;  4NMZ A;  3SK4 A;  4KHV A;  4EVO A;  1TQO A;  1SYD A;  4MIU A;  4K5X A;  3PMF A;  5CR3 A;  3SK8 A;  4DGZ A;  4J1M A;  4RKL A;  5K5P A;  5E1F A;  5KIX A;  3D8G A;  1EY8 A;  5J39 A;  3C1E A;  3NP8 A;  5CV4 A;  5F2D A;  5C5L A;  3SK6 A;  1EYA A;  4K14 A;  5JAV A;  2QDB A;  2F0Q A;  1A2U A;  1EZ8 A;  2F0H A;  2NUC A;  4WOR A;  3TP8 A;  4OL7 A;  5J22 A;  1STA A;  1F2Z A;  5CV7 A;  2PZW A;  1KDB A;  3RUZ A;  5KGU A;  2PQE A;  3QOJ A;  4NP5 A;  2OF1 A;  5CV9 A;  5I9P A;  1NUC A;  5IGD A;  1EZ6 A;  4YIJ A;  5C5M A;  1SYG A;  2EYL A;  3BDL A;  3QB3 A;  4PMC A;  4QB4 A;  5EGT A;  3TP6 A;  5IGE A;  5KYL A;  5C4H A;  2F0I A;  2F0P A;  5M9O A;  1TT2 A;  2F0T A;  4H7B A;  2LKV A;  3C1F A;  5HGT A; 
#chains in the Genus database with same CATH topology
 4IOA A;  1SNQ A;  3J81 i;  2A73 B;  2ZM6 L;  2OXP A;  1WFQ A;  3K5L A;  3S16 H;  4A3I H;  2XSC A;  3G48 A;  4KTA A;  1RKN A;  1X32 A;  5J1Z A;  3TEH B;  1PH7 A;  4CDD C;  2JSO A;  5IGB A;  3NEM A;  4ZQ3 A;  4B9X A;  2CH4 W;  2QIL A;  1X65 A;  1H9J A;  4ZCK A;  2CVR A;  3I4N H;  3TZD A;  1G91 A;  1BCP B;  5EKI A;  1KDA A;  3NSW A;  3MFG A;  2NZO A;  5IP9 G;  2VW9 A;  4B3R L;  1TU2 B;  1A63 A;  4JOI A;  2R7Z B;  3U9O A;  1E2W A;  3W3A A;  1WCM B;  2HD3 A;  3QJY A;  3NEL A;  1K83 B;  4L5Q A;  4AYB E;  1JOK A;  2PI2 E;  2F3I A;  4K6L A;  5CBE E;  3T56 B;  3LWU A;  4RWS C;  3D4R A;  5AJ3 Q;  1VQC A;  1NAP A;  2F0O A;  4C1N I;  3C3L A;  3IAY A;  4X3T A;  1VQ4 A;  4BXX H;  4HED A;  2RQX A;  5JVG 3;  4QJF A;  2J0T D;  1VQ6 A;  3P20 A;  4FYD A;  2SNM A;  4A3G H;  5IY0 A;  3GTJ H;  1V1P B;  1J5E L;  4A3J G;  3ZJY C;  3SEB A;  2EJM A;  2PW5 A;  2N55 A;  2EYP A;  5C4J H;  5I4D A;  5HY6 A;  1X3Q A;  3URY A;  1BBX C;  1S5D D;  1VS0 A;  1SLJ A;  4R4T A;  5IYB G;  2K50 A;  2RSO A;  4Y7N B;  3T13 A;  2VB2 X;  1ESF A;  2CWP A;  3HS0 C;  2JEA I;  1PFS A;  1SYE A;  2L4N A;  4IJH A;  4QIW B;  1ENC A;  1WVL A;  4KKT A;  1RD9 D;  3T51 B;  3KF8 A;  4DXG A;  1PH5 A;  1N8R C;  1B3A A;  1UEA B;  5JJL A;  1EQT A;  1R4Q B;  2I5M X;  2IHE A;  1DJR D;  1AFP A;  4B3M Q;  3A5Z B;  3C1E A;  3A8J E;  3OIQ A;  4C3H G;  3G71 A;  1KDB A;  1YEZ A;  4BY7 H;  4DK1 A;  1Y14 B;  4C3J G;  1SR3 A;  2KEE A;  4YIJ A;  1SYG A;  3BDL A;  1K8M A;  2B29 A;  4L8J A;  4RA8 A;  1NY4 A;  5ELB A;  2F0I A;  1LTL A;  1JJC B;  1QUQ B;  4P73 A;  1G6P A;  4X65 L;  4A3M B;  4XQN A;  4LFA L;  3CMA A;  3KF8 B;  2JE6 I;  4JYA Q;  1L1O C;  2JA6 G;  3M9B A;  3FPP A;  1D1K A;  5M3M B;  1M90 C;  3GTQ H;  1O7I A;  3RN5 A;  1PA6 A;  4DR4 Q;  2XGT A;  4A3J H;  4JOI C;  3TRE A;  2Q2H A;  2H1E A;  4RGT A;  2G5D A;  4JBJ A;  1TR5 A;  3K7A B;  4IPG A;  4TVA B;  4IUN A;  3HFZ B;  5M3F G;  1ENF A;  4CDC C;  4K5W A;  2JA8 H;  3PCO B;  4NPS A;  3FMC A;  2B2U C;  2IL8 A;  3KLW A;  5C44 B;  1LM0 A;  1YIJ A;  3NQI A;  3JAM i;  1PVO A;  4A3B B;  3OYY A;  2D9U A;  2YV5 A;  4IPD A;  3PIP A;  1XMO L;  2AQ1 B;  2GVA A;  3CC2 A;  2WIN B;  4YWL A;  2BE5 D;  1D5M C;  2EOT A;  4GKJ Q;  2PYK A;  1W2B A;  3CW2 C;  4LF8 L;  5FLX E;  5FO7 B;  1EQV A;  1ROD A;  4V19 0;  2F0S A;  2N49 A;  1LTT D;  2B2U A;  1N32 Q;  1EIY B;  2WB1 B;  4EGV A;  4DUZ Q;  4IPC A;  1HZC A;  3KBX A;  1M4V A;  2BDN A;  3C2P A;  2ATW A;  3WWV A;  5KYI A;  3T4A C;  2JXM B;  4LWC A;  4CKC A;  1WJJ A;  1NR2 A;  3SK4 A;  4NMZ A;  3PF5 A;  1SFO B;  5M3F H;  3GQB A;  1XPU A;  3A5U A;  1DOL A;  3K6O A;  1HR0 Q;  3SE0 A;  4DR5 Q;  2XRQ D;  3F2B A;  1HNX Q;  4K14 A;  4U68 A;  3RN2 A;  1EZ8 A;  4JYA L;  2AWO A;  1QUQ A;  2PZW A;  1H9M A;  3KLS A;  2KCN A;  4RHR A;  2Y0S G;  4DV5 L;  2JA7 B;  4B3T L;  5IWA Q;  1TWG H;  1RHP A;  1ZYR C;  1C8C A;  4BBS B;  3BYY B;  4CHT B;  4K0K L;  2EYL A;  4QB4 A;  3TP6 A;  1QVG A;  4DR6 L;  2K5H A;  3A56 A;  3S17 B;  3HOZ B;  2HQL A;  3K7A H;  4JBM A;  1I5F A;  2J4X A;  1JE4 A;  3H0G G;  5CV6 A;  5JOB A;  3TME A;  2EY5 A;  1EWH A;  4LFC L;  3GTG H;  1Q8K A;  1LT3 D;  5AJ3 L;  3H3V I;  3FRP B;  3S1N B;  4KKS A;  1VQ7 A;  1PH1 A;  1NSN S;  3GTK H;  1HQR D;  1K9M C;  2ID0 A;  3MWY W;  3NBH B;  2R93 H;  3EBE A;  2MNA A;  3KLS X;  3HOW H;  1EWC A;  2BOS A;  5ISR A;  5M5W B;  2XIW A;  4XXE A;  3G7L A;  1FVI A;  3LNN A;  5M5Y H;  1E1O A;  3S15 B;  1PYB A;  1A62 A;  1TS4 A;  1SYF A;  3TRZ A;  4UP8 A;  5C3E G;  3D4W A;  4OO1 G;  1PYW D;  1IBM Q;  3KJP A;  4HTH A;  2NB0 A;  1EOT A;  4QMG A;  4N8X 1;  5GQO A;  2K6A A;  1NTG A;  4KLK A;  2FXQ A;  4JW0 A;  3SK5 A;  1DYQ A;  2F52 A;  2J7Z A;  2V1C C;  3W2D A;  3OTO Q;  4GLA C;  1J9O A;  2K28 A;  3RNU A;  3QIA A;  1CSQ A;  2K75 A;  5EKK A;  1YNJ D;  1YHA A;  2AMC B;  1CA6 A;  3H0G H;  3M4Q A;  2AUK A;  1S5C D;  3BZD B;  3M4O H;  3M7N A;  4LK1 C;  1J6Q A;  4A3L H;  1AEX A;  1SSO A;  1HZB A;  1KRS A;  2EY6 A;  4OHJ A;  4X3S A;  2ZJP A;  1U4P A;  4B3R Q;  1DM0 B;  5C44 G;  1U5K A;  1VDZ A;  1XNQ L;  4KJN A;  4BY1 B;  1MSG A;  4JI7 L;  1SMY C;  1YNN C;  2WAQ B;  3WOF A;  2E2I H;  4OON A;  4XT1 B;  3MA2 B;  5EAY A;  4DV3 Q;  3HOW G;  2R93 G;  3S24 A;  3UE1 A;  4FXK C;  3U4Z A;  1U4L A;  5H1S E;  5KND A;  2VY3 A;  4EVO A;  1KIX A;  5I2Y A;  3OPO A;  4CKE A;  2HIX A;  2B8G A;  1PRT B;  1TWA H;  2B63 G;  4KMU C;  1GUS A;  3SK6 A;  5F2D A;  4LF7 Q;  3T1H L;  4HIM A;  2R3Z A;  5C3E H;  5EBC A;  2PI2 A;  4LF4 Q;  3GTM H;  2XWJ B;  2JK8 A;  4RH6 A;  3JC6 6;  3PGZ A;  2I5H A;  3T1H Q;  2L9H A;  3HZX A;  1I3Q H;  3K8A A;  5M5Y B;  4AYB B;  1OXV A;  4L5S A;  1ICF B;  1KXL A;  1JIC A;  2K5N A;  2ASB A;  1AW7 A;  1PH2 A;  1C0A A;  2BH2 A;  3TS2 A;  1D1I A;  1KL9 A;  4K8I A;  1TY2 A;  1S4Z A;  4B3S L;  3PIO A;  2QCP X;  5GAE C;  4C56 C;  4DV0 Q;  4GOP A;  4YWK A;  2FFK B;  1RCV D;  5HUR A;  3NTK A;  3J7Z C;  1SXT A;  2EYF A;  3A7A B;  3MEH A;  5KEE A;  4DNT B;  3SVM A;  2CQO A;  3I70 A;  3K81 C;  4JC0 A;  1CM9 A;  3ZYY X;  2B63 H;  1A6X A;  2E2J H;  4GNX A;  4ZUJ A;  5M3M H;  3GTQ B;  4X6A H;  4A3J B;  4JI3 L;  1A3U A;  4A3D H;  4DKA C;  3I8Z A;  1N34 Q;  3S9W A;  1D7Q A;  1EY7 A;  3SHL A;  5CV5 A;  2F0G A;  1VQP A;  3CPF A;  5FK9 C;  3I73 A;  3R3O A;  3U9S A;  5LMN W;  2JA9 A;  1TVX A;  3PV0 A;  5EBD A;  2F3V A;  2R61 A;  3A55 A;  1YI2 A;  4DV1 L;  4TKO B;  1LTR D;  1ET6 A;  2IX0 A;  4YWM A;  4DR1 L;  4ZYS A;  1BQQ T;  4G4K A;  4A3E H;  2NZH A;  2VS1 A;  4Z9C B;  3AEV A;  4FF3 A;  3S1M H;  1QZH A;  1HR0 W;  3CCQ A;  3H09 A;  5GAG C;  4QIW E;  3S1R H;  4GZY C;  1HJP A;  2LMC B;  5GAH C;  4J1M A;  1PH6 A;  3U58 A;  1AP0 A;  4BA1 I;  1KLG D;  2QW7 A;  2YYZ A;  5JAV A;  2QDB A;  3Q22 A;  2VUM G;  4WOR A;  3CAM A;  5EPK A;  2BH8 A;  1QWY A;  5J22 A;  2R7Z G;  3FKI B;  3ND8 A;  3OW2 A;  2B2T C;  5M3M G;  3VYR A;  2OF1 A;  5KNB A;  2E2H B;  1NUC A;  2G9H D;  4G7Z C;  5D3I B;  4NXM Q;  4FVM A;  4K0K Q;  1DCZ A;  2FMM A;  1Y8O B;  2NVT B;  2K4K A;  2F0T A;  4AH6 A;  4ALP A;  2EYO A;  2RDF A;  2PPB C;  2RVL A;  1BCP D;  2HHH L;  2JJQ A;  3FP9 A;  4IUT A;  1SFO H;  4GN3 B;  1XMQ Q;  2KQ3 A;  1BF4 A;  3I90 A;  3A0J A;  5FO8 B;  4A75 A;  2UXC L;  2KHS A;  1HR0 L;  1BUV T;  3Q24 A;  2XN9 C;  1GKH A;  4JI5 Q;  2B63 B;  4RAU C;  4KD3 A;  1V43 A;  2K5W A;  1WYD A;  3NWS A;  1GVP A;  3D6W A;  3O13 A;  2JYO A;  4A3B G;  1HA6 A;  1WCM H;  4CDF C;  1EOV A;  3PUW A;  2EYM A;  4K2K A;  3X3M A;  4JBW A;  4ZKC B;  4JI1 Q;  5CGK A;  1JQY D;  1U9R A;  2NTT A;  3QOL A;  1KAB A;  4K8J A;  2CFM A;  2HCC A;  5GRO A;  4DR7 Q;  1DGS A;  3STB C;  2K03 A;  4JI5 L;  2IY5 B;  3NEN A;  2VUM H;  2R7Z H;  2WKD A;  1XJV A;  1I4P A;  4IFD H;  1X3G A;  1STG A;  2Q2T A;  2EDG A;  4HR7 B;  2NVQ H;  5C4J B;  3D31 A;  1VQN A;  2N3S A;  2YTX A;  1AZP A;  1A3T A;  4J8Q A;  5J3B A;  1HNW L;  4A93 B;  2PW7 A;  5JJI A;  3PUX A;  3PUY A;  4XQJ A;  3GV3 A;  4DV6 Q;  1JCK B;  3V96 A;  3GTG B;  2MFI A;  3AFP A;  3J7A 5;  3EA6 A;  1A3V A;  4HSV A;  1KHI A;  3PQI A;  1X9N A;  4ZKB B;  1IW7 D;  3E9I A;  4OWT B;  3VYU A;  2KOL A;  4YHH Q;  2JQO A;  1SND A;  2Y0S B;  4NXN L;  1IBL Q;  2R92 B;  1AE2 A;  1WCM G;  4BY1 G;  4HIO A;  3KUP A;  2F1M A;  3BZK A;  3HEJ A;  4KD4 A;  3ONA B;  5COY A;  1E1T A;  4K5X A;  4GS3 A;  4BY7 B;  4DK6 C;  1K8O A;  1EY8 A;  3LGJ A;  2Z6B A;  1C48 A;  1VQI A;  4RMF A;  3GTO H;  2F0H A;  1LT6 D;  3TP8 A;  2Z6K C;  3N52 A;  2OWO A;  1VQB A;  1KD1 C;  2IT1 A;  1E2Z A;  1FYC A;  5LL6 S;  2XTI A;  3FEW X;  4XYO A;  1Q46 A;  4O42 A;  3RZD H;  1YJ9 A;  2K05 A;  5C0X H;  1SMX A;  1L1O B;  5C4H A;  1MSH A;  3CCV A;  1GO3 E;  4QUC A;  3ULP A;  4X3U A;  1ICW A;  3EFX D;  3FHW A;  1OO9 B;  1V1O A;  2K5Q A;  1VQE A;  5LMN L;  3QO2 A;  1JWM D;  4NDX A;  4R4I A;  4JI3 Q;  4DNR B;  2Z1C A;  1K3R A;  2X6L A;  5EPL A;  3KF6 A;  1HTL D;  1EY6 A;  1XX8 A;  1VQJ A;  2JA8 B;  1RDP D;  3SGI A;  2KUM A;  4P74 A;  1ET9 A;  1O78 A;  3GTP B;  5IGF A;  1GHJ A;  1VQ9 A;  1PFM A;  1SJH D;  2B2Y A;  4EQ5 A;  2OCE A;  2NBF A;  4LF9 Q;  4BA2 I;  1GOZ A;  2Q8I B;  4BY1 H;  1K0R A;  2PNH A;  1YHB A;  4MTN A;  1AN8 A;  2MGS A;  3HOY B;  2Z4I A;  1Y8P B;  3VYS A;  1E2V A;  1J5E Q;  1PH9 A;  1N9W A;  2VL6 A;  5CC4 A;  1VQG A;  3MZ5 A;  3V2T A;  4PNY A;  3OSO A;  2X6G A;  2A68 D;  4PQX A;  2PMZ B;  4DR7 L;  1Y1V B;  1QB5 D;  3NHH A;  1ZYR D;  1XTD A;  2AUJ D;  3L7Z C;  3HKS A;  5C0X G;  3A8K E;  3FVQ A;  1WTX A;  1JOO A;  1STN A;  3K58 A;  5IGE A;  1SYB A;  1GUO A;  2A19 A;  5GAD C;  3K80 C;  4Q5V A;  5JJZ A;  3CCU A;  4I7A A;  1TS3 A;  3J80 L;  4DUY L;  3A7L A;  4LUZ A;  4POF A;  3DLL A;  1VQL A;  2WAQ E;  1PTO H;  1EY4 A;  1JB7 A;  2ALY B;  1B3Q A;  1I6H H;  3AMU A;  1FGB D;  1SYD A;  1B1Z A;  2HDL A;  2ZXR A;  1WOC A;  1AZQ A;  4TQU S;  1A8V A;  2VXW A;  1R9T B;  2I07 B;  4C1N K;  3HOZ H;  3M7G A;  5CV7 A;  4B08 A;  1Y1W G;  2A74 C;  2A5H A;  2PQA A;  1EFI D;  3BVG A;  4AYB G;  1K8G A;  4B3M L;  4A3G B;  1CKO A;  5KYL A;  1JC7 A;  1Q90 A;  4BBR G;  2DY7 A;  4DA2 A;  1UWV A;  2EE1 A;  1TT2 A;  3G6E A;  3OTO L;  1TWC H;  1UUP A;  2GVB A;  3S1Q H;  5FLX c;  1B53 A;  4H13 C;  1D2B A;  4PZ7 A;  5E4X A;  1SNC A;  4LF5 L;  1XPR A;  4FF1 A;  4RKB A;  1IBK L;  2A1A A;  2EZV A;  2L11 A;  1CK1 A;  1W6J A;  1CZG A;  1BBU A;  4PZ8 A;  5ELC A;  3VYT A;  2AWN A;  3QWN A;  4A3M G;  3S15 H;  2NYZ D;  3VA5 A;  4QUF A;  3N6R A;  5IT9 E;  3S1N H;  3K5O A;  4XYQ A;  4HMI A;  1QE6 A;  1A2T A;  3KDF B;  3CF5 A;  1LLR D;  3TP7 A;  1STB A;  1EYC A;  2WAQ G;  3OOC A;  3OMC A;  1OXX K;  3CU7 A;  2D5D A;  4GN4 B;  5FLM G;  4DV7 Q;  2SNS A;  2OEO A;  1NNX A;  2FIN B;  3FPU B;  2JA7 G;  1IYJ B;  1EFW A;  4ZLT F;  4DAV A;  1DXM A;  3HOZ G;  1WD1 A;  1WTR A;  1HZA A;  2F0N A;  4AQY Q;  5C4X G;  3M4P A;  4A3F H;  4BBR H;  2A8V A;  4O0A A;  2RBM A;  2UXD Q;  2TSS A;  3VR6 A;  3UE0 A;  2A6E C;  4LNQ A;  1HFN A;  1S5B D;  1J8I A;  1EUJ A;  1LUZ A;  5C4Z A;  5EJW A;  4QF4 A;  2Z8L A;  2E2I B;  4RGO S;  5I6Y A;  1BKB A;  2Q2I A;  1HNX L;  4DR5 L;  4K6D A;  2OTL A;  2ZJR A;  5L37 A;  3MHB A;  4A3M H;  1QVF A;  3EIV A;  1MHW C;  4DV5 Q;  1BOS A;  1N33 L;  5BR8 L;  2QKI C;  4A3I G;  1IKL A;  4DAM A;  4MTK A;  1BCP F;  2NTS A;  1LTI D;  3NP8 A;  3GTM B;  4KN4 C;  4UY8 C;  2KCC A;  2OTJ A;  1SE3 A;  4HCE A;  5D14 A;  4OWW B;  2QEJ C;  3STB D;  1P16 A;  5A35 A;  5ELO A;  3JAM E;  3CXC A;  5FLX L;  1SRO A;  2B2W C;  3DWP A;  3R2I A;  5C4X H;  4A3C H;  1QCB D;  1V1P A;  5IP9 H;  1I94 L;  4OX9 Q;  1QG7 A;  4A3F G;  4A3K B;  5IIF A;  1NCV A;  4M8A A;  2MJ8 A;  3EJI A;  2I5L X;  3TSS A;  2A6H C;  2ZXP A;  1MBY A;  3A54 A;  4JI0 L;  4FF2 A;  4ZK9 B;  1PH4 A;  1TY0 A;  4FNF A;  4R4C A;  3G4S A;  3GP7 A;  4BWG B;  2VZA A;  5G3L D;  2D0O A;  4BXX G;  1EYD A;  3DWQ A;  1OTC A;  2QDL A;  3T1Y L;  2Q8R E;  5JPM C;  3S16 B;  4A3G G;  1SAP A;  2K1B A;  4DV2 Q;  2MP1 A;  4R8N A;  1UEB A;  4XQQ A;  4DUY Q;  4A3D B;  3R93 A;  4GLX A;  2IW3 A;  3MAQ A;  1UE1 A;  5DEH A;  4EQN A;  2CW0 D;  3MTS A;  4JI4 Q;  2R92 H;  1WD0 A;  5IYB H;  3NBH A;  4MN3 A;  1Q86 C;  2K04 A;  2KEC A;  3BVZ A;  4EX5 A;  4IPH A;  1UE7 A;  1A15 A;  2EJG C;  2B2Y C;  2RHQ B;  2AKW B;  4JI1 L;  3T16 A;  5FJ8 H;  4C3I G;  1WI5 A;  4WJ3 M;  2ZTC A;  4X66 Q;  3CC4 A;  2EYH A;  1VF5 C;  5CBA E;  3DUZ A;  3GTO B;  3SXH A;  5CYU A;  2H5X A;  3S1M B;  4A3C G;  1IXR A;  4O2D A;  4GOP B;  3VA7 A;  3S2D B;  1RF2 D;  4QY7 A;  1GD7 A;  4C3H H;  2HHH Q;  3B6Y A;  4BY7 G;  2RA4 A;  1OXU A;  1VCI A;  4J15 A;  4F8M A;  2K14 A;  1KAA A;  4OEM B;  2K33 A;  3WDN A;  2F4V Q;  2K32 A;  3VR5 A;  2CHB D;  2KCT A;  1UNS A;  2WII B;  1KRT A;  2YTV A;  3UI2 A;  1BR9 A;  2JA6 H;  2MQH A;  2E2D C;  5CR3 A;  3KYH C;  1HQM C;  2RCN A;  1EIH A;  1G8Z D;  4HAE A;  4R4O A;  4HJ8 A;  1FJG L;  1VMC A;  1F2Z A;  5LMU L;  1LT4 D;  5BR8 Q;  5M5W H;  3TBI B;  1HTP A;  3GTL B;  3QOJ A;  3HRZ C;  1RTN A;  5A2Q L;  4C3I H;  2KA7 A;  1B50 A;  1GUG A;  2LKV A;  2JA8 G;  5HGT A;  1CKN A;  3NXW A;  2B8F A;  2PZT A;  2D2C C;  2IPK D;  4NB3 A;  4DXF A;  4KHZ A;  1F77 A;  1KDC A;  2E5L L;  1D6E C;  4JV5 Q;  3IL8 A;  4H44 C;  2DN8 A;  1XNR Q;  2NZ1 D;  4DR2 L;  4GKK L;  3HKZ B;  4JVZ A;  4S3S A;  4LF8 Q;  3OW7 A;  2F4V L;  4LFB Q;  1LYL A;  3BJU A;  3CHB D;  1U0L A;  1STE A;  4XIG S;  3V05 A;  1KQS A;  3NWT A;  3MFY A;  1CKN B;  5DLQ E;  3DEP A;  2AHO B;  3P75 A;  3W5O A;  3RLN A;  1YHQ A;  4IFD I;  3IFD A;  2NWG A;  3KBG A;  3MXN B;  4HJ9 A;  2NVQ B;  4IJL A;  1MGS A;  3CPW A;  2R7F A;  3UDX A;  1CHQ D;  4FXD A;  1XWE A;  2UU9 Q;  3J81 E;  2PMZ E;  2TMP A;  5I9O A;  4X62 L;  1Z7T A;  2L12 A;  1B44 D;  1XYI A;  5ELD A;  5E7N A;  1KLU D;  4PMB A;  4I7Z C;  1EU3 A;  4KY6 A;  1BNZ A;  2UUC L;  4MZ9 A;  3I3C A;  4JI8 L;  2M00 A;  1GUT A;  3ITP A;  5JEA H;  2K5V A;  3K5N A;  3I4M G;  3AQQ A;  4L5R C;  2UXC Q;  2F0D A;  4H0L C;  4LMQ D;  3I55 A;  3RMH A;  4DU9 A;  4A4I A;  1E22 A;  5FKA C;  1EQQ A;  1STY A;  2PQA B;  1HRJ A;  2HDM A;  1HZ9 A;  1C7Y A;  2R7D A;  4MIU A;  4LF6 Q;  2RCF A;  4NXM L;  4U67 3;  3J7A V;  1PFB A;  4JI0 Q;  1F2L A;  3H3V C;  4P71 A;  1YJW A;  1I4Q A;  1A0I A;  4LF7 L;  3CRL C;  4HIK A;  3DM3 A;  5COR A;  4Q0F A;  3HOY G;  3C46 A;  5DNF A;  2C5C A;  3QR8 A;  1Y69 U;  1LV9 A;  1TWH B;  5DM7 3;  1HA5 A;  2E74 C;  2JEB I;  5IGD A;  1KNA A;  1HCZ A;  1SJE D;  3M4Y A;  2C9O A;  4JI7 Q;  3CCM A;  4XTC S;  2KCM A;  1XNQ Q;  4X64 L;  1I50 H;  4IUR A;  1OXS C;  1F9Q A;  4OO1 H;  3HOU H;  4JBK A;  2ZXO A;  1BBW A;  4IUU A;  4KHP L;  3J7A F;  1Z9F A;  3PO2 G;  3PO3 B;  1CUK A;  2FHT A;  3S1R B;  4DAP A;  1SNO A;  1PRT C;  1PYS B;  2ENB A;  3S2H B;  3AYH B;  3CCL A;  4ODG A;  1DOM A;  4DK0 A;  2BE5 C;  1HH2 P;  3VR4 A;  3MXN A;  4O1N A;  1GHK A;  3TZU A;  2YTY A;  1IBM L;  3KK7 A;  5EPJ A;  1LTS D;  4V0B A;  4A3L G;  2E2H H;  4UPA A;  3GTJ B;  1DD2 A;  1IBK Q;  5K36 H;  4BS9 A;  4JI6 Q;  1V8Q A;  4LF9 L;  3E9H A;  3ER0 A;  1CHP D;  4ME5 A;  3DWA A;  1HFG A;  3GDE A;  4X64 Q;  2NN6 I;  4RHS A;  2LS0 1;  2M9V A;  1G6Z A;  1G29 1;  4FXG C;  3I4N G;  2R6G A;  3IFT A;  1D8L A;  2RDH A;  4DN4 M;  5LHY 1;  2KHI A;  1PDQ A;  3MVV A;  4JI2 Q;  2F0M A;  3X3N A;  5LMN Q;  2L5T A;  3BVM A;  1PTO C;  1CQV A;  2KJX A;  2NN6 G;  2O2L D;  3PO2 H;  4YY3 L;  4OWX B;  2NVT H;  2DUD A;  1R9T H;  1WTP A;  1K28 A;  1B7Y B;  5IT9 c;  5IWA L;  1H9S A;  5IYC G;  1B9M A;  5HGQ A;  2VUM B;  1S40 A;  3HG9 A;  1I4G A;  1CTM A;  4PMW A;  2UXB Q;  1VMP A;  1RL2 A;  3CCJ A;  5K36 G;  3I4L A;  3S1Q B;  2SDF A;  2CCZ A;  5I9P A;  1HPC A;  1ILQ A;  3PO3 H;  1LT5 D;  1K73 C;  2Z0S A;  4KN7 C;  4PMC A;  1NMG A;  5CMD A;  1HNZ Q;  4XDX A;  4JG2 A;  4ABN A;  1JMC A;  4JK1 C;  4POG A;  1CT1 D;  4DAY A;  1JOQ A;  3CCE A;  4DV6 L;  2DJG C;  3Q0A A;  1VQA A;  1HXY D;  5IT9 L;  4GN5 A;  3TS0 A;  4AIM A;  4IZ8 A;  2F0W A;  2DJF C;  3HOV B;  4A3D G;  4PG3 A;  1MI2 A;  2IJ0 A;  3GD7 A;  3H3V H;  2NN6 H;  2F3W A;  5DAU A;  2IHF A;  4DK3 C;  1EL0 A;  5ELE A;  4C3J H;  1XMO Q;  1LAB A;  1EY5 A;  3H94 A;  3HKZ G;  5ELN A;  3CC7 A;  2EY1 A;  5IGC A;  1V9P A;  1TII D;  1QNK A;  4CJ0 B;  5IYC H;  1O80 A;  4HJA A;  3Q6S A;  5DM6 3;  3RZD B;  2YU9 B;  1MKH A;  1F9S A;  2MPM A;  2JA6 B;  2E5L Q;  1SMY D;  2L0C A;  2A69 D;  2WV6 D;  4KK7 A;  1X56 A;  4X62 Q;  4RCN A;  1S5E D;  1VQ8 A;  1W3S A;  1YNX A;  2EPB A;  1LTA D;  2Y0S E;  3PO3 G;  2XVS A;  3D6C A;  2EY2 A;  2B3G A;  3OWE B;  3JAM c;  2L1B A;  1GUW A;  1CFM A;  1M1K C;  3H91 A;  2VQE Q;  1VQK A;  1CI3 M;  2JA5 H;  2F0U A;  4APV A;  3MC0 B;  2AQ2 B;  1GXD C;  2VQF L;  2E2J B;  4RGN A;  4FDB A;  2MHV A;  4DV4 Q;  4A3F B;  2E76 C;  1LO5 D;  5D3D A;  3NPP A;  2QGQ A;  1II3 A;  1CSP A;  1VF7 A;  3LX0 A;  1ASY A;  1PH3 A;  4X65 Q;  3LWE A;  3ERQ A;  1FR3 A;  2A6E D;  1PTO D;  4IN3 A;  2Z4H A;  5A2Q E;  2EYJ A;  3Q23 A;  2C35 B;  1L2F A;  2F0E A;  4L63 B;  1H9R A;  1JWS D;  4NXN Q;  5C3W A;  1STH A;  4YHH L;  3E6Z X;  5AFW A;  2GA4 B;  4A76 A;  1QOH A;  4P2C B;  4DGZ A;  1XNR L;  1PHJ A;  3BZC A;  5E1F A;  2A69 C;  3JAM L;  1SBB B;  4IUQ A;  5J39 A;  2GN5 A;  5CV4 A;  5C5L A;  5T1I A;  5M9O A;  3GO5 A;  1BXT A;  3I4N B;  1A2U A;  2NUC A;  4OL7 A;  2QA4 A;  5C4X B;  4ILW A;  3GTP H;  1HNW Q;  3TN2 A;  1NJI C;  1QJO A;  1I6V C;  1UAP A;  1FGU A;  1EZ6 A;  5C5M A;  2VQE L;  1Q81 C;  2G9D A;  3HOX G;  2LSS A;  4TSS A;  3PUV A;  1Q12 A;  4B3T Q;  4H7B A;  1WTV A;  4X66 L;  5G3L F;  1CKM A;  3KOJ A;  1B9N A;  2XNA C;  3D4D A;  1Y1W B;  2JA5 G;  5IYD G;  4DUZ L;  1UE5 A;  3ULL A;  4DR1 Q;  1JWU D;  2H4O A;  2KVM A;  3MXG A;  1U4R A;  1VQM A;  2EJF C;  3HKZ E;  4P75 A;  3J81 L;  4R1J A;  2HQE A;  1JJ2 A;  3TP5 A;  1TWH H;  1WTH A;  2QEX A;  1SE8 A;  1SNM A;  2PNR C;  1N34 L;  4Y7N H;  1X3F A;  1N32 L;  2LY7 A;  4TRD A;  3TQY A;  4YCV A;  3U4V A;  2ZTE A;  3AB9 A;  2LXJ A;  1P8L A;  5EKL A;  2PCF B;  3M4O B;  4HSP A;  1N36 L;  4IOC A;  3E5S A;  3M3Y H;  2ZTD A;  2OQK A;  4DR3 Q;  3I4M B;  2OQ0 A;  2F03 A;  2HCI A;  1NE3 A;  3F2U A;  4CGY B;  4ME3 A;  1PZK D;  2EXZ A;  4R8I A;  1O7Z A;  1ZXT A;  2PO4 A;  2Q8T A;  1I6H B;  1ZKO A;  4K2L A;  3CP0 A;  3RZO H;  2RKS A;  4HJ5 A;  2NVX H;  2ZJQ A;  3RLF A;  3NUC A;  3HOX H;  1T5E A;  5C0X I;  3Q8D A;  4F7X A;  3F2D A;  4JCV E;  3FDT A;  4UDU C;  5IYD H;  3PIO 3;  3BS1 A;  4QL5 A;  2EXD A;  1CZW A;  5JPN C;  4QGU A;  1I50 B;  4C2M H;  2HUG A;  1RIP A;  1T9H A;  5C3E B;  4GOP C;  3G6J B;  4QCL A;  2WAC A;  1HUN A;  2EVB A;  1TWC B;  4C3H B;  1XTC D;  1PFN A;  4N9T A;  1K8A C;  2AQ3 B;  2CH4 A;  4UP7 A;  1BVS A;  1NMF A;  2OT2 A;  3GTL H;  2BA1 A;  1IL2 A;  4G7O C;  4WJ4 A;  5D65 A;  2RSN A;  4RG1 A;  4DAY B;  1EYA A;  1I3Q B;  1X3E A;  1BO0 A;  1VQH A;  1PH8 A;  1UE6 A;  4OIJ A;  1FNV A;  4CBV A;  5KGU A;  4LW1 A;  4NP5 A;  5C44 H;  3J80 c;  5EGT A;  2UXD L;  1FD7 D;  3M85 A;  1O7Y A;  4H02 A;  4RKL A;  4MNO A;  1SE2 A;  3S14 B;  4BBS G;  3A8I E;  3MXP A;  3KDF A;  4F87 A;  3E0J A;  3PSI A;  1F2M A;  1Q3L A;  1EWI A;  4YCU A;  2E8G A;  4HJ7 A;  1N33 Q;  2MO0 A;  1PTO F;  4L6T B;  2KBN A;  3K5M A;  3NK9 A;  4KY5 A;  3U50 C;  4DV1 Q;  4ZAI A;  2CW0 C;  2NVY B;  3KF6 B;  2DY8 A;  4LUV A;  1B4O A;  3PF4 A;  2I46 A;  2KEN A;  3ND9 A;  2V4D A;  2K01 A;  1RTO A;  3K57 A;  4JI6 L;  4XT3 B;  3P7J A;  1U4M A;  3H6M A;  4KI0 A;  3P1H A;  1C4Q A;  1X55 A;  2JN4 A;  1PZJ D;  1QVC A;  2IX3 A;  1TWF B;  2HIV A;  3KLR A;  4UHV A;  4A3K H;  4DF7 A;  3UDI A;  3MXU A;  3A74 A;  1X3P A;  3W1B A;  1JJG A;  2BCO A;  2E75 C;  1Q82 C;  4B3S Q;  3EVQ A;  4CKB A;  1Q8I A;  1ENA A;  1Z6H A;  4BBS H;  1JOR A;  1KNE A;  5KNC A;  2K7V A;  1ONL A;  3DEO A;  2WFW A;  1EEI D;  1BDO A;  5IOC A;  1MJC A;  3J81 j;  3NBI A;  4DV7 L;  5BN4 A;  4WRD A;  4HID A;  1K0S A;  1MJE A;  2MO1 A;  1SDF A;  4EQO A;  3AFQ A;  1ILP A;  4MHE A;  2ICI A;  3KJO A;  1Q7Y C;  5M5X H;  3CD6 A;  3I72 A;  3PMF A;  3I4O A;  5KIX A;  2RDG A;  5TSS A;  3ICE A;  1DOK A;  1SE4 A;  2DNC A;  1TS5 A;  4NW2 A;  2KHJ A;  2WP8 J;  4A3E G;  5LL6 X;  3PUZ A;  3J81 c;  3RUZ A;  1L0W A;  1D5X C;  4GNX B;  5C0X J;  4A3K G;  3BDO A;  4LF4 L;  3HOU B;  2F0P A;  2F4I A;  2N8N A;  1B8A A;  1YVC A;  3R2T A;  4KY7 A;  4OO1 I;  5FLM H;  1ZEQ X;  2B2W A;  4UP9 A;  3F2C A;  4HMJ A;  3I7F A;  1EY0 A;  4GLV B;  3S2H H;  1IZ6 A;  2LFN A;  1N36 Q;  4J6H A;  2WKC A;  4RFB A;  4OXP A;  1JE5 A;  3D3R A;  2JA5 B;  2KED A;  1X54 A;  1CA5 A;  4P72 A;  3K0X A;  4LJZ C;  4Y52 H;  1IYV A;  3S2D H;  2EQS A;  2SOB A;  3F8T A;  4G57 A;  1GUN A;  2N88 A;  3QG1 A;  4I65 A;  4LFB L;  5E3F A;  1IL8 A;  2P5Z X;  3K7U C;  4KJO A;  4ZRZ A;  3OMG A;  4ID6 A;  2F0K A;  1PLF A;  2DGY A;  3D0F A;  5BN3 A;  4C3I B;  4JI8 Q;  2UUB L;  1I4H A;  1PMR A;  1L0Y B;  1TWA B;  4FF4 A;  4N8F A;  4ZUI A;  2F0F A;  1D5Z C;  1S3O A;  4A3I B;  3I2Z A;  4A3B H;  1XPO A;  1YNJ C;  1NBW A;  2B2T A;  2UU9 L;  1E24 A;  4DR2 Q;  4GKK Q;  4DR6 Q;  1FNU A;  5C3X A;  4UAI A;  3K59 A;  1SYC A;  2F0L A;  4DFA A;  1F2Y A;  1TS2 A;  3J80 i;  4M1U B;  3H15 A;  1OXT A;  1X6O A;  1FJG Q;  1EQR A;  3SR1 A;  1YNN D;  2ZT9 C;  3BDC A;  5IGG A;  5JJK A;  1QNU A;  3SDZ A;  1WTQ A;  1B2T A;  3M3Y B;  2F0V A;  4X3K A;  1SRU A;  3CRK C;  3HOV G;  1E7Z A;  4IUP A;  4IFD G;  1G2T A;  1O7L A;  1EY9 A;  1KTK A;  5I2X A;  1SEB D;  4OEL B;  3ERS X;  1K83 H;  3NQT A;  1IBL L;  3CKI B;  2UUA Q;  1QIL A;  2B2V C;  2CKZ B;  2FJ2 A;  4WFN 3;  3VDY A;  2JP1 A;  3HOX B;  3L2P A;  4JV5 L;  3D8G A;  1HUM A;  3CCR A;  2QF7 A;  3HP3 A;  1G2S A;  4LFC Q;  2Q2U A;  2XRS D;  4HCS A;  1IW7 C;  4C2M B;  1PXU A;  3OIP A;  4R9W A;  1JT8 A;  2SEB D;  3KFU A;  1ASZ A;  1V1Q A;  2IWH A;  1C9O A;  2R92 G;  2Z6K A;  1VQD A;  4DV4 L;  3CCS A;  3S17 H;  4C3J B;  1EIG A;  3CME A;  3DMU A;  3VR3 A;  2VQF Q;  5NUC A;  3K0Y A;  3RR5 A;  2LXK A;  5FJ8 G;  1L1O A;  2I0Q A;  4IQZ A;  4QQB X;  3FKI H;  2UUC Q;  2CQA A;  1G51 A;  3HOV H;  1XXG A;  5JEA J;  1Y1V H;  3MEF A;  4OIK A;  1QZG A;  2ES2 A;  1PZI D;  2A6H D;  3IRB A;  3DHQ A;  2R93 B;  4G7H C;  3I91 A;  2K52 A;  4DR3 L;  2K5D A;  3NTH A;  1RJT A;  2N78 A;  3W1G A;  4GKJ L;  1XMQ L;  1GM5 A;  4IUV A;  2EIF A;  5JVH 3;  3T1Y Q;  1AH9 A;  3VR2 A;  1VQ5 A;  1SN8 A;  1Q1B A;  1I4X A;  5KRU A;  1PTO B;  3HGB A;  4RGM A;  1EIF A;  4L5T A;  1TKW B;  1EYG A;  1W6K A;  3CQZ H;  4JI4 L;  1M8A A;  2WB1 E;  3PIP 3;  3BG3 A;  2BDO A;  4FO2 A;  5C6A A;  1TWF H;  1HNZ L;  1IHZ A;  2O4X A;  4LFA Q;  4CJ1 B;  1E3P A;  3OWF A;  3FKI G;  4CDE C;  1PV4 A;  1I4R A;  3ULJ A;  1KAW A;  1H9K A;  4IFD J;  1Y1V G;  4KHV A;  1TQO A;  2FMC A;  3SK8 A;  3WOE A;  4F88 A;  1YJN A;  4DR4 L;  2D0P A;  5LMU Q;  2NVY H;  1ML0 D;  5IE8 A;  1LAC A;  3RLO A;  1STA A;  4A93 H;  4JI2 L;  2PQE A;  1E0B A;  1I94 Q;  1WTW A;  4OX9 L;  2BA0 A;  1T5X D;  4OGQ C;  3QB3 A;  4LUO A;  2B2V A;  3RD4 A;  2RF4 A;  5T1G A;  4YY3 Q;  1EEF D;  1PRT D;  3C1F A;  1ESR A;  1FNW A;  3DM1 A;  2Z9H A;  2O5I C;  1MIU A;  4NKL A;  3PO2 B;  3GV6 A;  2X69 A;  3BU2 A;  4EQP A;  3L0O A;  1B70 B;  2B39 A;  3EN2 A;  1LTB D;  1FL0 A;  4KV6 A;  5BN5 A;  4JPB W;  4K5V A;  5I6W A;  3ERO A;  2UUA L;  4CJ2 C;  5M3F B;  1CQF A;  3UDF A;  1Y1W H;  3DXJ C;  1EU4 A;  3L3O C;  3E3X A;  1PRT F;  4FP5 D;  5IP7 G;  2IX1 A;  3EQL C;  1MD2 D;  1VQF A;  1KC8 C;  4BBR B;  5JEA G;  3NE5 B;  4RCO A;  3I4M H;  1YZ6 A;  3TDQ A;  4B9W A;  1DZ1 A;  1R4P B;  2ICE C;  1BCP C;  5M5X B;  2UUB Q;  4E6I A;  4KHP Q;  1F9R A;  3CQZ B;  5FOB B;  3AU7 A;  4A93 G;  1F9P A;  1LTG D;  1WTO A;  3R8B A;  4DV2 L;  1VQO A;  2F0J A;  1Z47 A;  4N9P A;  3I56 A;  4AQY L;  3F1Z A;  3J80 E;  4HN7 A;  4PZ6 A;  1IYU A;  5FO9 B;  4ULL A;  2M2L A;  3GTK B;  2O5J C;  3BYT B;  1H9S B;  2HT1 A;  1GJX A;  4GNX C;  2MUY A;  2WB1 G;  2VNU D;  3RZO B;  3IKJ A;  2NVX B;  5IOD A;  3HOY H;  2JA7 H;  1TXY A;  1TWG B;  1SNP A;  3OHX C;  5E4W C;  3T53 B;  1JB3 A;  4PV1 C;  1S5F D;  1YIT A;  4DV0 L;  1JR0 D;  5ELF A;  1S72 A;  3L9A X;  2CWA A;  4LF6 L;  4WJW A;  4A3E B;  4IO9 A;  2PZU A;  1Y8N B;  4LAA A;  2YU9 H;  3E0E A;  1NR4 A;  2RHS B;  4IAL A;  5CV8 A;  5IP7 H;  4DPG A;  4DV3 L;  2D62 A;  2L15 A;  1HHV A;  1L0X B;  3UDG A;  4DNI A;  5K5P A;  3HOU G;  2A68 C;  4LF5 Q;  3NTI A;  2F0Q A;  3J7Y W;  4YCW A;  4KKU A;  2ZM6 Q;  2L55 A;  4R4Q A;  2UXB L;  3HOW B;  3S14 H;  5EQ0 A;  2XWB B;  1H95 A;  5CV9 A;  1Q1E A;  3H0G B;  1AE3 A;  2VB3 X;  1IKM A;  1YBY A;  1K3B C;  2DNE A;  1DON A; 
#chains in the Genus database with same CATH homology
 1SNQ A;  2A73 B;  2OXP A;  3K5L A;  2XSC A;  4KTA A;  1RKN A;  1X32 A;  5J1Z A;  2JSO A;  5IGB A;  4ZQ3 A;  4B9X A;  2QIL A;  1H9J A;  2CVR A;  3TZD A;  1G91 A;  1BCP B;  5EKI A;  1KDA A;  3NSW A;  3MFG A;  1TU2 B;  2R7Z B;  3U9O A;  1E2W A;  3W3A A;  1WCM B;  3QJY A;  1K83 B;  1JOK A;  4K6L A;  5CBE E;  3T56 B;  3LWU A;  4RWS C;  3D4R A;  1NAP A;  2F0O A;  4C1N I;  3C3L A;  3IAY A;  4X3T A;  4HED A;  2RQX A;  5JVG 3;  2J0T D;  3P20 A;  4FYD A;  2SNM A;  1V1P B;  3SEB A;  2EJM A;  2PW5 A;  2N55 A;  2EYP A;  5I4D A;  1X3Q A;  3URY A;  1BBX C;  1S5D D;  2RSO A;  4Y7N B;  3T13 A;  2VB2 X;  1ESF A;  3HS0 C;  2JEA I;  1SYE A;  2L4N A;  4QIW B;  1ENC A;  1WVL A;  4KKT A;  1RD9 D;  3T51 B;  3KF8 A;  4DXG A;  1B3A A;  1UEA B;  1EQT A;  1R4Q B;  1DJR D;  1AFP A;  3C1E A;  3A8J E;  3OIQ A;  4C3H G;  1KDB A;  4DK1 A;  4C3J G;  2KEE A;  4YIJ A;  1SYG A;  3BDL A;  1K8M A;  4L8J A;  4RA8 A;  5ELB A;  2F0I A;  4A3M B;  4XQN A;  2JE6 I;  3FPP A;  1D1K A;  5M3M B;  2H1E A;  4RGT A;  1TR5 A;  3K7A B;  4IUN A;  1ENF A;  4K5W A;  3FMC A;  2B2U C;  2IL8 A;  5C44 B;  3NQI A;  4A3B B;  2D9U A;  2AQ1 B;  2WIN B;  2BE5 D;  1D5M C;  2EOT A;  2PYK A;  5FLX E;  5FO7 B;  1EQV A;  1ROD A;  4V19 0;  2F0S A;  1LTT D;  2B2U A;  2WB1 B;  4EGV A;  3KBX A;  1M4V A;  2BDN A;  3C2P A;  5KYI A;  3T4A C;  2JXM B;  4CKC A;  1NR2 A;  3SK4 A;  4NMZ A;  1SFO B;  3GQB A;  1DOL A;  3K6O A;  3SE0 A;  2XRQ D;  4K14 A;  4U68 A;  1EZ8 A;  2AWO A;  2PZW A;  1H9M A;  3KLS A;  2KCN A;  4RHR A;  2JA7 B;  1RHP A;  1ZYR C;  1C8C A;  4BBS B;  3BYY B;  4CHT B;  2EYL A;  4QB4 A;  3TP6 A;  3A56 A;  3S17 B;  3HOZ B;  2J4X A;  1JE4 A;  5CV6 A;  5JOB A;  3TME A;  2EY5 A;  1EWH A;  1LT3 D;  3FRP B;  3S1N B;  4KKS A;  1NSN S;  1HQR D;  2ID0 A;  3MWY W;  3KLS X;  1EWC A;  2BOS A;  5ISR A;  5M5W B;  2XIW A;  4XXE A;  3G7L A;  3LNN A;  3S15 B;  1TS4 A;  1SYF A;  3D4W A;  4OO1 G;  1PYW D;  4HTH A;  2NB0 A;  1EOT A;  4QMG A;  2K6A A;  3SK5 A;  1DYQ A;  2J7Z A;  3W2D A;  1J9O A;  2K28 A;  3QIA A;  5EKK A;  1YNJ D;  1CA6 A;  2AUK A;  1S5C D;  3BZD B;  3M7N A;  4LK1 C;  1AEX A;  1SSO A;  2EY6 A;  4OHJ A;  4X3S A;  1U4P A;  1DM0 B;  1VDZ A;  4KJN A;  4BY1 B;  1MSG A;  1SMY C;  1YNN C;  2WAQ B;  3WOF A;  4XT1 B;  3MA2 B;  4FXK C;  1U4L A;  5KND A;  4EVO A;  5I2Y A;  3OPO A;  4CKE A;  2B8G A;  1PRT B;  4KMU C;  1GUS A;  3SK6 A;  5F2D A;  2R3Z A;  5EBC A;  2XWJ B;  4RH6 A;  2L9H A;  3HZX A;  5M5Y B;  4AYB B;  1OXV A;  1JIC A;  1AW7 A;  1D1I A;  4K8I A;  1TY2 A;  1S4Z A;  2QCP X;  4C56 C;  2FFK B;  1RCV D;  5HUR A;  3NTK A;  1SXT A;  2EYF A;  5KEE A;  3A7A B;  3SVM A;  4DNT B;  3MEH A;  3I70 A;  3ZYY X;  1CM9 A;  1A6X A;  4ZUJ A;  3GTQ B;  4A3J B;  1A3U A;  3I8Z A;  3S9W A;  1EY7 A;  3SHL A;  5CV5 A;  2F0G A;  5FK9 C;  3I73 A;  3R3O A;  3U9S A;  1TVX A;  3PV0 A;  5EBD A;  2F3V A;  2R61 A;  3A55 A;  4TKO B;  1LTR D;  1ET6 A;  2IX0 A;  4ZYS A;  1BQQ T;  4G4K A;  4Z9C B;  4FF3 A;  3H09 A;  4GZY C;  2LMC B;  1AP0 A;  4J1M A;  4BA1 I;  1KLG D;  2YYZ A;  3Q22 A;  5JAV A;  2QDB A;  4WOR A;  5EPK A;  1QWY A;  5J22 A;  3FKI B;  3ND8 A;  2B2T C;  3VYR A;  2OF1 A;  5KNB A;  2E2H B;  1NUC A;  2G9H D;  4G7Z C;  5D3I B;  4FVM A;  1DCZ A;  2FMM A;  1Y8O B;  2NVT B;  2F0T A;  2EYO A;  2RDF A;  2PPB C;  2RVL A;  1BCP D;  4IUT A;  2KQ3 A;  1BF4 A;  3I90 A;  5FO8 B;  2KHS A;  1BUV T;  3Q24 A;  2XN9 C;  2B63 B;  4RAU C;  4KD3 A;  1V43 A;  2K5W A;  3NWS A;  3O13 A;  3D6W A;  2JYO A;  1HA6 A;  3PUW A;  2EYM A;  4K2K A;  3X3M A;  4JBW A;  4ZKC B;  5CGK A;  1JQY D;  1U9R A;  2NTT A;  3QOL A;  1KAB A;  4K8J A;  2HCC A;  2K03 A;  2WKD A;  1I4P A;  4IFD H;  1STG A;  2EDG A;  4HR7 B;  5C4J B;  3D31 A;  1AZP A;  1A3T A;  4J8Q A;  4A93 B;  2PW7 A;  3PUX A;  3PUY A;  4XQJ A;  3GV3 A;  1JCK B;  3V96 A;  3GTG B;  3EA6 A;  1A3V A;  4HSV A;  4ZKB B;  1IW7 D;  3VYU A;  2KOL A;  2R92 B;  1SND A;  2Y0S B;  3KUP A;  2F1M A;  3HEJ A;  4KD4 A;  3ONA B;  5COY A;  4K5X A;  4BY7 B;  1K8O A;  1EY8 A;  1C48 A;  2F0H A;  1LT6 D;  3TP8 A;  3N52 A;  2IT1 A;  1E2Z A;  1FYC A;  5LL6 S;  3FEW X;  4XYO A;  4O42 A;  2K05 A;  5C0X H;  5C4H A;  1MSH A;  4QUC A;  4X3U A;  1ICW A;  3EFX D;  1OO9 B;  1V1O A;  2K5Q A;  3QO2 A;  1JWM D;  4NDX A;  4DNR B;  2Z1C A;  2X6L A;  5EPL A;  1HTL D;  1EY6 A;  1XX8 A;  2JA8 B;  1RDP D;  2KUM A;  1ET9 A;  1O78 A;  3GTP B;  5IGF A;  1GHJ A;  1PFM A;  1SJH D;  2B2Y A;  2NBF A;  4BA2 I;  1GOZ A;  2Q8I B;  1AN8 A;  2MGS A;  3HOY B;  2Z4I A;  1Y8P B;  3VYS A;  1E2V A;  5CC4 A;  3V2T A;  3MZ5 A;  4PNY A;  3OSO A;  2X6G A;  2A68 D;  4PQX A;  2PMZ B;  1Y1V B;  1QB5 D;  3NHH A;  1ZYR D;  2AUJ D;  3L7Z C;  5C0X G;  3A8K E;  3FVQ A;  1WTX A;  1JOO A;  1STN A;  3K58 A;  5IGE A;  1SYB A;  1GUO A;  4Q5V A;  5JJZ A;  1TS3 A;  3J80 L;  3A7L A;  1PTO H;  1EY4 A;  3AMU A;  1FGB D;  1SYD A;  1B1Z A;  2HDL A;  2ZXR A;  1AZQ A;  4TQU S;  2VXW A;  1R9T B;  2I07 B;  4C1N K;  3M7G A;  5CV7 A;  4B08 A;  2A74 C;  2A5H A;  3BVG A;  1EFI D;  4A3G B;  5KYL A;  1JC7 A;  1Q90 A;  2DY7 A;  4DA2 A;  2EE1 A;  1TT2 A;  1UUP A;  1B53 A;  4H13 C;  1D2B A;  5E4X A;  1SNC A;  4FF1 A;  4RKB A;  2EZV A;  2L11 A;  1CK1 A;  1W6J A;  1CZG A;  5ELC A;  3VYT A;  2AWN A;  3QWN A;  2NYZ D;  3VA5 A;  4QUF A;  3N6R A;  5IT9 E;  3K5O A;  4XYQ A;  4HMI A;  1QE6 A;  1A2T A;  1LLR D;  3TP7 A;  1STB A;  1EYC A;  3OOC A;  3OMC A;  1OXX K;  3CU7 A;  2D5D A;  2SNS A;  2OEO A;  2FIN B;  3FPU B;  4ZLT F;  4DAV A;  1DXM A;  1WD1 A;  1WTR A;  2F0N A;  2RBM A;  2TSS A;  3VR6 A;  2A6E C;  1HFN A;  1S5B D;  1J8I A;  5C4Z A;  5EJW A;  4QF4 A;  2Z8L A;  2E2I B;  4RGO S;  5I6Y A;  4K6D A;  3MHB A;  1BOS A;  2QKI C;  1IKL A;  1BCP F;  2NTS A;  1LTI D;  3NP8 A;  3GTM B;  4KN4 C;  2KCC A;  1SE3 A;  4HCE A;  5D14 A;  2QEJ C;  5A35 A;  3JAM E;  5FLX L;  2B2W C;  3DWP A;  3R2I A;  1QCB D;  1V1P A;  1QG7 A;  4A3K B;  5IIF A;  1NCV A;  4M8A A;  2MJ8 A;  3EJI A;  3TSS A;  2A6H C;  2ZXP A;  1MBY A;  3A54 A;  4FF2 A;  4ZK9 B;  1TY0 A;  4FNF A;  3GP7 A;  4BWG B;  5G3L D;  1EYD A;  3DWQ A;  2Q8R E;  5JPM C;  3S16 B;  1SAP A;  2K1B A;  2MP1 A;  4R8N A;  4XQQ A;  4A3D B;  3R93 A;  2IW3 A;  3MAQ A;  4EQN A;  5DEH A;  2CW0 D;  3MTS A;  1WD0 A;  3NBH A;  4MN3 A;  2K04 A;  2KEC A;  3BVZ A;  2EJG C;  1A15 A;  2B2Y C;  3T16 A;  4C3I G;  2EYH A;  5CBA E;  3GTO B;  1VF5 C;  3DUZ A;  3SXH A;  5CYU A;  3S1M B;  3S2D B;  3VA7 A;  1RF2 D;  2RA4 A;  1OXU A;  1VCI A;  4F8M A;  1KAA A;  2K33 A;  3WDN A;  2K32 A;  3VR5 A;  2CHB D;  1UNS A;  2WII B;  3UI2 A;  1BR9 A;  2E2D C;  5CR3 A;  1HQM C;  1EIH A;  1G8Z D;  4HAE A;  1VMC A;  1F2Z A;  1LT4 D;  3TBI B;  1HTP A;  3GTL B;  3QOJ A;  3HRZ C;  1RTN A;  5A2Q L;  2KA7 A;  1B50 A;  1GUG A;  2LKV A;  5HGT A;  3NXW A;  2B8F A;  2PZT A;  2D2C C;  2IPK D;  4DXF A;  4KHZ A;  1F77 A;  1KDC A;  1D6E C;  3IL8 A;  4H44 C;  2DN8 A;  2NZ1 D;  3HKZ B;  4S3S A;  3OW7 A;  3CHB D;  1STE A;  4XIG S;  3V05 A;  3NWT A;  3MFY A;  3DEP A;  3P75 A;  4IFD I;  3IFD A;  2NWG A;  3KBG A;  2NVQ B;  1MGS A;  1CHQ D;  4FXD A;  1XWE A;  3J81 E;  2TMP A;  5I9O A;  1Z7T A;  2L12 A;  1B44 D;  1XYI A;  5ELD A;  1KLU D;  4PMB A;  4I7Z C;  1EU3 A;  4KY6 A;  1BNZ A;  3I3C A;  2M00 A;  1GUT A;  3ITP A;  5JEA H;  3K5N A;  2F0D A;  4H0L C;  4LMQ D;  3RMH A;  4DU9 A;  5FKA C;  1STY A;  1HRJ A;  2HDM A;  4MIU A;  4U67 3;  3J7A V;  1PFB A;  1F2L A;  3H3V C;  1I4Q A;  3CRL C;  5COR A;  4Q0F A;  3C46 A;  5DNF A;  2C5C A;  1Y69 U;  1TWH B;  1LV9 A;  5DM7 3;  1HA5 A;  2E74 C;  2JEB I;  5IGD A;  1KNA A;  1HCZ A;  1SJE D;  3M4Y A;  2C9O A;  4XTC S;  4IUR A;  1OXS C;  1F9Q A;  4OO1 H;  2ZXO A;  4IUU A;  3J7A F;  3PO3 B;  2FHT A;  3S1R B;  4DAP A;  1SNO A;  1PRT C;  2ENB A;  3S2H B;  4ODG A;  1DOM A;  4DK0 A;  2BE5 C;  3VR4 A;  3MXN A;  4O1N A;  1GHK A;  3TZU A;  3KK7 A;  5EPJ A;  1LTS D;  4V0B A;  3GTJ B;  1DD2 A;  5K36 H;  4BS9 A;  1V8Q A;  1CHP D;  4ME5 A;  3DWA A;  1HFG A;  2NN6 I;  4RHS A;  2LS0 1;  2M9V A;  1G6Z A;  1G29 1;  4FXG C;  2R6G A;  3IFT A;  2RDH A;  4DN4 M;  5LHY 1;  1PDQ A;  3MVV A;  2F0M A;  3X3N A;  2L5T A;  3BVM A;  1PTO C;  1CQV A;  2KJX A;  2NN6 G;  2O2L D;  1WTP A;  1H9S A;  1B9M A;  2VUM B;  3HG9 A;  1I4G A;  1CTM A;  4PMW A;  1VMP A;  5K36 G;  3I4L A;  3S1Q B;  2SDF A;  5I9P A;  1HPC A;  1ILQ A;  1LT5 D;  4KN7 C;  4PMC A;  5CMD A;  4XDX A;  4ABN A;  4JK1 C;  1CT1 D;  4DAY A;  1JOQ A;  3Q0A A;  1HXY D;  5IT9 L;  4IZ8 A;  2F0W A;  3HOV B;  1MI2 A;  2IJ0 A;  3GD7 A;  2NN6 H;  2F3W A;  5DAU A;  1EL0 A;  5ELE A;  1LAB A;  1EY5 A;  3H94 A;  2EY1 A;  5IGC A;  1TII D;  1QNK A;  4CJ0 B;  1O80 A;  3Q6S A;  5DM6 3;  3RZD B;  2YU9 B;  2MPM A;  1F9S A;  2JA6 B;  1SMY D;  2L0C A;  2A69 D;  2WV6 D;  4KK7 A;  4RCN A;  1S5E D;  2EPB A;  1LTA D;  2XVS A;  3D6C A;  2EY2 A;  3OWE B;  1GUW A;  2L1B A;  1CFM A;  3H91 A;  1CI3 M;  2F0U A;  3MC0 B;  2AQ2 B;  1GXD C;  2E2J B;  4RGN A;  2MHV A;  4A3F B;  2E76 C;  1LO5 D;  5D3D A;  3NPP A;  1II3 A;  1VF7 A;  3LX0 A;  3LWE A;  3ERQ A;  1FR3 A;  2A6E D;  1PTO D;  4IN3 A;  2Z4H A;  5A2Q E;  2EYJ A;  3Q23 A;  2F0E A;  4L63 B;  1H9R A;  1JWS D;  5C3W A;  1STH A;  3E6Z X;  5AFW A;  2GA4 B;  1QOH A;  4P2C B;  4DGZ A;  5E1F A;  2A69 C;  3JAM L;  1SBB B;  4IUQ A;  5J39 A;  5C5L A;  5M9O A;  5CV4 A;  5T1I A;  3GO5 A;  1BXT A;  3I4N B;  1A2U A;  2NUC A;  4OL7 A;  5C4X B;  4ILW A;  3TN2 A;  1QJO A;  1I6V C;  1UAP A;  1EZ6 A;  5C5M A;  2G9D A;  4TSS A;  3PUV A;  1Q12 A;  4H7B A;  1WTV A;  5G3L F;  1B9N A;  2XNA C;  3D4D A;  1Y1W B;  1JWU D;  2H4O A;  2KVM A;  3MXG A;  1U4R A;  2EJF C;  3J81 L;  2HQE A;  3TP5 A;  1SNM A;  2PNR C;  2LY7 A;  4TRD A;  3AB9 A;  5EKL A;  2PCF B;  3M4O B;  4HSP A;  3E5S A;  3I4M B;  2F03 A;  2HCI A;  3F2U A;  4CGY B;  4R8I A;  1PZK D;  2EXZ A;  1O7Z A;  1ZXT A;  2PO4 A;  2Q8T A;  1I6H B;  1ZKO A;  4K2L A;  2RKS A;  3RLF A;  3NUC A;  1T5E A;  5C0X I;  4F7X A;  3FDT A;  4UDU C;  3PIO 3;  3BS1 A;  1CZW A;  5JPN C;  1I50 B;  2HUG A;  5C3E B;  3G6J B;  4QCL A;  2WAC A;  1HUN A;  2EVB A;  1TWC B;  4C3H B;  1XTC D;  1PFN A;  4N9T A;  2AQ3 B;  2OT2 A;  2BA1 A;  4G7O C;  5D65 A;  2RSN A;  1EYA A;  1I3Q B;  1BO0 A;  4OIJ A;  1FNV A;  4CBV A;  5KGU A;  4NP5 A;  5EGT A;  1FD7 D;  3M85 A;  1O7Y A;  4RKL A;  1SE2 A;  3S14 B;  3A8I E;  3MXP A;  4F87 A;  3E0J A;  1F2M A;  1Q3L A;  1PTO F;  4L6T B;  3K5M A;  3NK9 A;  4KY5 A;  4ZAI A;  2CW0 C;  2NVY B;  2DY8 A;  1B4O A;  2I46 A;  3ND9 A;  2V4D A;  2K01 A;  1RTO A;  3K57 A;  4XT3 B;  3P7J A;  1U4M A;  3H6M A;  4KI0 A;  3P1H A;  1C4Q A;  1PZJ D;  2IX3 A;  1TWF B;  3KLR A;  4DF7 A;  3MXU A;  1X3P A;  2BCO A;  2E75 C;  3EVQ A;  4CKB A;  1Q8I A;  1ENA A;  1Z6H A;  1JOR A;  1KNE A;  5KNC A;  2K7V A;  1ONL A;  3DEO A;  1EEI D;  1BDO A;  5IOC A;  3NBI A;  5BN4 A;  4WRD A;  1SDF A;  4EQO A;  1ILP A;  4MHE A;  2ICI A;  3I72 A;  3PMF A;  5KIX A;  2RDG A;  5TSS A;  1DOK A;  1SE4 A;  2DNC A;  1TS5 A;  4NW2 A;  2WP8 J;  5LL6 X;  3PUZ A;  3RUZ A;  1D5X C;  5C0X J;  3BDO A;  3HOU B;  2F0P A;  2F4I A;  3R2T A;  4OO1 I;  4KY7 A;  1ZEQ X;  2B2W A;  4HMJ A;  1EY0 A;  2LFN A;  4J6H A;  2WKC A;  4RFB A;  3D3R A;  2JA5 B;  2KED A;  1CA5 A;  4LJZ C;  1IYV A;  2SOB A;  4G57 A;  1GUN A;  2N88 A;  3QG1 A;  4I65 A;  5E3F A;  1IL8 A;  4KJO A;  4ZRZ A;  3OMG A;  4ID6 A;  2F0K A;  1PLF A;  5BN3 A;  4C3I B;  1I4H A;  1PMR A;  1L0Y B;  1TWA B;  4FF4 A;  4ZUI A;  2F0F A;  1D5Z C;  4A3I B;  1YNJ C;  2B2T A;  1FNU A;  5C3X A;  4UAI A;  3K59 A;  1SYC A;  2F0L A;  4DFA A;  1F2Y A;  1TS2 A;  4M1U B;  1OXT A;  3SR1 A;  1YNN D;  2ZT9 C;  3BDC A;  5IGG A;  1QNU A;  3SDZ A;  1WTQ A;  1B2T A;  3M3Y B;  2F0V A;  4X3K A;  3CRK C;  4IUP A;  4IFD G;  1G2T A;  1O7L A;  1EY9 A;  1KTK A;  5I2X A;  1SEB D;  3NQT A;  3CKI B;  1QIL A;  2B2V C;  2FJ2 A;  4WFN 3;  2JP1 A;  3HOX B;  3D8G A;  1HUM A;  2QF7 A;  3HP3 A;  1G2S A;  2XRS D;  4HCS A;  1IW7 C;  4C2M B;  1PXU A;  3OIP A;  4R9W A;  2SEB D;  2IWH A;  4C3J B;  1EIG A;  3DMU A;  3VR3 A;  5NUC A;  3K0Y A;  4IQZ A;  2CQA A;  1XXG A;  5JEA J;  4OIK A;  1PZI D;  2A6H D;  3DHQ A;  2R93 B;  4G7H C;  3I91 A;  2K5D A;  3NTH A;  1RJT A;  4IUV A;  5JVH 3;  3VR2 A;  1Q1B A;  1I4X A;  5KRU A;  1PTO B;  3HGB A;  4RGM A;  1TKW B;  1W6K A;  1M8A A;  3PIP 3;  3BG3 A;  2BDO A;  4FO2 A;  5C6A A;  1IHZ A;  2O4X A;  4CJ1 B;  3OWF A;  1I4R A;  1H9K A;  4IFD J;  4KHV A;  1TQO A;  2FMC A;  3SK8 A;  3WOE A;  4F88 A;  1ML0 D;  1LAC A;  1STA A;  2PQE A;  1E0B A;  1WTW A;  2BA0 A;  1T5X D;  4OGQ C;  3QB3 A;  3RD4 A;  2B2V A;  5T1G A;  1EEF D;  1PRT D;  3C1F A;  1ESR A;  1FNW A;  3DM1 A;  3PO2 B;  2O5I C;  4NKL A;  3GV6 A;  2X69 A;  4EQP A;  2B39 A;  1LTB D;  4KV6 A;  5BN5 A;  4K5V A;  5I6W A;  3ERO A;  4CJ2 C;  5M3F B;  1CQF A;  3DXJ C;  1EU4 A;  3L3O C;  1PRT F;  4FP5 D;  2IX1 A;  3EQL C;  1MD2 D;  4BBR B;  5JEA G;  3NE5 B;  4RCO A;  3TDQ A;  4B9W A;  1DZ1 A;  1R4P B;  2ICE C;  1BCP C;  5M5X B;  4E6I A;  1F9R A;  3CQZ B;  5FOB B;  3AU7 A;  1F9P A;  1LTG D;  1WTO A;  3R8B A;  2F0J A;  1Z47 A;  4N9P A;  3J80 E;  4HN7 A;  1IYU A;  5FO9 B;  4ULL A;  2M2L A;  3GTK B;  2O5J C;  3BYT B;  1H9S B;  1GJX A;  2MUY A;  2VNU D;  3RZO B;  3IKJ A;  2NVX B;  5IOD A;  1TWG B;  1SNP A;  3OHX C;  5E4W C;  3T53 B;  1JB3 A;  4PV1 C;  1S5F D;  1JR0 D;  5ELF A;  3L9A X;  4WJW A;  4A3E B;  2PZU A;  1Y8N B;  4LAA A;  1NR4 A;  4IAL A;  5CV8 A;  2D62 A;  1HHV A;  1L0X B;  5K5P A;  2A68 C;  3NTI A;  2F0Q A;  3J7Y W;  4KKU A;  2L55 A;  3HOW B;  5EQ0 A;  2XWB B;  5CV9 A;  1Q1E A;  3H0G B;  2VB3 X;  1IKM A;  2DNE A;  1DON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...