2F0JA

Crystal structure of staphylococcal nuclease mutant i72v
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKVEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0jA00
5HGTA 1KDAA 4KY6A 3OSOA 1NSNS 4NDXA 2PZTA 2EYHA 1IHZA 1F2YA 1F2ZA 1SNCA 1TT2A 2F0JA 2SOBA 3P75A 4TRDA 3SHLA 4F7XA 5IODA 5C5LA 2OF1A 2F0VA 1EYAA 1EY7A 4ME5A 5IGCA 5DAUA 3C1FA 4PMCA 1JORA 1KABA 1SYFA 2F0UA 1SYDA 5I9OA 3SK8A 2EYFA 3NQTA 4KHVA 5CV5A 2PW7A 4J1MA 1EY5A 3P1HA 4IUNA 4S3SA 5JAVA 3DMUA 4KJNA 4H7BA 5IOCA 5J22A 1SNDA 5C3XA 4EQOA 3EVQA 4B9WA 4K5XA 3E5SA 2PYKA 4ZUIA 4LAAA 1STGA 3NHHA 3MEHA 5CC4A 5J39A 1EYCA 2SNSA 1SNMA 3H6MA 4E6IA 5CGKA 1SYEA 2F0HA 5KYLA 2OEOA 4KD4A 3SK4A 3V2TA 3OMCA 2SNMA 3ERQA 5I6WA 5IGGA 5IIFA 1EY0A 4QMGA 3OMGA 1EY9A 4R8NA 4DFAA 4K5VA 3ITPA 1TQOA 5J1ZA 3SR1A 3QB3A 2EY5A 2F0IA 4IZ8A 3PMFA 2F0NA 4EQNA 4DU9A 1EZ6A 4EQPA 5C6AA 1EY4A 2F0TA 3D6CA 1EY8A 4HTHA 2F0PA 3MXPA 2OXPA 2NUCA 4K2LA 4RKBA 3HZXA 4ZUJA 4WRDA 3TMEA 5KEEA 2KQ3A 5EGTA 3TP8A 4K2KA 4NP5A 1STYA 3D4WA 4OL7A 1U9RA 5NUCA 1STAA 4DGZA 5DEHA 2EYMA 5I6YA 3T16A 5I9PA 4F8MA 5CV8A 3U9OA 3BDCA 3C1EA 5K5PA 3NP8A 4NMZA 4KTAA 1A2TA 5IGDA 1JOOA 1A2UA 1A3UA 2EYLA 1SNQA 1SYBA 2F0MA 2F0WA 2F0FA 3EROA 3MHBA 5CV9A 5F2DA 2RBMA 3SK6A 4ZQ3A 3QOJA 3TP5A 1EYDA 5KRUA 2F0KA 5C4HA 5ISRA 5CV6A 5C5MA 3D4DA 4MIUA 4PNYA 1EY6A 5EKKA 5IGEA 1SNPA 4QB4A 5KIXA 2F0EA 1ENCA 1JOKA 4ID6A 3S9WA 4KY7A 4IALA 4KJOA 2EYOA 2F0GA 2PZWA 4KD3A 2F3WA 2PZUA 4K14A 4RKLA 4K6DA 2O4XA 4YIJA 4PMBA 1SYCA 1KAAA 2EXZA 4KY5A 4K5WA 4KV6A 3SXHA 2PW5A 4G57A 4K8JA 1TR5A 2F0QA 2EYJA 1NUCA 3NXWA 5IGBA 2EYPA 3NUCA 2EY1A 2RDFA 1F2MA 4HMJA 1ENAA 4HMIA 4NKLA 4K8IA 5CV7A 3T13A 3TP7A 3VA5A 4N9TA 4QF4A 1KDBA 1A3VA 3R3OA 3BDLA 3TP6A 2F0DA 1EZ8A 3MZ5A 5HURA 2F3VA 5C3WA 4J6HA 4N9PA 5E3FA 5E1FA 5C4ZA 5IGFA 1A3TA 1STNA 3D8GA 1STHA 2RKSA 1AEXA 2F0LA 2HQEA 3MVVA 3DHQA 2KHSA 3OWFA 3NK9A 3SK5A 3QOLA 2QDBA 1STBA 5M9OA 5KGUA 2F0OA 2PQEA 2ENBA 5EKLA 1JOQA 4ODGA 5CV4A 1SNOA 2LKVA 2EY6A 3EJIA 1KDCA 5JOBA 1EQVA 2WACA 4WORA 2M00A 2EY2A 4EVOA 4I65A 5CR3A 3RUZA 4DF7A 5KYIA 2F0SA 1RKNA 3LX0A 3HEJA 4B9XA 1SYGA 1II3A
chains in the Genus database with same CATH superfamily
4C1NI 1JT8A 2MUYA 1TT2A 4B08A 3S1NH 2CFMA 5IODA 3LGJA 3HOYH 4BY7G 3NELA 1N8RC 1QWYA 2K33A 3NENA 2HUGA 4KKSA 1TWAB 2QILA 3Q23A 3NEMA 1GUNA 1M8AA 1XTCD 5M3FG 1VQFA 1PH2A 1N34L 1X9NA 1N36Q 1TU2B 4ZUIA 2A74C 2VZAA 1K28A 4E6IA 1EWIA 2O2LD 3G7LA 5M5XB 1I50B 5I2YA 1FJGQ 3ERQA 3E6ZX 1BDOA 2L1BA 1NJIC 1UE5A 2F0IA 1JC7A 5M3FB 4YWMA 4NPSA 3UDIA 4DU9A 1BBXC 3F8TA 2Z6KA 1CUKA 1KNAA 1X3QA 3Q8DA 5IYDG 4NXML 2NUCA 2C35B 2ZXOA 4JI6L 1VQ9A 4JI3L 3TP8A 4EQ5A 5ELFA 4B3SQ 3TDQA 5GROA 2C9OA 2Z4HA 1PYWD 5C4JB 4JI2Q 2NVXB 3WWVA 1GUGA 4JI8L 5K5PA 1MJEA 1I6HH 2VNUD 1A2TA 4BY1H 2ATWA 3BZDB 2WFWA 2F0MA 4BS9A 1FNUA 5F2DA 1L1OA 2DN8A 4JI1Q 1QVGA 1GHKA 2IWHA 4A3IH 5KNDA 1XPUA 1DD2A 3D31A 1VF5C 3ONAB 2XWBB 4HCSA 1V9PA 1UE6A 3F2DA 4K14A 4IQZA 3HOVG 2EXZA 5GAEC 4FF4A 1VDZA 3CU7A 1O80A 4IFDI 2XIWA 1ENAA 1JMCA 2BDNA 4HCEA 4RAUC 2NVQH 4OWWB 3CQZH 4CKBA 4R1JA 3HKSA 2RKSA 3QOLA 5D65A 1PFSA 1D7QA 1SMXA 4YCUA 4BBSH 1B70B 3FRPB 2EVBA 4RCOA 2MNAA 1FNVA 1EOVA 1PYBA 2JXMB 4XQNA 3H15A 2R93G 4IUQA 4GKKL 2F4VL 2CH4W 1DONA 1HA5A 3NWSA 2YTVA 2JA6B 1QG7A 3GTGB 3GTLB 1SJHD 5K36G 2R7ZG 4JYAQ 4KLKA 5I9OA 3A56A 1TY2A 2E2JH 3NTIA 2Q2UA 2NBFA 4DV2L 2HIVA 4KKUA 2X69A 1K9MC 3L9AX 2R93B 4DK1A 4FF3A 1VS0A 5J39A 1EYCA 1QUQA 3CCVA 5C44G 3I55A 1EIGA 1W6KA 4KD4A 1QNUA 1EY0A 5M5WH 4IPHA 4IPCA 4R8NA 4I7ZC 2R7ZB 2R3ZA 3OOCA 3SR1A 2VW9A 3FPPA 4RG1A 1WTRA 4EQNA 5C6AA 1HQMC 1YNND 4IFDJ 4HTHA 4YWLA 2UU9L 1A63A 4A3KG 4GS3A 5ELNA 4AH6A 4UDUC 3BYTB 3JAMi 2KQ3A 1R9TH 2EYMA 5CV8A 4CKEA 3S1MH 2BA1A 3UDFA 4RGTA 4R4QA 3Q24A 2F0WA 3E0EA 1LTRD 1Y8PB 2B2WA 1I4QA 3D4DA 4MIUA 4XT3B 3HOXH 3LNNA 2F0EA 4AQYQ 1EIYB 2L9HA 2G9HD 4DNIA 2IHFA 2PZUA 5AJ3L 2YTYA 4FF1A 1NE3A 2SEBD 4KY5A 2OCEA 1MSGA 2G9DA 1QZGA 1W6JA 3GTJB 4X65Q 4K8IA 2HDMA 5ELEA 1D1IA 4A93G 1YJWA 4LF5Q 2F0DA 5HURA 4C3JG 4FXDA 3HS0C 3E9IA 3HOUH 2F0LA 4QGUA 1EOTA 1D8LA 1CI3M 5JJLA 4K0KL 2RCNA 2NZHA 2CW0D 1X65A 3EJIA 5FO9B 3ND9A 2NN6G 5KYIA 4GN5A 1CHPD 2XTIA 4PZ6A 4POFA 4A93B 1K8MA 1XNQQ 4X64L 1PH3A 1NCVA 4C3JB 1HR0Q 3O13A 3OSOA 1TS2A 4NDXA 1RHPA 3GQBA 3AQQA 4K5WA 3ULLA 3CMAA 1D2BA 3K7AB 2JE6I 1WTPA 2LSSA 4P72A 4V190 5GAHC 2R7FA 4ME5A 2ZTDA 2VB2X 3H94A 2PMZE 2JA5G 3PO3H 1IZ6A 4FXGC 3CC7A 1L0WA 1A0IA 4RMFA 4CGYB 1K83H 3CAMA 1HNWQ 1K3RA 4ZYSA 3EVQA 1BCPF 3TREA 3GO5A 4BY7H 2RQXA 2A6HD 3OYYA 1ESFA 1STGA 3NHHA 4OELB 1B7YB 3MFGA 1NMFA 4JPBW 4GN3B 2B63G 3SK4A 5I6WA 4H02A 3FDTA 4K5VA 3ITPA 2DJGC 3JC66 3QB3A 2EY5A 1VQIA 1IW7D 3V05A 2NVTB 1Y1VG 1S5CD 1G2TA 3A8KE 1RF2D 2VL6A 4ALPA 1ASYA 2MGSA 1N33Q 1QZHA 3BZCA 2KHJA 5D3IB 4TVAB 4OO1G 2B63B 3PIP3 3GTKH 4PQXA 3AFPA 3C1EA 2EXDA 1N34Q 4RGNA 1VQOA 4GLAC 2EYLA 3I4MG 4FVMA 2F0FA 1VQGA 5KRUA 1TWFH 4ZQ3A 3H09A 3CCLA 1Z7TA 4J15A 3J7ZC 2NYZD 5FJ8G 2EYOA 4L63B 4X3SA 1IYVA 4KD3A 2WINB 5M3MH 4A75A 1WCMH 3S1RH 1LT6D 4C3IG 4IFDG 5LMNL 3WOEA 1VQLA 4OIKA 3LWUA 2F03A 3I4MB 3QG1A 3JAML 1JCKB 2WIIB 2KA7A 1BCPC 3SVMA 4YCVA 4DV3L 1ONLA 4M8AA 3C46A 4F88A 1YHQA 1O7YA 3HGBA 1WJJA 3MZ5A 3BU2A 3VR3A 3HOVH 1Y69U 3K5NA 1LV9A 2A68C 4A3BB 2HQEA 5JEAH 3PF4A 3NK9A 4C3IB 1JWMD 1NNXA 1PTOH 2WB1G 3NBHB 1RJTA 4UAIA 3TQYA 2MQHA 3R2IA 3CCUA 4A3GH 1S72A 4HJ9A 2MO0A 3H0GG 4EVOA 4I65A 4LFAL 5M5YB 5IYBG 3L2PA 2QCPX 3PF5A 2ID0A 1IHZA 1JWSD 2UUCL 3AFQA 1G6ZA 1CKNB 3AYHB 2BA0A 1Q8KA 1SXTA 2WB1B 5IGCA 3M4OH 1SYDA 2HHHL 2EYFA 3H0GB 4YY3L 3HOYG 2QA4A 1XWEA 4O0AA 4BWGB 3HFZB 1B2TA 2XN9C 3MXNB 2BDOA 3J80E 1PLFA 3FP9A 1VQ4A 5E4WC 4P71A 1OXSC 2KEEA 1EY9A 2E2HB 3MWYW 3FHWA 1TY0A 1QE6A 5D14A 1KRSA 2KJXA 4GKKQ 4K6LA 2F4VQ 3S1NB 1FYCA 3HOYB 4EQPA 4BBRH 1HZAA 4OWXB 3J81c 5C44H 1XMQQ 4AYBB 1CSPA 1VF7A 1OXVA 4JI2L 3NPPA 4YWKA 1LTBD 1LTGD 2PQAA 4DV2Q 1EIHA 4KN4C 5I9PA 3CKIB 4ME3A 5DEHA 4JVZA 4A3EG 1MIUA 1FGUA 2NZOA 3U9OA 4J8QA 4JI1L 2D9UA 4A3DH 1ESRA 1JOOA 5BN5A 3EN2A 4A3KH 1O7IA 4X66L 2Z8LA 3QOJA 5C4HA 3VR6A 4LF4L 1S5FD 5CV6A 5C5MA 1HRJA 2JEAI 1UAPA 2JJQA 1PRTD 2NWGA 1SJED 1O7ZA 2PZWA 4RKLA 3NWTA 1EU4A 2ZXRA 1EFID 2UXCL 2UU9Q 1OO9B 2P5ZX 1PFMA 3K5LA 2B2VC 1JWUD 1H9JA 1ICWA 4HSPA 4NKLA 3FEWX 1A3VA 1FVIA 2OT2A 1HTLD 1PH6A 1I6HB 4BY1B 1STNA 4Q5VA 3K8AA 4A3IB 2B8GA 2F4IA 1V8QA 3KBGA 2ENBA 1SROA 5EKLA 3NBIA 4ILWA 5JOBA 1UEAB 3VYRA 4C3JH 1JQYD 4QIWE 5AJ3Q 4JG2A 2UXDL 1V1PA 4GNXA 1KLGD 2L15A 3M3YH 4JBJA 4DA2A 2PZTA 3Q22A 4JK1C 1VQHA 2I0QA 4BBSG 4JYAL 1JE4A 1HUMA 1EY7A 1YZ6A 3G6JB 1SYFA 2NVQB 3CQZB 1NTGA 4EGVA 4LUVA 1X3EA 4H0LC 1TKWB 1FNWA 1ZXTA 3GTMH 3P7JA 4MTNA 2JA8H 5IOCA 4H7BA 1LT5D 1V1OA 4DK0A 5J22A 4K0KQ 3KLWA 1AP0A 4L8JA 2JA5H 4BBSB 2F0HA 2KOLA 1RD9D 4CDDC 2MJ8A 3CP0A 4X64Q 1CK1A 5IT9L 4IJLA 2XRQD 4JI4L 5J3BA 3S2HB 3GP7A 2B39A 4JI7L 1JB3A 2EJFC 2Z0SA 3OHXC 3HOZH 4DR4L 3I4LA 2WV6D 4LJZC 2E2JB 5ELCA 1STYA 3R2TA 4CJ0B 2H4OA 2Q8IB 5CORA 4F8MA 5BR8L 3S16H 4OX9L 1Y1VH 3GTOH 1PZID 4Y7NH 2PI2A 3A74A 3MHBA 2IX1A 2AQ1B 4KI0A 4AQYL 2F0KA 1R4QB 3K59A 5IGEA 3CXCA 1EY6A 4X3KA 3CPWA 5M5WB 5KIXA 1VQNA 3CC2A 2PI2E 2KUMA 4IALA 4KJOA 2O5JC 5JJZA 1YNJD 4HJ7A 5FLXL 2Y0SG 2DUDA 5JEAJ 3PV0A 3HOXG 3GTPH 3H91A 2ASBA 4A76A 4P74A 2QKIC 2R6GA 4QF4A 1RTNA 1R9TB 3PO2H 3S1MB 2Q2TA 2ICIA 3I3CA 1VQPA 2F3IA 5E7NA 1WI5A 2Y0SB 3ICEA 3M9BA 1M4VA 3CMEA 2PQEA 3HOXB 2QDLA 5CV4A 4HN7A 2LKVA 3GV6A 1EQVA 1WTHA 3UDGA 4C3HG 2AMCB 3HOUG 1U0LA 2ALYB 3RN5A 5DNFA 3U58A 1PVOA 3KLSX 2SDFA 3CCRA 4O2DA 1EYAA 4DV3Q 3PUYA 5IYBH 5IYCH 2QGQA 1YEZA 3NQTA 1E22A 3L3OC 3CPFA 4U673 3HOUB 4G7OC 4OEMB 5C3XA 3PO3G 4DK3C 1VMPA 2YYZA 4XXEA 4LF6L 4LFAQ 4X62L 2NN6I 1HNZL 4FO2A 1E2ZA 3A55A 3OMGA 1VQ5A 1G2SA 1IYJB 1WTVA 2UUCQ 4UPAA 1YNNC 5EBCA 1GD7A 4RFBA 1N32Q 2XRSD 5C4XH 4DUZQ 1N33L 2OXPA 3PO3B 2BH8A 1FD7D 2A1AA 2JQOA 2HIXA 2HHHQ 1A15A 2CCZA 3D4WA 1K83B 1YNXA 4YY3Q 3EFXD 2VB3X 4BY7B 3A7AB 1FL0A 1KC8C 1SNQA 4DV6L 1SE4A 2RBMA 1A62A 4JV5L 2NTSA 1DOMA 3DUZA 4CDCC 4A3EH 4JW0A 2KEDA 3DEPA 3IRBA 2LXKA 3ND8A 4KHZA 3KF6B 2B2YC 4LUZA 1G8ZD 1K3BC 4MZ9A 3U50C 2V4DA 1G6PA 1PH9A 1CSQA 1OXUA 4OO1I 5M3MG 1KDBA 3GTKB 1WCMG 3R3OA 3BDLA 2R92H 2ZXPA 2KCCA 1YHAA 5EPJA 1Y8OB 4XYOA 1J9OA 4C2MH 4KHPQ 1F9SA 3D8GA 1AEXA 4DR5L 1TWFB 4P2CB 4X66Q 2CW0C 4LF4Q 1BNZA 2UXBL 3ULJA 5GADC 2CQOA 3PUZA 2M00A 4FYDA 5M3MB 5LL6S 1WCMB 4A3LH 5JEAG 1PTOF 3S1RB 4NXNL 3P1HA 1EQRA 2UXCQ 1KDAA 4OHJA 1NSNS 1HQRD 5E1FA 1GVPA 2RHSB 4IPDA 4QL5A 2FINB 4A3GG 1Z9FA 5G3LD 2A6ED 1VQ6A 1X6OA 4UP9A 4A3MH 4PMCA 5A2QL 1RTOA 4OGQC 4CJ1B 3TN2A 1XXGA 1KTKA 3HOVB 1L0YB 4KHVA 2PW7A 1P16A 3G48A 4HAEA 3WOFA 4CDEC 2UUBL 2A6HC 1PTOB 5FKAC 4DAMA 1NY4A 4B9WA 1SNMA 2ZJPA 4A3GB 1D5XC 1G91A 5EPLA 3PIO3 4LNQA 1UEBA 1Q82C 2YV5A 4A3CH 1X55A 4DR3L 2UXDQ 2AQ2B 1SMYC 3S2HH 2VUMH 4B3ML 1CZWA 2CVRA 2F0NA 1XMQL 5DM63 1I4HA 3RZDH 4RWSC 2KCMA 5GQOA 4K2LA 3M4OB 1K8OA 5EGTA 1HZ9A 2A69C 2JA7H 4LF8L 1TWCH 5I6YA 4BBRG 3NP8A 1QJOA 1PTOC 1EQTA 1W3SA 4DAYA 1Q90A 4KMUC 1HH2P 2AWNA 3KBXA 3KLSA 1K73C 1XPOA 4ID6A 3S9WA 4A3DG 3RNUA 1GM5A 1VQDA 3TS0A 2OQ0A 1PH8A 4JI4Q 4BBRB 2OTLA 4JI7Q 3S2DH 5C44B 3I70A 5ELBA 1TR5A 1L1OB 4RHRA 4DR4Q 2IPKD 1HNXL 1F2MA 1YI2A 4DAPA 2LFNA 4AIMA 5LL6X 1UE1A 3FKIH 3J80c 5BR8Q 2F3VA 3JAME 3Q0AA 3CC4A 4OX9Q 4C56C 5C4ZA 5DLQE 4A3DB 1HXYD 1HFNA 1PFNA 4O42A 4A3KB 2K01A 4FP5D 2MP1A 2Z6KC 3IFTA 4JC0A 3HKZG 4DN4M 1Q12A 1LT3D 3J7YW 3ER0A 4PG3A 1H95A 2FMCA 3KYHC 3KDFA 1AFPA 4DR2L 2QW7A 2OF1A 3PIPA 1HTPA 2C5CA 3C1FA 3HKZB 4C3HH 1L2FA 3FPUB 1IYUA 2K28A 1EY5A 4FXKC 4FNFA 1PDQA 3K7UC 2R7DA 5IP7H 2QEJC 4IOCA 4JCVE 3W5OA 5IE8A 4L5SA 2WAQE 1MKHA 2JA8G 3HOWH 3M3YB 3I4NH 2RSNA 4IZ8A 4RH6A 2EE1A 2ICEC 1MBYA 2A8VA 2HT1A 3D3RA 1QOHA 4MHEA 1DJRD 4DV5L 2D62A 1C7YA 3MXUA 1T9HA 1EWCA 4RKBA 4WRDA 3T53B 2UUAL 3DEOA 5GAGC 2NVYH 3GTMB 2JA8B 3T16A 4DR6L 1KL9A 3MXGA 1JB7A 4ZK9B 3HOZG 1HZBA 4ZAIA 1LTID 1L0XB 2JA5B 1GOZA 4Q0FA 4U68A 1WD1A 4LF6Q 3PGZA 3R8BA 1LO5D 4X6AH 4X62Q 1HNZQ 1UE7A 2E8GA 1CKNA 1YHBA 2F3WA 1PH7A 1HR0W 4B3TQ 1M90C 3H3VH 1X32A 3HOZB 3EIVA 1S3OA 3NUCA 1S5ED 1GUSA 3CD6A 4JOIC 2HD3A 2VXWA 4L5RC 3S16B 1Y1VB 3GTOB 3MXNA 4Y7NB 4WJWA 1A3TA 1CTMA 4A3JG 4DV6Q 3K80C 1EUJA 1XJVA 1E2VA 2KHSA 2N49A 1HA6A 4JV5Q 3M4PA 3PO2G 2EPBA 1TS5A 2K14A 5KNBA 2F0SA 3LX0A 1U4MA 2B2VA 3HEJA 2PPBC 1HCZA 2F52A 5H1SE 2BE5C 3RLOA 2E5LQ 3GTPB 4TKOB 3F2CA 1F2ZA 2AWOA 2SOBA 4R9WA 1XNRL 2B2UA 2H5XA 2B2WC 1XMOL 1PMRA 5DAUA 1D5MC 2CHBD 4AYBE 1DM0B 3PO2B 1DXMA 1S5BD 4POGA 5FO7B 3TEHB 5EQ0A 1SE3A 3K58A 2PMZB 5JVH3 4H44C 4DR5Q 4WJ3M 4KJNA 1IL8A 2Z9HA 2I07B 2UXBQ 4BXXG 1LABA 3M85A 4LAAA 3A8IE 2FXQA 5IYCG 5CGKA 1KD1C 1SYEA 4DKAC 4DR1L 3KJOA 4NXNQ 5J1ZA 1N32L 1RDPD 4DUZL 1LM0A 5IT9E 3OW2A 3F1ZA 1SR3A 1E7ZA 1O78A 2MFIA 5JVG3 5EPKA 1B8AA 1D5ZC 1QILA 3LWEA 1DCZA 2CKZB 2E2IH 2UUBQ 5C4XG 2HDLA 2JP1A 2VQFL 4GOPA 3G6EA 1I6VC 1V1QA 1X54A 4HEDA 4DV1L 3M7NA 1MGSA 1SNPA 4DR3Q 3BZKA 1YNJC 1TWHH 4B3MQ 2HCIA 1VQCA 1H9SA 1D6EC 2K7VA 4YIJA 5C4XB 1LTTD 4IO9A 4JI5L 4DXFA 3TS2A 5FLXE 5D3DA 1GHJA 5C3EH 4F87A 1BR9A 2EY1A 3I4OA 3I7FA 1WYDA 1DGSA 3FVQA 4LF8Q 2LS01 4N9TA 3VYTA 4KHPL 2IL8A 4HJ8A 2K5WA 3SDZA 2EOTA 1IL2A 1STHA 2KCTA 1WTQA 2K05A 2AUKA 2R92G 3J7AV 2X6GA 4QJFA 1B53A 4A3EB 2XGTA 3L7ZC 3KFUA 2B2TC 3J81j 4MTKA 1SE2A 1WFQA 4DV7L 3P75A 3OIPA 2F0JA 1HNXQ 1F9PA 1SN8A 2K75A 5BN3A 4A3LG 1VQMA 4LUOA 2R92B 3OPOA 3AEVA 1WD0A 4C2MB 1ZYRC 1CFMA 3CCMA 2O5IC 1Y14B 3SEBA 1SNDA 4HIMA 4A3MG 3D6WA 4K5XA 1GJXA 3BVGA 2B8FA 1BQQT 1BKBA 3BS1A 1HFGA 1SE8A 1EL0A 4I7AA 4XT1B 5JPMC 4DR2Q 1I3QH 4OIJA 2N55A 2K5QA 4A3CG 4A3MB 1JE5A 1KHIA 3VDYA 1J5EL 2PNHA 4C1NK 2K03A 2ZT9C 3BVZA 3K5OA 2FHTA 2VUMG 4IUUA 4CJ2C 1ICFB 3U4ZA 4OL7A 3M4QA 2RA4A 3CF5A 4LW1A 2IX3A 3P20A 1QB5D 1AH9A 4KTAA 1BCPD 5DM73 2EJMA 3RUZA 2Y0SE 5T1IA 1H9KA 3EROA 1ML0D 5CBAE 2JA7G 5ISRA 1WTXA 3VYUA 4R4CA 4PNYA 2I5MX 2PQAB 2RVLA 2A68D 2ZTEA 2VUMB 1PZJD 1F9QA 3CRLC 2AQ3B 2O4XA 4DV5Q 1WOCA 4KV6A 3RZDB 1BO0A 1QVFA 4XYQA 4XQQA 4G7HC 3DM3A 3NXWA 3GDEA 1QCBD 4CBVA 2UUAQ 3E0JA 3KF8A 1EYGA 2JA7B 2PO4A 1FR3A 1TWCB 1WTWA 1RODA 4DR6Q 3URYA 1LTAD 5IGFA 2GN5A 2M2LA 3ZYYX 1MJCA 4HIKA 3K0XA 2LMCB 3ERSX 3FKIG 1UUPA 4Z9CB 1KIXA 1E3PA 3CCEA 2B2YA 5E4XA 2EY2A 3S15H 1MI2A 1CA6A 2N8NA 2MPMA 3IKJA 4HR7B 2I5HA 2KHIA 3T56B 1PV4A 3MA2B 3UE1A 4A3JH 3RZOH 3S2DB 2K52A 2QF7A 4LK1C 4HIOA 2A6EC 2Q8TA 4LF7L 4DNTB 2KECA 3FKIB 2H1EA 3DLLA 2YU9H 5CV5A 1V1PB 2L0CA 4GNXB 2K5NA 5A2QE 1EFWA 5JAVA 3DMUA 3GD7A 1H9RA 2IY5B 4GZYC 4OXPA 2IHEA 3KLRA 4P73A 1CHQD 2RHQB 2BCOA 4PZ8A 3A0JA 1PXUA 4IJHA 5I4DA 1I5FA 1A8VA 1B44D 3S24A 5IP7G 2AKWB 3JAMc 1C4QA 1B9NA 1D1KA 4RGOS 1XNRQ 4BXXH 2FJ2A 2F0TA 4JI0Q 1EY8A 1XMOQ 4YCWA 4ZUJA 4C3HB 1XPRA 3I2ZA 3HOWG 4YHHL 3PCOB 3OTOL 3I4NG 1IBMQ 2K5DA 3A5UA 2KENA 1LUZA 4QY7A 3J81i 3K57A 3UI2A 3DXJC 2ZM6L 4FDBA 1WVLA 5ELDA 1IBLL 3RMHA 2ES2A 1EYDA 4DR1Q 3S1QH 3HOWB 4QB4A 4ZKBB 4B3TL 3AB9A 4OWTB 1YJNA 3I4NB 4L6TB 1XX8A 5LMNW 3S14H 4K6DA 2L4NA 2I46A 1E0BA 4TSSA 1TVXA 1PH4A 4K8JA 2F0QA 1HUNA 1SEBD 2Z4IA 4HMJA 1BXTA 2NVYB 3BG3A 3X3NA 5C3WA 4N9PA 1KAWA 2L5TA 5ELOA 2VQFQ 3SGIA 2HCCA 2OQKA 1BOSA 2JN4A 3PIOA 2A73B 4DV1Q 3K6OA 4HSVA 1FGBD 5EBDA 4LFBL 1KDCA 4GLXA 2DY8A 1GUOA 4WORA 2M9VA 1CQFA 2E5LL 5C0XJ 4B9XA 4JI5Q 4KY6A 1VQ8A 2DNCA 4UHVA 1F2YA 2XNAC 1G291 1KQSA 3E9HA 3PUWA 4H13C 1Q3LA 1ILQA 2CWPA 2BOSA 2RDGA 4ZCKA 1KXLA 4DV4Q 1WTOA 1ENFA 1I94L 3CCQA 5COYA 1DZ1A 2TMPA 4EQOA 5KNCA 2RCFA 3E5SA 1ET6A 3MEHA 1VQKA 5KYLA 2JYOA 1B4OA 2K6AA 5FO8B 1VCIA 1EQQA 2EDGA 3V2TA 3T1YL 1K0SA 2SNMA 1V43A 4QMGA 3C2PA 4IUVA 3H3VC 4DV7Q 2K04A 4M1UB 2K4KA 2NZ1D 3BVMA 1B9MA 2XWJB 2D5DA 1KLUD 3RLNA 2F0PA 1S40A 4DAVA 2RDHA 1IBKL 5HGQA 4HJAA 4N8FA 3I8ZA 2QEXA 5NUCA 3M7GA 2IT1A 2VY3A 1CKOA 1C48A 1KRTA 4G7ZC 1LACA 1IW7C 3NTKA 1AE2A 1TWGH 2B29A 1Q46A 2JA6G 3STBD 1CA5A 1MD2D 3I91A 4KY7A 3TZUA 1HHVA 2N78A 5A35A 2K32A 2F1MA 1KAAA 3A54A 3T1HL 2L11A 5AFWA 1NUCA 1EIFA 5TSSA 2EYPA 5IGBA 1J5EQ 1SDFA 4HMIA 3HKZE 2MO1A 1YVCA 1LTSD 5IY0A 3J81L 2E2IB 4L5TA 3A5ZB 5CMDA 2VQEL 4DR7L 3J7AF 1F9RA 5C3EG 4DUYQ 2N88A 1SSOA 1NBWA 2WP8J 4RGMA 1JOQA 1B50A 4XDXA 4ODGA 4IN3A 1N9WA 5IT9c 1CT1D 3S17H 2WACA 1AW7A 1TWHB 3E3XA 5CR3A 4DF7A 2G5DA 3HG9A 1NR2A 4GKJL 3NE5B 4JOIA 3Q6SA 2EYHA 5C3EB 3F2BA 3SHLA 1TXYA 5IP9H 4F7XA 3F2UA 1Z6HA 4R4IA 2VS1A 1JORA 2F0UA 3V96A 2Z1CA 4LF9Q 1EEFD 1K8AC 2DGYA 1W2BA 1ILPA 1EU3A 4WJ4A 2TSSA 3IAYA 2PYKA 1NMGA 5LHY1 3EBEA 3H6MA 2DY7A 5FLXc 5C0XG 3W2DA 2V1CC 4DFAA 1PRTF 1TQOA 1L1OC 2OWOA 2OTJA 5CBEE 4APVA 1LLRD 4O1NA 4LF7Q 3OWEB 4MN3A 4N8X1 3D6CA 1AZPA 1DYQA 1E24A 3TMEA 4BA2I 1YIJA 3K81C 5KEEA 4UP8A 1PZKD 1PH1A 3N52A 2LXJA 1B1ZA 1U9RA 3TBIB 4DGZA 3SE0A 2BH2A 3BDCA 3BDOA 2J0TD 1IKMA 4NMZA 1A6XA 5IGDA 1PRTB 1A2UA 4LFCL 2PCFB 1PFBA 1T5XD 3IFDA 5CV9A 3VA7A 3EA6A 3CRKC 3OIQA 2HQLA 2CWAA 3QR8A 5T1GA 5L37A 5EKKA 4IURA 1SFOH 2AUJD 5FLMH 4UP7A 1QUQB 2F0GA 2L55A 1I3QB 1SLJA 1PHJA 2NB0A 1Y1WH 3GTQH 1SYCA 4DAYB 4XQJA 1ASZA 5EAYA 2EYJA 5LMUQ 4YHHQ 4G4KA 3OTOQ 3NBHA 4JBKA 4B3RL 2A5HA 4JBWA 3PUXA 4RHSA 1TWAH 1G51A 1F2LA 4DV0Q 1J8IA 2ZM6Q 3QJYA 1H9MA 4RCNA 3OWFA 3SK5A 3SXHA 1IBLQ 1PRTC 4MNOA 3G71A 1JJCB 5M5XH 1GUTA 4IUPA 1I50H 2ZJRA 1II3A 3CCSA 2WB1E 2CH4A 5M3FH 3W1BA 2MHVA 4KN7C 4Y52H 1S5DD 1SMYD 2RSOA 4PMWA 3SK8A 3NQIA 2WAQG 1DOLA 3QO2A 4UY8C 1BCPB 1E2WA 4IUNA 1STEA 5C4JH 3CCJA 2Q2IA 3KDFB 2NVXH 3VR4A 5FOBB 3MC0B 2A69D 2LY7A 4IPGA 1VQEA 1VQJA 2B2TA 2R61A 3VR2A 4LFBQ 3TRZA 2OEOA 3S15B 5IYDH 3OMCA 5IIFA 2KVMA 1QVCA 1PTOD 3A7LA 4A3JB 3RZOB 4V0BA 2WAQB 1GO3E 4JI0L 3DM1A 1ET9A 1EY4A 3M4YA 3AU7A 1IBML 3MXPA 4A3BG 3HZXA 4A3FG 4NXMQ 3DWPA 3MFYA 2YU9B 4K2KA 1I94Q 4JI6Q 4JI3Q 5BN4A 1UWVA 5EJWA 2NTTA 2AHOB 1AE3A 3QWNA 4GN4B 2RF4A 1LT4D 4JI8Q 2ZJQA 3VR5A 4PZ7A 2DNEA 1JJ2A 4CHTB 3KOJA 1I4GA 1NAPA 3T1YQ 2GA4B 1I4XA 1ENCA 1JOKA 1DOKA 3RR5A 5IWAL 4ABNA 4A3FB 3KK7A 1SBBB 2JK8A 3PSIA 3J7A5 1ZKOA 3B6YA 1BF4A 2J7ZA 1T5EA 3I90A 3N6RA 3HRZC 1CKMA 1BVSA 1IBKQ 4ZRZA 3TP7A 2JA6H 3GTGH 3GTLH 1Q7YC 1YJ9A 1OXXK 1EZ8A 1Z47A 3CHBD 1OTCA 4QCLA 2J4XA 4X3UA 3U4VA 3CW2C 5EKIA 4X3TA 2EIFA 3J80i 1R4PB 2R93H 4HIDA 2F0OA 1N36L 3X3MA 2JEBI 3S1QB 1IXRA 1SNOA 2JSOA 4CDFC 4IOAA 1HPCA 4AYBG 2ZTCA 1FJGL 3S14B 3UE0A 1VQ7A 5K36H 3T1HQ 2R7ZH 5HGTA 3BJUA 4TQUS 1E1OA 4R4TA 3BYYB 4TRDA 4R8IA 1U4RA 4DV4L 3W1GA 1AZQA 3NTHA 1EWHA 4DXGA 2WKCA 3AMUA 3H3VI 2XSCA 2VQEQ 3PQIA 4DR7Q 3MAQA 4B3SL 3I56A 1LTLA 3TZDA 1S4ZA 1PH5A 4DNRB 4P75A 1HZCA 3DWQA 1F77A 1VQAA 1M1KC 1U4LA 1X3GA 1JICA 1IKLA 4QUCA 2N3SA 4ZKCB 1EEID 2E74C 2K5VA 1YBYA 1Q81C 3MTSA 4GKJQ 3A8JE 2D0PA 1C9OA 3PMFA 1X56A 1BUVT 1EZ6A 1I4PA 2JA9A 3I72A 1O7LA 4BY1G 3PUVA 1SRUA 4A3IG 5HY6A 5C0XH 3GTJH 1XYIA 3EQLC 4IUTA 4NP5A 4XTCS 2D2CC 1B3QA 1PYSB 1NR4A 3ZJYC 4QQBX 3MEFA 4ZLTF 3T4AC 1SYBA 3G4SA 3U9SA 2FFKB 2B2UC 3TP5A 1PA6A 1AN8A 3DWAA 1GUWA 1Q1BA 4DK6C 4BA1I 1X3PA 3K5MA 4WFN3 1JR0D 5JJKA 1I4RA 2EQSA 4A93H 1KNEA 3C3LA 2D0OA 3VYSA 4GOPB 1Y8NB 3RD4A 2PW5A 5I2XA 2GVBA 1MSHA 3FMCA 2CQAA 3K7AH 2RDFA 5G3LF 2K50A 3VA5A 4L5QA 3T13A 2BE5D 1U4PA 1SAPA 4NW2A 2K1BA 1HJPA 1H9SB 1Q8IA 4DUYL 4J6HA 5E3FA 3KJPA 1YITA 2NN6H 4LFCQ 3DHQA 5M9OA 1B3AA 4GLVB 4OONA 5KGUA 1TWGB 1CZGA 2Q2HA 2EZVA 2E75C 3IL8A 1RIPA 5JJIA 1BBWA 1K8GA 1TS4A 2FMMA 4FF2A 1RKNA 1X3FA 1VQBA 2XVSA 1OXTA 1SNCA 4GOPC 2B3GA 2NVTH 3NSWA 5C5LA 1P8LA 2F0VA 2L12A 4LF9L 4B3RQ 4CKCA 2KBNA 4XIGS 4KK7A 1KABA 3QIAA 4QUFA 4R4OA 1TS3A 5IP9G 2B63H 4S3SA 3TSSA 2IJ0A 3J80L 4JBMA 5CC4A 2A19A 3S17B 2SNSA 1CQVA 4ULLA 1Q1EA 4KKTA 5IGGA 2KCNA 4QIWB 3RLFA 1LYLA 1QNKA 2E2DC 4OO1H 1C0AA 4RA8A 1JJGA 2GVAA 1MHWC 3I4MH 2PNRC 3WDNA 1RL2A 4EX5A 4X65L 2DJFC 1STAA 2IW3A 4LF5L 1Q86C 1RCVD 5FJ8H 1TIID 1U5KA 3RN2A 3KF6A 3K0YA 4J1MA 1A3UA 2IX0A 4A3BH 3SK6A 3HP3A 1GKHA 4C3IH 4IFDH 2E76C 2Z6BA 4A3FH 4NB3A 3STBC 5C0XI 1CM9A 2EJGC 3T51B 4DPGA 1XTDA 1VMCA 3UDXA 2YTXA 1E1TA 5M5YH 3D0FA 3GV3A 5LMUL 3R93A 1XNQL 4PMBA 3OW7A 1C8CA 1HR0L 4G57A 1J6QA 4A4IA 5FK9C 5LMNQ 3I73A 5FLMG 5CYUA 4GNXC 1K0RA 5CV7A 4DV0L 2I5LX 3TP6A 4HJ5A 1Y1WG 1BBUA 3L0OA 1ZEQX 1UNSA 4LMQD 3J81E 3H0GH 2WKDA 1HNWL 3MVVA 2QDBA 1STBA 5JPNC 1ZYRD 3W3AA 3KF8B 3ULPA 2EY6A 5IWAQ 4PV1C 2X6LA 1SFOB 2Q8RE 3D4RA 3KUPA 1GXDC 4LWCA 3GTQB 1Y1WB 1SYGA 2E2HH 2K5HA
chains in the Genus database with same CATH topology
4C1NI 2MUYA 1TT2A 4B08A 5IODA 1QWYA 2K33A 2HUGA 4KKSA 1TWAB 2QILA 3Q23A 1GUNA 1M8AA 1XTCD 1TU2B 4ZUIA 2A74C 4E6IA 2O2LD 3G7LA 5M5XB 1I50B 5I2YA 3ERQA 3E6ZX 1BDOA 2L1BA 2F0IA 1JC7A 5M3FB 4DU9A 1BBXC 1KNAA 1X3QA 2NUCA 2ZXOA 3TP8A 5ELFA 3TDQA 2C9OA 2Z4HA 1PYWD 5C4JB 2NVXB 1GUGA 5K5PA 2VNUD 1A2TA 3BZDB 4BS9A 2F0MA 1FNUA 5F2DA 2DN8A 1GHKA 2IWHA 5KNDA 1DD2A 3D31A 1VF5C 3ONAB 2XWBB 4HCSA 4K14A 4IQZA 2EXZA 4FF4A 1VDZA 3CU7A 1O80A 4IFDI 2XIWA 1ENAA 2BDNA 4HCEA 4RAUC 4CKBA 2RKSA 3QOLA 5D65A 3FRPB 2EVBA 4RCOA 1FNVA 2JXMB 4XQNA 4IUQA 1DONA 1HA5A 3NWSA 2JA6B 1QG7A 3GTGB 3GTLB 1SJHD 5K36G 5I9OA 3A56A 1TY2A 3NTIA 2NBFA 4KKUA 2X69A 3L9AX 2R93B 4DK1A 4FF3A 5J39A 1EYCA 1EIGA 1W6KA 4KD4A 1QNUA 1EY0A 4R8NA 2R7ZB 4I7ZC 2R3ZA 3OOCA 3SR1A 3FPPA 1WTRA 4EQNA 5C6AA 1HQMC 1YNND 4IFDJ 4HTHA 4UDUC 3BYTB 2KQ3A 2EYMA 5CV8A 4CKEA 2BA1A 4RGTA 3Q24A 2F0WA 1LTRD 1Y8PB 2B2WA 1I4QA 3D4DA 4MIUA 4XT3B 3LNNA 2F0EA 2L9HA 2G9HD 2PZUA 4FF1A 2SEBD 4KY5A 1MSGA 2G9DA 1W6JA 3GTJB 4K8IA 2HDMA 5ELEA 1D1IA 2F0DA 5HURA 4C3JG 4FXDA 3HS0C 2F0LA 1EOTA 1CI3M 2CW0D 3EJIA 5FO9B 3ND9A 2NN6G 5KYIA 1CHPD 4A93B 1K8MA 1NCVA 4C3JB 3O13A 3OSOA 1TS2A 4NDXA 1RHPA 3GQBA 4K5WA 1D2BA 3K7AB 2JE6I 1WTPA 4V190 4ME5A 2VB2X 3H94A 4FXGC 4CGYB 4ZYSA 3EVQA 1BCPF 3GO5A 2RQXA 2A6HD 1ESFA 1STGA 3NHHA 3MFGA 3SK4A 5I6WA 3FDTA 4K5VA 3ITPA 3QB3A 2EY5A 1IW7D 3V05A 2NVTB 1S5CD 1G2TA 3A8KE 1RF2D 2MGSA 4OO1G 5D3IB 2B63B 3PIP3 4PQXA 3C1EA 4RGNA 2EYLA 4FVMA 2F0FA 5KRUA 4ZQ3A 3H09A 1Z7TA 2NYZD 2EYOA 4L63B 4X3SA 1IYVA 4KD3A 2WINB 1LT6D 4C3IG 4IFDG 3WOEA 4OIKA 3LWUA 2F03A 3I4MB 3QG1A 3JAML 1JCKB 2WIIB 2KA7A 1BCPC 3SVMA 1ONLA 4M8AA 3C46A 4F88A 1O7YA 3HGBA 3MZ5A 3VR3A 1Y69U 3K5NA 1LV9A 2A68C 4A3BB 2HQEA 5JEAH 3NK9A 4C3IB 1JWMD 1PTOH 1RJTA 4UAIA 3R2IA 4EVOA 4I65A 5M5YB 2QCPX 2ID0A 1IHZA 1JWSD 1G6ZA 2BA0A 5IGCA 1SXTA 2WB1B 1SYDA 2EYFA 3H0GB 1XWEA 4BWGB 1B2TA 2XN9C 2BDOA 3J80E 1PLFA 5E4WC 1OXSC 2KEEA 1EY9A 2E2HB 3MWYW 1TY0A 1QE6A 5D14A 2KJXA 4K6LA 3S1NB 1FYCA 3HOYB 4EQPA 4AYBB 1VF7A 1OXVA 3NPPA 1LTBD 1LTGD 1EIHA 4KN4C 5I9PA 3CKIB 5DEHA 3U9OA 4J8QA 2D9UA 1ESRA 1JOOA 5BN5A 2Z8LA 3QOJA 5C4HA 3VR6A 1S5FD 5CV6A 5C5MA 1HRJA 2JEAI 1UAPA 1PRTD 2NWGA 1SJED 1O7ZA 2PZWA 4RKLA 3NWTA 1EU4A 2ZXRA 1EFID 1OO9B 1PFMA 3K5LA 2B2VC 1JWUD 1H9JA 1ICWA 4HSPA 4NKLA 3FEWX 1A3VA 2OT2A 1HTLD 1I6HB 4BY1B 1STNA 4Q5VA 4A3IB 2B8GA 2F4IA 1V8QA 3KBGA 2ENBA 5EKLA 3NBIA 4ILWA 5JOBA 1UEAB 3VYRA 1JQYD 1V1PA 1KLGD 4DA2A 2PZTA 3Q22A 4JK1C 1JE4A 1HUMA 1EY7A 3G6JB 1SYFA 2NVQB 3CQZB 4EGVA 4H0LC 1TKWB 1FNWA 1ZXTA 3P7JA 5IOCA 4H7BA 1LT5D 1V1OA 4DK0A 5J22A 1AP0A 4L8JA 4BBSB 2F0HA 2KOLA 1RD9D 2MJ8A 1CK1A 5IT9L 2XRQD 3S2HB 3GP7A 2B39A 1JB3A 2EJFC 3OHXC 3I4LA 2WV6D 4LJZC 2E2JB 5ELCA 1STYA 3R2TA 4CJ0B 2H4OA 2Q8IB 5CORA 4F8MA 1PZID 3MHBA 2IX1A 2AQ1B 4KI0A 2F0KA 1R4QB 3K59A 5IGEA 1EY6A 4X3KA 5M5WB 5KIXA 2KUMA 4IALA 4KJOA 2O5JC 5JJZA 1YNJD 5FLXL 5JEAJ 3PV0A 3H91A 2QKIC 2R6GA 4QF4A 1RTNA 1R9TB 3S1MB 2ICIA 3I3CA 2Y0SB 1M4VA 2PQEA 3HOXB 5CV4A 4HN7A 2LKVA 3GV6A 1EQVA 4C3HG 5DNFA 3KLSX 2SDFA 1EYAA 3PUYA 3NQTA 3L3OC 4U673 3HOUB 4G7OC 5C3XA 1VMPA 2YYZA 4XXEA 2NN6I 4FO2A 1E2ZA 3A55A 3OMGA 1G2SA 1WTVA 1YNNC 5EBCA 4RFBA 2XRSD 2OXPA 3PO3B 1FD7D 1A15A 3D4WA 1K83B 3EFXD 2VB3X 4BY7B 3A7AB 1SNQA 1SE4A 2RBMA 2NTSA 1DOMA 3DUZA 2KEDA 3DEPA 3ND8A 4KHZA 2B2YC 1G8ZD 2V4DA 4OO1I 1OXUA 1KDBA 3GTKB 3R3OA 3BDLA 2ZXPA 2KCCA 5EPJA 1Y8OB 4XYOA 1J9OA 1F9SA 3D8GA 1AEXA 1TWFB 4P2CB 2CW0C 1BNZA 3PUZA 2M00A 4FYDA 5M3MB 5LL6S 1WCMB 5JEAG 1PTOF 3S1RB 3P1HA 1KDAA 4OHJA 1NSNS 5E1FA 1HQRD 2FINB 5G3LD 2A6ED 4PMCA 5A2QL 1RTOA 4OGQC 4CJ1B 3TN2A 1XXGA 1KTKA 3HOVB 1L0YB 4KHVA 2PW7A 4HAEA 3WOFA 2A6HC 1PTOB 5FKAC 4B9WA 1SNMA 4A3GB 1D5XC 1G91A 5EPLA 3PIO3 2AQ2B 1SMYC 1CZWA 2CVRA 2F0NA 5DM63 1I4HA 4RWSC 4K2LA 3M4OB 1K8OA 5EGTA 2A69C 5I6YA 3NP8A 1QJOA 1PTOC 1EQTA 4DAYA 1Q90A 4KMUC 2AWNA 3KBXA 3KLSA 4ID6A 3S9WA 4BBRB 5C44B 3I70A 5ELBA 1TR5A 4RHRA 2IPKD 1F2MA 4DAPA 2LFNA 5LL6X 3JAME 2F3VA 3Q0AA 4C56C 5C4ZA 4A3DB 1HXYD 1HFNA 1PFNA 4O42A 4A3KB 2K01A 4FP5D 2MP1A 3IFTA 4DN4M 1Q12A 1LT3D 3J7YW 2FMCA 1AFPA 2OF1A 1HTPA 2C5CA 3C1FA 3HKZB 3FPUB 1IYUA 2K28A 1EY5A 4FXKC 4FNFA 1PDQA 2QEJC 3M3YB 2RSNA 4IZ8A 4RH6A 2EE1A 2ICEC 1MBYA 3D3RA 1QOHA 4MHEA 1DJRD 2D62A 3MXUA 4RKBA 1EWCA 4WRDA 3T53B 3DEOA 3GTMB 2JA8B 3T16A 3MXGA 4ZK9B 4ZAIA 1LTID 1L0XB 2JA5B 1GOZA 4Q0FA 4U68A 1WD1A 3R8BA 1LO5D 2F3WA 1X32A 3HOZB 3NUCA 1S5ED 1GUSA 2VXWA 3S16B 1Y1VB 3GTOB 3MXNA 4Y7NB 4WJWA 1A3TA 1CTMA 1E2VA 2KHSA 1HA6A 2EPBA 1TS5A 5KNBA 2F0SA 3LX0A 1U4MA 2B2VA 3HEJA 2PPBC 1HCZA 2BE5C 3GTPB 4TKOB 1F2ZA 2AWOA 2SOBA 4R9WA 2B2UA 2B2WC 1PMRA 5DAUA 1D5MC 2CHBD 1DM0B 3PO2B 1DXMA 1S5BD 5FO7B 5EQ0A 1SE3A 3K58A 2PMZB 5JVH3 4H44C 4KJNA 1IL8A 2I07B 1LABA 3M85A 4LAAA 3A8IE 5CGKA 1SYEA 5J1ZA 1RDPD 5IT9E 1O78A 5JVG3 5EPKA 1D5ZC 1QILA 3LWEA 1DCZA 2HDLA 2JP1A 1I6VC 4HEDA 3M7NA 1MGSA 1SNPA 1YNJC 2HCIA 1H9SA 1D6EC 2K7VA 4YIJA 5C4XB 1LTTD 4DXFA 5FLXE 5D3DA 1GHJA 4F87A 1BR9A 2EY1A 3FVQA 2LS01 4N9TA 3VYTA 2IL8A 2K5WA 3SDZA 2EOTA 1STHA 1WTQA 2K05A 2AUKA 3J7AV 2X6GA 1B53A 4A3EB 3L7ZC 2B2TC 1SE2A 3P75A 3OIPA 2F0JA 1F9PA 5BN3A 2R92B 3OPOA 1WD0A 4C2MB 1ZYRC 1CFMA 2O5IC 3SEBA 1SNDA 3D6WA 4K5XA 1GJXA 3BVGA 2B8FA 1BQQT 3BS1A 1HFGA 1EL0A 4XT1B 5JPMC 4OIJA 2N55A 2K5QA 4A3MB 4C1NK 2K03A 2ZT9C 3BVZA 3K5OA 2FHTA 4IUUA 4CJ2C 4OL7A 2RA4A 2IX3A 3P20A 1QB5D 4KTAA 1BCPD 5DM73 2EJMA 3RUZA 5T1IA 1H9KA 3EROA 1ML0D 5CBAE 5ISRA 1WTXA 3VYUA 4PNYA 2RVLA 2A68D 2VUMB 1PZJD 1F9QA 3CRLC 2AQ3B 2O4XA 4KV6A 3RZDB 1BO0A 4XYQA 4XQQA 4G7HC 3NXWA 1QCBD 4CBVA 3E0JA 3KF8A 2JA7B 2PO4A 1FR3A 1TWCB 1WTWA 1RODA 3URYA 1LTAD 5IGFA 2M2LA 3ZYYX 2LMCB 1UUPA 4Z9CB 2B2YA 5E4XA 2EY2A 1MI2A 1CA6A 2MPMA 3IKJA 4HR7B 3T56B 3MA2B 3S2DB 2QF7A 4LK1C 2A6EC 2Q8TA 4DNTB 2KECA 3FKIB 2H1EA 5CV5A 1V1PB 2L0CA 5A2QE 5JAVA 3DMUA 3GD7A 1H9RA 4GZYC 3KLRA 1CHQD 2BCOA 1PXUA 5I4DA 1B44D 1C4QA 1B9NA 1D1KA 4RGOS 2FJ2A 2F0TA 1EY8A 4ZUJA 4C3HB 2K5DA 3K57A 3UI2A 3DXJC 1WVLA 5ELDA 3RMHA 1EYDA 3HOWB 4QB4A 4ZKBB 3AB9A 3I4NB 4L6TB 1XX8A 4K6DA 2L4NA 2I46A 1E0BA 4TSSA 1TVXA 4K8JA 2F0QA 1HUNA 1SEBD 2Z4IA 4HMJA 1BXTA 2NVYB 3BG3A 3X3NA 5C3WA 4N9PA 2L5TA 2HCCA 1BOSA 2A73B 3K6OA 4HSVA 1FGBD 5EBDA 1KDCA 2DY8A 1GUOA 4WORA 2M9VA 1CQFA 5C0XJ 4B9XA 4KY6A 2DNCA 1F2YA 2XNAC 1G291 3PUWA 4H13C 1Q3LA 1ILQA 2RDGA 2BOSA 1WTOA 1ENFA 5COYA 1DZ1A 2TMPA 4EQOA 5KNCA 3E5SA 1ET6A 3MEHA 5KYLA 2JYOA 1B4OA 2K6AA 5FO8B 1VCIA 2EDGA 3V2TA 2SNMA 1V43A 4QMGA 3C2PA 4IUVA 3H3VC 2K04A 4M1UB 2NZ1D 3BVMA 1B9MA 2XWJB 2D5DA 1KLUD 2F0PA 4DAVA 2RDHA 3I8ZA 5NUCA 3M7GA 2IT1A 1C48A 4G7ZC 1LACA 1IW7C 3NTKA 1CA5A 1MD2D 3I91A 4KY7A 3TZUA 1HHVA 5A35A 2K32A 2F1MA 1KAAA 3A54A 2L11A 5AFWA 1NUCA 5TSSA 5IGBA 2EYPA 1SDFA 4HMIA 1LTSD 3J81L 2E2IB 5CMDA 3J7AF 1F9RA 2N88A 1SSOA 2WP8J 4RGMA 1JOQA 1B50A 4XDXA 4ODGA 4IN3A 1CT1D 2WACA 1AW7A 1TWHB 5CR3A 4DF7A 3HG9A 1NR2A 3NE5B 3Q6SA 2EYHA 5C3EB 3SHLA 4F7XA 3F2UA 1Z6HA 1JORA 2F0UA 3V96A 2Z1CA 1EEFD 1ILPA 1EU3A 2TSSA 3IAYA 2PYKA 5LHY1 3H6MA 2DY7A 5C0XG 3W2DA 4DFAA 1PRTF 1TQOA 5CBEE 1LLRD 4O1NA 3OWEB 4MN3A 3D6CA 1AZPA 1DYQA 3TMEA 4BA2I 5KEEA 1PZKD 3N52A 3TBIB 1B1ZA 1U9RA 4DGZA 3SE0A 3BDCA 3BDOA 2J0TD 1IKMA 4NMZA 1A6XA 5IGDA 1PRTB 1A2UA 2PCFB 1T5XD 1PFBA 3IFDA 5CV9A 3VA7A 3EA6A 3CRKC 3OIQA 5T1GA 5EKKA 4IURA 2AUJD 2F0GA 2L55A 1I3QB 2NB0A 1SYCA 4XQJA 2EYJA 4G4KA 3NBHA 2A5HA 4JBWA 3PUXA 4RHSA 1F2LA 1J8IA 3QJYA 1H9MA 4RCNA 3OWFA 3SK5A 3SXHA 1PRTC 1GUTA 4IUPA 1II3A 2MHVA 4KN7C 1S5DD 1SMYD 2RSOA 4PMWA 3SK8A 3NQIA 1DOLA 3QO2A 1BCPB 1E2WA 4IUNA 1STEA 3VR4A 5FOBB 3MC0B 2A69D 2LY7A 2R61A 2B2TA 3VR2A 2OEOA 3S15B 3OMCA 5IIFA 2KVMA 1PTOD 3A7LA 4A3JB 3RZOB 4V0BA 2WAQB 3DM1A 1ET9A 1EY4A 3M4YA 3AU7A 3MXPA 3HZXA 3DWPA 3MFYA 2YU9B 4K2KA 5BN4A 5EJWA 2NTTA 3QWNA 1LT4D 3VR5A 2DNEA 4CHTB 1I4GA 1NAPA 2GA4B 1I4XA 1ENCA 1JOKA 1DOKA 4ABNA 4A3FB 3KK7A 1SBBB 1ZKOA 1BF4A 2J7ZA 1T5EA 3I90A 3N6RA 3HRZC 4ZRZA 3TP7A 1OXXK 1EZ8A 1Z47A 3CHBD 4QCLA 2J4XA 4X3UA 5EKIA 4X3TA 1R4PB 2F0OA 3X3MA 2JEBI 3S1QB 1SNOA 2JSOA 1HPCA 3S14B 5K36H 5HGTA 4TQUS 3BYYB 4TRDA 4R8IA 1U4RA 1AZQA 3NTHA 1EWHA 4DXGA 2WKCA 3AMUA 2XSCA 3MAQA 3TZDA 1S4ZA 4DNRB 3DWQA 1F77A 1U4LA 1JICA 1IKLA 4QUCA 4ZKCB 1EEID 2E74C 3MTSA 3A8JE 3PMFA 1BUVT 1EZ6A 1I4PA 3I72A 1O7LA 3PUVA 5C0XH 1XYIA 3EQLC 4IUTA 4NP5A 4XTCS 2D2CC 1NR4A 4ZLTF 3T4AC 1SYBA 3U9SA 2FFKB 2B2UC 3TP5A 1GUWA 1AN8A 3DWAA 1Q1BA 4BA1I 1X3PA 3K5MA 4WFN3 1JR0D 1I4RA 1KNEA 3C3LA 3VYSA 1Y8NB 3RD4A 2PW5A 5I2XA 1MSHA 3FMCA 2CQAA 2RDFA 5G3LF 3VA5A 3T13A 2BE5D 1U4PA 1SAPA 4NW2A 2K1BA 1H9SB 1Q8IA 4J6HA 5E3FA 2NN6H 3DHQA 5M9OA 1B3AA 5KGUA 1TWGB 1CZGA 2EZVA 2E75C 3IL8A 1TS4A 2FMMA 4FF2A 1RKNA 2XVSA 1OXTA 1SNCA 3NSWA 5C5LA 2F0VA 2L12A 4CKCA 4XIGS 4KK7A 1KABA 3QIAA 4QUFA 1TS3A 4S3SA 3TSSA 2IJ0A 3J80L 5CC4A 3S17B 2SNSA 1CQVA 4ULLA 1Q1EA 4KKTA 5IGGA 2KCNA 4QIWB 3RLFA 2E2DC 1QNKA 4OO1H 4RA8A 2PNRC 3WDNA 1STAA 2IW3A 1RCVD 1TIID 3K0YA 4J1MA 1A3UA 2IX0A 3SK6A 3HP3A 4IFDH 2E76C 5C0XI 1CM9A 2EJGC 3T51B 1VMCA 3GV3A 3R93A 4PMBA 3OW7A 1C8CA 4G57A 5FK9C 3I73A 5CYUA 5CV7A 3TP6A 1ZEQX 1UNSA 4LMQD 3J81E 2WKDA 3MVVA 2QDBA 1STBA 5JPNC 1ZYRD 3W3AA 2EY6A 4PV1C 2X6LA 1SFOB 2Q8RE 3D4RA 3KUPA 1GXDC 3GTQB 1Y1WB 1SYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HGT A;  1KDA A;  4KY6 A;  3OSO A;  1NSN S;  4NDX A;  2PZT A;  2EYH A;  1IHZ A;  1F2Y A;  1F2Z A;  1SNC A;  1TT2 A;  2F0J A;  2SOB A;  3P75 A;  4TRD A;  3SHL A;  4F7X A;  5IOD A;  5C5L A;  2OF1 A;  2F0V A;  1EYA A;  1EY7 A;  4ME5 A;  5IGC A;  5DAU A;  3C1F A;  4PMC A;  1JOR A;  1KAB A;  1SYF A;  2F0U A;  1SYD A;  5I9O A;  3SK8 A;  2EYF A;  3NQT A;  4KHV A;  5CV5 A;  2PW7 A;  4J1M A;  1EY5 A;  3P1H A;  4IUN A;  4S3S A;  5JAV A;  3DMU A;  4KJN A;  4H7B A;  5IOC A;  5J22 A;  1SND A;  5C3X A;  4EQO A;  3EVQ A;  4B9W A;  4K5X A;  3E5S A;  2PYK A;  4ZUI A;  4LAA A;  1STG A;  3NHH A;  3MEH A;  5CC4 A;  5J39 A;  1EYC A;  2SNS A;  1SNM A;  3H6M A;  4E6I A;  5CGK A;  1SYE A;  2F0H A;  5KYL A;  2OEO A;  4KD4 A;  3SK4 A;  3V2T A;  3OMC A;  2SNM A;  3ERQ A;  5I6W A;  5IGG A;  5IIF A;  1EY0 A;  4QMG A;  3OMG A;  1EY9 A;  4R8N A;  4DFA A;  4K5V A;  3ITP A;  1TQO A;  5J1Z A;  3SR1 A;  3QB3 A;  2EY5 A;  2F0I A;  4IZ8 A;  3PMF A;  2F0N A;  4EQN A;  4DU9 A;  1EZ6 A;  4EQP A;  5C6A A;  1EY4 A;  2F0T A;  3D6C A;  1EY8 A;  4HTH A;  2F0P A;  3MXP A;  2OXP A;  2NUC A;  4K2L A;  4RKB A;  3HZX A;  4ZUJ A;  4WRD A;  3TME A;  5KEE A;  2KQ3 A;  5EGT A;  3TP8 A;  4K2K A;  4NP5 A;  1STY A;  3D4W A;  4OL7 A;  1U9R A;  5NUC A;  1STA A;  4DGZ A;  5DEH A;  2EYM A;  5I6Y A;  3T16 A;  5I9P A;  4F8M A;  5CV8 A;  3U9O A;  3BDC A;  3C1E A;  5K5P A;  3NP8 A;  4NMZ A;  4KTA A;  1A2T A;  5IGD A;  1JOO A;  1A2U A;  1A3U A;  2EYL A;  1SNQ A;  1SYB A;  2F0M A;  2F0W A;  2F0F A;  3ERO A;  3MHB A;  5CV9 A;  5F2D A;  2RBM A;  3SK6 A;  4ZQ3 A;  3QOJ A;  3TP5 A;  1EYD A;  5KRU A;  2F0K A;  5C4H A;  5ISR A;  5CV6 A;  5C5M A;  3D4D A;  4MIU A;  4PNY A;  1EY6 A;  5EKK A;  5IGE A;  1SNP A;  4QB4 A;  5KIX A;  2F0E A;  1ENC A;  1JOK A;  4ID6 A;  3S9W A;  4KY7 A;  4IAL A;  4KJO A;  2EYO A;  2F0G A;  2PZW A;  4KD3 A;  2F3W A;  2PZU A;  4K14 A;  4RKL A;  4K6D A;  2O4X A;  4YIJ A;  4PMB A;  1SYC A;  1KAA A;  2EXZ A;  4KY5 A;  4K5W A;  4KV6 A;  3SXH A;  2PW5 A;  4G57 A;  4K8J A;  1TR5 A;  2F0Q A;  2EYJ A;  1NUC A;  3NXW A;  5IGB A;  2EYP A;  3NUC A;  2EY1 A;  2RDF A;  1F2M A;  4HMJ A;  1ENA A;  4HMI A;  4NKL A;  4K8I A;  5CV7 A;  3T13 A;  3TP7 A;  3VA5 A;  4N9T A;  4QF4 A;  1KDB A;  1A3V A;  3R3O A;  3BDL A;  3TP6 A;  2F0D A;  1EZ8 A;  3MZ5 A;  5HUR A;  2F3V A;  5C3W A;  4J6H A;  4N9P A;  5E3F A;  5E1F A;  5C4Z A;  5IGF A;  1A3T A;  1STN A;  3D8G A;  1STH A;  2RKS A;  1AEX A;  2F0L A;  2HQE A;  3MVV A;  3DHQ A;  2KHS A;  3OWF A;  3NK9 A;  3SK5 A;  3QOL A;  2QDB A;  1STB A;  5M9O A;  5KGU A;  2F0O A;  2PQE A;  2ENB A;  5EKL A;  1JOQ A;  4ODG A;  5CV4 A;  1SNO A;  2LKV A;  2EY6 A;  3EJI A;  1KDC A;  5JOB A;  1EQV A;  2WAC A;  4WOR A;  2M00 A;  2EY2 A;  4EVO A;  4I65 A;  5CR3 A;  3RUZ A;  4DF7 A;  5KYI A;  2F0S A;  1RKN A;  3LX0 A;  3HEJ A;  4B9X A;  1SYG A;  1II3 A; 
#chains in the Genus database with same CATH topology
 4C1N I;  1JT8 A;  2MUY A;  1TT2 A;  4B08 A;  3S1N H;  2CFM A;  5IOD A;  3LGJ A;  3HOY H;  4BY7 G;  3NEL A;  1N8R C;  1QWY A;  2K33 A;  3NEN A;  2HUG A;  4KKS A;  1TWA B;  2QIL A;  3Q23 A;  3NEM A;  1GUN A;  1M8A A;  1XTC D;  5M3F G;  1VQF A;  1PH2 A;  1N34 L;  1X9N A;  1N36 Q;  1TU2 B;  4ZUI A;  2A74 C;  2VZA A;  1K28 A;  4E6I A;  1EWI A;  2O2L D;  3G7L A;  5M5X B;  1I50 B;  5I2Y A;  1FJG Q;  3ERQ A;  3E6Z X;  1BDO A;  2L1B A;  1NJI C;  1UE5 A;  2F0I A;  1JC7 A;  5M3F B;  4YWM A;  4NPS A;  3UDI A;  4DU9 A;  1BBX C;  3F8T A;  2Z6K A;  1CUK A;  1KNA A;  1X3Q A;  3Q8D A;  5IYD G;  4NXM L;  2NUC A;  2C35 B;  2ZXO A;  4JI6 L;  1VQ9 A;  4JI3 L;  3TP8 A;  4EQ5 A;  5ELF A;  4B3S Q;  3TDQ A;  5GRO A;  2C9O A;  2Z4H A;  1PYW D;  5C4J B;  4JI2 Q;  2NVX B;  3WWV A;  1GUG A;  4JI8 L;  5K5P A;  1MJE A;  1I6H H;  2VNU D;  1A2T A;  4BY1 H;  2ATW A;  3BZD B;  2WFW A;  2F0M A;  4BS9 A;  1FNU A;  5F2D A;  1L1O A;  2DN8 A;  4JI1 Q;  1QVG A;  1GHK A;  2IWH A;  4A3I H;  5KND A;  1XPU A;  1DD2 A;  3D31 A;  1VF5 C;  3ONA B;  2XWB B;  4HCS A;  1V9P A;  1UE6 A;  3F2D A;  4K14 A;  4IQZ A;  3HOV G;  2EXZ A;  5GAE C;  4FF4 A;  1VDZ A;  3CU7 A;  1O80 A;  4IFD I;  2XIW A;  1ENA A;  1JMC A;  2BDN A;  4HCE A;  4RAU C;  2NVQ H;  4OWW B;  3CQZ H;  4CKB A;  4R1J A;  3HKS A;  2RKS A;  3QOL A;  5D65 A;  1PFS A;  1D7Q A;  1SMX A;  4YCU A;  4BBS H;  1B70 B;  3FRP B;  2EVB A;  4RCO A;  2MNA A;  1FNV A;  1EOV A;  1PYB A;  2JXM B;  4XQN A;  3H15 A;  2R93 G;  4IUQ A;  4GKK L;  2F4V L;  2CH4 W;  1DON A;  1HA5 A;  3NWS A;  2YTV A;  2JA6 B;  1QG7 A;  3GTG B;  3GTL B;  1SJH D;  5K36 G;  2R7Z G;  4JYA Q;  4KLK A;  5I9O A;  3A56 A;  1TY2 A;  2E2J H;  3NTI A;  2Q2U A;  2NBF A;  4DV2 L;  2HIV A;  4KKU A;  2X69 A;  1K9M C;  3L9A X;  2R93 B;  4DK1 A;  4FF3 A;  1VS0 A;  5J39 A;  1EYC A;  1QUQ A;  3CCV A;  5C44 G;  3I55 A;  1EIG A;  1W6K A;  4KD4 A;  1QNU A;  1EY0 A;  5M5W H;  4IPH A;  4IPC A;  4R8N A;  4I7Z C;  2R7Z B;  2R3Z A;  3OOC A;  3SR1 A;  2VW9 A;  3FPP A;  4RG1 A;  1WTR A;  4EQN A;  5C6A A;  1HQM C;  1YNN D;  4IFD J;  4HTH A;  4YWL A;  2UU9 L;  1A63 A;  4A3K G;  4GS3 A;  5ELN A;  4AH6 A;  4UDU C;  3BYT B;  3JAM i;  2KQ3 A;  1R9T H;  2EYM A;  5CV8 A;  4CKE A;  3S1M H;  2BA1 A;  3UDF A;  4RGT A;  4R4Q A;  3Q24 A;  2F0W A;  3E0E A;  1LTR D;  1Y8P B;  2B2W A;  1I4Q A;  3D4D A;  4MIU A;  4XT3 B;  3HOX H;  3LNN A;  2F0E A;  4AQY Q;  1EIY B;  2L9H A;  2G9H D;  4DNI A;  2IHF A;  2PZU A;  5AJ3 L;  2YTY A;  4FF1 A;  1NE3 A;  2SEB D;  4KY5 A;  2OCE A;  1MSG A;  2G9D A;  1QZG A;  1W6J A;  3GTJ B;  4X65 Q;  4K8I A;  2HDM A;  5ELE A;  1D1I A;  4A93 G;  1YJW A;  4LF5 Q;  2F0D A;  5HUR A;  4C3J G;  4FXD A;  3HS0 C;  3E9I A;  3HOU H;  2F0L A;  4QGU A;  1EOT A;  1D8L A;  1CI3 M;  5JJL A;  4K0K L;  2RCN A;  2NZH A;  2CW0 D;  1X65 A;  3EJI A;  5FO9 B;  3ND9 A;  2NN6 G;  5KYI A;  4GN5 A;  1CHP D;  2XTI A;  4PZ6 A;  4POF A;  4A93 B;  1K8M A;  1XNQ Q;  4X64 L;  1PH3 A;  1NCV A;  4C3J B;  1HR0 Q;  3O13 A;  3OSO A;  1TS2 A;  4NDX A;  1RHP A;  3GQB A;  3AQQ A;  4K5W A;  3ULL A;  3CMA A;  1D2B A;  3K7A B;  2JE6 I;  1WTP A;  2LSS A;  4P72 A;  4V19 0;  5GAH C;  2R7F A;  4ME5 A;  2ZTD A;  2VB2 X;  3H94 A;  2PMZ E;  2JA5 G;  3PO3 H;  1IZ6 A;  4FXG C;  3CC7 A;  1L0W A;  1A0I A;  4RMF A;  4CGY B;  1K83 H;  3CAM A;  1HNW Q;  1K3R A;  4ZYS A;  3EVQ A;  1BCP F;  3TRE A;  3GO5 A;  4BY7 H;  2RQX A;  2A6H D;  3OYY A;  1ESF A;  1STG A;  3NHH A;  4OEL B;  1B7Y B;  3MFG A;  1NMF A;  4JPB W;  4GN3 B;  2B63 G;  3SK4 A;  5I6W A;  4H02 A;  3FDT A;  4K5V A;  3ITP A;  2DJG C;  3JC6 6;  3QB3 A;  2EY5 A;  1VQI A;  1IW7 D;  3V05 A;  2NVT B;  1Y1V G;  1S5C D;  1G2T A;  3A8K E;  1RF2 D;  2VL6 A;  4ALP A;  1ASY A;  2MGS A;  1N33 Q;  1QZH A;  3BZC A;  2KHJ A;  5D3I B;  4TVA B;  4OO1 G;  2B63 B;  3PIP 3;  3GTK H;  4PQX A;  3AFP A;  3C1E A;  2EXD A;  1N34 Q;  4RGN A;  1VQO A;  4GLA C;  2EYL A;  3I4M G;  4FVM A;  2F0F A;  1VQG A;  5KRU A;  1TWF H;  4ZQ3 A;  3H09 A;  3CCL A;  1Z7T A;  4J15 A;  3J7Z C;  2NYZ D;  5FJ8 G;  2EYO A;  4L63 B;  4X3S A;  1IYV A;  4KD3 A;  2WIN B;  5M3M H;  4A75 A;  1WCM H;  3S1R H;  1LT6 D;  4C3I G;  4IFD G;  5LMN L;  3WOE A;  1VQL A;  4OIK A;  3LWU A;  2F03 A;  3I4M B;  3QG1 A;  3JAM L;  1JCK B;  2WII B;  2KA7 A;  1BCP C;  3SVM A;  4YCV A;  4DV3 L;  1ONL A;  4M8A A;  3C46 A;  4F88 A;  1YHQ A;  1O7Y A;  3HGB A;  1WJJ A;  3MZ5 A;  3BU2 A;  3VR3 A;  3HOV H;  1Y69 U;  3K5N A;  1LV9 A;  2A68 C;  4A3B B;  2HQE A;  5JEA H;  3PF4 A;  3NK9 A;  4C3I B;  1JWM D;  1NNX A;  1PTO H;  2WB1 G;  3NBH B;  1RJT A;  4UAI A;  3TQY A;  2MQH A;  3R2I A;  3CCU A;  4A3G H;  1S72 A;  4HJ9 A;  2MO0 A;  3H0G G;  4EVO A;  4I65 A;  4LFA L;  5M5Y B;  5IYB G;  3L2P A;  2QCP X;  3PF5 A;  2ID0 A;  1IHZ A;  1JWS D;  2UUC L;  3AFQ A;  1G6Z A;  1CKN B;  3AYH B;  2BA0 A;  1Q8K A;  1SXT A;  2WB1 B;  5IGC A;  3M4O H;  1SYD A;  2HHH L;  2EYF A;  3H0G B;  4YY3 L;  3HOY G;  2QA4 A;  1XWE A;  4O0A A;  4BWG B;  3HFZ B;  1B2T A;  2XN9 C;  3MXN B;  2BDO A;  3J80 E;  1PLF A;  3FP9 A;  1VQ4 A;  5E4W C;  4P71 A;  1OXS C;  2KEE A;  1EY9 A;  2E2H B;  3MWY W;  3FHW A;  1TY0 A;  1QE6 A;  5D14 A;  1KRS A;  2KJX A;  4GKK Q;  4K6L A;  2F4V Q;  3S1N B;  1FYC A;  3HOY B;  4EQP A;  4BBR H;  1HZA A;  4OWX B;  3J81 c;  5C44 H;  1XMQ Q;  4AYB B;  1CSP A;  1VF7 A;  1OXV A;  4JI2 L;  3NPP A;  4YWK A;  1LTB D;  1LTG D;  2PQA A;  4DV2 Q;  1EIH A;  4KN4 C;  5I9P A;  3CKI B;  4ME3 A;  5DEH A;  4JVZ A;  4A3E G;  1MIU A;  1FGU A;  2NZO A;  3U9O A;  4J8Q A;  4JI1 L;  2D9U A;  4A3D H;  1ESR A;  1JOO A;  5BN5 A;  3EN2 A;  4A3K H;  1O7I A;  4X66 L;  2Z8L A;  3QOJ A;  5C4H A;  3VR6 A;  4LF4 L;  1S5F D;  5CV6 A;  5C5M A;  1HRJ A;  2JEA I;  1UAP A;  2JJQ A;  1PRT D;  2NWG A;  1SJE D;  1O7Z A;  2PZW A;  4RKL A;  3NWT A;  1EU4 A;  2ZXR A;  1EFI D;  2UXC L;  2UU9 Q;  1OO9 B;  2P5Z X;  1PFM A;  3K5L A;  2B2V C;  1JWU D;  1H9J A;  1ICW A;  4HSP A;  4NKL A;  3FEW X;  1A3V A;  1FVI A;  2OT2 A;  1HTL D;  1PH6 A;  1I6H B;  4BY1 B;  1STN A;  4Q5V A;  3K8A A;  4A3I B;  2B8G A;  2F4I A;  1V8Q A;  3KBG A;  2ENB A;  1SRO A;  5EKL A;  3NBI A;  4ILW A;  5JOB A;  1UEA B;  3VYR A;  4C3J H;  1JQY D;  4QIW E;  5AJ3 Q;  4JG2 A;  2UXD L;  1V1P A;  4GNX A;  1KLG D;  2L15 A;  3M3Y H;  4JBJ A;  4DA2 A;  2PZT A;  3Q22 A;  4JK1 C;  1VQH A;  2I0Q A;  4BBS G;  4JYA L;  1JE4 A;  1HUM A;  1EY7 A;  1YZ6 A;  3G6J B;  1SYF A;  2NVQ B;  3CQZ B;  1NTG A;  4EGV A;  4LUV A;  1X3E A;  4H0L C;  1TKW B;  1FNW A;  1ZXT A;  3GTM H;  3P7J A;  4MTN A;  2JA8 H;  5IOC A;  4H7B A;  1LT5 D;  1V1O A;  4DK0 A;  5J22 A;  4K0K Q;  3KLW A;  1AP0 A;  4L8J A;  2JA5 H;  4BBS B;  2F0H A;  2KOL A;  1RD9 D;  4CDD C;  2MJ8 A;  3CP0 A;  4X64 Q;  1CK1 A;  5IT9 L;  4IJL A;  2XRQ D;  4JI4 L;  5J3B A;  3S2H B;  3GP7 A;  2B39 A;  4JI7 L;  1JB3 A;  2EJF C;  2Z0S A;  3OHX C;  3HOZ H;  4DR4 L;  3I4L A;  2WV6 D;  4LJZ C;  2E2J B;  5ELC A;  1STY A;  3R2T A;  4CJ0 B;  2H4O A;  2Q8I B;  5COR A;  4F8M A;  5BR8 L;  3S16 H;  4OX9 L;  1Y1V H;  3GTO H;  1PZI D;  4Y7N H;  2PI2 A;  3A74 A;  3MHB A;  2IX1 A;  2AQ1 B;  4KI0 A;  4AQY L;  2F0K A;  1R4Q B;  3K59 A;  5IGE A;  3CXC A;  1EY6 A;  4X3K A;  3CPW A;  5M5W B;  5KIX A;  1VQN A;  3CC2 A;  2PI2 E;  2KUM A;  4IAL A;  4KJO A;  2O5J C;  5JJZ A;  1YNJ D;  4HJ7 A;  5FLX L;  2Y0S G;  2DUD A;  5JEA J;  3PV0 A;  3HOX G;  3GTP H;  3H91 A;  2ASB A;  4A76 A;  4P74 A;  2QKI C;  2R6G A;  4QF4 A;  1RTN A;  1R9T B;  3PO2 H;  3S1M B;  2Q2T A;  2ICI A;  3I3C A;  1VQP A;  2F3I A;  5E7N A;  1WI5 A;  2Y0S B;  3ICE A;  3M9B A;  1M4V A;  3CME A;  2PQE A;  3HOX B;  2QDL A;  5CV4 A;  4HN7 A;  2LKV A;  3GV6 A;  1EQV A;  1WTH A;  3UDG A;  4C3H G;  2AMC B;  3HOU G;  1U0L A;  2ALY B;  3RN5 A;  5DNF A;  3U58 A;  1PVO A;  3KLS X;  2SDF A;  3CCR A;  4O2D A;  1EYA A;  4DV3 Q;  3PUY A;  5IYB H;  5IYC H;  2QGQ A;  1YEZ A;  3NQT A;  1E22 A;  3L3O C;  3CPF A;  4U67 3;  3HOU B;  4G7O C;  4OEM B;  5C3X A;  3PO3 G;  4DK3 C;  1VMP A;  2YYZ A;  4XXE A;  4LF6 L;  4LFA Q;  4X62 L;  2NN6 I;  1HNZ L;  4FO2 A;  1E2Z A;  3A55 A;  3OMG A;  1VQ5 A;  1G2S A;  1IYJ B;  1WTV A;  2UUC Q;  4UPA A;  1YNN C;  5EBC A;  1GD7 A;  4RFB A;  1N32 Q;  2XRS D;  5C4X H;  4DUZ Q;  1N33 L;  2OXP A;  3PO3 B;  2BH8 A;  1FD7 D;  2A1A A;  2JQO A;  2HIX A;  2HHH Q;  1A15 A;  2CCZ A;  3D4W A;  1K83 B;  1YNX A;  4YY3 Q;  3EFX D;  2VB3 X;  4BY7 B;  3A7A B;  1FL0 A;  1KC8 C;  1SNQ A;  4DV6 L;  1SE4 A;  2RBM A;  1A62 A;  4JV5 L;  2NTS A;  1DOM A;  3DUZ A;  4CDC C;  4A3E H;  4JW0 A;  2KED A;  3DEP A;  3IRB A;  2LXK A;  3ND8 A;  4KHZ A;  3KF6 B;  2B2Y C;  4LUZ A;  1G8Z D;  1K3B C;  4MZ9 A;  3U50 C;  2V4D A;  1G6P A;  1PH9 A;  1CSQ A;  1OXU A;  4OO1 I;  5M3M G;  1KDB A;  3GTK B;  1WCM G;  3R3O A;  3BDL A;  2R92 H;  2ZXP A;  2KCC A;  1YHA A;  5EPJ A;  1Y8O B;  4XYO A;  1J9O A;  4C2M H;  4KHP Q;  1F9S A;  3D8G A;  1AEX A;  4DR5 L;  1TWF B;  4P2C B;  4X66 Q;  2CW0 C;  4LF4 Q;  1BNZ A;  2UXB L;  3ULJ A;  5GAD C;  2CQO A;  3PUZ A;  2M00 A;  4FYD A;  5M3M B;  5LL6 S;  1WCM B;  4A3L H;  5JEA G;  1PTO F;  3S1R B;  4NXN L;  3P1H A;  1EQR A;  2UXC Q;  1KDA A;  4OHJ A;  1NSN S;  1HQR D;  5E1F A;  1GVP A;  2RHS B;  4IPD A;  4QL5 A;  2FIN B;  4A3G G;  1Z9F A;  5G3L D;  2A6E D;  1VQ6 A;  1X6O A;  4UP9 A;  4A3M H;  4PMC A;  5A2Q L;  1RTO A;  4OGQ C;  4CJ1 B;  3TN2 A;  1XXG A;  1KTK A;  3HOV B;  1L0Y B;  4KHV A;  2PW7 A;  1P16 A;  3G48 A;  4HAE A;  3WOF A;  4CDE C;  2UUB L;  2A6H C;  1PTO B;  5FKA C;  4DAM A;  1NY4 A;  4B9W A;  1SNM A;  2ZJP A;  4A3G B;  1D5X C;  1G91 A;  5EPL A;  3PIO 3;  4LNQ A;  1UEB A;  1Q82 C;  2YV5 A;  4A3C H;  1X55 A;  4DR3 L;  2UXD Q;  2AQ2 B;  1SMY C;  3S2H H;  2VUM H;  4B3M L;  1CZW A;  2CVR A;  2F0N A;  1XMQ L;  5DM6 3;  1I4H A;  3RZD H;  4RWS C;  2KCM A;  5GQO A;  4K2L A;  3M4O B;  1K8O A;  5EGT A;  1HZ9 A;  2A69 C;  2JA7 H;  4LF8 L;  1TWC H;  5I6Y A;  4BBR G;  3NP8 A;  1QJO A;  1PTO C;  1EQT A;  1W3S A;  4DAY A;  1Q90 A;  4KMU C;  1HH2 P;  2AWN A;  3KBX A;  3KLS A;  1K73 C;  1XPO A;  4ID6 A;  3S9W A;  4A3D G;  3RNU A;  1GM5 A;  1VQD A;  3TS0 A;  2OQ0 A;  1PH8 A;  4JI4 Q;  4BBR B;  2OTL A;  4JI7 Q;  3S2D H;  5C44 B;  3I70 A;  5ELB A;  1TR5 A;  1L1O B;  4RHR A;  4DR4 Q;  2IPK D;  1HNX L;  1F2M A;  1YI2 A;  4DAP A;  2LFN A;  4AIM A;  5LL6 X;  1UE1 A;  3FKI H;  3J80 c;  5BR8 Q;  2F3V A;  3JAM E;  3Q0A A;  3CC4 A;  4OX9 Q;  4C56 C;  5C4Z A;  5DLQ E;  4A3D B;  1HXY D;  1HFN A;  1PFN A;  4O42 A;  4A3K B;  2K01 A;  4FP5 D;  2MP1 A;  2Z6K C;  3IFT A;  4JC0 A;  3HKZ G;  4DN4 M;  1Q12 A;  1LT3 D;  3J7Y W;  3ER0 A;  4PG3 A;  1H95 A;  2FMC A;  3KYH C;  3KDF A;  1AFP A;  4DR2 L;  2QW7 A;  2OF1 A;  3PIP A;  1HTP A;  2C5C A;  3C1F A;  3HKZ B;  4C3H H;  1L2F A;  3FPU B;  1IYU A;  2K28 A;  1EY5 A;  4FXK C;  4FNF A;  1PDQ A;  3K7U C;  2R7D A;  5IP7 H;  2QEJ C;  4IOC A;  4JCV E;  3W5O A;  5IE8 A;  4L5S A;  2WAQ E;  1MKH A;  2JA8 G;  3HOW H;  3M3Y B;  3I4N H;  2RSN A;  4IZ8 A;  4RH6 A;  2EE1 A;  2ICE C;  1MBY A;  2A8V A;  2HT1 A;  3D3R A;  1QOH A;  4MHE A;  1DJR D;  4DV5 L;  2D62 A;  1C7Y A;  3MXU A;  1T9H A;  1EWC A;  4RKB A;  4WRD A;  3T53 B;  2UUA L;  3DEO A;  5GAG C;  2NVY H;  3GTM B;  2JA8 B;  3T16 A;  4DR6 L;  1KL9 A;  3MXG A;  1JB7 A;  4ZK9 B;  3HOZ G;  1HZB A;  4ZAI A;  1LTI D;  1L0X B;  2JA5 B;  1GOZ A;  4Q0F A;  4U68 A;  1WD1 A;  4LF6 Q;  3PGZ A;  3R8B A;  1LO5 D;  4X6A H;  4X62 Q;  1HNZ Q;  1UE7 A;  2E8G A;  1CKN A;  1YHB A;  2F3W A;  1PH7 A;  1HR0 W;  4B3T Q;  1M90 C;  3H3V H;  1X32 A;  3HOZ B;  3EIV A;  1S3O A;  3NUC A;  1S5E D;  1GUS A;  3CD6 A;  4JOI C;  2HD3 A;  2VXW A;  4L5R C;  3S16 B;  1Y1V B;  3GTO B;  3MXN A;  4Y7N B;  4WJW A;  1A3T A;  1CTM A;  4A3J G;  4DV6 Q;  3K80 C;  1EUJ A;  1XJV A;  1E2V A;  2KHS A;  2N49 A;  1HA6 A;  4JV5 Q;  3M4P A;  3PO2 G;  2EPB A;  1TS5 A;  2K14 A;  5KNB A;  2F0S A;  3LX0 A;  1U4M A;  2B2V A;  3HEJ A;  2PPB C;  1HCZ A;  2F52 A;  5H1S E;  2BE5 C;  3RLO A;  2E5L Q;  3GTP B;  4TKO B;  3F2C A;  1F2Z A;  2AWO A;  2SOB A;  4R9W A;  1XNR L;  2B2U A;  2H5X A;  2B2W C;  1XMO L;  1PMR A;  5DAU A;  1D5M C;  2CHB D;  4AYB E;  1DM0 B;  3PO2 B;  1DXM A;  1S5B D;  4POG A;  5FO7 B;  3TEH B;  5EQ0 A;  1SE3 A;  3K58 A;  2PMZ B;  5JVH 3;  4H44 C;  4DR5 Q;  4WJ3 M;  4KJN A;  1IL8 A;  2Z9H A;  2I07 B;  2UXB Q;  4BXX G;  1LAB A;  3M85 A;  4LAA A;  3A8I E;  2FXQ A;  5IYC G;  5CGK A;  1KD1 C;  1SYE A;  4DKA C;  4DR1 L;  3KJO A;  4NXN Q;  5J1Z A;  1N32 L;  1RDP D;  4DUZ L;  1LM0 A;  5IT9 E;  3OW2 A;  3F1Z A;  1SR3 A;  1E7Z A;  1O78 A;  2MFI A;  5JVG 3;  5EPK A;  1B8A A;  1D5Z C;  1QIL A;  3LWE A;  1DCZ A;  2CKZ B;  2E2I H;  2UUB Q;  5C4X G;  2HDL A;  2JP1 A;  2VQF L;  4GOP A;  3G6E A;  1I6V C;  1V1Q A;  1X54 A;  4HED A;  4DV1 L;  3M7N A;  1MGS A;  1SNP A;  4DR3 Q;  3BZK A;  1YNJ C;  1TWH H;  4B3M Q;  2HCI A;  1VQC A;  1H9S A;  1D6E C;  2K7V A;  4YIJ A;  5C4X B;  1LTT D;  4IO9 A;  4JI5 L;  4DXF A;  3TS2 A;  5FLX E;  5D3D A;  1GHJ A;  5C3E H;  4F87 A;  1BR9 A;  2EY1 A;  3I4O A;  3I7F A;  1WYD A;  1DGS A;  3FVQ A;  4LF8 Q;  2LS0 1;  4N9T A;  3VYT A;  4KHP L;  2IL8 A;  4HJ8 A;  2K5W A;  3SDZ A;  2EOT A;  1IL2 A;  1STH A;  2KCT A;  1WTQ A;  2K05 A;  2AUK A;  2R92 G;  3J7A V;  2X6G A;  4QJF A;  1B53 A;  4A3E B;  2XGT A;  3L7Z C;  3KFU A;  2B2T C;  3J81 j;  4MTK A;  1SE2 A;  1WFQ A;  4DV7 L;  3P75 A;  3OIP A;  2F0J A;  1HNX Q;  1F9P A;  1SN8 A;  2K75 A;  5BN3 A;  4A3L G;  1VQM A;  4LUO A;  2R92 B;  3OPO A;  3AEV A;  1WD0 A;  4C2M B;  1ZYR C;  1CFM A;  3CCM A;  2O5I C;  1Y14 B;  3SEB A;  1SND A;  4HIM A;  4A3M G;  3D6W A;  4K5X A;  1GJX A;  3BVG A;  2B8F A;  1BQQ T;  1BKB A;  3BS1 A;  1HFG A;  1SE8 A;  1EL0 A;  4I7A A;  4XT1 B;  5JPM C;  4DR2 Q;  1I3Q H;  4OIJ A;  2N55 A;  2K5Q A;  4A3C G;  4A3M B;  1JE5 A;  1KHI A;  3VDY A;  1J5E L;  2PNH A;  4C1N K;  2K03 A;  2ZT9 C;  3BVZ A;  3K5O A;  2FHT A;  2VUM G;  4IUU A;  4CJ2 C;  1ICF B;  3U4Z A;  4OL7 A;  3M4Q A;  2RA4 A;  3CF5 A;  4LW1 A;  2IX3 A;  3P20 A;  1QB5 D;  1AH9 A;  4KTA A;  1BCP D;  5DM7 3;  2EJM A;  3RUZ A;  2Y0S E;  5T1I A;  1H9K A;  3ERO A;  1ML0 D;  5CBA E;  2JA7 G;  5ISR A;  1WTX A;  3VYU A;  4R4C A;  4PNY A;  2I5M X;  2PQA B;  2RVL A;  2A68 D;  2ZTE A;  2VUM B;  1PZJ D;  1F9Q A;  3CRL C;  2AQ3 B;  2O4X A;  4DV5 Q;  1WOC A;  4KV6 A;  3RZD B;  1BO0 A;  1QVF A;  4XYQ A;  4XQQ A;  4G7H C;  3DM3 A;  3NXW A;  3GDE A;  1QCB D;  4CBV A;  2UUA Q;  3E0J A;  3KF8 A;  1EYG A;  2JA7 B;  2PO4 A;  1FR3 A;  1TWC B;  1WTW A;  1ROD A;  4DR6 Q;  3URY A;  1LTA D;  5IGF A;  2GN5 A;  2M2L A;  3ZYY X;  1MJC A;  4HIK A;  3K0X A;  2LMC B;  3ERS X;  3FKI G;  1UUP A;  4Z9C B;  1KIX A;  1E3P A;  3CCE A;  2B2Y A;  5E4X A;  2EY2 A;  3S15 H;  1MI2 A;  1CA6 A;  2N8N A;  2MPM A;  3IKJ A;  4HR7 B;  2I5H A;  2KHI A;  3T56 B;  1PV4 A;  3MA2 B;  3UE1 A;  4A3J H;  3RZO H;  3S2D B;  2K52 A;  2QF7 A;  4LK1 C;  4HIO A;  2A6E C;  2Q8T A;  4LF7 L;  4DNT B;  2KEC A;  3FKI B;  2H1E A;  3DLL A;  2YU9 H;  5CV5 A;  1V1P B;  2L0C A;  4GNX B;  2K5N A;  5A2Q E;  1EFW A;  5JAV A;  3DMU A;  3GD7 A;  1H9R A;  2IY5 B;  4GZY C;  4OXP A;  2IHE A;  3KLR A;  4P73 A;  1CHQ D;  2RHQ B;  2BCO A;  4PZ8 A;  3A0J A;  1PXU A;  4IJH A;  5I4D A;  1I5F A;  1A8V A;  1B44 D;  3S24 A;  5IP7 G;  2AKW B;  3JAM c;  1C4Q A;  1B9N A;  1D1K A;  4RGO S;  1XNR Q;  4BXX H;  2FJ2 A;  2F0T A;  4JI0 Q;  1EY8 A;  1XMO Q;  4YCW A;  4ZUJ A;  4C3H B;  1XPR A;  3I2Z A;  3HOW G;  4YHH L;  3PCO B;  3OTO L;  3I4N G;  1IBM Q;  2K5D A;  3A5U A;  2KEN A;  1LUZ A;  4QY7 A;  3J81 i;  3K57 A;  3UI2 A;  3DXJ C;  2ZM6 L;  4FDB A;  1WVL A;  5ELD A;  1IBL L;  3RMH A;  2ES2 A;  1EYD A;  4DR1 Q;  3S1Q H;  3HOW B;  4QB4 A;  4ZKB B;  4B3T L;  3AB9 A;  4OWT B;  1YJN A;  3I4N B;  4L6T B;  1XX8 A;  5LMN W;  3S14 H;  4K6D A;  2L4N A;  2I46 A;  1E0B A;  4TSS A;  1TVX A;  1PH4 A;  4K8J A;  2F0Q A;  1HUN A;  1SEB D;  2Z4I A;  4HMJ A;  1BXT A;  2NVY B;  3BG3 A;  3X3N A;  5C3W A;  4N9P A;  1KAW A;  2L5T A;  5ELO A;  2VQF Q;  3SGI A;  2HCC A;  2OQK A;  1BOS A;  2JN4 A;  3PIO A;  2A73 B;  4DV1 Q;  3K6O A;  4HSV A;  1FGB D;  5EBD A;  4LFB L;  1KDC A;  4GLX A;  2DY8 A;  1GUO A;  4WOR A;  2M9V A;  1CQF A;  2E5L L;  5C0X J;  4B9X A;  4JI5 Q;  4KY6 A;  1VQ8 A;  2DNC A;  4UHV A;  1F2Y A;  2XNA C;  1G29 1;  1KQS A;  3E9H A;  3PUW A;  4H13 C;  1Q3L A;  1ILQ A;  2CWP A;  2BOS A;  2RDG A;  4ZCK A;  1KXL A;  4DV4 Q;  1WTO A;  1ENF A;  1I94 L;  3CCQ A;  5COY A;  1DZ1 A;  2TMP A;  4EQO A;  5KNC A;  2RCF A;  3E5S A;  1ET6 A;  3MEH A;  1VQK A;  5KYL A;  2JYO A;  1B4O A;  2K6A A;  5FO8 B;  1VCI A;  1EQQ A;  2EDG A;  3V2T A;  3T1Y L;  1K0S A;  2SNM A;  1V43 A;  4QMG A;  3C2P A;  4IUV A;  3H3V C;  4DV7 Q;  2K04 A;  4M1U B;  2K4K A;  2NZ1 D;  3BVM A;  1B9M A;  2XWJ B;  2D5D A;  1KLU D;  3RLN A;  2F0P A;  1S40 A;  4DAV A;  2RDH A;  1IBK L;  5HGQ A;  4HJA A;  4N8F A;  3I8Z A;  2QEX A;  5NUC A;  3M7G A;  2IT1 A;  2VY3 A;  1CKO A;  1C48 A;  1KRT A;  4G7Z C;  1LAC A;  1IW7 C;  3NTK A;  1AE2 A;  1TWG H;  2B29 A;  1Q46 A;  2JA6 G;  3STB D;  1CA5 A;  1MD2 D;  3I91 A;  4KY7 A;  3TZU A;  1HHV A;  2N78 A;  5A35 A;  2K32 A;  2F1M A;  1KAA A;  3A54 A;  3T1H L;  2L11 A;  5AFW A;  1NUC A;  1EIF A;  5TSS A;  2EYP A;  5IGB A;  1J5E Q;  1SDF A;  4HMI A;  3HKZ E;  2MO1 A;  1YVC A;  1LTS D;  5IY0 A;  3J81 L;  2E2I B;  4L5T A;  3A5Z B;  5CMD A;  2VQE L;  4DR7 L;  3J7A F;  1F9R A;  5C3E G;  4DUY Q;  2N88 A;  1SSO A;  1NBW A;  2WP8 J;  4RGM A;  1JOQ A;  1B50 A;  4XDX A;  4ODG A;  4IN3 A;  1N9W A;  5IT9 c;  1CT1 D;  3S17 H;  2WAC A;  1AW7 A;  1TWH B;  3E3X A;  5CR3 A;  4DF7 A;  2G5D A;  3HG9 A;  1NR2 A;  4GKJ L;  3NE5 B;  4JOI A;  3Q6S A;  2EYH A;  5C3E B;  3F2B A;  3SHL A;  1TXY A;  5IP9 H;  4F7X A;  3F2U A;  1Z6H A;  4R4I A;  2VS1 A;  1JOR A;  2F0U A;  3V96 A;  2Z1C A;  4LF9 Q;  1EEF D;  1K8A C;  2DGY A;  1W2B A;  1ILP A;  1EU3 A;  4WJ4 A;  2TSS A;  3IAY A;  2PYK A;  1NMG A;  5LHY 1;  3EBE A;  3H6M A;  2DY7 A;  5FLX c;  5C0X G;  3W2D A;  2V1C C;  4DFA A;  1PRT F;  1TQO A;  1L1O C;  2OWO A;  2OTJ A;  5CBE E;  4APV A;  1LLR D;  4O1N A;  4LF7 Q;  3OWE B;  4MN3 A;  4N8X 1;  3D6C A;  1AZP A;  1DYQ A;  1E24 A;  3TME A;  4BA2 I;  1YIJ A;  3K81 C;  5KEE A;  4UP8 A;  1PZK D;  1PH1 A;  3N52 A;  2LXJ A;  1B1Z A;  1U9R A;  3TBI B;  4DGZ A;  3SE0 A;  2BH2 A;  3BDC A;  3BDO A;  2J0T D;  1IKM A;  4NMZ A;  1A6X A;  5IGD A;  1PRT B;  1A2U A;  4LFC L;  2PCF B;  1PFB A;  1T5X D;  3IFD A;  5CV9 A;  3VA7 A;  3EA6 A;  3CRK C;  3OIQ A;  2HQL A;  2CWA A;  3QR8 A;  5T1G A;  5L37 A;  5EKK A;  4IUR A;  1SFO H;  2AUJ D;  5FLM H;  4UP7 A;  1QUQ B;  2F0G A;  2L55 A;  1I3Q B;  1SLJ A;  1PHJ A;  2NB0 A;  1Y1W H;  3GTQ H;  1SYC A;  4DAY B;  4XQJ A;  1ASZ A;  5EAY A;  2EYJ A;  5LMU Q;  4YHH Q;  4G4K A;  3OTO Q;  3NBH A;  4JBK A;  4B3R L;  2A5H A;  4JBW A;  3PUX A;  4RHS A;  1TWA H;  1G51 A;  1F2L A;  4DV0 Q;  1J8I A;  2ZM6 Q;  3QJY A;  1H9M A;  4RCN A;  3OWF A;  3SK5 A;  3SXH A;  1IBL Q;  1PRT C;  4MNO A;  3G71 A;  1JJC B;  5M5X H;  1GUT A;  4IUP A;  1I50 H;  2ZJR A;  1II3 A;  3CCS A;  2WB1 E;  2CH4 A;  5M3F H;  3W1B A;  2MHV A;  4KN7 C;  4Y52 H;  1S5D D;  1SMY D;  2RSO A;  4PMW A;  3SK8 A;  3NQI A;  2WAQ G;  1DOL A;  3QO2 A;  4UY8 C;  1BCP B;  1E2W A;  4IUN A;  1STE A;  5C4J H;  3CCJ A;  2Q2I A;  3KDF B;  2NVX H;  3VR4 A;  5FOB B;  3MC0 B;  2A69 D;  2LY7 A;  4IPG A;  1VQE A;  1VQJ A;  2B2T A;  2R61 A;  3VR2 A;  4LFB Q;  3TRZ A;  2OEO A;  3S15 B;  5IYD H;  3OMC A;  5IIF A;  2KVM A;  1QVC A;  1PTO D;  3A7L A;  4A3J B;  3RZO B;  4V0B A;  2WAQ B;  1GO3 E;  4JI0 L;  3DM1 A;  1ET9 A;  1EY4 A;  3M4Y A;  3AU7 A;  1IBM L;  3MXP A;  4A3B G;  3HZX A;  4A3F G;  4NXM Q;  3DWP A;  3MFY A;  2YU9 B;  4K2K A;  1I94 Q;  4JI6 Q;  4JI3 Q;  5BN4 A;  1UWV A;  5EJW A;  2NTT A;  2AHO B;  1AE3 A;  3QWN A;  4GN4 B;  2RF4 A;  1LT4 D;  4JI8 Q;  2ZJQ A;  3VR5 A;  4PZ7 A;  2DNE A;  1JJ2 A;  4CHT B;  3KOJ A;  1I4G A;  1NAP A;  3T1Y Q;  2GA4 B;  1I4X A;  1ENC A;  1JOK A;  1DOK A;  3RR5 A;  5IWA L;  4ABN A;  4A3F B;  3KK7 A;  1SBB B;  2JK8 A;  3PSI A;  3J7A 5;  1ZKO A;  3B6Y A;  1BF4 A;  2J7Z A;  1T5E A;  3I90 A;  3N6R A;  3HRZ C;  1CKM A;  1BVS A;  1IBK Q;  4ZRZ A;  3TP7 A;  2JA6 H;  3GTG H;  3GTL H;  1Q7Y C;  1YJ9 A;  1OXX K;  1EZ8 A;  1Z47 A;  3CHB D;  1OTC A;  4QCL A;  2J4X A;  4X3U A;  3U4V A;  3CW2 C;  5EKI A;  4X3T A;  2EIF A;  3J80 i;  1R4P B;  2R93 H;  4HID A;  2F0O A;  1N36 L;  3X3M A;  2JEB I;  3S1Q B;  1IXR A;  1SNO A;  2JSO A;  4CDF C;  4IOA A;  1HPC A;  4AYB G;  2ZTC A;  1FJG L;  3S14 B;  3UE0 A;  1VQ7 A;  5K36 H;  3T1H Q;  2R7Z H;  5HGT A;  3BJU A;  4TQU S;  1E1O A;  4R4T A;  3BYY B;  4TRD A;  4R8I A;  1U4R A;  4DV4 L;  3W1G A;  1AZQ A;  3NTH A;  1EWH A;  4DXG A;  2WKC A;  3AMU A;  3H3V I;  2XSC A;  2VQE Q;  3PQI A;  4DR7 Q;  3MAQ A;  4B3S L;  3I56 A;  1LTL A;  3TZD A;  1S4Z A;  1PH5 A;  4DNR B;  4P75 A;  1HZC A;  3DWQ A;  1F77 A;  1VQA A;  1M1K C;  1U4L A;  1X3G A;  1JIC A;  1IKL A;  4QUC A;  2N3S A;  4ZKC B;  1EEI D;  2E74 C;  2K5V A;  1YBY A;  1Q81 C;  3MTS A;  4GKJ Q;  3A8J E;  2D0P A;  1C9O A;  3PMF A;  1X56 A;  1BUV T;  1EZ6 A;  1I4P A;  2JA9 A;  3I72 A;  1O7L A;  4BY1 G;  3PUV A;  1SRU A;  4A3I G;  5HY6 A;  5C0X H;  3GTJ H;  1XYI A;  3EQL C;  4IUT A;  4NP5 A;  4XTC S;  2D2C C;  1B3Q A;  1PYS B;  1NR4 A;  3ZJY C;  4QQB X;  3MEF A;  4ZLT F;  3T4A C;  1SYB A;  3G4S A;  3U9S A;  2FFK B;  2B2U C;  3TP5 A;  1PA6 A;  1AN8 A;  3DWA A;  1GUW A;  1Q1B A;  4DK6 C;  4BA1 I;  1X3P A;  3K5M A;  4WFN 3;  1JR0 D;  5JJK A;  1I4R A;  2EQS A;  4A93 H;  1KNE A;  3C3L A;  2D0O A;  3VYS A;  4GOP B;  1Y8N B;  3RD4 A;  2PW5 A;  5I2X A;  2GVB A;  1MSH A;  3FMC A;  2CQA A;  3K7A H;  2RDF A;  5G3L F;  2K50 A;  3VA5 A;  4L5Q A;  3T13 A;  2BE5 D;  1U4P A;  1SAP A;  4NW2 A;  2K1B A;  1HJP A;  1H9S B;  1Q8I A;  4DUY L;  4J6H A;  5E3F A;  3KJP A;  1YIT A;  2NN6 H;  4LFC Q;  3DHQ A;  5M9O A;  1B3A A;  4GLV B;  4OON A;  5KGU A;  1TWG B;  1CZG A;  2Q2H A;  2EZV A;  2E75 C;  3IL8 A;  1RIP A;  5JJI A;  1BBW A;  1K8G A;  1TS4 A;  2FMM A;  4FF2 A;  1RKN A;  1X3F A;  1VQB A;  2XVS A;  1OXT A;  1SNC A;  4GOP C;  2B3G A;  2NVT H;  3NSW A;  5C5L A;  1P8L A;  2F0V A;  2L12 A;  4LF9 L;  4B3R Q;  4CKC A;  2KBN A;  4XIG S;  4KK7 A;  1KAB A;  3QIA A;  4QUF A;  4R4O A;  1TS3 A;  5IP9 G;  2B63 H;  4S3S A;  3TSS A;  2IJ0 A;  3J80 L;  4JBM A;  5CC4 A;  2A19 A;  3S17 B;  2SNS A;  1CQV A;  4ULL A;  1Q1E A;  4KKT A;  5IGG A;  2KCN A;  4QIW B;  3RLF A;  1LYL A;  1QNK A;  2E2D C;  4OO1 H;  1C0A A;  4RA8 A;  1JJG A;  2GVA A;  1MHW C;  3I4M H;  2PNR C;  3WDN A;  1RL2 A;  4EX5 A;  4X65 L;  2DJF C;  1STA A;  2IW3 A;  4LF5 L;  1Q86 C;  1RCV D;  5FJ8 H;  1TII D;  1U5K A;  3RN2 A;  3KF6 A;  3K0Y A;  4J1M A;  1A3U A;  2IX0 A;  4A3B H;  3SK6 A;  3HP3 A;  1GKH A;  4C3I H;  4IFD H;  2E76 C;  2Z6B A;  4A3F H;  4NB3 A;  3STB C;  5C0X I;  1CM9 A;  2EJG C;  3T51 B;  4DPG A;  1XTD A;  1VMC A;  3UDX A;  2YTX A;  1E1T A;  5M5Y H;  3D0F A;  3GV3 A;  5LMU L;  3R93 A;  1XNQ L;  4PMB A;  3OW7 A;  1C8C A;  1HR0 L;  4G57 A;  1J6Q A;  4A4I A;  5FK9 C;  5LMN Q;  3I73 A;  5FLM G;  5CYU A;  4GNX C;  1K0R A;  5CV7 A;  4DV0 L;  2I5L X;  3TP6 A;  4HJ5 A;  1Y1W G;  1BBU A;  3L0O A;  1ZEQ X;  1UNS A;  4LMQ D;  3J81 E;  3H0G H;  2WKD A;  1HNW L;  3MVV A;  2QDB A;  1STB A;  5JPN C;  1ZYR D;  3W3A A;  3KF8 B;  3ULP A;  2EY6 A;  5IWA Q;  4PV1 C;  2X6L A;  1SFO B;  2Q8R E;  3D4R A;  3KUP A;  1GXD C;  4LWC A;  3GTQ B;  1Y1W B;  1SYG A;  2E2H H;  2K5H A; 
#chains in the Genus database with same CATH homology
 4C1N I;  2MUY A;  1TT2 A;  4B08 A;  5IOD A;  1QWY A;  2K33 A;  2HUG A;  4KKS A;  1TWA B;  2QIL A;  3Q23 A;  1GUN A;  1M8A A;  1XTC D;  1TU2 B;  4ZUI A;  2A74 C;  4E6I A;  2O2L D;  3G7L A;  5M5X B;  1I50 B;  5I2Y A;  3ERQ A;  3E6Z X;  1BDO A;  2L1B A;  2F0I A;  1JC7 A;  5M3F B;  4DU9 A;  1BBX C;  1KNA A;  1X3Q A;  2NUC A;  2ZXO A;  3TP8 A;  5ELF A;  3TDQ A;  2C9O A;  2Z4H A;  1PYW D;  5C4J B;  2NVX B;  1GUG A;  5K5P A;  2VNU D;  1A2T A;  3BZD B;  4BS9 A;  2F0M A;  1FNU A;  5F2D A;  2DN8 A;  1GHK A;  2IWH A;  5KND A;  1DD2 A;  3D31 A;  1VF5 C;  3ONA B;  2XWB B;  4HCS A;  4K14 A;  4IQZ A;  2EXZ A;  4FF4 A;  1VDZ A;  3CU7 A;  1O80 A;  4IFD I;  2XIW A;  1ENA A;  2BDN A;  4HCE A;  4RAU C;  4CKB A;  2RKS A;  3QOL A;  5D65 A;  3FRP B;  2EVB A;  4RCO A;  1FNV A;  2JXM B;  4XQN A;  4IUQ A;  1DON A;  1HA5 A;  3NWS A;  2JA6 B;  1QG7 A;  3GTG B;  3GTL B;  1SJH D;  5K36 G;  5I9O A;  3A56 A;  1TY2 A;  3NTI A;  2NBF A;  4KKU A;  2X69 A;  3L9A X;  2R93 B;  4DK1 A;  4FF3 A;  5J39 A;  1EYC A;  1EIG A;  1W6K A;  4KD4 A;  1QNU A;  1EY0 A;  4R8N A;  2R7Z B;  4I7Z C;  2R3Z A;  3OOC A;  3SR1 A;  3FPP A;  1WTR A;  4EQN A;  5C6A A;  1HQM C;  1YNN D;  4IFD J;  4HTH A;  4UDU C;  3BYT B;  2KQ3 A;  2EYM A;  5CV8 A;  4CKE A;  2BA1 A;  4RGT A;  3Q24 A;  2F0W A;  1LTR D;  1Y8P B;  2B2W A;  1I4Q A;  3D4D A;  4MIU A;  4XT3 B;  3LNN A;  2F0E A;  2L9H A;  2G9H D;  2PZU A;  4FF1 A;  2SEB D;  4KY5 A;  1MSG A;  2G9D A;  1W6J A;  3GTJ B;  4K8I A;  2HDM A;  5ELE A;  1D1I A;  2F0D A;  5HUR A;  4C3J G;  4FXD A;  3HS0 C;  2F0L A;  1EOT A;  1CI3 M;  2CW0 D;  3EJI A;  5FO9 B;  3ND9 A;  2NN6 G;  5KYI A;  1CHP D;  4A93 B;  1K8M A;  1NCV A;  4C3J B;  3O13 A;  3OSO A;  1TS2 A;  4NDX A;  1RHP A;  3GQB A;  4K5W A;  1D2B A;  3K7A B;  2JE6 I;  1WTP A;  4V19 0;  4ME5 A;  2VB2 X;  3H94 A;  4FXG C;  4CGY B;  4ZYS A;  3EVQ A;  1BCP F;  3GO5 A;  2RQX A;  2A6H D;  1ESF A;  1STG A;  3NHH A;  3MFG A;  3SK4 A;  5I6W A;  3FDT A;  4K5V A;  3ITP A;  3QB3 A;  2EY5 A;  1IW7 D;  3V05 A;  2NVT B;  1S5C D;  1G2T A;  3A8K E;  1RF2 D;  2MGS A;  4OO1 G;  5D3I B;  2B63 B;  3PIP 3;  4PQX A;  3C1E A;  4RGN A;  2EYL A;  4FVM A;  2F0F A;  5KRU A;  4ZQ3 A;  3H09 A;  1Z7T A;  2NYZ D;  2EYO A;  4L63 B;  4X3S A;  1IYV A;  4KD3 A;  2WIN B;  1LT6 D;  4C3I G;  4IFD G;  3WOE A;  4OIK A;  3LWU A;  2F03 A;  3I4M B;  3QG1 A;  3JAM L;  1JCK B;  2WII B;  2KA7 A;  1BCP C;  3SVM A;  1ONL A;  4M8A A;  3C46 A;  4F88 A;  1O7Y A;  3HGB A;  3MZ5 A;  3VR3 A;  1Y69 U;  3K5N A;  1LV9 A;  2A68 C;  4A3B B;  2HQE A;  5JEA H;  3NK9 A;  4C3I B;  1JWM D;  1PTO H;  1RJT A;  4UAI A;  3R2I A;  4EVO A;  4I65 A;  5M5Y B;  2QCP X;  2ID0 A;  1IHZ A;  1JWS D;  1G6Z A;  2BA0 A;  5IGC A;  1SXT A;  2WB1 B;  1SYD A;  2EYF A;  3H0G B;  1XWE A;  4BWG B;  1B2T A;  2XN9 C;  2BDO A;  3J80 E;  1PLF A;  5E4W C;  1OXS C;  2KEE A;  1EY9 A;  2E2H B;  3MWY W;  1TY0 A;  1QE6 A;  5D14 A;  2KJX A;  4K6L A;  3S1N B;  1FYC A;  3HOY B;  4EQP A;  4AYB B;  1VF7 A;  1OXV A;  3NPP A;  1LTB D;  1LTG D;  1EIH A;  4KN4 C;  5I9P A;  3CKI B;  5DEH A;  3U9O A;  4J8Q A;  2D9U A;  1ESR A;  1JOO A;  5BN5 A;  2Z8L A;  3QOJ A;  5C4H A;  3VR6 A;  1S5F D;  5CV6 A;  5C5M A;  1HRJ A;  2JEA I;  1UAP A;  1PRT D;  2NWG A;  1SJE D;  1O7Z A;  2PZW A;  4RKL A;  3NWT A;  1EU4 A;  2ZXR A;  1EFI D;  1OO9 B;  1PFM A;  3K5L A;  2B2V C;  1JWU D;  1H9J A;  1ICW A;  4HSP A;  4NKL A;  3FEW X;  1A3V A;  2OT2 A;  1HTL D;  1I6H B;  4BY1 B;  1STN A;  4Q5V A;  4A3I B;  2B8G A;  2F4I A;  1V8Q A;  3KBG A;  2ENB A;  5EKL A;  3NBI A;  4ILW A;  5JOB A;  1UEA B;  3VYR A;  1JQY D;  1V1P A;  1KLG D;  4DA2 A;  2PZT A;  3Q22 A;  4JK1 C;  1JE4 A;  1HUM A;  1EY7 A;  3G6J B;  1SYF A;  2NVQ B;  3CQZ B;  4EGV A;  4H0L C;  1TKW B;  1FNW A;  1ZXT A;  3P7J A;  5IOC A;  4H7B A;  1LT5 D;  1V1O A;  4DK0 A;  5J22 A;  1AP0 A;  4L8J A;  4BBS B;  2F0H A;  2KOL A;  1RD9 D;  2MJ8 A;  1CK1 A;  5IT9 L;  2XRQ D;  3S2H B;  3GP7 A;  2B39 A;  1JB3 A;  2EJF C;  3OHX C;  3I4L A;  2WV6 D;  4LJZ C;  2E2J B;  5ELC A;  1STY A;  3R2T A;  4CJ0 B;  2H4O A;  2Q8I B;  5COR A;  4F8M A;  1PZI D;  3MHB A;  2IX1 A;  2AQ1 B;  4KI0 A;  2F0K A;  1R4Q B;  3K59 A;  5IGE A;  1EY6 A;  4X3K A;  5M5W B;  5KIX A;  2KUM A;  4IAL A;  4KJO A;  2O5J C;  5JJZ A;  1YNJ D;  5FLX L;  5JEA J;  3PV0 A;  3H91 A;  2QKI C;  2R6G A;  4QF4 A;  1RTN A;  1R9T B;  3S1M B;  2ICI A;  3I3C A;  2Y0S B;  1M4V A;  2PQE A;  3HOX B;  5CV4 A;  4HN7 A;  2LKV A;  3GV6 A;  1EQV A;  4C3H G;  5DNF A;  3KLS X;  2SDF A;  1EYA A;  3PUY A;  3NQT A;  3L3O C;  4U67 3;  3HOU B;  4G7O C;  5C3X A;  1VMP A;  2YYZ A;  4XXE A;  2NN6 I;  4FO2 A;  1E2Z A;  3A55 A;  3OMG A;  1G2S A;  1WTV A;  1YNN C;  5EBC A;  4RFB A;  2XRS D;  2OXP A;  3PO3 B;  1FD7 D;  1A15 A;  3D4W A;  1K83 B;  3EFX D;  2VB3 X;  4BY7 B;  3A7A B;  1SNQ A;  1SE4 A;  2RBM A;  2NTS A;  1DOM A;  3DUZ A;  2KED A;  3DEP A;  3ND8 A;  4KHZ A;  2B2Y C;  1G8Z D;  2V4D A;  4OO1 I;  1OXU A;  1KDB A;  3GTK B;  3R3O A;  3BDL A;  2ZXP A;  2KCC A;  5EPJ A;  1Y8O B;  4XYO A;  1J9O A;  1F9S A;  3D8G A;  1AEX A;  1TWF B;  4P2C B;  2CW0 C;  1BNZ A;  3PUZ A;  2M00 A;  4FYD A;  5M3M B;  5LL6 S;  1WCM B;  5JEA G;  1PTO F;  3S1R B;  3P1H A;  1KDA A;  4OHJ A;  1NSN S;  5E1F A;  1HQR D;  2FIN B;  5G3L D;  2A6E D;  4PMC A;  5A2Q L;  1RTO A;  4OGQ C;  4CJ1 B;  3TN2 A;  1XXG A;  1KTK A;  3HOV B;  1L0Y B;  4KHV A;  2PW7 A;  4HAE A;  3WOF A;  2A6H C;  1PTO B;  5FKA C;  4B9W A;  1SNM A;  4A3G B;  1D5X C;  1G91 A;  5EPL A;  3PIO 3;  2AQ2 B;  1SMY C;  1CZW A;  2CVR A;  2F0N A;  5DM6 3;  1I4H A;  4RWS C;  4K2L A;  3M4O B;  1K8O A;  5EGT A;  2A69 C;  5I6Y A;  3NP8 A;  1QJO A;  1PTO C;  1EQT A;  4DAY A;  1Q90 A;  4KMU C;  2AWN A;  3KBX A;  3KLS A;  4ID6 A;  3S9W A;  4BBR B;  5C44 B;  3I70 A;  5ELB A;  1TR5 A;  4RHR A;  2IPK D;  1F2M A;  4DAP A;  2LFN A;  5LL6 X;  3JAM E;  2F3V A;  3Q0A A;  4C56 C;  5C4Z A;  4A3D B;  1HXY D;  1HFN A;  1PFN A;  4O42 A;  4A3K B;  2K01 A;  4FP5 D;  2MP1 A;  3IFT A;  4DN4 M;  1Q12 A;  1LT3 D;  3J7Y W;  2FMC A;  1AFP A;  2OF1 A;  1HTP A;  2C5C A;  3C1F A;  3HKZ B;  3FPU B;  1IYU A;  2K28 A;  1EY5 A;  4FXK C;  4FNF A;  1PDQ A;  2QEJ C;  3M3Y B;  2RSN A;  4IZ8 A;  4RH6 A;  2EE1 A;  2ICE C;  1MBY A;  3D3R A;  1QOH A;  4MHE A;  1DJR D;  2D62 A;  3MXU A;  4RKB A;  1EWC A;  4WRD A;  3T53 B;  3DEO A;  3GTM B;  2JA8 B;  3T16 A;  3MXG A;  4ZK9 B;  4ZAI A;  1LTI D;  1L0X B;  2JA5 B;  1GOZ A;  4Q0F A;  4U68 A;  1WD1 A;  3R8B A;  1LO5 D;  2F3W A;  1X32 A;  3HOZ B;  3NUC A;  1S5E D;  1GUS A;  2VXW A;  3S16 B;  1Y1V B;  3GTO B;  3MXN A;  4Y7N B;  4WJW A;  1A3T A;  1CTM A;  1E2V A;  2KHS A;  1HA6 A;  2EPB A;  1TS5 A;  5KNB A;  2F0S A;  3LX0 A;  1U4M A;  2B2V A;  3HEJ A;  2PPB C;  1HCZ A;  2BE5 C;  3GTP B;  4TKO B;  1F2Z A;  2AWO A;  2SOB A;  4R9W A;  2B2U A;  2B2W C;  1PMR A;  5DAU A;  1D5M C;  2CHB D;  1DM0 B;  3PO2 B;  1DXM A;  1S5B D;  5FO7 B;  5EQ0 A;  1SE3 A;  3K58 A;  2PMZ B;  5JVH 3;  4H44 C;  4KJN A;  1IL8 A;  2I07 B;  1LAB A;  3M85 A;  4LAA A;  3A8I E;  5CGK A;  1SYE A;  5J1Z A;  1RDP D;  5IT9 E;  1O78 A;  5JVG 3;  5EPK A;  1D5Z C;  1QIL A;  3LWE A;  1DCZ A;  2HDL A;  2JP1 A;  1I6V C;  4HED A;  3M7N A;  1MGS A;  1SNP A;  1YNJ C;  2HCI A;  1H9S A;  1D6E C;  2K7V A;  4YIJ A;  5C4X B;  1LTT D;  4DXF A;  5FLX E;  5D3D A;  1GHJ A;  4F87 A;  1BR9 A;  2EY1 A;  3FVQ A;  2LS0 1;  4N9T A;  3VYT A;  2IL8 A;  2K5W A;  3SDZ A;  2EOT A;  1STH A;  1WTQ A;  2K05 A;  2AUK A;  3J7A V;  2X6G A;  1B53 A;  4A3E B;  3L7Z C;  2B2T C;  1SE2 A;  3P75 A;  3OIP A;  2F0J A;  1F9P A;  5BN3 A;  2R92 B;  3OPO A;  1WD0 A;  4C2M B;  1ZYR C;  1CFM A;  2O5I C;  3SEB A;  1SND A;  3D6W A;  4K5X A;  1GJX A;  3BVG A;  2B8F A;  1BQQ T;  3BS1 A;  1HFG A;  1EL0 A;  4XT1 B;  5JPM C;  4OIJ A;  2N55 A;  2K5Q A;  4A3M B;  4C1N K;  2K03 A;  2ZT9 C;  3BVZ A;  3K5O A;  2FHT A;  4IUU A;  4CJ2 C;  4OL7 A;  2RA4 A;  2IX3 A;  3P20 A;  1QB5 D;  4KTA A;  1BCP D;  5DM7 3;  2EJM A;  3RUZ A;  5T1I A;  1H9K A;  3ERO A;  1ML0 D;  5CBA E;  5ISR A;  1WTX A;  3VYU A;  4PNY A;  2RVL A;  2A68 D;  2VUM B;  1PZJ D;  1F9Q A;  3CRL C;  2AQ3 B;  2O4X A;  4KV6 A;  3RZD B;  1BO0 A;  4XYQ A;  4XQQ A;  4G7H C;  3NXW A;  1QCB D;  4CBV A;  3E0J A;  3KF8 A;  2JA7 B;  2PO4 A;  1FR3 A;  1TWC B;  1WTW A;  1ROD A;  3URY A;  1LTA D;  5IGF A;  2M2L A;  3ZYY X;  2LMC B;  1UUP A;  4Z9C B;  2B2Y A;  5E4X A;  2EY2 A;  1MI2 A;  1CA6 A;  2MPM A;  3IKJ A;  4HR7 B;  3T56 B;  3MA2 B;  3S2D B;  2QF7 A;  4LK1 C;  2A6E C;  2Q8T A;  4DNT B;  2KEC A;  3FKI B;  2H1E A;  5CV5 A;  1V1P B;  2L0C A;  5A2Q E;  5JAV A;  3DMU A;  3GD7 A;  1H9R A;  4GZY C;  3KLR A;  1CHQ D;  2BCO A;  1PXU A;  5I4D A;  1B44 D;  1C4Q A;  1B9N A;  1D1K A;  4RGO S;  2FJ2 A;  2F0T A;  1EY8 A;  4ZUJ A;  4C3H B;  2K5D A;  3K57 A;  3UI2 A;  3DXJ C;  1WVL A;  5ELD A;  3RMH A;  1EYD A;  3HOW B;  4QB4 A;  4ZKB B;  3AB9 A;  3I4N B;  4L6T B;  1XX8 A;  4K6D A;  2L4N A;  2I46 A;  1E0B A;  4TSS A;  1TVX A;  4K8J A;  2F0Q A;  1HUN A;  1SEB D;  2Z4I A;  4HMJ A;  1BXT A;  2NVY B;  3BG3 A;  3X3N A;  5C3W A;  4N9P A;  2L5T A;  2HCC A;  1BOS A;  2A73 B;  3K6O A;  4HSV A;  1FGB D;  5EBD A;  1KDC A;  2DY8 A;  1GUO A;  4WOR A;  2M9V A;  1CQF A;  5C0X J;  4B9X A;  4KY6 A;  2DNC A;  1F2Y A;  2XNA C;  1G29 1;  3PUW A;  4H13 C;  1Q3L A;  1ILQ A;  2RDG A;  2BOS A;  1WTO A;  1ENF A;  5COY A;  1DZ1 A;  2TMP A;  4EQO A;  5KNC A;  3E5S A;  1ET6 A;  3MEH A;  5KYL A;  2JYO A;  1B4O A;  2K6A A;  5FO8 B;  1VCI A;  2EDG A;  3V2T A;  2SNM A;  1V43 A;  4QMG A;  3C2P A;  4IUV A;  3H3V C;  2K04 A;  4M1U B;  2NZ1 D;  3BVM A;  1B9M A;  2XWJ B;  2D5D A;  1KLU D;  2F0P A;  4DAV A;  2RDH A;  3I8Z A;  5NUC A;  3M7G A;  2IT1 A;  1C48 A;  4G7Z C;  1LAC A;  1IW7 C;  3NTK A;  1CA5 A;  1MD2 D;  3I91 A;  4KY7 A;  3TZU A;  1HHV A;  5A35 A;  2K32 A;  2F1M A;  1KAA A;  3A54 A;  2L11 A;  5AFW A;  1NUC A;  5TSS A;  5IGB A;  2EYP A;  1SDF A;  4HMI A;  1LTS D;  3J81 L;  2E2I B;  5CMD A;  3J7A F;  1F9R A;  2N88 A;  1SSO A;  2WP8 J;  4RGM A;  1JOQ A;  1B50 A;  4XDX A;  4ODG A;  4IN3 A;  1CT1 D;  2WAC A;  1AW7 A;  1TWH B;  5CR3 A;  4DF7 A;  3HG9 A;  1NR2 A;  3NE5 B;  3Q6S A;  2EYH A;  5C3E B;  3SHL A;  4F7X A;  3F2U A;  1Z6H A;  1JOR A;  2F0U A;  3V96 A;  2Z1C A;  1EEF D;  1ILP A;  1EU3 A;  2TSS A;  3IAY A;  2PYK A;  5LHY 1;  3H6M A;  2DY7 A;  5C0X G;  3W2D A;  4DFA A;  1PRT F;  1TQO A;  5CBE E;  1LLR D;  4O1N A;  3OWE B;  4MN3 A;  3D6C A;  1AZP A;  1DYQ A;  3TME A;  4BA2 I;  5KEE A;  1PZK D;  3N52 A;  3TBI B;  1B1Z A;  1U9R A;  4DGZ A;  3SE0 A;  3BDC A;  3BDO A;  2J0T D;  1IKM A;  4NMZ A;  1A6X A;  5IGD A;  1PRT B;  1A2U A;  2PCF B;  1T5X D;  1PFB A;  3IFD A;  5CV9 A;  3VA7 A;  3EA6 A;  3CRK C;  3OIQ A;  5T1G A;  5EKK A;  4IUR A;  2AUJ D;  2F0G A;  2L55 A;  1I3Q B;  2NB0 A;  1SYC A;  4XQJ A;  2EYJ A;  4G4K A;  3NBH A;  2A5H A;  4JBW A;  3PUX A;  4RHS A;  1F2L A;  1J8I A;  3QJY A;  1H9M A;  4RCN A;  3OWF A;  3SK5 A;  3SXH A;  1PRT C;  1GUT A;  4IUP A;  1II3 A;  2MHV A;  4KN7 C;  1S5D D;  1SMY D;  2RSO A;  4PMW A;  3SK8 A;  3NQI A;  1DOL A;  3QO2 A;  1BCP B;  1E2W A;  4IUN A;  1STE A;  3VR4 A;  5FOB B;  3MC0 B;  2A69 D;  2LY7 A;  2R61 A;  2B2T A;  3VR2 A;  2OEO A;  3S15 B;  3OMC A;  5IIF A;  2KVM A;  1PTO D;  3A7L A;  4A3J B;  3RZO B;  4V0B A;  2WAQ B;  3DM1 A;  1ET9 A;  1EY4 A;  3M4Y A;  3AU7 A;  3MXP A;  3HZX A;  3DWP A;  3MFY A;  2YU9 B;  4K2K A;  5BN4 A;  5EJW A;  2NTT A;  3QWN A;  1LT4 D;  3VR5 A;  2DNE A;  4CHT B;  1I4G A;  1NAP A;  2GA4 B;  1I4X A;  1ENC A;  1JOK A;  1DOK A;  4ABN A;  4A3F B;  3KK7 A;  1SBB B;  1ZKO A;  1BF4 A;  2J7Z A;  1T5E A;  3I90 A;  3N6R A;  3HRZ C;  4ZRZ A;  3TP7 A;  1OXX K;  1EZ8 A;  1Z47 A;  3CHB D;  4QCL A;  2J4X A;  4X3U A;  5EKI A;  4X3T A;  1R4P B;  2F0O A;  3X3M A;  2JEB I;  3S1Q B;  1SNO A;  2JSO A;  1HPC A;  3S14 B;  5K36 H;  5HGT A;  4TQU S;  3BYY B;  4TRD A;  4R8I A;  1U4R A;  1AZQ A;  3NTH A;  1EWH A;  4DXG A;  2WKC A;  3AMU A;  2XSC A;  3MAQ A;  3TZD A;  1S4Z A;  4DNR B;  3DWQ A;  1F77 A;  1U4L A;  1JIC A;  1IKL A;  4QUC A;  4ZKC B;  1EEI D;  2E74 C;  3MTS A;  3A8J E;  3PMF A;  1BUV T;  1EZ6 A;  1I4P A;  3I72 A;  1O7L A;  3PUV A;  5C0X H;  1XYI A;  3EQL C;  4IUT A;  4NP5 A;  4XTC S;  2D2C C;  1NR4 A;  4ZLT F;  3T4A C;  1SYB A;  3U9S A;  2FFK B;  2B2U C;  3TP5 A;  1GUW A;  1AN8 A;  3DWA A;  1Q1B A;  4BA1 I;  1X3P A;  3K5M A;  4WFN 3;  1JR0 D;  1I4R A;  1KNE A;  3C3L A;  3VYS A;  1Y8N B;  3RD4 A;  2PW5 A;  5I2X A;  1MSH A;  3FMC A;  2CQA A;  2RDF A;  5G3L F;  3VA5 A;  3T13 A;  2BE5 D;  1U4P A;  1SAP A;  4NW2 A;  2K1B A;  1H9S B;  1Q8I A;  4J6H A;  5E3F A;  2NN6 H;  3DHQ A;  5M9O A;  1B3A A;  5KGU A;  1TWG B;  1CZG A;  2EZV A;  2E75 C;  3IL8 A;  1TS4 A;  2FMM A;  4FF2 A;  1RKN A;  2XVS A;  1OXT A;  1SNC A;  3NSW A;  5C5L A;  2F0V A;  2L12 A;  4CKC A;  4XIG S;  4KK7 A;  1KAB A;  3QIA A;  4QUF A;  1TS3 A;  4S3S A;  3TSS A;  2IJ0 A;  3J80 L;  5CC4 A;  3S17 B;  2SNS A;  1CQV A;  4ULL A;  1Q1E A;  4KKT A;  5IGG A;  2KCN A;  4QIW B;  3RLF A;  2E2D C;  1QNK A;  4OO1 H;  4RA8 A;  2PNR C;  3WDN A;  1STA A;  2IW3 A;  1RCV D;  1TII D;  3K0Y A;  4J1M A;  1A3U A;  2IX0 A;  3SK6 A;  3HP3 A;  4IFD H;  2E76 C;  5C0X I;  1CM9 A;  2EJG C;  3T51 B;  1VMC A;  3GV3 A;  3R93 A;  4PMB A;  3OW7 A;  1C8C A;  4G57 A;  5FK9 C;  3I73 A;  5CYU A;  5CV7 A;  3TP6 A;  1ZEQ X;  1UNS A;  4LMQ D;  3J81 E;  2WKD A;  3MVV A;  2QDB A;  1STB A;  5JPN C;  1ZYR D;  3W3A A;  2EY6 A;  4PV1 C;  2X6L A;  1SFO B;  2Q8R E;  3D4R A;  3KUP A;  1GXD C;  3GTQ B;  1Y1W B;  1SYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...