2F0JA

Crystal structure of staphylococcal nuclease mutant i72v
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKVEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0jA00
3P75A 1II3A 1EY5A 5CV9A 4DGZA 1EY4A 3ERQA 3OMCA 4KV6A 2F0WA 4RKBA 3RUZA 1F2MA 5CV8A 2KHSA 1SYCA 3EVQA 5I9OA 2EY5A 3C1FA 2F0KA 2EYFA 3EJIA 1SYEA 3MHBA 1SNMA 2EYJA 3LX0A 4HTHA 1KABA 5C3XA 2F0EA 4NMZA 1SYFA 5CV4A 2F0IA 2WACA 4IUNA 5IGCA 3D6CA 3EROA 5IODA 5KYLA 1JORA 5CC4A 4R8NA 2F0PA 1SNQA 4KJNA 5ISRA 4S3SA 2SNMA 4KY5A 4QF4A 4H7BA 5CV7A 3TP6A 5I6WA 1EYDA 3BDCA 5CV6A 5CV5A 4G57A 3VA5A 4NKLA 4LAAA 1JOKA 1SNCA 3D4DA 4DU9A 5IGGA 2LKVA 5KEEA 1EYCA 3E5SA 2F0QA 4ID6A 5F2DA 1EYAA 2F0VA 4ZQ3A 1IHZA 1EY6A 3BDLA 2F0DA 3H6MA 1STNA 4QB4A 3SK6A 1EY8A 4MIUA 5KYIA 3OMGA 1ENAA 4IALA 1STGA 4K14A 4EQPA 3OWFA 1A2TA 3NXWA 4NP5A 5IGEA 4PMCA 2SOBA 3SR1A 5HURA 5NUCA 2EY2A 5IIFA 5C5LA 3D4WA 5I6YA 1KDCA 1STAA 1KDAA 4N9PA 4NDXA 1EY0A 4WRDA 1AEXA 4B9XA 4B9WA 4PMBA 1STHA 2F3VA 4OL7A 4K6DA 3D8GA 2EY6A 3OSOA 2EYOA 2RBMA 3NUCA 1SNPA 4DF7A 4K5VA 5EKLA 3PMFA 2RDFA 2F0MA 3TP7A 1SYBA 4KY7A 5DEHA 3SXHA 3P1HA 2EY1A 4QMGA 4ODGA 1STBA 1U9RA 4HMJA 3HZXA 2PZWA 4HMIA 4K2LA 5C6AA 1TQOA 4K5XA 4N9TA 5C5MA 2ENBA 3QB3A 3DMUA 3ITPA 5CR3A 2PW5A 3C1EA 4KD4A 4F8MA 5IGFA 1A3TA 3T16A 4K5WA 5C4ZA 5IOCA 4RKLA 3TP5A 1A3VA 5J22A 4ME5A 1EZ8A 2PZTA 2F0NA 1JOOA 4E6IA 4KD3A 5C4HA 5M9OA 1A3UA 4WORA 5IGBA 2KQ3A 2NUCA 4ZUIA 4EQNA 3V2TA 4KHVA 1F2ZA 4PNYA 5K5PA 1KAAA 1EY7A 3MZ5A 5JAVA 5KIXA 4YIJA 4ZUJA 3NQTA 4EVOA 1A2UA 4K2KA 3SK5A 2PZUA 2PQEA 3MXPA 3S9WA 2RKSA 1NSNS 3NK9A 1STYA 1SNDA 1TT2A 4K8IA 3MVVA 2HQEA 2F0GA 2O4XA 3DHQA 4J6HA 1EQVA 2F0OA 1SYDA 2SNSA 5J1ZA 4KJOA 2F0TA 2F0HA 4I65A 5HGTA 3MEHA 1ENCA 1NUCA 4F7XA 5I9PA 3SHLA 5DAUA 1EZ6A 5JOBA 5E3FA 2F0LA 5KGUA 1KDBA 2F0JA 2PYKA 2EYPA 2QDBA 3TP8A 3NP8A 5C3WA 4K8JA 2M00A 2OXPA 3SK8A 2EYHA 2EYMA 4EQOA 1RKNA 1EY9A 3NHHA 3R3OA 4TRDA 5CGKA 2OEOA 2F0FA 4IZ8A 4DFAA 1TR5A 1SNOA 4J1MA 3U9OA 3QOLA 2PW7A 1F2YA 5J39A 5EGTA 2OF1A 5EKKA 4KY6A 5KRUA 3HEJA 5E1FA 3SK4A 3T13A 2F3WA 3QOJA 3TMEA 2F0SA 2F0UA 5IGDA 4KTAA 1SYGA 1JOQA 2EXZA 2EYLA
chains in the Genus database with same CATH superfamily
2R7DA 3HOZB 1II3A 3OMCA 1BNZA 1F2MA 1PFBA 4QUFA 2KHSA 4DR6L 3EJIA 3HS0C 3L3OC 4HTHA 3T53B 1N32L 3A8JE 5CV4A 1HR0W 2Q2UA 4FF4A 1Z6HA 3M4OH 3KBXA 3NBHB 1Y8PB 2K7VA 2KEDA 4P74A 3TP6A 3DEOA 5CV6A 1XMQQ 1I4HA 4NKLA 4BBSB 3GTMH 4LUOA 3GQBA 2K5NA 2F0QA 4ID6A 5C4XB 2EPBA 4PZ8A 2ES2A 4XTCS 1STNA 1EFWA 1HR0L 3H0GG 1S5CD 4A3MG 3UDIA 3SR1A 3PGZA 2EY2A 1KDAA 1XXGA 1IBKL 1BUVT 2LY7A 2WAQB 1TS2A 4DR7Q 2JJQA 3NTKA 1GUGA 5I4DA 4TSSA 4DAPA 3BG3A 4BWGB 3F2BA 1R9TB 1VQLA 4X3KA 4IFDI 2D62A 1LTAD 4MTNA 2B39A 3C2PA 1STBA 2JA5G 4KHPL 4BY1G 2A69D 4LW1A 1VQHA 2XVSA 3E9IA 5C4ZA 1PTOH 4KHZA 4I7AA 1A3UA 1L0YB 1Q86C 1C0AA 2KQ3A 2JA9A 4QY7A 3K0XA 1CQVA 3AMUA 1CUKA 1CA6A 4B3SQ 4RG1A 4AYBE 3J80c 2NVXB 3I4OA 4DUZL 5FK9C 4A3KG 2K52A 4N8X1 2D0PA 1JICA 3KK7A 3DHQA 2FINB 3W3AA 5J1ZA 5LL6S 2IWHA 2ZTCA 5JEAG 3GP7A 1LT6D 1Q3LA 1CA5A 2M00A 2OXPA 2XWBB 3I55A 5EQ0A 3HOZH 4B3TL 1CFMA 4FYDA 2GVAA 1TR5A 5EPKA 4X66L 1YNXA 3WOFA 2JQOA 3EBEA 3VR6A 4DV4Q 2DNEA 3PF4A 5EJWA 1WVLA 4L6TB 4GLXA 2ID0A 4DK1A 1HNZQ 4JI6L 3KF6A 1SE2A 4ZYSA 3SVMA 4BBSH 3BYYB 1LV9A 3X3MA 2HIVA 5C4XH 4LF5L 1PDQA 4IUNA 1WYDA 2WP8J 3Q23A 2HCIA 3K58A 1HH2P 1XPRA 2K5DA 5IYDG 1BR9A 3K7UC 2BDNA 5FLXc 1V9PA 3R2TA 2F0VA 1Q1EA 1SROA 2V4DA 3IRBA 3KJPA 1YBYA 3PO2G 5C44B 3KF6B 4C1NK 1R9TH 4LF4Q 3M4YA 4LF8L 4BY7B 1D5XC 3QJYA 3U50C 1MGSA 4A3JG 1PH4A 4N9PA 3S24A 3PIPA 3GTQB 2WIIB 2Q2HA 4OL7A 2BCOA 2B2VC 5E4WC 3PMFA 2VQFQ 2WINB 3G48A 4OO1G 4XT1B 2DY8A 3IKJA 5H1SE 2N88A 3CCJA 4HJ8A 1ASZA 4ZRZA 1YVCA 4DV2L 1NJIC 4HSPA 4A3FB 4A3CH 3J80i 2NVXH 2BE5C 3CMEA 1F77A 2QKIC 2DJGC 3FKIG 1H95A 4EQNA 2EXDA 4YWKA 3GD7A 1IZ6A 5C3EG 1YIJA 2VS1A 1T9HA 1OXVA 2L9HA 3OW2A 1NSNS 4OONA 3CCLA 3CCUA 1DYQA 1TY0A 4DV6Q 1XMQL 3K7AB 4M8AA 1H9RA 4J6HA 3S15B 1S72A 1UE6A 2A6HC 3D4RA 5DLQE 3C3LA 4DXGA 2CW0C 3K81C 1C48A 4DR2Q 4FO2A 1VF7A 1LTBD 4IPHA 1J5EQ 1SMYC 1O7ZA 4LK1C 3V05A 2E74C 1YNND 1ILQA 1D6EC 1QG7A 1TKWB 3HOYB 3ULLA 3HEJA 5GADC 2K14A 4NW2A 1CT1D 1MI2A 3U4ZA 3TMEA 1UWVA 3GO5A 2HD3A 2XNAC 2LFNA 2KCNA 4R8IA 4X6AH 2CHBD 4DXFA 2OQ0A 5C3XA 3J7YW 1KABA 2DY7A 3OIQA 4TVAB 2KHJA 4AIMA 3HKSA 1TWHB 3H3VH 5T1IA 3CC4A 2F0PA 5C44H 4BY7H 1BOSA 1TIID 1RCVD 4A75A 2E5LQ 3VA5A 2WB1B 3KYHC 3GTQH 4DK0A 1FNVA 4B3SL 1S5FD 2ZTDA 5HY6A 4V190 2IW3A 1XTCD 2NZHA 3BDOA 4MIUA 1ENAA 5D65A 1SXTA 1GO3E 4NP5A 1LM0A 3HOWB 5C5LA 1W6KA 1PH3A 3HGBA 1W6JA 4K6DA 2EY6A 3QR8A 4A3FH 4O0AA 1HTPA 3A7AB 3CF5A 4IJHA 1X3EA 4JI2Q 4FNFA 3P1HA 3WOEA 3L7ZC 1Y8OB 1PYBA 4HMIA 4C3HB 3L2PA 4DV4L 3QB3A 2Y0SB 5G3LD 1IL8A 1BXTA 1D8LA 1KHIA 2XGTA 1H9SA 1Y8NB 1A3VA 2ZXPA 4X3UA 1OO9B 1HNZL 5K36G 3K7AH 3S15H 3S1QB 1F2ZA 2KCCA 4YIJA 3DWAA 3MFGA 1MBYA 4A4IA 4IUPA 1SNDA 4A3IG 2VZAA 1TT2A 3FPPA 4DR1Q 2O4XA 2R7ZB 2F0TA 1JWMD 4ZCKA 1HZAA 4YHHQ 2L0CA 3J7AF 3HOYH 2DJFC 1VQBA 5D14A 2EYPA 3TP8A 4LF4L 4A93G 3K80C 1L2FA 3SK8A 2PMZB 4WJ4A 3N52A 4R4CA 2UUCQ 3K8AA 2UUAQ 2AKWB 1U5KA 3J7AV 2KBNA 3U9OA 4TKOB 3HOUB 1ASYA 1XX8A 2R92B 3SK4A 5E1FA 2VQFL 1BF4A 2EE1A 1TWHH 4RMFA 1B9MA 2PQAA 2ZXRA 1PH9A 5CV9A 2KA7A 4DAMA 1B70B 3ERQA 3NELA 5JJIA 1STEA 2F1MA 1PYSB 3EVQA 5GAEC 2H1EA 1SYEA 3A5ZB 1VQ7A 2F0EA 5A35A 1MJEA 2WACA 1GUOA 3OPOA 2GA4B 2VB2X 2GVBA 3NWSA 3HOWH 2XSCA 1PFSA 4DU9A 4H0LC 2F3IA 5M3FB 5IGGA 3DUZA 1LT4D 4LF9Q 1ESRA 1F9RA 4ME3A 1IHZA 1YHQA 2UXCQ 1GOZA 4DV6L 2LXJA 2XN9C 3CKIB 5JJZA 4QUCA 2HDLA 3EIVA 1STAA 4NDXA 4C3HH 4DK3C 3I8ZA 4DR2L 1BKBA 5IYBG 2F3VA 4IPCA 3OOCA 1CZGA 2RBMA 1DJRD 4RGMA 1ML0D 3K5OA 3I4NG 1PRTD 1WOCA 3S1QH 2JEAI 1E2VA 1TQOA 3UDXA 1PV4A 4JI8Q 4KD4A 5A2QL 4C3JB 1I6VC 1I4PA 3WWVA 4RHSA 1EZ8A 1E0BA 4EX5A 1T5EA 3H3VI 5JVH3 2CFMA 2EVBA 4NPSA 1RTOA 3P7JA 2R7ZH 1Y1WG 4PNYA 2XRQD 1B2TA 1QUQA 1PTOC 4XIGS 2L12A 1FNUA 4JOIA 4XYOA 5BN4A 1EQQA 3GTLB 3CCVA 2RDGA 1X65A 4IUTA 5D3DA 5ELFA 1W2BA 4C1NI 2E5LL 1SYDA 1BCPD 1EIYB 2NYZD 5A2QE 3HOUH 2R92H 2ZJRA 1K8MA 2H4OA 1HJPA 3NPPA 4OHJA 2BH8A 2L5TA 3KFUA 1TWFB 1VQ9A 4JBJA 4TRDA 2I5LX 1B50A 3QWNA 1QWYA 1XTDA 2EIFA 4J1MA 4CHTB 4A3DB 1JB3A 4B3MQ 5KRUA 5IP9G 2Z6BA 1FVIA 1GUNA 1JB7A 4JI2L 3M3YB 2MHVA 4HR7B 4OIKA 2F0WA 3RUZA 2RHSB 4QGUA 4HIMA 1SYCA 5M3FH 2E8GA 5FOBB 1Q8KA 1XPUA 2F0IA 2YV5A 1U4RA 3A74A 1UNSA 4P72A 3RMHA 2V1CC 2KECA 4X64Q 4QF4A 4UY8C 1FL0A 5AJ3Q 2JXMB 5I6WA 1DONA 2CWPA 4POGA 4GLAC 1CSPA 1K8GA 1EQTA 2NVQB 4EGVA 1XJVA 5COYA 4LFBL 5LMUQ 1EY8A 3HOVB 3W2DA 4DR1L 4FVMA 1CHPD 4YHHL 2CH4W 1AEXA 4GNXA 2Z6KA 3HFZB 3D8GA 3A55A 3PV0A 4C3JH 5GROA 5L37A 4GKJL 2EQSA 4H44C 2ZJQA 2UUCL 1U0LA 1U4PA 3FPUB 1HXYD 2UUAL 4DAYB 1HCZA 4JI1Q 5C4XG 3HZXA 5J22A 5C6AA 2Z9HA 4K5XA 5FJ8H 1HTLD 3F1ZA 3K0YA 4FDBA 2QEXA 3AU7A 5IOCA 3GTLH 2JA7B 1O7IA 2IJ0A 2FJ2A 2NN6H 4UPAA 4X3TA 2YTXA 4GNXB 2RCNA 5IYCG 3QO2A 2K5VA 1KTKA 1EY7A 2NBFA 4ZUJA 4EVOA 1FJGQ 1LACA 1NNXA 2C5CA 2CWAA 1SFOB 2P5ZX 3S17B 2ZT9C 3S9WA 2RHQB 2OTLA 5EBDA 3JAMc 1RJTA 5M3MG 3U58A 1TWFH 4XYQA 3HOXB 1VDZA 1XWEA 3PIOA 1TY2A 1C9OA 1TWAB 3B6YA 4A3DH 2XRSD 4LF9L 2NVTB 2MFIA 1PRTB 1EIFA 2E2HB 2UXCL 3UE0A 5EKIA 3KUPA 2NVYB 4Q0FA 3FEWX 1H9KA 4XDXA 1PLFA 4RGNA 3M3YH 2OEOA 2F0FA 2JK8A 1HHVA 4IPGA 1SNOA 4YCUA 1QNUA 4C3IB 4A3CG 3OW7A 5EGTA 1N36L 2JA8G 3KLSA 3S1NB 3DXJC 1NMFA 2B2YA 1KAWA 1AE2A 3ONAB 1Q12A 2Q8RE 2MPMA 4JI8L 4BBRB 1I4RA 2NVQH 3E9HA 3LX0A 1BCPB 3S1RB 1OTCA 5KYLA 1L1OA 3J7A5 3EROA 3HOVH 5JPMC 3ICEA 2PMZE 5C0XH 2QGQA 2B63B 4XQJA 3NTIA 3D4DA 1RDPD 2LKVA 4JCVE 3GTPB 3KOJA 3J81L 4O1NA 4IALA 1PTOF 4N8FA 4LF7Q 5NUCA 1E2ZA 2BA1A 1L1OB 4FP5D 3FMCA 4X62Q 2CQAA 2RSOA 1PFMA 2EYOA 3JC66 4G7HC 2JA7H 2NZOA 2IY5B 5M5YB 4YY3Q 4ABNA 4QMGA 3F8TA 3CCRA 2AWOA 1QE6A 1U9RA 3CAMA 2TSSA 4B3ML 3Q24A 5CR3A 4IOCA 1G2SA 4CDEC 3J81E 1WCMB 3T16A 1SFOH 4FXGC 3S17H 1K0SA 1SEBD 4DV0Q 3HOXH 1LT3D 3JAMi 2KHIA 3V2TA 3MZ5A 2NB0A 1TWAH 1EFID 2N49A 2NVTH 5GAGC 4DN4M 1HFGA 2RCFA 3SK5A 2E2HH 3MXNA 3MAQA 1VF5C 3L9AX 5IP7H 4X64L 2NVYH 3RLFA 3TS0A 2QW7A 1O78A 2K28A 5HGTA 2A69C 3NENA 1KQSA 4HJ5A 1FR3A 3PO3G 4JVZA 5E3FA 4UAIA 2JEBI 5LMUL 2E2DC 3GTGH 3S1NH 1NR4A 1E2WA 3GTKB 2EYMA 4CGYB 2SDFA 2HT1A 3R3OA 1EWCA 2JSOA 1OXTA 1P16A 4BA1I 3PUXA 3PUZA 3BU2A 1W3SA 4G4KA 5FO7B 1VQPA 1VQNA 2HUGA 3AEVA 4OX9Q 1QVCA 1B53A 2XTIA 4IN3A 5M5XB 3S1RH 2WFWA 1AFPA 3CPFA 1HUMA 1KNEA 1J9OA 1I5FA 4KKSA 5ELCA 3R93A 1DGSA 4JI1L 4XXEA 2R93B 3LWUA 1HA5A 2NN6I 2PPBC 3D3RA 2KCTA 1K8AC 5DM73 2B63H 3A54A 4X3SA 2AMCB 3MHBA 4LF6L 2H5XA 3GTPH 1JE5A 2LXKA 4G7ZC 5IGCA 1WJJA 5FLMH 4HJ9A 2VY3A 1SR3A 4KJNA 5ISRA 1VQ5A 4JI7Q 3VYRA 1MHWC 3RR5A 1FJGL 1SNCA 3E5SA 5F2DA 1EYAA 1VQIA 1JWUD 1I3QB 5M5YH 1UUPA 1X3GA 3EN2A 3FDTA 1A63A 3ND8A 3D31A 2L15A 2B2TA 3HKZG 4B9WA 4JBMA 1S5DD 1STHA 2LS01 1WTVA 1WCMH 2I5MX 2K4KA 3SGIA 4K5VA 3C46A 1YHAA 2VB3X 2EY1A 4NB3A 4DR3Q 3S14B 4K2LA 2PW5A 1HNXQ 3A56A 4HN7A 1KRTA 5IGFA 1PH6A 4CKBA 2K5WA 3BVMA 4ME5A 1PZID 1GKHA 1C8CA 1EU4A 3HRZC 4HEDA 3VR5A 3OHXC 1Y69U 1PA6A 1IBLQ 2LMCB 2JA6G 1AE3A 1D7QA 4DAVA 1M8AA 3BZCA 5C0XI 2Z4IA 3CMAA 2Z0SA 2F03A 5J3BA 4DR5Q 1I4GA 2MGSA 3GTKH 4A3GG 1SAPA 3GDEA 4OGQC 1YEZA 5LHY1 3RNUA 4KJOA 1IYJB 1VQFA 4LUZA 4A3BG 5DAUA 4A3MB 1OXUA 5HGQA 1UE1A 5ELDA 5M5XH 3I56A 2A74C 5C3WA 4OWTB 2R93H 1HA6A 2A68D 4LF7L 3CC2A 1EY9A 4IO9A 1X55A 1RF2D 5D3IB 4DA2A 1B4OA 2VUMB 1FD7D 4X62L 3S2DB 2AWNA 4X65Q 4J15A 4YY3L 4KTAA 4BY1B 2R7ZG 2JA5B 2EXZA 3RZDB 1EY5A 2EDGA 1EQRA 5CV8A 3PIP3 4DV5Q 1MIUA 3GV6A 3M4QA 4JYAQ 5IT9c 1I3QH 4LFAQ 1RIPA 4R9WA 4M1UB 1BO0A 2KEEA 1VQ6A 5CV7A 4IFDG 1PH1A 1YNNC 1EWIA 1EU3A 3OTOQ 3TS2A 4DR7L 1O7LA 3KBGA 5KEEA 4A3KB 1JJ2A 2KENA 1CQFA 1EY6A 1I94Q 2E2JB 3K6OA 3OMGA 1WD1A 3NTHA 1N33Q 1QVFA 2SOBA 3UDGA 2K01A 2QDLA 3PCOB 1X3FA 1VQ4A 3S14H 4WRDA 1IBMQ 1YITA 2A19A 1YJ9A 1PHJA 1VQEA 3NQIA 2MJ8A 3DM3A 5ELBA 3Q8DA 4IOAA 1TWCB 1BBUA 1YHBA 2D9UA 3NSWA 4BXXH 4YCWA 2O5JC 2PNHA 4OX9L 2CH4A 4N9TA 2VNUD 5BR8Q 3CD6A 3TP5A 3Q0AA 1LTTD 2JE6I 1A8VA 1D5ZC 5IGBA 2K1BA 2NWGA 1UE7A 1LT5D 3T56B 3I4MG 2K03A 3NQTA 2A6ED 4A3MH 2L1BA 3AFQA 3MXPA 3TSSA 3X3NA 2ICEC 1B9NA 5EPJA 4JI7L 1AZQA 4K8IA 4YCVA 1WTWA 2K50A 2SNSA 3MXGA 2F0HA 4UP9A 3MEHA 2VUMH 4DUYQ 3PO2B 1MSHA 1F2LA 3S2DH 2WKDA 3TREA 4JOIC 4RHRA 2K75A 1VQAA 2JA5H 2RDHA 4A3JB 3CW2C 2OWOA 1CM9A 3CCEA 4BY1H 4KN7C 3ULPA 3RZDH 4AYBG 1RKNA 3MFYA 1DZ1A 4YWLA 4DFAA 3CU7A 1ET6A 1V1QA 1XYIA 2PW7A 4IUVA 3TRZA 1IXRA 2AQ2B 2ZTEA 1HQMC 2F0SA 4DNIA 5FO8B 3KLSX 1SYGA 4DR3L 3KF8A 3ER0A 1H9SB 1HNXL 5E4XA 3FKIB 4A3KH 1K83B 1VQDA 2F0KA 1CKOA 1LTRD 5C3EB 3D6CA 1LO5D 2A1AA 2E2JH 4GOPA 4ALPA 5JEAH 1KLGD 2AQ1B 3HG9A 2KUMA 1CSQA 1VQOA 4GKKQ 5EAYA 2YTVA 1EOTA 4HIKA 1OXSC 3RD4A 4DR5L 1CI3M 4B08A 2F0DA 5C4JB 2HQLA 3UDFA 1TWCH 1STGA 4IPDA 1A2TA 1B8AA 4KKTA 2EJMA 3FP9A 4OXPA 2B2WA 3S16B 1VS0A 3J81j 2MUYA 3QG1A 1PYWD 4B9XA 2Q2IA 4A3LH 3IFDA 4K0KQ 1B3AA 2L11A 1I50B 4Z9CB 2RDFA 3IAYA 4P71A 2B8FA 3I72A 1EIHA 4X65L 2PQAB 4K6LA 1KC8C 5FKAC 3HOVG 1DOLA 1ILPA 4GNXC 4K5WA 3EFXD 1UAPA 2Z6KC 5IYDH 1LUZA 1SBBB 5M9OA 1X56A 4IUQA 1Q81C 1GUWA 1GJXA 2I46A 3F2UA 4DV5L 3NE5B 3PUWA 1N34Q 3M7GA 3PO2H 1CKNA 4JYAL 1Q90A 1J5EL 3Q6SA 3CRLC 4LFAL 4A3JH 3A8IE 4CJ0B 1EEID 3MVVA 2HQEA 4XQNA 1PRTC 1LTSD 1G6PA 2RQXA 3TQYA 1Q82C 1NUCA 3CCQA 3BJUA 3GTOB 3STBD 2QA4A 4OO1H 2F0LA 1JJGA 2FFKB 1I94L 4DR4Q 2QDBA 1M90C 1V1OA 2JP1A 1N33L 5CMDA 5LMNW 3I70A 5CGKA 1IBML 4DPGA 3MXUA 1B7YB 5J39A 3FKIH 1K83H 2NZ1D 4RA8A 2ALYB 5C3EH 2PI2A 5JPNC 1XNQQ 1S5ED 4JK1C 1GUSA 5EPLA 1BCPC 4JC0A 3A7LA 4GLVB 2SEBD 5BR8L 2MQHA 2N8NA 4CKCA 5I9OA 1YJWA 2EY5A 1TS5A 2O2LD 2EYJA 1IKMA 1I6HB 1QUQB 2AQ3B 2MNAA 5C4JH 3PUVA 1WD0A 2ZM6Q 2B2YC 1LYLA 4S3SA 2X69A 3S16H 3AQQA 3NWTA 3VR3A 5FLXE 2KCMA 4LAAA 2C35B 4H13C 3K57A 5I2YA 3SEBA 2R7FA 1EYGA 1EIGA 1NR2A 1I50H 1L1OC 4K14A 4C56C 2K6AA 3OWFA 1N8RC 3DM1A 1CTMA 5HURA 1E1TA 4DUYL 2K04A 2G5DA 4A93B 4U68A 4PMBA 1JC7A 3RZOB 1RTNA 4DF7A 5CBEE 1LTGD 5EKLA 3FVQA 2B63G 2F0MA 4KY7A 1SJED 3K5NA 4RH6A 5C5MA 3HOZG 1FYCA 4DV7Q 3NBIA 4F8MA 2EJGC 3L0OA 2DNCA 2OT2A 1JOOA 1AW7A 2Q8IB 1KLUD 1SJHD 1SDFA 1HUNA 1DM0B 2PO4A 2R6GA 2F4IA 3GTOH 1ZYRD 1HPCA 1K0RA 1WTHA 3BZKA 3CPWA 4J8QA 2RKSA 4DV1Q 4BBSG 1LTID 5IWAQ 1PZJD 4GKKL 5T1GA 1EOVA 4U673 1A0IA 3F2CA 1GM5A 1JJCB 1ENFA 1FNWA 1X3PA 2QCPX 5DNFA 3MA2B 1IL2A 4HCEA 4MZ9A 2CQOA 1Y1VB 4NXMQ 1E1OA 2WAQG 2ICIA 1HZ9A 2IX0A 1VQMA 4K0KL 4LNQA 3I4NB 1HRJA 4IJLA 5K36H 1S5BD 4JI4Q 1I6HH 2I0QA 2Z4HA 1T5XD 1KRSA 2TMPA 3Q22A 2G9HD 2F52A 3C1FA 1A15A 1O7YA 2L55A 1YNJD 4JW0A 4PMWA 1GXDC 2N55A 1Y1WB 5KNCA 1JE4A 1AH9A 1QOHA 4RCNA 2YYZA 3S1MB 1ZXTA 1PH5A 2YTYA 1RD9D 1D5MC 4H02A 1QJOA 4A76A 1K3BC 1JOKA 4A93H 2R93G 4ZQ3A 4OO1I 3H6MA 2E2IB 1BBWA 3SK6A 5KYIA 3S2HB 1HZCA 5IGEA 2PNRC 1SN8A 1PH8A 1PFNA 2D5DA 4DR4L 1BDOA 1NMGA 2VQEQ 3TP7A 4ODGA 3M4PA 3PIO3 2DGYA 3I91A 4KN4C 1X54A 1WFQA 3DMUA 2B2TC 1DOKA 2KJXA 1X3QA 2E76C 5CORA 1BQQT 2PZTA 1XNQL 1VMPA 5C4HA 2ATWA 1IW7D 2NUCA 2WKCA 4A3EB 2B2UA 3NBHA 3CC7A 5ELNA 1SE3A 2EJFC 2ZM6L 1XPOA 2HCCA 1Y1VH 1VCIA 4CDDC 2F0GA 1DXMA 5I9PA 4F7XA 3LWEA 5C44G 3G71A 4UP7A 3I4NH 4BY7G 3AB9A 3AFPA 4FXKC 3K5LA 1WTQA 4BXXG 1G91A 1S4ZA 4PG3A 2QF7A 4R4OA 3PUYA 3QOLA 1VQCA 5EKKA 4KY6A 4R4QA 1LABA 3I3CA 4KKUA 4IFDJ 1Y1WH 1X9NA 5AJ3L 4Y7NB 4I7ZC 3KLWA 3S1MH 3URYA 4XT3B 3I90A 4WJ3M 1XMOQ 1XNRQ 4A3FG 1MKHA 4C3IH 4DV7L 3PSIA 4IUUA 3A0JA 5IODA 2E2IH 2VUMG 5EBCA 3S2HH 3MXNB 4KY5A 1EYDA 4BBRH 1TU2B 4PZ7A 4RGOS 5M3MB 4JBWA 2FHTA 4QL5A 1H9MA 4DV1L 5IWAL 2UU9Q 1HQRD 1NBWA 2A73B 5IP9H 5GAHC 3DEPA 4LJZC 1ZKOA 1UEBA 4CDFC 4NXML 4DK6C 1ONLA 3HOYG 3SDZA 5DEHA 2JA8B 4A3EH 2BOSA 1R4QB 3HP3A 4F87A 3O13A 3I4LA 4PQXA 1MD2D 3ITPA 1HZBA 4JI4L 2OTJA 2PI2E 1HNWQ 3FHWA 2I07B 4WORA 4JI3Q 4ZUIA 1K8OA 4L5QA 1DCZA 1PH7A 2K5HA 4ZKCB 5K5PA 1KXLA 1KAAA 3TBIB 3VYTA 4ZKBB 1X6OA 4BS9A 3T1YQ 4K2KA 3MC0B 3CCSA 2WB1G 3NK9A 1L0WA 1CKMA 2WV6D 3D6WA 4A3LG 1ZEQX 2RVLA 1EQVA 4RFBA 4NXNQ 5JOBA 2Z1CA 1C4QA 1JQYD 1KDBA 2F0JA 4UDUC 3PF5A 1CHQD 3HOWG 3KDFA 4FF2A 3QIAA 4Y7NH 2EYHA 1FGUA 1I4QA 1L0XB 3N6RA 1F9PA 3VYUA 4L8JA 1SSOA 2VW9A 3TZUA 1KD1C 4EQ5A 5IYCH 2I5HA 2F0UA 5IGDA 3VR4A 3BZDB 2VQEL 4C3HG 1Z47A 1IYVA 2EYLA 4R1JA 2Y0SG 2VXWA 3W1GA 2BA0A 3H0GB 2OQKA 4BA2I 1NTGA 1AN8A 3KDFB 4OIJA 3K5MA 5M3MH 2EYFA 4ULLA 4FF3A 1JCKB 2A8VA 4CKEA 1WI5A 5CC4A 1S3OA 2A68C 2DN8A 2SNMA 3IL8A 2ZJPA 4H7BA 2UUBQ 3PQIA 4QCLA 3M9BA 1NE3A 3E3XA 2X6GA 3BDLA 1H9JA 4KI0A 4QJFA 1QILA 4EQPA 2BE5D 3PO3B 2IHFA 4JBKA 4GOPC 2JA8H 4JV5Q 5C0XJ 4O2DA 3E0EA 1A6XA 2L4NA 3TDQA 1E3PA 4DV0L 2R3ZA 3OSOA 1UE5A 3CHBD 2F4VQ 3HOUG 3JAML 1DD2A 3CXCA 2R92G 3SXHA 5TSSA 2A6HD 2B2WC 3RN2A 3C1EA 2CW0D 2ASBA 3KLRA 2Q8TA 2B8GA 4RKLA 1EWHA 4E6IA 1XMOL 1XNRL 1VQ8A 3M85A 1SMYD 4KHVA 2M9VA 2NTSA 3W5OA 5M5WB 4LUVA 4JI0Q 1A2UA 1GD7A 1JMCA 4AQYQ 2X6LA 2PQEA 1DOMA 3JAME 1X32A 3ZJYC 5M3FG 3TZDA 1C7YA 3LGJA 1NCVA 3BVZA 3LNNA 4ZLTF 4MN3A 2K5QA 5LMNQ 3G6JB 2AHOB 2CCZA 2XIWA 2HHHQ 5BN3A 5KGUA 2UU9L 2Q2TA 3NP8A 1G8ZD 2B29A 3HKZB 4RAUC 1SLJA 1PH2A 4EQOA 3DWPA 2XWJB 3CQZB 1NY4A 1D1IA 4IZ8A 3H0GH 3OYYA 1V1PA 4MNOA 4GZYC 1F2YA 2A6EC 3NEMA 4LFCQ 5E7NA 3T13A 2KVMA 2YU9B 1JOQA 1HFNA 1YI2A 1IYUA 1EY4A 4C3JG 4KV6A 2RF4A 1KIXA 1HNWL 1QNKA 2JA6B 1ESFA 4L5RC 3U9SA 5FJ8G 4JI3L 1JWSD 1K73C 3PO3H 1V1PB 2JN4A 2BDOA 5AFWA 2K05A 5ELOA 3T1YL 2NN6G 1WTXA 1EYCA 2B2VA 4A3GB 3WDNA 4DKAC 1TS3A 3A5UA 2AUKA 4G7OC 4A3BB 1B1ZA 4F88A 4JI5Q 1KDCA 4NXNL 4P75A 1TXYA 1EY0A 1G291 3BYTB 4QIWB 3T1HQ 1J6QA 3VDYA 1IBLL 4A3DG 2PCFB 1F9QA 1SE4A 1AZPA 2WAQE 3FRPB 4LFBQ 5M5WH 3KF8B 4IURA 4DV3Q 4JPBW 3J81c 4QQBX 4KMUC 4JG2A 1I4XA 4GKJQ 2G9DA 4UHVA 4HSVA 1O80A 3EA6A 1SMXA 2CKZB 1Y14B 5JAVA 1SE8A 4GOPB 1JR0D 3J80L 1LTLA 4OEMB 4L5SA 2UUBL 1PZKD 4GN3B 4P73A 4XQQA 1E7ZA 3RLOA 3CQZH 2F0OA 4I65A 1PMRA 3D0FA 1ENCA 4O42A 3SHLA 1EZ6A 2IT1A 5C0XG 3F2DA 2YU9H 1PVOA 1GUTA 3G6EA 4JV5L 2C9OA 2ZXOA 1RODA 2DUDA 3J80E 3R2IA 4AH6A 5JJKA 2F4VL 3ZYYX 4CJ2C 2JA6H 4CBVA 4OWWB 5FO9B 2UXDQ 3OTOL 4DGZA 4RKBA 4DNTB 3RLNA 3H94A 2JA7G 4RWSC 3STBC 1EL0A 1EUJA 1Y1VG 4B3RQ 2O5IC 1SNMA 4A3GH 5KNDA 2J4XA 4NMZA 1SYFA 1K3RA 1GVPA 4HAEA 4L63B 1N36Q 3I4MB 4R8NA 1CKNB 1SNQA 4A3BH 4MHEA 2UXBQ 1TWGB 4POFA 3BDCA 1M1KC 4JI0L 2HIXA 5LL6X 1VQKA 5FLXL 4AQYL 3HOXG 1G6ZA 3UE1A 3R8BA 4QB4A 1D1KA 4ZAIA 1S40A 1AP0A 2IX3A 3CP0A 3H15A 1ICFB 5LMNL 4PMCA 5IE8A 4HIDA 3D4WA 5IP7G 1PTOD 2B3GA 1QB5D 1K9MC 2HHHL 4AYBB 4V0BA 2M2LA 1YZ6A 3TEHB 3NUCA 4P2CB 1J8IA 3TN2A 1RHPA 4C3IG 3J81i 2QEJC 1SYBA 4MTKA 2JYOA 1VQGA 4RGTA 4OWXB 4A3IB 4KK7A 1U4LA 4LFCL 4Q5VA 2K32A 2QILA 4DR6Q 3G4SA 2NTTA 1MJCA 2CVRA 4IFDH 5IY0A 4Y52H 2Z8LA 2K33A 1VMCA 1N32Q 4UP8A 4BBRG 1K28A 4KD3A 3EQLC 1JT8A 2D2CC 1NAPA 4APVA 1D2BA 4PZ6A 1ET9A 1Z7TA 1MSGA 1P8LA 3K59A 3UI2A 2PZUA 4IQZA 3H09A 3AYHB 5G3LF 2N78A 1CZWA 1OXXK 5BN5A 1HR0Q 1E24A 2D0OA 1LLRD 3KJOA 5FLMG 3BVGA 4RCOA 1WTRA 2B2UC 3VA7A 3CRKC 1IBKQ 2PYKA 5IT9L 5DM63 3V96A 4A3EG 3VYSA 1BVSA 3I2ZA 5ELEA 3H91A 4JI5L 5CYUA 1UEAB 3DLLA 3T1HL 2HDMA 1ZYRC 1RL2A 5CBAE 4KHPQ 3J7ZC 2OF1A 4C2MB 2IPKD 4DAYA 3QOJA 2IX1A 5JVG3 1Q46A 1R4PB 2KOLA 2MO1A 3I4MH 3GV3A 3P75A 1YJNA 1WTPA 1QVGA 4LMQD 4DNRB 3GTJB 1WCMG 3OIPA 1TWGH 4PV1C 1B44D 2IHEA 1A62A 1ICWA 4DV3L 1VQJA 5IT9E 3M7NA 5I2XA 1Q1BA 2RA4A 4KLKA 1JORA 1N9WA 3DWQA 1QZHA 3ULJA 4FF1A 5KNBA 3HKZE 4DUZQ 5CV5A 2AUJD 4GN4B 4G57A 4HCSA 4YWMA 3P20A 2OCEA 3U4VA 1WTOA 3W1BA 1Q8IA 2WB1E 1E22A 2RSNA 3M4OB 2GN5A 4LF6Q 4HJAA 1GHKA 3NXWA 5GQOA 1SRUA 5JEAJ 4B3TQ 3OWEB 5IIFA 4A3IH 1GHJA 1G51A 5I6YA 2FMCA 3GTMB 4X66Q 4CDCC 1YNJC 4ZK9B 1IKLA 1M4VA 4GN5A 1V43A 1FGBD 1Q7YC 1SNPA 3ND9A 1TVXA 2EZVA 3E0JA 2FXQA 1N34L 1QZGA 2J7ZA 3IFTA 4HMJA 4ILWA 2PZWA 2BH2A 2IL8A 3MEFA 3BS1A 4JI6Q 2ENBA 3RZOH 3CCMA 3A8KE 1A3TA 2EOTA 3G7LA 4LWCA 4WJWA 1EEFD 4LF5Q 1Z9FA 2F0NA 2Y0SE 2UXDL 2FMMA 3T51B 1B3QA 4HJ7A 4WFN3 1KL9A 3I73A 5KIXA 4B3RL 1BBXC 2E75C 1PRTF 4QIWE 3GTGB 1PTOB 3SE0A 3VR2A 1STYA 2MO0A 2UXBL 1CK1A 4TQUS 4LF8Q 1KNAA 1G2TA 2LSSA 3MTSA 2N3SA 3T4AC 4CJ1B 2J0TD 4C2MH 3RN5A 4HIOA 1F9SA 4K8JA 2A5HA 1IW7C 1U4MA 5JJLA 2VL6A 3NHHA 3GTJH 2MP1A 3I7FA 3E6ZX 4OELB 4R4IA 4FXDA 1V8QA 3H3VC 1QCBD 3ERSX 3MWYW 4R4TA 2F3WA 1BCPF 2R61A 1TS4A 4DV2Q 4GS3A 1PXUA 5IYBH 4L5TA
chains in the Genus database with same CATH topology
3HOZB 1II3A 3OMCA 1BNZA 1F2MA 1PFBA 4QUFA 2KHSA 3EJIA 3HS0C 3L3OC 4HTHA 3T53B 3A8JE 5CV4A 4FF4A 1Z6HA 3KBXA 1Y8PB 2K7VA 2KEDA 3TP6A 3DEOA 5CV6A 1I4HA 4NKLA 4BBSB 3GQBA 2F0QA 4ID6A 5C4XB 2EPBA 4XTCS 1STNA 1S5CD 3SR1A 2EY2A 1KDAA 1XXGA 1BUVT 2LY7A 2WAQB 1TS2A 3NTKA 1GUGA 5I4DA 4TSSA 4DAPA 3BG3A 4BWGB 1R9TB 4X3KA 2D62A 1LTAD 2B39A 3C2PA 1STBA 2A69D 2XVSA 5C4ZA 1PTOH 4KHZA 1A3UA 1L0YB 2KQ3A 1CQVA 3AMUA 1CA6A 2NVXB 5FK9C 1JICA 3KK7A 3DHQA 2FINB 3W3AA 5J1ZA 5LL6S 2IWHA 5JEAG 3GP7A 1LT6D 1Q3LA 1CA5A 2M00A 2OXPA 2XWBB 5EQ0A 1CFMA 4FYDA 1TR5A 5EPKA 3WOFA 3VR6A 2DNEA 5EJWA 1WVLA 4L6TB 2ID0A 4DK1A 4ZYSA 1SE2A 3SVMA 3BYYB 1LV9A 3X3MA 1PDQA 4IUNA 2WP8J 3Q23A 2HCIA 3K58A 2K5DA 1BR9A 2BDNA 3R2TA 2F0VA 1Q1EA 2V4DA 5C44B 4C1NK 3M4YA 4BY7B 1D5XC 3QJYA 1MGSA 4N9PA 3GTQB 2WIIB 4OL7A 2BCOA 2B2VC 5E4WC 3PMFA 2WINB 4OO1G 4XT1B 2DY8A 3IKJA 2N88A 4ZRZA 4HSPA 4A3FB 2BE5C 1F77A 2QKIC 4EQNA 3GD7A 1OXVA 2L9HA 1NSNS 1DYQA 1TY0A 3K7AB 4M8AA 1H9RA 4J6HA 3S15B 2A6HC 3D4RA 3C3LA 4DXGA 2CW0C 1C48A 4FO2A 1VF7A 1LTBD 1SMYC 1O7ZA 4LK1C 3V05A 2E74C 1YNND 1ILQA 1D6EC 1TKWB 3HOYB 3HEJA 4NW2A 1CT1D 1MI2A 3TMEA 3GO5A 2XNAC 2LFNA 2KCNA 4R8IA 2CHBD 4DXFA 5C3XA 3J7YW 1KABA 2DY7A 3OIQA 1TWHB 5T1IA 2F0PA 1BOSA 1TIID 1RCVD 3VA5A 2WB1B 4DK0A 1FNVA 1S5FD 4V190 2IW3A 1XTCD 3BDOA 4MIUA 1ENAA 5D65A 1SXTA 4NP5A 3HOWB 5C5LA 1W6KA 3HGBA 1W6JA 4K6DA 2EY6A 1HTPA 3A7AB 4FNFA 3P1HA 3WOEA 3L7ZC 1Y8OB 4HMIA 4C3HB 3QB3A 2Y0SB 5G3LD 1IL8A 1BXTA 1H9SA 1Y8NB 1A3VA 2ZXPA 4X3UA 1OO9B 5K36G 3S1QB 1F2ZA 2KCCA 4YIJA 3DWAA 3MFGA 1MBYA 4IUPA 1SNDA 1TT2A 3FPPA 2O4XA 2R7ZB 2F0TA 1JWMD 2L0CA 3J7AF 5D14A 2EYPA 3TP8A 3SK8A 2PMZB 3N52A 3J7AV 3U9OA 4TKOB 3HOUB 1XX8A 2R92B 3SK4A 5E1FA 1BF4A 2EE1A 1B9MA 2ZXRA 5CV9A 2KA7A 3ERQA 1STEA 2F1MA 3EVQA 2H1EA 1SYEA 2F0EA 5A35A 2WACA 1GUOA 3OPOA 2GA4B 2VB2X 3NWSA 2XSCA 4DU9A 4H0LC 5M3FB 5IGGA 3DUZA 1LT4D 1ESRA 1F9RA 1IHZA 1GOZA 2XN9C 3CKIB 5JJZA 4QUCA 2HDLA 1STAA 4NDXA 3I8ZA 2F3VA 3OOCA 1CZGA 2RBMA 1DJRD 4RGMA 1ML0D 3K5OA 1PRTD 2JEAI 1E2VA 1TQOA 4KD4A 5A2QL 4C3JB 1I6VC 1I4PA 4RHSA 1EZ8A 1E0BA 1T5EA 5JVH3 2EVBA 1RTOA 3P7JA 4PNYA 2XRQD 1B2TA 1PTOC 4XIGS 2L12A 1FNUA 5BN4A 4XYOA 3GTLB 2RDGA 4IUTA 5D3DA 5ELFA 4C1NI 1SYDA 1BCPD 2NYZD 5A2QE 1K8MA 2H4OA 3NPPA 4OHJA 2L5TA 1TWFB 4TRDA 1B50A 3QWNA 1QWYA 4J1MA 4CHTB 4A3DB 1JB3A 5KRUA 1GUNA 3M3YB 2MHVA 4HR7B 4OIKA 2F0WA 3RUZA 1SYCA 5FOBB 2F0IA 1U4RA 1UNSA 3RMHA 2KECA 4QF4A 2JXMB 5I6WA 1DONA 2NVQB 1EQTA 4EGVA 5COYA 1EY8A 3HOVB 3W2DA 4FVMA 1CHPD 1AEXA 3D8GA 3A55A 3PV0A 4H44C 1U4PA 3FPUB 1HXYD 1HCZA 3HZXA 5J22A 5C6AA 4K5XA 1HTLD 3K0YA 3AU7A 5IOCA 2JA7B 2IJ0A 2FJ2A 2NN6H 4X3TA 3QO2A 1KTKA 1EY7A 2NBFA 4ZUJA 4EVOA 1LACA 2C5CA 1SFOB 3S17B 2ZT9C 3S9WA 5EBDA 3HOXB 1RJTA 4XYQA 1VDZA 1XWEA 1TY2A 1TWAB 2NVTB 2XRSD 1PRTB 2E2HB 5EKIA 3KUPA 2NVYB 4Q0FA 3FEWX 1H9KA 4XDXA 1PLFA 4RGNA 2OEOA 2F0FA 1HHVA 1SNOA 1QNUA 4C3IB 3OW7A 5EGTA 3KLSA 3S1NB 3DXJC 2B2YA 3ONAB 1Q12A 2Q8RE 2MPMA 4BBRB 1I4RA 3LX0A 1BCPB 3S1RB 5KYLA 3EROA 5JPMC 5C0XH 2B63B 4XQJA 3NTIA 3D4DA 1RDPD 2LKVA 3GTPB 3J81L 4O1NA 4IALA 1PTOF 5NUCA 1E2ZA 2BA1A 4FP5D 3FMCA 2CQAA 2RSOA 1PFMA 2EYOA 4G7HC 5M5YB 4ABNA 4QMGA 2AWOA 1QE6A 1U9RA 2TSSA 3Q24A 5CR3A 1G2SA 3J81E 1WCMB 3T16A 4FXGC 1SEBD 1LT3D 3V2TA 3MZ5A 2NB0A 1EFID 4DN4M 1HFGA 3SK5A 3MXNA 3MAQA 1VF5C 3L9AX 3RLFA 1O78A 2K28A 5HGTA 2A69C 1FR3A 5E3FA 4UAIA 2JEBI 2E2DC 1NR4A 1E2WA 3GTKB 2EYMA 4CGYB 2SDFA 3R3OA 1EWCA 2JSOA 1OXTA 4BA1I 3PUXA 3PUZA 4G4KA 5FO7B 2HUGA 1B53A 4IN3A 5M5XB 1AFPA 1HUMA 1KNEA 1J9OA 4KKSA 3R93A 5ELCA 4XXEA 2R93B 3LWUA 1HA5A 2NN6I 2PPBC 3D3RA 5DM73 3A54A 4X3SA 3MHBA 4G7ZC 5IGCA 4KJNA 5ISRA 3VYRA 1SNCA 3E5SA 5F2DA 1EYAA 1JWUD 1I3QB 1UUPA 3FDTA 3ND8A 3D31A 2B2TA 4B9WA 1S5DD 1STHA 2LS01 1WTVA 4K5VA 3C46A 2VB3X 2EY1A 3S14B 4K2LA 2PW5A 3A56A 4HN7A 5IGFA 4CKBA 2K5WA 3BVMA 4ME5A 1PZID 1C8CA 1EU4A 3HRZC 4HEDA 3VR5A 3OHXC 1Y69U 2LMCB 4DAVA 1M8AA 5C0XI 2Z4IA 2F03A 1I4GA 2MGSA 1SAPA 4OGQC 5LHY1 4KJOA 5DAUA 4A3MB 1OXUA 5ELDA 2A74C 5C3WA 1HA6A 2A68D 1EY9A 1RF2D 5D3IB 4DA2A 1B4OA 2VUMB 1FD7D 3S2DB 2AWNA 2JA5B 4KTAA 4BY1B 2EXZA 3RZDB 1EY5A 2EDGA 5CV8A 3PIP3 3GV6A 4R9WA 4M1UB 1BO0A 2KEEA 5CV7A 4IFDG 1YNNC 1EU3A 1O7LA 3KBGA 5KEEA 4A3KB 1CQFA 1EY6A 2E2JB 3K6OA 3OMGA 1WD1A 3NTHA 2SOBA 2K01A 4WRDA 5ELBA 3NQIA 2MJ8A 1TWCB 2D9UA 3NSWA 2O5JC 4N9TA 2VNUD 3TP5A 3Q0AA 1LTTD 2JE6I 5IGBA 1D5ZC 2K1BA 2NWGA 1LT5D 3T56B 2K03A 3NQTA 2A6ED 2L1BA 3MXPA 3TSSA 3X3NA 2ICEC 1B9NA 5EPJA 1AZQA 4K8IA 1WTWA 2SNSA 3MXGA 2F0HA 3MEHA 3PO2B 1MSHA 1F2LA 2WKDA 4RHRA 2RDHA 4A3JB 1CM9A 4KN7C 1RKNA 3MFYA 1DZ1A 4DFAA 3CU7A 1ET6A 1XYIA 2PW7A 4IUVA 2AQ2B 5FO8B 1HQMC 2F0SA 3KLSX 1SYGA 3KF8A 1H9SB 5E4XA 3FKIB 1K83B 2F0KA 1LTRD 5C3EB 3D6CA 1LO5D 5JEAH 1KLGD 2AQ1B 3HG9A 2KUMA 1EOTA 1OXSC 3RD4A 1CI3M 4B08A 2F0DA 5C4JB 1STGA 1A2TA 4KKTA 2EJMA 2B2WA 3S16B 2MUYA 3QG1A 1PYWD 4B9XA 3IFDA 1B3AA 2L11A 1I50B 4Z9CB 2RDFA 3IAYA 2B8FA 3I72A 1EIHA 4K6LA 5FKAC 1DOLA 1ILPA 4K5WA 3EFXD 1UAPA 1SBBB 5M9OA 4IUQA 1GUWA 1GJXA 2I46A 3F2UA 3NE5B 3PUWA 3M7GA 1Q90A 3Q6SA 3CRLC 3A8IE 4CJ0B 1EEID 3MVVA 2HQEA 4XQNA 1PRTC 1LTSD 2RQXA 1NUCA 3GTOB 4OO1H 2F0LA 2FFKB 2QDBA 1V1OA 2JP1A 5CMDA 3I70A 5CGKA 3MXUA 5J39A 2NZ1D 4RA8A 5JPNC 1S5ED 4JK1C 1GUSA 5EPLA 1BCPC 3A7LA 2SEBD 4CKCA 5I9OA 2EY5A 1TS5A 2O2LD 2EYJA 1IKMA 1I6HB 2AQ3B 3PUVA 1WD0A 2B2YC 4S3SA 2X69A 3NWTA 3VR3A 5FLXE 4LAAA 4H13C 3K57A 5I2YA 3SEBA 1EIGA 1NR2A 4K14A 4C56C 2K6AA 3OWFA 3DM1A 1CTMA 5HURA 2K04A 4A93B 4U68A 4PMBA 1JC7A 3RZOB 1RTNA 4DF7A 5CBEE 1LTGD 5EKLA 3FVQA 2F0MA 4KY7A 1SJED 3K5NA 4RH6A 5C5MA 1FYCA 3NBIA 4F8MA 2EJGC 2DNCA 2OT2A 1JOOA 1AW7A 2Q8IB 1KLUD 1SJHD 1SDFA 1HUNA 1DM0B 2R6GA 2PO4A 2F4IA 1ZYRD 1HPCA 4J8QA 2RKSA 1LTID 1PZJD 5T1GA 4U673 1ENFA 1FNWA 1X3PA 2QCPX 5DNFA 3MA2B 4HCEA 1Y1VB 2ICIA 2IX0A 3I4NB 1HRJA 5K36H 1S5BD 2Z4HA 1T5XD 2TMPA 3Q22A 2G9HD 3C1FA 1A15A 1O7YA 2L55A 1YNJD 4PMWA 1GXDC 2N55A 1Y1WB 5KNCA 1JE4A 1QOHA 4RCNA 2YYZA 3S1MB 1ZXTA 1RD9D 1D5MC 1QJOA 1JOKA 4ZQ3A 4OO1I 3H6MA 2E2IB 3SK6A 5KYIA 3S2HB 5IGEA 2PNRC 1PFNA 2D5DA 1BDOA 3TP7A 4ODGA 3PIO3 3I91A 4KN4C 3DMUA 2B2TC 1DOKA 2KJXA 5CORA 1X3QA 2E76C 1BQQT 2PZTA 1VMPA 5C4HA 1IW7D 2NUCA 2WKCA 4A3EB 2B2UA 3NBHA 1SE3A 2EJFC 2HCCA 1VCIA 2F0GA 1DXMA 5I9PA 4F7XA 3LWEA 3AB9A 4FXKC 3K5LA 1WTQA 1G91A 1S4ZA 2QF7A 3PUYA 3QOLA 5EKKA 4KY6A 1LABA 3I3CA 4KKUA 4IFDJ 4Y7NB 4I7ZC 3URYA 4XT3B 3I90A 4IUUA 5IODA 5EBCA 4KY5A 1EYDA 1TU2B 4RGOS 5M3MB 4JBWA 2FHTA 1H9MA 1HQRD 2A73B 3DEPA 4LJZC 1ZKOA 1ONLA 3SDZA 5DEHA 2JA8B 2BOSA 4F87A 1R4QB 3HP3A 3O13A 3I4LA 4PQXA 1MD2D 3ITPA 2I07B 4WORA 4ZUIA 1K8OA 1DCZA 4ZKCB 5K5PA 1KAAA 3TBIB 3VYTA 4ZKBB 4BS9A 4K2KA 3MC0B 3NK9A 2WV6D 3D6WA 1ZEQX 2RVLA 1EQVA 4RFBA 5JOBA 2Z1CA 1C4QA 1JQYD 1KDBA 2F0JA 4UDUC 1CHQD 4FF2A 3QIAA 2EYHA 1I4QA 1L0XB 3N6RA 1F9PA 3VYUA 4L8JA 1SSOA 3TZUA 5IGDA 2F0UA 3VR4A 3BZDB 4C3HG 1Z47A 1IYVA 2EYLA 2VXWA 2BA0A 3H0GB 4BA2I 3K5MA 1AN8A 4OIJA 2EYFA 4ULLA 4FF3A 1JCKB 4CKEA 5CC4A 2A68C 2DN8A 2SNMA 3IL8A 4H7BA 4QCLA 2X6GA 3BDLA 1H9JA 4KI0A 1QILA 4EQPA 2BE5D 3PO3B 5C0XJ 1A6XA 2L4NA 3TDQA 2R3ZA 3OSOA 3CHBD 3JAML 1DD2A 3SXHA 5TSSA 2A6HD 2B2WC 3C1EA 2CW0D 3KLRA 2Q8TA 2B8GA 4RKLA 1EWHA 4E6IA 3M85A 1SMYD 4KHVA 2M9VA 2NTSA 5M5WB 1A2UA 2X6LA 2PQEA 1DOMA 3JAME 1X32A 3TZDA 4ZLTF 1NCVA 3BVZA 3LNNA 4MN3A 2K5QA 3G6JB 2XIWA 5BN3A 5KGUA 3NP8A 1G8ZD 3HKZB 4RAUC 4EQOA 3DWPA 2XWJB 3CQZB 1D1IA 4IZ8A 1V1PA 4GZYC 1F2YA 2A6EC 3T13A 2KVMA 2YU9B 1JOQA 1HFNA 1IYUA 1EY4A 4C3JG 4KV6A 1QNKA 2JA6B 1ESFA 3U9SA 1JWSD 1V1PB 2BDOA 5AFWA 2K05A 2NN6G 1WTXA 1EYCA 2B2VA 4A3GB 3WDNA 1TS3A 2AUKA 4G7OC 4A3BB 1B1ZA 4F88A 1KDCA 1EY0A 1G291 3BYTB 4QIWB 2PCFB 1F9QA 1SE4A 1AZPA 3FRPB 4IURA 4KMUC 1I4XA 2G9DA 4HSVA 1O80A 3EA6A 5JAVA 1JR0D 3J80L 1PZKD 4XQQA 2F0OA 4I65A 1PMRA 1ENCA 4O42A 3SHLA 1EZ6A 2IT1A 5C0XG 1GUTA 2C9OA 2ZXOA 1RODA 3J80E 3R2IA 3ZYYX 4CJ2C 4CBVA 5FO9B 4DGZA 4RKBA 4DNTB 3H94A 4RWSC 1EL0A 2O5IC 1SNMA 5KNDA 2J4XA 4NMZA 1SYFA 4HAEA 4L63B 3I4MB 4R8NA 1SNQA 4MHEA 1TWGB 3BDCA 5LL6X 5FLXL 1G6ZA 3R8BA 4QB4A 1D1KA 4ZAIA 1AP0A 2IX3A 4PMCA 3D4WA 1PTOD 1QB5D 4AYBB 4V0BA 2M2LA 3NUCA 4P2CB 1J8IA 3TN2A 1RHPA 4C3IG 2QEJC 1SYBA 2JYOA 4RGTA 4A3IB 4KK7A 1U4LA 4Q5VA 2K32A 2QILA 2NTTA 2CVRA 4IFDH 2Z8LA 2K33A 1VMCA 4KD3A 3EQLC 2D2CC 1NAPA 1D2BA 1ET9A 1Z7TA 1MSGA 3K59A 3UI2A 2PZUA 4IQZA 3H09A 5G3LF 1CZWA 1OXXK 5BN5A 1LLRD 3BVGA 4RCOA 1WTRA 2B2UC 3VA7A 3CRKC 2PYKA 5IT9L 5DM63 3V96A 3VYSA 5ELEA 3H91A 5CYUA 1UEAB 2HDMA 1ZYRC 5CBAE 2OF1A 4C2MB 2IPKD 4DAYA 3QOJA 2IX1A 5JVG3 1R4PB 2KOLA 3GV3A 3P75A 1WTPA 4LMQD 4DNRB 3GTJB 3OIPA 4PV1C 1B44D 1ICWA 5IT9E 3M7NA 5I2XA 1Q1BA 2RA4A 1JORA 3DWQA 4FF1A 5KNBA 5CV5A 2AUJD 4G57A 4HCSA 3P20A 1WTOA 1Q8IA 2RSNA 3M4OB 1GHKA 3NXWA 5JEAJ 3OWEB 5IIFA 1GHJA 5I6YA 2FMCA 3GTMB 1YNJC 4ZK9B 1IKLA 1M4VA 1V43A 1FGBD 1SNPA 3ND9A 1TVXA 2EZVA 3E0JA 2J7ZA 3IFTA 4HMJA 4ILWA 2PZWA 2IL8A 3BS1A 2ENBA 3A8KE 1A3TA 2EOTA 3G7LA 4WJWA 1EEFD 2F0NA 2FMMA 3T51B 4WFN3 3I73A 5KIXA 1BBXC 2E75C 1PRTF 3GTGB 1PTOB 3SE0A 3VR2A 1STYA 1CK1A 4TQUS 1KNAA 1G2TA 3MTSA 3T4AC 4CJ1B 2J0TD 1F9SA 4K8JA 2A5HA 1IW7C 1U4MA 3NHHA 2MP1A 3E6ZX 4FXDA 1V8QA 3H3VC 1QCBD 3MWYW 2F3WA 1BCPF 2R61A 1TS4A 1QG7A 1PXUA 4IFDI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P75 A;  1II3 A;  1EY5 A;  5CV9 A;  4DGZ A;  1EY4 A;  3ERQ A;  3OMC A;  4KV6 A;  2F0W A;  4RKB A;  3RUZ A;  1F2M A;  5CV8 A;  2KHS A;  1SYC A;  3EVQ A;  5I9O A;  2EY5 A;  3C1F A;  2F0K A;  2EYF A;  3EJI A;  1SYE A;  3MHB A;  1SNM A;  2EYJ A;  3LX0 A;  4HTH A;  1KAB A;  5C3X A;  2F0E A;  4NMZ A;  1SYF A;  5CV4 A;  2F0I A;  2WAC A;  4IUN A;  5IGC A;  3D6C A;  3ERO A;  5IOD A;  5KYL A;  1JOR A;  5CC4 A;  4R8N A;  2F0P A;  1SNQ A;  4KJN A;  5ISR A;  4S3S A;  2SNM A;  4KY5 A;  4QF4 A;  4H7B A;  5CV7 A;  3TP6 A;  5I6W A;  1EYD A;  3BDC A;  5CV6 A;  5CV5 A;  4G57 A;  3VA5 A;  4NKL A;  4LAA A;  1JOK A;  1SNC A;  3D4D A;  4DU9 A;  5IGG A;  2LKV A;  5KEE A;  1EYC A;  3E5S A;  2F0Q A;  4ID6 A;  5F2D A;  1EYA A;  2F0V A;  4ZQ3 A;  1IHZ A;  1EY6 A;  3BDL A;  2F0D A;  3H6M A;  1STN A;  4QB4 A;  3SK6 A;  1EY8 A;  4MIU A;  5KYI A;  3OMG A;  1ENA A;  4IAL A;  1STG A;  4K14 A;  4EQP A;  3OWF A;  1A2T A;  3NXW A;  4NP5 A;  5IGE A;  4PMC A;  2SOB A;  3SR1 A;  5HUR A;  5NUC A;  2EY2 A;  5IIF A;  5C5L A;  3D4W A;  5I6Y A;  1KDC A;  1STA A;  1KDA A;  4N9P A;  4NDX A;  1EY0 A;  4WRD A;  1AEX A;  4B9X A;  4B9W A;  4PMB A;  1STH A;  2F3V A;  4OL7 A;  4K6D A;  3D8G A;  2EY6 A;  3OSO A;  2EYO A;  2RBM A;  3NUC A;  1SNP A;  4DF7 A;  4K5V A;  5EKL A;  3PMF A;  2RDF A;  2F0M A;  3TP7 A;  1SYB A;  4KY7 A;  5DEH A;  3SXH A;  3P1H A;  2EY1 A;  4QMG A;  4ODG A;  1STB A;  1U9R A;  4HMJ A;  3HZX A;  2PZW A;  4HMI A;  4K2L A;  5C6A A;  1TQO A;  4K5X A;  4N9T A;  5C5M A;  2ENB A;  3QB3 A;  3DMU A;  3ITP A;  5CR3 A;  2PW5 A;  3C1E A;  4KD4 A;  4F8M A;  5IGF A;  1A3T A;  3T16 A;  4K5W A;  5C4Z A;  5IOC A;  4RKL A;  3TP5 A;  1A3V A;  5J22 A;  4ME5 A;  1EZ8 A;  2PZT A;  2F0N A;  1JOO A;  4E6I A;  4KD3 A;  5C4H A;  5M9O A;  1A3U A;  4WOR A;  5IGB A;  2KQ3 A;  2NUC A;  4ZUI A;  4EQN A;  3V2T A;  4KHV A;  1F2Z A;  4PNY A;  5K5P A;  1KAA A;  1EY7 A;  3MZ5 A;  5JAV A;  5KIX A;  4YIJ A;  4ZUJ A;  3NQT A;  4EVO A;  1A2U A;  4K2K A;  3SK5 A;  2PZU A;  2PQE A;  3MXP A;  3S9W A;  2RKS A;  1NSN S;  3NK9 A;  1STY A;  1SND A;  1TT2 A;  4K8I A;  3MVV A;  2HQE A;  2F0G A;  2O4X A;  3DHQ A;  4J6H A;  1EQV A;  2F0O A;  1SYD A;  2SNS A;  5J1Z A;  4KJO A;  2F0T A;  2F0H A;  4I65 A;  5HGT A;  3MEH A;  1ENC A;  1NUC A;  4F7X A;  5I9P A;  3SHL A;  5DAU A;  1EZ6 A;  5JOB A;  5E3F A;  2F0L A;  5KGU A;  1KDB A;  2F0J A;  2PYK A;  2EYP A;  2QDB A;  3TP8 A;  3NP8 A;  5C3W A;  4K8J A;  2M00 A;  2OXP A;  3SK8 A;  2EYH A;  2EYM A;  4EQO A;  1RKN A;  1EY9 A;  3NHH A;  3R3O A;  4TRD A;  5CGK A;  2OEO A;  2F0F A;  4IZ8 A;  4DFA A;  1TR5 A;  1SNO A;  4J1M A;  3U9O A;  3QOL A;  2PW7 A;  1F2Y A;  5J39 A;  5EGT A;  2OF1 A;  5EKK A;  4KY6 A;  5KRU A;  3HEJ A;  5E1F A;  3SK4 A;  3T13 A;  2F3W A;  3QOJ A;  3TME A;  2F0S A;  2F0U A;  5IGD A;  4KTA A;  1SYG A;  1JOQ A;  2EXZ A;  2EYL A; 
#chains in the Genus database with same CATH topology
 2R7D A;  3HOZ B;  1II3 A;  3OMC A;  1BNZ A;  1F2M A;  1PFB A;  4QUF A;  2KHS A;  4DR6 L;  3EJI A;  3HS0 C;  3L3O C;  4HTH A;  3T53 B;  1N32 L;  3A8J E;  5CV4 A;  1HR0 W;  2Q2U A;  4FF4 A;  1Z6H A;  3M4O H;  3KBX A;  3NBH B;  1Y8P B;  2K7V A;  2KED A;  4P74 A;  3TP6 A;  3DEO A;  5CV6 A;  1XMQ Q;  1I4H A;  4NKL A;  4BBS B;  3GTM H;  4LUO A;  3GQB A;  2K5N A;  2F0Q A;  4ID6 A;  5C4X B;  2EPB A;  4PZ8 A;  2ES2 A;  4XTC S;  1STN A;  1EFW A;  1HR0 L;  3H0G G;  1S5C D;  4A3M G;  3UDI A;  3SR1 A;  3PGZ A;  2EY2 A;  1KDA A;  1XXG A;  1IBK L;  1BUV T;  2LY7 A;  2WAQ B;  1TS2 A;  4DR7 Q;  2JJQ A;  3NTK A;  1GUG A;  5I4D A;  4TSS A;  4DAP A;  3BG3 A;  4BWG B;  3F2B A;  1R9T B;  1VQL A;  4X3K A;  4IFD I;  2D62 A;  1LTA D;  4MTN A;  2B39 A;  3C2P A;  1STB A;  2JA5 G;  4KHP L;  4BY1 G;  2A69 D;  4LW1 A;  1VQH A;  2XVS A;  3E9I A;  5C4Z A;  1PTO H;  4KHZ A;  4I7A A;  1A3U A;  1L0Y B;  1Q86 C;  1C0A A;  2KQ3 A;  2JA9 A;  4QY7 A;  3K0X A;  1CQV A;  3AMU A;  1CUK A;  1CA6 A;  4B3S Q;  4RG1 A;  4AYB E;  3J80 c;  2NVX B;  3I4O A;  4DUZ L;  5FK9 C;  4A3K G;  2K52 A;  4N8X 1;  2D0P A;  1JIC A;  3KK7 A;  3DHQ A;  2FIN B;  3W3A A;  5J1Z A;  5LL6 S;  2IWH A;  2ZTC A;  5JEA G;  3GP7 A;  1LT6 D;  1Q3L A;  1CA5 A;  2M00 A;  2OXP A;  2XWB B;  3I55 A;  5EQ0 A;  3HOZ H;  4B3T L;  1CFM A;  4FYD A;  2GVA A;  1TR5 A;  5EPK A;  4X66 L;  1YNX A;  3WOF A;  2JQO A;  3EBE A;  3VR6 A;  4DV4 Q;  2DNE A;  3PF4 A;  5EJW A;  1WVL A;  4L6T B;  4GLX A;  2ID0 A;  4DK1 A;  1HNZ Q;  4JI6 L;  3KF6 A;  1SE2 A;  4ZYS A;  3SVM A;  4BBS H;  3BYY B;  1LV9 A;  3X3M A;  2HIV A;  5C4X H;  4LF5 L;  1PDQ A;  4IUN A;  1WYD A;  2WP8 J;  3Q23 A;  2HCI A;  3K58 A;  1HH2 P;  1XPR A;  2K5D A;  5IYD G;  1BR9 A;  3K7U C;  2BDN A;  5FLX c;  1V9P A;  3R2T A;  2F0V A;  1Q1E A;  1SRO A;  2V4D A;  3IRB A;  3KJP A;  1YBY A;  3PO2 G;  5C44 B;  3KF6 B;  4C1N K;  1R9T H;  4LF4 Q;  3M4Y A;  4LF8 L;  4BY7 B;  1D5X C;  3QJY A;  3U50 C;  1MGS A;  4A3J G;  1PH4 A;  4N9P A;  3S24 A;  3PIP A;  3GTQ B;  2WII B;  2Q2H A;  4OL7 A;  2BCO A;  2B2V C;  5E4W C;  3PMF A;  2VQF Q;  2WIN B;  3G48 A;  4OO1 G;  4XT1 B;  2DY8 A;  3IKJ A;  5H1S E;  2N88 A;  3CCJ A;  4HJ8 A;  1ASZ A;  4ZRZ A;  1YVC A;  4DV2 L;  1NJI C;  4HSP A;  4A3F B;  4A3C H;  3J80 i;  2NVX H;  2BE5 C;  3CME A;  1F77 A;  2QKI C;  2DJG C;  3FKI G;  1H95 A;  4EQN A;  2EXD A;  4YWK A;  3GD7 A;  1IZ6 A;  5C3E G;  1YIJ A;  2VS1 A;  1T9H A;  1OXV A;  2L9H A;  3OW2 A;  1NSN S;  4OON A;  3CCL A;  3CCU A;  1DYQ A;  1TY0 A;  4DV6 Q;  1XMQ L;  3K7A B;  4M8A A;  1H9R A;  4J6H A;  3S15 B;  1S72 A;  1UE6 A;  2A6H C;  3D4R A;  5DLQ E;  3C3L A;  4DXG A;  2CW0 C;  3K81 C;  1C48 A;  4DR2 Q;  4FO2 A;  1VF7 A;  1LTB D;  4IPH A;  1J5E Q;  1SMY C;  1O7Z A;  4LK1 C;  3V05 A;  2E74 C;  1YNN D;  1ILQ A;  1D6E C;  1QG7 A;  1TKW B;  3HOY B;  3ULL A;  3HEJ A;  5GAD C;  2K14 A;  4NW2 A;  1CT1 D;  1MI2 A;  3U4Z A;  3TME A;  1UWV A;  3GO5 A;  2HD3 A;  2XNA C;  2LFN A;  2KCN A;  4R8I A;  4X6A H;  2CHB D;  4DXF A;  2OQ0 A;  5C3X A;  3J7Y W;  1KAB A;  2DY7 A;  3OIQ A;  4TVA B;  2KHJ A;  4AIM A;  3HKS A;  1TWH B;  3H3V H;  5T1I A;  3CC4 A;  2F0P A;  5C44 H;  4BY7 H;  1BOS A;  1TII D;  1RCV D;  4A75 A;  2E5L Q;  3VA5 A;  2WB1 B;  3KYH C;  3GTQ H;  4DK0 A;  1FNV A;  4B3S L;  1S5F D;  2ZTD A;  5HY6 A;  4V19 0;  2IW3 A;  1XTC D;  2NZH A;  3BDO A;  4MIU A;  1ENA A;  5D65 A;  1SXT A;  1GO3 E;  4NP5 A;  1LM0 A;  3HOW B;  5C5L A;  1W6K A;  1PH3 A;  3HGB A;  1W6J A;  4K6D A;  2EY6 A;  3QR8 A;  4A3F H;  4O0A A;  1HTP A;  3A7A B;  3CF5 A;  4IJH A;  1X3E A;  4JI2 Q;  4FNF A;  3P1H A;  3WOE A;  3L7Z C;  1Y8O B;  1PYB A;  4HMI A;  4C3H B;  3L2P A;  4DV4 L;  3QB3 A;  2Y0S B;  5G3L D;  1IL8 A;  1BXT A;  1D8L A;  1KHI A;  2XGT A;  1H9S A;  1Y8N B;  1A3V A;  2ZXP A;  4X3U A;  1OO9 B;  1HNZ L;  5K36 G;  3K7A H;  3S15 H;  3S1Q B;  1F2Z A;  2KCC A;  4YIJ A;  3DWA A;  3MFG A;  1MBY A;  4A4I A;  4IUP A;  1SND A;  4A3I G;  2VZA A;  1TT2 A;  3FPP A;  4DR1 Q;  2O4X A;  2R7Z B;  2F0T A;  1JWM D;  4ZCK A;  1HZA A;  4YHH Q;  2L0C A;  3J7A F;  3HOY H;  2DJF C;  1VQB A;  5D14 A;  2EYP A;  3TP8 A;  4LF4 L;  4A93 G;  3K80 C;  1L2F A;  3SK8 A;  2PMZ B;  4WJ4 A;  3N52 A;  4R4C A;  2UUC Q;  3K8A A;  2UUA Q;  2AKW B;  1U5K A;  3J7A V;  2KBN A;  3U9O A;  4TKO B;  3HOU B;  1ASY A;  1XX8 A;  2R92 B;  3SK4 A;  5E1F A;  2VQF L;  1BF4 A;  2EE1 A;  1TWH H;  4RMF A;  1B9M A;  2PQA A;  2ZXR A;  1PH9 A;  5CV9 A;  2KA7 A;  4DAM A;  1B70 B;  3ERQ A;  3NEL A;  5JJI A;  1STE A;  2F1M A;  1PYS B;  3EVQ A;  5GAE C;  2H1E A;  1SYE A;  3A5Z B;  1VQ7 A;  2F0E A;  5A35 A;  1MJE A;  2WAC A;  1GUO A;  3OPO A;  2GA4 B;  2VB2 X;  2GVB A;  3NWS A;  3HOW H;  2XSC A;  1PFS A;  4DU9 A;  4H0L C;  2F3I A;  5M3F B;  5IGG A;  3DUZ A;  1LT4 D;  4LF9 Q;  1ESR A;  1F9R A;  4ME3 A;  1IHZ A;  1YHQ A;  2UXC Q;  1GOZ A;  4DV6 L;  2LXJ A;  2XN9 C;  3CKI B;  5JJZ A;  4QUC A;  2HDL A;  3EIV A;  1STA A;  4NDX A;  4C3H H;  4DK3 C;  3I8Z A;  4DR2 L;  1BKB A;  5IYB G;  2F3V A;  4IPC A;  3OOC A;  1CZG A;  2RBM A;  1DJR D;  4RGM A;  1ML0 D;  3K5O A;  3I4N G;  1PRT D;  1WOC A;  3S1Q H;  2JEA I;  1E2V A;  1TQO A;  3UDX A;  1PV4 A;  4JI8 Q;  4KD4 A;  5A2Q L;  4C3J B;  1I6V C;  1I4P A;  3WWV A;  4RHS A;  1EZ8 A;  1E0B A;  4EX5 A;  1T5E A;  3H3V I;  5JVH 3;  2CFM A;  2EVB A;  4NPS A;  1RTO A;  3P7J A;  2R7Z H;  1Y1W G;  4PNY A;  2XRQ D;  1B2T A;  1QUQ A;  1PTO C;  4XIG S;  2L12 A;  1FNU A;  4JOI A;  4XYO A;  5BN4 A;  1EQQ A;  3GTL B;  3CCV A;  2RDG A;  1X65 A;  4IUT A;  5D3D A;  5ELF A;  1W2B A;  4C1N I;  2E5L L;  1SYD A;  1BCP D;  1EIY B;  2NYZ D;  5A2Q E;  3HOU H;  2R92 H;  2ZJR A;  1K8M A;  2H4O A;  1HJP A;  3NPP A;  4OHJ A;  2BH8 A;  2L5T A;  3KFU A;  1TWF B;  1VQ9 A;  4JBJ A;  4TRD A;  2I5L X;  1B50 A;  3QWN A;  1QWY A;  1XTD A;  2EIF A;  4J1M A;  4CHT B;  4A3D B;  1JB3 A;  4B3M Q;  5KRU A;  5IP9 G;  2Z6B A;  1FVI A;  1GUN A;  1JB7 A;  4JI2 L;  3M3Y B;  2MHV A;  4HR7 B;  4OIK A;  2F0W A;  3RUZ A;  2RHS B;  4QGU A;  4HIM A;  1SYC A;  5M3F H;  2E8G A;  5FOB B;  1Q8K A;  1XPU A;  2F0I A;  2YV5 A;  1U4R A;  3A74 A;  1UNS A;  4P72 A;  3RMH A;  2V1C C;  2KEC A;  4X64 Q;  4QF4 A;  4UY8 C;  1FL0 A;  5AJ3 Q;  2JXM B;  5I6W A;  1DON A;  2CWP A;  4POG A;  4GLA C;  1CSP A;  1K8G A;  1EQT A;  2NVQ B;  4EGV A;  1XJV A;  5COY A;  4LFB L;  5LMU Q;  1EY8 A;  3HOV B;  3W2D A;  4DR1 L;  4FVM A;  1CHP D;  4YHH L;  2CH4 W;  1AEX A;  4GNX A;  2Z6K A;  3HFZ B;  3D8G A;  3A55 A;  3PV0 A;  4C3J H;  5GRO A;  5L37 A;  4GKJ L;  2EQS A;  4H44 C;  2ZJQ A;  2UUC L;  1U0L A;  1U4P A;  3FPU B;  1HXY D;  2UUA L;  4DAY B;  1HCZ A;  4JI1 Q;  5C4X G;  3HZX A;  5J22 A;  5C6A A;  2Z9H A;  4K5X A;  5FJ8 H;  1HTL D;  3F1Z A;  3K0Y A;  4FDB A;  2QEX A;  3AU7 A;  5IOC A;  3GTL H;  2JA7 B;  1O7I A;  2IJ0 A;  2FJ2 A;  2NN6 H;  4UPA A;  4X3T A;  2YTX A;  4GNX B;  2RCN A;  5IYC G;  3QO2 A;  2K5V A;  1KTK A;  1EY7 A;  2NBF A;  4ZUJ A;  4EVO A;  1FJG Q;  1LAC A;  1NNX A;  2C5C A;  2CWA A;  1SFO B;  2P5Z X;  3S17 B;  2ZT9 C;  3S9W A;  2RHQ B;  2OTL A;  5EBD A;  3JAM c;  1RJT A;  5M3M G;  3U58 A;  1TWF H;  4XYQ A;  3HOX B;  1VDZ A;  1XWE A;  3PIO A;  1TY2 A;  1C9O A;  1TWA B;  3B6Y A;  4A3D H;  2XRS D;  4LF9 L;  2NVT B;  2MFI A;  1PRT B;  1EIF A;  2E2H B;  2UXC L;  3UE0 A;  5EKI A;  3KUP A;  2NVY B;  4Q0F A;  3FEW X;  1H9K A;  4XDX A;  1PLF A;  4RGN A;  3M3Y H;  2OEO A;  2F0F A;  2JK8 A;  1HHV A;  4IPG A;  1SNO A;  4YCU A;  1QNU A;  4C3I B;  4A3C G;  3OW7 A;  5EGT A;  1N36 L;  2JA8 G;  3KLS A;  3S1N B;  3DXJ C;  1NMF A;  2B2Y A;  1KAW A;  1AE2 A;  3ONA B;  1Q12 A;  2Q8R E;  2MPM A;  4JI8 L;  4BBR B;  1I4R A;  2NVQ H;  3E9H A;  3LX0 A;  1BCP B;  3S1R B;  1OTC A;  5KYL A;  1L1O A;  3J7A 5;  3ERO A;  3HOV H;  5JPM C;  3ICE A;  2PMZ E;  5C0X H;  2QGQ A;  2B63 B;  4XQJ A;  3NTI A;  3D4D A;  1RDP D;  2LKV A;  4JCV E;  3GTP B;  3KOJ A;  3J81 L;  4O1N A;  4IAL A;  1PTO F;  4N8F A;  4LF7 Q;  5NUC A;  1E2Z A;  2BA1 A;  1L1O B;  4FP5 D;  3FMC A;  4X62 Q;  2CQA A;  2RSO A;  1PFM A;  2EYO A;  3JC6 6;  4G7H C;  2JA7 H;  2NZO A;  2IY5 B;  5M5Y B;  4YY3 Q;  4ABN A;  4QMG A;  3F8T A;  3CCR A;  2AWO A;  1QE6 A;  1U9R A;  3CAM A;  2TSS A;  4B3M L;  3Q24 A;  5CR3 A;  4IOC A;  1G2S A;  4CDE C;  3J81 E;  1WCM B;  3T16 A;  1SFO H;  4FXG C;  3S17 H;  1K0S A;  1SEB D;  4DV0 Q;  3HOX H;  1LT3 D;  3JAM i;  2KHI A;  3V2T A;  3MZ5 A;  2NB0 A;  1TWA H;  1EFI D;  2N49 A;  2NVT H;  5GAG C;  4DN4 M;  1HFG A;  2RCF A;  3SK5 A;  2E2H H;  3MXN A;  3MAQ A;  1VF5 C;  3L9A X;  5IP7 H;  4X64 L;  2NVY H;  3RLF A;  3TS0 A;  2QW7 A;  1O78 A;  2K28 A;  5HGT A;  2A69 C;  3NEN A;  1KQS A;  4HJ5 A;  1FR3 A;  3PO3 G;  4JVZ A;  5E3F A;  4UAI A;  2JEB I;  5LMU L;  2E2D C;  3GTG H;  3S1N H;  1NR4 A;  1E2W A;  3GTK B;  2EYM A;  4CGY B;  2SDF A;  2HT1 A;  3R3O A;  1EWC A;  2JSO A;  1OXT A;  1P16 A;  4BA1 I;  3PUX A;  3PUZ A;  3BU2 A;  1W3S A;  4G4K A;  5FO7 B;  1VQP A;  1VQN A;  2HUG A;  3AEV A;  4OX9 Q;  1QVC A;  1B53 A;  2XTI A;  4IN3 A;  5M5X B;  3S1R H;  2WFW A;  1AFP A;  3CPF A;  1HUM A;  1KNE A;  1J9O A;  1I5F A;  4KKS A;  5ELC A;  3R93 A;  1DGS A;  4JI1 L;  4XXE A;  2R93 B;  3LWU A;  1HA5 A;  2NN6 I;  2PPB C;  3D3R A;  2KCT A;  1K8A C;  5DM7 3;  2B63 H;  3A54 A;  4X3S A;  2AMC B;  3MHB A;  4LF6 L;  2H5X A;  3GTP H;  1JE5 A;  2LXK A;  4G7Z C;  5IGC A;  1WJJ A;  5FLM H;  4HJ9 A;  2VY3 A;  1SR3 A;  4KJN A;  5ISR A;  1VQ5 A;  4JI7 Q;  3VYR A;  1MHW C;  3RR5 A;  1FJG L;  1SNC A;  3E5S A;  5F2D A;  1EYA A;  1VQI A;  1JWU D;  1I3Q B;  5M5Y H;  1UUP A;  1X3G A;  3EN2 A;  3FDT A;  1A63 A;  3ND8 A;  3D31 A;  2L15 A;  2B2T A;  3HKZ G;  4B9W A;  4JBM A;  1S5D D;  1STH A;  2LS0 1;  1WTV A;  1WCM H;  2I5M X;  2K4K A;  3SGI A;  4K5V A;  3C46 A;  1YHA A;  2VB3 X;  2EY1 A;  4NB3 A;  4DR3 Q;  3S14 B;  4K2L A;  2PW5 A;  1HNX Q;  3A56 A;  4HN7 A;  1KRT A;  5IGF A;  1PH6 A;  4CKB A;  2K5W A;  3BVM A;  4ME5 A;  1PZI D;  1GKH A;  1C8C A;  1EU4 A;  3HRZ C;  4HED A;  3VR5 A;  3OHX C;  1Y69 U;  1PA6 A;  1IBL Q;  2LMC B;  2JA6 G;  1AE3 A;  1D7Q A;  4DAV A;  1M8A A;  3BZC A;  5C0X I;  2Z4I A;  3CMA A;  2Z0S A;  2F03 A;  5J3B A;  4DR5 Q;  1I4G A;  2MGS A;  3GTK H;  4A3G G;  1SAP A;  3GDE A;  4OGQ C;  1YEZ A;  5LHY 1;  3RNU A;  4KJO A;  1IYJ B;  1VQF A;  4LUZ A;  4A3B G;  5DAU A;  4A3M B;  1OXU A;  5HGQ A;  1UE1 A;  5ELD A;  5M5X H;  3I56 A;  2A74 C;  5C3W A;  4OWT B;  2R93 H;  1HA6 A;  2A68 D;  4LF7 L;  3CC2 A;  1EY9 A;  4IO9 A;  1X55 A;  1RF2 D;  5D3I B;  4DA2 A;  1B4O A;  2VUM B;  1FD7 D;  4X62 L;  3S2D B;  2AWN A;  4X65 Q;  4J15 A;  4YY3 L;  4KTA A;  4BY1 B;  2R7Z G;  2JA5 B;  2EXZ A;  3RZD B;  1EY5 A;  2EDG A;  1EQR A;  5CV8 A;  3PIP 3;  4DV5 Q;  1MIU A;  3GV6 A;  3M4Q A;  4JYA Q;  5IT9 c;  1I3Q H;  4LFA Q;  1RIP A;  4R9W A;  4M1U B;  1BO0 A;  2KEE A;  1VQ6 A;  5CV7 A;  4IFD G;  1PH1 A;  1YNN C;  1EWI A;  1EU3 A;  3OTO Q;  3TS2 A;  4DR7 L;  1O7L A;  3KBG A;  5KEE A;  4A3K B;  1JJ2 A;  2KEN A;  1CQF A;  1EY6 A;  1I94 Q;  2E2J B;  3K6O A;  3OMG A;  1WD1 A;  3NTH A;  1N33 Q;  1QVF A;  2SOB A;  3UDG A;  2K01 A;  2QDL A;  3PCO B;  1X3F A;  1VQ4 A;  3S14 H;  4WRD A;  1IBM Q;  1YIT A;  2A19 A;  1YJ9 A;  1PHJ A;  1VQE A;  3NQI A;  2MJ8 A;  3DM3 A;  5ELB A;  3Q8D A;  4IOA A;  1TWC B;  1BBU A;  1YHB A;  2D9U A;  3NSW A;  4BXX H;  4YCW A;  2O5J C;  2PNH A;  4OX9 L;  2CH4 A;  4N9T A;  2VNU D;  5BR8 Q;  3CD6 A;  3TP5 A;  3Q0A A;  1LTT D;  2JE6 I;  1A8V A;  1D5Z C;  5IGB A;  2K1B A;  2NWG A;  1UE7 A;  1LT5 D;  3T56 B;  3I4M G;  2K03 A;  3NQT A;  2A6E D;  4A3M H;  2L1B A;  3AFQ A;  3MXP A;  3TSS A;  3X3N A;  2ICE C;  1B9N A;  5EPJ A;  4JI7 L;  1AZQ A;  4K8I A;  4YCV A;  1WTW A;  2K50 A;  2SNS A;  3MXG A;  2F0H A;  4UP9 A;  3MEH A;  2VUM H;  4DUY Q;  3PO2 B;  1MSH A;  1F2L A;  3S2D H;  2WKD A;  3TRE A;  4JOI C;  4RHR A;  2K75 A;  1VQA A;  2JA5 H;  2RDH A;  4A3J B;  3CW2 C;  2OWO A;  1CM9 A;  3CCE A;  4BY1 H;  4KN7 C;  3ULP A;  3RZD H;  4AYB G;  1RKN A;  3MFY A;  1DZ1 A;  4YWL A;  4DFA A;  3CU7 A;  1ET6 A;  1V1Q A;  1XYI A;  2PW7 A;  4IUV A;  3TRZ A;  1IXR A;  2AQ2 B;  2ZTE A;  1HQM C;  2F0S A;  4DNI A;  5FO8 B;  3KLS X;  1SYG A;  4DR3 L;  3KF8 A;  3ER0 A;  1H9S B;  1HNX L;  5E4X A;  3FKI B;  4A3K H;  1K83 B;  1VQD A;  2F0K A;  1CKO A;  1LTR D;  5C3E B;  3D6C A;  1LO5 D;  2A1A A;  2E2J H;  4GOP A;  4ALP A;  5JEA H;  1KLG D;  2AQ1 B;  3HG9 A;  2KUM A;  1CSQ A;  1VQO A;  4GKK Q;  5EAY A;  2YTV A;  1EOT A;  4HIK A;  1OXS C;  3RD4 A;  4DR5 L;  1CI3 M;  4B08 A;  2F0D A;  5C4J B;  2HQL A;  3UDF A;  1TWC H;  1STG A;  4IPD A;  1A2T A;  1B8A A;  4KKT A;  2EJM A;  3FP9 A;  4OXP A;  2B2W A;  3S16 B;  1VS0 A;  3J81 j;  2MUY A;  3QG1 A;  1PYW D;  4B9X A;  2Q2I A;  4A3L H;  3IFD A;  4K0K Q;  1B3A A;  2L11 A;  1I50 B;  4Z9C B;  2RDF A;  3IAY A;  4P71 A;  2B8F A;  3I72 A;  1EIH A;  4X65 L;  2PQA B;  4K6L A;  1KC8 C;  5FKA C;  3HOV G;  1DOL A;  1ILP A;  4GNX C;  4K5W A;  3EFX D;  1UAP A;  2Z6K C;  5IYD H;  1LUZ A;  1SBB B;  5M9O A;  1X56 A;  4IUQ A;  1Q81 C;  1GUW A;  1GJX A;  2I46 A;  3F2U A;  4DV5 L;  3NE5 B;  3PUW A;  1N34 Q;  3M7G A;  3PO2 H;  1CKN A;  4JYA L;  1Q90 A;  1J5E L;  3Q6S A;  3CRL C;  4LFA L;  4A3J H;  3A8I E;  4CJ0 B;  1EEI D;  3MVV A;  2HQE A;  4XQN A;  1PRT C;  1LTS D;  1G6P A;  2RQX A;  3TQY A;  1Q82 C;  1NUC A;  3CCQ A;  3BJU A;  3GTO B;  3STB D;  2QA4 A;  4OO1 H;  2F0L A;  1JJG A;  2FFK B;  1I94 L;  4DR4 Q;  2QDB A;  1M90 C;  1V1O A;  2JP1 A;  1N33 L;  5CMD A;  5LMN W;  3I70 A;  5CGK A;  1IBM L;  4DPG A;  3MXU A;  1B7Y B;  5J39 A;  3FKI H;  1K83 H;  2NZ1 D;  4RA8 A;  2ALY B;  5C3E H;  2PI2 A;  5JPN C;  1XNQ Q;  1S5E D;  4JK1 C;  1GUS A;  5EPL A;  1BCP C;  4JC0 A;  3A7L A;  4GLV B;  2SEB D;  5BR8 L;  2MQH A;  2N8N A;  4CKC A;  5I9O A;  1YJW A;  2EY5 A;  1TS5 A;  2O2L D;  2EYJ A;  1IKM A;  1I6H B;  1QUQ B;  2AQ3 B;  2MNA A;  5C4J H;  3PUV A;  1WD0 A;  2ZM6 Q;  2B2Y C;  1LYL A;  4S3S A;  2X69 A;  3S16 H;  3AQQ A;  3NWT A;  3VR3 A;  5FLX E;  2KCM A;  4LAA A;  2C35 B;  4H13 C;  3K57 A;  5I2Y A;  3SEB A;  2R7F A;  1EYG A;  1EIG A;  1NR2 A;  1I50 H;  1L1O C;  4K14 A;  4C56 C;  2K6A A;  3OWF A;  1N8R C;  3DM1 A;  1CTM A;  5HUR A;  1E1T A;  4DUY L;  2K04 A;  2G5D A;  4A93 B;  4U68 A;  4PMB A;  1JC7 A;  3RZO B;  1RTN A;  4DF7 A;  5CBE E;  1LTG D;  5EKL A;  3FVQ A;  2B63 G;  2F0M A;  4KY7 A;  1SJE D;  3K5N A;  4RH6 A;  5C5M A;  3HOZ G;  1FYC A;  4DV7 Q;  3NBI A;  4F8M A;  2EJG C;  3L0O A;  2DNC A;  2OT2 A;  1JOO A;  1AW7 A;  2Q8I B;  1KLU D;  1SJH D;  1SDF A;  1HUN A;  1DM0 B;  2PO4 A;  2R6G A;  2F4I A;  3GTO H;  1ZYR D;  1HPC A;  1K0R A;  1WTH A;  3BZK A;  3CPW A;  4J8Q A;  2RKS A;  4DV1 Q;  4BBS G;  1LTI D;  5IWA Q;  1PZJ D;  4GKK L;  5T1G A;  1EOV A;  4U67 3;  1A0I A;  3F2C A;  1GM5 A;  1JJC B;  1ENF A;  1FNW A;  1X3P A;  2QCP X;  5DNF A;  3MA2 B;  1IL2 A;  4HCE A;  4MZ9 A;  2CQO A;  1Y1V B;  4NXM Q;  1E1O A;  2WAQ G;  2ICI A;  1HZ9 A;  2IX0 A;  1VQM A;  4K0K L;  4LNQ A;  3I4N B;  1HRJ A;  4IJL A;  5K36 H;  1S5B D;  4JI4 Q;  1I6H H;  2I0Q A;  2Z4H A;  1T5X D;  1KRS A;  2TMP A;  3Q22 A;  2G9H D;  2F52 A;  3C1F A;  1A15 A;  1O7Y A;  2L55 A;  1YNJ D;  4JW0 A;  4PMW A;  1GXD C;  2N55 A;  1Y1W B;  5KNC A;  1JE4 A;  1AH9 A;  1QOH A;  4RCN A;  2YYZ A;  3S1M B;  1ZXT A;  1PH5 A;  2YTY A;  1RD9 D;  1D5M C;  4H02 A;  1QJO A;  4A76 A;  1K3B C;  1JOK A;  4A93 H;  2R93 G;  4ZQ3 A;  4OO1 I;  3H6M A;  2E2I B;  1BBW A;  3SK6 A;  5KYI A;  3S2H B;  1HZC A;  5IGE A;  2PNR C;  1SN8 A;  1PH8 A;  1PFN A;  2D5D A;  4DR4 L;  1BDO A;  1NMG A;  2VQE Q;  3TP7 A;  4ODG A;  3M4P A;  3PIO 3;  2DGY A;  3I91 A;  4KN4 C;  1X54 A;  1WFQ A;  3DMU A;  2B2T C;  1DOK A;  2KJX A;  1X3Q A;  2E76 C;  5COR A;  1BQQ T;  2PZT A;  1XNQ L;  1VMP A;  5C4H A;  2ATW A;  1IW7 D;  2NUC A;  2WKC A;  4A3E B;  2B2U A;  3NBH A;  3CC7 A;  5ELN A;  1SE3 A;  2EJF C;  2ZM6 L;  1XPO A;  2HCC A;  1Y1V H;  1VCI A;  4CDD C;  2F0G A;  1DXM A;  5I9P A;  4F7X A;  3LWE A;  5C44 G;  3G71 A;  4UP7 A;  3I4N H;  4BY7 G;  3AB9 A;  3AFP A;  4FXK C;  3K5L A;  1WTQ A;  4BXX G;  1G91 A;  1S4Z A;  4PG3 A;  2QF7 A;  4R4O A;  3PUY A;  3QOL A;  1VQC A;  5EKK A;  4KY6 A;  4R4Q A;  1LAB A;  3I3C A;  4KKU A;  4IFD J;  1Y1W H;  1X9N A;  5AJ3 L;  4Y7N B;  4I7Z C;  3KLW A;  3S1M H;  3URY A;  4XT3 B;  3I90 A;  4WJ3 M;  1XMO Q;  1XNR Q;  4A3F G;  1MKH A;  4C3I H;  4DV7 L;  3PSI A;  4IUU A;  3A0J A;  5IOD A;  2E2I H;  2VUM G;  5EBC A;  3S2H H;  3MXN B;  4KY5 A;  1EYD A;  4BBR H;  1TU2 B;  4PZ7 A;  4RGO S;  5M3M B;  4JBW A;  2FHT A;  4QL5 A;  1H9M A;  4DV1 L;  5IWA L;  2UU9 Q;  1HQR D;  1NBW A;  2A73 B;  5IP9 H;  5GAH C;  3DEP A;  4LJZ C;  1ZKO A;  1UEB A;  4CDF C;  4NXM L;  4DK6 C;  1ONL A;  3HOY G;  3SDZ A;  5DEH A;  2JA8 B;  4A3E H;  2BOS A;  1R4Q B;  3HP3 A;  4F87 A;  3O13 A;  3I4L A;  4PQX A;  1MD2 D;  3ITP A;  1HZB A;  4JI4 L;  2OTJ A;  2PI2 E;  1HNW Q;  3FHW A;  2I07 B;  4WOR A;  4JI3 Q;  4ZUI A;  1K8O A;  4L5Q A;  1DCZ A;  1PH7 A;  2K5H A;  4ZKC B;  5K5P A;  1KXL A;  1KAA A;  3TBI B;  3VYT A;  4ZKB B;  1X6O A;  4BS9 A;  3T1Y Q;  4K2K A;  3MC0 B;  3CCS A;  2WB1 G;  3NK9 A;  1L0W A;  1CKM A;  2WV6 D;  3D6W A;  4A3L G;  1ZEQ X;  2RVL A;  1EQV A;  4RFB A;  4NXN Q;  5JOB A;  2Z1C A;  1C4Q A;  1JQY D;  1KDB A;  2F0J A;  4UDU C;  3PF5 A;  1CHQ D;  3HOW G;  3KDF A;  4FF2 A;  3QIA A;  4Y7N H;  2EYH A;  1FGU A;  1I4Q A;  1L0X B;  3N6R A;  1F9P A;  3VYU A;  4L8J A;  1SSO A;  2VW9 A;  3TZU A;  1KD1 C;  4EQ5 A;  5IYC H;  2I5H A;  2F0U A;  5IGD A;  3VR4 A;  3BZD B;  2VQE L;  4C3H G;  1Z47 A;  1IYV A;  2EYL A;  4R1J A;  2Y0S G;  2VXW A;  3W1G A;  2BA0 A;  3H0G B;  2OQK A;  4BA2 I;  1NTG A;  1AN8 A;  3KDF B;  4OIJ A;  3K5M A;  5M3M H;  2EYF A;  4ULL A;  4FF3 A;  1JCK B;  2A8V A;  4CKE A;  1WI5 A;  5CC4 A;  1S3O A;  2A68 C;  2DN8 A;  2SNM A;  3IL8 A;  2ZJP A;  4H7B A;  2UUB Q;  3PQI A;  4QCL A;  3M9B A;  1NE3 A;  3E3X A;  2X6G A;  3BDL A;  1H9J A;  4KI0 A;  4QJF A;  1QIL A;  4EQP A;  2BE5 D;  3PO3 B;  2IHF A;  4JBK A;  4GOP C;  2JA8 H;  4JV5 Q;  5C0X J;  4O2D A;  3E0E A;  1A6X A;  2L4N A;  3TDQ A;  1E3P A;  4DV0 L;  2R3Z A;  3OSO A;  1UE5 A;  3CHB D;  2F4V Q;  3HOU G;  3JAM L;  1DD2 A;  3CXC A;  2R92 G;  3SXH A;  5TSS A;  2A6H D;  2B2W C;  3RN2 A;  3C1E A;  2CW0 D;  2ASB A;  3KLR A;  2Q8T A;  2B8G A;  4RKL A;  1EWH A;  4E6I A;  1XMO L;  1XNR L;  1VQ8 A;  3M85 A;  1SMY D;  4KHV A;  2M9V A;  2NTS A;  3W5O A;  5M5W B;  4LUV A;  4JI0 Q;  1A2U A;  1GD7 A;  1JMC A;  4AQY Q;  2X6L A;  2PQE A;  1DOM A;  3JAM E;  1X32 A;  3ZJY C;  5M3F G;  3TZD A;  1C7Y A;  3LGJ A;  1NCV A;  3BVZ A;  3LNN A;  4ZLT F;  4MN3 A;  2K5Q A;  5LMN Q;  3G6J B;  2AHO B;  2CCZ A;  2XIW A;  2HHH Q;  5BN3 A;  5KGU A;  2UU9 L;  2Q2T A;  3NP8 A;  1G8Z D;  2B29 A;  3HKZ B;  4RAU C;  1SLJ A;  1PH2 A;  4EQO A;  3DWP A;  2XWJ B;  3CQZ B;  1NY4 A;  1D1I A;  4IZ8 A;  3H0G H;  3OYY A;  1V1P A;  4MNO A;  4GZY C;  1F2Y A;  2A6E C;  3NEM A;  4LFC Q;  5E7N A;  3T13 A;  2KVM A;  2YU9 B;  1JOQ A;  1HFN A;  1YI2 A;  1IYU A;  1EY4 A;  4C3J G;  4KV6 A;  2RF4 A;  1KIX A;  1HNW L;  1QNK A;  2JA6 B;  1ESF A;  4L5R C;  3U9S A;  5FJ8 G;  4JI3 L;  1JWS D;  1K73 C;  3PO3 H;  1V1P B;  2JN4 A;  2BDO A;  5AFW A;  2K05 A;  5ELO A;  3T1Y L;  2NN6 G;  1WTX A;  1EYC A;  2B2V A;  4A3G B;  3WDN A;  4DKA C;  1TS3 A;  3A5U A;  2AUK A;  4G7O C;  4A3B B;  1B1Z A;  4F88 A;  4JI5 Q;  1KDC A;  4NXN L;  4P75 A;  1TXY A;  1EY0 A;  1G29 1;  3BYT B;  4QIW B;  3T1H Q;  1J6Q A;  3VDY A;  1IBL L;  4A3D G;  2PCF B;  1F9Q A;  1SE4 A;  1AZP A;  2WAQ E;  3FRP B;  4LFB Q;  5M5W H;  3KF8 B;  4IUR A;  4DV3 Q;  4JPB W;  3J81 c;  4QQB X;  4KMU C;  4JG2 A;  1I4X A;  4GKJ Q;  2G9D A;  4UHV A;  4HSV A;  1O80 A;  3EA6 A;  1SMX A;  2CKZ B;  1Y14 B;  5JAV A;  1SE8 A;  4GOP B;  1JR0 D;  3J80 L;  1LTL A;  4OEM B;  4L5S A;  2UUB L;  1PZK D;  4GN3 B;  4P73 A;  4XQQ A;  1E7Z A;  3RLO A;  3CQZ H;  2F0O A;  4I65 A;  1PMR A;  3D0F A;  1ENC A;  4O42 A;  3SHL A;  1EZ6 A;  2IT1 A;  5C0X G;  3F2D A;  2YU9 H;  1PVO A;  1GUT A;  3G6E A;  4JV5 L;  2C9O A;  2ZXO A;  1ROD A;  2DUD A;  3J80 E;  3R2I A;  4AH6 A;  5JJK A;  2F4V L;  3ZYY X;  4CJ2 C;  2JA6 H;  4CBV A;  4OWW B;  5FO9 B;  2UXD Q;  3OTO L;  4DGZ A;  4RKB A;  4DNT B;  3RLN A;  3H94 A;  2JA7 G;  4RWS C;  3STB C;  1EL0 A;  1EUJ A;  1Y1V G;  4B3R Q;  2O5I C;  1SNM A;  4A3G H;  5KND A;  2J4X A;  4NMZ A;  1SYF A;  1K3R A;  1GVP A;  4HAE A;  4L63 B;  1N36 Q;  3I4M B;  4R8N A;  1CKN B;  1SNQ A;  4A3B H;  4MHE A;  2UXB Q;  1TWG B;  4POF A;  3BDC A;  1M1K C;  4JI0 L;  2HIX A;  5LL6 X;  1VQK A;  5FLX L;  4AQY L;  3HOX G;  1G6Z A;  3UE1 A;  3R8B A;  4QB4 A;  1D1K A;  4ZAI A;  1S40 A;  1AP0 A;  2IX3 A;  3CP0 A;  3H15 A;  1ICF B;  5LMN L;  4PMC A;  5IE8 A;  4HID A;  3D4W A;  5IP7 G;  1PTO D;  2B3G A;  1QB5 D;  1K9M C;  2HHH L;  4AYB B;  4V0B A;  2M2L A;  1YZ6 A;  3TEH B;  3NUC A;  4P2C B;  1J8I A;  3TN2 A;  1RHP A;  4C3I G;  3J81 i;  2QEJ C;  1SYB A;  4MTK A;  2JYO A;  1VQG A;  4RGT A;  4OWX B;  4A3I B;  4KK7 A;  1U4L A;  4LFC L;  4Q5V A;  2K32 A;  2QIL A;  4DR6 Q;  3G4S A;  2NTT A;  1MJC A;  2CVR A;  4IFD H;  5IY0 A;  4Y52 H;  2Z8L A;  2K33 A;  1VMC A;  1N32 Q;  4UP8 A;  4BBR G;  1K28 A;  4KD3 A;  3EQL C;  1JT8 A;  2D2C C;  1NAP A;  4APV A;  1D2B A;  4PZ6 A;  1ET9 A;  1Z7T A;  1MSG A;  1P8L A;  3K59 A;  3UI2 A;  2PZU A;  4IQZ A;  3H09 A;  3AYH B;  5G3L F;  2N78 A;  1CZW A;  1OXX K;  5BN5 A;  1HR0 Q;  1E24 A;  2D0O A;  1LLR D;  3KJO A;  5FLM G;  3BVG A;  4RCO A;  1WTR A;  2B2U C;  3VA7 A;  3CRK C;  1IBK Q;  2PYK A;  5IT9 L;  5DM6 3;  3V96 A;  4A3E G;  3VYS A;  1BVS A;  3I2Z A;  5ELE A;  3H91 A;  4JI5 L;  5CYU A;  1UEA B;  3DLL A;  3T1H L;  2HDM A;  1ZYR C;  1RL2 A;  5CBA E;  4KHP Q;  3J7Z C;  2OF1 A;  4C2M B;  2IPK D;  4DAY A;  3QOJ A;  2IX1 A;  5JVG 3;  1Q46 A;  1R4P B;  2KOL A;  2MO1 A;  3I4M H;  3GV3 A;  3P75 A;  1YJN A;  1WTP A;  1QVG A;  4LMQ D;  4DNR B;  3GTJ B;  1WCM G;  3OIP A;  1TWG H;  4PV1 C;  1B44 D;  2IHE A;  1A62 A;  1ICW A;  4DV3 L;  1VQJ A;  5IT9 E;  3M7N A;  5I2X A;  1Q1B A;  2RA4 A;  4KLK A;  1JOR A;  1N9W A;  3DWQ A;  1QZH A;  3ULJ A;  4FF1 A;  5KNB A;  3HKZ E;  4DUZ Q;  5CV5 A;  2AUJ D;  4GN4 B;  4G57 A;  4HCS A;  4YWM A;  3P20 A;  2OCE A;  3U4V A;  1WTO A;  3W1B A;  1Q8I A;  2WB1 E;  1E22 A;  2RSN A;  3M4O B;  2GN5 A;  4LF6 Q;  4HJA A;  1GHK A;  3NXW A;  5GQO A;  1SRU A;  5JEA J;  4B3T Q;  3OWE B;  5IIF A;  4A3I H;  1GHJ A;  1G51 A;  5I6Y A;  2FMC A;  3GTM B;  4X66 Q;  4CDC C;  1YNJ C;  4ZK9 B;  1IKL A;  1M4V A;  4GN5 A;  1V43 A;  1FGB D;  1Q7Y C;  1SNP A;  3ND9 A;  1TVX A;  2EZV A;  3E0J A;  2FXQ A;  1N34 L;  1QZG A;  2J7Z A;  3IFT A;  4HMJ A;  4ILW A;  2PZW A;  2BH2 A;  2IL8 A;  3MEF A;  3BS1 A;  4JI6 Q;  2ENB A;  3RZO H;  3CCM A;  3A8K E;  1A3T A;  2EOT A;  3G7L A;  4LWC A;  4WJW A;  1EEF D;  4LF5 Q;  1Z9F A;  2F0N A;  2Y0S E;  2UXD L;  2FMM A;  3T51 B;  1B3Q A;  4HJ7 A;  4WFN 3;  1KL9 A;  3I73 A;  5KIX A;  4B3R L;  1BBX C;  2E75 C;  1PRT F;  4QIW E;  3GTG B;  1PTO B;  3SE0 A;  3VR2 A;  1STY A;  2MO0 A;  2UXB L;  1CK1 A;  4TQU S;  4LF8 Q;  1KNA A;  1G2T A;  2LSS A;  3MTS A;  2N3S A;  3T4A C;  4CJ1 B;  2J0T D;  4C2M H;  3RN5 A;  4HIO A;  1F9S A;  4K8J A;  2A5H A;  1IW7 C;  1U4M A;  5JJL A;  2VL6 A;  3NHH A;  3GTJ H;  2MP1 A;  3I7F A;  3E6Z X;  4OEL B;  4R4I A;  4FXD A;  1V8Q A;  3H3V C;  1QCB D;  3ERS X;  3MWY W;  4R4T A;  2F3W A;  1BCP F;  2R61 A;  1TS4 A;  4DV2 Q;  4GS3 A;  1PXU A;  5IYB H;  4L5T A; 
#chains in the Genus database with same CATH homology
 3HOZ B;  1II3 A;  3OMC A;  1BNZ A;  1F2M A;  1PFB A;  4QUF A;  2KHS A;  3EJI A;  3HS0 C;  3L3O C;  4HTH A;  3T53 B;  3A8J E;  5CV4 A;  4FF4 A;  1Z6H A;  3KBX A;  1Y8P B;  2K7V A;  2KED A;  3TP6 A;  3DEO A;  5CV6 A;  1I4H A;  4NKL A;  4BBS B;  3GQB A;  2F0Q A;  4ID6 A;  5C4X B;  2EPB A;  4XTC S;  1STN A;  1S5C D;  3SR1 A;  2EY2 A;  1KDA A;  1XXG A;  1BUV T;  2LY7 A;  2WAQ B;  1TS2 A;  3NTK A;  1GUG A;  5I4D A;  4TSS A;  4DAP A;  3BG3 A;  4BWG B;  1R9T B;  4X3K A;  2D62 A;  1LTA D;  2B39 A;  3C2P A;  1STB A;  2A69 D;  2XVS A;  5C4Z A;  1PTO H;  4KHZ A;  1A3U A;  1L0Y B;  2KQ3 A;  1CQV A;  3AMU A;  1CA6 A;  2NVX B;  5FK9 C;  1JIC A;  3KK7 A;  3DHQ A;  2FIN B;  3W3A A;  5J1Z A;  5LL6 S;  2IWH A;  5JEA G;  3GP7 A;  1LT6 D;  1Q3L A;  1CA5 A;  2M00 A;  2OXP A;  2XWB B;  5EQ0 A;  1CFM A;  4FYD A;  1TR5 A;  5EPK A;  3WOF A;  3VR6 A;  2DNE A;  5EJW A;  1WVL A;  4L6T B;  2ID0 A;  4DK1 A;  4ZYS A;  1SE2 A;  3SVM A;  3BYY B;  1LV9 A;  3X3M A;  1PDQ A;  4IUN A;  2WP8 J;  3Q23 A;  2HCI A;  3K58 A;  2K5D A;  1BR9 A;  2BDN A;  3R2T A;  2F0V A;  1Q1E A;  2V4D A;  5C44 B;  4C1N K;  3M4Y A;  4BY7 B;  1D5X C;  3QJY A;  1MGS A;  4N9P A;  3GTQ B;  2WII B;  4OL7 A;  2BCO A;  2B2V C;  5E4W C;  3PMF A;  2WIN B;  4OO1 G;  4XT1 B;  2DY8 A;  3IKJ A;  2N88 A;  4ZRZ A;  4HSP A;  4A3F B;  2BE5 C;  1F77 A;  2QKI C;  4EQN A;  3GD7 A;  1OXV A;  2L9H A;  1NSN S;  1DYQ A;  1TY0 A;  3K7A B;  4M8A A;  1H9R A;  4J6H A;  3S15 B;  2A6H C;  3D4R A;  3C3L A;  4DXG A;  2CW0 C;  1C48 A;  4FO2 A;  1VF7 A;  1LTB D;  1SMY C;  1O7Z A;  4LK1 C;  3V05 A;  2E74 C;  1YNN D;  1ILQ A;  1D6E C;  1TKW B;  3HOY B;  3HEJ A;  4NW2 A;  1CT1 D;  1MI2 A;  3TME A;  3GO5 A;  2XNA C;  2LFN A;  2KCN A;  4R8I A;  2CHB D;  4DXF A;  5C3X A;  3J7Y W;  1KAB A;  2DY7 A;  3OIQ A;  1TWH B;  5T1I A;  2F0P A;  1BOS A;  1TII D;  1RCV D;  3VA5 A;  2WB1 B;  4DK0 A;  1FNV A;  1S5F D;  4V19 0;  2IW3 A;  1XTC D;  3BDO A;  4MIU A;  1ENA A;  5D65 A;  1SXT A;  4NP5 A;  3HOW B;  5C5L A;  1W6K A;  3HGB A;  1W6J A;  4K6D A;  2EY6 A;  1HTP A;  3A7A B;  4FNF A;  3P1H A;  3WOE A;  3L7Z C;  1Y8O B;  4HMI A;  4C3H B;  3QB3 A;  2Y0S B;  5G3L D;  1IL8 A;  1BXT A;  1H9S A;  1Y8N B;  1A3V A;  2ZXP A;  4X3U A;  1OO9 B;  5K36 G;  3S1Q B;  1F2Z A;  2KCC A;  4YIJ A;  3DWA A;  3MFG A;  1MBY A;  4IUP A;  1SND A;  1TT2 A;  3FPP A;  2O4X A;  2R7Z B;  2F0T A;  1JWM D;  2L0C A;  3J7A F;  5D14 A;  2EYP A;  3TP8 A;  3SK8 A;  2PMZ B;  3N52 A;  3J7A V;  3U9O A;  4TKO B;  3HOU B;  1XX8 A;  2R92 B;  3SK4 A;  5E1F A;  1BF4 A;  2EE1 A;  1B9M A;  2ZXR A;  5CV9 A;  2KA7 A;  3ERQ A;  1STE A;  2F1M A;  3EVQ A;  2H1E A;  1SYE A;  2F0E A;  5A35 A;  2WAC A;  1GUO A;  3OPO A;  2GA4 B;  2VB2 X;  3NWS A;  2XSC A;  4DU9 A;  4H0L C;  5M3F B;  5IGG A;  3DUZ A;  1LT4 D;  1ESR A;  1F9R A;  1IHZ A;  1GOZ A;  2XN9 C;  3CKI B;  5JJZ A;  4QUC A;  2HDL A;  1STA A;  4NDX A;  3I8Z A;  2F3V A;  3OOC A;  1CZG A;  2RBM A;  1DJR D;  4RGM A;  1ML0 D;  3K5O A;  1PRT D;  2JEA I;  1E2V A;  1TQO A;  4KD4 A;  5A2Q L;  4C3J B;  1I6V C;  1I4P A;  4RHS A;  1EZ8 A;  1E0B A;  1T5E A;  5JVH 3;  2EVB A;  1RTO A;  3P7J A;  4PNY A;  2XRQ D;  1B2T A;  1PTO C;  4XIG S;  2L12 A;  1FNU A;  5BN4 A;  4XYO A;  3GTL B;  2RDG A;  4IUT A;  5D3D A;  5ELF A;  4C1N I;  1SYD A;  1BCP D;  2NYZ D;  5A2Q E;  1K8M A;  2H4O A;  3NPP A;  4OHJ A;  2L5T A;  1TWF B;  4TRD A;  1B50 A;  3QWN A;  1QWY A;  4J1M A;  4CHT B;  4A3D B;  1JB3 A;  5KRU A;  1GUN A;  3M3Y B;  2MHV A;  4HR7 B;  4OIK A;  2F0W A;  3RUZ A;  1SYC A;  5FOB B;  2F0I A;  1U4R A;  1UNS A;  3RMH A;  2KEC A;  4QF4 A;  2JXM B;  5I6W A;  1DON A;  2NVQ B;  1EQT A;  4EGV A;  5COY A;  1EY8 A;  3HOV B;  3W2D A;  4FVM A;  1CHP D;  1AEX A;  3D8G A;  3A55 A;  3PV0 A;  4H44 C;  1U4P A;  3FPU B;  1HXY D;  1HCZ A;  3HZX A;  5J22 A;  5C6A A;  4K5X A;  1HTL D;  3K0Y A;  3AU7 A;  5IOC A;  2JA7 B;  2IJ0 A;  2FJ2 A;  2NN6 H;  4X3T A;  3QO2 A;  1KTK A;  1EY7 A;  2NBF A;  4ZUJ A;  4EVO A;  1LAC A;  2C5C A;  1SFO B;  3S17 B;  2ZT9 C;  3S9W A;  5EBD A;  3HOX B;  1RJT A;  4XYQ A;  1VDZ A;  1XWE A;  1TY2 A;  1TWA B;  2NVT B;  2XRS D;  1PRT B;  2E2H B;  5EKI A;  3KUP A;  2NVY B;  4Q0F A;  3FEW X;  1H9K A;  4XDX A;  1PLF A;  4RGN A;  2OEO A;  2F0F A;  1HHV A;  1SNO A;  1QNU A;  4C3I B;  3OW7 A;  5EGT A;  3KLS A;  3S1N B;  3DXJ C;  2B2Y A;  3ONA B;  1Q12 A;  2Q8R E;  2MPM A;  4BBR B;  1I4R A;  3LX0 A;  1BCP B;  3S1R B;  5KYL A;  3ERO A;  5JPM C;  5C0X H;  2B63 B;  4XQJ A;  3NTI A;  3D4D A;  1RDP D;  2LKV A;  3GTP B;  3J81 L;  4O1N A;  4IAL A;  1PTO F;  5NUC A;  1E2Z A;  2BA1 A;  4FP5 D;  3FMC A;  2CQA A;  2RSO A;  1PFM A;  2EYO A;  4G7H C;  5M5Y B;  4ABN A;  4QMG A;  2AWO A;  1QE6 A;  1U9R A;  2TSS A;  3Q24 A;  5CR3 A;  1G2S A;  3J81 E;  1WCM B;  3T16 A;  4FXG C;  1SEB D;  1LT3 D;  3V2T A;  3MZ5 A;  2NB0 A;  1EFI D;  4DN4 M;  1HFG A;  3SK5 A;  3MXN A;  3MAQ A;  1VF5 C;  3L9A X;  3RLF A;  1O78 A;  2K28 A;  5HGT A;  2A69 C;  1FR3 A;  5E3F A;  4UAI A;  2JEB I;  2E2D C;  1NR4 A;  1E2W A;  3GTK B;  2EYM A;  4CGY B;  2SDF A;  3R3O A;  1EWC A;  2JSO A;  1OXT A;  4BA1 I;  3PUX A;  3PUZ A;  4G4K A;  5FO7 B;  2HUG A;  1B53 A;  4IN3 A;  5M5X B;  1AFP A;  1HUM A;  1KNE A;  1J9O A;  4KKS A;  3R93 A;  5ELC A;  4XXE A;  2R93 B;  3LWU A;  1HA5 A;  2NN6 I;  2PPB C;  3D3R A;  5DM7 3;  3A54 A;  4X3S A;  3MHB A;  4G7Z C;  5IGC A;  4KJN A;  5ISR A;  3VYR A;  1SNC A;  3E5S A;  5F2D A;  1EYA A;  1JWU D;  1I3Q B;  1UUP A;  3FDT A;  3ND8 A;  3D31 A;  2B2T A;  4B9W A;  1S5D D;  1STH A;  2LS0 1;  1WTV A;  4K5V A;  3C46 A;  2VB3 X;  2EY1 A;  3S14 B;  4K2L A;  2PW5 A;  3A56 A;  4HN7 A;  5IGF A;  4CKB A;  2K5W A;  3BVM A;  4ME5 A;  1PZI D;  1C8C A;  1EU4 A;  3HRZ C;  4HED A;  3VR5 A;  3OHX C;  1Y69 U;  2LMC B;  4DAV A;  1M8A A;  5C0X I;  2Z4I A;  2F03 A;  1I4G A;  2MGS A;  1SAP A;  4OGQ C;  5LHY 1;  4KJO A;  5DAU A;  4A3M B;  1OXU A;  5ELD A;  2A74 C;  5C3W A;  1HA6 A;  2A68 D;  1EY9 A;  1RF2 D;  5D3I B;  4DA2 A;  1B4O A;  2VUM B;  1FD7 D;  3S2D B;  2AWN A;  2JA5 B;  4KTA A;  4BY1 B;  2EXZ A;  3RZD B;  1EY5 A;  2EDG A;  5CV8 A;  3PIP 3;  3GV6 A;  4R9W A;  4M1U B;  1BO0 A;  2KEE A;  5CV7 A;  4IFD G;  1YNN C;  1EU3 A;  1O7L A;  3KBG A;  5KEE A;  4A3K B;  1CQF A;  1EY6 A;  2E2J B;  3K6O A;  3OMG A;  1WD1 A;  3NTH A;  2SOB A;  2K01 A;  4WRD A;  5ELB A;  3NQI A;  2MJ8 A;  1TWC B;  2D9U A;  3NSW A;  2O5J C;  4N9T A;  2VNU D;  3TP5 A;  3Q0A A;  1LTT D;  2JE6 I;  5IGB A;  1D5Z C;  2K1B A;  2NWG A;  1LT5 D;  3T56 B;  2K03 A;  3NQT A;  2A6E D;  2L1B A;  3MXP A;  3TSS A;  3X3N A;  2ICE C;  1B9N A;  5EPJ A;  1AZQ A;  4K8I A;  1WTW A;  2SNS A;  3MXG A;  2F0H A;  3MEH A;  3PO2 B;  1MSH A;  1F2L A;  2WKD A;  4RHR A;  2RDH A;  4A3J B;  1CM9 A;  4KN7 C;  1RKN A;  3MFY A;  1DZ1 A;  4DFA A;  3CU7 A;  1ET6 A;  1XYI A;  2PW7 A;  4IUV A;  2AQ2 B;  5FO8 B;  1HQM C;  2F0S A;  3KLS X;  1SYG A;  3KF8 A;  1H9S B;  5E4X A;  3FKI B;  1K83 B;  2F0K A;  1LTR D;  5C3E B;  3D6C A;  1LO5 D;  5JEA H;  1KLG D;  2AQ1 B;  3HG9 A;  2KUM A;  1EOT A;  1OXS C;  3RD4 A;  1CI3 M;  4B08 A;  2F0D A;  5C4J B;  1STG A;  1A2T A;  4KKT A;  2EJM A;  2B2W A;  3S16 B;  2MUY A;  3QG1 A;  1PYW D;  4B9X A;  3IFD A;  1B3A A;  2L11 A;  1I50 B;  4Z9C B;  2RDF A;  3IAY A;  2B8F A;  3I72 A;  1EIH A;  4K6L A;  5FKA C;  1DOL A;  1ILP A;  4K5W A;  3EFX D;  1UAP A;  1SBB B;  5M9O A;  4IUQ A;  1GUW A;  1GJX A;  2I46 A;  3F2U A;  3NE5 B;  3PUW A;  3M7G A;  1Q90 A;  3Q6S A;  3CRL C;  3A8I E;  4CJ0 B;  1EEI D;  3MVV A;  2HQE A;  4XQN A;  1PRT C;  1LTS D;  2RQX A;  1NUC A;  3GTO B;  4OO1 H;  2F0L A;  2FFK B;  2QDB A;  1V1O A;  2JP1 A;  5CMD A;  3I70 A;  5CGK A;  3MXU A;  5J39 A;  2NZ1 D;  4RA8 A;  5JPN C;  1S5E D;  4JK1 C;  1GUS A;  5EPL A;  1BCP C;  3A7L A;  2SEB D;  4CKC A;  5I9O A;  2EY5 A;  1TS5 A;  2O2L D;  2EYJ A;  1IKM A;  1I6H B;  2AQ3 B;  3PUV A;  1WD0 A;  2B2Y C;  4S3S A;  2X69 A;  3NWT A;  3VR3 A;  5FLX E;  4LAA A;  4H13 C;  3K57 A;  5I2Y A;  3SEB A;  1EIG A;  1NR2 A;  4K14 A;  4C56 C;  2K6A A;  3OWF A;  3DM1 A;  1CTM A;  5HUR A;  2K04 A;  4A93 B;  4U68 A;  4PMB A;  1JC7 A;  3RZO B;  1RTN A;  4DF7 A;  5CBE E;  1LTG D;  5EKL A;  3FVQ A;  2F0M A;  4KY7 A;  1SJE D;  3K5N A;  4RH6 A;  5C5M A;  1FYC A;  3NBI A;  4F8M A;  2EJG C;  2DNC A;  2OT2 A;  1JOO A;  1AW7 A;  2Q8I B;  1KLU D;  1SJH D;  1SDF A;  1HUN A;  1DM0 B;  2R6G A;  2PO4 A;  2F4I A;  1ZYR D;  1HPC A;  4J8Q A;  2RKS A;  1LTI D;  1PZJ D;  5T1G A;  4U67 3;  1ENF A;  1FNW A;  1X3P A;  2QCP X;  5DNF A;  3MA2 B;  4HCE A;  1Y1V B;  2ICI A;  2IX0 A;  3I4N B;  1HRJ A;  5K36 H;  1S5B D;  2Z4H A;  1T5X D;  2TMP A;  3Q22 A;  2G9H D;  3C1F A;  1A15 A;  1O7Y A;  2L55 A;  1YNJ D;  4PMW A;  1GXD C;  2N55 A;  1Y1W B;  5KNC A;  1JE4 A;  1QOH A;  4RCN A;  2YYZ A;  3S1M B;  1ZXT A;  1RD9 D;  1D5M C;  1QJO A;  1JOK A;  4ZQ3 A;  4OO1 I;  3H6M A;  2E2I B;  3SK6 A;  5KYI A;  3S2H B;  5IGE A;  2PNR C;  1PFN A;  2D5D A;  1BDO A;  3TP7 A;  4ODG A;  3PIO 3;  3I91 A;  4KN4 C;  3DMU A;  2B2T C;  1DOK A;  2KJX A;  5COR A;  1X3Q A;  2E76 C;  1BQQ T;  2PZT A;  1VMP A;  5C4H A;  1IW7 D;  2NUC A;  2WKC A;  4A3E B;  2B2U A;  3NBH A;  1SE3 A;  2EJF C;  2HCC A;  1VCI A;  2F0G A;  1DXM A;  5I9P A;  4F7X A;  3LWE A;  3AB9 A;  4FXK C;  3K5L A;  1WTQ A;  1G91 A;  1S4Z A;  2QF7 A;  3PUY A;  3QOL A;  5EKK A;  4KY6 A;  1LAB A;  3I3C A;  4KKU A;  4IFD J;  4Y7N B;  4I7Z C;  3URY A;  4XT3 B;  3I90 A;  4IUU A;  5IOD A;  5EBC A;  4KY5 A;  1EYD A;  1TU2 B;  4RGO S;  5M3M B;  4JBW A;  2FHT A;  1H9M A;  1HQR D;  2A73 B;  3DEP A;  4LJZ C;  1ZKO A;  1ONL A;  3SDZ A;  5DEH A;  2JA8 B;  2BOS A;  4F87 A;  1R4Q B;  3HP3 A;  3O13 A;  3I4L A;  4PQX A;  1MD2 D;  3ITP A;  2I07 B;  4WOR A;  4ZUI A;  1K8O A;  1DCZ A;  4ZKC B;  5K5P A;  1KAA A;  3TBI B;  3VYT A;  4ZKB B;  4BS9 A;  4K2K A;  3MC0 B;  3NK9 A;  2WV6 D;  3D6W A;  1ZEQ X;  2RVL A;  1EQV A;  4RFB A;  5JOB A;  2Z1C A;  1C4Q A;  1JQY D;  1KDB A;  2F0J A;  4UDU C;  1CHQ D;  4FF2 A;  3QIA A;  2EYH A;  1I4Q A;  1L0X B;  3N6R A;  1F9P A;  3VYU A;  4L8J A;  1SSO A;  3TZU A;  5IGD A;  2F0U A;  3VR4 A;  3BZD B;  4C3H G;  1Z47 A;  1IYV A;  2EYL A;  2VXW A;  2BA0 A;  3H0G B;  4BA2 I;  3K5M A;  1AN8 A;  4OIJ A;  2EYF A;  4ULL A;  4FF3 A;  1JCK B;  4CKE A;  5CC4 A;  2A68 C;  2DN8 A;  2SNM A;  3IL8 A;  4H7B A;  4QCL A;  2X6G A;  3BDL A;  1H9J A;  4KI0 A;  1QIL A;  4EQP A;  2BE5 D;  3PO3 B;  5C0X J;  1A6X A;  2L4N A;  3TDQ A;  2R3Z A;  3OSO A;  3CHB D;  3JAM L;  1DD2 A;  3SXH A;  5TSS A;  2A6H D;  2B2W C;  3C1E A;  2CW0 D;  3KLR A;  2Q8T A;  2B8G A;  4RKL A;  1EWH A;  4E6I A;  3M85 A;  1SMY D;  4KHV A;  2M9V A;  2NTS A;  5M5W B;  1A2U A;  2X6L A;  2PQE A;  1DOM A;  3JAM E;  1X32 A;  3TZD A;  4ZLT F;  1NCV A;  3BVZ A;  3LNN A;  4MN3 A;  2K5Q A;  3G6J B;  2XIW A;  5BN3 A;  5KGU A;  3NP8 A;  1G8Z D;  3HKZ B;  4RAU C;  4EQO A;  3DWP A;  2XWJ B;  3CQZ B;  1D1I A;  4IZ8 A;  1V1P A;  4GZY C;  1F2Y A;  2A6E C;  3T13 A;  2KVM A;  2YU9 B;  1JOQ A;  1HFN A;  1IYU A;  1EY4 A;  4C3J G;  4KV6 A;  1QNK A;  2JA6 B;  1ESF A;  3U9S A;  1JWS D;  1V1P B;  2BDO A;  5AFW A;  2K05 A;  2NN6 G;  1WTX A;  1EYC A;  2B2V A;  4A3G B;  3WDN A;  1TS3 A;  2AUK A;  4G7O C;  4A3B B;  1B1Z A;  4F88 A;  1KDC A;  1EY0 A;  1G29 1;  3BYT B;  4QIW B;  2PCF B;  1F9Q A;  1SE4 A;  1AZP A;  3FRP B;  4IUR A;  4KMU C;  1I4X A;  2G9D A;  4HSV A;  1O80 A;  3EA6 A;  5JAV A;  1JR0 D;  3J80 L;  1PZK D;  4XQQ A;  2F0O A;  4I65 A;  1PMR A;  1ENC A;  4O42 A;  3SHL A;  1EZ6 A;  2IT1 A;  5C0X G;  1GUT A;  2C9O A;  2ZXO A;  1ROD A;  3J80 E;  3R2I A;  3ZYY X;  4CJ2 C;  4CBV A;  5FO9 B;  4DGZ A;  4RKB A;  4DNT B;  3H94 A;  4RWS C;  1EL0 A;  2O5I C;  1SNM A;  5KND A;  2J4X A;  4NMZ A;  1SYF A;  4HAE A;  4L63 B;  3I4M B;  4R8N A;  1SNQ A;  4MHE A;  1TWG B;  3BDC A;  5LL6 X;  5FLX L;  1G6Z A;  3R8B A;  4QB4 A;  1D1K A;  4ZAI A;  1AP0 A;  2IX3 A;  4PMC A;  3D4W A;  1PTO D;  1QB5 D;  4AYB B;  4V0B A;  2M2L A;  3NUC A;  4P2C B;  1J8I A;  3TN2 A;  1RHP A;  4C3I G;  2QEJ C;  1SYB A;  2JYO A;  4RGT A;  4A3I B;  4KK7 A;  1U4L A;  4Q5V A;  2K32 A;  2QIL A;  2NTT A;  2CVR A;  4IFD H;  2Z8L A;  2K33 A;  1VMC A;  4KD3 A;  3EQL C;  2D2C C;  1NAP A;  1D2B A;  1ET9 A;  1Z7T A;  1MSG A;  3K59 A;  3UI2 A;  2PZU A;  4IQZ A;  3H09 A;  5G3L F;  1CZW A;  1OXX K;  5BN5 A;  1LLR D;  3BVG A;  4RCO A;  1WTR A;  2B2U C;  3VA7 A;  3CRK C;  2PYK A;  5IT9 L;  5DM6 3;  3V96 A;  3VYS A;  5ELE A;  3H91 A;  5CYU A;  1UEA B;  2HDM A;  1ZYR C;  5CBA E;  2OF1 A;  4C2M B;  2IPK D;  4DAY A;  3QOJ A;  2IX1 A;  5JVG 3;  1R4P B;  2KOL A;  3GV3 A;  3P75 A;  1WTP A;  4LMQ D;  4DNR B;  3GTJ B;  3OIP A;  4PV1 C;  1B44 D;  1ICW A;  5IT9 E;  3M7N A;  5I2X A;  1Q1B A;  2RA4 A;  1JOR A;  3DWQ A;  4FF1 A;  5KNB A;  5CV5 A;  2AUJ D;  4G57 A;  4HCS A;  3P20 A;  1WTO A;  1Q8I A;  2RSN A;  3M4O B;  1GHK A;  3NXW A;  5JEA J;  3OWE B;  5IIF A;  1GHJ A;  5I6Y A;  2FMC A;  3GTM B;  1YNJ C;  4ZK9 B;  1IKL A;  1M4V A;  1V43 A;  1FGB D;  1SNP A;  3ND9 A;  1TVX A;  2EZV A;  3E0J A;  2J7Z A;  3IFT A;  4HMJ A;  4ILW A;  2PZW A;  2IL8 A;  3BS1 A;  2ENB A;  3A8K E;  1A3T A;  2EOT A;  3G7L A;  4WJW A;  1EEF D;  2F0N A;  2FMM A;  3T51 B;  4WFN 3;  3I73 A;  5KIX A;  1BBX C;  2E75 C;  1PRT F;  3GTG B;  1PTO B;  3SE0 A;  3VR2 A;  1STY A;  1CK1 A;  4TQU S;  1KNA A;  1G2T A;  3MTS A;  3T4A C;  4CJ1 B;  2J0T D;  1F9S A;  4K8J A;  2A5H A;  1IW7 C;  1U4M A;  3NHH A;  2MP1 A;  3E6Z X;  4FXD A;  1V8Q A;  3H3V C;  1QCB D;  3MWY W;  2F3W A;  1BCP F;  2R61 A;  1TS4 A;  1QG7 A;  1PXU A;  4IFD I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...