2F0HA

Crystal structure of staphylococcal nuclease mutant v66l
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 39
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0hA00
2RDFA 4KTAA 1KDAA 2LKVA 4KJOA 5IIFA 3RUZA 3TP5A 2F0PA 3HEJA 3D4WA 3P1HA 4H7BA 4G57A 5ISRA 5CC4A 4OL7A 3NHHA 4KHVA 5KRUA 3SK5A 4J6HA 5C3XA 1SYFA 4YIJA 4HMIA 1EY6A 2O4XA 4K6DA 3R3OA 3TMEA 1EY5A 3NXWA 1ENAA 3MZ5A 4K8JA 4DGZA 2F0EA 4KD3A 5NUCA 1JORA 3BDLA 2F0TA 2F3WA 1KAAA 4PNYA 2F0FA 2F0IA 2RKSA 3QOJA 4K8IA 5C5MA 4DU9A 5IGEA 1EQVA 1SYEA 1EY9A 1KABA 5DEHA 3C1FA 3NQTA 3SXHA 4PMBA 5IGGA 1SNPA 3P75A 4F8MA 1AEXA 3QB3A 4K5VA 2EYOA 4RKBA 4HMJA 3SHLA 1EZ6A 4DF7A 3MEHA 5KIXA 4EQNA 2RBMA 1NUCA 4EQOA 5KYLA 2EXZA 1F2MA 2F0KA 3BDCA 1EYDA 4KV6A 5CR3A 1SNQA 5CV7A 3OMCA 2EYFA 2F0DA 5KEEA 5CV8A 1A3UA 1F2YA 4WRDA 4ID6A 3U9OA 2EY6A 1SYCA 3D4DA 4K5XA 3EJIA 1SYDA 2EYLA 4B9XA 5DAUA 2HQEA 4N9PA 2F0SA 1SNOA 2ENBA 3E5SA 2EY5A 4DFAA 3OSOA 3DHQA 5C4HA 5HURA 2F0NA 4KD4A 2F0MA 3ERQA 2PZTA 2KQ3A 2NUCA 5C4ZA 5EKKA 5IGCA 4MIUA 3NK9A 5C5LA 1IHZA 2F0OA 2PZWA 3NP8A 4ODGA 1EZ8A 4TRDA 5CV6A 1STAA 2F0QA 4NMZA 2F0VA 2F0UA 4RKLA 5IOCA 1SYBA 1JOOA 1A2UA 1EY0A 2EY1A 3EVQA 3MHBA 3OWFA 5I6YA 1JOQA 4QF4A 1STYA 2SNSA 5F2DA 4K5WA 4B9WA 1STHA 4ZUIA 1A2TA 2F0WA 5JOBA 1SYGA 5CV4A 2EYMA 2PQEA 4KY6A 4I65A 5CV5A 4ZQ3A 5J39A 1RKNA 3HZXA 2EY2A 4ZUJA 3TP8A 3S9WA 5E1FA 1KDBA 5IODA 1TT2A 4LAAA 2KHSA 1A3TA 1JOKA 2F0GA 4R8NA 3T13A 5M9OA 3H6MA 1SNDA 2OEOA 1U9RA 3SK8A 2OF1A 5CGKA 4KY7A 4E6IA 3T16A 3DMUA 4QMGA 5C6AA 1KDCA 1EY4A 2PZUA 3D8GA 4KJNA 2F3VA 2F0LA 1EY7A 2PW5A 4IUNA 5EGTA 3TP6A 3OMGA 2WACA 5IGFA 1EYCA 1TQOA 2EYHA 5C3WA 4J1MA 1STGA 1STNA 4K14A 1STBA 4KY5A 5EKLA 2EYJA 3MXPA 1ENCA 2OXPA 3C1EA 4EQPA 3V2TA 5IGBA 4QB4A 2EYPA 2PW7A 4K2LA 4NKLA 5I9OA 5J1ZA 3PMFA 5CV9A 5E3FA 2M00A 4N9TA 1EYAA 3VA5A 4WORA 3LX0A 1F2ZA 3QOLA 3SR1A 4S3SA 3SK6A 5I6WA 1SNMA 3SK4A 1II3A 4HTHA 4IALA 2F0HA 1A3VA 2PYKA 4NP5A 2F0JA 4EVOA 4F7XA 5J22A 1EY8A 4NDXA 4ME5A 4IZ8A 3MVVA 5JAVA 1NSNS 1TR5A 5IGDA 5K5PA 1SNCA 3ITPA 4PMCA 2QDBA 2SNMA 4K2KA 5KYIA 2SOBA 3EROA 5HGTA 3D6CA 5I9PA 5KGUA 3NUCA 3TP7A
chains in the Genus database with same CATH superfamily
1U5KA 1GOZA 1TWAH 1D5XC 4DV2Q 2E2HB 3VYRA 1Y1VB 1HZAA 3S14H 3KK7A 5ELEA 3HOVG 3A5ZB 3G6EA 1RJTA 1ET9A 4RGMA 2DUDA 1NR4A 3C1FA 3KFUA 1NY4A 1WCMB 1JE4A 4X62Q 4POFA 3BZDB 2E8GA 3P75A 2L9HA 1VQGA 3J7A5 2IX1A 4U673 4LUOA 5I2XA 4MTKA 1TWAB 2AWNA 2EJFC 3MXGA 3HKZB 2E76C 1A3UA 4YY3L 1NAPA 2QCPX 2B63H 1UE6A 1AFPA 1C9OA 3UDFA 3EIVA 3TREA 2GN5A 3DHQA 3CMEA 3CC7A 1IKMA 4KD4A 1VMCA 5C4ZA 3I4NB 1S72A 3S17H 4JVZA 3KDFA 4NXNQ 3R8BA 2IJ0A 4QL5A 4X6AH 4WJWA 4JI8Q 3S1NB 3UDXA 4MHEA 3PO2G 3GV6A 5COYA 2D2CC 2HHHQ 4QF4A 1IBLQ 3I90A 4BA2I 4C3HG 5CV5A 4O1NA 1BF4A 5JJZA 1RL2A 2EOTA 3FPUB 3GDEA 1GM5A 5C44H 1KL9A 5K36H 2JE6I 1A62A 1G91A 3J7YW 3DMUA 5IWAQ 2VUMB 1EY4A 3HGBA 1D2BA 1JCKB 1EY7A 2KENA 4DAYB 1IBMQ 3KLSA 4IOAA 4J1MA 1STGA 1STNA 3CCJA 3PQIA 4R4OA 3SVMA 4RWSC 4FVMA 3CCSA 3BDOA 3V2TA 5FO9B 1BUVT 4BBSG 4QB4A 4IN3A 2M2LA 2Z6KC 5LMUL 4AQYQ 4V190 1XNQL 2HCCA 3KF6B 3PUWA 5ELNA 2WKCA 1H9SB 2UXBL 1DOMA 3ULPA 2PQAB 2JA6G 3E9IA 4LFAQ 3ITPA 1G2SA 2Q2HA 1HTPA 3CCQA 3KF6A 2JA8H 3EROA 1SXTA 2JEBI 5HGTA 3TP7A 3W5OA 1B53A 2CW0C 3BZCA 2C9OA 5BR8L 2K4KA 2NBFA 2LKVA 5ISRA 4IOCA 4JPBW 3MAQA 5IYCG 5M3MG 5KYIA 2O2LD 2MGSA 2NWGA 3RLNA 1HHVA 2A69D 4DU9A 1WD0A 2D62A 3E6ZX 2RSOA 1HUMA 4LWCA 2VQEL 3RZDB 2HUGA 3OW2A 2MFIA 1SMXA 4B3RQ 1AEXA 1N33L 1DGSA 1G291 1I3QH 2H1EA 4DAVA 4EQOA 4BWGB 3F2CA 5CV7A 3A55A 1TWHH 2Z9HA 3ERSX 5CV8A 3LWEA 2EY6A 1EU3A 5FO8B 5A2QL 3T1HQ 1BBWA 1M4VA 2E5LL 1X3PA 3HOUG 2EY5A 4JI8L 1D6EC 1I94L 3HOXH 2JA5H 1J8IA 3AB9A 3GTJH 4JI0Q 2EVBA 2R93H 2K5QA 4OWXB 2RQXA 2HQLA 3GTQB 2UXCL 1L1OC 4WFN3 1F77A 1I50B 3S16H 3KBGA 3H0GB 4DV7Q 2KECA 1EWIA 4HAEA 4XYQA 1S5DD 2K28A 4X3SA 1UNSA 2K5NA 5FLMH 2PQEA 3HOYG 1HQMC 5FO7B 1TWGB 1E22A 2CWPA 1DONA 4X62L 1F9SA 3U50C 3K58A 1KAWA 5GQOA 4PZ7A 2GA4B 2MQHA 3I72A 1Q12A 3EN2A 2F3VA 3TP6A 2AUKA 1TS5A 1PFBA 3HOZB 1EEID 1GXDC 2EJGC 2EYHA 1MJEA 1FNVA 3DLLA 1HZ9A 4N8X1 1IXRA 3GTKB 1SDFA 3TQYA 2K5DA 2IY5B 1Q86C 2DN8A 2E2IB 1HZCA 2V1CC 2BA0A 4TSSA 1CI3M 2OTLA 4UAIA 4A3EH 2HD3A 4GOPC 4EVOA 3I4MG 1B4OA 2EPBA 4OX9Q 3KYHC 2FMMA 4OHJA 2AQ2B 2K14A 2ALYB 5ELCA 4HJ8A 1CA5A 4DNRB 2WP8J 2SOBA 1SFOB 4AYBE 5I9PA 3FKIB 3NUCA 2PI2A 4JI2Q 3S1RB 1DD2A 3T1YQ 1QNKA 2NTSA 2IPKD 4CDEC 5ELBA 1HJPA 1ENAA 4B3TQ 3K6OA 1NTGA 2AUJD 1KD1C 2QEJC 2RKSA 1VQDA 1EQVA 1SYEA 1T5XD 5EKIA 3URYA 2RF4A 1HFNA 3SE0A 1JE5A 1CT1D 2Z8LA 4HEDA 4IPGA 2RBMA 1AH9A 2EXZA 3LNNA 4LF4Q 4AYBB 2F0DA 4C3JG 4R9WA 4WJ4A 2AMCB 3HS0C 3GTLB 4F87A 1UE5A 3RNUA 3QR8A 2HQEA 2HCIA 1A0IA 5CBAE 1I6HB 1NNXA 1PTOB 1SAPA 4DV6L 5HURA 3PIOA 4A3GB 3FKIH 2PO4A 1TS4A 2KCCA 5ELDA 1AP0A 4ZCKA 4KKSA 1FJGL 2L1BA 2QGQA 1KQSA 4BY7H 3K5NA 1K3RA 2YU9B 1JOQA 2VL6A 3UE0A 1A2TA 4LNQA 5IYDG 1IZ6A 5IY0A 2EY2A 4OEMB 1O7LA 1MJCA 2OT2A 3M4PA 3PO3G 3CKIB 3UE1A 3K8AA 1FYCA 3T53B 1PH4A 3L3OC 2AHOB 2NVTB 3S2HB 3I70A 1LV9A 1PTOC 1VQ6A 3GD7A 5C3EH 3C3LA 4DR3L 3H3VC 1PYSB 2OWOA 2OXPA 4APVA 1YNNC 4GKKL 3VR4A 1B8AA 2PW7A 4K2LA 4X66L 2EDGA 5J1ZA 2AWOA 1GUSA 4B3MQ 1LTAD 1F2ZA 1E2VA 4JG2A 4BS9A 1JJGA 1LTLA 2ZTDA 4RH6A 1D8LA 1JWSD 1E7ZA 1X3QA 2NYZD 4HJ9A 4ME5A 3KF8A 3MVVA 4K0KL 2HIVA 2K1BA 2WIIB 4P71A 2V4DA 5M5XB 4JOIA 2D5DA 1T9HA 4DR4Q 1N32L 1S5CD 5H1SE 2ICIA 1QNUA 2SDFA 5EAYA 2WFWA 1Y14B 2E5LQ 4KTAA 4JI6L 3M9BA 1XJVA 4JOIC 4TQUS 2CVRA 5G3LF 3CRKC 3S1RH 1HPCA 3U4VA 2K03A 2CFMA 3AFQA 5C3XA 1PH2A 2O4XA 4LFAL 3NXWA 4HR7B 1LTTD 4YWLA 5JEAH 3QOJA 5IGEA 4X66Q 4MNOA 4BY1B 1ASYA 2JA5G 3P7JA 1NMGA 4YY3Q 1EIFA 5GROA 4OWWB 2K6AA 1CZGA 2WAQG 1YNND 5M5YB 3EJIA 4NW2A 5LMNL 1B9MA 4JI5Q 2VW9A 5EPLA 1JICA 1FGUA 3OHXC 4AYBG 4C3JB 3HOYH 1CKMA 1X32A 2RCNA 3CW2C 3HOVH 2E2JB 4DNTB 4CGYB 1OXSC 4PG3A 1SE8A 4MZ9A 1I6HH 1IBLL 5CV6A 4ABNA 1SRUA 3NTIA 1QE6A 5IOCA 1A2UA 1Q81C 1Q3LA 1AN8A 2QDLA 1MIUA 1UE1A 4I7ZC 3ER0A 1RD9D 1KDBA 1O7ZA 1RCVD 3Q24A 4KKTA 3HOUB 1WFQA 1SNDA 3PUYA 3L7ZC 5CGKA 3OYYA 1LTGD 1PRTF 1O80A 2A6HD 1Z6HA 2NN6G 2VS1A 3E3XA 3I4MH 4GKKQ 2N55A 5C3WA 1PH6A 1E24A 1I4RA 3BJUA 1ENCA 2KVMA 1UE7A 4NKLA 4QGUA 1S4ZA 2XWBB 3S1NH 3LX0A 1L0XB 2ZTEA 4S3SA 4A3MH 1SMYC 4DAPA 1VQPA 1XPRA 4BXXH 4GLAC 5IYCH 3IKJA 1HR0Q 4JBKA 4OIJA 3AQQA 2M9VA 3K0XA 5JVH3 4DR2L 5K36G 1U4RA 1E0BA 4FF3A 2WB1E 4X65Q 2KCTA 3B6YA 3MEFA 1EIGA 2JJQA 4EGVA 1KDAA 1I6VC 4G57A 1Z47A 2I5MX 2DNEA 4FDBA 4P73A 4A3JG 1QCBD 3F2BA 2CW0D 1W2BA 1CA6A 4DR1L 4JI4L 1KAAA 2UXBQ 3IL8A 1BKBA 2CH4A 4LF8L 4PZ6A 5M3MB 1Y8PB 3OIPA 1HZBA 5KNBA 3PIO3 3CCRA 1PTOD 4MTNA 3QB3A 3IFTA 3H3VI 4HMJA 1YHQA 1HCZA 1IKLA 3MEHA 1WJJA 4LF4L 2F0KA 1JB3A 1EYDA 3GTLH 3CHBD 4DK3C 3M3YH 1W3SA 4RHSA 5I4DA 3PUVA 5ELOA 4A3DH 1VQLA 5FLMG 2BDNA 4RGOS 1YJNA 2LXJA 1XNRQ 4ULLA 5EKKA 3K0YA 1H9SA 2NB0A 1D7QA 2VQEQ 2NVXH 3NP8A 4ZAIA 4X64L 1VQHA 2C5CA 2F0VA 4OXPA 1PTOF 2JA9A 2K7VA 1L1OA 4B9WA 5JOBA 3RD4A 2B2UC 2F0WA 5C0XH 2EE1A 2K52A 4KY6A 2VUMG 1N36Q 2PNHA 2YTYA 3M3YB 5E1FA 1H9MA 4I7AA 1B3QA 1LYLA 2Z6BA 2UUCQ 2OEOA 3W3AA 4E6IA 1ZYRC 3S1QB 4UP7A 1SROA 2QF7A 2YYZA 2JEAI 4DR3Q 2WACA 4KMUC 1EYCA 3G71A 5IP9G 2E2DC 4A3IB 2R3ZA 4GN5A 3BS1A 2ZJPA 2EQSA 3NBIA 1VQOA 2Q2TA 2N8NA 3I4OA 1XX8A 4Y7NB 2K5HA 3EFXD 3FHWA 2JA6H 2MJ8A 1LT3D 3K7AH 3I2ZA 4NDXA 3VR5A 4R4QA 4C3IH 1XWEA 1TWFB 1IL2A 4FXGC 3NBHB 5DM63 4J15A 1VQ8A 2N78A 1BXTA 1VQAA 3D6CA 4CJ2C 2RDFA 1V1OA 3O13A 1YJ9A 2F0PA 3Q22A 3D4WA 5EBDA 5M3MH 2CH4W 2QEXA 1JJCB 2B2TC 3S9WA 3TMEA 2E74C 3F2UA 4LF9L 5IYBH 5NUCA 1SJHD 3BDLA 2CCZA 2F0TA 2MO1A 1VQBA 1A63A 2N3SA 4DR5L 1PH9A 1EY9A 1KABA 4JI7Q 1O78A 1F9QA 3ONAB 3GTPH 1HRJA 1AE2A 3I8ZA 2EYOA 4DF7A 3SHLA 4A3JB 4A3KB 3BDCA 1F2MA 3CPFA 3OMCA 2L4NA 5D3DA 4QQBX 1VQ7A 4RA8A 2K33A 3GTQH 2R7FA 4A3GG 2K75A 1LT6D 4H13C 4LF5Q 2LFNA 4GLXA 3M4OB 3HKZG 2RSNA 3CCMA 3RZOH 3RZDH 4JBJA 3L2PA 3OOCA 3SDZA 5C4JH 2B2UA 4HJAA 3T4AC 1X55A 2A68D 2B2VA 3BU2A 4ZKBB 2IT1A 5A35A 1TS2A 4P72A 3EBEA 1BNZA 1STHA 1ICFB 1X54A 2BDOA 1AW7A 2GVAA 4I65A 3BG3A 2IWHA 5DLQE 4JYAL 3I55A 1Q1BA 4GS3A 1SN8A 2UXCQ 5C4XH 3I73A 5E4WC 2F4VL 2PPBC 2H5XA 4IUNA 3AEVA 1NE3A 2XVSA 4QCLA 1GUOA 1YZ6A 2B3GA 4IJLA 3CXCA 2KHIA 2JA7H 4ZRZA 5I9OA 2FMCA 2XGTA 5D3IB 1M90C 4K0KQ 2ZXPA 1CKNA 2FXQA 1II3A 3CCVA 4PV1C 5JAVA 1QJOA 1GUTA 1RHPA 1XXGA 2NVYH 2L11A 4GKJQ 4ZLTF 1H9KA 3PO3H 2IHFA 5IE8A 1F9PA 2I5HA 2BCOA 1B9NA 3PF5A 1EIHA 4JI2L 4LF9Q 1S40A 3T1YL 3Q6SA 1LT4D 1FR3A 4BBSB 2A6ED 3I4NG 1O7YA 3A7LA 4DR6Q 1EY6A 3D0FA 4A93H 2R92B 2F0EA 4JI4Q 4L8JA 4G7OC 4XDXA 2CKZB 3GTOH 1R9TH 1ESRA 1ZYRD 3J7AF 1KC8C 4F8MA 3NELA 2L15A 4M8AA 1TWHB 4HN7A 5LMNQ 2A69C 1SNQA 4JI6Q 2WKDA 1G8ZD 1SYCA 1XMOQ 3S2HH 4DXFA 2VY3A 4KLKA 1C8CA 2I5LX 3G7LA 1XNRL 2KA7A 2N49A 2F0NA 1VQEA 3ERQA 4KN4C 4QUFA 1XMQL 3IFDA 1VQKA 1C7YA 2WINB 5JEAG 1BDOA 2PZWA 4A3FG 2MHVA 2F0QA 4RMFA 1NJIC 1EOVA 4NMZA 1WTXA 2EY1A 3MHBA 2RDHA 2SNSA 4ZUIA 2BE5C 5CV4A 4YHHQ 1EFWA 4DV7L 4DR5Q 5FOBB 3T13A 4A3GH 1LM0A 3J7ZC 1U4MA 3K5MA 1PH5A 3S15H 1TWGH 5I2YA 2Z4HA 3T16A 4QMGA 2KEEA 4IQZA 5C3EG 4PQXA 1MD2D 1Q82C 2PW5A 1PH7A 1PYBA 1TQOA 5AJ3L 1KTKA 4P74A 4K14A 5EJWA 5C4XB 1KHIA 3ULJA 1PH8A 1ZXTA 4YCVA 1Y1VG 2EYPA 3K7AB 1SSOA 4B3ML 3NWTA 3AU7A 4KN7C 1BCPB 5J3BA 5GAGC 2M00A 2O5JC 1EYAA 3RN2A 3QOLA 1QVFA 3JAMc 1L0YB 1AZPA 3GTPB 1A6XA 5C3EB 3WOFA 2R92H 1FNWA 1UAPA 5KGUA 1SMYD 4F88A 1ICWA 4OGQC 2HDLA 2L55A 3NTHA 3RUZA 3P1HA 2D0PA 1F2LA 5D14A 4LFCL 1WD1A 1WTVA 3BYYB 1J6QA 4YIJA 3S17B 5CMDA 3F2DA 1EY5A 2XRQD 3MXNB 4B3SQ 2B8FA 2ZXRA 3MA2B 4JI5L 1SE2A 4DUZQ 2NVYB 3P20A 4G4KA 4K8IA 4DV5Q 5DNFA 2K04A 5DEHA 1EWCA 1I4GA 4B3TL 1PHJA 1JWUD 4K5VA 1T5EA 5KIXA 3A8KE 4UPAA 3J80i 4KV6A 4C1NI 1B7YB 4XYOA 1TWCH 1PTOH 4WRDA 1UEBA 2JA8B 4NXNL 4CKBA 3K59A 3GTGH 1Z7TA 2JQOA 3KLRA 4JV5L 4DV0Q 5BN3A 3M7GA 4RCNA 4OWTB 3UDIA 3E0JA 2JA6B 3S1QH 4A3BG 4TRDA 5C4XG 4IUUA 2F0UA 3HOZH 1TIID 1V9PA 1EY0A 4JBMA 2JK8A 5F2DA 2C35B 1EQRA 2VNUD 1HTLD 1QOHA 1NMFA 5IP9H 1A15A 1QZHA 2YTVA 1KIXA 1KRTA 2HHHL 3KJOA 4JYAQ 4LAAA 2KHSA 1U4PA 3OTOL 1K83H 4RGNA 3RR5A 5C6AA 3FRPB 1KDCA 1PYWD 4IUTA 4HSVA 4B3RL 4HJ7A 5EKLA 1BCPD 4EQPA 3U58A 4A3FH 1JQYD 4GNXC 1HNWQ 3QJYA 2CHBD 3X3NA 1H9JA 2KCNA 3HOXB 5C0XG 4LMQD 2B2WA 3I4NH 5J22A 5DM73 4FNFA 4F7XA 2F4VQ 1NSNS 3PCOB 1PV4A 2QDBA 1TY2A 1GUWA 2EIFA 3CCUA 2ATWA 1DCZA 1GHJA 4C3HH 1TY0A 3RMHA 1E2ZA 5IP7G 5M3FB 1R4PB 1E1OA 4NB3A 3DUZA 1EQTA 4IO9A 4A75A 3NWSA 4IURA 3R3OA 4Q0FA 2UUCL 1JORA 4KD3A 2ZM6L 2F3WA 4OIKA 4DR2Q 4A3CH 1CFMA 2IHEA 1G6ZA 5JVG3 2J4XA 2K32A 4YCUA 1RF2D 4UDUC 2BOSA 3DXJC 1SNPA 1TXYA 4CDDC 4YHHL 3S14B 2OTJA 1GO3E 3I91A 3TBIB 3CF5A 4JCVE 1QWYA 2DGYA 4DV1Q 4X64Q 1X3GA 1YNXA 2QA4A 3N6RA 4MN3A 4CJ1B 1PVOA 3S2DB 4R4CA 4LW1A 3J80L 1SBBB 2F0SA 2LMCB 1SNOA 2ENBA 5M5YH 1QVCA 3VYTA 3NE5B 4G7ZC 1XMQQ 2HIXA 3AMUA 4FF4A 2LY7A 1GUNA 4LJZC 4PZ8A 2F0OA 1U4LA 1I5FA 1SE3A 5IYDH 1IYVA 3J81L 4A3IG 2L5TA 1R4QB 2NVQH 1XMOL 1PMRA 2X6GA 1PLFA 4K5WA 1VQ9A 2VUMH 1V1PA 1IBKQ 1IBML 1WTRA 4N8FA 4CKEA 1GD7A 3CCEA 1BCPC 4KHZA 4LFCQ 2XNAC 4O0AA 4Q5VA 2G9HD 2F0LA 5CORA 2LSSA 5IGFA 3S2DH 4GN4B 1LTRD 2K5VA 2EYJA 3H3VH 4DPGA 3Q0AA 4JW0A 1EQQA 3HOUH 4EX5A 5FLXL 4DR4L 5L37A 3HOZG 1B70B 2KOLA 5JJIA 2PMZB 4L5TA 3SK6A 5I6WA 1SNMA 1OO9B 1N8RC 2JN4A 4BY7B 2B63B 5IGDA 1XTCD 1K3BC 4WJ3M 1NBWA 4BY1H 1DXMA 1VQIA 1D1KA 5JJKA 2BH8A 2YV5A 2XN9C 2RHSB 4JV5Q 2F3IA 4R4IA 3J7AV 2NZHA 3J80c 2CQAA 4XIGS 1N34L 1CUKA 5E7NA 4K6DA 3MZ5A 4OO1G 1CQFA 1FL0A 4JC0A 2F0IA 2AQ1B 3WWVA 4A3LG 2A6HC 1I4XA 1I94Q 5LMNW 2Q2IA 2G9DA 1YEZA 5KYLA 3S1MB 4IPCA 4BBRG 2R7DA 1VQNA 1S5FD 2XWJB 1F2YA 2KBNA 3OIQA 2Y0SE 4RGTA 1PZJD 4YWMA 2F4IA 1QG7A 4BXXG 3DM1A 4POGA 1LACA 4DFAA 3K7UC 3CQZH 1YHAA 1SFOH 1QUQB 4P75A 1HNWL 5EPKA 4DV4Q 3QO2A 2P5ZX 1STAA 1LTID 4RAUC 1EOTA 2I46A 5M5XH 1SYBA 4IUPA 3MC0B 1RIPA 1CHQD 3VDYA 4O42A 3J81j 4LF5L 5FJ8H 5M3FG 1BQQT 3HRZC 3G6JB 3HZXA 1E1TA 4ZUJA 1FJGQ 1GVPA 4DR7Q 1Y1VH 4FXDA 1A3TA 2NZ1D 4KI0A 2E2HH 4OELB 4H02A 1CQVA 5AJ3Q 1E3PA 3EQLC 4KHPL 1HA6A 5EQ0A 1K28A 3OMGA 4IPDA 5IT9c 2NVTH 1MBYA 3VR2A 4CDFC 4XQJA 5LMUQ 3W2DA 1GUGA 3STBC 5JJLA 1KNEA 3MXUA 2XRSD 5GADC 4A3IH 4A3EB 4LK1C 5HGQA 5IP7H 2EXDA 4DAYA 4KHPQ 1TWFH 3SR1A 2RHQB 4DUYQ 2F0HA 1JJ2A 1PRTD 3A8IE 3HP3A 5M5WH 3LWUA 3M4QA 2MPMA 3CU7A 4RCOA 4A3FB 2WB1B 1LTBD 2FINB 3K5OA 3J80E 1CM9A 2DY8A 2R93G 1E2WA 1VQ4A 3L9AX 1VQMA 1YJWA 2ZT9C 4QJFA 3D31A 1RDPD 2N88A 1PH3A 1V43A 5BR8Q 3IRBA 2QW7A 1F9RA 4U68A 4B08A 2GVBA 2KEDA 4A93B 4CHTB 2PNRC 1XPOA 3SGIA 4L6TB 4DV1L 2R92G 4IUQA 4A3KH 4A3DG 2ICEC 3Q8DA 4IFDH 2B8GA 3A74A 4JI0L 2A74C 5DAUA 3PO3B 3E5SA 4GNXA 4X3KA 1LTSD 5C0XJ 1FGBD 3PSIA 3H09A 4OO1I 2AKWB 1CTMA 2J0TD 3DWQA 3HOWB 1LO5D 3JAMi 1IHZA 3HOVB 5AFWA 4HIDA 1JOOA 3OWFA 4OONA 3G48A 3GTKH 2A1AA 4DV3Q 4P2CB 1HNXQ 4RG1A 4NXML 3TP8A 1M1KC 1C0AA 2JSOA 3PUXA 3I56A 1TT2A 5IT9E 4EQ5A 2RVLA 4IPHA 1VMPA 5EPJA 3TSSA 3FEWX 3TRZA 4L5RC 1KXLA 3H6MA 1HH2P 2YTXA 1K8MA 3A7AB 4DR1Q 1STEA 3G4SA 3W1BA 3UI2A 3K5LA 3PGZA 1HNZQ 1PFSA 1SJED 5GAHC 3BZKA 2FJ2A 5FK9C 3NTKA 4A3BH 3RLFA 2ID0A 1I4QA 1PRTC 5FLXc 4BBRB 5CYUA 3AYHB 1S3OA 3VYUA 4WORA 3DM3A 4L5SA 4C3IG 2R6GA 5LL6S 4FXKC 1NCVA 1PFNA 1I3QB 2VB3X 3R2TA 3CCLA 3KLWA 1FNUA 4PMCA 3M4OH 2SNMA 4HIOA 2A19A 4Z9CB 4A3LH 1ESFA 3KDFB 3PIP3 1JWMD 4K6LA 3NPPA 1Q90A 3H15A 1K8OA 4J8QA 1B44D 5TSSA 1Q8IA 1X3FA 4BBRH 2NZOA 4IJHA 4J6HA 1UUPA 2WB1G 4HMIA 4X65L 4K8JA 3HFZB 1B50A 2F0FA 3KBXA 1V1QA 3GO5A 1YITA 1PDQA 1BVSA 5C44G 4DR6L 4PMBA 4Y52H 2Q2UA 4RKBA 2B2YC 2QKIC 5GAEC 4EQNA 1VDZA 2D0OA 1ILPA 3LGJA 3STBD 4LUZA 1X65A 5LHY1 1N34Q 2WV6D 1H9RA 1YNJD 3U9OA 4FYDA 1LUZA 1CKNB 3WOEA 4N9PA 2Y0SB 3J81E 4DV5L 4XT3B 1PFMA 4C3IB 3OSOA 1BR9A 2KQ3A 3QWNA 2UUAL 3V05A 1BBUA 1Y1WH 2MUYA 4LUVA 5JPMC 2OQKA 1K8AC 4G7HC 4XQNA 2A73B 2ZXOA 4R8IA 4DK6C 3QG1A 3M7NA 3I7FA 1A8VA 3TS2A 4R4TA 4JI1L 1WYDA 4AQYL 2WAQB 1EL0A 1P8LA 4XT1B 3CRLC 4JI3L 1VQCA 1J5EL 5IODA 2A5HA 3OPOA 1BBXC 3PIPA 2R93B 1U9RA 3L0OA 4HCEA 4IUVA 2UXDL 2JA5B 3F1ZA 3M85A 1WI5A 4NXMQ 2PZUA 5C44B 2QILA 4HIKA 1Q8KA 1AE3A 2K50A 2BH2A 2KCMA 3BVGA 4H44C 1I4PA 3TN2A 5JEAJ 3VA7A 2NVQB 5FKAC 2F03A 1HNZL 3K81C 4N9TA 3RLOA 3A5UA 4DV6Q 1JR0D 2VQFQ 3SK4A 1Q7YC 2EJMA 2PYKA 1X3EA 1G51A 1LLRD 1XYIA 5KNCA 4LFBQ 1B3AA 2A8VA 1SNCA 1UWVA 1DOLA 4KK7A 3HOXG 4GKJL 3M4YA 1PRTB 5IWAL 3QIAA 3TDQA 2LS01 2UUBL 5BN4A 1SR3A 1HA5A 5IIFA 4ZK9B 3T51B 4A93G 4H7BA 1YBYA 2VB2X 2B29A 3K57A 2HDMA 2VXWA 1OXVA 2YU9H 4A3CG 4CKCA 4Y7NH 4IFDJ 4FF1A 2E2JH 1WCMH 1P16A 2NTTA 2UUBQ 3NQTA 2UU9Q 3WDNA 1ML0D 1K0SA 4XXEA 1EUJA 2JA7B 1GKHA 1PXUA 1EZ6A 1VCIA 1NUCA 2H4OA 1EIYB 2B2WC 4FP5D 5KEEA 4KKUA 1SEBD 3BVMA 4ID6A 3I4LA 1SYDA 2B63G 4ZKCB 2K01A 3JAML 4DN4M 1G2TA 4H0LC 1N36L 4C3HB 2Z6KA 3OWEB 1YVCA 4DXGA 1EZ8A 1HR0W 4JI3Q 1VQFA 2CQOA 1IYUA 3R2IA 5CBEE 3FKIG 1YI2A 2R7ZG 4XQQA 2IX0A 1X6OA 1IL8A 4A76A 3BVZA 1SYGA 1WVLA 3ZJYC 3A0JA 2EZVA 4ZQ3A 3CPWA 1UEAB 3FMCA 2NVXB 3K80C 3I4MB 1ILQA 1JOKA 3NEMA 4FF2A 4L63B 2K5WA 2DY7A 4DK1A 2IX3A 3SK8A 2B2VC 4KY7A 1N33Q 1ENFA 1EEFD 3BYTB 4KJNA 3D8GA 5T1IA 1MSHA 2JXMB 2E75C 1QVGA 3MWYW 4ILWA 5BN5A 3DWPA 1BO0A 3Q23A 1K83B 4O2DA 2R7ZB 1Y8OB 1YNJC 1W6JA 3PMFA 5CV9A 1L2FA 2JYOA 5E3FA 1GHKA 4UHVA 5FJ8G 4X3TA 3NBHA 1A3VA 4NP5A 4BY1G 3VYSA 1MSGA 1XTDA 3HOYB 3V96A 4GOPB 1OXTA 1TU2B 3E9HA 2A6EC 3DEPA 2FHTA 5A2QE 1BOSA 4DUZL 1ZEQX 5EBCA 2G5DA 2Y0SG 1H95A 1B2TA 1TWCB 3ND9A 4KJOA 4HJ5A 3NHHA 4LF8Q 3CP0A 1SYFA 1S5ED 1C4QA 1L0WA 3HKSA 3CMAA 2KJXA 3NQIA 1IW7C 4JK1C 2AQ3B 4OX9L 2MP1A 3NENA 1VQ5A 4AIMA 4LF6L 1WTPA 2KUMA 3A8JE 3H91A 4C2MH 4HIMA 1HQRD 2EYFA 3SEBA 2UXDQ 2TMPA 4DV2L 4K5XA 4LF7Q 4JI7L 4ALPA 2K05A 1HR0L 3MXNA 1JT8A 1JMCA 3GTJB 1KRSA 1Y69U 1CK1A 5C4HA 4IFDI 2NUCA 3PUZA 2ZJQA 2HT1A 2I07B 5C5LA 3CD6A 2BE5D 3X3MA 4C1NK 2FFKB 1WCMG 5JPNC 5G3LD 3ZYYX 4RKLA 2ES2A 1DJRD 3EVQA 5I6YA 1D5ZC 4R1JA 1LT5D 2L0CA 2MO0A 3PF4A 4A3KG 3ICEA 3D3RA 3HG9A 4R8NA 1ONLA 1HFGA 4QIWB 3KLSX 1EFID 5IYBG 2RA4A 5EGTA 2OQ0A 1RTNA 5T1GA 1M8AA 3C2PA 4JI1Q 1EWHA 1DM0B 3UDGA 1STBA 4KY5A 4UP8A 1MKHA 2L12A 3C1EA 4HSPA 4QUCA 5IGBA 1Y1WB 1S5BD 5HY6A 1I4HA 5E4XA 4QY7A 1SE4A 4TKOB 2KHJA 3VA5A 3VR6A 2RCFA 3KUPA 3VR3A 1XPUA 4IALA 1QUQA 1EY8A 4A3EG 1TR5A 1N9WA 2MNAA 1VS0A 3U4ZA 2J7ZA 3HOWG 2B39A 5ELFA 2VZAA 3OTOQ 3KF8B 1MHWC 2XIWA 3TP5A 3H0GH 3W1GA 3E0EA 3JAME 5CC4A 4KHVA 1X9NA 3SK5A 2ZTCA 4AH6A 4DGZA 1V1PB 4ZYSA 3KJPA 4PNYA 1WTHA 3U9SA 4ME3A 3CQZB 4A3JH 2TSSA 4A3BB 2IW3A 2SEBD 2NN6I 1WTOA 3FVQA 1DYQA 5IGGA 1KNAA 4PMWA 2ASBA 1N32Q 1Y1WG 1R9TB 2DJGC 5CR3A 4IFDG 2DNCA 4YWKA 2ZJRA 4BA1I 3D4DA 4C3JH 2EYLA 4B9XA 4DA2A 2JA7G 1DZ1A 2I0QA 3T1HL 4UY8C 5IGCA 4MIUA 1FD7D 2DJFC 4M1UB 3GP7A 4ODGA 4HCSA 2E2IH 1K9MC 4GN3B 3DEOA 1WTWA 4JBWA 1BCPF 4OO1H 1RKNA 4YCWA 4DNIA 1RTOA 1CKOA 1EU4A 4DKAC 2F0GA 4C56C 5M9OA 5C0XI 1IW7D 3MFYA 1V8QA 2Q8IB 2BA1A 2OF1A 1XNQQ 4FO2A 1NR2A 4GZYC 1O7IA 1PA6A 2Z4IA 4UP9A 2CWAA 3RZOB 4TVAB 4X3UA 4CJ0B 3MXPA 3PV0A 1OXXK 1AZQA 1KLUD 3R93A 3GTMH 4CBVA 2Z1CA 4DK0A 3ULLA 1MI2A 3AFPA 1X56A 4V0BA 3RN5A 3TEHB 1J5EQ 2UUAQ 2D9UA 1VF5C 2F0JA 5C4JB 2F52A 2WAQE 3GTOB 2UU9L 1YIJA 1IBKL 5K5PA 1CSPA 1TKWB 1TS3A 2XTIA 4DAMA 3NSWA 2F1MA 2PCFB 1LABA 1MGSA 1PZID 3HKZE 4BBSH 1C48A 5D65A 2ZM6Q 4A3DB 2Q8RE 3EA6A 4A4IA 3HEJA 2B2TA 5M5WB 2PMZE 4OL7A 3FDTA 4CDCC 5KRUA 2JP1A 1J9OA 3J81c 1KLGD 3J81i 2Z0SA 3TZDA 2X69A 5C5MA 2PQAA 4LFBL 2JA8G 3GQBA 3SXHA 3PO2H 2X6LA 3D4RA 4BY7G 1RODA 3S15B 1QILA 1WTQA 1D5MC 3DWAA 1Y8NB 1CSQA 4L5QA 3CAMA 1Z9FA 3HOWH 4DV4L 1VQJA 1HXYD 1WOCA 2XSCA 1TVXA 4LF7L 1EYGA 1Q1EA 1DOKA 3KOJA 5LL6X 3MFGA 2R7ZH 1IYJB 1CZWA 1VF7A 3OW7A 4GOPA 2PI2E 3FP9A 1K0RA 1G6PA 1CHPD 1SLJA 2F0MA 1JC7A 2PZTA 1K8GA 4LF6Q 3NK9A 3GTGB 4XTCS 3FPPA 3MTSA 4GLVB 4B3SL 1JB7A 1QB5D 1ZKOA 5M3FH 3ND8A 1QZGA 3T56B 1B1ZA 1FVIA 1K73C 1STYA 3D6WA 3CC4A 3S16B 3A54A 2IL8A 3F8TA 2EYMA 1OTCA 5J39A 3PO2B 2R61A 1W6KA 3C46A 1L1OB 4DV3L 1HNXL 5FLXE 2B2YA 4RHRA 1U0LA 3I3CA 2O5IC 4DUYL 3JC66 3IAYA 5KNDA 2NN6H 3CC2A 3TZUA 3H94A 1PZKD 1Q46A 4DV0L 1I50H 5IT9L 1ASZA 3S1MH 3GV3A 4C2MB 1ET6A 4A3MB 3H0GG 3A56A 1PH1A 2LXKA 3S24A 4GNXB 4NPSA 4RFBA 1GJXA 4HTHA 2VQFL 1HUNA 2RDGA 4IZ8A 4A3MG 1D1IA 2OCEA 1YHBA 3TS0A 4K2KA 2Q8TA 3GTMB 2A68C 3N52A 4DR7L 1OXUA 4QIWE
chains in the Genus database with same CATH topology
1GOZA 1D5XC 2E2HB 3VYRA 1Y1VB 3KK7A 5ELEA 1RJTA 1ET9A 4RGMA 1NR4A 3C1FA 1WCMB 1JE4A 3BZDB 3P75A 2L9HA 2IX1A 4U673 5I2XA 1TWAB 2AWNA 2EJFC 3MXGA 3HKZB 2E76C 1A3UA 1NAPA 2QCPX 1AFPA 3DHQA 1IKMA 4KD4A 1VMCA 5C4ZA 3I4NB 3R8BA 2IJ0A 4WJWA 3S1NB 4MHEA 3GV6A 5COYA 2D2CC 4QF4A 3I90A 4BA2I 4C3HG 5CV5A 4O1NA 1BF4A 5JJZA 2EOTA 3FPUB 5K36H 2JE6I 1G91A 3J7YW 3DMUA 2VUMB 1EY4A 3HGBA 1D2BA 1JCKB 1EY7A 3KLSA 4J1MA 1STGA 1STNA 3SVMA 4RWSC 4FVMA 3BDOA 3V2TA 5FO9B 1BUVT 4QB4A 4IN3A 2M2LA 4V190 2HCCA 3PUWA 2WKCA 1H9SB 1DOMA 3ITPA 1G2SA 1HTPA 3EROA 1SXTA 2JEBI 5HGTA 3TP7A 1B53A 2CW0C 2C9OA 2NBFA 2LKVA 5ISRA 3MAQA 5KYIA 2O2LD 2MGSA 2NWGA 1HHVA 2A69D 4DU9A 1WD0A 2D62A 3E6ZX 2RSOA 1HUMA 3RZDB 2HUGA 1AEXA 1G291 4DAVA 2H1EA 4EQOA 4BWGB 5CV7A 3A55A 5CV8A 3LWEA 2EY6A 1EU3A 5FO8B 5A2QL 1M4VA 1X3PA 2EY5A 1D6EC 1J8IA 3AB9A 2EVBA 2K5QA 2RQXA 3GTQB 4WFN3 1F77A 1I50B 3KBGA 3H0GB 2KECA 4HAEA 4XYQA 1S5DD 2K28A 4X3SA 1UNSA 2PQEA 1HQMC 5FO7B 1TWGB 1DONA 1F9SA 3K58A 2GA4B 3I72A 1Q12A 2F3VA 3TP6A 2AUKA 1TS5A 1PFBA 3HOZB 1EEID 1GXDC 2EJGC 2EYHA 1FNVA 3GTKB 1SDFA 2K5DA 2DN8A 2E2IB 4TSSA 2BA0A 1CI3M 4UAIA 4EVOA 1B4OA 2EPBA 2FMMA 4OHJA 2AQ2B 5ELCA 1CA5A 4DNRB 2WP8J 2SOBA 1SFOB 5I9PA 3FKIB 3NUCA 3S1RB 1DD2A 1QNKA 2NTSA 2IPKD 5ELBA 1ENAA 3K6OA 2AUJD 2QEJC 2RKSA 1EQVA 1SYEA 1T5XD 5EKIA 3URYA 1HFNA 3SE0A 2Z8LA 1CT1D 4HEDA 2RBMA 2EXZA 3LNNA 4AYBB 2F0DA 4C3JG 4R9WA 3HS0C 3GTLB 4F87A 2HQEA 2HCIA 5CBAE 1I6HB 1PTOB 1SAPA 5HURA 4A3GB 2PO4A 1TS4A 2KCCA 5ELDA 1AP0A 4KKSA 2L1BA 3K5NA 1JOQA 2YU9B 1A2TA 2EY2A 1O7LA 2OT2A 3CKIB 1FYCA 3T53B 3L3OC 2NVTB 3S2HB 3I70A 1LV9A 1PTOC 3GD7A 3C3LA 3H3VC 2OXPA 1YNNC 3VR4A 2PW7A 4K2LA 2EDGA 5J1ZA 2AWOA 1GUSA 1LTAD 1F2ZA 1E2VA 4BS9A 4RH6A 1JWSD 1X3QA 2NYZD 4ME5A 3KF8A 3MVVA 2K1BA 2WIIB 2V4DA 5M5XB 2D5DA 1S5CD 2ICIA 1QNUA 2SDFA 4KTAA 4TQUS 2CVRA 5G3LF 3CRKC 1HPCA 2K03A 5C3XA 2O4XA 3NXWA 4HR7B 1LTTD 5JEAH 3QOJA 5IGEA 4BY1B 3P7JA 2K6AA 1CZGA 1YNND 5M5YB 3EJIA 4NW2A 1B9MA 5EPLA 1JICA 3OHXC 4C3JB 1X32A 2E2JB 4DNTB 4CGYB 1OXSC 5CV6A 4ABNA 3NTIA 1QE6A 5IOCA 1A2UA 1Q3LA 1AN8A 4I7ZC 1RD9D 1KDBA 1O7ZA 1RCVD 3Q24A 4KKTA 3HOUB 1SNDA 3PUYA 3L7ZC 5CGKA 1LTGD 1PRTF 1O80A 2A6HD 1Z6HA 2NN6G 2N55A 5C3WA 1I4RA 1ENCA 2KVMA 4NKLA 1S4ZA 2XWBB 3LX0A 1L0XB 4S3SA 1SMYC 4DAPA 3IKJA 4OIJA 2M9VA 5JVH3 5K36G 1U4RA 1E0BA 4FF3A 1EIGA 4EGVA 1KDAA 1I6VC 4G57A 1Z47A 2DNEA 1QCBD 1CA6A 2CW0D 1KAAA 3IL8A 5M3MB 1Y8PB 3OIPA 5KNBA 3PIO3 1PTOD 3QB3A 3IFTA 4HMJA 1HCZA 1IKLA 3MEHA 2F0KA 1JB3A 1EYDA 3CHBD 4RHSA 5I4DA 3PUVA 2BDNA 4RGOS 4ULLA 5EKKA 3K0YA 1H9SA 2NB0A 3NP8A 4ZAIA 2C5CA 2F0VA 1PTOF 2K7VA 4B9WA 5JOBA 3RD4A 2B2UC 2F0WA 5C0XH 2EE1A 4KY6A 3M3YB 5E1FA 1H9MA 2OEOA 3W3AA 4E6IA 1ZYRC 3S1QB 2QF7A 2YYZA 2JEAI 2WACA 4KMUC 1EYCA 2E2DC 4A3IB 2R3ZA 3BS1A 3NBIA 1XX8A 4Y7NB 3EFXD 2MJ8A 1LT3D 4NDXA 3VR5A 1XWEA 1TWFB 4FXGC 5DM63 1BXTA 3D6CA 4CJ2C 2RDFA 1V1OA 3O13A 2F0PA 3Q22A 3D4WA 5EBDA 2B2TC 3S9WA 3TMEA 2E74C 3F2UA 5NUCA 1SJHD 3BDLA 2F0TA 1EY9A 1KABA 1O78A 1F9QA 3ONAB 1HRJA 3I8ZA 2EYOA 4DF7A 3SHLA 4A3JB 4A3KB 3BDCA 1F2MA 3OMCA 2L4NA 5D3DA 4RA8A 2K33A 1LT6D 4H13C 2LFNA 3M4OB 2RSNA 3OOCA 3SDZA 2B2UA 3T4AC 2A68D 2B2VA 4ZKBB 2IT1A 5A35A 1TS2A 1BNZA 1STHA 2BDOA 1AW7A 4I65A 3BG3A 2IWHA 1Q1BA 3I73A 5E4WC 2PPBC 4IUNA 2XVSA 4QCLA 1GUOA 4ZRZA 5I9OA 2FMCA 5D3IB 2ZXPA 1II3A 4PV1C 5JAVA 1QJOA 1GUTA 1RHPA 1XXGA 2L11A 4ZLTF 1H9KA 1F9PA 2BCOA 1B9NA 1EIHA 3Q6SA 1LT4D 1FR3A 4BBSB 2A6ED 1O7YA 3A7LA 1EY6A 2R92B 2F0EA 4L8JA 4G7OC 4XDXA 1ESRA 1ZYRD 3J7AF 4F8MA 4M8AA 1TWHB 4HN7A 2A69C 1SNQA 2WKDA 1G8ZD 1SYCA 4DXFA 1C8CA 3G7LA 2KA7A 2F0NA 3ERQA 4KN4C 4QUFA 3IFDA 2WINB 5JEAG 1BDOA 2PZWA 2MHVA 2F0QA 4NMZA 1WTXA 2EY1A 3MHBA 2RDHA 2SNSA 4ZUIA 2BE5C 5CV4A 5FOBB 3T13A 3K5MA 1U4MA 5I2YA 2Z4HA 3T16A 4QMGA 2KEEA 4IQZA 4PQXA 1MD2D 2PW5A 1TQOA 1KTKA 4K14A 5EJWA 5C4XB 1ZXTA 2EYPA 3K7AB 1SSOA 3NWTA 3AU7A 4KN7C 1BCPB 2M00A 2O5JC 1EYAA 3QOLA 1L0YB 1AZPA 3GTPB 1A6XA 5C3EB 3WOFA 1FNWA 1UAPA 5KGUA 1SMYD 4F88A 1ICWA 4OGQC 2HDLA 2L55A 3NTHA 3RUZA 3P1HA 5D14A 1F2LA 1WD1A 1WTVA 3BYYB 4YIJA 3S17B 5CMDA 1EY5A 2XRQD 2B8FA 2ZXRA 3MA2B 1SE2A 2NVYB 3P20A 4G4KA 4K8IA 5DNFA 2K04A 5DEHA 1EWCA 1I4GA 1JWUD 4K5VA 1T5EA 5KIXA 3A8KE 4KV6A 4C1NI 4XYOA 1PTOH 4WRDA 2JA8B 4CKBA 3K59A 1Z7TA 3KLRA 5BN3A 3M7GA 4RCNA 3E0JA 2JA6B 4TRDA 4IUUA 2F0UA 1TIID 1EY0A 5F2DA 2VNUD 1HTLD 1QOHA 1A15A 4LAAA 2KHSA 1U4PA 4RGNA 5C6AA 3FRPB 1KDCA 1PYWD 4IUTA 4HSVA 5EKLA 1BCPD 4EQPA 1JQYD 3QJYA 2CHBD 3X3NA 1H9JA 2KCNA 3HOXB 5C0XG 4LMQD 2B2WA 5J22A 5DM73 4FNFA 4F7XA 1NSNS 2QDBA 1TY2A 1GUWA 1DCZA 1GHJA 1TY0A 3RMHA 1E2ZA 5M3FB 1R4PB 3DUZA 1EQTA 3NWSA 4IURA 3R3OA 4Q0FA 1JORA 4KD3A 2F3WA 4OIKA 1CFMA 1G6ZA 5JVG3 2J4XA 2K32A 1RF2D 4UDUC 2BOSA 3DXJC 1SNPA 3S14B 3I91A 3TBIB 1QWYA 3N6RA 4MN3A 4CJ1B 3S2DB 3J80L 1SBBB 2F0SA 2LMCB 1SNOA 2ENBA 3VYTA 3NE5B 4G7ZC 3AMUA 4FF4A 2LY7A 1GUNA 4LJZC 2F0OA 1U4LA 1SE3A 1IYVA 3J81L 2L5TA 1R4QB 1PMRA 2X6GA 1PLFA 4K5WA 1V1PA 1WTRA 4CKEA 1BCPC 4KHZA 2XNAC 4Q5VA 2G9HD 2F0LA 5CORA 5IGFA 1LTRD 2EYJA 3Q0AA 5FLXL 2KOLA 2PMZB 3SK6A 5I6WA 1SNMA 1OO9B 4BY7B 2B63B 5IGDA 1XTCD 1DXMA 1D1KA 2XN9C 3J7AV 2CQAA 4XIGS 4K6DA 3MZ5A 4OO1G 1CQFA 2F0IA 2AQ1B 2A6HC 1I4XA 2G9DA 5KYLA 3S1MB 1S5FD 2XWJB 1F2YA 3OIQA 4RGTA 1PZJD 2F4IA 1QG7A 3DM1A 1LACA 4DFAA 5EPKA 3QO2A 1STAA 1LTID 4RAUC 1EOTA 2I46A 1SYBA 4IUPA 3MC0B 1CHQD 4O42A 1BQQT 3HRZC 3G6JB 3HZXA 4ZUJA 4FXDA 1A3TA 2NZ1D 4KI0A 1CQVA 3EQLC 1HA6A 5EQ0A 3OMGA 1MBYA 3VR2A 4XQJA 3W2DA 1GUGA 1KNEA 3MXUA 2XRSD 4A3EB 4LK1C 4DAYA 3SR1A 2F0HA 1PRTD 3A8IE 3HP3A 4RCOA 4A3FB 3LWUA 3CU7A 2MPMA 2WB1B 1LTBD 2FINB 3K5OA 3J80E 1CM9A 2DY8A 1E2WA 3L9AX 2ZT9C 3D31A 1RDPD 2N88A 1V43A 1F9RA 4U68A 4B08A 2KEDA 4A93B 4CHTB 2PNRC 4L6TB 4IUQA 2ICEC 4IFDH 2B8GA 2A74C 5DAUA 3PO3B 3E5SA 4X3KA 1LTSD 5C0XJ 1FGBD 3H09A 4OO1I 1CTMA 2J0TD 3DWQA 3HOWB 1LO5D 1IHZA 3HOVB 5AFWA 1JOOA 3OWFA 4P2CB 3TP8A 2JSOA 3PUXA 1TT2A 5IT9E 2RVLA 1VMPA 5EPJA 3TSSA 3FEWX 3H6MA 1K8MA 3A7AB 1STEA 3UI2A 3K5LA 1SJED 2FJ2A 5FK9C 3NTKA 3RLFA 2ID0A 1I4QA 1PRTC 4BBRB 5CYUA 3VYUA 4WORA 4C3IG 2R6GA 5LL6S 4FXKC 1NCVA 1PFNA 1I3QB 2VB3X 3R2TA 1FNUA 4PMCA 2SNMA 4Z9CB 1ESFA 3PIP3 1JWMD 4K6LA 3NPPA 1Q90A 1K8OA 4J8QA 1B44D 5TSSA 1Q8IA 1UUPA 4J6HA 4HMIA 4K8JA 1B50A 2F0FA 3KBXA 3GO5A 1PDQA 4PMBA 4RKBA 2B2YC 2QKIC 4EQNA 1VDZA 1ILPA 5LHY1 2WV6D 1H9RA 1YNJD 3U9OA 4FYDA 3WOEA 4N9PA 2Y0SB 3J81E 4XT3B 1PFMA 4C3IB 3OSOA 1BR9A 2KQ3A 3QWNA 3V05A 2MUYA 5JPMC 4G7HC 4XQNA 2A73B 2ZXOA 4R8IA 3QG1A 3M7NA 2WAQB 1EL0A 4XT1B 3CRLC 5IODA 2A5HA 3OPOA 1BBXC 2R93B 1U9RA 4HCEA 4IUVA 2JA5B 3M85A 2PZUA 5C44B 2QILA 3BVGA 4H44C 1I4PA 3TN2A 5JEAJ 3VA7A 2NVQB 5FKAC 2F03A 4N9TA 1JR0D 3SK4A 2EJMA 2PYKA 1LLRD 1XYIA 5KNCA 1B3AA 1SNCA 1DOLA 4KK7A 3M4YA 1PRTB 3QIAA 3TDQA 2LS01 5BN4A 1HA5A 5IIFA 4ZK9B 3T51B 4H7BA 2VB2X 3K57A 2HDMA 2VXWA 1OXVA 4CKCA 4IFDJ 4FF1A 2NTTA 3NQTA 3WDNA 1ML0D 4XXEA 2JA7B 1PXUA 1EZ6A 1VCIA 1NUCA 2H4OA 2B2WC 4FP5D 5KEEA 4KKUA 1SEBD 3BVMA 4ID6A 3I4LA 1SYDA 4ZKCB 2K01A 3JAML 4DN4M 1G2TA 4H0LC 4C3HB 3OWEB 4DXGA 1EZ8A 1IYUA 3R2IA 5CBEE 4XQQA 2IX0A 1IL8A 3BVZA 1SYGA 1WVLA 2EZVA 4ZQ3A 1UEAB 3FMCA 2NVXB 3I4MB 1ILQA 1JOKA 4FF2A 4L63B 2K5WA 2DY7A 4DK1A 2IX3A 3SK8A 2B2VC 4KY7A 1ENFA 1EEFD 3BYTB 4KJNA 3D8GA 5T1IA 1MSHA 2JXMB 2E75C 3MWYW 4ILWA 5BN5A 3DWPA 1BO0A 3Q23A 1K83B 2R7ZB 1Y8OB 1YNJC 1W6JA 3PMFA 5CV9A 2JYOA 5E3FA 1GHKA 4X3TA 3NBHA 1A3VA 4NP5A 3VYSA 1MSGA 3HOYB 3V96A 1OXTA 1TU2B 2A6EC 3DEPA 2FHTA 5A2QE 1BOSA 1ZEQX 5EBCA 1B2TA 1TWCB 3ND9A 4KJOA 3NHHA 1SYFA 1S5ED 1C4QA 2KJXA 3NQIA 1IW7C 4JK1C 2AQ3B 2MP1A 1WTPA 2KUMA 3A8JE 3H91A 1HQRD 2EYFA 3SEBA 2TMPA 4K5XA 2K05A 3MXNA 3GTJB 1Y69U 1CK1A 5C4HA 4IFDI 2NUCA 3PUZA 2I07B 5C5LA 2BE5D 3X3MA 4C1NK 2FFKB 5JPNC 5G3LD 3ZYYX 4RKLA 1DJRD 3EVQA 5I6YA 1D5ZC 1LT5D 2L0CA 3D3RA 3HG9A 4R8NA 1ONLA 1HFGA 4QIWB 3KLSX 1EFID 2RA4A 5EGTA 5T1GA 1RTNA 3C2PA 1M8AA 1EWHA 1DM0B 1STBA 4KY5A 2L12A 3C1EA 4HSPA 4QUCA 5IGBA 1Y1WB 1S5BD 1I4HA 5E4XA 1SE4A 4TKOB 3VA5A 3VR6A 3KUPA 3VR3A 4IALA 1EY8A 1TR5A 2J7ZA 2B39A 5ELFA 2XIWA 3TP5A 3JAME 5CC4A 4KHVA 3SK5A 4DGZA 1V1PB 4ZYSA 4PNYA 3U9SA 3CQZB 2TSSA 4A3BB 2IW3A 2SEBD 2NN6I 1WTOA 3FVQA 1DYQA 5IGGA 1KNAA 4PMWA 1R9TB 5CR3A 4IFDG 2DNCA 4BA1I 3D4DA 2EYLA 4B9XA 4DA2A 1DZ1A 5IGCA 4MIUA 1FD7D 4M1UB 3GP7A 4ODGA 4HCSA 3DEOA 1WTWA 4JBWA 1BCPF 4OO1H 1RKNA 1RTOA 1EU4A 5C0XI 2F0GA 4C56C 5M9OA 1IW7D 3MFYA 1V8QA 2Q8IB 2BA1A 2OF1A 4FO2A 1NR2A 4GZYC 2Z4IA 3RZOB 4X3UA 4CJ0B 3MXPA 3PV0A 1OXXK 1AZQA 1KLUD 3R93A 4CBVA 2Z1CA 4DK0A 1MI2A 4V0BA 2D9UA 1VF5C 2F0JA 5C4JB 3GTOB 5K5PA 1TKWB 1TS3A 3NSWA 2F1MA 2PCFB 1LABA 1MGSA 1PZID 1C48A 5D65A 4A3DB 2Q8RE 3EA6A 3HEJA 2B2TA 5M5WB 4OL7A 3FDTA 5KRUA 2JP1A 1J9OA 1KLGD 3TZDA 2X69A 5C5MA 3GQBA 3SXHA 2X6LA 3D4RA 1RODA 3S15B 1QILA 1WTQA 1D5MC 3DWAA 1Y8NB 1HXYD 2XSCA 1TVXA 1Q1EA 1DOKA 5LL6X 3MFGA 1CZWA 1VF7A 3OW7A 1CHPD 2F0MA 1JC7A 2PZTA 3NK9A 3GTGB 4XTCS 3FPPA 3MTSA 1QB5D 1ZKOA 3ND8A 3T56B 1B1ZA 1STYA 3D6WA 3S16B 3A54A 2IL8A 2EYMA 5J39A 3PO2B 2R61A 1W6KA 3C46A 5FLXE 2B2YA 4RHRA 3I3CA 2O5IC 3IAYA 5KNDA 2NN6H 3TZUA 3H94A 1PZKD 5IT9L 3GV3A 4C2MB 1ET6A 4A3MB 3A56A 4RFBA 1GJXA 4HTHA 1HUNA 2RDGA 4IZ8A 1D1IA 4K2KA 2Q8TA 3GTMB 2A68C 3N52A 1OXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RDF A;  4KTA A;  1KDA A;  2LKV A;  4KJO A;  5IIF A;  3RUZ A;  3TP5 A;  2F0P A;  3HEJ A;  3D4W A;  3P1H A;  4H7B A;  4G57 A;  5ISR A;  5CC4 A;  4OL7 A;  3NHH A;  4KHV A;  5KRU A;  3SK5 A;  4J6H A;  5C3X A;  1SYF A;  4YIJ A;  4HMI A;  1EY6 A;  2O4X A;  4K6D A;  3R3O A;  3TME A;  1EY5 A;  3NXW A;  1ENA A;  3MZ5 A;  4K8J A;  4DGZ A;  2F0E A;  4KD3 A;  5NUC A;  1JOR A;  3BDL A;  2F0T A;  2F3W A;  1KAA A;  4PNY A;  2F0F A;  2F0I A;  2RKS A;  3QOJ A;  4K8I A;  5C5M A;  4DU9 A;  5IGE A;  1EQV A;  1SYE A;  1EY9 A;  1KAB A;  5DEH A;  3C1F A;  3NQT A;  3SXH A;  4PMB A;  5IGG A;  1SNP A;  3P75 A;  4F8M A;  1AEX A;  3QB3 A;  4K5V A;  2EYO A;  4RKB A;  4HMJ A;  3SHL A;  1EZ6 A;  4DF7 A;  3MEH A;  5KIX A;  4EQN A;  2RBM A;  1NUC A;  4EQO A;  5KYL A;  2EXZ A;  1F2M A;  2F0K A;  3BDC A;  1EYD A;  4KV6 A;  5CR3 A;  1SNQ A;  5CV7 A;  3OMC A;  2EYF A;  2F0D A;  5KEE A;  5CV8 A;  1A3U A;  1F2Y A;  4WRD A;  4ID6 A;  3U9O A;  2EY6 A;  1SYC A;  3D4D A;  4K5X A;  3EJI A;  1SYD A;  2EYL A;  4B9X A;  5DAU A;  2HQE A;  4N9P A;  2F0S A;  1SNO A;  2ENB A;  3E5S A;  2EY5 A;  4DFA A;  3OSO A;  3DHQ A;  5C4H A;  5HUR A;  2F0N A;  4KD4 A;  2F0M A;  3ERQ A;  2PZT A;  2KQ3 A;  2NUC A;  5C4Z A;  5EKK A;  5IGC A;  4MIU A;  3NK9 A;  5C5L A;  1IHZ A;  2F0O A;  2PZW A;  3NP8 A;  4ODG A;  1EZ8 A;  4TRD A;  5CV6 A;  1STA A;  2F0Q A;  4NMZ A;  2F0V A;  2F0U A;  4RKL A;  5IOC A;  1SYB A;  1JOO A;  1A2U A;  1EY0 A;  2EY1 A;  3EVQ A;  3MHB A;  3OWF A;  5I6Y A;  1JOQ A;  4QF4 A;  1STY A;  2SNS A;  5F2D A;  4K5W A;  4B9W A;  1STH A;  4ZUI A;  1A2T A;  2F0W A;  5JOB A;  1SYG A;  5CV4 A;  2EYM A;  2PQE A;  4KY6 A;  4I65 A;  5CV5 A;  4ZQ3 A;  5J39 A;  1RKN A;  3HZX A;  2EY2 A;  4ZUJ A;  3TP8 A;  3S9W A;  5E1F A;  1KDB A;  5IOD A;  1TT2 A;  4LAA A;  2KHS A;  1A3T A;  1JOK A;  2F0G A;  4R8N A;  3T13 A;  5M9O A;  3H6M A;  1SND A;  2OEO A;  1U9R A;  3SK8 A;  2OF1 A;  5CGK A;  4KY7 A;  4E6I A;  3T16 A;  3DMU A;  4QMG A;  5C6A A;  1KDC A;  1EY4 A;  2PZU A;  3D8G A;  4KJN A;  2F3V A;  2F0L A;  1EY7 A;  2PW5 A;  4IUN A;  5EGT A;  3TP6 A;  3OMG A;  2WAC A;  5IGF A;  1EYC A;  1TQO A;  2EYH A;  5C3W A;  4J1M A;  1STG A;  1STN A;  4K14 A;  1STB A;  4KY5 A;  5EKL A;  2EYJ A;  3MXP A;  1ENC A;  2OXP A;  3C1E A;  4EQP A;  3V2T A;  5IGB A;  4QB4 A;  2EYP A;  2PW7 A;  4K2L A;  4NKL A;  5I9O A;  5J1Z A;  3PMF A;  5CV9 A;  5E3F A;  2M00 A;  4N9T A;  1EYA A;  3VA5 A;  4WOR A;  3LX0 A;  1F2Z A;  3QOL A;  3SR1 A;  4S3S A;  3SK6 A;  5I6W A;  1SNM A;  3SK4 A;  1II3 A;  4HTH A;  4IAL A;  2F0H A;  1A3V A;  2PYK A;  4NP5 A;  2F0J A;  4EVO A;  4F7X A;  5J22 A;  1EY8 A;  4NDX A;  4ME5 A;  4IZ8 A;  3MVV A;  5JAV A;  1NSN S;  1TR5 A;  5IGD A;  5K5P A;  1SNC A;  3ITP A;  4PMC A;  2QDB A;  2SNM A;  4K2K A;  5KYI A;  2SOB A;  3ERO A;  5HGT A;  3D6C A;  5I9P A;  5KGU A;  3NUC A;  3TP7 A; 
#chains in the Genus database with same CATH topology
 1U5K A;  1GOZ A;  1TWA H;  1D5X C;  4DV2 Q;  2E2H B;  3VYR A;  1Y1V B;  1HZA A;  3S14 H;  3KK7 A;  5ELE A;  3HOV G;  3A5Z B;  3G6E A;  1RJT A;  1ET9 A;  4RGM A;  2DUD A;  1NR4 A;  3C1F A;  3KFU A;  1NY4 A;  1WCM B;  1JE4 A;  4X62 Q;  4POF A;  3BZD B;  2E8G A;  3P75 A;  2L9H A;  1VQG A;  3J7A 5;  2IX1 A;  4U67 3;  4LUO A;  5I2X A;  4MTK A;  1TWA B;  2AWN A;  2EJF C;  3MXG A;  3HKZ B;  2E76 C;  1A3U A;  4YY3 L;  1NAP A;  2QCP X;  2B63 H;  1UE6 A;  1AFP A;  1C9O A;  3UDF A;  3EIV A;  3TRE A;  2GN5 A;  3DHQ A;  3CME A;  3CC7 A;  1IKM A;  4KD4 A;  1VMC A;  5C4Z A;  3I4N B;  1S72 A;  3S17 H;  4JVZ A;  3KDF A;  4NXN Q;  3R8B A;  2IJ0 A;  4QL5 A;  4X6A H;  4WJW A;  4JI8 Q;  3S1N B;  3UDX A;  4MHE A;  3PO2 G;  3GV6 A;  5COY A;  2D2C C;  2HHH Q;  4QF4 A;  1IBL Q;  3I90 A;  4BA2 I;  4C3H G;  5CV5 A;  4O1N A;  1BF4 A;  5JJZ A;  1RL2 A;  2EOT A;  3FPU B;  3GDE A;  1GM5 A;  5C44 H;  1KL9 A;  5K36 H;  2JE6 I;  1A62 A;  1G91 A;  3J7Y W;  3DMU A;  5IWA Q;  2VUM B;  1EY4 A;  3HGB A;  1D2B A;  1JCK B;  1EY7 A;  2KEN A;  4DAY B;  1IBM Q;  3KLS A;  4IOA A;  4J1M A;  1STG A;  1STN A;  3CCJ A;  3PQI A;  4R4O A;  3SVM A;  4RWS C;  4FVM A;  3CCS A;  3BDO A;  3V2T A;  5FO9 B;  1BUV T;  4BBS G;  4QB4 A;  4IN3 A;  2M2L A;  2Z6K C;  5LMU L;  4AQY Q;  4V19 0;  1XNQ L;  2HCC A;  3KF6 B;  3PUW A;  5ELN A;  2WKC A;  1H9S B;  2UXB L;  1DOM A;  3ULP A;  2PQA B;  2JA6 G;  3E9I A;  4LFA Q;  3ITP A;  1G2S A;  2Q2H A;  1HTP A;  3CCQ A;  3KF6 A;  2JA8 H;  3ERO A;  1SXT A;  2JEB I;  5HGT A;  3TP7 A;  3W5O A;  1B53 A;  2CW0 C;  3BZC A;  2C9O A;  5BR8 L;  2K4K A;  2NBF A;  2LKV A;  5ISR A;  4IOC A;  4JPB W;  3MAQ A;  5IYC G;  5M3M G;  5KYI A;  2O2L D;  2MGS A;  2NWG A;  3RLN A;  1HHV A;  2A69 D;  4DU9 A;  1WD0 A;  2D62 A;  3E6Z X;  2RSO A;  1HUM A;  4LWC A;  2VQE L;  3RZD B;  2HUG A;  3OW2 A;  2MFI A;  1SMX A;  4B3R Q;  1AEX A;  1N33 L;  1DGS A;  1G29 1;  1I3Q H;  2H1E A;  4DAV A;  4EQO A;  4BWG B;  3F2C A;  5CV7 A;  3A55 A;  1TWH H;  2Z9H A;  3ERS X;  5CV8 A;  3LWE A;  2EY6 A;  1EU3 A;  5FO8 B;  5A2Q L;  3T1H Q;  1BBW A;  1M4V A;  2E5L L;  1X3P A;  3HOU G;  2EY5 A;  4JI8 L;  1D6E C;  1I94 L;  3HOX H;  2JA5 H;  1J8I A;  3AB9 A;  3GTJ H;  4JI0 Q;  2EVB A;  2R93 H;  2K5Q A;  4OWX B;  2RQX A;  2HQL A;  3GTQ B;  2UXC L;  1L1O C;  4WFN 3;  1F77 A;  1I50 B;  3S16 H;  3KBG A;  3H0G B;  4DV7 Q;  2KEC A;  1EWI A;  4HAE A;  4XYQ A;  1S5D D;  2K28 A;  4X3S A;  1UNS A;  2K5N A;  5FLM H;  2PQE A;  3HOY G;  1HQM C;  5FO7 B;  1TWG B;  1E22 A;  2CWP A;  1DON A;  4X62 L;  1F9S A;  3U50 C;  3K58 A;  1KAW A;  5GQO A;  4PZ7 A;  2GA4 B;  2MQH A;  3I72 A;  1Q12 A;  3EN2 A;  2F3V A;  3TP6 A;  2AUK A;  1TS5 A;  1PFB A;  3HOZ B;  1EEI D;  1GXD C;  2EJG C;  2EYH A;  1MJE A;  1FNV A;  3DLL A;  1HZ9 A;  4N8X 1;  1IXR A;  3GTK B;  1SDF A;  3TQY A;  2K5D A;  2IY5 B;  1Q86 C;  2DN8 A;  2E2I B;  1HZC A;  2V1C C;  2BA0 A;  4TSS A;  1CI3 M;  2OTL A;  4UAI A;  4A3E H;  2HD3 A;  4GOP C;  4EVO A;  3I4M G;  1B4O A;  2EPB A;  4OX9 Q;  3KYH C;  2FMM A;  4OHJ A;  2AQ2 B;  2K14 A;  2ALY B;  5ELC A;  4HJ8 A;  1CA5 A;  4DNR B;  2WP8 J;  2SOB A;  1SFO B;  4AYB E;  5I9P A;  3FKI B;  3NUC A;  2PI2 A;  4JI2 Q;  3S1R B;  1DD2 A;  3T1Y Q;  1QNK A;  2NTS A;  2IPK D;  4CDE C;  5ELB A;  1HJP A;  1ENA A;  4B3T Q;  3K6O A;  1NTG A;  2AUJ D;  1KD1 C;  2QEJ C;  2RKS A;  1VQD A;  1EQV A;  1SYE A;  1T5X D;  5EKI A;  3URY A;  2RF4 A;  1HFN A;  3SE0 A;  1JE5 A;  1CT1 D;  2Z8L A;  4HED A;  4IPG A;  2RBM A;  1AH9 A;  2EXZ A;  3LNN A;  4LF4 Q;  4AYB B;  2F0D A;  4C3J G;  4R9W A;  4WJ4 A;  2AMC B;  3HS0 C;  3GTL B;  4F87 A;  1UE5 A;  3RNU A;  3QR8 A;  2HQE A;  2HCI A;  1A0I A;  5CBA E;  1I6H B;  1NNX A;  1PTO B;  1SAP A;  4DV6 L;  5HUR A;  3PIO A;  4A3G B;  3FKI H;  2PO4 A;  1TS4 A;  2KCC A;  5ELD A;  1AP0 A;  4ZCK A;  4KKS A;  1FJG L;  2L1B A;  2QGQ A;  1KQS A;  4BY7 H;  3K5N A;  1K3R A;  2YU9 B;  1JOQ A;  2VL6 A;  3UE0 A;  1A2T A;  4LNQ A;  5IYD G;  1IZ6 A;  5IY0 A;  2EY2 A;  4OEM B;  1O7L A;  1MJC A;  2OT2 A;  3M4P A;  3PO3 G;  3CKI B;  3UE1 A;  3K8A A;  1FYC A;  3T53 B;  1PH4 A;  3L3O C;  2AHO B;  2NVT B;  3S2H B;  3I70 A;  1LV9 A;  1PTO C;  1VQ6 A;  3GD7 A;  5C3E H;  3C3L A;  4DR3 L;  3H3V C;  1PYS B;  2OWO A;  2OXP A;  4APV A;  1YNN C;  4GKK L;  3VR4 A;  1B8A A;  2PW7 A;  4K2L A;  4X66 L;  2EDG A;  5J1Z A;  2AWO A;  1GUS A;  4B3M Q;  1LTA D;  1F2Z A;  1E2V A;  4JG2 A;  4BS9 A;  1JJG A;  1LTL A;  2ZTD A;  4RH6 A;  1D8L A;  1JWS D;  1E7Z A;  1X3Q A;  2NYZ D;  4HJ9 A;  4ME5 A;  3KF8 A;  3MVV A;  4K0K L;  2HIV A;  2K1B A;  2WII B;  4P71 A;  2V4D A;  5M5X B;  4JOI A;  2D5D A;  1T9H A;  4DR4 Q;  1N32 L;  1S5C D;  5H1S E;  2ICI A;  1QNU A;  2SDF A;  5EAY A;  2WFW A;  1Y14 B;  2E5L Q;  4KTA A;  4JI6 L;  3M9B A;  1XJV A;  4JOI C;  4TQU S;  2CVR A;  5G3L F;  3CRK C;  3S1R H;  1HPC A;  3U4V A;  2K03 A;  2CFM A;  3AFQ A;  5C3X A;  1PH2 A;  2O4X A;  4LFA L;  3NXW A;  4HR7 B;  1LTT D;  4YWL A;  5JEA H;  3QOJ A;  5IGE A;  4X66 Q;  4MNO A;  4BY1 B;  1ASY A;  2JA5 G;  3P7J A;  1NMG A;  4YY3 Q;  1EIF A;  5GRO A;  4OWW B;  2K6A A;  1CZG A;  2WAQ G;  1YNN D;  5M5Y B;  3EJI A;  4NW2 A;  5LMN L;  1B9M A;  4JI5 Q;  2VW9 A;  5EPL A;  1JIC A;  1FGU A;  3OHX C;  4AYB G;  4C3J B;  3HOY H;  1CKM A;  1X32 A;  2RCN A;  3CW2 C;  3HOV H;  2E2J B;  4DNT B;  4CGY B;  1OXS C;  4PG3 A;  1SE8 A;  4MZ9 A;  1I6H H;  1IBL L;  5CV6 A;  4ABN A;  1SRU A;  3NTI A;  1QE6 A;  5IOC A;  1A2U A;  1Q81 C;  1Q3L A;  1AN8 A;  2QDL A;  1MIU A;  1UE1 A;  4I7Z C;  3ER0 A;  1RD9 D;  1KDB A;  1O7Z A;  1RCV D;  3Q24 A;  4KKT A;  3HOU B;  1WFQ A;  1SND A;  3PUY A;  3L7Z C;  5CGK A;  3OYY A;  1LTG D;  1PRT F;  1O80 A;  2A6H D;  1Z6H A;  2NN6 G;  2VS1 A;  3E3X A;  3I4M H;  4GKK Q;  2N55 A;  5C3W A;  1PH6 A;  1E24 A;  1I4R A;  3BJU A;  1ENC A;  2KVM A;  1UE7 A;  4NKL A;  4QGU A;  1S4Z A;  2XWB B;  3S1N H;  3LX0 A;  1L0X B;  2ZTE A;  4S3S A;  4A3M H;  1SMY C;  4DAP A;  1VQP A;  1XPR A;  4BXX H;  4GLA C;  5IYC H;  3IKJ A;  1HR0 Q;  4JBK A;  4OIJ A;  3AQQ A;  2M9V A;  3K0X A;  5JVH 3;  4DR2 L;  5K36 G;  1U4R A;  1E0B A;  4FF3 A;  2WB1 E;  4X65 Q;  2KCT A;  3B6Y A;  3MEF A;  1EIG A;  2JJQ A;  4EGV A;  1KDA A;  1I6V C;  4G57 A;  1Z47 A;  2I5M X;  2DNE A;  4FDB A;  4P73 A;  4A3J G;  1QCB D;  3F2B A;  2CW0 D;  1W2B A;  1CA6 A;  4DR1 L;  4JI4 L;  1KAA A;  2UXB Q;  3IL8 A;  1BKB A;  2CH4 A;  4LF8 L;  4PZ6 A;  5M3M B;  1Y8P B;  3OIP A;  1HZB A;  5KNB A;  3PIO 3;  3CCR A;  1PTO D;  4MTN A;  3QB3 A;  3IFT A;  3H3V I;  4HMJ A;  1YHQ A;  1HCZ A;  1IKL A;  3MEH A;  1WJJ A;  4LF4 L;  2F0K A;  1JB3 A;  1EYD A;  3GTL H;  3CHB D;  4DK3 C;  3M3Y H;  1W3S A;  4RHS A;  5I4D A;  3PUV A;  5ELO A;  4A3D H;  1VQL A;  5FLM G;  2BDN A;  4RGO S;  1YJN A;  2LXJ A;  1XNR Q;  4ULL A;  5EKK A;  3K0Y A;  1H9S A;  2NB0 A;  1D7Q A;  2VQE Q;  2NVX H;  3NP8 A;  4ZAI A;  4X64 L;  1VQH A;  2C5C A;  2F0V A;  4OXP A;  1PTO F;  2JA9 A;  2K7V A;  1L1O A;  4B9W A;  5JOB A;  3RD4 A;  2B2U C;  2F0W A;  5C0X H;  2EE1 A;  2K52 A;  4KY6 A;  2VUM G;  1N36 Q;  2PNH A;  2YTY A;  3M3Y B;  5E1F A;  1H9M A;  4I7A A;  1B3Q A;  1LYL A;  2Z6B A;  2UUC Q;  2OEO A;  3W3A A;  4E6I A;  1ZYR C;  3S1Q B;  4UP7 A;  1SRO A;  2QF7 A;  2YYZ A;  2JEA I;  4DR3 Q;  2WAC A;  4KMU C;  1EYC A;  3G71 A;  5IP9 G;  2E2D C;  4A3I B;  2R3Z A;  4GN5 A;  3BS1 A;  2ZJP A;  2EQS A;  3NBI A;  1VQO A;  2Q2T A;  2N8N A;  3I4O A;  1XX8 A;  4Y7N B;  2K5H A;  3EFX D;  3FHW A;  2JA6 H;  2MJ8 A;  1LT3 D;  3K7A H;  3I2Z A;  4NDX A;  3VR5 A;  4R4Q A;  4C3I H;  1XWE A;  1TWF B;  1IL2 A;  4FXG C;  3NBH B;  5DM6 3;  4J15 A;  1VQ8 A;  2N78 A;  1BXT A;  1VQA A;  3D6C A;  4CJ2 C;  2RDF A;  1V1O A;  3O13 A;  1YJ9 A;  2F0P A;  3Q22 A;  3D4W A;  5EBD A;  5M3M H;  2CH4 W;  2QEX A;  1JJC B;  2B2T C;  3S9W A;  3TME A;  2E74 C;  3F2U A;  4LF9 L;  5IYB H;  5NUC A;  1SJH D;  3BDL A;  2CCZ A;  2F0T A;  2MO1 A;  1VQB A;  1A63 A;  2N3S A;  4DR5 L;  1PH9 A;  1EY9 A;  1KAB A;  4JI7 Q;  1O78 A;  1F9Q A;  3ONA B;  3GTP H;  1HRJ A;  1AE2 A;  3I8Z A;  2EYO A;  4DF7 A;  3SHL A;  4A3J B;  4A3K B;  3BDC A;  1F2M A;  3CPF A;  3OMC A;  2L4N A;  5D3D A;  4QQB X;  1VQ7 A;  4RA8 A;  2K33 A;  3GTQ H;  2R7F A;  4A3G G;  2K75 A;  1LT6 D;  4H13 C;  4LF5 Q;  2LFN A;  4GLX A;  3M4O B;  3HKZ G;  2RSN A;  3CCM A;  3RZO H;  3RZD H;  4JBJ A;  3L2P A;  3OOC A;  3SDZ A;  5C4J H;  2B2U A;  4HJA A;  3T4A C;  1X55 A;  2A68 D;  2B2V A;  3BU2 A;  4ZKB B;  2IT1 A;  5A35 A;  1TS2 A;  4P72 A;  3EBE A;  1BNZ A;  1STH A;  1ICF B;  1X54 A;  2BDO A;  1AW7 A;  2GVA A;  4I65 A;  3BG3 A;  2IWH A;  5DLQ E;  4JYA L;  3I55 A;  1Q1B A;  4GS3 A;  1SN8 A;  2UXC Q;  5C4X H;  3I73 A;  5E4W C;  2F4V L;  2PPB C;  2H5X A;  4IUN A;  3AEV A;  1NE3 A;  2XVS A;  4QCL A;  1GUO A;  1YZ6 A;  2B3G A;  4IJL A;  3CXC A;  2KHI A;  2JA7 H;  4ZRZ A;  5I9O A;  2FMC A;  2XGT A;  5D3I B;  1M90 C;  4K0K Q;  2ZXP A;  1CKN A;  2FXQ A;  1II3 A;  3CCV A;  4PV1 C;  5JAV A;  1QJO A;  1GUT A;  1RHP A;  1XXG A;  2NVY H;  2L11 A;  4GKJ Q;  4ZLT F;  1H9K A;  3PO3 H;  2IHF A;  5IE8 A;  1F9P A;  2I5H A;  2BCO A;  1B9N A;  3PF5 A;  1EIH A;  4JI2 L;  4LF9 Q;  1S40 A;  3T1Y L;  3Q6S A;  1LT4 D;  1FR3 A;  4BBS B;  2A6E D;  3I4N G;  1O7Y A;  3A7L A;  4DR6 Q;  1EY6 A;  3D0F A;  4A93 H;  2R92 B;  2F0E A;  4JI4 Q;  4L8J A;  4G7O C;  4XDX A;  2CKZ B;  3GTO H;  1R9T H;  1ESR A;  1ZYR D;  3J7A F;  1KC8 C;  4F8M A;  3NEL A;  2L15 A;  4M8A A;  1TWH B;  4HN7 A;  5LMN Q;  2A69 C;  1SNQ A;  4JI6 Q;  2WKD A;  1G8Z D;  1SYC A;  1XMO Q;  3S2H H;  4DXF A;  2VY3 A;  4KLK A;  1C8C A;  2I5L X;  3G7L A;  1XNR L;  2KA7 A;  2N49 A;  2F0N A;  1VQE A;  3ERQ A;  4KN4 C;  4QUF A;  1XMQ L;  3IFD A;  1VQK A;  1C7Y A;  2WIN B;  5JEA G;  1BDO A;  2PZW A;  4A3F G;  2MHV A;  2F0Q A;  4RMF A;  1NJI C;  1EOV A;  4NMZ A;  1WTX A;  2EY1 A;  3MHB A;  2RDH A;  2SNS A;  4ZUI A;  2BE5 C;  5CV4 A;  4YHH Q;  1EFW A;  4DV7 L;  4DR5 Q;  5FOB B;  3T13 A;  4A3G H;  1LM0 A;  3J7Z C;  1U4M A;  3K5M A;  1PH5 A;  3S15 H;  1TWG H;  5I2Y A;  2Z4H A;  3T16 A;  4QMG A;  2KEE A;  4IQZ A;  5C3E G;  4PQX A;  1MD2 D;  1Q82 C;  2PW5 A;  1PH7 A;  1PYB A;  1TQO A;  5AJ3 L;  1KTK A;  4P74 A;  4K14 A;  5EJW A;  5C4X B;  1KHI A;  3ULJ A;  1PH8 A;  1ZXT A;  4YCV A;  1Y1V G;  2EYP A;  3K7A B;  1SSO A;  4B3M L;  3NWT A;  3AU7 A;  4KN7 C;  1BCP B;  5J3B A;  5GAG C;  2M00 A;  2O5J C;  1EYA A;  3RN2 A;  3QOL A;  1QVF A;  3JAM c;  1L0Y B;  1AZP A;  3GTP B;  1A6X A;  5C3E B;  3WOF A;  2R92 H;  1FNW A;  1UAP A;  5KGU A;  1SMY D;  4F88 A;  1ICW A;  4OGQ C;  2HDL A;  2L55 A;  3NTH A;  3RUZ A;  3P1H A;  2D0P A;  1F2L A;  5D14 A;  4LFC L;  1WD1 A;  1WTV A;  3BYY B;  1J6Q A;  4YIJ A;  3S17 B;  5CMD A;  3F2D A;  1EY5 A;  2XRQ D;  3MXN B;  4B3S Q;  2B8F A;  2ZXR A;  3MA2 B;  4JI5 L;  1SE2 A;  4DUZ Q;  2NVY B;  3P20 A;  4G4K A;  4K8I A;  4DV5 Q;  5DNF A;  2K04 A;  5DEH A;  1EWC A;  1I4G A;  4B3T L;  1PHJ A;  1JWU D;  4K5V A;  1T5E A;  5KIX A;  3A8K E;  4UPA A;  3J80 i;  4KV6 A;  4C1N I;  1B7Y B;  4XYO A;  1TWC H;  1PTO H;  4WRD A;  1UEB A;  2JA8 B;  4NXN L;  4CKB A;  3K59 A;  3GTG H;  1Z7T A;  2JQO A;  3KLR A;  4JV5 L;  4DV0 Q;  5BN3 A;  3M7G A;  4RCN A;  4OWT B;  3UDI A;  3E0J A;  2JA6 B;  3S1Q H;  4A3B G;  4TRD A;  5C4X G;  4IUU A;  2F0U A;  3HOZ H;  1TII D;  1V9P A;  1EY0 A;  4JBM A;  2JK8 A;  5F2D A;  2C35 B;  1EQR A;  2VNU D;  1HTL D;  1QOH A;  1NMF A;  5IP9 H;  1A15 A;  1QZH A;  2YTV A;  1KIX A;  1KRT A;  2HHH L;  3KJO A;  4JYA Q;  4LAA A;  2KHS A;  1U4P A;  3OTO L;  1K83 H;  4RGN A;  3RR5 A;  5C6A A;  3FRP B;  1KDC A;  1PYW D;  4IUT A;  4HSV A;  4B3R L;  4HJ7 A;  5EKL A;  1BCP D;  4EQP A;  3U58 A;  4A3F H;  1JQY D;  4GNX C;  1HNW Q;  3QJY A;  2CHB D;  3X3N A;  1H9J A;  2KCN A;  3HOX B;  5C0X G;  4LMQ D;  2B2W A;  3I4N H;  5J22 A;  5DM7 3;  4FNF A;  4F7X A;  2F4V Q;  1NSN S;  3PCO B;  1PV4 A;  2QDB A;  1TY2 A;  1GUW A;  2EIF A;  3CCU A;  2ATW A;  1DCZ A;  1GHJ A;  4C3H H;  1TY0 A;  3RMH A;  1E2Z A;  5IP7 G;  5M3F B;  1R4P B;  1E1O A;  4NB3 A;  3DUZ A;  1EQT A;  4IO9 A;  4A75 A;  3NWS A;  4IUR A;  3R3O A;  4Q0F A;  2UUC L;  1JOR A;  4KD3 A;  2ZM6 L;  2F3W A;  4OIK A;  4DR2 Q;  4A3C H;  1CFM A;  2IHE A;  1G6Z A;  5JVG 3;  2J4X A;  2K32 A;  4YCU A;  1RF2 D;  4UDU C;  2BOS A;  3DXJ C;  1SNP A;  1TXY A;  4CDD C;  4YHH L;  3S14 B;  2OTJ A;  1GO3 E;  3I91 A;  3TBI B;  3CF5 A;  4JCV E;  1QWY A;  2DGY A;  4DV1 Q;  4X64 Q;  1X3G A;  1YNX A;  2QA4 A;  3N6R A;  4MN3 A;  4CJ1 B;  1PVO A;  3S2D B;  4R4C A;  4LW1 A;  3J80 L;  1SBB B;  2F0S A;  2LMC B;  1SNO A;  2ENB A;  5M5Y H;  1QVC A;  3VYT A;  3NE5 B;  4G7Z C;  1XMQ Q;  2HIX A;  3AMU A;  4FF4 A;  2LY7 A;  1GUN A;  4LJZ C;  4PZ8 A;  2F0O A;  1U4L A;  1I5F A;  1SE3 A;  5IYD H;  1IYV A;  3J81 L;  4A3I G;  2L5T A;  1R4Q B;  2NVQ H;  1XMO L;  1PMR A;  2X6G A;  1PLF A;  4K5W A;  1VQ9 A;  2VUM H;  1V1P A;  1IBK Q;  1IBM L;  1WTR A;  4N8F A;  4CKE A;  1GD7 A;  3CCE A;  1BCP C;  4KHZ A;  4LFC Q;  2XNA C;  4O0A A;  4Q5V A;  2G9H D;  2F0L A;  5COR A;  2LSS A;  5IGF A;  3S2D H;  4GN4 B;  1LTR D;  2K5V A;  2EYJ A;  3H3V H;  4DPG A;  3Q0A A;  4JW0 A;  1EQQ A;  3HOU H;  4EX5 A;  5FLX L;  4DR4 L;  5L37 A;  3HOZ G;  1B70 B;  2KOL A;  5JJI A;  2PMZ B;  4L5T A;  3SK6 A;  5I6W A;  1SNM A;  1OO9 B;  1N8R C;  2JN4 A;  4BY7 B;  2B63 B;  5IGD A;  1XTC D;  1K3B C;  4WJ3 M;  1NBW A;  4BY1 H;  1DXM A;  1VQI A;  1D1K A;  5JJK A;  2BH8 A;  2YV5 A;  2XN9 C;  2RHS B;  4JV5 Q;  2F3I A;  4R4I A;  3J7A V;  2NZH A;  3J80 c;  2CQA A;  4XIG S;  1N34 L;  1CUK A;  5E7N A;  4K6D A;  3MZ5 A;  4OO1 G;  1CQF A;  1FL0 A;  4JC0 A;  2F0I A;  2AQ1 B;  3WWV A;  4A3L G;  2A6H C;  1I4X A;  1I94 Q;  5LMN W;  2Q2I A;  2G9D A;  1YEZ A;  5KYL A;  3S1M B;  4IPC A;  4BBR G;  2R7D A;  1VQN A;  1S5F D;  2XWJ B;  1F2Y A;  2KBN A;  3OIQ A;  2Y0S E;  4RGT A;  1PZJ D;  4YWM A;  2F4I A;  1QG7 A;  4BXX G;  3DM1 A;  4POG A;  1LAC A;  4DFA A;  3K7U C;  3CQZ H;  1YHA A;  1SFO H;  1QUQ B;  4P75 A;  1HNW L;  5EPK A;  4DV4 Q;  3QO2 A;  2P5Z X;  1STA A;  1LTI D;  4RAU C;  1EOT A;  2I46 A;  5M5X H;  1SYB A;  4IUP A;  3MC0 B;  1RIP A;  1CHQ D;  3VDY A;  4O42 A;  3J81 j;  4LF5 L;  5FJ8 H;  5M3F G;  1BQQ T;  3HRZ C;  3G6J B;  3HZX A;  1E1T A;  4ZUJ A;  1FJG Q;  1GVP A;  4DR7 Q;  1Y1V H;  4FXD A;  1A3T A;  2NZ1 D;  4KI0 A;  2E2H H;  4OEL B;  4H02 A;  1CQV A;  5AJ3 Q;  1E3P A;  3EQL C;  4KHP L;  1HA6 A;  5EQ0 A;  1K28 A;  3OMG A;  4IPD A;  5IT9 c;  2NVT H;  1MBY A;  3VR2 A;  4CDF C;  4XQJ A;  5LMU Q;  3W2D A;  1GUG A;  3STB C;  5JJL A;  1KNE A;  3MXU A;  2XRS D;  5GAD C;  4A3I H;  4A3E B;  4LK1 C;  5HGQ A;  5IP7 H;  2EXD A;  4DAY A;  4KHP Q;  1TWF H;  3SR1 A;  2RHQ B;  4DUY Q;  2F0H A;  1JJ2 A;  1PRT D;  3A8I E;  3HP3 A;  5M5W H;  3LWU A;  3M4Q A;  2MPM A;  3CU7 A;  4RCO A;  4A3F B;  2WB1 B;  1LTB D;  2FIN B;  3K5O A;  3J80 E;  1CM9 A;  2DY8 A;  2R93 G;  1E2W A;  1VQ4 A;  3L9A X;  1VQM A;  1YJW A;  2ZT9 C;  4QJF A;  3D31 A;  1RDP D;  2N88 A;  1PH3 A;  1V43 A;  5BR8 Q;  3IRB A;  2QW7 A;  1F9R A;  4U68 A;  4B08 A;  2GVB A;  2KED A;  4A93 B;  4CHT B;  2PNR C;  1XPO A;  3SGI A;  4L6T B;  4DV1 L;  2R92 G;  4IUQ A;  4A3K H;  4A3D G;  2ICE C;  3Q8D A;  4IFD H;  2B8G A;  3A74 A;  4JI0 L;  2A74 C;  5DAU A;  3PO3 B;  3E5S A;  4GNX A;  4X3K A;  1LTS D;  5C0X J;  1FGB D;  3PSI A;  3H09 A;  4OO1 I;  2AKW B;  1CTM A;  2J0T D;  3DWQ A;  3HOW B;  1LO5 D;  3JAM i;  1IHZ A;  3HOV B;  5AFW A;  4HID A;  1JOO A;  3OWF A;  4OON A;  3G48 A;  3GTK H;  2A1A A;  4DV3 Q;  4P2C B;  1HNX Q;  4RG1 A;  4NXM L;  3TP8 A;  1M1K C;  1C0A A;  2JSO A;  3PUX A;  3I56 A;  1TT2 A;  5IT9 E;  4EQ5 A;  2RVL A;  4IPH A;  1VMP A;  5EPJ A;  3TSS A;  3FEW X;  3TRZ A;  4L5R C;  1KXL A;  3H6M A;  1HH2 P;  2YTX A;  1K8M A;  3A7A B;  4DR1 Q;  1STE A;  3G4S A;  3W1B A;  3UI2 A;  3K5L A;  3PGZ A;  1HNZ Q;  1PFS A;  1SJE D;  5GAH C;  3BZK A;  2FJ2 A;  5FK9 C;  3NTK A;  4A3B H;  3RLF A;  2ID0 A;  1I4Q A;  1PRT C;  5FLX c;  4BBR B;  5CYU A;  3AYH B;  1S3O A;  3VYU A;  4WOR A;  3DM3 A;  4L5S A;  4C3I G;  2R6G A;  5LL6 S;  4FXK C;  1NCV A;  1PFN A;  1I3Q B;  2VB3 X;  3R2T A;  3CCL A;  3KLW A;  1FNU A;  4PMC A;  3M4O H;  2SNM A;  4HIO A;  2A19 A;  4Z9C B;  4A3L H;  1ESF A;  3KDF B;  3PIP 3;  1JWM D;  4K6L A;  3NPP A;  1Q90 A;  3H15 A;  1K8O A;  4J8Q A;  1B44 D;  5TSS A;  1Q8I A;  1X3F A;  4BBR H;  2NZO A;  4IJH A;  4J6H A;  1UUP A;  2WB1 G;  4HMI A;  4X65 L;  4K8J A;  3HFZ B;  1B50 A;  2F0F A;  3KBX A;  1V1Q A;  3GO5 A;  1YIT A;  1PDQ A;  1BVS A;  5C44 G;  4DR6 L;  4PMB A;  4Y52 H;  2Q2U A;  4RKB A;  2B2Y C;  2QKI C;  5GAE C;  4EQN A;  1VDZ A;  2D0O A;  1ILP A;  3LGJ A;  3STB D;  4LUZ A;  1X65 A;  5LHY 1;  1N34 Q;  2WV6 D;  1H9R A;  1YNJ D;  3U9O A;  4FYD A;  1LUZ A;  1CKN B;  3WOE A;  4N9P A;  2Y0S B;  3J81 E;  4DV5 L;  4XT3 B;  1PFM A;  4C3I B;  3OSO A;  1BR9 A;  2KQ3 A;  3QWN A;  2UUA L;  3V05 A;  1BBU A;  1Y1W H;  2MUY A;  4LUV A;  5JPM C;  2OQK A;  1K8A C;  4G7H C;  4XQN A;  2A73 B;  2ZXO A;  4R8I A;  4DK6 C;  3QG1 A;  3M7N A;  3I7F A;  1A8V A;  3TS2 A;  4R4T A;  4JI1 L;  1WYD A;  4AQY L;  2WAQ B;  1EL0 A;  1P8L A;  4XT1 B;  3CRL C;  4JI3 L;  1VQC A;  1J5E L;  5IOD A;  2A5H A;  3OPO A;  1BBX C;  3PIP A;  2R93 B;  1U9R A;  3L0O A;  4HCE A;  4IUV A;  2UXD L;  2JA5 B;  3F1Z A;  3M85 A;  1WI5 A;  4NXM Q;  2PZU A;  5C44 B;  2QIL A;  4HIK A;  1Q8K A;  1AE3 A;  2K50 A;  2BH2 A;  2KCM A;  3BVG A;  4H44 C;  1I4P A;  3TN2 A;  5JEA J;  3VA7 A;  2NVQ B;  5FKA C;  2F03 A;  1HNZ L;  3K81 C;  4N9T A;  3RLO A;  3A5U A;  4DV6 Q;  1JR0 D;  2VQF Q;  3SK4 A;  1Q7Y C;  2EJM A;  2PYK A;  1X3E A;  1G51 A;  1LLR D;  1XYI A;  5KNC A;  4LFB Q;  1B3A A;  2A8V A;  1SNC A;  1UWV A;  1DOL A;  4KK7 A;  3HOX G;  4GKJ L;  3M4Y A;  1PRT B;  5IWA L;  3QIA A;  3TDQ A;  2LS0 1;  2UUB L;  5BN4 A;  1SR3 A;  1HA5 A;  5IIF A;  4ZK9 B;  3T51 B;  4A93 G;  4H7B A;  1YBY A;  2VB2 X;  2B29 A;  3K57 A;  2HDM A;  2VXW A;  1OXV A;  2YU9 H;  4A3C G;  4CKC A;  4Y7N H;  4IFD J;  4FF1 A;  2E2J H;  1WCM H;  1P16 A;  2NTT A;  2UUB Q;  3NQT A;  2UU9 Q;  3WDN A;  1ML0 D;  1K0S A;  4XXE A;  1EUJ A;  2JA7 B;  1GKH A;  1PXU A;  1EZ6 A;  1VCI A;  1NUC A;  2H4O A;  1EIY B;  2B2W C;  4FP5 D;  5KEE A;  4KKU A;  1SEB D;  3BVM A;  4ID6 A;  3I4L A;  1SYD A;  2B63 G;  4ZKC B;  2K01 A;  3JAM L;  4DN4 M;  1G2T A;  4H0L C;  1N36 L;  4C3H B;  2Z6K A;  3OWE B;  1YVC A;  4DXG A;  1EZ8 A;  1HR0 W;  4JI3 Q;  1VQF A;  2CQO A;  1IYU A;  3R2I A;  5CBE E;  3FKI G;  1YI2 A;  2R7Z G;  4XQQ A;  2IX0 A;  1X6O A;  1IL8 A;  4A76 A;  3BVZ A;  1SYG A;  1WVL A;  3ZJY C;  3A0J A;  2EZV A;  4ZQ3 A;  3CPW A;  1UEA B;  3FMC A;  2NVX B;  3K80 C;  3I4M B;  1ILQ A;  1JOK A;  3NEM A;  4FF2 A;  4L63 B;  2K5W A;  2DY7 A;  4DK1 A;  2IX3 A;  3SK8 A;  2B2V C;  4KY7 A;  1N33 Q;  1ENF A;  1EEF D;  3BYT B;  4KJN A;  3D8G A;  5T1I A;  1MSH A;  2JXM B;  2E75 C;  1QVG A;  3MWY W;  4ILW A;  5BN5 A;  3DWP A;  1BO0 A;  3Q23 A;  1K83 B;  4O2D A;  2R7Z B;  1Y8O B;  1YNJ C;  1W6J A;  3PMF A;  5CV9 A;  1L2F A;  2JYO A;  5E3F A;  1GHK A;  4UHV A;  5FJ8 G;  4X3T A;  3NBH A;  1A3V A;  4NP5 A;  4BY1 G;  3VYS A;  1MSG A;  1XTD A;  3HOY B;  3V96 A;  4GOP B;  1OXT A;  1TU2 B;  3E9H A;  2A6E C;  3DEP A;  2FHT A;  5A2Q E;  1BOS A;  4DUZ L;  1ZEQ X;  5EBC A;  2G5D A;  2Y0S G;  1H95 A;  1B2T A;  1TWC B;  3ND9 A;  4KJO A;  4HJ5 A;  3NHH A;  4LF8 Q;  3CP0 A;  1SYF A;  1S5E D;  1C4Q A;  1L0W A;  3HKS A;  3CMA A;  2KJX A;  3NQI A;  1IW7 C;  4JK1 C;  2AQ3 B;  4OX9 L;  2MP1 A;  3NEN A;  1VQ5 A;  4AIM A;  4LF6 L;  1WTP A;  2KUM A;  3A8J E;  3H91 A;  4C2M H;  4HIM A;  1HQR D;  2EYF A;  3SEB A;  2UXD Q;  2TMP A;  4DV2 L;  4K5X A;  4LF7 Q;  4JI7 L;  4ALP A;  2K05 A;  1HR0 L;  3MXN A;  1JT8 A;  1JMC A;  3GTJ B;  1KRS A;  1Y69 U;  1CK1 A;  5C4H A;  4IFD I;  2NUC A;  3PUZ A;  2ZJQ A;  2HT1 A;  2I07 B;  5C5L A;  3CD6 A;  2BE5 D;  3X3M A;  4C1N K;  2FFK B;  1WCM G;  5JPN C;  5G3L D;  3ZYY X;  4RKL A;  2ES2 A;  1DJR D;  3EVQ A;  5I6Y A;  1D5Z C;  4R1J A;  1LT5 D;  2L0C A;  2MO0 A;  3PF4 A;  4A3K G;  3ICE A;  3D3R A;  3HG9 A;  4R8N A;  1ONL A;  1HFG A;  4QIW B;  3KLS X;  1EFI D;  5IYB G;  2RA4 A;  5EGT A;  2OQ0 A;  1RTN A;  5T1G A;  1M8A A;  3C2P A;  4JI1 Q;  1EWH A;  1DM0 B;  3UDG A;  1STB A;  4KY5 A;  4UP8 A;  1MKH A;  2L12 A;  3C1E A;  4HSP A;  4QUC A;  5IGB A;  1Y1W B;  1S5B D;  5HY6 A;  1I4H A;  5E4X A;  4QY7 A;  1SE4 A;  4TKO B;  2KHJ A;  3VA5 A;  3VR6 A;  2RCF A;  3KUP A;  3VR3 A;  1XPU A;  4IAL A;  1QUQ A;  1EY8 A;  4A3E G;  1TR5 A;  1N9W A;  2MNA A;  1VS0 A;  3U4Z A;  2J7Z A;  3HOW G;  2B39 A;  5ELF A;  2VZA A;  3OTO Q;  3KF8 B;  1MHW C;  2XIW A;  3TP5 A;  3H0G H;  3W1G A;  3E0E A;  3JAM E;  5CC4 A;  4KHV A;  1X9N A;  3SK5 A;  2ZTC A;  4AH6 A;  4DGZ A;  1V1P B;  4ZYS A;  3KJP A;  4PNY A;  1WTH A;  3U9S A;  4ME3 A;  3CQZ B;  4A3J H;  2TSS A;  4A3B B;  2IW3 A;  2SEB D;  2NN6 I;  1WTO A;  3FVQ A;  1DYQ A;  5IGG A;  1KNA A;  4PMW A;  2ASB A;  1N32 Q;  1Y1W G;  1R9T B;  2DJG C;  5CR3 A;  4IFD G;  2DNC A;  4YWK A;  2ZJR A;  4BA1 I;  3D4D A;  4C3J H;  2EYL A;  4B9X A;  4DA2 A;  2JA7 G;  1DZ1 A;  2I0Q A;  3T1H L;  4UY8 C;  5IGC A;  4MIU A;  1FD7 D;  2DJF C;  4M1U B;  3GP7 A;  4ODG A;  4HCS A;  2E2I H;  1K9M C;  4GN3 B;  3DEO A;  1WTW A;  4JBW A;  1BCP F;  4OO1 H;  1RKN A;  4YCW A;  4DNI A;  1RTO A;  1CKO A;  1EU4 A;  4DKA C;  2F0G A;  4C56 C;  5M9O A;  5C0X I;  1IW7 D;  3MFY A;  1V8Q A;  2Q8I B;  2BA1 A;  2OF1 A;  1XNQ Q;  4FO2 A;  1NR2 A;  4GZY C;  1O7I A;  1PA6 A;  2Z4I A;  4UP9 A;  2CWA A;  3RZO B;  4TVA B;  4X3U A;  4CJ0 B;  3MXP A;  3PV0 A;  1OXX K;  1AZQ A;  1KLU D;  3R93 A;  3GTM H;  4CBV A;  2Z1C A;  4DK0 A;  3ULL A;  1MI2 A;  3AFP A;  1X56 A;  4V0B A;  3RN5 A;  3TEH B;  1J5E Q;  2UUA Q;  2D9U A;  1VF5 C;  2F0J A;  5C4J B;  2F52 A;  2WAQ E;  3GTO B;  2UU9 L;  1YIJ A;  1IBK L;  5K5P A;  1CSP A;  1TKW B;  1TS3 A;  2XTI A;  4DAM A;  3NSW A;  2F1M A;  2PCF B;  1LAB A;  1MGS A;  1PZI D;  3HKZ E;  4BBS H;  1C48 A;  5D65 A;  2ZM6 Q;  4A3D B;  2Q8R E;  3EA6 A;  4A4I A;  3HEJ A;  2B2T A;  5M5W B;  2PMZ E;  4OL7 A;  3FDT A;  4CDC C;  5KRU A;  2JP1 A;  1J9O A;  3J81 c;  1KLG D;  3J81 i;  2Z0S A;  3TZD A;  2X69 A;  5C5M A;  2PQA A;  4LFB L;  2JA8 G;  3GQB A;  3SXH A;  3PO2 H;  2X6L A;  3D4R A;  4BY7 G;  1ROD A;  3S15 B;  1QIL A;  1WTQ A;  1D5M C;  3DWA A;  1Y8N B;  1CSQ A;  4L5Q A;  3CAM A;  1Z9F A;  3HOW H;  4DV4 L;  1VQJ A;  1HXY D;  1WOC A;  2XSC A;  1TVX A;  4LF7 L;  1EYG A;  1Q1E A;  1DOK A;  3KOJ A;  5LL6 X;  3MFG A;  2R7Z H;  1IYJ B;  1CZW A;  1VF7 A;  3OW7 A;  4GOP A;  2PI2 E;  3FP9 A;  1K0R A;  1G6P A;  1CHP D;  1SLJ A;  2F0M A;  1JC7 A;  2PZT A;  1K8G A;  4LF6 Q;  3NK9 A;  3GTG B;  4XTC S;  3FPP A;  3MTS A;  4GLV B;  4B3S L;  1JB7 A;  1QB5 D;  1ZKO A;  5M3F H;  3ND8 A;  1QZG A;  3T56 B;  1B1Z A;  1FVI A;  1K73 C;  1STY A;  3D6W A;  3CC4 A;  3S16 B;  3A54 A;  2IL8 A;  3F8T A;  2EYM A;  1OTC A;  5J39 A;  3PO2 B;  2R61 A;  1W6K A;  3C46 A;  1L1O B;  4DV3 L;  1HNX L;  5FLX E;  2B2Y A;  4RHR A;  1U0L A;  3I3C A;  2O5I C;  4DUY L;  3JC6 6;  3IAY A;  5KND A;  2NN6 H;  3CC2 A;  3TZU A;  3H94 A;  1PZK D;  1Q46 A;  4DV0 L;  1I50 H;  5IT9 L;  1ASZ A;  3S1M H;  3GV3 A;  4C2M B;  1ET6 A;  4A3M B;  3H0G G;  3A56 A;  1PH1 A;  2LXK A;  3S24 A;  4GNX B;  4NPS A;  4RFB A;  1GJX A;  4HTH A;  2VQF L;  1HUN A;  2RDG A;  4IZ8 A;  4A3M G;  1D1I A;  2OCE A;  1YHB A;  3TS0 A;  4K2K A;  2Q8T A;  3GTM B;  2A68 C;  3N52 A;  4DR7 L;  1OXU A;  4QIW E; 
#chains in the Genus database with same CATH homology
 1GOZ A;  1D5X C;  2E2H B;  3VYR A;  1Y1V B;  3KK7 A;  5ELE A;  1RJT A;  1ET9 A;  4RGM A;  1NR4 A;  3C1F A;  1WCM B;  1JE4 A;  3BZD B;  3P75 A;  2L9H A;  2IX1 A;  4U67 3;  5I2X A;  1TWA B;  2AWN A;  2EJF C;  3MXG A;  3HKZ B;  2E76 C;  1A3U A;  1NAP A;  2QCP X;  1AFP A;  3DHQ A;  1IKM A;  4KD4 A;  1VMC A;  5C4Z A;  3I4N B;  3R8B A;  2IJ0 A;  4WJW A;  3S1N B;  4MHE A;  3GV6 A;  5COY A;  2D2C C;  4QF4 A;  3I90 A;  4BA2 I;  4C3H G;  5CV5 A;  4O1N A;  1BF4 A;  5JJZ A;  2EOT A;  3FPU B;  5K36 H;  2JE6 I;  1G91 A;  3J7Y W;  3DMU A;  2VUM B;  1EY4 A;  3HGB A;  1D2B A;  1JCK B;  1EY7 A;  3KLS A;  4J1M A;  1STG A;  1STN A;  3SVM A;  4RWS C;  4FVM A;  3BDO A;  3V2T A;  5FO9 B;  1BUV T;  4QB4 A;  4IN3 A;  2M2L A;  4V19 0;  2HCC A;  3PUW A;  2WKC A;  1H9S B;  1DOM A;  3ITP A;  1G2S A;  1HTP A;  3ERO A;  1SXT A;  2JEB I;  5HGT A;  3TP7 A;  1B53 A;  2CW0 C;  2C9O A;  2NBF A;  2LKV A;  5ISR A;  3MAQ A;  5KYI A;  2O2L D;  2MGS A;  2NWG A;  1HHV A;  2A69 D;  4DU9 A;  1WD0 A;  2D62 A;  3E6Z X;  2RSO A;  1HUM A;  3RZD B;  2HUG A;  1AEX A;  1G29 1;  4DAV A;  2H1E A;  4EQO A;  4BWG B;  5CV7 A;  3A55 A;  5CV8 A;  3LWE A;  2EY6 A;  1EU3 A;  5FO8 B;  5A2Q L;  1M4V A;  1X3P A;  2EY5 A;  1D6E C;  1J8I A;  3AB9 A;  2EVB A;  2K5Q A;  2RQX A;  3GTQ B;  4WFN 3;  1F77 A;  1I50 B;  3KBG A;  3H0G B;  2KEC A;  4HAE A;  4XYQ A;  1S5D D;  2K28 A;  4X3S A;  1UNS A;  2PQE A;  1HQM C;  5FO7 B;  1TWG B;  1DON A;  1F9S A;  3K58 A;  2GA4 B;  3I72 A;  1Q12 A;  2F3V A;  3TP6 A;  2AUK A;  1TS5 A;  1PFB A;  3HOZ B;  1EEI D;  1GXD C;  2EJG C;  2EYH A;  1FNV A;  3GTK B;  1SDF A;  2K5D A;  2DN8 A;  2E2I B;  4TSS A;  2BA0 A;  1CI3 M;  4UAI A;  4EVO A;  1B4O A;  2EPB A;  2FMM A;  4OHJ A;  2AQ2 B;  5ELC A;  1CA5 A;  4DNR B;  2WP8 J;  2SOB A;  1SFO B;  5I9P A;  3FKI B;  3NUC A;  3S1R B;  1DD2 A;  1QNK A;  2NTS A;  2IPK D;  5ELB A;  1ENA A;  3K6O A;  2AUJ D;  2QEJ C;  2RKS A;  1EQV A;  1SYE A;  1T5X D;  5EKI A;  3URY A;  1HFN A;  3SE0 A;  2Z8L A;  1CT1 D;  4HED A;  2RBM A;  2EXZ A;  3LNN A;  4AYB B;  2F0D A;  4C3J G;  4R9W A;  3HS0 C;  3GTL B;  4F87 A;  2HQE A;  2HCI A;  5CBA E;  1I6H B;  1PTO B;  1SAP A;  5HUR A;  4A3G B;  2PO4 A;  1TS4 A;  2KCC A;  5ELD A;  1AP0 A;  4KKS A;  2L1B A;  3K5N A;  1JOQ A;  2YU9 B;  1A2T A;  2EY2 A;  1O7L A;  2OT2 A;  3CKI B;  1FYC A;  3T53 B;  3L3O C;  2NVT B;  3S2H B;  3I70 A;  1LV9 A;  1PTO C;  3GD7 A;  3C3L A;  3H3V C;  2OXP A;  1YNN C;  3VR4 A;  2PW7 A;  4K2L A;  2EDG A;  5J1Z A;  2AWO A;  1GUS A;  1LTA D;  1F2Z A;  1E2V A;  4BS9 A;  4RH6 A;  1JWS D;  1X3Q A;  2NYZ D;  4ME5 A;  3KF8 A;  3MVV A;  2K1B A;  2WII B;  2V4D A;  5M5X B;  2D5D A;  1S5C D;  2ICI A;  1QNU A;  2SDF A;  4KTA A;  4TQU S;  2CVR A;  5G3L F;  3CRK C;  1HPC A;  2K03 A;  5C3X A;  2O4X A;  3NXW A;  4HR7 B;  1LTT D;  5JEA H;  3QOJ A;  5IGE A;  4BY1 B;  3P7J A;  2K6A A;  1CZG A;  1YNN D;  5M5Y B;  3EJI A;  4NW2 A;  1B9M A;  5EPL A;  1JIC A;  3OHX C;  4C3J B;  1X32 A;  2E2J B;  4DNT B;  4CGY B;  1OXS C;  5CV6 A;  4ABN A;  3NTI A;  1QE6 A;  5IOC A;  1A2U A;  1Q3L A;  1AN8 A;  4I7Z C;  1RD9 D;  1KDB A;  1O7Z A;  1RCV D;  3Q24 A;  4KKT A;  3HOU B;  1SND A;  3PUY A;  3L7Z C;  5CGK A;  1LTG D;  1PRT F;  1O80 A;  2A6H D;  1Z6H A;  2NN6 G;  2N55 A;  5C3W A;  1I4R A;  1ENC A;  2KVM A;  4NKL A;  1S4Z A;  2XWB B;  3LX0 A;  1L0X B;  4S3S A;  1SMY C;  4DAP A;  3IKJ A;  4OIJ A;  2M9V A;  5JVH 3;  5K36 G;  1U4R A;  1E0B A;  4FF3 A;  1EIG A;  4EGV A;  1KDA A;  1I6V C;  4G57 A;  1Z47 A;  2DNE A;  1QCB D;  1CA6 A;  2CW0 D;  1KAA A;  3IL8 A;  5M3M B;  1Y8P B;  3OIP A;  5KNB A;  3PIO 3;  1PTO D;  3QB3 A;  3IFT A;  4HMJ A;  1HCZ A;  1IKL A;  3MEH A;  2F0K A;  1JB3 A;  1EYD A;  3CHB D;  4RHS A;  5I4D A;  3PUV A;  2BDN A;  4RGO S;  4ULL A;  5EKK A;  3K0Y A;  1H9S A;  2NB0 A;  3NP8 A;  4ZAI A;  2C5C A;  2F0V A;  1PTO F;  2K7V A;  4B9W A;  5JOB A;  3RD4 A;  2B2U C;  2F0W A;  5C0X H;  2EE1 A;  4KY6 A;  3M3Y B;  5E1F A;  1H9M A;  2OEO A;  3W3A A;  4E6I A;  1ZYR C;  3S1Q B;  2QF7 A;  2YYZ A;  2JEA I;  2WAC A;  4KMU C;  1EYC A;  2E2D C;  4A3I B;  2R3Z A;  3BS1 A;  3NBI A;  1XX8 A;  4Y7N B;  3EFX D;  2MJ8 A;  1LT3 D;  4NDX A;  3VR5 A;  1XWE A;  1TWF B;  4FXG C;  5DM6 3;  1BXT A;  3D6C A;  4CJ2 C;  2RDF A;  1V1O A;  3O13 A;  2F0P A;  3Q22 A;  3D4W A;  5EBD A;  2B2T C;  3S9W A;  3TME A;  2E74 C;  3F2U A;  5NUC A;  1SJH D;  3BDL A;  2F0T A;  1EY9 A;  1KAB A;  1O78 A;  1F9Q A;  3ONA B;  1HRJ A;  3I8Z A;  2EYO A;  4DF7 A;  3SHL A;  4A3J B;  4A3K B;  3BDC A;  1F2M A;  3OMC A;  2L4N A;  5D3D A;  4RA8 A;  2K33 A;  1LT6 D;  4H13 C;  2LFN A;  3M4O B;  2RSN A;  3OOC A;  3SDZ A;  2B2U A;  3T4A C;  2A68 D;  2B2V A;  4ZKB B;  2IT1 A;  5A35 A;  1TS2 A;  1BNZ A;  1STH A;  2BDO A;  1AW7 A;  4I65 A;  3BG3 A;  2IWH A;  1Q1B A;  3I73 A;  5E4W C;  2PPB C;  4IUN A;  2XVS A;  4QCL A;  1GUO A;  4ZRZ A;  5I9O A;  2FMC A;  5D3I B;  2ZXP A;  1II3 A;  4PV1 C;  5JAV A;  1QJO A;  1GUT A;  1RHP A;  1XXG A;  2L11 A;  4ZLT F;  1H9K A;  1F9P A;  2BCO A;  1B9N A;  1EIH A;  3Q6S A;  1LT4 D;  1FR3 A;  4BBS B;  2A6E D;  1O7Y A;  3A7L A;  1EY6 A;  2R92 B;  2F0E A;  4L8J A;  4G7O C;  4XDX A;  1ESR A;  1ZYR D;  3J7A F;  4F8M A;  4M8A A;  1TWH B;  4HN7 A;  2A69 C;  1SNQ A;  2WKD A;  1G8Z D;  1SYC A;  4DXF A;  1C8C A;  3G7L A;  2KA7 A;  2F0N A;  3ERQ A;  4KN4 C;  4QUF A;  3IFD A;  2WIN B;  5JEA G;  1BDO A;  2PZW A;  2MHV A;  2F0Q A;  4NMZ A;  1WTX A;  2EY1 A;  3MHB A;  2RDH A;  2SNS A;  4ZUI A;  2BE5 C;  5CV4 A;  5FOB B;  3T13 A;  3K5M A;  1U4M A;  5I2Y A;  2Z4H A;  3T16 A;  4QMG A;  2KEE A;  4IQZ A;  4PQX A;  1MD2 D;  2PW5 A;  1TQO A;  1KTK A;  4K14 A;  5EJW A;  5C4X B;  1ZXT A;  2EYP A;  3K7A B;  1SSO A;  3NWT A;  3AU7 A;  4KN7 C;  1BCP B;  2M00 A;  2O5J C;  1EYA A;  3QOL A;  1L0Y B;  1AZP A;  3GTP B;  1A6X A;  5C3E B;  3WOF A;  1FNW A;  1UAP A;  5KGU A;  1SMY D;  4F88 A;  1ICW A;  4OGQ C;  2HDL A;  2L55 A;  3NTH A;  3RUZ A;  3P1H A;  5D14 A;  1F2L A;  1WD1 A;  1WTV A;  3BYY B;  4YIJ A;  3S17 B;  5CMD A;  1EY5 A;  2XRQ D;  2B8F A;  2ZXR A;  3MA2 B;  1SE2 A;  2NVY B;  3P20 A;  4G4K A;  4K8I A;  5DNF A;  2K04 A;  5DEH A;  1EWC A;  1I4G A;  1JWU D;  4K5V A;  1T5E A;  5KIX A;  3A8K E;  4KV6 A;  4C1N I;  4XYO A;  1PTO H;  4WRD A;  2JA8 B;  4CKB A;  3K59 A;  1Z7T A;  3KLR A;  5BN3 A;  3M7G A;  4RCN A;  3E0J A;  2JA6 B;  4TRD A;  4IUU A;  2F0U A;  1TII D;  1EY0 A;  5F2D A;  2VNU D;  1HTL D;  1QOH A;  1A15 A;  4LAA A;  2KHS A;  1U4P A;  4RGN A;  5C6A A;  3FRP B;  1KDC A;  1PYW D;  4IUT A;  4HSV A;  5EKL A;  1BCP D;  4EQP A;  1JQY D;  3QJY A;  2CHB D;  3X3N A;  1H9J A;  2KCN A;  3HOX B;  5C0X G;  4LMQ D;  2B2W A;  5J22 A;  5DM7 3;  4FNF A;  4F7X A;  1NSN S;  2QDB A;  1TY2 A;  1GUW A;  1DCZ A;  1GHJ A;  1TY0 A;  3RMH A;  1E2Z A;  5M3F B;  1R4P B;  3DUZ A;  1EQT A;  3NWS A;  4IUR A;  3R3O A;  4Q0F A;  1JOR A;  4KD3 A;  2F3W A;  4OIK A;  1CFM A;  1G6Z A;  5JVG 3;  2J4X A;  2K32 A;  1RF2 D;  4UDU C;  2BOS A;  3DXJ C;  1SNP A;  3S14 B;  3I91 A;  3TBI B;  1QWY A;  3N6R A;  4MN3 A;  4CJ1 B;  3S2D B;  3J80 L;  1SBB B;  2F0S A;  2LMC B;  1SNO A;  2ENB A;  3VYT A;  3NE5 B;  4G7Z C;  3AMU A;  4FF4 A;  2LY7 A;  1GUN A;  4LJZ C;  2F0O A;  1U4L A;  1SE3 A;  1IYV A;  3J81 L;  2L5T A;  1R4Q B;  1PMR A;  2X6G A;  1PLF A;  4K5W A;  1V1P A;  1WTR A;  4CKE A;  1BCP C;  4KHZ A;  2XNA C;  4Q5V A;  2G9H D;  2F0L A;  5COR A;  5IGF A;  1LTR D;  2EYJ A;  3Q0A A;  5FLX L;  2KOL A;  2PMZ B;  3SK6 A;  5I6W A;  1SNM A;  1OO9 B;  4BY7 B;  2B63 B;  5IGD A;  1XTC D;  1DXM A;  1D1K A;  2XN9 C;  3J7A V;  2CQA A;  4XIG S;  4K6D A;  3MZ5 A;  4OO1 G;  1CQF A;  2F0I A;  2AQ1 B;  2A6H C;  1I4X A;  2G9D A;  5KYL A;  3S1M B;  1S5F D;  2XWJ B;  1F2Y A;  3OIQ A;  4RGT A;  1PZJ D;  2F4I A;  1QG7 A;  3DM1 A;  1LAC A;  4DFA A;  5EPK A;  3QO2 A;  1STA A;  1LTI D;  4RAU C;  1EOT A;  2I46 A;  1SYB A;  4IUP A;  3MC0 B;  1CHQ D;  4O42 A;  1BQQ T;  3HRZ C;  3G6J B;  3HZX A;  4ZUJ A;  4FXD A;  1A3T A;  2NZ1 D;  4KI0 A;  1CQV A;  3EQL C;  1HA6 A;  5EQ0 A;  3OMG A;  1MBY A;  3VR2 A;  4XQJ A;  3W2D A;  1GUG A;  1KNE A;  3MXU A;  2XRS D;  4A3E B;  4LK1 C;  4DAY A;  3SR1 A;  2F0H A;  1PRT D;  3A8I E;  3HP3 A;  4RCO A;  4A3F B;  3LWU A;  3CU7 A;  2MPM A;  2WB1 B;  1LTB D;  2FIN B;  3K5O A;  3J80 E;  1CM9 A;  2DY8 A;  1E2W A;  3L9A X;  2ZT9 C;  3D31 A;  1RDP D;  2N88 A;  1V43 A;  1F9R A;  4U68 A;  4B08 A;  2KED A;  4A93 B;  4CHT B;  2PNR C;  4L6T B;  4IUQ A;  2ICE C;  4IFD H;  2B8G A;  2A74 C;  5DAU A;  3PO3 B;  3E5S A;  4X3K A;  1LTS D;  5C0X J;  1FGB D;  3H09 A;  4OO1 I;  1CTM A;  2J0T D;  3DWQ A;  3HOW B;  1LO5 D;  1IHZ A;  3HOV B;  5AFW A;  1JOO A;  3OWF A;  4P2C B;  3TP8 A;  2JSO A;  3PUX A;  1TT2 A;  5IT9 E;  2RVL A;  1VMP A;  5EPJ A;  3TSS A;  3FEW X;  3H6M A;  1K8M A;  3A7A B;  1STE A;  3UI2 A;  3K5L A;  1SJE D;  2FJ2 A;  5FK9 C;  3NTK A;  3RLF A;  2ID0 A;  1I4Q A;  1PRT C;  4BBR B;  5CYU A;  3VYU A;  4WOR A;  4C3I G;  2R6G A;  5LL6 S;  4FXK C;  1NCV A;  1PFN A;  1I3Q B;  2VB3 X;  3R2T A;  1FNU A;  4PMC A;  2SNM A;  4Z9C B;  1ESF A;  3PIP 3;  1JWM D;  4K6L A;  3NPP A;  1Q90 A;  1K8O A;  4J8Q A;  1B44 D;  5TSS A;  1Q8I A;  1UUP A;  4J6H A;  4HMI A;  4K8J A;  1B50 A;  2F0F A;  3KBX A;  3GO5 A;  1PDQ A;  4PMB A;  4RKB A;  2B2Y C;  2QKI C;  4EQN A;  1VDZ A;  1ILP A;  5LHY 1;  2WV6 D;  1H9R A;  1YNJ D;  3U9O A;  4FYD A;  3WOE A;  4N9P A;  2Y0S B;  3J81 E;  4XT3 B;  1PFM A;  4C3I B;  3OSO A;  1BR9 A;  2KQ3 A;  3QWN A;  3V05 A;  2MUY A;  5JPM C;  4G7H C;  4XQN A;  2A73 B;  2ZXO A;  4R8I A;  3QG1 A;  3M7N A;  2WAQ B;  1EL0 A;  4XT1 B;  3CRL C;  5IOD A;  2A5H A;  3OPO A;  1BBX C;  2R93 B;  1U9R A;  4HCE A;  4IUV A;  2JA5 B;  3M85 A;  2PZU A;  5C44 B;  2QIL A;  3BVG A;  4H44 C;  1I4P A;  3TN2 A;  5JEA J;  3VA7 A;  2NVQ B;  5FKA C;  2F03 A;  4N9T A;  1JR0 D;  3SK4 A;  2EJM A;  2PYK A;  1LLR D;  1XYI A;  5KNC A;  1B3A A;  1SNC A;  1DOL A;  4KK7 A;  3M4Y A;  1PRT B;  3QIA A;  3TDQ A;  2LS0 1;  5BN4 A;  1HA5 A;  5IIF A;  4ZK9 B;  3T51 B;  4H7B A;  2VB2 X;  3K57 A;  2HDM A;  2VXW A;  1OXV A;  4CKC A;  4IFD J;  4FF1 A;  2NTT A;  3NQT A;  3WDN A;  1ML0 D;  4XXE A;  2JA7 B;  1PXU A;  1EZ6 A;  1VCI A;  1NUC A;  2H4O A;  2B2W C;  4FP5 D;  5KEE A;  4KKU A;  1SEB D;  3BVM A;  4ID6 A;  3I4L A;  1SYD A;  4ZKC B;  2K01 A;  3JAM L;  4DN4 M;  1G2T A;  4H0L C;  4C3H B;  3OWE B;  4DXG A;  1EZ8 A;  1IYU A;  3R2I A;  5CBE E;  4XQQ A;  2IX0 A;  1IL8 A;  3BVZ A;  1SYG A;  1WVL A;  2EZV A;  4ZQ3 A;  1UEA B;  3FMC A;  2NVX B;  3I4M B;  1ILQ A;  1JOK A;  4FF2 A;  4L63 B;  2K5W A;  2DY7 A;  4DK1 A;  2IX3 A;  3SK8 A;  2B2V C;  4KY7 A;  1ENF A;  1EEF D;  3BYT B;  4KJN A;  3D8G A;  5T1I A;  1MSH A;  2JXM B;  2E75 C;  3MWY W;  4ILW A;  5BN5 A;  3DWP A;  1BO0 A;  3Q23 A;  1K83 B;  2R7Z B;  1Y8O B;  1YNJ C;  1W6J A;  3PMF A;  5CV9 A;  2JYO A;  5E3F A;  1GHK A;  4X3T A;  3NBH A;  1A3V A;  4NP5 A;  3VYS A;  1MSG A;  3HOY B;  3V96 A;  1OXT A;  1TU2 B;  2A6E C;  3DEP A;  2FHT A;  5A2Q E;  1BOS A;  1ZEQ X;  5EBC A;  1B2T A;  1TWC B;  3ND9 A;  4KJO A;  3NHH A;  1SYF A;  1S5E D;  1C4Q A;  2KJX A;  3NQI A;  1IW7 C;  4JK1 C;  2AQ3 B;  2MP1 A;  1WTP A;  2KUM A;  3A8J E;  3H91 A;  1HQR D;  2EYF A;  3SEB A;  2TMP A;  4K5X A;  2K05 A;  3MXN A;  3GTJ B;  1Y69 U;  1CK1 A;  5C4H A;  4IFD I;  2NUC A;  3PUZ A;  2I07 B;  5C5L A;  2BE5 D;  3X3M A;  4C1N K;  2FFK B;  5JPN C;  5G3L D;  3ZYY X;  4RKL A;  1DJR D;  3EVQ A;  5I6Y A;  1D5Z C;  1LT5 D;  2L0C A;  3D3R A;  3HG9 A;  4R8N A;  1ONL A;  1HFG A;  4QIW B;  3KLS X;  1EFI D;  2RA4 A;  5EGT A;  5T1G A;  1RTN A;  3C2P A;  1M8A A;  1EWH A;  1DM0 B;  1STB A;  4KY5 A;  2L12 A;  3C1E A;  4HSP A;  4QUC A;  5IGB A;  1Y1W B;  1S5B D;  1I4H A;  5E4X A;  1SE4 A;  4TKO B;  3VA5 A;  3VR6 A;  3KUP A;  3VR3 A;  4IAL A;  1EY8 A;  1TR5 A;  2J7Z A;  2B39 A;  5ELF A;  2XIW A;  3TP5 A;  3JAM E;  5CC4 A;  4KHV A;  3SK5 A;  4DGZ A;  1V1P B;  4ZYS A;  4PNY A;  3U9S A;  3CQZ B;  2TSS A;  4A3B B;  2IW3 A;  2SEB D;  2NN6 I;  1WTO A;  3FVQ A;  1DYQ A;  5IGG A;  1KNA A;  4PMW A;  1R9T B;  5CR3 A;  4IFD G;  2DNC A;  4BA1 I;  3D4D A;  2EYL A;  4B9X A;  4DA2 A;  1DZ1 A;  5IGC A;  4MIU A;  1FD7 D;  4M1U B;  3GP7 A;  4ODG A;  4HCS A;  3DEO A;  1WTW A;  4JBW A;  1BCP F;  4OO1 H;  1RKN A;  1RTO A;  1EU4 A;  5C0X I;  2F0G A;  4C56 C;  5M9O A;  1IW7 D;  3MFY A;  1V8Q A;  2Q8I B;  2BA1 A;  2OF1 A;  4FO2 A;  1NR2 A;  4GZY C;  2Z4I A;  3RZO B;  4X3U A;  4CJ0 B;  3MXP A;  3PV0 A;  1OXX K;  1AZQ A;  1KLU D;  3R93 A;  4CBV A;  2Z1C A;  4DK0 A;  1MI2 A;  4V0B A;  2D9U A;  1VF5 C;  2F0J A;  5C4J B;  3GTO B;  5K5P A;  1TKW B;  1TS3 A;  3NSW A;  2F1M A;  2PCF B;  1LAB A;  1MGS A;  1PZI D;  1C48 A;  5D65 A;  4A3D B;  2Q8R E;  3EA6 A;  3HEJ A;  2B2T A;  5M5W B;  4OL7 A;  3FDT A;  5KRU A;  2JP1 A;  1J9O A;  1KLG D;  3TZD A;  2X69 A;  5C5M A;  3GQB A;  3SXH A;  2X6L A;  3D4R A;  1ROD A;  3S15 B;  1QIL A;  1WTQ A;  1D5M C;  3DWA A;  1Y8N B;  1HXY D;  2XSC A;  1TVX A;  1Q1E A;  1DOK A;  5LL6 X;  3MFG A;  1CZW A;  1VF7 A;  3OW7 A;  1CHP D;  2F0M A;  1JC7 A;  2PZT A;  3NK9 A;  3GTG B;  4XTC S;  3FPP A;  3MTS A;  1QB5 D;  1ZKO A;  3ND8 A;  3T56 B;  1B1Z A;  1STY A;  3D6W A;  3S16 B;  3A54 A;  2IL8 A;  2EYM A;  5J39 A;  3PO2 B;  2R61 A;  1W6K A;  3C46 A;  5FLX E;  2B2Y A;  4RHR A;  3I3C A;  2O5I C;  3IAY A;  5KND A;  2NN6 H;  3TZU A;  3H94 A;  1PZK D;  5IT9 L;  3GV3 A;  4C2M B;  1ET6 A;  4A3M B;  3A56 A;  4RFB A;  1GJX A;  4HTH A;  1HUN A;  2RDG A;  4IZ8 A;  1D1I A;  4K2K A;  2Q8T A;  3GTM B;  2A68 C;  3N52 A;  1OXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...