2F0HA

Crystal structure of staphylococcal nuclease mutant v66l
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 39
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0hA00
1U9RA 3NUCA 4ZUJA 4TRDA 5J1ZA 2SNSA 2RBMA 5J22A 1EY4A 3OSOA 4QF4A 5I9OA 3ITPA 3SK6A 3TP8A 2EYHA 1STYA 4MIUA 2F3WA 5EKLA 2KQ3A 1SYCA 5C5MA 1A3VA 1SNPA 1SYDA 1II3A 3S9WA 1SNOA 3HEJA 3MVVA 4IUNA 3C1EA 3ERQA 3RUZA 5C3XA 2EY2A 3BDLA 2EY6A 3QOLA 2EYMA 4KV6A 2F0SA 2QDBA 1ENCA 4N9TA 4RKBA 5CV9A 5CC4A 5M9OA 2SNMA 4ZUIA 5IOCA 5IODA 2EYJA 4RKLA 4WORA 1NSNS 2PZWA 5KGUA 1A3TA 2PZUA 3MEHA 5HURA 4K2KA 3MHBA 4DF7A 1SYBA 5KIXA 5IGFA 2F0EA 2HQEA 3LX0A 2PW7A 1TT2A 4J6HA 3V2TA 5E1FA 5EGTA 1EYCA 3P1HA 2WACA 2F0WA 3D4WA 2OF1A 1KABA 4K2LA 4KD3A 4K5WA 1JOOA 1A3UA 2F0IA 3TP7A 3E5SA 1NUCA 5F2DA 1SNCA 3TP5A 4KTAA 2F0GA 2EYPA 5K5PA 4PNYA 5EKKA 2PQEA 1EY7A 4F8MA 2NUCA 1STAA 3T13A 1EYAA 5C5LA 3TMEA 5CGKA 1EY5A 4ME5A 5KYIA 4ID6A 3H6MA 5CV8A 1EY0A 5JAVA 4F7XA 1SNMA 5I6YA 3D8GA 5IGCA 4IALA 5CV5A 5DEHA 2F0DA 4E6IA 2F0NA 1SYEA 4N9PA 1EQVA 2F0FA 5C6AA 1TQOA 1STGA 3NP8A 5CV4A 1AEXA 1SNDA 5CV6A 3SK5A 1JOKA 2F0JA 1EY6A 5C4ZA 5ISRA 5DAUA 5I9PA 3R3OA 1EY8A 1F2MA 2F0PA 3NK9A 4K5XA 4LAAA 3TP6A 2F0QA 4KY7A 5IIFA 2EY5A 1STNA 3QB3A 3P75A 1F2ZA 2EYOA 2RKSA 2EXZA 1TR5A 2F0OA 3OMCA 3OWFA 4K6DA 4PMBA 3U9OA 4EQNA 2KHSA 5IGEA 3SK4A 3BDCA 4HMJA 1IHZA 4KD4A 1A2UA 3D4DA 5CR3A 2EYFA 3D6CA 5KYLA 4PMCA 4J1MA 3MXPA 4HTHA 3PMFA 5I6WA 1RKNA 5IGGA 1SYFA 1JORA 1JOQA 5JOBA 2PW5A 4EQOA 3EROA 1A2TA 2F0HA 1SYGA 4NKLA 3NHHA 2F0TA 4G57A 1STBA 5CV7A 5NUCA 1KDCA 4KJNA 5C3WA 2M00A 4NP5A 4K14A 2F0MA 5J39A 1EZ6A 1EZ8A 2F0UA 4YIJA 1EY9A 3OMGA 5KRUA 4KJOA 5IGBA 4DU9A 2ENBA 3C1FA 4K5VA 3SR1A 5HGTA 2SOBA 4R8NA 4K8JA 1STHA 4ZQ3A 3DMUA 4ODGA 2PZTA 3EJIA 1F2YA 3HZXA 4KHVA 1ENAA 4WRDA 2OEOA 2F0KA 2EYLA 3SK8A 4I65A 4EQPA 5C4HA 2O4XA 3MZ5A 4KY6A 1SNQA 3DHQA 4S3SA 3T16A 3QOJA 4KY5A 2F0LA 4HMIA 4EVOA 4QB4A 4DGZA 3NQTA 3NXWA 4B9WA 5IGDA 4B9XA 4H7BA 3EVQA 2F0VA 1EYDA 2OXPA 2PYKA 3SHLA 1KDAA 2RDFA 3VA5A 2LKVA 1KAAA 4OL7A 4QMGA 5E3FA 4DFAA 2F3VA 3SXHA 2EY1A 5KEEA 4NMZA 4IZ8A 4K8IA 1KDBA 4NDXA
chains in the Genus database with same CATH superfamily
3DLLA 3WDNA 2ICIA 3TP8A 3HKZB 2EYHA 3UI2A 1X54A 4C1NK 3C46A 2XTIA 4X62Q 4RH6A 2WINB 5BN3A 3BDLA 2EY6A 1H9JA 2GA4B 4HSVA 2QEJC 1AZQA 2VXWA 3D0FA 1ASYA 5IODA 4WORA 4UP9A 2JSOA 1D1KA 4IUPA 1CSQA 1BDOA 4XYOA 3H3VH 4LFCL 2WP8J 3S2DH 5CORA 1SXTA 5E1FA 5GROA 1VQBA 4OO1G 4K5WA 1PH2A 3OTOL 2RHQB 3BZCA 2EYPA 5IYCG 4IJLA 5GAHC 2KUMA 3CQZH 1HZ9A 5EPLA 4LF9Q 5M5YB 3HOWG 4BXXG 3EQLC 1U4MA 1O78A 3D8GA 3DEPA 5A35A 1BCPC 4YHHQ 4JI1Q 4R4TA 1SYEA 4QL5A 1YNXA 3I73A 3HOUB 1AEXA 3HKZG 3PUYA 2UUCL 1CQVA 1LV9A 2AQ3B 2NWGA 1XMQL 2B8GA 4LFBQ 4KKSA 1EIGA 3CPFA 3U9SA 4JC0A 4GOPC 4JI7L 1EYGA 4IPGA 4POGA 5J3BA 1SE2A 4PMBA 4DV0L 2OT2A 2SEBD 4UY8C 1ICFB 1GJXA 2AQ1B 1S5CD 4F88A 2TSSA 1A2TA 1SYGA 4DR7Q 4DV5Q 4C3JH 2CFMA 1G8ZD 4DR2L 2IX0A 3HG9A 3L2PA 3HGBA 4JI6L 3GTQH 1QCBD 1Y1WB 4K5VA 1D1IA 1E0BA 4K8JA 4LF8Q 2OQKA 4B3RQ 4DR5Q 4A76A 1YJWA 3SK8A 3S1RH 3T1YQ 2V4DA 4WJ3M 3HOUG 3CXCA 3H15A 2A6HC 1HUMA 1HR0W 5H1SE 2OXPA 3SHLA 3HOVB 1EIYB 5A2QL 1PH3A 4R4QA 3BG3A 1VQHA 3PF4A 3W1GA 2KCNA 2L15A 4ZUJA 2XVSA 5KNCA 2B39A 4QIWB 3K59A 5C5MA 2Z6KC 3S9WA 3VYRA 3HEJA 3UDIA 2KVMA 3ERQA 2CQOA 3K57A 5LMNL 2MPMA 4JV5L 1RHPA 1PRTB 2FMMA 4EX5A 4OWTB 4L5TA 2AMCB 2AUJD 3MEHA 5HURA 4XXEA 4K2KA 1E7ZA 2CVRA 2RDGA 4K0KQ 1MBYA 1WTQA 1L0XB 3I2ZA 2JN4A 4DV1L 3J7AF 5EPKA 2YTVA 4HCSA 1A3UA 4XQNA 5C0XI 1HXYD 3CKIB 2PQEA 2F4VQ 4LF7Q 3CPWA 1P8LA 1EY5A 3HOVG 1EY0A 2NVYB 1SFOB 1E2VA 4IUUA 4RA8A 4X6AH 1X56A 2R7FA 4BY1B 4OX9L 2B63B 1ESRA 3PIP3 3RN5A 2XRQD 3J81j 1F9SA 5DAUA 3S16H 1OXXK 1X3EA 3OYYA 2F0PA 3B6YA 1TWGH 2NZHA 3D31A 1H9KA 4DK1A 3QB3A 3CAMA 1KIXA 1K83H 1UEAB 1O7ZA 5KYLA 4PMCA 4BBRH 3PO2B 1SYFA 3F1ZA 4DR3Q 2K5HA 4EQOA 1ILPA 1AH9A 1FGUA 4PMWA 1KDCA 2KENA 5C3WA 2M00A 2R93H 4K14A 3K7UC 2IWHA 3H94A 1K3BC 1I5FA 1Y1VB 5BN5A 2L11A 1HNWQ 3IFTA 3ZYYX 4O2DA 4CJ0B 3J7ZC 3J7A5 2FHTA 3ZJYC 2XWJB 1WTHA 3A8IE 2JA5H 5IY0A 4I65A 5EAYA 4BY1G 2B63G 2Z1CA 2R92H 4GLXA 1NMGA 2PI2A 3NXWA 3HFZB 1VQ5A 1V1OA 1VQMA 3HKZE 1G91A 1F9QA 3GTGH 4IOAA 2EY1A 4KLKA 2A8VA 4QGUA 1C4QA 3CCUA 1EY4A 1DZ1A 1D8LA 1SRUA 5C0XG 4HIMA 1EQQA 3PO2G 3H3VC 1II3A 4TKOB 1IBLL 4ZUIA 3S1QH 1F9RA 4NXML 1Y1VG 1UE7A 3DXJC 3MHBA 2F3IA 3MXNA 5IGFA 1DGSA 5IE8A 1TT2A 4ABNA 2EJMA 2M2LA 1GUGA 4GLVB 2HCCA 2YV5A 1E1OA 2QW7A 1LT6D 3U4ZA 1JICA 4DR6L 2NN6I 4JPBW 4V190 5ELEA 3EFXD 3GTLH 3FKIB 4IPDA 4B3TL 2NUCA 2N3SA 1VQAA 1CI3M 3IRBA 3BYTB 2DNCA 2JEBI 1OTCA 1VF7A 1MKHA 1WI5A 1C8CA 4HN7A 1JB3A 2B2TA 2K33A 2KEDA 2L55A 5FO9B 3F2BA 1TWHB 2JA7B 1HZCA 5DM63 5TSSA 2NVQH 2K28A 1I94Q 3SK5A 4Y52H 1NR4A 2E5LQ 2I07B 4YWKA 1Q46A 3RLOA 4TVAB 4LAAA 1RDPD 2AUKA 3P75A 1XYIA 2E2HB 1I4GA 2E75C 1WVLA 1LABA 3BDCA 3H0GB 4KD4A 1KD1C 4C56C 5FOBB 2QKIC 2JJQA 2NVXH 2UUAL 2PW5A 5C3EH 2V1CC 3CD6A 5JPNC 5D3DA 1YBYA 3DWAA 2MO1A 1ML0D 4GN5A 2A68D 2KHJA 3J81c 1ILQA 1UNSA 4JI4Q 4GLAC 3FKIG 2CW0C 1C9OA 2UXBQ 5KRUA 5D3IB 1BR9A 5IP7G 3GDEA 4JBJA 2JYOA 2ENBA 1XNRL 4O0AA 4BA1I 2R61A 3A5ZB 3W1BA 4ZQ3A 4PZ7A 4P74A 3HZXA 1VMCA 5T1GA 4F87A 1KL9A 5C4HA 2EZVA 3RNUA 3PO3H 4DV3L 1FGBD 1PFSA 2F1MA 2QCPX 4KN4C 3KLWA 3HRZC 1W3SA 4H7BA 2K14A 4QQBX 1M4VA 5JVG3 1EEFD 3NTKA 1XTCD 1K8AC 5AFWA 2NN6G 1TY0A 2UXDQ 3H0GG 1I50H 4DV2L 2KQ3A 2ASBA 2X6GA 1JC7A 4C3HB 3NQIA 5GAEC 2KEEA 3M4OB 2N78A 2PMZB 4LFAL 5C4XH 4G7HC 4G7OC 1IBKQ 2HUGA 3MA2B 4G7ZC 2K5NA 1L1OA 1PFMA 1SEBD 1LTBD 1LUZA 4JG2A 1B3AA 2E2DC 3F2DA 4KTAA 3NTHA 1RL2A 3VYSA 4FDBA 4RG1A 3NWTA 4LMQD 3ICEA 3HOYB 2VY3A 2ZJRA 1S4ZA 4BY7H 4F7XA 4DAYB 2K32A 2I5HA 4A3JH 1I4QA 4ZCKA 3Q22A 1KNAA 2WB1G 1V43A 3QG1A 2N49A 5C4ZA 1S5FD 2J4XA 2L1BA 1TKWB 3A7LA 5DNFA 4C3HG 2A1AA 5JJZA 5C4JB 3TREA 3TP6A 2YTYA 1HH2P 1KLGD 3MTSA 1SR3A 1QUQB 2G9HD 2I5MX 2DUDA 3ERSX 1Y8OB 2MHVA 2I0QA 1S3OA 1D5MC 1C7YA 1IHZA 1A2UA 1EWIA 1JJGA 2EYFA 1VQ7A 2YU9H 1QJOA 1JT8A 2H5XA 1AP0A 3CCMA 3Q8DA 1K8OA 4JI3Q 2K5WA 5EBCA 1FNVA 3CW2C 5CBAE 1AN8A 1VQLA 3CMAA 1EY9A 4LF6Q 5DM73 2CWAA 5HGTA 4C3IH 2A69C 4RAUC 2WV6D 4JCVE 3TN2A 4FYDA 3I72A 1PV4A 1HNXQ 3Q6SA 4IUTA 1GOZA 3IAYA 2OEOA 4LNQA 1PTOH 5M5XH 4MTNA 3G48A 1QZHA 3LGJA 2Q2HA 2RVLA 4FF1A 4IOCA 2R7ZH 5FK9C 2RDFA 2LKVA 2NTSA 2K05A 3SDZA 5LMNQ 4IPHA 1WD1A 1Y69U 1CM9A 3PCOB 4BY7G 3VYTA 1CTMA 2HHHL 1ESFA 1HTLD 3LNNA 1IYVA 5I2XA 2Q2TA 1M90C 3R93A 3L7ZC 1DONA 3I4MB 1LLRD 2BH8A 2HIVA 4FVMA 1E2ZA 5G3LF 5CC4A 3OPOA 1NSNS 4GNXB 2C5CA 3X3MA 5JJKA 1IW7D 2PZUA 1VF5C 5I2YA 2K4KA 1TS2A 1S5DD 3AB9A 3KLSX 4QJFA 5FO7B 1U4LA 1ONLA 5EGTA 1TWAB 3J80c 1NMFA 4CBVA 4K2LA 2SDFA 2CCZA 4V0BA 1PMRA 1VDZA 3AFPA 4KHZA 3GTOH 3MFGA 2NB0A 2ICEC 3KF6A 5CGKA 5LHY1 1BBWA 1V1QA 4BWGB 5BR8L 1SMXA 1JJCB 2K75A 4RGOS 4LF5Q 2E2IB 4MZ9A 4OWWB 2IT1A 1IBMQ 2A19A 2ZXOA 4LF4L 1SMYC 3OHXC 4RCNA 3PIO3 2GN5A 3I4MG 3M9BA 4DR4L 1LTID 2DGYA 1S72A 1CSPA 4AIMA 1CA5A 1PYSB 1KRSA 4KI0A 1J8IA 2KHSA 1SJHD 2CKZB 2AWNA 3EROA 5IYDG 1CT1D 3TSSA 2F0TA 1HCZA 2IHFA 3H09A 1S5ED 1U4PA 1HR0Q 1XPOA 3FMCA 3A74A 4X65Q 3OMGA 3RLNA 2WKCA 2ZJPA 3URYA 3D4RA 2NZ1D 4RCOA 1STHA 3GTKB 5C0XJ 1YHAA 1WTRA 2Q2UA 5FLXL 5JPMC 1YNNC 1ENAA 3MXGA 2A5HA 2WAQB 4TQUS 4OELB 2B3GA 1BQQT 2KOLA 1A62A 1HZAA 3DHQA 4CJ2C 2F0LA 2B2WA 2WB1E 2ZJQA 1KDAA 4KHPL 5LL6X 1HQMC 2UXCQ 3HOWH 5IGGA 5IT9E 4BXXH 2XGTA 1GUNA 4JI5Q 3OSOA 1HNZQ 3JAMc 4DUYL 2HQLA 2J0TD 1SNPA 4YCUA 4DV4L 3C1EA 1BF4A 1CKNB 3ONAB 2F0SA 3K5LA 4A3MB 4FF2A 1BCPD 2SNMA 3W5OA 4B3SQ 3GTJB 4RKLA 1XMOQ 2QA4A 2XSCA 4JBKA 5KIXA 3LX0A 1J5EL 1EFID 1M1KC 3V2TA 1N33L 3T1HL 4NXNQ 2F0IA 2WAQG 2B2TC 3NELA 4DXFA 2EE1A 3AFQA 4EGVA 2JEAI 1I4HA 1ZKOA 1MJEA 5HGQA 1E24A 4P73A 5IGCA 3S1MB 2JQOA 5M5YH 2X69A 4A3EB 4QUCA 5LMNW 1STGA 1FR3A 3FDTA 5CV6A 5I9PA 3TS0A 1F2MA 1S5BD 3NK9A 3HOUH 4BA2I 3S2HB 3KF6B 4X66Q 1STNA 2H4OA 4IQZA 2EYOA 4A3MG 2VUMB 3BS1A 3G6EA 3E0JA 1GUWA 1YI2A 4OIJA 2N8NA 2A6HD 1PA6A 1Q1BA 4DNRB 3V05A 1TXYA 4A3IB 3F8TA 3J81L 5IWAQ 2JA6B 2C35B 4P71A 2VQEQ 4X3TA 3SEBA 1I6VC 2ZM6L 1PTOC 4DV3Q 3K5MA 2K5QA 2B2UC 3CU7A 1MD2D 3QO2A 1Y1WH 1EWHA 5JEAG 1JCKB 1X32A 5FO8B 2RA4A 2DJGC 1K73C 5K36G 4A3EG 4B3MQ 1K8MA 2EXDA 4GKKL 4HEDA 1N32Q 1FD7D 3U4VA 1HFNA 3RZOB 5FLMG 3EA6A 1B44D 1RD9D 1QVGA 3FVQA 1VQKA 3M3YB 3A54A 1UWVA 4JI8Q 2VUMG 5CR3A 1RODA 3HOVH 4NDXA 1O7IA 4A4IA 4LK1C 1VS0A 4RGTA 4DAMA 1B1ZA 3NBIA 3G7LA 2QEXA 1L1OC 3ND9A 4O1NA 4A3IG 2JA6G 2QDBA 1XX8A 3A8JE 2B2VA 1NNXA 2K52A 1A15A 3CC4A 3FHWA 1BKBA 2AKWB 1X3FA 1VQPA 2WACA 5T1IA 4NB3A 2B2YA 1KABA 3S15B 4DR1Q 3E5SA 1SAPA 4XT1B 2IJ0A 5K5PA 1PDQA 2EQSA 1VCIA 2D0OA 2MFIA 3MWYW 4CDFC 2XIWA 3T13A 3TMEA 1HTPA 4Z9CB 5LMUQ 1FVIA 3W3AA 5CV8A 1U0LA 1NAPA 1WD0A 1Q81C 2F0DA 4ALPA 2NVYH 3K5OA 1SFOH 1Y1WG 3NE5B 1EY6A 1QVFA 1WTWA 1QOHA 3I8ZA 4BY1H 2B63H 5ELOA 1Y8NB 1GHKA 4KY7A 4A3CH 3OMCA 1V9PA 1TU2B 3OIQA 1TS4A 2ID0A 3U58A 3CRLC 3FEWX 1JOQA 4A93B 1JORA 1BOSA 1CKOA 2F0HA 5C0XH 4JI0Q 5A2QE 1LACA 2E74C 1XNQL 4RGMA 3AYHB 3PO2H 4I7AA 1PH7A 1FNUA 1HQRD 3J81i 1F9PA 1EZ8A 2L9HA 1Q8IA 1VQ8A 2Z9HA 3NBHA 1D2BA 3SR1A 1Q86C 1Y1VH 4FXDA 1E22A 4R8NA 4YWLA 1O80A 2PZTA 3CC7A 1IKMA 3U50C 4BBSB 1WCMB 2NYZD 2Z0SA 4HJ9A 3GD7A 3I56A 2XRSD 1A8VA 1B9MA 3DWPA 1QWYA 3TDQA 5AJ3Q 5IGDA 2AQ2B 1X65A 2LY7A 3QIAA 2R7DA 3AU7A 4CDCC 4XTCS 5E3FA 3VA7A 1BO0A 2UUBQ 4LUVA 4IZ8A 5FJ8G 1PH6A 1JB7A 4IFDI 4XYQA 1F2LA 4X64L 5M3MB 2Q8RE 2BE5C 2EOTA 1A6XA 3EIVA 4U68A 1G2TA 4A93G 4IUNA 4OIKA 4GS3A 3KFUA 1GM5A 5CV9A 2HT1A 1ENCA 4JK1C 1EFWA 2A73B 5FLXc 5M9OA 2VZAA 5IOCA 1EQTA 3UDXA 4ZYSA 2MUYA 4PQXA 4A3CG 4A3KB 4DK0A 3PQIA 1T5EA 3J80L 3EBEA 3P1HA 4YY3L 1IYJB 4RGNA 1I4XA 4BBSG 1JOOA 1SJED 1WCMG 1JWMD 4PZ8A 5F2DA 1GHJA 4B08A 2DY7A 5EKKA 1D6EC 2AHOB 4JYAQ 3FKIH 4M1UB 1N36L 3QR8A 1B2TA 5IP7H 3KDFA 2R93B 3TS2A 3FRPB 3MEFA 3E6ZX 4MTKA 2CW0D 5M3MG 3HP3A 1DXMA 4DAYA 1HA6A 1GO3E 4JI2Q 2UU9Q 1TWHH 2JA7H 2Z4IA 1B9NA 3BVMA 1J6QA 3PF5A 1N34Q 2CWPA 4RHRA 2EY5A 2HDMA 1L2FA 4A3LG 3CCJA 2NVTB 1QUQA 3ULLA 2E2HH 1N8RC 4A3KG 2L12A 3VR5A 3GV6A 2NN6H 3PMFA 2E2JB 3H0GH 3KJOA 1CFMA 1XJVA 1KTKA 3CCRA 5EKIA 3VR4A 5J39A 1MJCA 4H0LC 3SGIA 4IFDG 1HZBA 3K8AA 2N55A 4KJOA 3AEVA 4A3DB 2FINB 4DV6Q 1HPCA 4A3GB 1XTDA 2A6EC 4OEMB 3IL8A 4GKJL 2B2WC 5GAGC 2DNEA 4AQYL 4KHPQ 4A3BB 3STBC 4JOIA 2EYLA 4MNOA 3T53B 1EIHA 5C44B 2F52A 1QNUA 2JA8B 1G2SA 3L9AX 4R8IA 4X62L 4YCWA 3EVQA 1GXDC 1LTLA 3NBHB 4GN3B 2EJGC 4DV4Q 5ELFA 4MHEA 4NMZA 1UEBA 3JAML 4DV7Q 1J9OA 1QILA 4TRDA 1CQFA 2IX3A 3AQQA 1Q3LA 1STYA 1FJGQ 4WJWA 4MIUA 2F3WA 1FL0A 1PRTC 1IXRA 1G6PA 1A63A 4QY7A 2EY2A 2Z4HA 2RSOA 4N9TA 4LUZA 3A5UA 4C3HH 2JA7G 3FPPA 2IX1A 3BDOA 5IP9G 1JE4A 3S24A 3M4OH 4L5QA 1A3TA 3BVGA 3C2PA 4A3DG 1QB5D 3A7AB 4DK6C 4A3GG 4LF9L 1E2WA 3KLSA 4GNXA 3LWUA 4QIWE 3J80i 1BXTA 2OF1A 2OCEA 3D4WA 4KD3A 1I4RA 1Z9FA 4YHHL 4A3BG 4JI1L 3TP5A 3RMHA 2ALYB 1VQFA 5C44G 1VQIA 2JA8G 1ET6A 3TRZA 4LFBL 2NTTA 4LFCQ 2WFWA 1LT4D 2JA9A 3KOJA 5JAVA 1R9TB 1I3QB 1HFGA 4N8FA 1NJIC 3HOYH 3OTOQ 3KJPA 1TQOA 1LTTD 5CV4A 4KKUA 2JK8A 1JOKA 2A69D 1EY8A 3UE0A 3O13A 1OO9B 4DR7L 4DV5L 4ILWA 1F2ZA 5C4JH 1JR0D 2EXZA 2ZTCA 3KDFB 1I4PA 2D62A 3SK4A 5JEAJ 2D5DA 2UUCQ 1YEZA 1CK1A 2ZXPA 1XMQQ 2ATWA 4ULLA 4L8JA 4JI7Q 1STBA 1JE5A 2VW9A 4LF8L 4B3RL 2H1EA 2RQXA 4DV0Q 5EPJA 3I4NB 3T1YL 1LT3D 1F77A 2EDGA 2IHEA 4ZLTF 1NBWA 1M8AA 3WWVA 5GQOA 1X55A 3DMUA 3S17B 2EJFC 3GTMB 1SDFA 5COYA 4DR2Q 1NR2A 3KUPA 1CA6A 1SNQA 4JI6Q 3QOJA 2TMPA 4OONA 1KHIA 1YZ6A 1RF2D 4B9XA 1KAAA 1QNKA 2EPBA 2FXQA 1TWCB 1PLFA 3HOZB 5DLQE 4P72A 4CKCA 3ITPA 4FXKC 3JAMi 1I6HB 3TZDA 3HOYG 4K0KL 3DM1A 3M4PA 2AWOA 2KCTA 4CJ1B 1LO5D 1LYLA 4HIDA 2VS1A 3I4MH 1K0SA 3I4NG 1YHBA 1XPRA 3S14B 1CKNA 1TWFB 3CCSA 1K8GA 2XNAC 4ME3A 2MP1A 2F4VL 5HY6A 1SYBA 2D0PA 1SMYD 5IYBG 3M7NA 3X3NA 2OTJA 2MO0A 3S1NB 3VR6A 3GTPB 4JV5Q 1Q8KA 1S40A 1TWAH 4DNTB 5IYDH 4HIKA 2K5DA 1NCVA 1QVCA 1B50A 1QG7A 2I5LX 4G4KA 4OHJA 3HOXB 4R4CA 3KLRA 3SVMA 4DV1Q 4IALA 2F0NA 1EIFA 1RIPA 2PO4A 5ISRA 2E2IH 1BCPB 4CDDC 4LW1A 4DR3L 2Y0SB 4C2MB 4A3FB 1R4QB 1E3PA 4Q0FA 4RFBA 3ER0A 5IGEA 4EQNA 4K6DA 1YNND 3GV3A 4EQ5A 1HA5A 3Q24A 4OX9Q 1RTNA 1HNWL 3EN2A 2PNHA 1OXUA 4OWXB 5I6WA 2OWOA 3NHHA 4G57A 5NUCA 2Q8IB 4KJNA 1Q90A 4PV1C 4X3UA 4HJ5A 2EIFA 1JJ2A 2KJXA 3K5NA 4XT3B 4KMUC 5IGBA 3K81C 1G291 1K9MC 3HOXG 5M5WB 2KA7A 2DY8A 3DEOA 1EU3A 2VQFL 4HJ7A 3GTKH 2QGQA 2M9VA 1ICWA 1X3PA 1NY4A 2F03A 2FMCA 3N6RA 4GN4B 2Y0SG 2PYKA 1PZID 3D6WA 4A3FG 4OL7A 2C9OA 2JP1A 1EQRA 2F3VA 4HJAA 5M3FB 1DOKA 3OIPA 2QF7A 2MNAA 3KF8B 1KDBA 1LTGD 1U9RA 4OGQC 1B53A 1TS3A 3W2DA 1U5KA 3I55A 1SE4A 4UAIA 3I4LA 3RN2A 5ELBA 4UPAA 2IY5B 4PG3A 3ULJA 1D7QA 1Q7YC 2ZXRA 2EYJA 2IPKD 4XIGS 4YCVA 4A3MH 3VDYA 3F2UA 3GTJH 4Y7NB 4RMFA 2LFNA 2KCMA 3DWQA 3A56A 2L0CA 3MAQA 1Z47A 2CHBD 2ZTDA 3K0YA 1IBLQ 1Q1EA 1NUCA 2PMZE 4NXMQ 4PNYA 4IUQA 4BS9A 1I94L 3RZDB 1QZGA 2OQ0A 4LWCA 2E5LL 1AZPA 3VYUA 1X9NA 3A8KE 5M3FG 5I6YA 2K1BA 4E6IA 4DR6Q 1SROA 3K7AB 3S1MH 5JEAH 2RSNA 4B3TQ 5ELCA 1PTOD 5K36H 4A3EH 2O5JC 1Z6HA 4IFDJ 2K03A 1LTSD 5FLXE 4L5RC 5FLMH 4ZK9B 3S2HH 4JI4L 1K0RA 2UXBL 4HMJA 3R2TA 2VUMH 2ZT9C 2CH4A 4HTHA 2IW3A 1EEID 2R3ZA 5JOBA 3CMEA 2GVBA 5CV7A 3G6JB 2HD3A 4GKJQ 4R4OA 4A3IH 2JA6H 3L3OC 5EBDA 3NSWA 1V8QA 1A0IA 1MIUA 3BZKA 1VQNA 3FPUB 2UUAQ 3T51B 2K04A 1B4OA 3H3VI 3QWNA 5EQ0A 2MGSA 3EJIA 3WOEA 4KHVA 1YJNA 4L6TB 2F0KA 5ELNA 2UXDL 4S3SA 4QB4A 4DGZA 3TZUA 1SE8A 3UE1A 1XNRQ 3NTIA 1EYDA 4DFAA 3RZOH 1WJJA 2K01A 1XXGA 4K8IA 2MQHA 1IBKL 1H9SB 2PQAB 2RBMA 3M3YH 2O2LD 2QILA 2BDNA 3M4QA 4GNXC 1GUOA 3QOLA 4RKBA 1X3QA 3GP7A 1N9WA 4N8X1 4DAPA 1T9HA 1VQEA 2BOSA 3S2DB 1IKLA 4CDEC 4U673 1GD7A 4DV2Q 2KBNA 4J6HA 1PH9A 3NEMA 1YNJC 1ZYRC 5ELDA 3OW2A 3HS0C 2DJFC 3CQZB 4LFAQ 1BVSA 5LL6S 3S15H 1G51A 1VQDA 2D2CC 4CGYB 2B29A 3H6MA 3J81E 3BZDB 3Q23A 3CRKC 2ZTEA 1NTGA 2BA1A 5CV5A 3WOFA 3UDGA 2Q8TA 1R4PB 1IL2A 2Y0SE 1HHVA 4A75A 3M85A 3M4YA 3PIPA 3NP8A 4IUVA 1PH5A 3L0OA 3GO5A 1TY2A 4JI3L 2RHSB 3G71A 2XWBB 2F4IA 1PH8A 5E4WC 4LF6L 5FJ8H 4IN3A 3BVZA 3JC66 4C3JB 4NKLA 5G3LD 1HNXL 4A93H 3GTQB 4NP5A 3TQYA 2YYZA 2BE5D 1O7YA 4DU9A 1H9MA 2I46A 4DNIA 1WOCA 2VB3X 1PXUA 3S1RB 1K3RA 1F2YA 3VR3A 1B7YB 4JW0A 2EVBA 4KY6A 4BBSH 3K58A 3T16A 1WCMH 4X3KA 5JJLA 1P16A 3KBGA 4EVOA 4IPCA 3KK7A 2O5IC 4B9WA 2ES2A 4POFA 2E76C 3G4SA 1DOLA 1HUNA 1PHJA 3UDFA 1JMCA 3I7FA 1RTOA 1BNZA 3RR5A 1BUVT 5J22A 1DM0B 4QF4A 2WAQE 4HR7B 3I4OA 1Q82C 4FF3A 1H95A 1ZXTA 3BU2A 4C3JG 4X3SA 3H91A 5M3MH 1SNOA 1RJTA 3MVVA 2IL8A 4UP8A 2EYMA 4KV6A 2D9UA 1WYDA 2MJ8A 2A74C 3NPPA 4DXGA 2HHHQ 1KRTA 4A3LH 1CZGA 1OXTA 1Y14B 5CMDA 4QCLA 2LXKA 4A3KH 4R9WA 4LF5L 2R6GA 1VMPA 4R4IA 1PZKD 4C1NI 3CCQA 1IBML 2RCNA 2Z8LA 3ULPA 2G9DA 5IT9c 4KKTA 1EYAA 5C5LA 4IFDH 4ID6A 3E0EA 1TIID 2CH4W 1BBUA 5DEHA 2WIIB 2Z6BA 3S16B 1YHQA 5D65A 1TWGB 2A6ED 4JBMA 4Q5VA 1PYBA 1LT5D 1VQ4A 3IFDA 1K83B 1X6OA 2Q2IA 5BR8Q 5KGUA 2F0OA 1TR5A 3OWFA 1VQJA 3STBD 1HR0L 4BBRB 4X65L 3CC2A 3T56B 3K0XA 4LF4Q 4O42A 4AH6A 1PVOA 2VNUD 5FKAC 2NVTH 1JWSD 1LM0A 3A55A 4FF4A 4DR4Q 5GADC 2E2JH 1EZ6A 1ASZA 1U4RA 2VQFQ 3E3XA 1KQSA 2BA0A 5IP9H 1Q12A 2SOBA 1PRTD 1PZJD 2J7ZA 4A3DH 2K7VA 2JA5B 1HRJA 4ODGA 1C48A 4A3GH 2RCFA 3PGZA 2UXCL 2R92B 2B8FA 4WRDA 4JI5L 3SE0A 2O4XA 1HNZL 1PFNA 4DUZL 4A3BH 3J80E 1CUKA 2L5TA 2HDLA 3KBXA 5C44H 3GTGB 3PUVA 2JA8H 1WTOA 1KC8C 3SXHA 3RLFA 5KEEA 4B3SL 2K6AA 4IURA 1XMOL 4BBRG 3NUCA 3R8BA 1CHQD 2K50A 5EKLA 4P75A 4H13C 2R93G 1ET9A 5C3XA 5I4DA 3RUZA 3P7JA 3S1QB 1IZ6A 4NXNL 4R1JA 2OTLA 4ZKBB 3TEHB 2X6LA 4CKBA 4DUYQ 1DYQA 1O7LA 1PH1A 5BN4A 1EYCA 2JA5G 3GTLB 4KK7A 2K5VA 1EU4A 2R92G 5E4XA 3TP7A 3DUZA 3MFYA 2F0GA 4H02A 4DAVA 1XPUA 1VQCA 2JE6I 2NZOA 2KCCA 4AYBB 5KYIA 4ME5A 5D14A 3LWEA 1J5EQ 1N33Q 4X66L 3T1HQ 4FP5D 4HSPA 2NVQB 5KNDA 1EUJA 1UE1A 2E8GA 1R9TH 1W6JA 1I3QH 4N9PA 1EQVA 1Y8PB 2HCIA 1PFBA 1VQ6A 2LXJA 5IWAL 5CBEE 3CHBD 2L4NA 4NW2A 2CQAA 4DN4M 1AFPA 3C3LA 2VQEL 2NVXB 1BCPF 5C3EB 4IJHA 4I7ZC 4J1MA 4LUOA 1UE5A 2PNRC 4GOPA 2B2UA 3IKJA 4QUFA 1PTOF 3NWSA 1SN8A 3JAME 2N88A 2NBFA 1E1TA 1UE6A 1Z7TA 5L37A 2F0UA 1SSOA 2XN9C 4B3ML 5JVH3 1N32L 2WB1B 1RCVD 3C1FA 3FP9A 1YVCA 2HIXA 3GQBA 3CP0A 4AYBG 1W2BA 3I4NH 1L0YB 2BDOA 1D5XC 5IYBH 3PO3B 4JI8L 3T4AC 3N52A 4EQPA 3S17H 2LMCB 1OXVA 2BCOA 3GTMH 2G5DA 3ND8A 1KNEA 2ZM6Q 2WKDA 3K80C 1VQGA 3VA5A 4FO2A 4DR5L 3CCLA 2A68C 3Q0AA 2DN8A 2RF4A 1I50B 4JBWA 4UDUC 4RHSA 3DM3A 5C3EG 5I9OA 4GKKQ 2RDHA 4KN7C 1TWCH 3HOZH 1SYCA 1A3VA 3KF8A 1SYDA 3PUZA 5C4XB 1I6HH 1WTVA 1GKHA 1C0AA 3MXNB 4DR1L 1T5XD 1FYCA 1AE2A 2FJ2A 3E9HA 3D3RA 3RD4A 1KAWA 3CCEA 2F0EA 3PV0A 2Z6KA 4DK3C 1SLJA 5LMUL 3S14H 2VL6A 1TWFH 3I3CA 1CZWA 3PO3G 4WJ4A 2QDLA 2B2VC 1YJ9A 4HJ8A 3S1NH 3GTPH 1YITA 1V1PA 4F8MA 1AW7A 3I90A 4BY7B 2LSSA 1JWUD 4A3JB 2B2YC 1ZEQX 3HOXH 1G6ZA 1VQ9A 1BBXC 2F0FA 4LF7L 1STEA 4DKAC 1PYWD 3PSIA 3PIOA 4FNFA 4GZYC 4JI0L 1K28A 5C4XG 2F0QA 5IIFA 3CCVA 4LJZC 1IL8A 2RKSA 4M8AA 4C2MH 4A3FH 2YU9B 1TS5A 4XQJA 4DPGA 5CYUA 1KLUD 3K6OA 1AE3A 3D6CA 3BJUA 3MXPA 3AMUA 3F2CA 3E9IA 1WTXA 1L0WA 5E7NA 3HOZG 4HIOA 2F0MA 1X3GA 4H44C 4C3IB 4WFN3 1DOMA 3M7GA 5AJ3L 2P5ZX 2FFKB 4A3JG 3CF5A 1SE3A 1PTOB 1XNQQ 4GOPB 1WTPA 2UUBL 3PUWA 5M5WH 5M5XB 1D5ZC 1EWCA 1HJPA 4APVA 2R7ZB 1GUSA 1W6KA 4HMIA 4CKEA 3NQTA 1EOTA 2F0VA 4YWMA 1FNWA 4QMGA 1MGSA 4K6LA 5J1ZA 5M3FH 2SNSA 1KXLA 1QE6A 4P2CB 3SK6A 1EL0A 2JXMB 1H9SA 2PQAA 3I91A 2VB2X 4ZKCB 3NENA 1L1OB 2PZWA 5EJWA 4C3IG 1B70B 4X64Q 1B3QA 4DF7A 4HCEA 4JYAL 1EOVA 2HQEA 2PW7A 4Y7NH 2F0WA 3GTOB 4CHTB 4AYBE 1SNCA 5IT9L 2KECA 2R7ZG 1EY7A 1GUTA 2YTXA 4JI2L 2UU9L 1STAA 4MN3A 3OOCA 1CKMA 1GVPA 1DD2A 3RZDH 5JJIA 1N34L 4YY3Q 1SNMA 4FXGC 4UP7A 2KHIA 1CHPD 5KNBA 1IW7C 4L63B 5C6AA 4PZ6A 1SNDA 3QJYA 2F0JA 1B8AA 2LS01 4J8QA 1MI2A 4TSSA 3K7AH 3OWEB 3R3OA 4UHVA 1N36Q 3PUXA 1V1PB 4K5XA 1MHWC 4IO9A 4OO1I 4HAEA 3V96A 1SBBB 3U9OA 4RWSC 1DCZA 3D4DA 1OXSC 4DV6L 1VQOA 4XDXA 4OO1H 1MSGA 3A0JA 1RKNA 2PPBC 3BYYB 1JQYD 5IYCH 3I70A 1NE3A 1WFQA 1UUPA 1IYUA 1UAPA 1XWEA 1LTRD 2GVAA 4YIJA 2PCFB 3P20A 2PI2E 3OW7A 4DA2A 1PH4A 4L5SA 4DUZQ 3MXUA 4JVZA 1ENFA 3R2IA 4J15A 3J7AV 4NPSA 4DV7L 3MZ5A 4ZAIA 1H9RA 4ZRZA 4KY5A 1FJGL 3KYHC 2BH2A 1MSHA 1LTAD 1DJRD 1YIJA 3HKSA 3TBIB 1YNJD 1ZYRD 3HOWB 3MC0B 3J7YW 4AQYQ 1PRTF 4OXPA 4JOIC 4XQQA 1TVXA 3VR2A
chains in the Genus database with same CATH topology
3WDNA 2ICIA 3TP8A 3HKZB 2EYHA 3UI2A 3C46A 4C1NK 4RH6A 2WINB 5BN3A 3BDLA 2EY6A 1H9JA 2GA4B 4HSVA 2QEJC 1AZQA 2VXWA 5IODA 4WORA 2JSOA 1D1KA 4IUPA 1BDOA 4XYOA 2WP8J 5CORA 1SXTA 5E1FA 4OO1G 4K5WA 2EYPA 2KUMA 5EPLA 5M5YB 3EQLC 1U4MA 1O78A 3D8GA 3DEPA 5A35A 1BCPC 1SYEA 3I73A 3HOUB 1AEXA 3PUYA 1CQVA 1LV9A 2AQ3B 2NWGA 2B8GA 4KKSA 1EIGA 3U9SA 1SE2A 4PMBA 2OT2A 2SEBD 1GJXA 2AQ1B 1S5CD 4F88A 2TSSA 1A2TA 1SYGA 1G8ZD 2IX0A 3HG9A 3HGBA 1QCBD 1Y1WB 4K5VA 1D1IA 1E0BA 4K8JA 3SK8A 2V4DA 2A6HC 1HUMA 2OXPA 3SHLA 3HOVB 5A2QL 3BG3A 2KCNA 4ZUJA 2XVSA 5KNCA 2B39A 4QIWB 3K59A 5C5MA 3S9WA 3VYRA 3HEJA 2KVMA 3ERQA 3K57A 2MPMA 1RHPA 1PRTB 2FMMA 2AUJD 3MEHA 5HURA 4XXEA 4K2KA 2CVRA 2RDGA 1MBYA 1WTQA 1L0XB 3J7AF 5EPKA 4HCSA 1A3UA 4XQNA 5C0XI 1HXYD 3CKIB 2PQEA 1EY5A 1EY0A 2NVYB 1SFOB 1E2VA 4IUUA 4RA8A 4BY1B 2B63B 1ESRA 3PIP3 2XRQD 1F9SA 5DAUA 1OXXK 2F0PA 3D31A 1H9KA 4DK1A 3QB3A 1UEAB 1O7ZA 5KYLA 4PMCA 3PO2B 1SYFA 4EQOA 1ILPA 4PMWA 1KDCA 5C3WA 2M00A 4K14A 2IWHA 3H94A 1Y1VB 5BN5A 2L11A 3IFTA 3ZYYX 4CJ0B 2FHTA 2XWJB 3A8IE 4I65A 2Z1CA 3NXWA 1V1OA 1G91A 1F9QA 2EY1A 1C4QA 1EY4A 1DZ1A 5C0XG 3H3VC 1II3A 4TKOB 4ZUIA 1F9RA 3DXJC 3MHBA 3MXNA 5IGFA 1TT2A 4ABNA 2EJMA 2M2LA 1GUGA 2HCCA 1LT6D 1JICA 2NN6I 4V190 5ELEA 3EFXD 3FKIB 2NUCA 1CI3M 3BYTB 2DNCA 2JEBI 1VF7A 1C8CA 4HN7A 1JB3A 2B2TA 2K33A 2KEDA 2L55A 5FO9B 1TWHB 2JA7B 5DM63 5TSSA 2K28A 3SK5A 1NR4A 2I07B 4LAAA 1RDPD 2AUKA 3P75A 1XYIA 2E2HB 1I4GA 2E75C 1WVLA 1LABA 3BDCA 3H0GB 4KD4A 4C56C 5FOBB 2QKIC 2PW5A 5JPNC 5D3DA 3DWAA 1ML0D 2A68D 1ILQA 1UNSA 2CW0C 5KRUA 5D3IB 1BR9A 2JYOA 2ENBA 4BA1I 2R61A 4ZQ3A 3HZXA 1VMCA 5T1GA 4F87A 5C4HA 2EZVA 1FGBD 2F1MA 2QCPX 4KN4C 3HRZC 4H7BA 1M4VA 5JVG3 1EEFD 3NTKA 1XTCD 5AFWA 2NN6G 1TY0A 2KQ3A 2X6GA 1JC7A 4C3HB 3NQIA 2KEEA 3M4OB 2PMZB 4G7HC 4G7OC 2HUGA 3MA2B 4G7ZC 1PFMA 1SEBD 1LTBD 1B3AA 2E2DC 4KTAA 3NTHA 3VYSA 3NWTA 4LMQD 3HOYB 1S4ZA 4F7XA 2K32A 1I4QA 3Q22A 1KNAA 1V43A 3QG1A 5C4ZA 1S5FD 2J4XA 2L1BA 1TKWB 3A7LA 5DNFA 4C3HG 5JJZA 5C4JB 3TP6A 1KLGD 3MTSA 2G9HD 1Y8OB 2MHVA 1D5MC 1IHZA 1A2UA 2EYFA 1QJOA 1AP0A 1K8OA 2K5WA 5EBCA 1FNVA 5CBAE 1AN8A 1EY9A 5DM73 5HGTA 2A69C 4RAUC 2WV6D 3TN2A 4FYDA 3I72A 3Q6SA 4IUTA 1GOZA 3IAYA 2OEOA 1PTOH 4FF1A 2RVLA 5FK9C 2RDFA 2LKVA 2NTSA 2K05A 3SDZA 1WD1A 1Y69U 1CM9A 3VYTA 1CTMA 1ESFA 1HTLD 3LNNA 1IYVA 5I2XA 3R93A 3L7ZC 1DONA 3I4MB 1LLRD 4FVMA 1E2ZA 5G3LF 5CC4A 3OPOA 1NSNS 2C5CA 3X3MA 1IW7D 2PZUA 1VF5C 5I2YA 1TS2A 1S5DD 3AB9A 3KLSX 5FO7B 1U4LA 1ONLA 5EGTA 1TWAB 4CBVA 4K2LA 2SDFA 4V0BA 1PMRA 1VDZA 4KHZA 3MFGA 2NB0A 2ICEC 5CGKA 5LHY1 4BWGB 4RGOS 2E2IB 2IT1A 2ZXOA 1SMYC 3OHXC 4RCNA 3PIO3 1LTID 1CA5A 1J8IA 4KI0A 2KHSA 1SJHD 2AWNA 3EROA 1CT1D 3TSSA 2F0TA 1HCZA 3H09A 1S5ED 1U4PA 3FMCA 3OMGA 2WKCA 3URYA 3D4RA 2NZ1D 4RCOA 1STHA 3GTKB 5C0XJ 1WTRA 5FLXL 5JPMC 1YNNC 1ENAA 3MXGA 2A5HA 2WAQB 4TQUS 2KOLA 1BQQT 3DHQA 4CJ2C 2F0LA 2B2WA 1KDAA 5LL6X 1HQMC 5IGGA 5IT9E 1GUNA 3OSOA 2J0TD 1SNPA 3C1EA 1BF4A 3ONAB 2F0SA 3K5LA 4A3MB 4FF2A 1BCPD 2SNMA 3GTJB 4RKLA 2XSCA 5KIXA 3LX0A 1EFID 3V2TA 2F0IA 2B2TC 4DXFA 2EE1A 2JEAI 4EGVA 1I4HA 1ZKOA 5IGCA 3S1MB 2X69A 4A3EB 4QUCA 1STGA 1FR3A 3FDTA 5CV6A 5I9PA 1F2MA 1S5BD 3NK9A 4BA2I 3S2HB 1STNA 2H4OA 4IQZA 2EYOA 2VUMB 3BS1A 3E0JA 1GUWA 4OIJA 2A6HD 1Q1BA 4DNRB 3V05A 4A3IB 3J81L 2JA6B 4X3TA 3SEBA 1I6VC 1PTOC 3K5MA 2K5QA 2B2UC 3CU7A 1MD2D 3QO2A 1EWHA 5JEAG 1JCKB 1X32A 5FO8B 2RA4A 5K36G 1K8MA 4HEDA 1FD7D 1HFNA 3RZOB 3EA6A 1B44D 1RD9D 3FVQA 3M3YB 3A54A 5CR3A 1RODA 4NDXA 4LK1C 4RGTA 1B1ZA 3NBIA 3G7LA 3ND9A 4O1NA 2QDBA 1XX8A 3A8JE 2B2VA 1A15A 2WACA 5T1IA 2B2YA 1KABA 3S15B 3E5SA 1SAPA 4XT1B 2IJ0A 5K5PA 1PDQA 1VCIA 3MWYW 2XIWA 3T13A 3TMEA 1HTPA 4Z9CB 3W3AA 5CV8A 1NAPA 1WD0A 2F0DA 3K5OA 3NE5B 1EY6A 1WTWA 1QOHA 3I8ZA 1Y8NB 1GHKA 4KY7A 3OMCA 1TU2B 3OIQA 1TS4A 2ID0A 3CRLC 3FEWX 1JOQA 4A93B 1JORA 1BOSA 2F0HA 5C0XH 5A2QE 1LACA 2E74C 4RGMA 1FNUA 1HQRD 1F9PA 1EZ8A 2L9HA 1Q8IA 3NBHA 1D2BA 3SR1A 4FXDA 4R8NA 1O80A 2PZTA 1IKMA 4BBSB 1WCMB 2NYZD 3GD7A 2XRSD 1B9MA 3DWPA 1QWYA 3TDQA 5IGDA 2AQ2B 2LY7A 3QIAA 3AU7A 4XTCS 5E3FA 3VA7A 1BO0A 4IZ8A 4IFDI 4XYQA 1F2LA 5M3MB 2Q8RE 2BE5C 2EOTA 1A6XA 4U68A 1G2TA 4IUNA 4OIKA 5CV9A 1ENCA 4JK1C 2A73B 5M9OA 5IOCA 1EQTA 4ZYSA 2MUYA 4PQXA 4A3KB 4DK0A 3J80L 1T5EA 3P1HA 4RGNA 1I4XA 1JOOA 1SJED 1JWMD 5F2DA 1GHJA 4B08A 2DY7A 5EKKA 1D6EC 4M1UB 1B2TA 2R93B 3FRPB 3E6ZX 2CW0D 3HP3A 1DXMA 4DAYA 1HA6A 2Z4IA 1B9NA 3BVMA 4RHRA 2EY5A 2HDMA 2NVTB 2L12A 3VR5A 3GV6A 2NN6H 3PMFA 2E2JB 1CFMA 1KTKA 5EKIA 3VR4A 5J39A 4H0LC 4IFDG 2N55A 4KJOA 4A3DB 2FINB 1HPCA 4A3GB 2A6EC 3IL8A 2B2WC 2DNEA 4A3BB 2EYLA 3T53B 1EIHA 5C44B 1QNUA 2JA8B 1G2SA 3L9AX 4R8IA 3EVQA 1GXDC 2EJGC 5ELFA 4NMZA 4MHEA 3JAML 1J9OA 1QILA 4TRDA 1CQFA 2IX3A 1Q3LA 1STYA 4WJWA 4MIUA 2F3WA 1PRTC 2EY2A 2Z4HA 2RSOA 4N9TA 3FPPA 2IX1A 3BDOA 1JE4A 1A3TA 3BVGA 3C2PA 1QB5D 3A7AB 1E2WA 3KLSA 3LWUA 1BXTA 2OF1A 3D4WA 4KD3A 1I4RA 3TP5A 3RMHA 1ET6A 2NTTA 1LT4D 5JAVA 1R9TB 1I3QB 1HFGA 1TQOA 1LTTD 5CV4A 4KKUA 1JOKA 2A69D 1EY8A 3O13A 1OO9B 4ILWA 1F2ZA 1JR0D 2EXZA 1I4PA 2D62A 3SK4A 5JEAJ 2D5DA 1CK1A 2ZXPA 4ULLA 4L8JA 1STBA 2H1EA 2RQXA 5EPJA 3I4NB 1LT3D 1F77A 2EDGA 4ZLTF 1M8AA 3DMUA 3S17B 2EJFC 3GTMB 1SDFA 5COYA 1NR2A 3KUPA 1CA6A 1SNQA 3QOJA 2TMPA 4B9XA 1RF2D 1KAAA 1QNKA 2EPBA 1TWCB 1PLFA 3HOZB 4CKCA 3ITPA 4FXKC 1I6HB 3TZDA 3DM1A 2AWOA 4CJ1B 1LO5D 3S14B 1TWFB 2XNAC 2MP1A 1SYBA 1SMYD 3M7NA 3X3NA 3S1NB 3VR6A 3GTPB 4DNTB 2K5DA 1NCVA 1B50A 1QG7A 4G4KA 4OHJA 3HOXB 3KLRA 3SVMA 4IALA 2F0NA 2PO4A 5ISRA 1BCPB 2Y0SB 4C2MB 4A3FB 1R4QB 4Q0FA 4RFBA 5IGEA 4EQNA 4K6DA 1YNND 3GV3A 1HA5A 3Q24A 1RTNA 1OXUA 5I6WA 3NHHA 4G57A 5NUCA 2Q8IB 4KJNA 1Q90A 4PV1C 4X3UA 2KJXA 3K5NA 4XT3B 4KMUC 5IGBA 1G291 5M5WB 2KA7A 2DY8A 3DEOA 1EU3A 2M9VA 1ICWA 1X3PA 2F03A 2FMCA 3N6RA 2PYKA 1PZID 3D6WA 4OL7A 2C9OA 2JP1A 2F3VA 5M3FB 1DOKA 3OIPA 2QF7A 1KDBA 1LTGD 1U9RA 4OGQC 1B53A 1TS3A 3W2DA 1SE4A 4UAIA 3I4LA 5ELBA 2ZXRA 2EYJA 2IPKD 4XIGS 3F2UA 4Y7NB 2LFNA 3DWQA 3A56A 2L0CA 3MAQA 1Z47A 2CHBD 3K0YA 1Q1EA 1NUCA 4PNYA 4IUQA 4BS9A 3RZDB 1AZPA 3VYUA 3A8KE 5I6YA 2K1BA 4E6IA 3K7AB 5JEAH 2RSNA 5ELCA 1PTOD 5K36H 2O5JC 1Z6HA 4IFDJ 2K03A 1LTSD 5FLXE 4ZK9B 4HMJA 3R2TA 2ZT9C 4HTHA 2IW3A 1EEID 2R3ZA 5JOBA 5CV7A 3G6JB 3L3OC 5EBDA 3NSWA 1V8QA 3FPUB 3T51B 2K04A 1B4OA 3QWNA 5EQ0A 2MGSA 3EJIA 3WOEA 4KHVA 4L6TB 2F0KA 4S3SA 4QB4A 4DGZA 3TZUA 3NTIA 1EYDA 4DFAA 2K01A 1XXGA 4K8IA 1H9SB 2RBMA 2O2LD 2QILA 2BDNA 1GUOA 3QOLA 4RKBA 1X3QA 3GP7A 4DAPA 2BOSA 3S2DB 1IKLA 4U673 4J6HA 1YNJC 1ZYRC 5ELDA 3HS0C 3CQZB 5LL6S 2D2CC 4CGYB 3H6MA 3J81E 3BZDB 3Q23A 3CRKC 2BA1A 5CV5A 3WOFA 2Q8TA 1R4PB 1HHVA 3M85A 3M4YA 3NP8A 4IUVA 3GO5A 1TY2A 2XWBB 2F4IA 5E4WC 4IN3A 3BVZA 4C3JB 4NKLA 5G3LD 3GTQB 4NP5A 2YYZA 2BE5D 1O7YA 4DU9A 1H9MA 2I46A 2VB3X 1PXUA 3S1RB 1F2YA 3VR3A 2EVBA 4KY6A 3K58A 3T16A 4X3KA 3KBGA 2O5IC 4EVOA 3KK7A 4B9WA 2E76C 1DOLA 1HUNA 1RTOA 1BNZA 1BUVT 5J22A 1DM0B 4QF4A 4FF3A 4HR7B 1ZXTA 4C3JG 4X3SA 3H91A 1SNOA 1RJTA 3MVVA 2IL8A 2EYMA 4KV6A 2D9UA 2MJ8A 2A74C 3NPPA 4DXGA 1CZGA 1OXTA 5CMDA 4QCLA 4R9WA 2R6GA 1VMPA 4C1NI 1PZKD 2Z8LA 2G9DA 4KKTA 1EYAA 5C5LA 4IFDH 4ID6A 1TIID 5DEHA 2WIIB 3S16B 5D65A 1TWGB 2A6ED 4Q5VA 1LT5D 3IFDA 1K83B 5KGUA 2F0OA 1TR5A 3OWFA 4BBRB 3T56B 4O42A 2VNUD 5FKAC 1JWSD 3A55A 4FF4A 1EZ6A 1U4RA 2BA0A 1Q12A 2SOBA 1PRTD 1PZJD 2J7ZA 2K7VA 2JA5B 1HRJA 4ODGA 1C48A 2R92B 2B8FA 4WRDA 3SE0A 2O4XA 1PFNA 3J80E 2L5TA 2HDLA 3KBXA 3GTGB 3PUVA 1WTOA 3SXHA 3RLFA 5KEEA 2K6AA 4IURA 3NUCA 3R8BA 1CHQD 5EKLA 4H13C 1ET9A 5C3XA 5I4DA 3RUZA 3P7JA 3S1QB 4ZKBB 2X6LA 4CKBA 1DYQA 1O7LA 5BN4A 1EYCA 3GTLB 4KK7A 1EU4A 5E4XA 3TP7A 3DUZA 3MFYA 2F0GA 4DAVA 2JE6I 2KCCA 4AYBB 5KYIA 4ME5A 5D14A 3LWEA 4FP5D 4HSPA 2NVQB 5KNDA 1W6JA 4N9PA 1EQVA 1Y8PB 2HCIA 1PFBA 5CBEE 3CHBD 2L4NA 4NW2A 2CQAA 4DN4M 1AFPA 3C3LA 2NVXB 1BCPF 5C3EB 4I7ZC 4J1MA 2PNRC 2B2UA 3IKJA 4QUFA 1PTOF 3NWSA 3JAME 2N88A 2NBFA 1Z7TA 2F0UA 1SSOA 2XN9C 5JVH3 2WB1B 1RCVD 3C1FA 3GQBA 1L0YB 2BDOA 1D5XC 3PO3B 3T4AC 3N52A 4EQPA 2LMCB 1OXVA 2BCOA 3ND8A 1KNEA 2WKDA 3VA5A 4FO2A 2A68C 3Q0AA 2DN8A 1I50B 4JBWA 4UDUC 4RHSA 5I9OA 2RDHA 4KN7C 1SYCA 1A3VA 3KF8A 1SYDA 3PUZA 5C4XB 1WTVA 1T5XD 1FYCA 2FJ2A 3D3RA 3RD4A 2F0EA 3PV0A 3I3CA 1CZWA 2B2VC 1V1PA 4F8MA 1AW7A 3I90A 4BY7B 1JWUD 4A3JB 2B2YC 1ZEQX 1G6ZA 1BBXC 2F0FA 1STEA 1PYWD 4FNFA 4GZYC 2F0QA 5IIFA 4LJZC 1IL8A 2RKSA 4M8AA 2YU9B 1TS5A 4XQJA 5CYUA 1KLUD 3K6OA 3D6CA 3MXPA 3AMUA 1WTXA 2F0MA 4H44C 4C3IB 4WFN3 1DOMA 3M7GA 2FFKB 1SE3A 1PTOB 1WTPA 3PUWA 5M5XB 1D5ZC 1EWCA 2R7ZB 1GUSA 1W6KA 4HMIA 4CKEA 3NQTA 1EOTA 2F0VA 1FNWA 4QMGA 1MGSA 4K6LA 5J1ZA 2SNSA 1QE6A 4P2CB 3SK6A 1EL0A 2JXMB 1H9SA 3I91A 2VB2X 4ZKCB 2PZWA 5EJWA 4C3IG 4DF7A 4HCEA 2HQEA 2PW7A 2F0WA 3GTOB 4CHTB 1SNCA 5IT9L 2KECA 1EY7A 1GUTA 1STAA 4MN3A 3OOCA 1DD2A 1SNMA 4FXGC 1CHPD 5KNBA 1IW7C 4L63B 5C6AA 1SNDA 3QJYA 2F0JA 4TSSA 2LS01 1MI2A 4J8QA 3OWEB 3R3OA 3PUXA 1V1PB 4K5XA 4OO1I 4HAEA 3V96A 1SBBB 3U9OA 4RWSC 1DCZA 3D4DA 1OXSC 4XDXA 4OO1H 1MSGA 2PPBC 1RKNA 3BYYB 1JQYD 3I70A 1UUPA 1IYUA 1UAPA 1XWEA 1LTRD 4YIJA 2PCFB 3P20A 3OW7A 4DA2A 3MXUA 1ENFA 3R2IA 3J7AV 3MZ5A 4ZAIA 1H9RA 4ZRZA 4KY5A 1MSHA 1LTAD 1DJRD 3TBIB 1YNJD 1ZYRD 3HOWB 3MC0B 3J7YW 1PRTF 4XQQA 1TVXA 3VR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U9R A;  3NUC A;  4ZUJ A;  4TRD A;  5J1Z A;  2SNS A;  2RBM A;  5J22 A;  1EY4 A;  3OSO A;  4QF4 A;  5I9O A;  3ITP A;  3SK6 A;  3TP8 A;  2EYH A;  1STY A;  4MIU A;  2F3W A;  5EKL A;  2KQ3 A;  1SYC A;  5C5M A;  1A3V A;  1SNP A;  1SYD A;  1II3 A;  3S9W A;  1SNO A;  3HEJ A;  3MVV A;  4IUN A;  3C1E A;  3ERQ A;  3RUZ A;  5C3X A;  2EY2 A;  3BDL A;  2EY6 A;  3QOL A;  2EYM A;  4KV6 A;  2F0S A;  2QDB A;  1ENC A;  4N9T A;  4RKB A;  5CV9 A;  5CC4 A;  5M9O A;  2SNM A;  4ZUI A;  5IOC A;  5IOD A;  2EYJ A;  4RKL A;  4WOR A;  1NSN S;  2PZW A;  5KGU A;  1A3T A;  2PZU A;  3MEH A;  5HUR A;  4K2K A;  3MHB A;  4DF7 A;  1SYB A;  5KIX A;  5IGF A;  2F0E A;  2HQE A;  3LX0 A;  2PW7 A;  1TT2 A;  4J6H A;  3V2T A;  5E1F A;  5EGT A;  1EYC A;  3P1H A;  2WAC A;  2F0W A;  3D4W A;  2OF1 A;  1KAB A;  4K2L A;  4KD3 A;  4K5W A;  1JOO A;  1A3U A;  2F0I A;  3TP7 A;  3E5S A;  1NUC A;  5F2D A;  1SNC A;  3TP5 A;  4KTA A;  2F0G A;  2EYP A;  5K5P A;  4PNY A;  5EKK A;  2PQE A;  1EY7 A;  4F8M A;  2NUC A;  1STA A;  3T13 A;  1EYA A;  5C5L A;  3TME A;  5CGK A;  1EY5 A;  4ME5 A;  5KYI A;  4ID6 A;  3H6M A;  5CV8 A;  1EY0 A;  5JAV A;  4F7X A;  1SNM A;  5I6Y A;  3D8G A;  5IGC A;  4IAL A;  5CV5 A;  5DEH A;  2F0D A;  4E6I A;  2F0N A;  1SYE A;  4N9P A;  1EQV A;  2F0F A;  5C6A A;  1TQO A;  1STG A;  3NP8 A;  5CV4 A;  1AEX A;  1SND A;  5CV6 A;  3SK5 A;  1JOK A;  2F0J A;  1EY6 A;  5C4Z A;  5ISR A;  5DAU A;  5I9P A;  3R3O A;  1EY8 A;  1F2M A;  2F0P A;  3NK9 A;  4K5X A;  4LAA A;  3TP6 A;  2F0Q A;  4KY7 A;  5IIF A;  2EY5 A;  1STN A;  3QB3 A;  3P75 A;  1F2Z A;  2EYO A;  2RKS A;  2EXZ A;  1TR5 A;  2F0O A;  3OMC A;  3OWF A;  4K6D A;  4PMB A;  3U9O A;  4EQN A;  2KHS A;  5IGE A;  3SK4 A;  3BDC A;  4HMJ A;  1IHZ A;  4KD4 A;  1A2U A;  3D4D A;  5CR3 A;  2EYF A;  3D6C A;  5KYL A;  4PMC A;  4J1M A;  3MXP A;  4HTH A;  3PMF A;  5I6W A;  1RKN A;  5IGG A;  1SYF A;  1JOR A;  1JOQ A;  5JOB A;  2PW5 A;  4EQO A;  3ERO A;  1A2T A;  2F0H A;  1SYG A;  4NKL A;  3NHH A;  2F0T A;  4G57 A;  1STB A;  5CV7 A;  5NUC A;  1KDC A;  4KJN A;  5C3W A;  2M00 A;  4NP5 A;  4K14 A;  2F0M A;  5J39 A;  1EZ6 A;  1EZ8 A;  2F0U A;  4YIJ A;  1EY9 A;  3OMG A;  5KRU A;  4KJO A;  5IGB A;  4DU9 A;  2ENB A;  3C1F A;  4K5V A;  3SR1 A;  5HGT A;  2SOB A;  4R8N A;  4K8J A;  1STH A;  4ZQ3 A;  3DMU A;  4ODG A;  2PZT A;  3EJI A;  1F2Y A;  3HZX A;  4KHV A;  1ENA A;  4WRD A;  2OEO A;  2F0K A;  2EYL A;  3SK8 A;  4I65 A;  4EQP A;  5C4H A;  2O4X A;  3MZ5 A;  4KY6 A;  1SNQ A;  3DHQ A;  4S3S A;  3T16 A;  3QOJ A;  4KY5 A;  2F0L A;  4HMI A;  4EVO A;  4QB4 A;  4DGZ A;  3NQT A;  3NXW A;  4B9W A;  5IGD A;  4B9X A;  4H7B A;  3EVQ A;  2F0V A;  1EYD A;  2OXP A;  2PYK A;  3SHL A;  1KDA A;  2RDF A;  3VA5 A;  2LKV A;  1KAA A;  4OL7 A;  4QMG A;  5E3F A;  4DFA A;  2F3V A;  3SXH A;  2EY1 A;  5KEE A;  4NMZ A;  4IZ8 A;  4K8I A;  1KDB A;  4NDX A; 
#chains in the Genus database with same CATH topology
 3DLL A;  3WDN A;  2ICI A;  3TP8 A;  3HKZ B;  2EYH A;  3UI2 A;  1X54 A;  4C1N K;  3C46 A;  2XTI A;  4X62 Q;  4RH6 A;  2WIN B;  5BN3 A;  3BDL A;  2EY6 A;  1H9J A;  2GA4 B;  4HSV A;  2QEJ C;  1AZQ A;  2VXW A;  3D0F A;  1ASY A;  5IOD A;  4WOR A;  4UP9 A;  2JSO A;  1D1K A;  4IUP A;  1CSQ A;  1BDO A;  4XYO A;  3H3V H;  4LFC L;  2WP8 J;  3S2D H;  5COR A;  1SXT A;  5E1F A;  5GRO A;  1VQB A;  4OO1 G;  4K5W A;  1PH2 A;  3OTO L;  2RHQ B;  3BZC A;  2EYP A;  5IYC G;  4IJL A;  5GAH C;  2KUM A;  3CQZ H;  1HZ9 A;  5EPL A;  4LF9 Q;  5M5Y B;  3HOW G;  4BXX G;  3EQL C;  1U4M A;  1O78 A;  3D8G A;  3DEP A;  5A35 A;  1BCP C;  4YHH Q;  4JI1 Q;  4R4T A;  1SYE A;  4QL5 A;  1YNX A;  3I73 A;  3HOU B;  1AEX A;  3HKZ G;  3PUY A;  2UUC L;  1CQV A;  1LV9 A;  2AQ3 B;  2NWG A;  1XMQ L;  2B8G A;  4LFB Q;  4KKS A;  1EIG A;  3CPF A;  3U9S A;  4JC0 A;  4GOP C;  4JI7 L;  1EYG A;  4IPG A;  4POG A;  5J3B A;  1SE2 A;  4PMB A;  4DV0 L;  2OT2 A;  2SEB D;  4UY8 C;  1ICF B;  1GJX A;  2AQ1 B;  1S5C D;  4F88 A;  2TSS A;  1A2T A;  1SYG A;  4DR7 Q;  4DV5 Q;  4C3J H;  2CFM A;  1G8Z D;  4DR2 L;  2IX0 A;  3HG9 A;  3L2P A;  3HGB A;  4JI6 L;  3GTQ H;  1QCB D;  1Y1W B;  4K5V A;  1D1I A;  1E0B A;  4K8J A;  4LF8 Q;  2OQK A;  4B3R Q;  4DR5 Q;  4A76 A;  1YJW A;  3SK8 A;  3S1R H;  3T1Y Q;  2V4D A;  4WJ3 M;  3HOU G;  3CXC A;  3H15 A;  2A6H C;  1HUM A;  1HR0 W;  5H1S E;  2OXP A;  3SHL A;  3HOV B;  1EIY B;  5A2Q L;  1PH3 A;  4R4Q A;  3BG3 A;  1VQH A;  3PF4 A;  3W1G A;  2KCN A;  2L15 A;  4ZUJ A;  2XVS A;  5KNC A;  2B39 A;  4QIW B;  3K59 A;  5C5M A;  2Z6K C;  3S9W A;  3VYR A;  3HEJ A;  3UDI A;  2KVM A;  3ERQ A;  2CQO A;  3K57 A;  5LMN L;  2MPM A;  4JV5 L;  1RHP A;  1PRT B;  2FMM A;  4EX5 A;  4OWT B;  4L5T A;  2AMC B;  2AUJ D;  3MEH A;  5HUR A;  4XXE A;  4K2K A;  1E7Z A;  2CVR A;  2RDG A;  4K0K Q;  1MBY A;  1WTQ A;  1L0X B;  3I2Z A;  2JN4 A;  4DV1 L;  3J7A F;  5EPK A;  2YTV A;  4HCS A;  1A3U A;  4XQN A;  5C0X I;  1HXY D;  3CKI B;  2PQE A;  2F4V Q;  4LF7 Q;  3CPW A;  1P8L A;  1EY5 A;  3HOV G;  1EY0 A;  2NVY B;  1SFO B;  1E2V A;  4IUU A;  4RA8 A;  4X6A H;  1X56 A;  2R7F A;  4BY1 B;  4OX9 L;  2B63 B;  1ESR A;  3PIP 3;  3RN5 A;  2XRQ D;  3J81 j;  1F9S A;  5DAU A;  3S16 H;  1OXX K;  1X3E A;  3OYY A;  2F0P A;  3B6Y A;  1TWG H;  2NZH A;  3D31 A;  1H9K A;  4DK1 A;  3QB3 A;  3CAM A;  1KIX A;  1K83 H;  1UEA B;  1O7Z A;  5KYL A;  4PMC A;  4BBR H;  3PO2 B;  1SYF A;  3F1Z A;  4DR3 Q;  2K5H A;  4EQO A;  1ILP A;  1AH9 A;  1FGU A;  4PMW A;  1KDC A;  2KEN A;  5C3W A;  2M00 A;  2R93 H;  4K14 A;  3K7U C;  2IWH A;  3H94 A;  1K3B C;  1I5F A;  1Y1V B;  5BN5 A;  2L11 A;  1HNW Q;  3IFT A;  3ZYY X;  4O2D A;  4CJ0 B;  3J7Z C;  3J7A 5;  2FHT A;  3ZJY C;  2XWJ B;  1WTH A;  3A8I E;  2JA5 H;  5IY0 A;  4I65 A;  5EAY A;  4BY1 G;  2B63 G;  2Z1C A;  2R92 H;  4GLX A;  1NMG A;  2PI2 A;  3NXW A;  3HFZ B;  1VQ5 A;  1V1O A;  1VQM A;  3HKZ E;  1G91 A;  1F9Q A;  3GTG H;  4IOA A;  2EY1 A;  4KLK A;  2A8V A;  4QGU A;  1C4Q A;  3CCU A;  1EY4 A;  1DZ1 A;  1D8L A;  1SRU A;  5C0X G;  4HIM A;  1EQQ A;  3PO2 G;  3H3V C;  1II3 A;  4TKO B;  1IBL L;  4ZUI A;  3S1Q H;  1F9R A;  4NXM L;  1Y1V G;  1UE7 A;  3DXJ C;  3MHB A;  2F3I A;  3MXN A;  5IGF A;  1DGS A;  5IE8 A;  1TT2 A;  4ABN A;  2EJM A;  2M2L A;  1GUG A;  4GLV B;  2HCC A;  2YV5 A;  1E1O A;  2QW7 A;  1LT6 D;  3U4Z A;  1JIC A;  4DR6 L;  2NN6 I;  4JPB W;  4V19 0;  5ELE A;  3EFX D;  3GTL H;  3FKI B;  4IPD A;  4B3T L;  2NUC A;  2N3S A;  1VQA A;  1CI3 M;  3IRB A;  3BYT B;  2DNC A;  2JEB I;  1OTC A;  1VF7 A;  1MKH A;  1WI5 A;  1C8C A;  4HN7 A;  1JB3 A;  2B2T A;  2K33 A;  2KED A;  2L55 A;  5FO9 B;  3F2B A;  1TWH B;  2JA7 B;  1HZC A;  5DM6 3;  5TSS A;  2NVQ H;  2K28 A;  1I94 Q;  3SK5 A;  4Y52 H;  1NR4 A;  2E5L Q;  2I07 B;  4YWK A;  1Q46 A;  3RLO A;  4TVA B;  4LAA A;  1RDP D;  2AUK A;  3P75 A;  1XYI A;  2E2H B;  1I4G A;  2E75 C;  1WVL A;  1LAB A;  3BDC A;  3H0G B;  4KD4 A;  1KD1 C;  4C56 C;  5FOB B;  2QKI C;  2JJQ A;  2NVX H;  2UUA L;  2PW5 A;  5C3E H;  2V1C C;  3CD6 A;  5JPN C;  5D3D A;  1YBY A;  3DWA A;  2MO1 A;  1ML0 D;  4GN5 A;  2A68 D;  2KHJ A;  3J81 c;  1ILQ A;  1UNS A;  4JI4 Q;  4GLA C;  3FKI G;  2CW0 C;  1C9O A;  2UXB Q;  5KRU A;  5D3I B;  1BR9 A;  5IP7 G;  3GDE A;  4JBJ A;  2JYO A;  2ENB A;  1XNR L;  4O0A A;  4BA1 I;  2R61 A;  3A5Z B;  3W1B A;  4ZQ3 A;  4PZ7 A;  4P74 A;  3HZX A;  1VMC A;  5T1G A;  4F87 A;  1KL9 A;  5C4H A;  2EZV A;  3RNU A;  3PO3 H;  4DV3 L;  1FGB D;  1PFS A;  2F1M A;  2QCP X;  4KN4 C;  3KLW A;  3HRZ C;  1W3S A;  4H7B A;  2K14 A;  4QQB X;  1M4V A;  5JVG 3;  1EEF D;  3NTK A;  1XTC D;  1K8A C;  5AFW A;  2NN6 G;  1TY0 A;  2UXD Q;  3H0G G;  1I50 H;  4DV2 L;  2KQ3 A;  2ASB A;  2X6G A;  1JC7 A;  4C3H B;  3NQI A;  5GAE C;  2KEE A;  3M4O B;  2N78 A;  2PMZ B;  4LFA L;  5C4X H;  4G7H C;  4G7O C;  1IBK Q;  2HUG A;  3MA2 B;  4G7Z C;  2K5N A;  1L1O A;  1PFM A;  1SEB D;  1LTB D;  1LUZ A;  4JG2 A;  1B3A A;  2E2D C;  3F2D A;  4KTA A;  3NTH A;  1RL2 A;  3VYS A;  4FDB A;  4RG1 A;  3NWT A;  4LMQ D;  3ICE A;  3HOY B;  2VY3 A;  2ZJR A;  1S4Z A;  4BY7 H;  4F7X A;  4DAY B;  2K32 A;  2I5H A;  4A3J H;  1I4Q A;  4ZCK A;  3Q22 A;  1KNA A;  2WB1 G;  1V43 A;  3QG1 A;  2N49 A;  5C4Z A;  1S5F D;  2J4X A;  2L1B A;  1TKW B;  3A7L A;  5DNF A;  4C3H G;  2A1A A;  5JJZ A;  5C4J B;  3TRE A;  3TP6 A;  2YTY A;  1HH2 P;  1KLG D;  3MTS A;  1SR3 A;  1QUQ B;  2G9H D;  2I5M X;  2DUD A;  3ERS X;  1Y8O B;  2MHV A;  2I0Q A;  1S3O A;  1D5M C;  1C7Y A;  1IHZ A;  1A2U A;  1EWI A;  1JJG A;  2EYF A;  1VQ7 A;  2YU9 H;  1QJO A;  1JT8 A;  2H5X A;  1AP0 A;  3CCM A;  3Q8D A;  1K8O A;  4JI3 Q;  2K5W A;  5EBC A;  1FNV A;  3CW2 C;  5CBA E;  1AN8 A;  1VQL A;  3CMA A;  1EY9 A;  4LF6 Q;  5DM7 3;  2CWA A;  5HGT A;  4C3I H;  2A69 C;  4RAU C;  2WV6 D;  4JCV E;  3TN2 A;  4FYD A;  3I72 A;  1PV4 A;  1HNX Q;  3Q6S A;  4IUT A;  1GOZ A;  3IAY A;  2OEO A;  4LNQ A;  1PTO H;  5M5X H;  4MTN A;  3G48 A;  1QZH A;  3LGJ A;  2Q2H A;  2RVL A;  4FF1 A;  4IOC A;  2R7Z H;  5FK9 C;  2RDF A;  2LKV A;  2NTS A;  2K05 A;  3SDZ A;  5LMN Q;  4IPH A;  1WD1 A;  1Y69 U;  1CM9 A;  3PCO B;  4BY7 G;  3VYT A;  1CTM A;  2HHH L;  1ESF A;  1HTL D;  3LNN A;  1IYV A;  5I2X A;  2Q2T A;  1M90 C;  3R93 A;  3L7Z C;  1DON A;  3I4M B;  1LLR D;  2BH8 A;  2HIV A;  4FVM A;  1E2Z A;  5G3L F;  5CC4 A;  3OPO A;  1NSN S;  4GNX B;  2C5C A;  3X3M A;  5JJK A;  1IW7 D;  2PZU A;  1VF5 C;  5I2Y A;  2K4K A;  1TS2 A;  1S5D D;  3AB9 A;  3KLS X;  4QJF A;  5FO7 B;  1U4L A;  1ONL A;  5EGT A;  1TWA B;  3J80 c;  1NMF A;  4CBV A;  4K2L A;  2SDF A;  2CCZ A;  4V0B A;  1PMR A;  1VDZ A;  3AFP A;  4KHZ A;  3GTO H;  3MFG A;  2NB0 A;  2ICE C;  3KF6 A;  5CGK A;  5LHY 1;  1BBW A;  1V1Q A;  4BWG B;  5BR8 L;  1SMX A;  1JJC B;  2K75 A;  4RGO S;  4LF5 Q;  2E2I B;  4MZ9 A;  4OWW B;  2IT1 A;  1IBM Q;  2A19 A;  2ZXO A;  4LF4 L;  1SMY C;  3OHX C;  4RCN A;  3PIO 3;  2GN5 A;  3I4M G;  3M9B A;  4DR4 L;  1LTI D;  2DGY A;  1S72 A;  1CSP A;  4AIM A;  1CA5 A;  1PYS B;  1KRS A;  4KI0 A;  1J8I A;  2KHS A;  1SJH D;  2CKZ B;  2AWN A;  3ERO A;  5IYD G;  1CT1 D;  3TSS A;  2F0T A;  1HCZ A;  2IHF A;  3H09 A;  1S5E D;  1U4P A;  1HR0 Q;  1XPO A;  3FMC A;  3A74 A;  4X65 Q;  3OMG A;  3RLN A;  2WKC A;  2ZJP A;  3URY A;  3D4R A;  2NZ1 D;  4RCO A;  1STH A;  3GTK B;  5C0X J;  1YHA A;  1WTR A;  2Q2U A;  5FLX L;  5JPM C;  1YNN C;  1ENA A;  3MXG A;  2A5H A;  2WAQ B;  4TQU S;  4OEL B;  2B3G A;  1BQQ T;  2KOL A;  1A62 A;  1HZA A;  3DHQ A;  4CJ2 C;  2F0L A;  2B2W A;  2WB1 E;  2ZJQ A;  1KDA A;  4KHP L;  5LL6 X;  1HQM C;  2UXC Q;  3HOW H;  5IGG A;  5IT9 E;  4BXX H;  2XGT A;  1GUN A;  4JI5 Q;  3OSO A;  1HNZ Q;  3JAM c;  4DUY L;  2HQL A;  2J0T D;  1SNP A;  4YCU A;  4DV4 L;  3C1E A;  1BF4 A;  1CKN B;  3ONA B;  2F0S A;  3K5L A;  4A3M B;  4FF2 A;  1BCP D;  2SNM A;  3W5O A;  4B3S Q;  3GTJ B;  4RKL A;  1XMO Q;  2QA4 A;  2XSC A;  4JBK A;  5KIX A;  3LX0 A;  1J5E L;  1EFI D;  1M1K C;  3V2T A;  1N33 L;  3T1H L;  4NXN Q;  2F0I A;  2WAQ G;  2B2T C;  3NEL A;  4DXF A;  2EE1 A;  3AFQ A;  4EGV A;  2JEA I;  1I4H A;  1ZKO A;  1MJE A;  5HGQ A;  1E24 A;  4P73 A;  5IGC A;  3S1M B;  2JQO A;  5M5Y H;  2X69 A;  4A3E B;  4QUC A;  5LMN W;  1STG A;  1FR3 A;  3FDT A;  5CV6 A;  5I9P A;  3TS0 A;  1F2M A;  1S5B D;  3NK9 A;  3HOU H;  4BA2 I;  3S2H B;  3KF6 B;  4X66 Q;  1STN A;  2H4O A;  4IQZ A;  2EYO A;  4A3M G;  2VUM B;  3BS1 A;  3G6E A;  3E0J A;  1GUW A;  1YI2 A;  4OIJ A;  2N8N A;  2A6H D;  1PA6 A;  1Q1B A;  4DNR B;  3V05 A;  1TXY A;  4A3I B;  3F8T A;  3J81 L;  5IWA Q;  2JA6 B;  2C35 B;  4P71 A;  2VQE Q;  4X3T A;  3SEB A;  1I6V C;  2ZM6 L;  1PTO C;  4DV3 Q;  3K5M A;  2K5Q A;  2B2U C;  3CU7 A;  1MD2 D;  3QO2 A;  1Y1W H;  1EWH A;  5JEA G;  1JCK B;  1X32 A;  5FO8 B;  2RA4 A;  2DJG C;  1K73 C;  5K36 G;  4A3E G;  4B3M Q;  1K8M A;  2EXD A;  4GKK L;  4HED A;  1N32 Q;  1FD7 D;  3U4V A;  1HFN A;  3RZO B;  5FLM G;  3EA6 A;  1B44 D;  1RD9 D;  1QVG A;  3FVQ A;  1VQK A;  3M3Y B;  3A54 A;  1UWV A;  4JI8 Q;  2VUM G;  5CR3 A;  1ROD A;  3HOV H;  4NDX A;  1O7I A;  4A4I A;  4LK1 C;  1VS0 A;  4RGT A;  4DAM A;  1B1Z A;  3NBI A;  3G7L A;  2QEX A;  1L1O C;  3ND9 A;  4O1N A;  4A3I G;  2JA6 G;  2QDB A;  1XX8 A;  3A8J E;  2B2V A;  1NNX A;  2K52 A;  1A15 A;  3CC4 A;  3FHW A;  1BKB A;  2AKW B;  1X3F A;  1VQP A;  2WAC A;  5T1I A;  4NB3 A;  2B2Y A;  1KAB A;  3S15 B;  4DR1 Q;  3E5S A;  1SAP A;  4XT1 B;  2IJ0 A;  5K5P A;  1PDQ A;  2EQS A;  1VCI A;  2D0O A;  2MFI A;  3MWY W;  4CDF C;  2XIW A;  3T13 A;  3TME A;  1HTP A;  4Z9C B;  5LMU Q;  1FVI A;  3W3A A;  5CV8 A;  1U0L A;  1NAP A;  1WD0 A;  1Q81 C;  2F0D A;  4ALP A;  2NVY H;  3K5O A;  1SFO H;  1Y1W G;  3NE5 B;  1EY6 A;  1QVF A;  1WTW A;  1QOH A;  3I8Z A;  4BY1 H;  2B63 H;  5ELO A;  1Y8N B;  1GHK A;  4KY7 A;  4A3C H;  3OMC A;  1V9P A;  1TU2 B;  3OIQ A;  1TS4 A;  2ID0 A;  3U58 A;  3CRL C;  3FEW X;  1JOQ A;  4A93 B;  1JOR A;  1BOS A;  1CKO A;  2F0H A;  5C0X H;  4JI0 Q;  5A2Q E;  1LAC A;  2E74 C;  1XNQ L;  4RGM A;  3AYH B;  3PO2 H;  4I7A A;  1PH7 A;  1FNU A;  1HQR D;  3J81 i;  1F9P A;  1EZ8 A;  2L9H A;  1Q8I A;  1VQ8 A;  2Z9H A;  3NBH A;  1D2B A;  3SR1 A;  1Q86 C;  1Y1V H;  4FXD A;  1E22 A;  4R8N A;  4YWL A;  1O80 A;  2PZT A;  3CC7 A;  1IKM A;  3U50 C;  4BBS B;  1WCM B;  2NYZ D;  2Z0S A;  4HJ9 A;  3GD7 A;  3I56 A;  2XRS D;  1A8V A;  1B9M A;  3DWP A;  1QWY A;  3TDQ A;  5AJ3 Q;  5IGD A;  2AQ2 B;  1X65 A;  2LY7 A;  3QIA A;  2R7D A;  3AU7 A;  4CDC C;  4XTC S;  5E3F A;  3VA7 A;  1BO0 A;  2UUB Q;  4LUV A;  4IZ8 A;  5FJ8 G;  1PH6 A;  1JB7 A;  4IFD I;  4XYQ A;  1F2L A;  4X64 L;  5M3M B;  2Q8R E;  2BE5 C;  2EOT A;  1A6X A;  3EIV A;  4U68 A;  1G2T A;  4A93 G;  4IUN A;  4OIK A;  4GS3 A;  3KFU A;  1GM5 A;  5CV9 A;  2HT1 A;  1ENC A;  4JK1 C;  1EFW A;  2A73 B;  5FLX c;  5M9O A;  2VZA A;  5IOC A;  1EQT A;  3UDX A;  4ZYS A;  2MUY A;  4PQX A;  4A3C G;  4A3K B;  4DK0 A;  3PQI A;  1T5E A;  3J80 L;  3EBE A;  3P1H A;  4YY3 L;  1IYJ B;  4RGN A;  1I4X A;  4BBS G;  1JOO A;  1SJE D;  1WCM G;  1JWM D;  4PZ8 A;  5F2D A;  1GHJ A;  4B08 A;  2DY7 A;  5EKK A;  1D6E C;  2AHO B;  4JYA Q;  3FKI H;  4M1U B;  1N36 L;  3QR8 A;  1B2T A;  5IP7 H;  3KDF A;  2R93 B;  3TS2 A;  3FRP B;  3MEF A;  3E6Z X;  4MTK A;  2CW0 D;  5M3M G;  3HP3 A;  1DXM A;  4DAY A;  1HA6 A;  1GO3 E;  4JI2 Q;  2UU9 Q;  1TWH H;  2JA7 H;  2Z4I A;  1B9N A;  3BVM A;  1J6Q A;  3PF5 A;  1N34 Q;  2CWP A;  4RHR A;  2EY5 A;  2HDM A;  1L2F A;  4A3L G;  3CCJ A;  2NVT B;  1QUQ A;  3ULL A;  2E2H H;  1N8R C;  4A3K G;  2L12 A;  3VR5 A;  3GV6 A;  2NN6 H;  3PMF A;  2E2J B;  3H0G H;  3KJO A;  1CFM A;  1XJV A;  1KTK A;  3CCR A;  5EKI A;  3VR4 A;  5J39 A;  1MJC A;  4H0L C;  3SGI A;  4IFD G;  1HZB A;  3K8A A;  2N55 A;  4KJO A;  3AEV A;  4A3D B;  2FIN B;  4DV6 Q;  1HPC A;  4A3G B;  1XTD A;  2A6E C;  4OEM B;  3IL8 A;  4GKJ L;  2B2W C;  5GAG C;  2DNE A;  4AQY L;  4KHP Q;  4A3B B;  3STB C;  4JOI A;  2EYL A;  4MNO A;  3T53 B;  1EIH A;  5C44 B;  2F52 A;  1QNU A;  2JA8 B;  1G2S A;  3L9A X;  4R8I A;  4X62 L;  4YCW A;  3EVQ A;  1GXD C;  1LTL A;  3NBH B;  4GN3 B;  2EJG C;  4DV4 Q;  5ELF A;  4MHE A;  4NMZ A;  1UEB A;  3JAM L;  4DV7 Q;  1J9O A;  1QIL A;  4TRD A;  1CQF A;  2IX3 A;  3AQQ A;  1Q3L A;  1STY A;  1FJG Q;  4WJW A;  4MIU A;  2F3W A;  1FL0 A;  1PRT C;  1IXR A;  1G6P A;  1A63 A;  4QY7 A;  2EY2 A;  2Z4H A;  2RSO A;  4N9T A;  4LUZ A;  3A5U A;  4C3H H;  2JA7 G;  3FPP A;  2IX1 A;  3BDO A;  5IP9 G;  1JE4 A;  3S24 A;  3M4O H;  4L5Q A;  1A3T A;  3BVG A;  3C2P A;  4A3D G;  1QB5 D;  3A7A B;  4DK6 C;  4A3G G;  4LF9 L;  1E2W A;  3KLS A;  4GNX A;  3LWU A;  4QIW E;  3J80 i;  1BXT A;  2OF1 A;  2OCE A;  3D4W A;  4KD3 A;  1I4R A;  1Z9F A;  4YHH L;  4A3B G;  4JI1 L;  3TP5 A;  3RMH A;  2ALY B;  1VQF A;  5C44 G;  1VQI A;  2JA8 G;  1ET6 A;  3TRZ A;  4LFB L;  2NTT A;  4LFC Q;  2WFW A;  1LT4 D;  2JA9 A;  3KOJ A;  5JAV A;  1R9T B;  1I3Q B;  1HFG A;  4N8F A;  1NJI C;  3HOY H;  3OTO Q;  3KJP A;  1TQO A;  1LTT D;  5CV4 A;  4KKU A;  2JK8 A;  1JOK A;  2A69 D;  1EY8 A;  3UE0 A;  3O13 A;  1OO9 B;  4DR7 L;  4DV5 L;  4ILW A;  1F2Z A;  5C4J H;  1JR0 D;  2EXZ A;  2ZTC A;  3KDF B;  1I4P A;  2D62 A;  3SK4 A;  5JEA J;  2D5D A;  2UUC Q;  1YEZ A;  1CK1 A;  2ZXP A;  1XMQ Q;  2ATW A;  4ULL A;  4L8J A;  4JI7 Q;  1STB A;  1JE5 A;  2VW9 A;  4LF8 L;  4B3R L;  2H1E A;  2RQX A;  4DV0 Q;  5EPJ A;  3I4N B;  3T1Y L;  1LT3 D;  1F77 A;  2EDG A;  2IHE A;  4ZLT F;  1NBW A;  1M8A A;  3WWV A;  5GQO A;  1X55 A;  3DMU A;  3S17 B;  2EJF C;  3GTM B;  1SDF A;  5COY A;  4DR2 Q;  1NR2 A;  3KUP A;  1CA6 A;  1SNQ A;  4JI6 Q;  3QOJ A;  2TMP A;  4OON A;  1KHI A;  1YZ6 A;  1RF2 D;  4B9X A;  1KAA A;  1QNK A;  2EPB A;  2FXQ A;  1TWC B;  1PLF A;  3HOZ B;  5DLQ E;  4P72 A;  4CKC A;  3ITP A;  4FXK C;  3JAM i;  1I6H B;  3TZD A;  3HOY G;  4K0K L;  3DM1 A;  3M4P A;  2AWO A;  2KCT A;  4CJ1 B;  1LO5 D;  1LYL A;  4HID A;  2VS1 A;  3I4M H;  1K0S A;  3I4N G;  1YHB A;  1XPR A;  3S14 B;  1CKN A;  1TWF B;  3CCS A;  1K8G A;  2XNA C;  4ME3 A;  2MP1 A;  2F4V L;  5HY6 A;  1SYB A;  2D0P A;  1SMY D;  5IYB G;  3M7N A;  3X3N A;  2OTJ A;  2MO0 A;  3S1N B;  3VR6 A;  3GTP B;  4JV5 Q;  1Q8K A;  1S40 A;  1TWA H;  4DNT B;  5IYD H;  4HIK A;  2K5D A;  1NCV A;  1QVC A;  1B50 A;  1QG7 A;  2I5L X;  4G4K A;  4OHJ A;  3HOX B;  4R4C A;  3KLR A;  3SVM A;  4DV1 Q;  4IAL A;  2F0N A;  1EIF A;  1RIP A;  2PO4 A;  5ISR A;  2E2I H;  1BCP B;  4CDD C;  4LW1 A;  4DR3 L;  2Y0S B;  4C2M B;  4A3F B;  1R4Q B;  1E3P A;  4Q0F A;  4RFB A;  3ER0 A;  5IGE A;  4EQN A;  4K6D A;  1YNN D;  3GV3 A;  4EQ5 A;  1HA5 A;  3Q24 A;  4OX9 Q;  1RTN A;  1HNW L;  3EN2 A;  2PNH A;  1OXU A;  4OWX B;  5I6W A;  2OWO A;  3NHH A;  4G57 A;  5NUC A;  2Q8I B;  4KJN A;  1Q90 A;  4PV1 C;  4X3U A;  4HJ5 A;  2EIF A;  1JJ2 A;  2KJX A;  3K5N A;  4XT3 B;  4KMU C;  5IGB A;  3K81 C;  1G29 1;  1K9M C;  3HOX G;  5M5W B;  2KA7 A;  2DY8 A;  3DEO A;  1EU3 A;  2VQF L;  4HJ7 A;  3GTK H;  2QGQ A;  2M9V A;  1ICW A;  1X3P A;  1NY4 A;  2F03 A;  2FMC A;  3N6R A;  4GN4 B;  2Y0S G;  2PYK A;  1PZI D;  3D6W A;  4A3F G;  4OL7 A;  2C9O A;  2JP1 A;  1EQR A;  2F3V A;  4HJA A;  5M3F B;  1DOK A;  3OIP A;  2QF7 A;  2MNA A;  3KF8 B;  1KDB A;  1LTG D;  1U9R A;  4OGQ C;  1B53 A;  1TS3 A;  3W2D A;  1U5K A;  3I55 A;  1SE4 A;  4UAI A;  3I4L A;  3RN2 A;  5ELB A;  4UPA A;  2IY5 B;  4PG3 A;  3ULJ A;  1D7Q A;  1Q7Y C;  2ZXR A;  2EYJ A;  2IPK D;  4XIG S;  4YCV A;  4A3M H;  3VDY A;  3F2U A;  3GTJ H;  4Y7N B;  4RMF A;  2LFN A;  2KCM A;  3DWQ A;  3A56 A;  2L0C A;  3MAQ A;  1Z47 A;  2CHB D;  2ZTD A;  3K0Y A;  1IBL Q;  1Q1E A;  1NUC A;  2PMZ E;  4NXM Q;  4PNY A;  4IUQ A;  4BS9 A;  1I94 L;  3RZD B;  1QZG A;  2OQ0 A;  4LWC A;  2E5L L;  1AZP A;  3VYU A;  1X9N A;  3A8K E;  5M3F G;  5I6Y A;  2K1B A;  4E6I A;  4DR6 Q;  1SRO A;  3K7A B;  3S1M H;  5JEA H;  2RSN A;  4B3T Q;  5ELC A;  1PTO D;  5K36 H;  4A3E H;  2O5J C;  1Z6H A;  4IFD J;  2K03 A;  1LTS D;  5FLX E;  4L5R C;  5FLM H;  4ZK9 B;  3S2H H;  4JI4 L;  1K0R A;  2UXB L;  4HMJ A;  3R2T A;  2VUM H;  2ZT9 C;  2CH4 A;  4HTH A;  2IW3 A;  1EEI D;  2R3Z A;  5JOB A;  3CME A;  2GVB A;  5CV7 A;  3G6J B;  2HD3 A;  4GKJ Q;  4R4O A;  4A3I H;  2JA6 H;  3L3O C;  5EBD A;  3NSW A;  1V8Q A;  1A0I A;  1MIU A;  3BZK A;  1VQN A;  3FPU B;  2UUA Q;  3T51 B;  2K04 A;  1B4O A;  3H3V I;  3QWN A;  5EQ0 A;  2MGS A;  3EJI A;  3WOE A;  4KHV A;  1YJN A;  4L6T B;  2F0K A;  5ELN A;  2UXD L;  4S3S A;  4QB4 A;  4DGZ A;  3TZU A;  1SE8 A;  3UE1 A;  1XNR Q;  3NTI A;  1EYD A;  4DFA A;  3RZO H;  1WJJ A;  2K01 A;  1XXG A;  4K8I A;  2MQH A;  1IBK L;  1H9S B;  2PQA B;  2RBM A;  3M3Y H;  2O2L D;  2QIL A;  2BDN A;  3M4Q A;  4GNX C;  1GUO A;  3QOL A;  4RKB A;  1X3Q A;  3GP7 A;  1N9W A;  4N8X 1;  4DAP A;  1T9H A;  1VQE A;  2BOS A;  3S2D B;  1IKL A;  4CDE C;  4U67 3;  1GD7 A;  4DV2 Q;  2KBN A;  4J6H A;  1PH9 A;  3NEM A;  1YNJ C;  1ZYR C;  5ELD A;  3OW2 A;  3HS0 C;  2DJF C;  3CQZ B;  4LFA Q;  1BVS A;  5LL6 S;  3S15 H;  1G51 A;  1VQD A;  2D2C C;  4CGY B;  2B29 A;  3H6M A;  3J81 E;  3BZD B;  3Q23 A;  3CRK C;  2ZTE A;  1NTG A;  2BA1 A;  5CV5 A;  3WOF A;  3UDG A;  2Q8T A;  1R4P B;  1IL2 A;  2Y0S E;  1HHV A;  4A75 A;  3M85 A;  3M4Y A;  3PIP A;  3NP8 A;  4IUV A;  1PH5 A;  3L0O A;  3GO5 A;  1TY2 A;  4JI3 L;  2RHS B;  3G71 A;  2XWB B;  2F4I A;  1PH8 A;  5E4W C;  4LF6 L;  5FJ8 H;  4IN3 A;  3BVZ A;  3JC6 6;  4C3J B;  4NKL A;  5G3L D;  1HNX L;  4A93 H;  3GTQ B;  4NP5 A;  3TQY A;  2YYZ A;  2BE5 D;  1O7Y A;  4DU9 A;  1H9M A;  2I46 A;  4DNI A;  1WOC A;  2VB3 X;  1PXU A;  3S1R B;  1K3R A;  1F2Y A;  3VR3 A;  1B7Y B;  4JW0 A;  2EVB A;  4KY6 A;  4BBS H;  3K58 A;  3T16 A;  1WCM H;  4X3K A;  5JJL A;  1P16 A;  3KBG A;  4EVO A;  4IPC A;  3KK7 A;  2O5I C;  4B9W A;  2ES2 A;  4POF A;  2E76 C;  3G4S A;  1DOL A;  1HUN A;  1PHJ A;  3UDF A;  1JMC A;  3I7F A;  1RTO A;  1BNZ A;  3RR5 A;  1BUV T;  5J22 A;  1DM0 B;  4QF4 A;  2WAQ E;  4HR7 B;  3I4O A;  1Q82 C;  4FF3 A;  1H95 A;  1ZXT A;  3BU2 A;  4C3J G;  4X3S A;  3H91 A;  5M3M H;  1SNO A;  1RJT A;  3MVV A;  2IL8 A;  4UP8 A;  2EYM A;  4KV6 A;  2D9U A;  1WYD A;  2MJ8 A;  2A74 C;  3NPP A;  4DXG A;  2HHH Q;  1KRT A;  4A3L H;  1CZG A;  1OXT A;  1Y14 B;  5CMD A;  4QCL A;  2LXK A;  4A3K H;  4R9W A;  4LF5 L;  2R6G A;  1VMP A;  4R4I A;  1PZK D;  4C1N I;  3CCQ A;  1IBM L;  2RCN A;  2Z8L A;  3ULP A;  2G9D A;  5IT9 c;  4KKT A;  1EYA A;  5C5L A;  4IFD H;  4ID6 A;  3E0E A;  1TII D;  2CH4 W;  1BBU A;  5DEH A;  2WII B;  2Z6B A;  3S16 B;  1YHQ A;  5D65 A;  1TWG B;  2A6E D;  4JBM A;  4Q5V A;  1PYB A;  1LT5 D;  1VQ4 A;  3IFD A;  1K83 B;  1X6O A;  2Q2I A;  5BR8 Q;  5KGU A;  2F0O A;  1TR5 A;  3OWF A;  1VQJ A;  3STB D;  1HR0 L;  4BBR B;  4X65 L;  3CC2 A;  3T56 B;  3K0X A;  4LF4 Q;  4O42 A;  4AH6 A;  1PVO A;  2VNU D;  5FKA C;  2NVT H;  1JWS D;  1LM0 A;  3A55 A;  4FF4 A;  4DR4 Q;  5GAD C;  2E2J H;  1EZ6 A;  1ASZ A;  1U4R A;  2VQF Q;  3E3X A;  1KQS A;  2BA0 A;  5IP9 H;  1Q12 A;  2SOB A;  1PRT D;  1PZJ D;  2J7Z A;  4A3D H;  2K7V A;  2JA5 B;  1HRJ A;  4ODG A;  1C48 A;  4A3G H;  2RCF A;  3PGZ A;  2UXC L;  2R92 B;  2B8F A;  4WRD A;  4JI5 L;  3SE0 A;  2O4X A;  1HNZ L;  1PFN A;  4DUZ L;  4A3B H;  3J80 E;  1CUK A;  2L5T A;  2HDL A;  3KBX A;  5C44 H;  3GTG B;  3PUV A;  2JA8 H;  1WTO A;  1KC8 C;  3SXH A;  3RLF A;  5KEE A;  4B3S L;  2K6A A;  4IUR A;  1XMO L;  4BBR G;  3NUC A;  3R8B A;  1CHQ D;  2K50 A;  5EKL A;  4P75 A;  4H13 C;  2R93 G;  1ET9 A;  5C3X A;  5I4D A;  3RUZ A;  3P7J A;  3S1Q B;  1IZ6 A;  4NXN L;  4R1J A;  2OTL A;  4ZKB B;  3TEH B;  2X6L A;  4CKB A;  4DUY Q;  1DYQ A;  1O7L A;  1PH1 A;  5BN4 A;  1EYC A;  2JA5 G;  3GTL B;  4KK7 A;  2K5V A;  1EU4 A;  2R92 G;  5E4X A;  3TP7 A;  3DUZ A;  3MFY A;  2F0G A;  4H02 A;  4DAV A;  1XPU A;  1VQC A;  2JE6 I;  2NZO A;  2KCC A;  4AYB B;  5KYI A;  4ME5 A;  5D14 A;  3LWE A;  1J5E Q;  1N33 Q;  4X66 L;  3T1H Q;  4FP5 D;  4HSP A;  2NVQ B;  5KND A;  1EUJ A;  1UE1 A;  2E8G A;  1R9T H;  1W6J A;  1I3Q H;  4N9P A;  1EQV A;  1Y8P B;  2HCI A;  1PFB A;  1VQ6 A;  2LXJ A;  5IWA L;  5CBE E;  3CHB D;  2L4N A;  4NW2 A;  2CQA A;  4DN4 M;  1AFP A;  3C3L A;  2VQE L;  2NVX B;  1BCP F;  5C3E B;  4IJH A;  4I7Z C;  4J1M A;  4LUO A;  1UE5 A;  2PNR C;  4GOP A;  2B2U A;  3IKJ A;  4QUF A;  1PTO F;  3NWS A;  1SN8 A;  3JAM E;  2N88 A;  2NBF A;  1E1T A;  1UE6 A;  1Z7T A;  5L37 A;  2F0U A;  1SSO A;  2XN9 C;  4B3M L;  5JVH 3;  1N32 L;  2WB1 B;  1RCV D;  3C1F A;  3FP9 A;  1YVC A;  2HIX A;  3GQB A;  3CP0 A;  4AYB G;  1W2B A;  3I4N H;  1L0Y B;  2BDO A;  1D5X C;  5IYB H;  3PO3 B;  4JI8 L;  3T4A C;  3N52 A;  4EQP A;  3S17 H;  2LMC B;  1OXV A;  2BCO A;  3GTM H;  2G5D A;  3ND8 A;  1KNE A;  2ZM6 Q;  2WKD A;  3K80 C;  1VQG A;  3VA5 A;  4FO2 A;  4DR5 L;  3CCL A;  2A68 C;  3Q0A A;  2DN8 A;  2RF4 A;  1I50 B;  4JBW A;  4UDU C;  4RHS A;  3DM3 A;  5C3E G;  5I9O A;  4GKK Q;  2RDH A;  4KN7 C;  1TWC H;  3HOZ H;  1SYC A;  1A3V A;  3KF8 A;  1SYD A;  3PUZ A;  5C4X B;  1I6H H;  1WTV A;  1GKH A;  1C0A A;  3MXN B;  4DR1 L;  1T5X D;  1FYC A;  1AE2 A;  2FJ2 A;  3E9H A;  3D3R A;  3RD4 A;  1KAW A;  3CCE A;  2F0E A;  3PV0 A;  2Z6K A;  4DK3 C;  1SLJ A;  5LMU L;  3S14 H;  2VL6 A;  1TWF H;  3I3C A;  1CZW A;  3PO3 G;  4WJ4 A;  2QDL A;  2B2V C;  1YJ9 A;  4HJ8 A;  3S1N H;  3GTP H;  1YIT A;  1V1P A;  4F8M A;  1AW7 A;  3I90 A;  4BY7 B;  2LSS A;  1JWU D;  4A3J B;  2B2Y C;  1ZEQ X;  3HOX H;  1G6Z A;  1VQ9 A;  1BBX C;  2F0F A;  4LF7 L;  1STE A;  4DKA C;  1PYW D;  3PSI A;  3PIO A;  4FNF A;  4GZY C;  4JI0 L;  1K28 A;  5C4X G;  2F0Q A;  5IIF A;  3CCV A;  4LJZ C;  1IL8 A;  2RKS A;  4M8A A;  4C2M H;  4A3F H;  2YU9 B;  1TS5 A;  4XQJ A;  4DPG A;  5CYU A;  1KLU D;  3K6O A;  1AE3 A;  3D6C A;  3BJU A;  3MXP A;  3AMU A;  3F2C A;  3E9I A;  1WTX A;  1L0W A;  5E7N A;  3HOZ G;  4HIO A;  2F0M A;  1X3G A;  4H44 C;  4C3I B;  4WFN 3;  1DOM A;  3M7G A;  5AJ3 L;  2P5Z X;  2FFK B;  4A3J G;  3CF5 A;  1SE3 A;  1PTO B;  1XNQ Q;  4GOP B;  1WTP A;  2UUB L;  3PUW A;  5M5W H;  5M5X B;  1D5Z C;  1EWC A;  1HJP A;  4APV A;  2R7Z B;  1GUS A;  1W6K A;  4HMI A;  4CKE A;  3NQT A;  1EOT A;  2F0V A;  4YWM A;  1FNW A;  4QMG A;  1MGS A;  4K6L A;  5J1Z A;  5M3F H;  2SNS A;  1KXL A;  1QE6 A;  4P2C B;  3SK6 A;  1EL0 A;  2JXM B;  1H9S A;  2PQA A;  3I91 A;  2VB2 X;  4ZKC B;  3NEN A;  1L1O B;  2PZW A;  5EJW A;  4C3I G;  1B70 B;  4X64 Q;  1B3Q A;  4DF7 A;  4HCE A;  4JYA L;  1EOV A;  2HQE A;  2PW7 A;  4Y7N H;  2F0W A;  3GTO B;  4CHT B;  4AYB E;  1SNC A;  5IT9 L;  2KEC A;  2R7Z G;  1EY7 A;  1GUT A;  2YTX A;  4JI2 L;  2UU9 L;  1STA A;  4MN3 A;  3OOC A;  1CKM A;  1GVP A;  1DD2 A;  3RZD H;  5JJI A;  1N34 L;  4YY3 Q;  1SNM A;  4FXG C;  4UP7 A;  2KHI A;  1CHP D;  5KNB A;  1IW7 C;  4L63 B;  5C6A A;  4PZ6 A;  1SND A;  3QJY A;  2F0J A;  1B8A A;  2LS0 1;  4J8Q A;  1MI2 A;  4TSS A;  3K7A H;  3OWE B;  3R3O A;  4UHV A;  1N36 Q;  3PUX A;  1V1P B;  4K5X A;  1MHW C;  4IO9 A;  4OO1 I;  4HAE A;  3V96 A;  1SBB B;  3U9O A;  4RWS C;  1DCZ A;  3D4D A;  1OXS C;  4DV6 L;  1VQO A;  4XDX A;  4OO1 H;  1MSG A;  3A0J A;  1RKN A;  2PPB C;  3BYY B;  1JQY D;  5IYC H;  3I70 A;  1NE3 A;  1WFQ A;  1UUP A;  1IYU A;  1UAP A;  1XWE A;  1LTR D;  2GVA A;  4YIJ A;  2PCF B;  3P20 A;  2PI2 E;  3OW7 A;  4DA2 A;  1PH4 A;  4L5S A;  4DUZ Q;  3MXU A;  4JVZ A;  1ENF A;  3R2I A;  4J15 A;  3J7A V;  4NPS A;  4DV7 L;  3MZ5 A;  4ZAI A;  1H9R A;  4ZRZ A;  4KY5 A;  1FJG L;  3KYH C;  2BH2 A;  1MSH A;  1LTA D;  1DJR D;  1YIJ A;  3HKS A;  3TBI B;  1YNJ D;  1ZYR D;  3HOW B;  3MC0 B;  3J7Y W;  4AQY Q;  1PRT F;  4OXP A;  4JOI C;  4XQQ A;  1TVX A;  3VR2 A; 
#chains in the Genus database with same CATH homology
 3WDN A;  2ICI A;  3TP8 A;  3HKZ B;  2EYH A;  3UI2 A;  3C46 A;  4C1N K;  4RH6 A;  2WIN B;  5BN3 A;  3BDL A;  2EY6 A;  1H9J A;  2GA4 B;  4HSV A;  2QEJ C;  1AZQ A;  2VXW A;  5IOD A;  4WOR A;  2JSO A;  1D1K A;  4IUP A;  1BDO A;  4XYO A;  2WP8 J;  5COR A;  1SXT A;  5E1F A;  4OO1 G;  4K5W A;  2EYP A;  2KUM A;  5EPL A;  5M5Y B;  3EQL C;  1U4M A;  1O78 A;  3D8G A;  3DEP A;  5A35 A;  1BCP C;  1SYE A;  3I73 A;  3HOU B;  1AEX A;  3PUY A;  1CQV A;  1LV9 A;  2AQ3 B;  2NWG A;  2B8G A;  4KKS A;  1EIG A;  3U9S A;  1SE2 A;  4PMB A;  2OT2 A;  2SEB D;  1GJX A;  2AQ1 B;  1S5C D;  4F88 A;  2TSS A;  1A2T A;  1SYG A;  1G8Z D;  2IX0 A;  3HG9 A;  3HGB A;  1QCB D;  1Y1W B;  4K5V A;  1D1I A;  1E0B A;  4K8J A;  3SK8 A;  2V4D A;  2A6H C;  1HUM A;  2OXP A;  3SHL A;  3HOV B;  5A2Q L;  3BG3 A;  2KCN A;  4ZUJ A;  2XVS A;  5KNC A;  2B39 A;  4QIW B;  3K59 A;  5C5M A;  3S9W A;  3VYR A;  3HEJ A;  2KVM A;  3ERQ A;  3K57 A;  2MPM A;  1RHP A;  1PRT B;  2FMM A;  2AUJ D;  3MEH A;  5HUR A;  4XXE A;  4K2K A;  2CVR A;  2RDG A;  1MBY A;  1WTQ A;  1L0X B;  3J7A F;  5EPK A;  4HCS A;  1A3U A;  4XQN A;  5C0X I;  1HXY D;  3CKI B;  2PQE A;  1EY5 A;  1EY0 A;  2NVY B;  1SFO B;  1E2V A;  4IUU A;  4RA8 A;  4BY1 B;  2B63 B;  1ESR A;  3PIP 3;  2XRQ D;  1F9S A;  5DAU A;  1OXX K;  2F0P A;  3D31 A;  1H9K A;  4DK1 A;  3QB3 A;  1UEA B;  1O7Z A;  5KYL A;  4PMC A;  3PO2 B;  1SYF A;  4EQO A;  1ILP A;  4PMW A;  1KDC A;  5C3W A;  2M00 A;  4K14 A;  2IWH A;  3H94 A;  1Y1V B;  5BN5 A;  2L11 A;  3IFT A;  3ZYY X;  4CJ0 B;  2FHT A;  2XWJ B;  3A8I E;  4I65 A;  2Z1C A;  3NXW A;  1V1O A;  1G91 A;  1F9Q A;  2EY1 A;  1C4Q A;  1EY4 A;  1DZ1 A;  5C0X G;  3H3V C;  1II3 A;  4TKO B;  4ZUI A;  1F9R A;  3DXJ C;  3MHB A;  3MXN A;  5IGF A;  1TT2 A;  4ABN A;  2EJM A;  2M2L A;  1GUG A;  2HCC A;  1LT6 D;  1JIC A;  2NN6 I;  4V19 0;  5ELE A;  3EFX D;  3FKI B;  2NUC A;  1CI3 M;  3BYT B;  2DNC A;  2JEB I;  1VF7 A;  1C8C A;  4HN7 A;  1JB3 A;  2B2T A;  2K33 A;  2KED A;  2L55 A;  5FO9 B;  1TWH B;  2JA7 B;  5DM6 3;  5TSS A;  2K28 A;  3SK5 A;  1NR4 A;  2I07 B;  4LAA A;  1RDP D;  2AUK A;  3P75 A;  1XYI A;  2E2H B;  1I4G A;  2E75 C;  1WVL A;  1LAB A;  3BDC A;  3H0G B;  4KD4 A;  4C56 C;  5FOB B;  2QKI C;  2PW5 A;  5JPN C;  5D3D A;  3DWA A;  1ML0 D;  2A68 D;  1ILQ A;  1UNS A;  2CW0 C;  5KRU A;  5D3I B;  1BR9 A;  2JYO A;  2ENB A;  4BA1 I;  2R61 A;  4ZQ3 A;  3HZX A;  1VMC A;  5T1G A;  4F87 A;  5C4H A;  2EZV A;  1FGB D;  2F1M A;  2QCP X;  4KN4 C;  3HRZ C;  4H7B A;  1M4V A;  5JVG 3;  1EEF D;  3NTK A;  1XTC D;  5AFW A;  2NN6 G;  1TY0 A;  2KQ3 A;  2X6G A;  1JC7 A;  4C3H B;  3NQI A;  2KEE A;  3M4O B;  2PMZ B;  4G7H C;  4G7O C;  2HUG A;  3MA2 B;  4G7Z C;  1PFM A;  1SEB D;  1LTB D;  1B3A A;  2E2D C;  4KTA A;  3NTH A;  3VYS A;  3NWT A;  4LMQ D;  3HOY B;  1S4Z A;  4F7X A;  2K32 A;  1I4Q A;  3Q22 A;  1KNA A;  1V43 A;  3QG1 A;  5C4Z A;  1S5F D;  2J4X A;  2L1B A;  1TKW B;  3A7L A;  5DNF A;  4C3H G;  5JJZ A;  5C4J B;  3TP6 A;  1KLG D;  3MTS A;  2G9H D;  1Y8O B;  2MHV A;  1D5M C;  1IHZ A;  1A2U A;  2EYF A;  1QJO A;  1AP0 A;  1K8O A;  2K5W A;  5EBC A;  1FNV A;  5CBA E;  1AN8 A;  1EY9 A;  5DM7 3;  5HGT A;  2A69 C;  4RAU C;  2WV6 D;  3TN2 A;  4FYD A;  3I72 A;  3Q6S A;  4IUT A;  1GOZ A;  3IAY A;  2OEO A;  1PTO H;  4FF1 A;  2RVL A;  5FK9 C;  2RDF A;  2LKV A;  2NTS A;  2K05 A;  3SDZ A;  1WD1 A;  1Y69 U;  1CM9 A;  3VYT A;  1CTM A;  1ESF A;  1HTL D;  3LNN A;  1IYV A;  5I2X A;  3R93 A;  3L7Z C;  1DON A;  3I4M B;  1LLR D;  4FVM A;  1E2Z A;  5G3L F;  5CC4 A;  3OPO A;  1NSN S;  2C5C A;  3X3M A;  1IW7 D;  2PZU A;  1VF5 C;  5I2Y A;  1TS2 A;  1S5D D;  3AB9 A;  3KLS X;  5FO7 B;  1U4L A;  1ONL A;  5EGT A;  1TWA B;  4CBV A;  4K2L A;  2SDF A;  4V0B A;  1PMR A;  1VDZ A;  4KHZ A;  3MFG A;  2NB0 A;  2ICE C;  5CGK A;  5LHY 1;  4BWG B;  4RGO S;  2E2I B;  2IT1 A;  2ZXO A;  1SMY C;  3OHX C;  4RCN A;  3PIO 3;  1LTI D;  1CA5 A;  1J8I A;  4KI0 A;  2KHS A;  1SJH D;  2AWN A;  3ERO A;  1CT1 D;  3TSS A;  2F0T A;  1HCZ A;  3H09 A;  1S5E D;  1U4P A;  3FMC A;  3OMG A;  2WKC A;  3URY A;  3D4R A;  2NZ1 D;  4RCO A;  1STH A;  3GTK B;  5C0X J;  1WTR A;  5FLX L;  5JPM C;  1YNN C;  1ENA A;  3MXG A;  2A5H A;  2WAQ B;  4TQU S;  2KOL A;  1BQQ T;  3DHQ A;  4CJ2 C;  2F0L A;  2B2W A;  1KDA A;  5LL6 X;  1HQM C;  5IGG A;  5IT9 E;  1GUN A;  3OSO A;  2J0T D;  1SNP A;  3C1E A;  1BF4 A;  3ONA B;  2F0S A;  3K5L A;  4A3M B;  4FF2 A;  1BCP D;  2SNM A;  3GTJ B;  4RKL A;  2XSC A;  5KIX A;  3LX0 A;  1EFI D;  3V2T A;  2F0I A;  2B2T C;  4DXF A;  2EE1 A;  2JEA I;  4EGV A;  1I4H A;  1ZKO A;  5IGC A;  3S1M B;  2X69 A;  4A3E B;  4QUC A;  1STG A;  1FR3 A;  3FDT A;  5CV6 A;  5I9P A;  1F2M A;  1S5B D;  3NK9 A;  4BA2 I;  3S2H B;  1STN A;  2H4O A;  4IQZ A;  2EYO A;  2VUM B;  3BS1 A;  3E0J A;  1GUW A;  4OIJ A;  2A6H D;  1Q1B A;  4DNR B;  3V05 A;  4A3I B;  3J81 L;  2JA6 B;  4X3T A;  3SEB A;  1I6V C;  1PTO C;  3K5M A;  2K5Q A;  2B2U C;  3CU7 A;  1MD2 D;  3QO2 A;  1EWH A;  5JEA G;  1JCK B;  1X32 A;  5FO8 B;  2RA4 A;  5K36 G;  1K8M A;  4HED A;  1FD7 D;  1HFN A;  3RZO B;  3EA6 A;  1B44 D;  1RD9 D;  3FVQ A;  3M3Y B;  3A54 A;  5CR3 A;  1ROD A;  4NDX A;  4LK1 C;  4RGT A;  1B1Z A;  3NBI A;  3G7L A;  3ND9 A;  4O1N A;  2QDB A;  1XX8 A;  3A8J E;  2B2V A;  1A15 A;  2WAC A;  5T1I A;  2B2Y A;  1KAB A;  3S15 B;  3E5S A;  1SAP A;  4XT1 B;  2IJ0 A;  5K5P A;  1PDQ A;  1VCI A;  3MWY W;  2XIW A;  3T13 A;  3TME A;  1HTP A;  4Z9C B;  3W3A A;  5CV8 A;  1NAP A;  1WD0 A;  2F0D A;  3K5O A;  3NE5 B;  1EY6 A;  1WTW A;  1QOH A;  3I8Z A;  1Y8N B;  1GHK A;  4KY7 A;  3OMC A;  1TU2 B;  3OIQ A;  1TS4 A;  2ID0 A;  3CRL C;  3FEW X;  1JOQ A;  4A93 B;  1JOR A;  1BOS A;  2F0H A;  5C0X H;  5A2Q E;  1LAC A;  2E74 C;  4RGM A;  1FNU A;  1HQR D;  1F9P A;  1EZ8 A;  2L9H A;  1Q8I A;  3NBH A;  1D2B A;  3SR1 A;  4FXD A;  4R8N A;  1O80 A;  2PZT A;  1IKM A;  4BBS B;  1WCM B;  2NYZ D;  3GD7 A;  2XRS D;  1B9M A;  3DWP A;  1QWY A;  3TDQ A;  5IGD A;  2AQ2 B;  2LY7 A;  3QIA A;  3AU7 A;  4XTC S;  5E3F A;  3VA7 A;  1BO0 A;  4IZ8 A;  4IFD I;  4XYQ A;  1F2L A;  5M3M B;  2Q8R E;  2BE5 C;  2EOT A;  1A6X A;  4U68 A;  1G2T A;  4IUN A;  4OIK A;  5CV9 A;  1ENC A;  4JK1 C;  2A73 B;  5M9O A;  5IOC A;  1EQT A;  4ZYS A;  2MUY A;  4PQX A;  4A3K B;  4DK0 A;  3J80 L;  1T5E A;  3P1H A;  4RGN A;  1I4X A;  1JOO A;  1SJE D;  1JWM D;  5F2D A;  1GHJ A;  4B08 A;  2DY7 A;  5EKK A;  1D6E C;  4M1U B;  1B2T A;  2R93 B;  3FRP B;  3E6Z X;  2CW0 D;  3HP3 A;  1DXM A;  4DAY A;  1HA6 A;  2Z4I A;  1B9N A;  3BVM A;  4RHR A;  2EY5 A;  2HDM A;  2NVT B;  2L12 A;  3VR5 A;  3GV6 A;  2NN6 H;  3PMF A;  2E2J B;  1CFM A;  1KTK A;  5EKI A;  3VR4 A;  5J39 A;  4H0L C;  4IFD G;  2N55 A;  4KJO A;  4A3D B;  2FIN B;  1HPC A;  4A3G B;  2A6E C;  3IL8 A;  2B2W C;  2DNE A;  4A3B B;  2EYL A;  3T53 B;  1EIH A;  5C44 B;  1QNU A;  2JA8 B;  1G2S A;  3L9A X;  4R8I A;  3EVQ A;  1GXD C;  2EJG C;  5ELF A;  4NMZ A;  4MHE A;  3JAM L;  1J9O A;  1QIL A;  4TRD A;  1CQF A;  2IX3 A;  1Q3L A;  1STY A;  4WJW A;  4MIU A;  2F3W A;  1PRT C;  2EY2 A;  2Z4H A;  2RSO A;  4N9T A;  3FPP A;  2IX1 A;  3BDO A;  1JE4 A;  1A3T A;  3BVG A;  3C2P A;  1QB5 D;  3A7A B;  1E2W A;  3KLS A;  3LWU A;  1BXT A;  2OF1 A;  3D4W A;  4KD3 A;  1I4R A;  3TP5 A;  3RMH A;  1ET6 A;  2NTT A;  1LT4 D;  5JAV A;  1R9T B;  1I3Q B;  1HFG A;  1TQO A;  1LTT D;  5CV4 A;  4KKU A;  1JOK A;  2A69 D;  1EY8 A;  3O13 A;  1OO9 B;  4ILW A;  1F2Z A;  1JR0 D;  2EXZ A;  1I4P A;  2D62 A;  3SK4 A;  5JEA J;  2D5D A;  1CK1 A;  2ZXP A;  4ULL A;  4L8J A;  1STB A;  2H1E A;  2RQX A;  5EPJ A;  3I4N B;  1LT3 D;  1F77 A;  2EDG A;  4ZLT F;  1M8A A;  3DMU A;  3S17 B;  2EJF C;  3GTM B;  1SDF A;  5COY A;  1NR2 A;  3KUP A;  1CA6 A;  1SNQ A;  3QOJ A;  2TMP A;  4B9X A;  1RF2 D;  1KAA A;  1QNK A;  2EPB A;  1TWC B;  1PLF A;  3HOZ B;  4CKC A;  3ITP A;  4FXK C;  1I6H B;  3TZD A;  3DM1 A;  2AWO A;  4CJ1 B;  1LO5 D;  3S14 B;  1TWF B;  2XNA C;  2MP1 A;  1SYB A;  1SMY D;  3M7N A;  3X3N A;  3S1N B;  3VR6 A;  3GTP B;  4DNT B;  2K5D A;  1NCV A;  1B50 A;  1QG7 A;  4G4K A;  4OHJ A;  3HOX B;  3KLR A;  3SVM A;  4IAL A;  2F0N A;  2PO4 A;  5ISR A;  1BCP B;  2Y0S B;  4C2M B;  4A3F B;  1R4Q B;  4Q0F A;  4RFB A;  5IGE A;  4EQN A;  4K6D A;  1YNN D;  3GV3 A;  1HA5 A;  3Q24 A;  1RTN A;  1OXU A;  5I6W A;  3NHH A;  4G57 A;  5NUC A;  2Q8I B;  4KJN A;  1Q90 A;  4PV1 C;  4X3U A;  2KJX A;  3K5N A;  4XT3 B;  4KMU C;  5IGB A;  1G29 1;  5M5W B;  2KA7 A;  2DY8 A;  3DEO A;  1EU3 A;  2M9V A;  1ICW A;  1X3P A;  2F03 A;  2FMC A;  3N6R A;  2PYK A;  1PZI D;  3D6W A;  4OL7 A;  2C9O A;  2JP1 A;  2F3V A;  5M3F B;  1DOK A;  3OIP A;  2QF7 A;  1KDB A;  1LTG D;  1U9R A;  4OGQ C;  1B53 A;  1TS3 A;  3W2D A;  1SE4 A;  4UAI A;  3I4L A;  5ELB A;  2ZXR A;  2EYJ A;  2IPK D;  4XIG S;  3F2U A;  4Y7N B;  2LFN A;  3DWQ A;  3A56 A;  2L0C A;  3MAQ A;  1Z47 A;  2CHB D;  3K0Y A;  1Q1E A;  1NUC A;  4PNY A;  4IUQ A;  4BS9 A;  3RZD B;  1AZP A;  3VYU A;  3A8K E;  5I6Y A;  2K1B A;  4E6I A;  3K7A B;  5JEA H;  2RSN A;  5ELC A;  1PTO D;  5K36 H;  2O5J C;  1Z6H A;  4IFD J;  2K03 A;  1LTS D;  5FLX E;  4ZK9 B;  4HMJ A;  3R2T A;  2ZT9 C;  4HTH A;  2IW3 A;  1EEI D;  2R3Z A;  5JOB A;  5CV7 A;  3G6J B;  3L3O C;  5EBD A;  3NSW A;  1V8Q A;  3FPU B;  3T51 B;  2K04 A;  1B4O A;  3QWN A;  5EQ0 A;  2MGS A;  3EJI A;  3WOE A;  4KHV A;  4L6T B;  2F0K A;  4S3S A;  4QB4 A;  4DGZ A;  3TZU A;  3NTI A;  1EYD A;  4DFA A;  2K01 A;  1XXG A;  4K8I A;  1H9S B;  2RBM A;  2O2L D;  2QIL A;  2BDN A;  1GUO A;  3QOL A;  4RKB A;  1X3Q A;  3GP7 A;  4DAP A;  2BOS A;  3S2D B;  1IKL A;  4U67 3;  4J6H A;  1YNJ C;  1ZYR C;  5ELD A;  3HS0 C;  3CQZ B;  5LL6 S;  2D2C C;  4CGY B;  3H6M A;  3J81 E;  3BZD B;  3Q23 A;  3CRK C;  2BA1 A;  5CV5 A;  3WOF A;  2Q8T A;  1R4P B;  1HHV A;  3M85 A;  3M4Y A;  3NP8 A;  4IUV A;  3GO5 A;  1TY2 A;  2XWB B;  2F4I A;  5E4W C;  4IN3 A;  3BVZ A;  4C3J B;  4NKL A;  5G3L D;  3GTQ B;  4NP5 A;  2YYZ A;  2BE5 D;  1O7Y A;  4DU9 A;  1H9M A;  2I46 A;  2VB3 X;  1PXU A;  3S1R B;  1F2Y A;  3VR3 A;  2EVB A;  4KY6 A;  3K58 A;  3T16 A;  4X3K A;  3KBG A;  2O5I C;  4EVO A;  3KK7 A;  4B9W A;  2E76 C;  1DOL A;  1HUN A;  1RTO A;  1BNZ A;  1BUV T;  5J22 A;  1DM0 B;  4QF4 A;  4FF3 A;  4HR7 B;  1ZXT A;  4C3J G;  4X3S A;  3H91 A;  1SNO A;  1RJT A;  3MVV A;  2IL8 A;  2EYM A;  4KV6 A;  2D9U A;  2MJ8 A;  2A74 C;  3NPP A;  4DXG A;  1CZG A;  1OXT A;  5CMD A;  4QCL A;  4R9W A;  2R6G A;  1VMP A;  4C1N I;  1PZK D;  2Z8L A;  2G9D A;  4KKT A;  1EYA A;  5C5L A;  4IFD H;  4ID6 A;  1TII D;  5DEH A;  2WII B;  3S16 B;  5D65 A;  1TWG B;  2A6E D;  4Q5V A;  1LT5 D;  3IFD A;  1K83 B;  5KGU A;  2F0O A;  1TR5 A;  3OWF A;  4BBR B;  3T56 B;  4O42 A;  2VNU D;  5FKA C;  1JWS D;  3A55 A;  4FF4 A;  1EZ6 A;  1U4R A;  2BA0 A;  1Q12 A;  2SOB A;  1PRT D;  1PZJ D;  2J7Z A;  2K7V A;  2JA5 B;  1HRJ A;  4ODG A;  1C48 A;  2R92 B;  2B8F A;  4WRD A;  3SE0 A;  2O4X A;  1PFN A;  3J80 E;  2L5T A;  2HDL A;  3KBX A;  3GTG B;  3PUV A;  1WTO A;  3SXH A;  3RLF A;  5KEE A;  2K6A A;  4IUR A;  3NUC A;  3R8B A;  1CHQ D;  5EKL A;  4H13 C;  1ET9 A;  5C3X A;  5I4D A;  3RUZ A;  3P7J A;  3S1Q B;  4ZKB B;  2X6L A;  4CKB A;  1DYQ A;  1O7L A;  5BN4 A;  1EYC A;  3GTL B;  4KK7 A;  1EU4 A;  5E4X A;  3TP7 A;  3DUZ A;  3MFY A;  2F0G A;  4DAV A;  2JE6 I;  2KCC A;  4AYB B;  5KYI A;  4ME5 A;  5D14 A;  3LWE A;  4FP5 D;  4HSP A;  2NVQ B;  5KND A;  1W6J A;  4N9P A;  1EQV A;  1Y8P B;  2HCI A;  1PFB A;  5CBE E;  3CHB D;  2L4N A;  4NW2 A;  2CQA A;  4DN4 M;  1AFP A;  3C3L A;  2NVX B;  1BCP F;  5C3E B;  4I7Z C;  4J1M A;  2PNR C;  2B2U A;  3IKJ A;  4QUF A;  1PTO F;  3NWS A;  3JAM E;  2N88 A;  2NBF A;  1Z7T A;  2F0U A;  1SSO A;  2XN9 C;  5JVH 3;  2WB1 B;  1RCV D;  3C1F A;  3GQB A;  1L0Y B;  2BDO A;  1D5X C;  3PO3 B;  3T4A C;  3N52 A;  4EQP A;  2LMC B;  1OXV A;  2BCO A;  3ND8 A;  1KNE A;  2WKD A;  3VA5 A;  4FO2 A;  2A68 C;  3Q0A A;  2DN8 A;  1I50 B;  4JBW A;  4UDU C;  4RHS A;  5I9O A;  2RDH A;  4KN7 C;  1SYC A;  1A3V A;  3KF8 A;  1SYD A;  3PUZ A;  5C4X B;  1WTV A;  1T5X D;  1FYC A;  2FJ2 A;  3D3R A;  3RD4 A;  2F0E A;  3PV0 A;  3I3C A;  1CZW A;  2B2V C;  1V1P A;  4F8M A;  1AW7 A;  3I90 A;  4BY7 B;  1JWU D;  4A3J B;  2B2Y C;  1ZEQ X;  1G6Z A;  1BBX C;  2F0F A;  1STE A;  1PYW D;  4FNF A;  4GZY C;  2F0Q A;  5IIF A;  4LJZ C;  1IL8 A;  2RKS A;  4M8A A;  2YU9 B;  1TS5 A;  4XQJ A;  5CYU A;  1KLU D;  3K6O A;  3D6C A;  3MXP A;  3AMU A;  1WTX A;  2F0M A;  4H44 C;  4C3I B;  4WFN 3;  1DOM A;  3M7G A;  2FFK B;  1SE3 A;  1PTO B;  1WTP A;  3PUW A;  5M5X B;  1D5Z C;  1EWC A;  2R7Z B;  1GUS A;  1W6K A;  4HMI A;  4CKE A;  3NQT A;  1EOT A;  2F0V A;  1FNW A;  4QMG A;  1MGS A;  4K6L A;  5J1Z A;  2SNS A;  1QE6 A;  4P2C B;  3SK6 A;  1EL0 A;  2JXM B;  1H9S A;  3I91 A;  2VB2 X;  4ZKC B;  2PZW A;  5EJW A;  4C3I G;  4DF7 A;  4HCE A;  2HQE A;  2PW7 A;  2F0W A;  3GTO B;  4CHT B;  1SNC A;  5IT9 L;  2KEC A;  1EY7 A;  1GUT A;  1STA A;  4MN3 A;  3OOC A;  1DD2 A;  1SNM A;  4FXG C;  1CHP D;  5KNB A;  1IW7 C;  4L63 B;  5C6A A;  1SND A;  3QJY A;  2F0J A;  4TSS A;  2LS0 1;  1MI2 A;  4J8Q A;  3OWE B;  3R3O A;  3PUX A;  1V1P B;  4K5X A;  4OO1 I;  4HAE A;  3V96 A;  1SBB B;  3U9O A;  4RWS C;  1DCZ A;  3D4D A;  1OXS C;  4XDX A;  4OO1 H;  1MSG A;  2PPB C;  1RKN A;  3BYY B;  1JQY D;  3I70 A;  1UUP A;  1IYU A;  1UAP A;  1XWE A;  1LTR D;  4YIJ A;  2PCF B;  3P20 A;  3OW7 A;  4DA2 A;  3MXU A;  1ENF A;  3R2I A;  3J7A V;  3MZ5 A;  4ZAI A;  1H9R A;  4ZRZ A;  4KY5 A;  1MSH A;  1LTA D;  1DJR D;  3TBI B;  1YNJ D;  1ZYR D;  3HOW B;  3MC0 B;  3J7Y W;  1PRT F;  4XQQ A;  1TVX A;  3VR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...