2F0HA

Crystal structure of staphylococcal nuclease mutant v66l
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 39
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0hA00
2EYLA 1SYFA 4B9WA 3HEJA 2F0PA 2F0OA 4QF4A 5KEEA 3MZ5A 1EYCA 1SNOA 1SYDA 3HZXA 3PMFA 4RKLA 5DEHA 3MHBA 1JOQA 4KHVA 3EJIA 4KY7A 1JORA 4K2LA 4QMGA 3E5SA 1KDAA 1TR5A 2F0FA 4KV6A 1IHZA 5ISRA 4HTHA 3MEHA 4B9XA 4KY6A 1A2TA 2KHSA 2EYHA 1II3A 5C5LA 2F0TA 4EVOA 3D4DA 4ZUJA 1EY7A 1EY5A 4S3SA 5CV5A 3NHHA 5IOCA 1EY9A 4DU9A 2F0UA 2F0DA 4IALA 4K5XA 1EY4A 4QB4A 1STAA 1EYDA 2O4XA 4J1MA 2PZTA 4K8IA 5CR3A 4ZQ3A 2F0JA 2RBMA 5C3WA 5CC4A 3T13A 3DMUA 1STYA 3MXPA 5CV4A 3LX0A 4KY5A 3NUCA 4H7BA 3RUZA 1KDBA 1STBA 4EQNA 1SYCA 2EYJA 5E1FA 3SHLA 2F0QA 2WACA 4NDXA 2F0GA 4OL7A 5CV6A 5J1ZA 2RKSA 1NSNS 1STHA 2EYOA 4ZUIA 2EY2A 3V2TA 3SR1A 5IGGA 2HQEA 2KQ3A 1SYGA 5C6AA 4EQPA 5C4HA 2EY6A 4KJOA 5IGFA 5M9OA 4WORA 1TT2A 3SK5A 4PMBA 2EYPA 3QB3A 4G57A 5EKKA 1JOKA 2EYMA 1ENAA 4N9TA 3QOJA 3D6CA 3U9OA 5KYLA 5HGTA 3EROA 3D4WA 4HMJA 5IGEA 3BDCA 3TP8A 2F3WA 4LAAA 2F0LA 1EZ8A 5E3FA 2F0EA 3C1FA 3NXWA 3P75A 2LKVA 5F2DA 1SYBA 3NQTA 5DAUA 5C3XA 5KIXA 1JOOA 5KYIA 2F3VA 2SNMA 3OMGA 1KABA 1NUCA 4ME5A 4E6IA 5CV9A 5C4ZA 2QDBA 1SNDA 5IGDA 1SNCA 3S9WA 2EY1A 2F0IA 2PYKA 3ITPA 1STGA 3NP8A 3OSOA 1KAAA 1SNPA 3SK4A 4K8JA 1STNA 4J6HA 5NUCA 4N9PA 3ERQA 5IGBA 2EYFA 5JAVA 4IZ8A 3P1HA 1SNQA 4TRDA 5KRUA 4K5WA 3T16A 5J39A 2EY5A 2F0MA 3TP5A 4KD3A 2F0VA 2NUCA 2F0KA 3BDLA 5CGKA 5I9OA 3H6MA 1EQVA 4K6DA 4HMIA 2F0NA 3OWFA 1TQOA 3TP6A 1F2YA 1A3VA 2PW5A 4NMZA 5C5MA 4IUNA 4KJNA 2M00A 4KTAA 4EQOA 5K5PA 4NKLA 3NK9A 4YIJA 3MVVA 2ENBA 3QOLA 4WRDA 1U9RA 2PZUA 4K5VA 1EY6A 4ID6A 3SXHA 1F2ZA 4K2KA 1EYAA 5EKLA 1KDCA 4R8NA 4ODGA 4I65A 1ENCA 1EY8A 4PNYA 3TMEA 4DFAA 4NP5A 3EVQA 1F2MA 1SNMA 5CV7A 3VA5A 1RKNA 5JOBA 1AEXA 2OEOA 4F7XA 5HURA 2F0HA 1A3TA 3R3OA 4RKBA 5IODA 4MIUA 1EZ6A 2RDFA 3C1EA 4DGZA 5IGCA 5KGUA 1A3UA 5I9PA 2PZWA 1SYEA 2OF1A 3D8GA 3TP7A 5IIFA 5J22A 5EGTA 2PQEA 2OXPA 5I6WA 1EY0A 4F8MA 3OMCA 1A2UA 2PW7A 4PMCA 4K14A 4KD4A 2F0WA 3DHQA 5CV8A 2F0SA 4DF7A 3SK8A 2SNSA 3SK6A 2SOBA 2EXZA 5I6YA
chains in the Genus database with same CATH superfamily
3CPWA 4LFAL 2F0PA 3CC4A 1EYCA 2BDOA 4CKCA 4C2MB 3K7UC 1JOQA 1L0XB 4FXGC 3M9BA 3J81L 5DM73 4R4IA 2XWBB 3TBIB 4CGYB 1NTGA 1QVCA 4S3SA 4HAEA 4JYAL 3NHHA 3HOZH 1XWEA 4IALA 2XWJB 4UP9A 1F2LA 1JWMD 1CA6A 3VA7A 3H94A 2HDLA 3CXCA 1SYCA 3S1MH 1GUOA 5E1FA 5K36H 2X6LA 5JPMC 1N8RC 1E2ZA 4ZUIA 1QB5D 2OTLA 3KLSX 1HZBA 1J5EQ 3GDEA 3L2PA 2C35B 2Y0SG 1CSQA 1VQPA 1YITA 3U9OA 3D6CA 5FLMG 4X66Q 3TP8A 3DWAA 2VQFL 2CW0C 2B2TC 4XT1B 1F9PA 2CQAA 2OQ0A 4DV3L 4IQZA 3A7LA 1E3PA 1SNPA 1I3QB 4A75A 5FK9C 1FNUA 4J6HA 1BBXC 1WTHA 4AIMA 2EPBA 3W3AA 4RH6A 3ULPA 1U4LA 1VQGA 4XTCS 1I4HA 1J9OA 2MUYA 5EBCA 3G7LA 2RCNA 5M5XH 4DV6Q 3PO3H 3NBIA 2KEEA 4GN5A 4JBJA 5JEAH 2R93H 1WTRA 1B4OA 1LTSD 3IAYA 5IP9H 3N6RA 4IJHA 4AQYL 5C3EG 4NP5A 1JQYD 3MC0B 4LF5Q 4PZ6A 1UE5A 4F7XA 1LO5D 1HXYD 2F0HA 1Q1BA 3KDFA 3FHWA 1M4VA 5C0XH 1CK1A 2N88A 4C3IB 2SNSA 1RD9D 3A54A 1GHJA 3HZXA 3PMFA 4P72A 3K8AA 4IUTA 1F9SA 3EJIA 1IBLQ 1A2TA 2KHSA 1IYJB 3I4NH 2PNHA 2RVLA 5T1IA 2NBFA 2PNRC 4GLAC 1B50A 1YNXA 3MTSA 3G6EA 3F1ZA 1E7ZA 1VQOA 1IYUA 3T13A 4HIMA 1CKOA 3NUCA 1XMOL 3PO3G 1VQFA 5FLXE 3I91A 4J8QA 3SHLA 1K0SA 2R93G 2DGYA 1G51A 3IKJA 4ZCKA 4MTKA 5IP9G 2N55A 4RGOS 1DZ1A 1Z7TA 3AFQA 1BBWA 5EKKA 4WJ4A 1DOLA 1PH7A 5HGTA 3I4MH 4BY1B 1WJJA 1PDQA 3PUVA 1HQMC 3F2DA 2A8VA 2LMCB 1E0BA 2Z6KA 5C3XA 3RZDH 3A8KE 5AFWA 1O7YA 5EBDA 3NQIA 4LFCQ 1PTOF 4DK6C 2QDBA 4KLKA 1HNWL 5LHY1 3U4VA 3LGJA 1W2BA 3S1NB 3T51B 2QCPX 3A5ZB 4N9PA 4K6LA 4DR6L 2JA7H 5KNBA 5E7NA 5IE8A 5AJ3Q 5LMUQ 1Y1WG 1X3GA 3S1RB 1L1OC 3S2DB 2F0NA 3TP6A 3J81E 2QEXA 2HCIA 4NKLA 4EX5A 1U9RA 3FP9A 3KBGA 4K2KA 4LFAQ 4R8NA 4ODGA 1LTGD 3F2UA 5FKAC 2NTTA 4QY7A 3OYYA 1STEA 5D3IB 3Q8DA 4OO1G 5ELNA 1K83H 2RDFA 1KIXA 4JYAQ 1HZCA 3S2HH 1Y1VG 4IO9A 3T1HL 1K28A 3HOXH 4X3SA 1I50H 2H5XA 2EYLA 3HEJA 3MZ5A 3Q0AA 5DEHA 4KN4C 3CQZH 2NVTH 3HOWG 1F9RA 3GD7A 1U4PA 3CCSA 4B9XA 1K8AC 3H15A 3PF5A 2R7ZB 2JA7G 2F0UA 3DM3A 3NTIA 1CTMA 2B63H 1WTWA 3J7ZC 4YCUA 5FO7B 4JOIC 3BVZA 2VQFQ 3OW7A 2YTYA 1PYBA 1STYA 4DUYQ 4H7BA 2A73B 4PQXA 4BY7H 2EYJA 3J81j 2WACA 1OXUA 2RKSA 2D0PA 5IYCH 2NZHA 2ZJPA 1SFOH 4MN3A 2NB0A 1O78A 1TT2A 3N52A 1SRUA 4LUZA 3I72A 3PV0A 3NPPA 3R2IA 3HKZG 5JJZA 2ID0A 1BCPC 1OXVA 5IGEA 2OTJA 3HRZC 4YY3L 4HIKA 1TWCB 4IPDA 1LTRD 2UXDL 3P75A 4Y52H 4BBRH 3HOXG 4GS3A 3TDQA 3RNUA 1I4PA 2PYKA 3B6YA 3KLRA 4ME3A 3UDFA 4JI7L 1VQ5A 2QDLA 2JA6H 2QKIC 2JA5B 4AQYQ 3CHBD 3P1HA 2VZAA 4ILWA 1GUTA 4DAPA 4R9WA 1IBKQ 4K5WA 3RMHA 1WD0A 3HOYH 1PH1A 2F0MA 5EPJA 2I0QA 3GV6A 3CCQA 1LTTD 4UDUC 1VMCA 1A3VA 5C5MA 4OWWB 4BA1I 2EJFC 4A3LG 4LMQD 3H09A 4XQJA 5JJKA 1BOSA 3S16B 4BY7G 4HJ8A 1XPUA 1BQQT 2VUMH 1ESRA 5EKLA 4A3FH 3VYTA 4I65A 5IYCG 3D4RA 1F2MA 1FGUA 2WKCA 3E6ZX 1VQCA 1TVXA 3A5UA 1LM0A 4JK1C 2YU9H 1YNNC 1CZWA 5IP7H 3ONAB 4FP5D 5G3LF 4CDDC 1NR2A 2A74C 4F8MA 3LWEA 3DEPA 4OWXB 4PMCA 3K7AB 5LL6X 3SK8A 5M5WB 1KRTA 3Q22A 2EVBA 4X65L 3MEFA 5BR8L 4HTHA 4R4OA 1X56A 2CFMA 1JJGA 3PIP3 5C4JB 1Z6HA 1BCPB 4LF4L 3KDFB 2CWPA 1R4QB 1Y8OB 3HOYG 2UXBQ 4C1NI 1I6HH 4J1MA 4UP7A 3DMUA 1PMRA 3DM1A 4UY8C 3CPFA 4YWLA 5IT9L 4NDXA 4OL7A 2ICIA 2VUMG 3D6WA 1HNWQ 2M2LA 4XQNA 1PTOH 4A3BB 1EWHA 1V43A 5DLQE 3JAML 3QB3A 4G57A 2UXCL 1N36L 4N9TA 2EYMA 1ENAA 2CKZB 1XPRA 1I4RA 4LF9L 1CFMA 2R7FA 3I73A 3R93A 1JWUD 4JI6L 4L5SA 5IP7G 1JMCA 1C48A 3CC7A 1XX8A 3NWTA 2LKVA 5DAUA 4FF3A 3M85A 1SJHD 1SE4A 1HQRD 2NYZD 4CJ0B 1H9RA 4E6IA 2A5HA 1Z47A 1X3FA 2B2WA 1WCMH 3GTJB 4WFN3 1STNA 1TWFH 3S15H 1D1KA 5C44B 3RZOB 1GO3E 1VQMA 1XNQL 2CH4A 1EOVA 3KFUA 5J39A 2ZTCA 4DAYA 3QWNA 1EQVA 3NSWA 3AB9A 4DR2L 2B2YA 1HZ9A 5C0XJ 2VL6A 2FMMA 1KL9A 3A0JA 4UP8A 1EY6A 3M3YH 3ND9A 1HNZL 5EPLA 4LUOA 2Q2HA 2HD3A 2E2IH 1KRSA 4DFAA 4QJFA 3FMCA 4A3JH 4RCOA 1AN8A 3VA5A 1RKNA 2WB1E 1FNVA 3P7JA 4LK1C 2XRQD 3LWUA 1WVLA 1SYEA 2R7DA 1JICA 2B2UA 1M90C 5I6WA 4FF2A 1DGSA 2F0SA 2L15A 2DNEA 1MJCA 2K5VA 4RKLA 5EQ0A 2A1AA 3JC66 1KDAA 4KV6A 1WCMG 5ISRA 3RD4A 3ICEA 4B3MQ 2EJGC 2EXDA 4CKBA 2Z4IA 1BKBA 3OPOA 4C3JB 1EY5A 2UUCL 3GTGH 3I8ZA 4C3IG 3J81i 4L5QA 2MNAA 3PIPA 4YY3Q 5CR3A 1PH3A 2MHVA 4OIKA 2F0JA 1PH4A 1A15A 2UXDQ 1TWHB 3I3CA 2Z1CA 3LX0A 1CM9A 4JPBW 1VQ4A 1FJGL 2K04A 3R8BA 4IURA 4HJAA 2E74C 4HIOA 3VR2A 3NELA 3K5OA 2WB1B 4DN4M 2K1BA 4QIWB 1GM5A 4DAMA 1HTLD 1I6VC 4LF6L 3TS2A 2GN5A 1TWGH 1NBWA 5F2DA 4DNRB 1BVSA 3PUXA 3GP7A 2I5LX 3OMGA 5C4ZA 4DV2L 3FDTA 4GNXC 5J3BA 1ICFB 3DLLA 2Q2UA 3BYYB 5JJLA 1K9MC 3D31A 1KNAA 2F4VL 1JJCB 3E0JA 2YTVA 3L7ZC 4GKKL 4TRDA 3J7AF 4O42A 1SR3A 5FJ8H 4C1NK 3CMAA 1HR0L 2FFKB 4LF8L 4X64L 2DJGC 1KD1C 4A3MB 2RDHA 4EQOA 5M5YB 1A63A 1U4MA 3H91A 3MVVA 1EOTA 1V1OA 4FYDA 4QUFA 5M3FB 4OO1I 1PV4A 4A93B 1KHIA 5CORA 4C3HB 1HA5A 1EY8A 1FVIA 3TMEA 1IYVA 1K8OA 5BR8Q 1S3OA 1UEBA 4R4CA 3QIAA 3EBEA 2NVQH 2E2JH 3GTMB 5IT9E 2BH2A 5IODA 4JI2L 4DPGA 3I4OA 5KGUA 1QVGA 2OF1A 3EQLC 2GVAA 1MSHA 1CQFA 2CW0D 3OMCA 4TVAB 1F77A 2IPKD 4KD4A 3JAME 2SOBA 2QGQA 1I94L 2F52A 3W1BA 3U58A 2HUGA 3A74A 1GD7A 3PF4A 4XQQA 2IX3A 5C4XH 4GOPA 4DV7L 4G7HC 2LY7A 3GQBA 5FLMH 2UXCQ 4DU9A 3G71A 1N36Q 5HY6A 4QB4A 1K8MA 4LWCA 3RLOA 4LF9Q 5IYDH 1EYDA 4JI6Q 1V1PA 2KCTA 1EEFD 1KDBA 2B2VA 2F0QA 5COYA 2QILA 3KF6A 4B3TL 3SVMA 1XNRL 2R7ZG 2JA8B 3QJYA 2KQ3A 1SYGA 5C4HA 1K73C 4R1JA 1WI5A 4XDXA 2MQHA 4A3DB 1B1ZA 3QOJA 3X3MA 1CQVA 5KYLA 1CUKA 5HGQA 4HMJA 5LMNW 2NN6I 2K5NA 4AYBE 1EZ8A 2F0EA 4RA8A 4DR2Q 2ZJRA 2A69D 5KNDA 1PVOA 1VF7A 2SNMA 1JC7A 4OHJA 1N33L 2F0IA 2VXWA 2N3SA 3E0EA 1HNZQ 5C3EH 4LW1A 2K75A 3ZJYC 4A3KB 3K5LA 4RFBA 1B44D 1TWAB 1RCVD 3I55A 5C4XG 4HSVA 1VQJA 1XTCD 4BXXG 3OWEB 3AYHB 1SE3A 5IYDG 2KHIA 4JI1L 1YHAA 3J80L 4P73A 2ENBA 3QOLA 2HIVA 2Z0SA 3RR5A 2ZT9C 2JA5G 1Q46A 1YBYA 3UE1A 1PH5A 4FF1A 4A76A 5T1GA 5GADC 1SNMA 3A8IE 4MTNA 5JOBA 2AUKA 4L8JA 4ZRZA 2B8FA 3F2BA 1UE7A 4IPHA 3PO2H 2WAQE 3BZCA 4DAYB 2VY3A 3C1EA 1KC8C 4X3UA 4AYBB 3CRKC 3NTHA 3SE0A 1YJ9A 3HOVB 3DHQA 4N8FA 5M3MB 3K58A 1X9NA 2EY5A 2GA4B 5IYBG 1O7IA 5DM63 5EJWA 4RGTA 1FJGQ 1ILQA 4DNTB 1JORA 4QMGA 3KUPA 1A62A 1TS3A 4NPSA 1B53A 3NBHA 1YJNA 3D4DA 2Q8RE 3OTOL 2AHOB 3BYTB 3STBD 1W3SA 4LF6Q 4HIDA 4QL5A 3MFGA 3RUZA 2VS1A 4KY5A 2A69C 2D9UA 3IRBA 5CV6A 1ML0D 5IGGA 4JV5Q 1LT3D 1QCBD 5IGFA 3GTKB 4KJOA 1LTID 2Q2IA 4NB3A 2PI2A 4RMFA 2XTIA 1GVPA 4LNQA 2F4VQ 3CD6A 4GKKQ 2O2LD 1Y1WH 2WAQB 1DOMA 3PO2G 2K5HA 2XGTA 2EDGA 4LF8Q 2WP8J 1QUQA 4X64Q 3PSIA 3GTQH 2HHHL 1B3AA 4KHZA 3GTOH 1SYBA 4A3BG 1CT1D 2EE1A 2UUBL 3NP8A 3DXJC 3OSOA 1OXXK 1D5MC 2X69A 4FXKC 2KBNA 2L11A 3CW2C 5FO9B 4OO1H 2IX1A 1PLFA 3T1YL 4Y7NB 1KLUD 5JVH3 4CDCC 3O13A 4R4TA 4JI2Q 2NUCA 4CKEA 1HFNA 4IUQA 1Y1VH 1U0LA 4K6DA 1PFMA 1BR9A 4DR5L 1S5FD 2L4NA 4JCVE 4JI0Q 1N32L 1SLJA 4GLVB 1Q12A 4K5VA 5C44G 3HOWH 1QOHA 2J7ZA 3GTPH 2TMPA 3GTLH 2E2HB 2R92B 3EVQA 1PFSA 3CCRA 3I90A 1NE3A 4DR3L 4C56C 2JK8A 2FHTA 4DK1A 4DV7Q 4A3EH 1SMYC 2NWGA 2Q8IB 4Q5VA 1BCPD 3EA6A 3DEOA 3STBC 1PRTB 1TIID 4JI3L 2WFWA 4RGMA 4GN4B 2CVRA 1X54A 1LYLA 2JA9A 2KUMA 1VQDA 2K7VA 1DONA 2HQLA 1EYGA 1XNRQ 1B7YB 4A3IH 3CMEA 2B3GA 2KCNA 4LF7L 1EY7A 4O2DA 4IFDI 1OTCA 1ICWA 2XSCA 3BG3A 5CBAE 2NVXH 1HJPA 3M4OB 5D3DA 1CKMA 1G291 2KA7A 2EIFA 3S14B 2MFIA 3ND8A 3SK6A 3MXUA 2NN6H 2EYOA 4LFBL 1QVFA 1WTOA 4DK3C 4A3MH 4QGUA 4WORA 1Q8KA 1IZ6A 3H0GB 4K0KL 1QG7A 3J80E 2QEJC 3EROA 4YCVA 1YNND 1Y8PB 4A3EG 4DV1L 3KLSA 2NZ1D 3JAMi 3S1QB 3K57A 4A3LH 1UE1A 3NXWA 2FINB 1SE8A 4DV3Q 3KF6B 1QZHA 2WB1G 2ZM6L 2AWOA 2BCOA 2Q2TA 1KAAA 2XRSD 4V190 4BBSB 2A19A 5NUCA 3W5OA 1ZEQX 5JAVA 4A3IG 1PH2A 3T16A 3BDOA 4L63B 1D1IA 3CC2A 1MGSA 3FVQA 1NNXA 2ZXOA 1B8AA 1WFQA 1TQOA 5E4XA 5CGKA 1HNXL 3K59A 4IUNA 4KTAA 4JI5L 1SROA 5K5PA 5ELEA 3P20A 2WV6D 1E22A 5JVG3 2D62A 2NN6G 3K81C 2ZXPA 1UWVA 1T9HA 2JP1A 1B70B 1KNEA 4BWGB 2BOSA 3K0XA 2QW7A 4A3MG 1RDPD 4OX9L 1QNUA 4KKUA 1M8AA 3CCLA 1LUZA 1R9TH 3I4LA 1QWYA 3OTOQ 1SXTA 4EQ5A 5M3FG 1U4RA 4A93G 1RODA 4C2MH 3IFDA 4C3HG 5CV8A 2E8GA 4ZK9B 1RL2A 2NVYB 2VQEL 2EXZA 5I6YA 1B3QA 1IXRA 4JBWA 4B9WA 3KJPA 3KOJA 1E2WA 1H9SA 2RCFA 1PXUA 2PI2E 2F0FA 1P16A 2PQAA 1PH9A 3MEHA 1B9NA 4PG3A 5IOCA 1EY4A 1BUVT 3BS1A 1VQKA 2JEAI 1X3QA 3MXPA 2Z6KC 3HOZB 2RHQB 5TSSA 1XMOQ 1NSNS 1STHA 4UAIA 2RHSB 5GQOA 5EPKA 2K4KA 1NR4A 3Q23A 3A7AB 2UUBQ 1HHVA 1Q1EA 3S1MB 4JBKA 3U9SA 2NZOA 3FPPA 2L55A 3C3LA 2BA0A 1G91A 4UPAA 2ZJQA 4IUUA 1PHJA 3I7FA 2V4DA 1YIJA 2AMCB 4KKTA 2JA8G 2K52A 3NQTA 3R2TA 1I3QH 2FMCA 2L0CA 2WINB 3D0FA 1EEID 4DXGA 4G4KA 1A6XA 1WYDA 4A3DG 1WTPA 3G4SA 1AZPA 2JXMB 4K8JA 5DNFA 2EJMA 4ABNA 2EYFA 4HN7A 1X32A 4DR3Q 3K6OA 5LMNL 2FXQA 4QCLA 4DR6Q 1ASZA 1QNKA 2F0VA 1HA6A 1EIYB 1SMXA 4H02A 1JT8A 4A3KG 1EQQA 1G6ZA 3RLFA 1CA5A 4B08A 3AMUA 3E9IA 4B3RL 4RGNA 4V0BA 3TZDA 2Z4HA 5M5XB 3PO3B 1F9QA 3A55A 3T56B 3NEMA 3AFPA 2R93B 1I4QA 4DKAC 4O1NA 4HCEA 2G5DA 2KEDA 4ULLA 4C3IH 4DGZA 1VQAA 4LF7Q 2PZWA 3TQYA 1MJEA 2F4IA 4G7ZC 5LL6S 3S24A 3T1HQ 1L0WA 4IFDH 1S72A 1Z9FA 1IKLA 1SYFA 4EGVA 1HFGA 4U68A 1IL2A 2O5JC 1DOKA 4GN3B 1KQSA 1TY0A 4LFBQ 1NCVA 3E5SA 4F88A 1R4PB 2AQ2B 2PMZE 3H3VC 1JB3A 4AYBG 1SDFA 4EVOA 5BN3A 4K0KQ 5D14A 2VB2X 4YHHL 3HOVG 5M3MG 4G7OC 3D3RA 1VQ9A 1STAA 4DV1Q 4ZQ3A 1W6KA 1H95A 5CC4A 3I4NB 1MBYA 1EQTA 1VF5C 1UAPA 1BCPF 1STBA 2PO4A 1V9PA 4DUZL 1X3PA 2JJQA 4UHVA 2ZM6Q 1UUPA 4BY1H 4EQPA 4BA2I 2EY6A 4KK7A 4QUCA 1IL8A 2EYPA 4PV1C 2CHBD 2MJ8A 3HOUB 1TKWB 2L9HA 3I56A 4X3TA 2WIIB 3VYUA 1G6PA 3BDCA 4N8X1 1D5ZC 2UU9L 3HKZE 3C2PA 3C1FA 1VQ8A 2E2HH 1HNXQ 4ZAIA 3S1NH 2L12A 3I4MB 2KENA 3SEBA 4IFDG 1DJRD 1SNCA 2RSNA 1E1TA 4MNOA 2IWHA 4DXFA 3T4AC 2WAQG 3CAMA 3RZDB 2PMZB 3S1RH 4XXEA 3A56A 2N8NA 3S2DH 3EIVA 3BVGA 4JI7Q 4FVMA 5A2QL 4JC0A 2I5HA 4JBMA 4OX9Q 1V8QA 2B39A 4JG2A 3MA2B 1I4GA 2O5IC 3VDYA 1G2TA 3KBXA 4KJNA 3VYSA 4CDFC 3G48A 4IJLA 1HTPA 2VQEQ 4PZ8A 2D2CC 1RTOA 2K28A 1F2ZA 1LV9A 4DV0L 4O0AA 3L3OC 1ENCA 5FLXc 4LF5L 3KF8A 3J80i 4BY1G 1VQNA 3CCUA 4DNIA 4A4IA 5EAYA 2B29A 1KTKA 5IGCA 4Z9CB 1BXTA 2ZXRA 4R8IA 2ES2A 2JYOA 3TEHB 1X65A 1X55A 3HKZB 1A2UA 1Q3LA 1LT4D 3QG1A 1K83B 1L0YB 1E2VA 4FNFA 2R92G 2QF7A 1Q82C 2DJFC 1FL0A 2R7ZH 4RCNA 1FD7D 3MHBA 4X65Q 2KHJA 3HOXB 1IBML 4OWTB 2EYHA 1II3A 2R61A 5C5LA 1GUNA 1RHPA 4P2CB 4I7AA 1PH6A 2AWNA 3CQZB 2NVTB 3K0YA 4LF4Q 1Q90A 2IJ0A 5ELCA 4HCSA 1ILPA 4F87A 1ENFA 4BBSH 2MO0A 2X6GA 4EQNA 2XVSA 3J81c 2B63B 1H9SB 1XYIA 1G2SA 2BE5D 3SR1A 2B2WC 2PQAB 3TN2A 3ULJA 4BY7B 1TWCH 4OIJA 2G9DA 3M7NA 1PYSB 1M1KC 1SFOB 3UDIA 1AZQA 1LT6D 2F03A 4BXXH 1CKNA 4DR7L 1PA6A 4ZLTF 4HJ9A 1I5FA 2F3WA 4LAAA 1JR0D 1SEBD 1Y69U 2B2YC 1WTXA 3M4QA 1EIGA 1JOOA 4TSSA 1A8VA 2JA5H 2A68D 3BJUA 3TSSA 4RHSA 1E1OA 5IGDA 4B3RQ 1Y8NB 2EY1A 2Z9HA 1N34L 4BBRB 3L0OA 3H3VI 4A3GB 4U673 5AJ3L 2IX0A 1YHBA 5LMUL 2A6EC 1XJVA 4DR4L 1JB7A 4JI8L 5H1SE 1XNQQ 3S16H 2JA6B 2B2UC 3PQIA 4NMZA 2RSOA 1PRTD 1PZID 2XNAC 3HOYB 1CHQD 5IYBH 4BBSG 2HT1A 3PIO3 4MHEA 1UE6A 1KDCA 3SGIA 4ALPA 1CZGA 1QILA 4JW0A 4NXML 1NJIC 4GKJL 2NTSA 1UNSA 2KOLA 2VUMB 3K7AH 2JSOA 4A3FB 2QA4A 5M5WH 4ZKCB 4YHHQ 1TS4A 2CCZA 5IIFA 4CHTB 1L1OA 5BN4A 4OONA 1EY0A 4RHRA 3M7GA 2YU9B 2EQSA 4FXDA 1DM0B 4FO2A 1VDZA 1K8GA 5C4JH 4DUZQ 1HRJA 1D5XC 2BE5C 4KHVA 2ASBA 1ZKOA 1L2FA 1VQ6A 2MP1A 3CCMA 1IKMA 4X6AH 2AQ1B 2AUJD 1S4ZA 2UUCQ 1HUMA 3EN2A 4JI4L 1VQIA 2RF4A 3MWYW 2D0OA 4DUYL 4IOCA 3QR8A 4R4QA 2UU9Q 2CH4W 1VCIA 4A3BH 5CYUA 5A2QE 3F2CA 4IPGA 1WD1A 2A68C 5I2YA 1C4QA 1I6HB 1LACA 1PFBA 1D2BA 3OHXC 3I2ZA 3UE0A 3L9AX 1H9JA 5G3LD 1B9MA 3S17B 1W6JA 5ELBA 2K5DA 3HS0C 1EUJA 1SMYD 3HOZG 1PTOB 3J7AV 4L6TB 4JOIA 2MO1A 1H9KA 1QE6A 3DUZA 3GTJH 3VR3A 3CKIB 2LS01 1PRTC 3OIPA 2XN9C 3VR4A 2UUAL 5C44H 3RZOH 2F3VA 3CCVA 5K36G 1SNDA 3NE5B 2RQXA 3K5NA 4DV2Q 4DV0Q 3SK4A 1I4XA 1S5DD 1T5XD 4HEDA 2FJ2A 1IBKL 4IZ8A 4X62L 2IW3A 1WCMB 1C7YA 5I9OA 3BDLA 1TWFB 3S15B 1HR0Q 3KLWA 3OWFA 1Q81C 5ELOA 1F2YA 1O7ZA 2PW5A 4KN7C 2M00A 3DWQA 5FO8B 1DD2A 1KAWA 4KKSA 4M8AA 1ONLA 4IFDJ 3FEWX 1XXGA 3SXHA 3C46A 3UI2A 3BU2A 1PH8A 3WWVA 4HJ7A 3TS0A 1VQLA 1K0RA 2OEOA 3PIOA 4GOPC 2I07B 2I46A 4P75A 4QQBX 1TS2A 3M3YB 1IBMQ 1MI2A 3W2DA 3AQQA 3FKIB 4RKBA 4XYOA 2E2IB 3PUWA 3D8GA 2HCCA 4A3JB 2SDFA 1LTLA 2OCEA 2F0WA 3UDXA 1EIHA 5KNCA 2B2VC 1AE3A 5JEAG 3HOUH 4QF4A 4C3JH 3KF8B 1WOCA 1I94Q 3G6JB 2K5QA 1LTBD 1TR5A 1ESFA 3ULLA 2VW9A 4KY6A 1O80A 2ATWA 1TWHH 2D5DA 3CU7A 2UXBL 1HR0W 3DWPA 1ZYRD 3U4ZA 4DR7Q 4K8IA 2PZTA 1T5EA 2V1CC 5C0XG 3QO2A 3GTGB 1SN8A 1RF2D 1WTVA 1GUGA 3PUZA 5FOBB 4DR1L 4ZYSA 1AFPA 1OXSC 1H9MA 2N78A 3KJOA 1BO0A 5JPNC 5M9OA 4B3TQ 3FRPB 1HZAA 4IUPA 5GAHC 1N34Q 2DY8A 2Z8LA 3I4NG 2KCMA 4DR4Q 3D4WA 1VQEA 3K5MA 1GXDC 4JI8Q 3H3VH 1BDOA 4X3KA 2K50A 4KHPL 1YI2A 5KYIA 4ME5A 1KABA 2OQKA 1TWGB 3HOUG 2L5TA 3OOCA 4POFA 1N33Q 2E75C 4C3JG 5GAGC 1YEZA 1GJXA 4GOPB 1DXMA 4IUVA 2C9OA 4NXMQ 2DNCA 4GKJQ 5M5YH 1CKNB 1KLGD 5KRUA 2OT2A 1OO9B 2K14A 3WDNA 1FNWA 4HSPA 2JEBI 4KD3A 4JVZA 1V1PB 3I4MG 5M3FH 3PGZA 4A93H 2Y0SE 4HMIA 2K03A 4C3HH 5ELFA 1D7QA 4TKOB 4AH6A 1Q8IA 2BDNA 2CWAA 2IT1A 4YIJA 2IY5B 4JI1Q 1P8LA 1EIFA 3KK7A 3TZUA 3GTMH 4PNYA 1C8CA 1D6EC 1N9WA 5CV7A 1QZGA 2HDMA 1GUSA 2YV5A 2YYZA 2BA1A 1MIUA 1ZYRC 2E2DC 5I2XA 2PQEA 2OXPA 3GO5A 4JI4Q 1NMGA 2E5LL 1CSPA 1TS5A 3M4PA 2NVQB 2E2JB 1SBBB 1B2TA 1MHWC 2JQOA 2WKDA 2OWOA 1Q7YC 1FGBD 1BBUA 1V1QA 1SYDA 2N49A 4WJ3M 2ICEC 1PRTF 1FR3A 2F3IA 2H4OA 4B3ML 1MD2D 2K01A 1S5ED 2DY7A 3NENA 3OW2A 2G9HD 5CV5A 3V96A 4DV5L 1L1OB 3EFXD 2LXKA 5C4XB 3CRLC 2Y0SB 4NXNL 5C3WA 5GAEC 1TY2A 2JA8H 1JE4A 3UDGA 1SE2A 4YCWA 5CV4A 1S40A 3F8TA 4A3GH 1VQHA 2UUAQ 2K6AA 2K32A 3X3NA 4A3DH 2EY2A 2LFNA 3RN5A 1AP0A 2F1MA 4L5TA 3SK5A 1EWIA 4B3SL 2Q8TA 2HIXA 1GOZA 1YHQA 4X62Q 1EU3A 1K3RA 4IN3A 1GHKA 5IY0A 2GVBA 3E3XA 1AE2A 4MZ9A 2B63G 2K33A 5IT9c 5BN5A 5IWAQ 1X3EA 1ASYA 3AU7A 2AQ3B 4A3KH 1ET6A 3MXNA 2HHHQ 1EU4A 2IHEA 1TWAH 4CBVA 1NUCA 1HUNA 1Y14B 5CV9A 5L37A 1NAPA 3JAMc 3E9HA 1STGA 2IHFA 3RN2A 4HJ5A 3NBHB 3ER0A 4BS9A 5IGBA 4OELB 4Q0FA 1RIPA 2A6HD 2P5ZX 4RAUC 3I70A 5C3EB 3T1YQ 1LLRD 3TP5A 1BF4A 1GUWA 2MPMA 1ZXTA 2SEBD 2E76C 4M1UB 1ET9A 1SAPA 1XMQL 4L5RC 4RWSC 3MAQA 4DR5Q 4BBRG 2C5CA 1N32Q 2AKWB 4A3GG 2KJXA 4ID6A 4WJWA 4GNXA 4PMWA 3BZDB 3KYHC 1TXYA 2KVMA 1RJTA 3LNNA 2JA6G 1AEXA 1MSGA 2DUDA 1HPCA 2JN4A 2B8GA 2R6GA 3HOVH 5M3MH 1Q86C 4KMUC 1EZ6A 1EL0A 1D8LA 1QUQB 4ZKBB 1O7LA 2K05A 5ELDA 3PO2B 4JI3Q 2LXJA 3S17H 5D65A 2F0OA 5KEEA 3PUYA 1CI3M 3WOFA 3URYA 1EQRA 1QJOA 4A3FG 4P71A 2LSSA 4DR1Q 4CJ2C 1IHZA 1VQ7A 4H13C 4ZUJA 5EKIA 4DV4L 1PZJD 2F0DA 4DK0A 5I4DA 1J6QA 1IW7D 2O4XA 3HP3A 1VMPA 1HCZA 3GTKH 5IWAL 5JEAJ 4KHPQ 3J7A5 3CCJA 2F0GA 4RG1A 1AW7A 3V2TA 2HQEA 2XIWA 4PZ7A 5C6AA 3BZKA 4PMBA 3HGBA 1JOKA 2A6HC 4POGA 3WOEA 2PCFB 4OEMB 4I7ZC 3PCOB 1GKHA 5E3FA 2ALYB 4OXPA 1XTDA 2ZTDA 1HH2P 1Y1WB 1G8ZD 3HFZB 2M9VA 3IL8A 3FKIH 4GLXA 2I5MX 4Y7NH 3ITPA 1J5EL 3GTQB 3GTOB 1EWCA 1TU2B 2EOTA 3ERQA 3NWSA 3SDZA 5GROA 4QIWE 1VS0A 3CCEA 4X66L 1U5KA 3H6MA 4HR7B 1FYCA 2R3ZA 4FF4A 2E5LQ 1YJWA 4GZYC 3NK9A 2R92H 4WRDA 4JI5Q 4XT3B 3V05A 1Y1VB 1YNJD 5E4WC 5A35A 3VR6A 4CJ1B 1LABA 3K80C 1JWSD 1MKHA 4J15A 3T53B 5JJIA 1LT5D 2CQOA 1X6OA 4XIGS 2H1EA 5HURA 3HG9A 3OIQA 1A3TA 3HOWB 4DAVA 4MIUA 3GTPB 1NY4A 4DV5Q 3GTLB 2KCCA 3TP7A 5J22A 1JCKB 1IW7C 1PFNA 5EGTA 2PPBC 4DV6L 2EZVA 3M4YA 2B2TA 4CDEC 4NXNQ 2PW7A 2VNUD 4K14A 4A3EB 3RLNA 4DF7A 2JA7B 3BVMA 4APVA 1NMFA 1DCZA 3CP0A 1SNOA 3FKIG 1XPOA 4KY7A 4K2LA 3MXGA 3Q6SA 4A3JG 3ZYYX 1SSOA 3M4OH 5C0XI 2F0TA 3HKSA 4B3SQ 2A6ED 3S14H 1OXTA 1EY9A 4YWMA 4K5XA 4A3CH 2J4XA 1PTOD 1UEAB 2RBMA 4A3IB 4H44C 3Q24A 4LUVA 1PZKD 1YVCA 3H0GH 4JV5L 5J1ZA 3IFTA 2ZTEA 4XYQA 3S2HB 2NVXB 3MFYA 2K5WA 1IBLL 1LTAD 4OGQC 1J8IA 1I50B 1JE5A 2RDGA 3VYRA 1EFWA 1RTNA 1C9OA 3S1QH 1AH9A 1A0IA 3U50C 1SJED 2YTXA 1WTQA 1S5CD 3NTKA 2F0LA 1CHPD 2MGSA 3TREA 3CF5A 4H0LC 5KIXA 1XMQQ 3AEVA 3W1GA 3J7YW 2KECA 1YNJC 1YZ6A 3FPUB 3S9WA 1S5BD 1DYQA 2VB3X 2L1BA 4FDBA 3VR5A 5CBEE 5FLXL 2DN8A 1SNQA 4P74A 4LJZC 2Z6BA 1K3BC 1PYWD 2F0KA 5LMNQ 4JI0L 1E24A 4A3CG 3TRZA 5I9PA 3ERSX 3MXNB 4IOAA 5CMDA 1JJ2A 1VQBA 4LFCL 4DA2A 2PZUA 3H0GG 1EYAA 2TSSA 2J0TD 2RA4A 4IPCA 2IL8A 1C0AA 1BNZA 4TQUS 3R3OA 2NVYH 1KXLA 2BH8A 5FJ8G 4DV4Q 1A3UA 3GV3A 4YWKA 3J80c 4NW2A 1PTOC 1EFID 3A8JE 2JE6I 4GNXB 1R9TB 4KI0A
chains in the Genus database with same CATH topology
2F0PA 1EYCA 2BDOA 4CKCA 4C2MB 1JOQA 1L0XB 4FXGC 3J81L 5DM73 2XWBB 3TBIB 4CGYB 4S3SA 4HAEA 3NHHA 1XWEA 4IALA 2XWJB 1F2LA 1JWMD 1CA6A 3VA7A 3H94A 2HDLA 1SYCA 1GUOA 5E1FA 5K36H 2X6LA 5JPMC 1E2ZA 4ZUIA 1QB5D 3KLSX 3U9OA 3D6CA 3TP8A 3DWAA 2CW0C 2B2TC 4XT1B 1F9PA 2CQAA 4IQZA 3A7LA 1SNPA 1I3QB 5FK9C 1FNUA 4J6HA 1BBXC 2EPBA 3W3AA 4RH6A 1U4LA 4XTCS 1I4HA 1J9OA 2MUYA 5EBCA 3G7LA 3NBIA 2KEEA 5JEAH 1WTRA 1B4OA 1LTSD 3IAYA 3N6RA 4NP5A 1JQYD 3MC0B 4F7XA 1LO5D 1HXYD 2F0HA 1Q1BA 1M4VA 5C0XH 1CK1A 2N88A 4C3IB 2SNSA 1RD9D 3A54A 1GHJA 3HZXA 3PMFA 4IUTA 1F9SA 3EJIA 1A2TA 2KHSA 2RVLA 5T1IA 2NBFA 2PNRC 1B50A 3MTSA 1IYUA 3T13A 3NUCA 5FLXE 3I91A 4J8QA 3SHLA 3IKJA 2N55A 4RGOS 1DZ1A 1Z7TA 5EKKA 1DOLA 5HGTA 4BY1B 1PDQA 3PUVA 1HQMC 2LMCB 1E0BA 5C3XA 3A8KE 5AFWA 1O7YA 5EBDA 3NQIA 1PTOF 2QDBA 5LHY1 3S1NB 3T51B 2QCPX 4N9PA 4K6LA 5KNBA 3S1RB 3S2DB 2F0NA 3TP6A 3J81E 2HCIA 4NKLA 1U9RA 3KBGA 4K2KA 4R8NA 4ODGA 1LTGD 3F2UA 5FKAC 2NTTA 1STEA 5D3IB 4OO1G 2RDFA 4X3SA 2EYLA 3HEJA 3MZ5A 3Q0AA 5DEHA 4KN4C 1F9RA 3GD7A 1U4PA 4B9XA 2R7ZB 2F0UA 3NTIA 1CTMA 1WTWA 5FO7B 3BVZA 3OW7A 1STYA 4H7BA 2A73B 4PQXA 2EYJA 2WACA 1OXUA 2RKSA 4MN3A 2NB0A 1O78A 1TT2A 3N52A 3I72A 3PV0A 3NPPA 3R2IA 5JJZA 2ID0A 1BCPC 1OXVA 5IGEA 3HRZC 1TWCB 1LTRD 3P75A 3TDQA 1I4PA 2PYKA 3KLRA 2QKIC 2JA5B 3CHBD 3P1HA 4ILWA 1GUTA 4DAPA 4R9WA 4K5WA 3RMHA 1WD0A 2F0MA 5EPJA 3GV6A 1LTTD 4UDUC 1VMCA 1A3VA 5C5MA 4BA1I 2EJFC 4LMQD 3H09A 4XQJA 1BOSA 3S16B 1BQQT 1ESRA 5EKLA 3VYTA 4I65A 3D4RA 1F2MA 2WKCA 3E6ZX 1TVXA 4JK1C 1YNNC 1CZWA 3ONAB 4FP5D 5G3LF 1NR2A 2A74C 4F8MA 3LWEA 3DEPA 4PMCA 3K7AB 5LL6X 3SK8A 5M5WB 3Q22A 2EVBA 4HTHA 3PIP3 5C4JB 1Z6HA 1BCPB 1R4QB 1Y8OB 4C1NI 4J1MA 3DMUA 1PMRA 3DM1A 5IT9L 4NDXA 4OL7A 2ICIA 3D6WA 2M2LA 4XQNA 1PTOH 4A3BB 1EWHA 1V43A 3JAML 3QB3A 4G57A 4N9TA 2EYMA 1ENAA 1I4RA 1CFMA 3I73A 3R93A 1JWUD 1C48A 1XX8A 3NWTA 2LKVA 5DAUA 4FF3A 3M85A 1SJHD 1SE4A 1HQRD 2NYZD 4CJ0B 1H9RA 4E6IA 2A5HA 1Z47A 2B2WA 3GTJB 4WFN3 1STNA 1D1KA 5C44B 3RZOB 5J39A 4DAYA 3QWNA 1EQVA 3NSWA 3AB9A 2B2YA 5C0XJ 2FMMA 1EY6A 3ND9A 5EPLA 4DFAA 3FMCA 4RCOA 1AN8A 3VA5A 1RKNA 1FNVA 3P7JA 4LK1C 2XRQD 3LWUA 1WVLA 1SYEA 1JICA 2B2UA 5I6WA 4FF2A 2F0SA 2DNEA 4RKLA 5EQ0A 1KDAA 4KV6A 5ISRA 3RD4A 2EJGC 4CKBA 2Z4IA 3OPOA 4C3JB 1EY5A 3I8ZA 4C3IG 5CR3A 2MHVA 4OIKA 2F0JA 1A15A 1TWHB 3I3CA 2Z1CA 3LX0A 1CM9A 2K04A 3R8BA 4IURA 2E74C 3VR2A 3K5OA 2WB1B 4DN4M 2K1BA 4QIWB 1HTLD 1I6VC 5F2DA 4DNRB 3PUXA 3GP7A 3OMGA 5C4ZA 3FDTA 3BYYB 3D31A 1KNAA 3E0JA 3L7ZC 4TRDA 3J7AF 4O42A 4C1NK 2FFKB 4A3MB 2RDHA 4EQOA 5M5YB 1U4MA 3H91A 3MVVA 1EOTA 1V1OA 4FYDA 4QUFA 5M3FB 4OO1I 4A93B 5CORA 4C3HB 1HA5A 1EY8A 3TMEA 1IYVA 1K8OA 3QIAA 3GTMB 5IT9E 5IODA 5KGUA 2OF1A 3EQLC 1MSHA 1CQFA 2CW0D 3OMCA 1F77A 2IPKD 4KD4A 3JAME 2SOBA 2HUGA 4XQQA 2IX3A 4G7HC 2LY7A 3GQBA 4DU9A 4QB4A 1K8MA 1EYDA 1V1PA 1EEFD 1KDBA 2B2VA 2F0QA 5COYA 2QILA 3SVMA 2JA8B 3QJYA 2KQ3A 1SYGA 5C4HA 4XDXA 4A3DB 1B1ZA 3QOJA 3X3MA 1CQVA 5KYLA 4HMJA 2NN6I 1EZ8A 2F0EA 4RA8A 2A69D 5KNDA 1VF7A 2SNMA 1JC7A 4OHJA 2F0IA 2VXWA 4A3KB 3K5LA 4RFBA 1B44D 1TWAB 1RCVD 4HSVA 1XTCD 3OWEB 1SE3A 3J80L 2ENBA 3QOLA 2ZT9C 4FF1A 5T1GA 1SNMA 3A8IE 5JOBA 2AUKA 4L8JA 4ZRZA 2B8FA 3C1EA 4X3UA 4AYBB 3CRKC 3NTHA 3SE0A 3HOVB 3DHQA 5M3MB 3K58A 2EY5A 2GA4B 5DM63 5EJWA 4RGTA 1ILQA 4DNTB 1JORA 4QMGA 3KUPA 1TS3A 1B53A 3NBHA 3D4DA 2Q8RE 3BYTB 3MFGA 3RUZA 4KY5A 2A69C 2D9UA 5CV6A 1ML0D 5IGGA 1LT3D 1QCBD 5IGFA 3GTKB 4KJOA 1LTID 2O2LD 2WAQB 1DOMA 2EDGA 2WP8J 1B3AA 4KHZA 1SYBA 1CT1D 2EE1A 3NP8A 3DXJC 3OSOA 1OXXK 1D5MC 2X69A 4FXKC 2L11A 5FO9B 4OO1H 2IX1A 1PLFA 4Y7NB 1KLUD 5JVH3 3O13A 2NUCA 4CKEA 1HFNA 4IUQA 4K6DA 1PFMA 1BR9A 1S5FD 2L4NA 1Q12A 4K5VA 1QOHA 2J7ZA 2TMPA 2E2HB 2R92B 3EVQA 3I90A 4C56C 2FHTA 4DK1A 1SMYC 2NWGA 2Q8IB 4Q5VA 1BCPD 3EA6A 3DEOA 1PRTB 1TIID 4RGMA 2CVRA 2KUMA 2K7VA 1DONA 2KCNA 1EY7A 4IFDI 1ICWA 2XSCA 3BG3A 5CBAE 3M4OB 5D3DA 1G291 2KA7A 3S14B 3ND8A 3SK6A 3MXUA 2NN6H 2EYOA 1WTOA 4WORA 3H0GB 1QG7A 3J80E 2QEJC 3EROA 1YNND 1Y8PB 3KLSA 2NZ1D 3S1QB 3K57A 3NXWA 2FINB 2AWOA 2BCOA 1KAAA 2XRSD 4V190 4BBSB 5NUCA 1ZEQX 5JAVA 3T16A 3BDOA 4L63B 1D1IA 1MGSA 3FVQA 2ZXOA 5E4XA 5CGKA 1TQOA 3K59A 4IUNA 4KTAA 5K5PA 5ELEA 3P20A 2WV6D 5JVG3 2D62A 2NN6G 2ZXPA 2JP1A 1KNEA 4BWGB 2BOSA 1RDPD 1QNUA 4KKUA 1M8AA 3I4LA 1QWYA 1SXTA 1U4RA 1RODA 3IFDA 4C3HG 5CV8A 4ZK9B 2NVYB 2EXZA 5I6YA 4JBWA 4B9WA 1E2WA 1H9SA 1PXUA 2F0FA 3MEHA 1B9NA 5IOCA 1EY4A 1BUVT 3BS1A 2JEAI 1X3QA 3MXPA 3HOZB 5TSSA 1NSNS 1STHA 4UAIA 5EPKA 1NR4A 3Q23A 3A7AB 1HHVA 1Q1EA 3S1MB 3U9SA 3FPPA 2L55A 3C3LA 2BA0A 1G91A 4IUUA 2V4DA 4KKTA 3NQTA 3R2TA 2FMCA 2L0CA 2WINB 1EEID 4DXGA 4G4KA 1A6XA 1WTPA 1AZPA 2JXMB 4K8JA 5DNFA 2EJMA 4ABNA 2EYFA 4HN7A 1X32A 3K6OA 4QCLA 1QNKA 2F0VA 1HA6A 1G6ZA 3RLFA 1CA5A 4B08A 3AMUA 4RGNA 4V0BA 3TZDA 2Z4HA 5M5XB 3PO3B 1F9QA 3A55A 3T56B 2R93B 1I4QA 4O1NA 4HCEA 2KEDA 4ULLA 4DGZA 2PZWA 2F4IA 4G7ZC 5LL6S 4IFDH 1IKLA 1SYFA 4EGVA 1HFGA 4U68A 2O5JC 1DOKA 1TY0A 1NCVA 3E5SA 4F88A 1R4PB 2AQ2B 3H3VC 1JB3A 1SDFA 4EVOA 5BN3A 5D14A 2VB2X 4G7OC 3D3RA 1STAA 4ZQ3A 1W6KA 5CC4A 3I4NB 1MBYA 1EQTA 1VF5C 1UAPA 1BCPF 1STBA 2PO4A 1X3PA 1UUPA 4EQPA 4BA2I 2EY6A 4KK7A 4QUCA 1IL8A 2EYPA 4PV1C 2CHBD 2MJ8A 3HOUB 1TKWB 2L9HA 4X3TA 2WIIB 3VYUA 3BDCA 1D5ZC 3C2PA 3C1FA 4ZAIA 2L12A 3I4MB 3SEBA 4IFDG 1DJRD 1SNCA 2RSNA 2IWHA 4DXFA 3T4AC 3RZDB 2PMZB 4XXEA 3A56A 3BVGA 4FVMA 5A2QL 1V8QA 2B39A 3MA2B 1I4GA 2O5IC 1G2TA 3KBXA 4KJNA 3VYSA 1HTPA 2D2CC 1RTOA 2K28A 1F2ZA 1LV9A 3L3OC 1ENCA 3KF8A 1KTKA 5IGCA 4Z9CB 1BXTA 2ZXRA 4R8IA 2JYOA 3HKZB 1A2UA 1Q3LA 1LT4D 3QG1A 1K83B 1L0YB 1E2VA 4FNFA 2QF7A 4RCNA 1FD7D 3MHBA 3HOXB 2EYHA 5C5LA 1II3A 2R61A 1GUNA 1RHPA 4P2CB 2AWNA 3CQZB 2NVTB 3K0YA 1Q90A 2IJ0A 5ELCA 4HCSA 1ILPA 4F87A 1ENFA 2X6GA 4EQNA 2XVSA 2B63B 1H9SB 1XYIA 1G2SA 2BE5D 3SR1A 2B2WC 3TN2A 4BY7B 4OIJA 2G9DA 3M7NA 1AZQA 1SFOB 2F03A 1LT6D 4ZLTF 2F3WA 4LAAA 1JR0D 1SEBD 1Y69U 2B2YC 1WTXA 1EIGA 1JOOA 4TSSA 2A68D 3TSSA 4RHSA 5IGDA 1Y8NB 2EY1A 4BBRB 4A3GB 4U673 2IX0A 2A6EC 2JA6B 2B2UC 4NMZA 2RSOA 1PRTD 1PZID 2XNAC 3HOYB 1CHQD 3PIO3 4MHEA 1KDCA 1CZGA 1QILA 2NTSA 1UNSA 2KOLA 2VUMB 2JSOA 4A3FB 4ZKCB 1TS4A 5IIFA 4CHTB 5BN4A 1EY0A 4RHRA 3M7GA 2YU9B 4FXDA 1DM0B 4FO2A 1VDZA 1HRJA 1D5XC 2BE5C 4KHVA 1ZKOA 2MP1A 1IKMA 2AQ1B 2AUJD 1S4ZA 1HUMA 3MWYW 1VCIA 5CYUA 5A2QE 1WD1A 2A68C 5I2YA 1C4QA 1I6HB 1LACA 1PFBA 1D2BA 3OHXC 3L9AX 1H9JA 5G3LD 1B9MA 3S17B 1W6JA 5ELBA 2K5DA 3HS0C 1SMYD 1PTOB 3J7AV 4L6TB 1H9KA 1QE6A 3DUZA 3VR3A 3CKIB 2LS01 1PRTC 3OIPA 2XN9C 3VR4A 2F3VA 5K36G 1SNDA 3NE5B 2RQXA 3K5NA 3SK4A 1I4XA 1S5DD 1T5XD 4HEDA 2FJ2A 4IZ8A 2IW3A 1WCMB 5I9OA 3BDLA 1TWFB 3S15B 3OWFA 1F2YA 1O7ZA 2PW5A 4KN7C 2M00A 3DWQA 5FO8B 1DD2A 4KKSA 4M8AA 1ONLA 4IFDJ 3FEWX 1XXGA 3SXHA 3C46A 3UI2A 2OEOA 2I07B 2I46A 1TS2A 3M3YB 1MI2A 3W2DA 3FKIB 4XYOA 4RKBA 2E2IB 3PUWA 3D8GA 2HCCA 4A3JB 2SDFA 2F0WA 1EIHA 5KNCA 2B2VC 5JEAG 4QF4A 3G6JB 2K5QA 1LTBD 1TR5A 1ESFA 4KY6A 1O80A 2D5DA 3CU7A 3DWPA 1ZYRD 4K8IA 2PZTA 1T5EA 5C0XG 3QO2A 3GTGB 1RF2D 1WTVA 1GUGA 3PUZA 5FOBB 4ZYSA 1AFPA 1OXSC 1H9MA 1BO0A 5JPNC 5M9OA 3FRPB 4IUPA 2DY8A 2Z8LA 3D4WA 3K5MA 1GXDC 1BDOA 4X3KA 5KYIA 4ME5A 1KABA 1TWGB 2L5TA 3OOCA 2E75C 4C3JG 1GJXA 1DXMA 4IUVA 2C9OA 2DNCA 1KLGD 5KRUA 2OT2A 1OO9B 3WDNA 1FNWA 4HSPA 2JEBI 4KD3A 1V1PB 4HMIA 2K03A 5ELFA 4TKOB 1Q8IA 2BDNA 2IT1A 4YIJA 3KK7A 3TZUA 4PNYA 1C8CA 1D6EC 5CV7A 2HDMA 1GUSA 2YYZA 2BA1A 1ZYRC 2E2DC 5I2XA 2PQEA 2OXPA 3GO5A 1TS5A 2NVQB 2E2JB 1SBBB 1B2TA 2WKDA 1FGBD 1SYDA 2ICEC 1PRTF 1FR3A 2H4OA 1MD2D 2K01A 1S5ED 2DY7A 2G9HD 5CV5A 3V96A 3EFXD 5C4XB 3CRLC 2Y0SB 5C3WA 1TY2A 1JE4A 1SE2A 5CV4A 2K6AA 2K32A 3X3NA 2EY2A 2LFNA 1AP0A 2F1MA 3SK5A 2Q8TA 1GOZA 1EU3A 4IN3A 1GHKA 2K33A 5BN5A 3AU7A 2AQ3B 1ET6A 3MXNA 1EU4A 4CBVA 1NUCA 1HUNA 5CV9A 1NAPA 1STGA 4BS9A 5IGBA 4Q0FA 2A6HD 4RAUC 3I70A 5C3EB 1LLRD 3TP5A 1BF4A 1GUWA 2MPMA 1ZXTA 2SEBD 2E76C 4M1UB 1ET9A 1SAPA 4RWSC 3MAQA 2C5CA 2KJXA 4ID6A 4WJWA 4PMWA 3BZDB 2KVMA 1RJTA 3LNNA 1AEXA 1MSGA 1HPCA 2B8GA 2R6GA 4KMUC 1EZ6A 1EL0A 4ZKBB 1O7LA 2K05A 5ELDA 3PO2B 5D65A 2F0OA 5KEEA 3PUYA 1CI3M 3WOFA 3URYA 1QJOA 4CJ2C 1IHZA 4H13C 4ZUJA 5EKIA 1PZJD 2F0DA 4DK0A 5I4DA 1IW7D 2O4XA 3HP3A 1VMPA 1HCZA 5JEAJ 2F0GA 1AW7A 3V2TA 2HQEA 2XIWA 5C6AA 4PMBA 3HGBA 1JOKA 2A6HC 3WOEA 2PCFB 4I7ZC 5E3FA 1Y1WB 1G8ZD 2M9VA 3IL8A 3GTQB 3ITPA 3GTOB 1EWCA 1TU2B 2EOTA 3ERQA 3NWSA 3SDZA 3H6MA 4HR7B 1FYCA 2R3ZA 4FF4A 4GZYC 3NK9A 4WRDA 4XT3B 3V05A 1Y1VB 1YNJD 5E4WC 5A35A 3VR6A 4CJ1B 1LABA 1JWSD 3T53B 1LT5D 4XIGS 2H1EA 5HURA 3HG9A 3OIQA 1A3TA 3HOWB 4DAVA 4MIUA 3GTPB 3GTLB 2KCCA 3TP7A 5J22A 1JCKB 1IW7C 1PFNA 5EGTA 2PPBC 2EZVA 3M4YA 2B2TA 2PW7A 2VNUD 4K14A 4A3EB 2JA7B 4DF7A 3BVMA 1DCZA 1SNOA 4KY7A 4K2LA 3MXGA 3Q6SA 3ZYYX 1SSOA 5C0XI 2F0TA 2A6ED 1OXTA 1EY9A 4K5XA 2J4XA 1PTOD 1UEAB 2RBMA 4A3IB 4H44C 3Q24A 1PZKD 5J1ZA 3IFTA 4XYQA 3S2HB 2NVXB 3MFYA 2K5WA 1LTAD 4OGQC 1J8IA 1I50B 3VYRA 2RDGA 1RTNA 1SJED 1WTQA 1S5CD 3NTKA 2F0LA 1CHPD 2MGSA 4H0LC 5KIXA 3J7YW 2KECA 1YNJC 3FPUB 3S9WA 1S5BD 1DYQA 2VB3X 2L1BA 3VR5A 5CBEE 5FLXL 2DN8A 1SNQA 4LJZC 1PYWD 2F0KA 5I9PA 5CMDA 4DA2A 2PZUA 1EYAA 2TSSA 2J0TD 2RA4A 2IL8A 1BNZA 4TQUS 3R3OA 1A3UA 3GV3A 4NW2A 1PTOC 1EFID 3A8JE 2JE6I 1R9TB 4KI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYL A;  1SYF A;  4B9W A;  3HEJ A;  2F0P A;  2F0O A;  4QF4 A;  5KEE A;  3MZ5 A;  1EYC A;  1SNO A;  1SYD A;  3HZX A;  3PMF A;  4RKL A;  5DEH A;  3MHB A;  1JOQ A;  4KHV A;  3EJI A;  4KY7 A;  1JOR A;  4K2L A;  4QMG A;  3E5S A;  1KDA A;  1TR5 A;  2F0F A;  4KV6 A;  1IHZ A;  5ISR A;  4HTH A;  3MEH A;  4B9X A;  4KY6 A;  1A2T A;  2KHS A;  2EYH A;  1II3 A;  5C5L A;  2F0T A;  4EVO A;  3D4D A;  4ZUJ A;  1EY7 A;  1EY5 A;  4S3S A;  5CV5 A;  3NHH A;  5IOC A;  1EY9 A;  4DU9 A;  2F0U A;  2F0D A;  4IAL A;  4K5X A;  1EY4 A;  4QB4 A;  1STA A;  1EYD A;  2O4X A;  4J1M A;  2PZT A;  4K8I A;  5CR3 A;  4ZQ3 A;  2F0J A;  2RBM A;  5C3W A;  5CC4 A;  3T13 A;  3DMU A;  1STY A;  3MXP A;  5CV4 A;  3LX0 A;  4KY5 A;  3NUC A;  4H7B A;  3RUZ A;  1KDB A;  1STB A;  4EQN A;  1SYC A;  2EYJ A;  5E1F A;  3SHL A;  2F0Q A;  2WAC A;  4NDX A;  2F0G A;  4OL7 A;  5CV6 A;  5J1Z A;  2RKS A;  1NSN S;  1STH A;  2EYO A;  4ZUI A;  2EY2 A;  3V2T A;  3SR1 A;  5IGG A;  2HQE A;  2KQ3 A;  1SYG A;  5C6A A;  4EQP A;  5C4H A;  2EY6 A;  4KJO A;  5IGF A;  5M9O A;  4WOR A;  1TT2 A;  3SK5 A;  4PMB A;  2EYP A;  3QB3 A;  4G57 A;  5EKK A;  1JOK A;  2EYM A;  1ENA A;  4N9T A;  3QOJ A;  3D6C A;  3U9O A;  5KYL A;  5HGT A;  3ERO A;  3D4W A;  4HMJ A;  5IGE A;  3BDC A;  3TP8 A;  2F3W A;  4LAA A;  2F0L A;  1EZ8 A;  5E3F A;  2F0E A;  3C1F A;  3NXW A;  3P75 A;  2LKV A;  5F2D A;  1SYB A;  3NQT A;  5DAU A;  5C3X A;  5KIX A;  1JOO A;  5KYI A;  2F3V A;  2SNM A;  3OMG A;  1KAB A;  1NUC A;  4ME5 A;  4E6I A;  5CV9 A;  5C4Z A;  2QDB A;  1SND A;  5IGD A;  1SNC A;  3S9W A;  2EY1 A;  2F0I A;  2PYK A;  3ITP A;  1STG A;  3NP8 A;  3OSO A;  1KAA A;  1SNP A;  3SK4 A;  4K8J A;  1STN A;  4J6H A;  5NUC A;  4N9P A;  3ERQ A;  5IGB A;  2EYF A;  5JAV A;  4IZ8 A;  3P1H A;  1SNQ A;  4TRD A;  5KRU A;  4K5W A;  3T16 A;  5J39 A;  2EY5 A;  2F0M A;  3TP5 A;  4KD3 A;  2F0V A;  2NUC A;  2F0K A;  3BDL A;  5CGK A;  5I9O A;  3H6M A;  1EQV A;  4K6D A;  4HMI A;  2F0N A;  3OWF A;  1TQO A;  3TP6 A;  1F2Y A;  1A3V A;  2PW5 A;  4NMZ A;  5C5M A;  4IUN A;  4KJN A;  2M00 A;  4KTA A;  4EQO A;  5K5P A;  4NKL A;  3NK9 A;  4YIJ A;  3MVV A;  2ENB A;  3QOL A;  4WRD A;  1U9R A;  2PZU A;  4K5V A;  1EY6 A;  4ID6 A;  3SXH A;  1F2Z A;  4K2K A;  1EYA A;  5EKL A;  1KDC A;  4R8N A;  4ODG A;  4I65 A;  1ENC A;  1EY8 A;  4PNY A;  3TME A;  4DFA A;  4NP5 A;  3EVQ A;  1F2M A;  1SNM A;  5CV7 A;  3VA5 A;  1RKN A;  5JOB A;  1AEX A;  2OEO A;  4F7X A;  5HUR A;  2F0H A;  1A3T A;  3R3O A;  4RKB A;  5IOD A;  4MIU A;  1EZ6 A;  2RDF A;  3C1E A;  4DGZ A;  5IGC A;  5KGU A;  1A3U A;  5I9P A;  2PZW A;  1SYE A;  2OF1 A;  3D8G A;  3TP7 A;  5IIF A;  5J22 A;  5EGT A;  2PQE A;  2OXP A;  5I6W A;  1EY0 A;  4F8M A;  3OMC A;  1A2U A;  2PW7 A;  4PMC A;  4K14 A;  4KD4 A;  2F0W A;  3DHQ A;  5CV8 A;  2F0S A;  4DF7 A;  3SK8 A;  2SNS A;  3SK6 A;  2SOB A;  2EXZ A;  5I6Y A; 
#chains in the Genus database with same CATH topology
 3CPW A;  4LFA L;  2F0P A;  3CC4 A;  1EYC A;  2BDO A;  4CKC A;  4C2M B;  3K7U C;  1JOQ A;  1L0X B;  4FXG C;  3M9B A;  3J81 L;  5DM7 3;  4R4I A;  2XWB B;  3TBI B;  4CGY B;  1NTG A;  1QVC A;  4S3S A;  4HAE A;  4JYA L;  3NHH A;  3HOZ H;  1XWE A;  4IAL A;  2XWJ B;  4UP9 A;  1F2L A;  1JWM D;  1CA6 A;  3VA7 A;  3H94 A;  2HDL A;  3CXC A;  1SYC A;  3S1M H;  1GUO A;  5E1F A;  5K36 H;  2X6L A;  5JPM C;  1N8R C;  1E2Z A;  4ZUI A;  1QB5 D;  2OTL A;  3KLS X;  1HZB A;  1J5E Q;  3GDE A;  3L2P A;  2C35 B;  2Y0S G;  1CSQ A;  1VQP A;  1YIT A;  3U9O A;  3D6C A;  5FLM G;  4X66 Q;  3TP8 A;  3DWA A;  2VQF L;  2CW0 C;  2B2T C;  4XT1 B;  1F9P A;  2CQA A;  2OQ0 A;  4DV3 L;  4IQZ A;  3A7L A;  1E3P A;  1SNP A;  1I3Q B;  4A75 A;  5FK9 C;  1FNU A;  4J6H A;  1BBX C;  1WTH A;  4AIM A;  2EPB A;  3W3A A;  4RH6 A;  3ULP A;  1U4L A;  1VQG A;  4XTC S;  1I4H A;  1J9O A;  2MUY A;  5EBC A;  3G7L A;  2RCN A;  5M5X H;  4DV6 Q;  3PO3 H;  3NBI A;  2KEE A;  4GN5 A;  4JBJ A;  5JEA H;  2R93 H;  1WTR A;  1B4O A;  1LTS D;  3IAY A;  5IP9 H;  3N6R A;  4IJH A;  4AQY L;  5C3E G;  4NP5 A;  1JQY D;  3MC0 B;  4LF5 Q;  4PZ6 A;  1UE5 A;  4F7X A;  1LO5 D;  1HXY D;  2F0H A;  1Q1B A;  3KDF A;  3FHW A;  1M4V A;  5C0X H;  1CK1 A;  2N88 A;  4C3I B;  2SNS A;  1RD9 D;  3A54 A;  1GHJ A;  3HZX A;  3PMF A;  4P72 A;  3K8A A;  4IUT A;  1F9S A;  3EJI A;  1IBL Q;  1A2T A;  2KHS A;  1IYJ B;  3I4N H;  2PNH A;  2RVL A;  5T1I A;  2NBF A;  2PNR C;  4GLA C;  1B50 A;  1YNX A;  3MTS A;  3G6E A;  3F1Z A;  1E7Z A;  1VQO A;  1IYU A;  3T13 A;  4HIM A;  1CKO A;  3NUC A;  1XMO L;  3PO3 G;  1VQF A;  5FLX E;  3I91 A;  4J8Q A;  3SHL A;  1K0S A;  2R93 G;  2DGY A;  1G51 A;  3IKJ A;  4ZCK A;  4MTK A;  5IP9 G;  2N55 A;  4RGO S;  1DZ1 A;  1Z7T A;  3AFQ A;  1BBW A;  5EKK A;  4WJ4 A;  1DOL A;  1PH7 A;  5HGT A;  3I4M H;  4BY1 B;  1WJJ A;  1PDQ A;  3PUV A;  1HQM C;  3F2D A;  2A8V A;  2LMC B;  1E0B A;  2Z6K A;  5C3X A;  3RZD H;  3A8K E;  5AFW A;  1O7Y A;  5EBD A;  3NQI A;  4LFC Q;  1PTO F;  4DK6 C;  2QDB A;  4KLK A;  1HNW L;  5LHY 1;  3U4V A;  3LGJ A;  1W2B A;  3S1N B;  3T51 B;  2QCP X;  3A5Z B;  4N9P A;  4K6L A;  4DR6 L;  2JA7 H;  5KNB A;  5E7N A;  5IE8 A;  5AJ3 Q;  5LMU Q;  1Y1W G;  1X3G A;  3S1R B;  1L1O C;  3S2D B;  2F0N A;  3TP6 A;  3J81 E;  2QEX A;  2HCI A;  4NKL A;  4EX5 A;  1U9R A;  3FP9 A;  3KBG A;  4K2K A;  4LFA Q;  4R8N A;  4ODG A;  1LTG D;  3F2U A;  5FKA C;  2NTT A;  4QY7 A;  3OYY A;  1STE A;  5D3I B;  3Q8D A;  4OO1 G;  5ELN A;  1K83 H;  2RDF A;  1KIX A;  4JYA Q;  1HZC A;  3S2H H;  1Y1V G;  4IO9 A;  3T1H L;  1K28 A;  3HOX H;  4X3S A;  1I50 H;  2H5X A;  2EYL A;  3HEJ A;  3MZ5 A;  3Q0A A;  5DEH A;  4KN4 C;  3CQZ H;  2NVT H;  3HOW G;  1F9R A;  3GD7 A;  1U4P A;  3CCS A;  4B9X A;  1K8A C;  3H15 A;  3PF5 A;  2R7Z B;  2JA7 G;  2F0U A;  3DM3 A;  3NTI A;  1CTM A;  2B63 H;  1WTW A;  3J7Z C;  4YCU A;  5FO7 B;  4JOI C;  3BVZ A;  2VQF Q;  3OW7 A;  2YTY A;  1PYB A;  1STY A;  4DUY Q;  4H7B A;  2A73 B;  4PQX A;  4BY7 H;  2EYJ A;  3J81 j;  2WAC A;  1OXU A;  2RKS A;  2D0P A;  5IYC H;  2NZH A;  2ZJP A;  1SFO H;  4MN3 A;  2NB0 A;  1O78 A;  1TT2 A;  3N52 A;  1SRU A;  4LUZ A;  3I72 A;  3PV0 A;  3NPP A;  3R2I A;  3HKZ G;  5JJZ A;  2ID0 A;  1BCP C;  1OXV A;  5IGE A;  2OTJ A;  3HRZ C;  4YY3 L;  4HIK A;  1TWC B;  4IPD A;  1LTR D;  2UXD L;  3P75 A;  4Y52 H;  4BBR H;  3HOX G;  4GS3 A;  3TDQ A;  3RNU A;  1I4P A;  2PYK A;  3B6Y A;  3KLR A;  4ME3 A;  3UDF A;  4JI7 L;  1VQ5 A;  2QDL A;  2JA6 H;  2QKI C;  2JA5 B;  4AQY Q;  3CHB D;  3P1H A;  2VZA A;  4ILW A;  1GUT A;  4DAP A;  4R9W A;  1IBK Q;  4K5W A;  3RMH A;  1WD0 A;  3HOY H;  1PH1 A;  2F0M A;  5EPJ A;  2I0Q A;  3GV6 A;  3CCQ A;  1LTT D;  4UDU C;  1VMC A;  1A3V A;  5C5M A;  4OWW B;  4BA1 I;  2EJF C;  4A3L G;  4LMQ D;  3H09 A;  4XQJ A;  5JJK A;  1BOS A;  3S16 B;  4BY7 G;  4HJ8 A;  1XPU A;  1BQQ T;  2VUM H;  1ESR A;  5EKL A;  4A3F H;  3VYT A;  4I65 A;  5IYC G;  3D4R A;  1F2M A;  1FGU A;  2WKC A;  3E6Z X;  1VQC A;  1TVX A;  3A5U A;  1LM0 A;  4JK1 C;  2YU9 H;  1YNN C;  1CZW A;  5IP7 H;  3ONA B;  4FP5 D;  5G3L F;  4CDD C;  1NR2 A;  2A74 C;  4F8M A;  3LWE A;  3DEP A;  4OWX B;  4PMC A;  3K7A B;  5LL6 X;  3SK8 A;  5M5W B;  1KRT A;  3Q22 A;  2EVB A;  4X65 L;  3MEF A;  5BR8 L;  4HTH A;  4R4O A;  1X56 A;  2CFM A;  1JJG A;  3PIP 3;  5C4J B;  1Z6H A;  1BCP B;  4LF4 L;  3KDF B;  2CWP A;  1R4Q B;  1Y8O B;  3HOY G;  2UXB Q;  4C1N I;  1I6H H;  4J1M A;  4UP7 A;  3DMU A;  1PMR A;  3DM1 A;  4UY8 C;  3CPF A;  4YWL A;  5IT9 L;  4NDX A;  4OL7 A;  2ICI A;  2VUM G;  3D6W A;  1HNW Q;  2M2L A;  4XQN A;  1PTO H;  4A3B B;  1EWH A;  1V43 A;  5DLQ E;  3JAM L;  3QB3 A;  4G57 A;  2UXC L;  1N36 L;  4N9T A;  2EYM A;  1ENA A;  2CKZ B;  1XPR A;  1I4R A;  4LF9 L;  1CFM A;  2R7F A;  3I73 A;  3R93 A;  1JWU D;  4JI6 L;  4L5S A;  5IP7 G;  1JMC A;  1C48 A;  3CC7 A;  1XX8 A;  3NWT A;  2LKV A;  5DAU A;  4FF3 A;  3M85 A;  1SJH D;  1SE4 A;  1HQR D;  2NYZ D;  4CJ0 B;  1H9R A;  4E6I A;  2A5H A;  1Z47 A;  1X3F A;  2B2W A;  1WCM H;  3GTJ B;  4WFN 3;  1STN A;  1TWF H;  3S15 H;  1D1K A;  5C44 B;  3RZO B;  1GO3 E;  1VQM A;  1XNQ L;  2CH4 A;  1EOV A;  3KFU A;  5J39 A;  2ZTC A;  4DAY A;  3QWN A;  1EQV A;  3NSW A;  3AB9 A;  4DR2 L;  2B2Y A;  1HZ9 A;  5C0X J;  2VL6 A;  2FMM A;  1KL9 A;  3A0J A;  4UP8 A;  1EY6 A;  3M3Y H;  3ND9 A;  1HNZ L;  5EPL A;  4LUO A;  2Q2H A;  2HD3 A;  2E2I H;  1KRS A;  4DFA A;  4QJF A;  3FMC A;  4A3J H;  4RCO A;  1AN8 A;  3VA5 A;  1RKN A;  2WB1 E;  1FNV A;  3P7J A;  4LK1 C;  2XRQ D;  3LWU A;  1WVL A;  1SYE A;  2R7D A;  1JIC A;  2B2U A;  1M90 C;  5I6W A;  4FF2 A;  1DGS A;  2F0S A;  2L15 A;  2DNE A;  1MJC A;  2K5V A;  4RKL A;  5EQ0 A;  2A1A A;  3JC6 6;  1KDA A;  4KV6 A;  1WCM G;  5ISR A;  3RD4 A;  3ICE A;  4B3M Q;  2EJG C;  2EXD A;  4CKB A;  2Z4I A;  1BKB A;  3OPO A;  4C3J B;  1EY5 A;  2UUC L;  3GTG H;  3I8Z A;  4C3I G;  3J81 i;  4L5Q A;  2MNA A;  3PIP A;  4YY3 Q;  5CR3 A;  1PH3 A;  2MHV A;  4OIK A;  2F0J A;  1PH4 A;  1A15 A;  2UXD Q;  1TWH B;  3I3C A;  2Z1C A;  3LX0 A;  1CM9 A;  4JPB W;  1VQ4 A;  1FJG L;  2K04 A;  3R8B A;  4IUR A;  4HJA A;  2E74 C;  4HIO A;  3VR2 A;  3NEL A;  3K5O A;  2WB1 B;  4DN4 M;  2K1B A;  4QIW B;  1GM5 A;  4DAM A;  1HTL D;  1I6V C;  4LF6 L;  3TS2 A;  2GN5 A;  1TWG H;  1NBW A;  5F2D A;  4DNR B;  1BVS A;  3PUX A;  3GP7 A;  2I5L X;  3OMG A;  5C4Z A;  4DV2 L;  3FDT A;  4GNX C;  5J3B A;  1ICF B;  3DLL A;  2Q2U A;  3BYY B;  5JJL A;  1K9M C;  3D31 A;  1KNA A;  2F4V L;  1JJC B;  3E0J A;  2YTV A;  3L7Z C;  4GKK L;  4TRD A;  3J7A F;  4O42 A;  1SR3 A;  5FJ8 H;  4C1N K;  3CMA A;  1HR0 L;  2FFK B;  4LF8 L;  4X64 L;  2DJG C;  1KD1 C;  4A3M B;  2RDH A;  4EQO A;  5M5Y B;  1A63 A;  1U4M A;  3H91 A;  3MVV A;  1EOT A;  1V1O A;  4FYD A;  4QUF A;  5M3F B;  4OO1 I;  1PV4 A;  4A93 B;  1KHI A;  5COR A;  4C3H B;  1HA5 A;  1EY8 A;  1FVI A;  3TME A;  1IYV A;  1K8O A;  5BR8 Q;  1S3O A;  1UEB A;  4R4C A;  3QIA A;  3EBE A;  2NVQ H;  2E2J H;  3GTM B;  5IT9 E;  2BH2 A;  5IOD A;  4JI2 L;  4DPG A;  3I4O A;  5KGU A;  1QVG A;  2OF1 A;  3EQL C;  2GVA A;  1MSH A;  1CQF A;  2CW0 D;  3OMC A;  4TVA B;  1F77 A;  2IPK D;  4KD4 A;  3JAM E;  2SOB A;  2QGQ A;  1I94 L;  2F52 A;  3W1B A;  3U58 A;  2HUG A;  3A74 A;  1GD7 A;  3PF4 A;  4XQQ A;  2IX3 A;  5C4X H;  4GOP A;  4DV7 L;  4G7H C;  2LY7 A;  3GQB A;  5FLM H;  2UXC Q;  4DU9 A;  3G71 A;  1N36 Q;  5HY6 A;  4QB4 A;  1K8M A;  4LWC A;  3RLO A;  4LF9 Q;  5IYD H;  1EYD A;  4JI6 Q;  1V1P A;  2KCT A;  1EEF D;  1KDB A;  2B2V A;  2F0Q A;  5COY A;  2QIL A;  3KF6 A;  4B3T L;  3SVM A;  1XNR L;  2R7Z G;  2JA8 B;  3QJY A;  2KQ3 A;  1SYG A;  5C4H A;  1K73 C;  4R1J A;  1WI5 A;  4XDX A;  2MQH A;  4A3D B;  1B1Z A;  3QOJ A;  3X3M A;  1CQV A;  5KYL A;  1CUK A;  5HGQ A;  4HMJ A;  5LMN W;  2NN6 I;  2K5N A;  4AYB E;  1EZ8 A;  2F0E A;  4RA8 A;  4DR2 Q;  2ZJR A;  2A69 D;  5KND A;  1PVO A;  1VF7 A;  2SNM A;  1JC7 A;  4OHJ A;  1N33 L;  2F0I A;  2VXW A;  2N3S A;  3E0E A;  1HNZ Q;  5C3E H;  4LW1 A;  2K75 A;  3ZJY C;  4A3K B;  3K5L A;  4RFB A;  1B44 D;  1TWA B;  1RCV D;  3I55 A;  5C4X G;  4HSV A;  1VQJ A;  1XTC D;  4BXX G;  3OWE B;  3AYH B;  1SE3 A;  5IYD G;  2KHI A;  4JI1 L;  1YHA A;  3J80 L;  4P73 A;  2ENB A;  3QOL A;  2HIV A;  2Z0S A;  3RR5 A;  2ZT9 C;  2JA5 G;  1Q46 A;  1YBY A;  3UE1 A;  1PH5 A;  4FF1 A;  4A76 A;  5T1G A;  5GAD C;  1SNM A;  3A8I E;  4MTN A;  5JOB A;  2AUK A;  4L8J A;  4ZRZ A;  2B8F A;  3F2B A;  1UE7 A;  4IPH A;  3PO2 H;  2WAQ E;  3BZC A;  4DAY B;  2VY3 A;  3C1E A;  1KC8 C;  4X3U A;  4AYB B;  3CRK C;  3NTH A;  3SE0 A;  1YJ9 A;  3HOV B;  3DHQ A;  4N8F A;  5M3M B;  3K58 A;  1X9N A;  2EY5 A;  2GA4 B;  5IYB G;  1O7I A;  5DM6 3;  5EJW A;  4RGT A;  1FJG Q;  1ILQ A;  4DNT B;  1JOR A;  4QMG A;  3KUP A;  1A62 A;  1TS3 A;  4NPS A;  1B53 A;  3NBH A;  1YJN A;  3D4D A;  2Q8R E;  3OTO L;  2AHO B;  3BYT B;  3STB D;  1W3S A;  4LF6 Q;  4HID A;  4QL5 A;  3MFG A;  3RUZ A;  2VS1 A;  4KY5 A;  2A69 C;  2D9U A;  3IRB A;  5CV6 A;  1ML0 D;  5IGG A;  4JV5 Q;  1LT3 D;  1QCB D;  5IGF A;  3GTK B;  4KJO A;  1LTI D;  2Q2I A;  4NB3 A;  2PI2 A;  4RMF A;  2XTI A;  1GVP A;  4LNQ A;  2F4V Q;  3CD6 A;  4GKK Q;  2O2L D;  1Y1W H;  2WAQ B;  1DOM A;  3PO2 G;  2K5H A;  2XGT A;  2EDG A;  4LF8 Q;  2WP8 J;  1QUQ A;  4X64 Q;  3PSI A;  3GTQ H;  2HHH L;  1B3A A;  4KHZ A;  3GTO H;  1SYB A;  4A3B G;  1CT1 D;  2EE1 A;  2UUB L;  3NP8 A;  3DXJ C;  3OSO A;  1OXX K;  1D5M C;  2X69 A;  4FXK C;  2KBN A;  2L11 A;  3CW2 C;  5FO9 B;  4OO1 H;  2IX1 A;  1PLF A;  3T1Y L;  4Y7N B;  1KLU D;  5JVH 3;  4CDC C;  3O13 A;  4R4T A;  4JI2 Q;  2NUC A;  4CKE A;  1HFN A;  4IUQ A;  1Y1V H;  1U0L A;  4K6D A;  1PFM A;  1BR9 A;  4DR5 L;  1S5F D;  2L4N A;  4JCV E;  4JI0 Q;  1N32 L;  1SLJ A;  4GLV B;  1Q12 A;  4K5V A;  5C44 G;  3HOW H;  1QOH A;  2J7Z A;  3GTP H;  2TMP A;  3GTL H;  2E2H B;  2R92 B;  3EVQ A;  1PFS A;  3CCR A;  3I90 A;  1NE3 A;  4DR3 L;  4C56 C;  2JK8 A;  2FHT A;  4DK1 A;  4DV7 Q;  4A3E H;  1SMY C;  2NWG A;  2Q8I B;  4Q5V A;  1BCP D;  3EA6 A;  3DEO A;  3STB C;  1PRT B;  1TII D;  4JI3 L;  2WFW A;  4RGM A;  4GN4 B;  2CVR A;  1X54 A;  1LYL A;  2JA9 A;  2KUM A;  1VQD A;  2K7V A;  1DON A;  2HQL A;  1EYG A;  1XNR Q;  1B7Y B;  4A3I H;  3CME A;  2B3G A;  2KCN A;  4LF7 L;  1EY7 A;  4O2D A;  4IFD I;  1OTC A;  1ICW A;  2XSC A;  3BG3 A;  5CBA E;  2NVX H;  1HJP A;  3M4O B;  5D3D A;  1CKM A;  1G29 1;  2KA7 A;  2EIF A;  3S14 B;  2MFI A;  3ND8 A;  3SK6 A;  3MXU A;  2NN6 H;  2EYO A;  4LFB L;  1QVF A;  1WTO A;  4DK3 C;  4A3M H;  4QGU A;  4WOR A;  1Q8K A;  1IZ6 A;  3H0G B;  4K0K L;  1QG7 A;  3J80 E;  2QEJ C;  3ERO A;  4YCV A;  1YNN D;  1Y8P B;  4A3E G;  4DV1 L;  3KLS A;  2NZ1 D;  3JAM i;  3S1Q B;  3K57 A;  4A3L H;  1UE1 A;  3NXW A;  2FIN B;  1SE8 A;  4DV3 Q;  3KF6 B;  1QZH A;  2WB1 G;  2ZM6 L;  2AWO A;  2BCO A;  2Q2T A;  1KAA A;  2XRS D;  4V19 0;  4BBS B;  2A19 A;  5NUC A;  3W5O A;  1ZEQ X;  5JAV A;  4A3I G;  1PH2 A;  3T16 A;  3BDO A;  4L63 B;  1D1I A;  3CC2 A;  1MGS A;  3FVQ A;  1NNX A;  2ZXO A;  1B8A A;  1WFQ A;  1TQO A;  5E4X A;  5CGK A;  1HNX L;  3K59 A;  4IUN A;  4KTA A;  4JI5 L;  1SRO A;  5K5P A;  5ELE A;  3P20 A;  2WV6 D;  1E22 A;  5JVG 3;  2D62 A;  2NN6 G;  3K81 C;  2ZXP A;  1UWV A;  1T9H A;  2JP1 A;  1B70 B;  1KNE A;  4BWG B;  2BOS A;  3K0X A;  2QW7 A;  4A3M G;  1RDP D;  4OX9 L;  1QNU A;  4KKU A;  1M8A A;  3CCL A;  1LUZ A;  1R9T H;  3I4L A;  1QWY A;  3OTO Q;  1SXT A;  4EQ5 A;  5M3F G;  1U4R A;  4A93 G;  1ROD A;  4C2M H;  3IFD A;  4C3H G;  5CV8 A;  2E8G A;  4ZK9 B;  1RL2 A;  2NVY B;  2VQE L;  2EXZ A;  5I6Y A;  1B3Q A;  1IXR A;  4JBW A;  4B9W A;  3KJP A;  3KOJ A;  1E2W A;  1H9S A;  2RCF A;  1PXU A;  2PI2 E;  2F0F A;  1P16 A;  2PQA A;  1PH9 A;  3MEH A;  1B9N A;  4PG3 A;  5IOC A;  1EY4 A;  1BUV T;  3BS1 A;  1VQK A;  2JEA I;  1X3Q A;  3MXP A;  2Z6K C;  3HOZ B;  2RHQ B;  5TSS A;  1XMO Q;  1NSN S;  1STH A;  4UAI A;  2RHS B;  5GQO A;  5EPK A;  2K4K A;  1NR4 A;  3Q23 A;  3A7A B;  2UUB Q;  1HHV A;  1Q1E A;  3S1M B;  4JBK A;  3U9S A;  2NZO A;  3FPP A;  2L55 A;  3C3L A;  2BA0 A;  1G91 A;  4UPA A;  2ZJQ A;  4IUU A;  1PHJ A;  3I7F A;  2V4D A;  1YIJ A;  2AMC B;  4KKT A;  2JA8 G;  2K52 A;  3NQT A;  3R2T A;  1I3Q H;  2FMC A;  2L0C A;  2WIN B;  3D0F A;  1EEI D;  4DXG A;  4G4K A;  1A6X A;  1WYD A;  4A3D G;  1WTP A;  3G4S A;  1AZP A;  2JXM B;  4K8J A;  5DNF A;  2EJM A;  4ABN A;  2EYF A;  4HN7 A;  1X32 A;  4DR3 Q;  3K6O A;  5LMN L;  2FXQ A;  4QCL A;  4DR6 Q;  1ASZ A;  1QNK A;  2F0V A;  1HA6 A;  1EIY B;  1SMX A;  4H02 A;  1JT8 A;  4A3K G;  1EQQ A;  1G6Z A;  3RLF A;  1CA5 A;  4B08 A;  3AMU A;  3E9I A;  4B3R L;  4RGN A;  4V0B A;  3TZD A;  2Z4H A;  5M5X B;  3PO3 B;  1F9Q A;  3A55 A;  3T56 B;  3NEM A;  3AFP A;  2R93 B;  1I4Q A;  4DKA C;  4O1N A;  4HCE A;  2G5D A;  2KED A;  4ULL A;  4C3I H;  4DGZ A;  1VQA A;  4LF7 Q;  2PZW A;  3TQY A;  1MJE A;  2F4I A;  4G7Z C;  5LL6 S;  3S24 A;  3T1H Q;  1L0W A;  4IFD H;  1S72 A;  1Z9F A;  1IKL A;  1SYF A;  4EGV A;  1HFG A;  4U68 A;  1IL2 A;  2O5J C;  1DOK A;  4GN3 B;  1KQS A;  1TY0 A;  4LFB Q;  1NCV A;  3E5S A;  4F88 A;  1R4P B;  2AQ2 B;  2PMZ E;  3H3V C;  1JB3 A;  4AYB G;  1SDF A;  4EVO A;  5BN3 A;  4K0K Q;  5D14 A;  2VB2 X;  4YHH L;  3HOV G;  5M3M G;  4G7O C;  3D3R A;  1VQ9 A;  1STA A;  4DV1 Q;  4ZQ3 A;  1W6K A;  1H95 A;  5CC4 A;  3I4N B;  1MBY A;  1EQT A;  1VF5 C;  1UAP A;  1BCP F;  1STB A;  2PO4 A;  1V9P A;  4DUZ L;  1X3P A;  2JJQ A;  4UHV A;  2ZM6 Q;  1UUP A;  4BY1 H;  4EQP A;  4BA2 I;  2EY6 A;  4KK7 A;  4QUC A;  1IL8 A;  2EYP A;  4PV1 C;  2CHB D;  2MJ8 A;  3HOU B;  1TKW B;  2L9H A;  3I56 A;  4X3T A;  2WII B;  3VYU A;  1G6P A;  3BDC A;  4N8X 1;  1D5Z C;  2UU9 L;  3HKZ E;  3C2P A;  3C1F A;  1VQ8 A;  2E2H H;  1HNX Q;  4ZAI A;  3S1N H;  2L12 A;  3I4M B;  2KEN A;  3SEB A;  4IFD G;  1DJR D;  1SNC A;  2RSN A;  1E1T A;  4MNO A;  2IWH A;  4DXF A;  3T4A C;  2WAQ G;  3CAM A;  3RZD B;  2PMZ B;  3S1R H;  4XXE A;  3A56 A;  2N8N A;  3S2D H;  3EIV A;  3BVG A;  4JI7 Q;  4FVM A;  5A2Q L;  4JC0 A;  2I5H A;  4JBM A;  4OX9 Q;  1V8Q A;  2B39 A;  4JG2 A;  3MA2 B;  1I4G A;  2O5I C;  3VDY A;  1G2T A;  3KBX A;  4KJN A;  3VYS A;  4CDF C;  3G48 A;  4IJL A;  1HTP A;  2VQE Q;  4PZ8 A;  2D2C C;  1RTO A;  2K28 A;  1F2Z A;  1LV9 A;  4DV0 L;  4O0A A;  3L3O C;  1ENC A;  5FLX c;  4LF5 L;  3KF8 A;  3J80 i;  4BY1 G;  1VQN A;  3CCU A;  4DNI A;  4A4I A;  5EAY A;  2B29 A;  1KTK A;  5IGC A;  4Z9C B;  1BXT A;  2ZXR A;  4R8I A;  2ES2 A;  2JYO A;  3TEH B;  1X65 A;  1X55 A;  3HKZ B;  1A2U A;  1Q3L A;  1LT4 D;  3QG1 A;  1K83 B;  1L0Y B;  1E2V A;  4FNF A;  2R92 G;  2QF7 A;  1Q82 C;  2DJF C;  1FL0 A;  2R7Z H;  4RCN A;  1FD7 D;  3MHB A;  4X65 Q;  2KHJ A;  3HOX B;  1IBM L;  4OWT B;  2EYH A;  1II3 A;  2R61 A;  5C5L A;  1GUN A;  1RHP A;  4P2C B;  4I7A A;  1PH6 A;  2AWN A;  3CQZ B;  2NVT B;  3K0Y A;  4LF4 Q;  1Q90 A;  2IJ0 A;  5ELC A;  4HCS A;  1ILP A;  4F87 A;  1ENF A;  4BBS H;  2MO0 A;  2X6G A;  4EQN A;  2XVS A;  3J81 c;  2B63 B;  1H9S B;  1XYI A;  1G2S A;  2BE5 D;  3SR1 A;  2B2W C;  2PQA B;  3TN2 A;  3ULJ A;  4BY7 B;  1TWC H;  4OIJ A;  2G9D A;  3M7N A;  1PYS B;  1M1K C;  1SFO B;  3UDI A;  1AZQ A;  1LT6 D;  2F03 A;  4BXX H;  1CKN A;  4DR7 L;  1PA6 A;  4ZLT F;  4HJ9 A;  1I5F A;  2F3W A;  4LAA A;  1JR0 D;  1SEB D;  1Y69 U;  2B2Y C;  1WTX A;  3M4Q A;  1EIG A;  1JOO A;  4TSS A;  1A8V A;  2JA5 H;  2A68 D;  3BJU A;  3TSS A;  4RHS A;  1E1O A;  5IGD A;  4B3R Q;  1Y8N B;  2EY1 A;  2Z9H A;  1N34 L;  4BBR B;  3L0O A;  3H3V I;  4A3G B;  4U67 3;  5AJ3 L;  2IX0 A;  1YHB A;  5LMU L;  2A6E C;  1XJV A;  4DR4 L;  1JB7 A;  4JI8 L;  5H1S E;  1XNQ Q;  3S16 H;  2JA6 B;  2B2U C;  3PQI A;  4NMZ A;  2RSO A;  1PRT D;  1PZI D;  2XNA C;  3HOY B;  1CHQ D;  5IYB H;  4BBS G;  2HT1 A;  3PIO 3;  4MHE A;  1UE6 A;  1KDC A;  3SGI A;  4ALP A;  1CZG A;  1QIL A;  4JW0 A;  4NXM L;  1NJI C;  4GKJ L;  2NTS A;  1UNS A;  2KOL A;  2VUM B;  3K7A H;  2JSO A;  4A3F B;  2QA4 A;  5M5W H;  4ZKC B;  4YHH Q;  1TS4 A;  2CCZ A;  5IIF A;  4CHT B;  1L1O A;  5BN4 A;  4OON A;  1EY0 A;  4RHR A;  3M7G A;  2YU9 B;  2EQS A;  4FXD A;  1DM0 B;  4FO2 A;  1VDZ A;  1K8G A;  5C4J H;  4DUZ Q;  1HRJ A;  1D5X C;  2BE5 C;  4KHV A;  2ASB A;  1ZKO A;  1L2F A;  1VQ6 A;  2MP1 A;  3CCM A;  1IKM A;  4X6A H;  2AQ1 B;  2AUJ D;  1S4Z A;  2UUC Q;  1HUM A;  3EN2 A;  4JI4 L;  1VQI A;  2RF4 A;  3MWY W;  2D0O A;  4DUY L;  4IOC A;  3QR8 A;  4R4Q A;  2UU9 Q;  2CH4 W;  1VCI A;  4A3B H;  5CYU A;  5A2Q E;  3F2C A;  4IPG A;  1WD1 A;  2A68 C;  5I2Y A;  1C4Q A;  1I6H B;  1LAC A;  1PFB A;  1D2B A;  3OHX C;  3I2Z A;  3UE0 A;  3L9A X;  1H9J A;  5G3L D;  1B9M A;  3S17 B;  1W6J A;  5ELB A;  2K5D A;  3HS0 C;  1EUJ A;  1SMY D;  3HOZ G;  1PTO B;  3J7A V;  4L6T B;  4JOI A;  2MO1 A;  1H9K A;  1QE6 A;  3DUZ A;  3GTJ H;  3VR3 A;  3CKI B;  2LS0 1;  1PRT C;  3OIP A;  2XN9 C;  3VR4 A;  2UUA L;  5C44 H;  3RZO H;  2F3V A;  3CCV A;  5K36 G;  1SND A;  3NE5 B;  2RQX A;  3K5N A;  4DV2 Q;  4DV0 Q;  3SK4 A;  1I4X A;  1S5D D;  1T5X D;  4HED A;  2FJ2 A;  1IBK L;  4IZ8 A;  4X62 L;  2IW3 A;  1WCM B;  1C7Y A;  5I9O A;  3BDL A;  1TWF B;  3S15 B;  1HR0 Q;  3KLW A;  3OWF A;  1Q81 C;  5ELO A;  1F2Y A;  1O7Z A;  2PW5 A;  4KN7 C;  2M00 A;  3DWQ A;  5FO8 B;  1DD2 A;  1KAW A;  4KKS A;  4M8A A;  1ONL A;  4IFD J;  3FEW X;  1XXG A;  3SXH A;  3C46 A;  3UI2 A;  3BU2 A;  1PH8 A;  3WWV A;  4HJ7 A;  3TS0 A;  1VQL A;  1K0R A;  2OEO A;  3PIO A;  4GOP C;  2I07 B;  2I46 A;  4P75 A;  4QQB X;  1TS2 A;  3M3Y B;  1IBM Q;  1MI2 A;  3W2D A;  3AQQ A;  3FKI B;  4RKB A;  4XYO A;  2E2I B;  3PUW A;  3D8G A;  2HCC A;  4A3J B;  2SDF A;  1LTL A;  2OCE A;  2F0W A;  3UDX A;  1EIH A;  5KNC A;  2B2V C;  1AE3 A;  5JEA G;  3HOU H;  4QF4 A;  4C3J H;  3KF8 B;  1WOC A;  1I94 Q;  3G6J B;  2K5Q A;  1LTB D;  1TR5 A;  1ESF A;  3ULL A;  2VW9 A;  4KY6 A;  1O80 A;  2ATW A;  1TWH H;  2D5D A;  3CU7 A;  2UXB L;  1HR0 W;  3DWP A;  1ZYR D;  3U4Z A;  4DR7 Q;  4K8I A;  2PZT A;  1T5E A;  2V1C C;  5C0X G;  3QO2 A;  3GTG B;  1SN8 A;  1RF2 D;  1WTV A;  1GUG A;  3PUZ A;  5FOB B;  4DR1 L;  4ZYS A;  1AFP A;  1OXS C;  1H9M A;  2N78 A;  3KJO A;  1BO0 A;  5JPN C;  5M9O A;  4B3T Q;  3FRP B;  1HZA A;  4IUP A;  5GAH C;  1N34 Q;  2DY8 A;  2Z8L A;  3I4N G;  2KCM A;  4DR4 Q;  3D4W A;  1VQE A;  3K5M A;  1GXD C;  4JI8 Q;  3H3V H;  1BDO A;  4X3K A;  2K50 A;  4KHP L;  1YI2 A;  5KYI A;  4ME5 A;  1KAB A;  2OQK A;  1TWG B;  3HOU G;  2L5T A;  3OOC A;  4POF A;  1N33 Q;  2E75 C;  4C3J G;  5GAG C;  1YEZ A;  1GJX A;  4GOP B;  1DXM A;  4IUV A;  2C9O A;  4NXM Q;  2DNC A;  4GKJ Q;  5M5Y H;  1CKN B;  1KLG D;  5KRU A;  2OT2 A;  1OO9 B;  2K14 A;  3WDN A;  1FNW A;  4HSP A;  2JEB I;  4KD3 A;  4JVZ A;  1V1P B;  3I4M G;  5M3F H;  3PGZ A;  4A93 H;  2Y0S E;  4HMI A;  2K03 A;  4C3H H;  5ELF A;  1D7Q A;  4TKO B;  4AH6 A;  1Q8I A;  2BDN A;  2CWA A;  2IT1 A;  4YIJ A;  2IY5 B;  4JI1 Q;  1P8L A;  1EIF A;  3KK7 A;  3TZU A;  3GTM H;  4PNY A;  1C8C A;  1D6E C;  1N9W A;  5CV7 A;  1QZG A;  2HDM A;  1GUS A;  2YV5 A;  2YYZ A;  2BA1 A;  1MIU A;  1ZYR C;  2E2D C;  5I2X A;  2PQE A;  2OXP A;  3GO5 A;  4JI4 Q;  1NMG A;  2E5L L;  1CSP A;  1TS5 A;  3M4P A;  2NVQ B;  2E2J B;  1SBB B;  1B2T A;  1MHW C;  2JQO A;  2WKD A;  2OWO A;  1Q7Y C;  1FGB D;  1BBU A;  1V1Q A;  1SYD A;  2N49 A;  4WJ3 M;  2ICE C;  1PRT F;  1FR3 A;  2F3I A;  2H4O A;  4B3M L;  1MD2 D;  2K01 A;  1S5E D;  2DY7 A;  3NEN A;  3OW2 A;  2G9H D;  5CV5 A;  3V96 A;  4DV5 L;  1L1O B;  3EFX D;  2LXK A;  5C4X B;  3CRL C;  2Y0S B;  4NXN L;  5C3W A;  5GAE C;  1TY2 A;  2JA8 H;  1JE4 A;  3UDG A;  1SE2 A;  4YCW A;  5CV4 A;  1S40 A;  3F8T A;  4A3G H;  1VQH A;  2UUA Q;  2K6A A;  2K32 A;  3X3N A;  4A3D H;  2EY2 A;  2LFN A;  3RN5 A;  1AP0 A;  2F1M A;  4L5T A;  3SK5 A;  1EWI A;  4B3S L;  2Q8T A;  2HIX A;  1GOZ A;  1YHQ A;  4X62 Q;  1EU3 A;  1K3R A;  4IN3 A;  1GHK A;  5IY0 A;  2GVB A;  3E3X A;  1AE2 A;  4MZ9 A;  2B63 G;  2K33 A;  5IT9 c;  5BN5 A;  5IWA Q;  1X3E A;  1ASY A;  3AU7 A;  2AQ3 B;  4A3K H;  1ET6 A;  3MXN A;  2HHH Q;  1EU4 A;  2IHE A;  1TWA H;  4CBV A;  1NUC A;  1HUN A;  1Y14 B;  5CV9 A;  5L37 A;  1NAP A;  3JAM c;  3E9H A;  1STG A;  2IHF A;  3RN2 A;  4HJ5 A;  3NBH B;  3ER0 A;  4BS9 A;  5IGB A;  4OEL B;  4Q0F A;  1RIP A;  2A6H D;  2P5Z X;  4RAU C;  3I70 A;  5C3E B;  3T1Y Q;  1LLR D;  3TP5 A;  1BF4 A;  1GUW A;  2MPM A;  1ZXT A;  2SEB D;  2E76 C;  4M1U B;  1ET9 A;  1SAP A;  1XMQ L;  4L5R C;  4RWS C;  3MAQ A;  4DR5 Q;  4BBR G;  2C5C A;  1N32 Q;  2AKW B;  4A3G G;  2KJX A;  4ID6 A;  4WJW A;  4GNX A;  4PMW A;  3BZD B;  3KYH C;  1TXY A;  2KVM A;  1RJT A;  3LNN A;  2JA6 G;  1AEX A;  1MSG A;  2DUD A;  1HPC A;  2JN4 A;  2B8G A;  2R6G A;  3HOV H;  5M3M H;  1Q86 C;  4KMU C;  1EZ6 A;  1EL0 A;  1D8L A;  1QUQ B;  4ZKB B;  1O7L A;  2K05 A;  5ELD A;  3PO2 B;  4JI3 Q;  2LXJ A;  3S17 H;  5D65 A;  2F0O A;  5KEE A;  3PUY A;  1CI3 M;  3WOF A;  3URY A;  1EQR A;  1QJO A;  4A3F G;  4P71 A;  2LSS A;  4DR1 Q;  4CJ2 C;  1IHZ A;  1VQ7 A;  4H13 C;  4ZUJ A;  5EKI A;  4DV4 L;  1PZJ D;  2F0D A;  4DK0 A;  5I4D A;  1J6Q A;  1IW7 D;  2O4X A;  3HP3 A;  1VMP A;  1HCZ A;  3GTK H;  5IWA L;  5JEA J;  4KHP Q;  3J7A 5;  3CCJ A;  2F0G A;  4RG1 A;  1AW7 A;  3V2T A;  2HQE A;  2XIW A;  4PZ7 A;  5C6A A;  3BZK A;  4PMB A;  3HGB A;  1JOK A;  2A6H C;  4POG A;  3WOE A;  2PCF B;  4OEM B;  4I7Z C;  3PCO B;  1GKH A;  5E3F A;  2ALY B;  4OXP A;  1XTD A;  2ZTD A;  1HH2 P;  1Y1W B;  1G8Z D;  3HFZ B;  2M9V A;  3IL8 A;  3FKI H;  4GLX A;  2I5M X;  4Y7N H;  3ITP A;  1J5E L;  3GTQ B;  3GTO B;  1EWC A;  1TU2 B;  2EOT A;  3ERQ A;  3NWS A;  3SDZ A;  5GRO A;  4QIW E;  1VS0 A;  3CCE A;  4X66 L;  1U5K A;  3H6M A;  4HR7 B;  1FYC A;  2R3Z A;  4FF4 A;  2E5L Q;  1YJW A;  4GZY C;  3NK9 A;  2R92 H;  4WRD A;  4JI5 Q;  4XT3 B;  3V05 A;  1Y1V B;  1YNJ D;  5E4W C;  5A35 A;  3VR6 A;  4CJ1 B;  1LAB A;  3K80 C;  1JWS D;  1MKH A;  4J15 A;  3T53 B;  5JJI A;  1LT5 D;  2CQO A;  1X6O A;  4XIG S;  2H1E A;  5HUR A;  3HG9 A;  3OIQ A;  1A3T A;  3HOW B;  4DAV A;  4MIU A;  3GTP B;  1NY4 A;  4DV5 Q;  3GTL B;  2KCC A;  3TP7 A;  5J22 A;  1JCK B;  1IW7 C;  1PFN A;  5EGT A;  2PPB C;  4DV6 L;  2EZV A;  3M4Y A;  2B2T A;  4CDE C;  4NXN Q;  2PW7 A;  2VNU D;  4K14 A;  4A3E B;  3RLN A;  4DF7 A;  2JA7 B;  3BVM A;  4APV A;  1NMF A;  1DCZ A;  3CP0 A;  1SNO A;  3FKI G;  1XPO A;  4KY7 A;  4K2L A;  3MXG A;  3Q6S A;  4A3J G;  3ZYY X;  1SSO A;  3M4O H;  5C0X I;  2F0T A;  3HKS A;  4B3S Q;  2A6E D;  3S14 H;  1OXT A;  1EY9 A;  4YWM A;  4K5X A;  4A3C H;  2J4X A;  1PTO D;  1UEA B;  2RBM A;  4A3I B;  4H44 C;  3Q24 A;  4LUV A;  1PZK D;  1YVC A;  3H0G H;  4JV5 L;  5J1Z A;  3IFT A;  2ZTE A;  4XYQ A;  3S2H B;  2NVX B;  3MFY A;  2K5W A;  1IBL L;  1LTA D;  4OGQ C;  1J8I A;  1I50 B;  1JE5 A;  2RDG A;  3VYR A;  1EFW A;  1RTN A;  1C9O A;  3S1Q H;  1AH9 A;  1A0I A;  3U50 C;  1SJE D;  2YTX A;  1WTQ A;  1S5C D;  3NTK A;  2F0L A;  1CHP D;  2MGS A;  3TRE A;  3CF5 A;  4H0L C;  5KIX A;  1XMQ Q;  3AEV A;  3W1G A;  3J7Y W;  2KEC A;  1YNJ C;  1YZ6 A;  3FPU B;  3S9W A;  1S5B D;  1DYQ A;  2VB3 X;  2L1B A;  4FDB A;  3VR5 A;  5CBE E;  5FLX L;  2DN8 A;  1SNQ A;  4P74 A;  4LJZ C;  2Z6B A;  1K3B C;  1PYW D;  2F0K A;  5LMN Q;  4JI0 L;  1E24 A;  4A3C G;  3TRZ A;  5I9P A;  3ERS X;  3MXN B;  4IOA A;  5CMD A;  1JJ2 A;  1VQB A;  4LFC L;  4DA2 A;  2PZU A;  3H0G G;  1EYA A;  2TSS A;  2J0T D;  2RA4 A;  4IPC A;  2IL8 A;  1C0A A;  1BNZ A;  4TQU S;  3R3O A;  2NVY H;  1KXL A;  2BH8 A;  5FJ8 G;  4DV4 Q;  1A3U A;  3GV3 A;  4YWK A;  3J80 c;  4NW2 A;  1PTO C;  1EFI D;  3A8J E;  2JE6 I;  4GNX B;  1R9T B;  4KI0 A; 
#chains in the Genus database with same CATH homology
 2F0P A;  1EYC A;  2BDO A;  4CKC A;  4C2M B;  1JOQ A;  1L0X B;  4FXG C;  3J81 L;  5DM7 3;  2XWB B;  3TBI B;  4CGY B;  4S3S A;  4HAE A;  3NHH A;  1XWE A;  4IAL A;  2XWJ B;  1F2L A;  1JWM D;  1CA6 A;  3VA7 A;  3H94 A;  2HDL A;  1SYC A;  1GUO A;  5E1F A;  5K36 H;  2X6L A;  5JPM C;  1E2Z A;  4ZUI A;  1QB5 D;  3KLS X;  3U9O A;  3D6C A;  3TP8 A;  3DWA A;  2CW0 C;  2B2T C;  4XT1 B;  1F9P A;  2CQA A;  4IQZ A;  3A7L A;  1SNP A;  1I3Q B;  5FK9 C;  1FNU A;  4J6H A;  1BBX C;  2EPB A;  3W3A A;  4RH6 A;  1U4L A;  4XTC S;  1I4H A;  1J9O A;  2MUY A;  5EBC A;  3G7L A;  3NBI A;  2KEE A;  5JEA H;  1WTR A;  1B4O A;  1LTS D;  3IAY A;  3N6R A;  4NP5 A;  1JQY D;  3MC0 B;  4F7X A;  1LO5 D;  1HXY D;  2F0H A;  1Q1B A;  1M4V A;  5C0X H;  1CK1 A;  2N88 A;  4C3I B;  2SNS A;  1RD9 D;  3A54 A;  1GHJ A;  3HZX A;  3PMF A;  4IUT A;  1F9S A;  3EJI A;  1A2T A;  2KHS A;  2RVL A;  5T1I A;  2NBF A;  2PNR C;  1B50 A;  3MTS A;  1IYU A;  3T13 A;  3NUC A;  5FLX E;  3I91 A;  4J8Q A;  3SHL A;  3IKJ A;  2N55 A;  4RGO S;  1DZ1 A;  1Z7T A;  5EKK A;  1DOL A;  5HGT A;  4BY1 B;  1PDQ A;  3PUV A;  1HQM C;  2LMC B;  1E0B A;  5C3X A;  3A8K E;  5AFW A;  1O7Y A;  5EBD A;  3NQI A;  1PTO F;  2QDB A;  5LHY 1;  3S1N B;  3T51 B;  2QCP X;  4N9P A;  4K6L A;  5KNB A;  3S1R B;  3S2D B;  2F0N A;  3TP6 A;  3J81 E;  2HCI A;  4NKL A;  1U9R A;  3KBG A;  4K2K A;  4R8N A;  4ODG A;  1LTG D;  3F2U A;  5FKA C;  2NTT A;  1STE A;  5D3I B;  4OO1 G;  2RDF A;  4X3S A;  2EYL A;  3HEJ A;  3MZ5 A;  3Q0A A;  5DEH A;  4KN4 C;  1F9R A;  3GD7 A;  1U4P A;  4B9X A;  2R7Z B;  2F0U A;  3NTI A;  1CTM A;  1WTW A;  5FO7 B;  3BVZ A;  3OW7 A;  1STY A;  4H7B A;  2A73 B;  4PQX A;  2EYJ A;  2WAC A;  1OXU A;  2RKS A;  4MN3 A;  2NB0 A;  1O78 A;  1TT2 A;  3N52 A;  3I72 A;  3PV0 A;  3NPP A;  3R2I A;  5JJZ A;  2ID0 A;  1BCP C;  1OXV A;  5IGE A;  3HRZ C;  1TWC B;  1LTR D;  3P75 A;  3TDQ A;  1I4P A;  2PYK A;  3KLR A;  2QKI C;  2JA5 B;  3CHB D;  3P1H A;  4ILW A;  1GUT A;  4DAP A;  4R9W A;  4K5W A;  3RMH A;  1WD0 A;  2F0M A;  5EPJ A;  3GV6 A;  1LTT D;  4UDU C;  1VMC A;  1A3V A;  5C5M A;  4BA1 I;  2EJF C;  4LMQ D;  3H09 A;  4XQJ A;  1BOS A;  3S16 B;  1BQQ T;  1ESR A;  5EKL A;  3VYT A;  4I65 A;  3D4R A;  1F2M A;  2WKC A;  3E6Z X;  1TVX A;  4JK1 C;  1YNN C;  1CZW A;  3ONA B;  4FP5 D;  5G3L F;  1NR2 A;  2A74 C;  4F8M A;  3LWE A;  3DEP A;  4PMC A;  3K7A B;  5LL6 X;  3SK8 A;  5M5W B;  3Q22 A;  2EVB A;  4HTH A;  3PIP 3;  5C4J B;  1Z6H A;  1BCP B;  1R4Q B;  1Y8O B;  4C1N I;  4J1M A;  3DMU A;  1PMR A;  3DM1 A;  5IT9 L;  4NDX A;  4OL7 A;  2ICI A;  3D6W A;  2M2L A;  4XQN A;  1PTO H;  4A3B B;  1EWH A;  1V43 A;  3JAM L;  3QB3 A;  4G57 A;  4N9T A;  2EYM A;  1ENA A;  1I4R A;  1CFM A;  3I73 A;  3R93 A;  1JWU D;  1C48 A;  1XX8 A;  3NWT A;  2LKV A;  5DAU A;  4FF3 A;  3M85 A;  1SJH D;  1SE4 A;  1HQR D;  2NYZ D;  4CJ0 B;  1H9R A;  4E6I A;  2A5H A;  1Z47 A;  2B2W A;  3GTJ B;  4WFN 3;  1STN A;  1D1K A;  5C44 B;  3RZO B;  5J39 A;  4DAY A;  3QWN A;  1EQV A;  3NSW A;  3AB9 A;  2B2Y A;  5C0X J;  2FMM A;  1EY6 A;  3ND9 A;  5EPL A;  4DFA A;  3FMC A;  4RCO A;  1AN8 A;  3VA5 A;  1RKN A;  1FNV A;  3P7J A;  4LK1 C;  2XRQ D;  3LWU A;  1WVL A;  1SYE A;  1JIC A;  2B2U A;  5I6W A;  4FF2 A;  2F0S A;  2DNE A;  4RKL A;  5EQ0 A;  1KDA A;  4KV6 A;  5ISR A;  3RD4 A;  2EJG C;  4CKB A;  2Z4I A;  3OPO A;  4C3J B;  1EY5 A;  3I8Z A;  4C3I G;  5CR3 A;  2MHV A;  4OIK A;  2F0J A;  1A15 A;  1TWH B;  3I3C A;  2Z1C A;  3LX0 A;  1CM9 A;  2K04 A;  3R8B A;  4IUR A;  2E74 C;  3VR2 A;  3K5O A;  2WB1 B;  4DN4 M;  2K1B A;  4QIW B;  1HTL D;  1I6V C;  5F2D A;  4DNR B;  3PUX A;  3GP7 A;  3OMG A;  5C4Z A;  3FDT A;  3BYY B;  3D31 A;  1KNA A;  3E0J A;  3L7Z C;  4TRD A;  3J7A F;  4O42 A;  4C1N K;  2FFK B;  4A3M B;  2RDH A;  4EQO A;  5M5Y B;  1U4M A;  3H91 A;  3MVV A;  1EOT A;  1V1O A;  4FYD A;  4QUF A;  5M3F B;  4OO1 I;  4A93 B;  5COR A;  4C3H B;  1HA5 A;  1EY8 A;  3TME A;  1IYV A;  1K8O A;  3QIA A;  3GTM B;  5IT9 E;  5IOD A;  5KGU A;  2OF1 A;  3EQL C;  1MSH A;  1CQF A;  2CW0 D;  3OMC A;  1F77 A;  2IPK D;  4KD4 A;  3JAM E;  2SOB A;  2HUG A;  4XQQ A;  2IX3 A;  4G7H C;  2LY7 A;  3GQB A;  4DU9 A;  4QB4 A;  1K8M A;  1EYD A;  1V1P A;  1EEF D;  1KDB A;  2B2V A;  2F0Q A;  5COY A;  2QIL A;  3SVM A;  2JA8 B;  3QJY A;  2KQ3 A;  1SYG A;  5C4H A;  4XDX A;  4A3D B;  1B1Z A;  3QOJ A;  3X3M A;  1CQV A;  5KYL A;  4HMJ A;  2NN6 I;  1EZ8 A;  2F0E A;  4RA8 A;  2A69 D;  5KND A;  1VF7 A;  2SNM A;  1JC7 A;  4OHJ A;  2F0I A;  2VXW A;  4A3K B;  3K5L A;  4RFB A;  1B44 D;  1TWA B;  1RCV D;  4HSV A;  1XTC D;  3OWE B;  1SE3 A;  3J80 L;  2ENB A;  3QOL A;  2ZT9 C;  4FF1 A;  5T1G A;  1SNM A;  3A8I E;  5JOB A;  2AUK A;  4L8J A;  4ZRZ A;  2B8F A;  3C1E A;  4X3U A;  4AYB B;  3CRK C;  3NTH A;  3SE0 A;  3HOV B;  3DHQ A;  5M3M B;  3K58 A;  2EY5 A;  2GA4 B;  5DM6 3;  5EJW A;  4RGT A;  1ILQ A;  4DNT B;  1JOR A;  4QMG A;  3KUP A;  1TS3 A;  1B53 A;  3NBH A;  3D4D A;  2Q8R E;  3BYT B;  3MFG A;  3RUZ A;  4KY5 A;  2A69 C;  2D9U A;  5CV6 A;  1ML0 D;  5IGG A;  1LT3 D;  1QCB D;  5IGF A;  3GTK B;  4KJO A;  1LTI D;  2O2L D;  2WAQ B;  1DOM A;  2EDG A;  2WP8 J;  1B3A A;  4KHZ A;  1SYB A;  1CT1 D;  2EE1 A;  3NP8 A;  3DXJ C;  3OSO A;  1OXX K;  1D5M C;  2X69 A;  4FXK C;  2L11 A;  5FO9 B;  4OO1 H;  2IX1 A;  1PLF A;  4Y7N B;  1KLU D;  5JVH 3;  3O13 A;  2NUC A;  4CKE A;  1HFN A;  4IUQ A;  4K6D A;  1PFM A;  1BR9 A;  1S5F D;  2L4N A;  1Q12 A;  4K5V A;  1QOH A;  2J7Z A;  2TMP A;  2E2H B;  2R92 B;  3EVQ A;  3I90 A;  4C56 C;  2FHT A;  4DK1 A;  1SMY C;  2NWG A;  2Q8I B;  4Q5V A;  1BCP D;  3EA6 A;  3DEO A;  1PRT B;  1TII D;  4RGM A;  2CVR A;  2KUM A;  2K7V A;  1DON A;  2KCN A;  1EY7 A;  4IFD I;  1ICW A;  2XSC A;  3BG3 A;  5CBA E;  3M4O B;  5D3D A;  1G29 1;  2KA7 A;  3S14 B;  3ND8 A;  3SK6 A;  3MXU A;  2NN6 H;  2EYO A;  1WTO A;  4WOR A;  3H0G B;  1QG7 A;  3J80 E;  2QEJ C;  3ERO A;  1YNN D;  1Y8P B;  3KLS A;  2NZ1 D;  3S1Q B;  3K57 A;  3NXW A;  2FIN B;  2AWO A;  2BCO A;  1KAA A;  2XRS D;  4V19 0;  4BBS B;  5NUC A;  1ZEQ X;  5JAV A;  3T16 A;  3BDO A;  4L63 B;  1D1I A;  1MGS A;  3FVQ A;  2ZXO A;  5E4X A;  5CGK A;  1TQO A;  3K59 A;  4IUN A;  4KTA A;  5K5P A;  5ELE A;  3P20 A;  2WV6 D;  5JVG 3;  2D62 A;  2NN6 G;  2ZXP A;  2JP1 A;  1KNE A;  4BWG B;  2BOS A;  1RDP D;  1QNU A;  4KKU A;  1M8A A;  3I4L A;  1QWY A;  1SXT A;  1U4R A;  1ROD A;  3IFD A;  4C3H G;  5CV8 A;  4ZK9 B;  2NVY B;  2EXZ A;  5I6Y A;  4JBW A;  4B9W A;  1E2W A;  1H9S A;  1PXU A;  2F0F A;  3MEH A;  1B9N A;  5IOC A;  1EY4 A;  1BUV T;  3BS1 A;  2JEA I;  1X3Q A;  3MXP A;  3HOZ B;  5TSS A;  1NSN S;  1STH A;  4UAI A;  5EPK A;  1NR4 A;  3Q23 A;  3A7A B;  1HHV A;  1Q1E A;  3S1M B;  3U9S A;  3FPP A;  2L55 A;  3C3L A;  2BA0 A;  1G91 A;  4IUU A;  2V4D A;  4KKT A;  3NQT A;  3R2T A;  2FMC A;  2L0C A;  2WIN B;  1EEI D;  4DXG A;  4G4K A;  1A6X A;  1WTP A;  1AZP A;  2JXM B;  4K8J A;  5DNF A;  2EJM A;  4ABN A;  2EYF A;  4HN7 A;  1X32 A;  3K6O A;  4QCL A;  1QNK A;  2F0V A;  1HA6 A;  1G6Z A;  3RLF A;  1CA5 A;  4B08 A;  3AMU A;  4RGN A;  4V0B A;  3TZD A;  2Z4H A;  5M5X B;  3PO3 B;  1F9Q A;  3A55 A;  3T56 B;  2R93 B;  1I4Q A;  4O1N A;  4HCE A;  2KED A;  4ULL A;  4DGZ A;  2PZW A;  2F4I A;  4G7Z C;  5LL6 S;  4IFD H;  1IKL A;  1SYF A;  4EGV A;  1HFG A;  4U68 A;  2O5J C;  1DOK A;  1TY0 A;  1NCV A;  3E5S A;  4F88 A;  1R4P B;  2AQ2 B;  3H3V C;  1JB3 A;  1SDF A;  4EVO A;  5BN3 A;  5D14 A;  2VB2 X;  4G7O C;  3D3R A;  1STA A;  4ZQ3 A;  1W6K A;  5CC4 A;  3I4N B;  1MBY A;  1EQT A;  1VF5 C;  1UAP A;  1BCP F;  1STB A;  2PO4 A;  1X3P A;  1UUP A;  4EQP A;  4BA2 I;  2EY6 A;  4KK7 A;  4QUC A;  1IL8 A;  2EYP A;  4PV1 C;  2CHB D;  2MJ8 A;  3HOU B;  1TKW B;  2L9H A;  4X3T A;  2WII B;  3VYU A;  3BDC A;  1D5Z C;  3C2P A;  3C1F A;  4ZAI A;  2L12 A;  3I4M B;  3SEB A;  4IFD G;  1DJR D;  1SNC A;  2RSN A;  2IWH A;  4DXF A;  3T4A C;  3RZD B;  2PMZ B;  4XXE A;  3A56 A;  3BVG A;  4FVM A;  5A2Q L;  1V8Q A;  2B39 A;  3MA2 B;  1I4G A;  2O5I C;  1G2T A;  3KBX A;  4KJN A;  3VYS A;  1HTP A;  2D2C C;  1RTO A;  2K28 A;  1F2Z A;  1LV9 A;  3L3O C;  1ENC A;  3KF8 A;  1KTK A;  5IGC A;  4Z9C B;  1BXT A;  2ZXR A;  4R8I A;  2JYO A;  3HKZ B;  1A2U A;  1Q3L A;  1LT4 D;  3QG1 A;  1K83 B;  1L0Y B;  1E2V A;  4FNF A;  2QF7 A;  4RCN A;  1FD7 D;  3MHB A;  3HOX B;  2EYH A;  5C5L A;  1II3 A;  2R61 A;  1GUN A;  1RHP A;  4P2C B;  2AWN A;  3CQZ B;  2NVT B;  3K0Y A;  1Q90 A;  2IJ0 A;  5ELC A;  4HCS A;  1ILP A;  4F87 A;  1ENF A;  2X6G A;  4EQN A;  2XVS A;  2B63 B;  1H9S B;  1XYI A;  1G2S A;  2BE5 D;  3SR1 A;  2B2W C;  3TN2 A;  4BY7 B;  4OIJ A;  2G9D A;  3M7N A;  1AZQ A;  1SFO B;  2F03 A;  1LT6 D;  4ZLT F;  2F3W A;  4LAA A;  1JR0 D;  1SEB D;  1Y69 U;  2B2Y C;  1WTX A;  1EIG A;  1JOO A;  4TSS A;  2A68 D;  3TSS A;  4RHS A;  5IGD A;  1Y8N B;  2EY1 A;  4BBR B;  4A3G B;  4U67 3;  2IX0 A;  2A6E C;  2JA6 B;  2B2U C;  4NMZ A;  2RSO A;  1PRT D;  1PZI D;  2XNA C;  3HOY B;  1CHQ D;  3PIO 3;  4MHE A;  1KDC A;  1CZG A;  1QIL A;  2NTS A;  1UNS A;  2KOL A;  2VUM B;  2JSO A;  4A3F B;  4ZKC B;  1TS4 A;  5IIF A;  4CHT B;  5BN4 A;  1EY0 A;  4RHR A;  3M7G A;  2YU9 B;  4FXD A;  1DM0 B;  4FO2 A;  1VDZ A;  1HRJ A;  1D5X C;  2BE5 C;  4KHV A;  1ZKO A;  2MP1 A;  1IKM A;  2AQ1 B;  2AUJ D;  1S4Z A;  1HUM A;  3MWY W;  1VCI A;  5CYU A;  5A2Q E;  1WD1 A;  2A68 C;  5I2Y A;  1C4Q A;  1I6H B;  1LAC A;  1PFB A;  1D2B A;  3OHX C;  3L9A X;  1H9J A;  5G3L D;  1B9M A;  3S17 B;  1W6J A;  5ELB A;  2K5D A;  3HS0 C;  1SMY D;  1PTO B;  3J7A V;  4L6T B;  1H9K A;  1QE6 A;  3DUZ A;  3VR3 A;  3CKI B;  2LS0 1;  1PRT C;  3OIP A;  2XN9 C;  3VR4 A;  2F3V A;  5K36 G;  1SND A;  3NE5 B;  2RQX A;  3K5N A;  3SK4 A;  1I4X A;  1S5D D;  1T5X D;  4HED A;  2FJ2 A;  4IZ8 A;  2IW3 A;  1WCM B;  5I9O A;  3BDL A;  1TWF B;  3S15 B;  3OWF A;  1F2Y A;  1O7Z A;  2PW5 A;  4KN7 C;  2M00 A;  3DWQ A;  5FO8 B;  1DD2 A;  4KKS A;  4M8A A;  1ONL A;  4IFD J;  3FEW X;  1XXG A;  3SXH A;  3C46 A;  3UI2 A;  2OEO A;  2I07 B;  2I46 A;  1TS2 A;  3M3Y B;  1MI2 A;  3W2D A;  3FKI B;  4XYO A;  4RKB A;  2E2I B;  3PUW A;  3D8G A;  2HCC A;  4A3J B;  2SDF A;  2F0W A;  1EIH A;  5KNC A;  2B2V C;  5JEA G;  4QF4 A;  3G6J B;  2K5Q A;  1LTB D;  1TR5 A;  1ESF A;  4KY6 A;  1O80 A;  2D5D A;  3CU7 A;  3DWP A;  1ZYR D;  4K8I A;  2PZT A;  1T5E A;  5C0X G;  3QO2 A;  3GTG B;  1RF2 D;  1WTV A;  1GUG A;  3PUZ A;  5FOB B;  4ZYS A;  1AFP A;  1OXS C;  1H9M A;  1BO0 A;  5JPN C;  5M9O A;  3FRP B;  4IUP A;  2DY8 A;  2Z8L A;  3D4W A;  3K5M A;  1GXD C;  1BDO A;  4X3K A;  5KYI A;  4ME5 A;  1KAB A;  1TWG B;  2L5T A;  3OOC A;  2E75 C;  4C3J G;  1GJX A;  1DXM A;  4IUV A;  2C9O A;  2DNC A;  1KLG D;  5KRU A;  2OT2 A;  1OO9 B;  3WDN A;  1FNW A;  4HSP A;  2JEB I;  4KD3 A;  1V1P B;  4HMI A;  2K03 A;  5ELF A;  4TKO B;  1Q8I A;  2BDN A;  2IT1 A;  4YIJ A;  3KK7 A;  3TZU A;  4PNY A;  1C8C A;  1D6E C;  5CV7 A;  2HDM A;  1GUS A;  2YYZ A;  2BA1 A;  1ZYR C;  2E2D C;  5I2X A;  2PQE A;  2OXP A;  3GO5 A;  1TS5 A;  2NVQ B;  2E2J B;  1SBB B;  1B2T A;  2WKD A;  1FGB D;  1SYD A;  2ICE C;  1PRT F;  1FR3 A;  2H4O A;  1MD2 D;  2K01 A;  1S5E D;  2DY7 A;  2G9H D;  5CV5 A;  3V96 A;  3EFX D;  5C4X B;  3CRL C;  2Y0S B;  5C3W A;  1TY2 A;  1JE4 A;  1SE2 A;  5CV4 A;  2K6A A;  2K32 A;  3X3N A;  2EY2 A;  2LFN A;  1AP0 A;  2F1M A;  3SK5 A;  2Q8T A;  1GOZ A;  1EU3 A;  4IN3 A;  1GHK A;  2K33 A;  5BN5 A;  3AU7 A;  2AQ3 B;  1ET6 A;  3MXN A;  1EU4 A;  4CBV A;  1NUC A;  1HUN A;  5CV9 A;  1NAP A;  1STG A;  4BS9 A;  5IGB A;  4Q0F A;  2A6H D;  4RAU C;  3I70 A;  5C3E B;  1LLR D;  3TP5 A;  1BF4 A;  1GUW A;  2MPM A;  1ZXT A;  2SEB D;  2E76 C;  4M1U B;  1ET9 A;  1SAP A;  4RWS C;  3MAQ A;  2C5C A;  2KJX A;  4ID6 A;  4WJW A;  4PMW A;  3BZD B;  2KVM A;  1RJT A;  3LNN A;  1AEX A;  1MSG A;  1HPC A;  2B8G A;  2R6G A;  4KMU C;  1EZ6 A;  1EL0 A;  4ZKB B;  1O7L A;  2K05 A;  5ELD A;  3PO2 B;  5D65 A;  2F0O A;  5KEE A;  3PUY A;  1CI3 M;  3WOF A;  3URY A;  1QJO A;  4CJ2 C;  1IHZ A;  4H13 C;  4ZUJ A;  5EKI A;  1PZJ D;  2F0D A;  4DK0 A;  5I4D A;  1IW7 D;  2O4X A;  3HP3 A;  1VMP A;  1HCZ A;  5JEA J;  2F0G A;  1AW7 A;  3V2T A;  2HQE A;  2XIW A;  5C6A A;  4PMB A;  3HGB A;  1JOK A;  2A6H C;  3WOE A;  2PCF B;  4I7Z C;  5E3F A;  1Y1W B;  1G8Z D;  2M9V A;  3IL8 A;  3GTQ B;  3ITP A;  3GTO B;  1EWC A;  1TU2 B;  2EOT A;  3ERQ A;  3NWS A;  3SDZ A;  3H6M A;  4HR7 B;  1FYC A;  2R3Z A;  4FF4 A;  4GZY C;  3NK9 A;  4WRD A;  4XT3 B;  3V05 A;  1Y1V B;  1YNJ D;  5E4W C;  5A35 A;  3VR6 A;  4CJ1 B;  1LAB A;  1JWS D;  3T53 B;  1LT5 D;  4XIG S;  2H1E A;  5HUR A;  3HG9 A;  3OIQ A;  1A3T A;  3HOW B;  4DAV A;  4MIU A;  3GTP B;  3GTL B;  2KCC A;  3TP7 A;  5J22 A;  1JCK B;  1IW7 C;  1PFN A;  5EGT A;  2PPB C;  2EZV A;  3M4Y A;  2B2T A;  2PW7 A;  2VNU D;  4K14 A;  4A3E B;  2JA7 B;  4DF7 A;  3BVM A;  1DCZ A;  1SNO A;  4KY7 A;  4K2L A;  3MXG A;  3Q6S A;  3ZYY X;  1SSO A;  5C0X I;  2F0T A;  2A6E D;  1OXT A;  1EY9 A;  4K5X A;  2J4X A;  1PTO D;  1UEA B;  2RBM A;  4A3I B;  4H44 C;  3Q24 A;  1PZK D;  5J1Z A;  3IFT A;  4XYQ A;  3S2H B;  2NVX B;  3MFY A;  2K5W A;  1LTA D;  4OGQ C;  1J8I A;  1I50 B;  3VYR A;  2RDG A;  1RTN A;  1SJE D;  1WTQ A;  1S5C D;  3NTK A;  2F0L A;  1CHP D;  2MGS A;  4H0L C;  5KIX A;  3J7Y W;  2KEC A;  1YNJ C;  3FPU B;  3S9W A;  1S5B D;  1DYQ A;  2VB3 X;  2L1B A;  3VR5 A;  5CBE E;  5FLX L;  2DN8 A;  1SNQ A;  4LJZ C;  1PYW D;  2F0K A;  5I9P A;  5CMD A;  4DA2 A;  2PZU A;  1EYA A;  2TSS A;  2J0T D;  2RA4 A;  2IL8 A;  1BNZ A;  4TQU S;  3R3O A;  1A3U A;  3GV3 A;  4NW2 A;  1PTO C;  1EFI D;  3A8J E;  2JE6 I;  1R9T B;  4KI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...