2F0OA

Crystal structure of staphylococcal nuclease mutant v66i/i72v
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMIENAKKVEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0oA00
3SK4A 2PW7A 4KJOA 5KYIA 3NQTA 1KABA 4K14A 4K5WA 1SYGA 2F0NA 1SYDA 1SYEA 2SOBA 3C1FA 4K2LA 5CV4A 5IGCA 5CV6A 4K6DA 1SNCA 1JOOA 1EY0A 4NMZA 3QB3A 5E1FA 3QOLA 2EY5A 1EYAA 1EY5A 3MEHA 3OMGA 5C4ZA 1JOQA 4KHVA 2EYFA 3VA5A 5IGGA 4IZ8A 2F0OA 3PMFA 4J6HA 5CR3A 3D4WA 4N9TA 1ENCA 3HEJA 1SYCA 2EYLA 2NUCA 5C3WA 5M9OA 5KEEA 2F0HA 1SNMA 2F0DA 1EYCA 3SHLA 1EY8A 4DF7A 3SK6A 4HTHA 3EVQA 2KHSA 1A3UA 2WACA 3OWFA 3P1HA 5EKKA 5I6YA 1KDAA 1F2ZA 2EY2A 1EY9A 2LKVA 3SK5A 5J39A 3LX0A 4KJNA 4QF4A 4IUNA 5IGDA 1EQVA 2EYHA 4EQOA 4J1MA 5IODA 5C3XA 2EYOA 3U9OA 4EQPA 5IGEA 5K5PA 4KY6A 4DFAA 5CV7A 3RUZA 5DEHA 1EZ6A 3SK8A 3D6CA 1F2MA 3D8GA 4QB4A 4OL7A 1EY6A 4PMCA 2OXPA 3DMUA 3NHHA 3ERQA 5DAUA 4EVOA 2F0WA 2EY6A 5J22A 2OEOA 5KGUA 2F0VA 5C4HA 3ITPA 1TT2A 4S3SA 3MXPA 4K5XA 1II3A 4K5VA 2F0SA 4F8MA 2F0JA 4NP5A 4KY7A 4KTAA 1KDBA 1EZ8A 1EY4A 4HMJA 3SR1A 2F0LA 3R3OA 4B9XA 5IOCA 1STAA 2F0FA 5C6AA 3E5SA 4DU9A 3MVVA 1SNQA 5EGTA 4H7BA 2PQEA 1RKNA 3SXHA 2M00A 2F0EA 4HMIA 5F2DA 2RBMA 4G57A 4KV6A 5C5MA 4RKBA 1STBA 5CV5A 1EY7A 1STHA 3C1EA 5CV8A 4I65A 4KY5A 2RKSA 4IALA 1A2UA 3OSOA 1JORA 1NSNS 4KD4A 1JOKA 3DHQA 4F7XA 5JAVA 1A2TA 3D4DA 2OF1A 5HURA 4KD3A 3V2TA 5KRUA 2ENBA 4NKLA 3S9WA 5IIFA 4QMGA 4R8NA 5I9OA 2F3VA 2RDFA 4N9PA 4YIJA 3NP8A 3TP8A 1A3TA 4EQNA 5EKLA 1KAAA 2HQEA 2F0GA 5I6WA 2F0KA 2PYKA 3TP5A 3MZ5A 5KIXA 1A3VA 1F2YA 4PNYA 5E3FA 2EYJA 1ENAA 1TQOA 3NUCA 1U9RA 1KDCA 5ISRA 2SNMA 3T16A 4E6IA 5CGKA 1EYDA 2EXZA 5CC4A 4K8IA 1STGA 3QOJA 4ZUJA 1NUCA 2F3WA 3OMCA 2F0IA 3MHBA 2PW5A 4RKLA 4WRDA 2F0TA 1IHZA 2F0QA 1STYA 2F0PA 3NK9A 1SNPA 4K2KA 4LAAA 5JOBA 4ME5A 4DGZA 5IGBA 4ZUIA 1TR5A 5CV9A 3TP6A 4B9WA 5KYLA 4NDXA 4WORA 5NUCA 3T13A 5IGFA 3NXWA 1SNDA 3P75A 3HZXA 3EROA 3TMEA 2O4XA 2PZWA 3BDCA 2PZTA 2EYPA 2EY1A 2SNSA 4MIUA 4PMBA 2QDBA 5J1ZA 2KQ3A 5I9PA 1SYFA 4ODGA 1SYBA 2F0UA 2PZUA 1STNA 3H6MA 1AEXA 2EYMA 3EJIA 2F0MA 5C5LA 5HGTA 4ID6A 3TP7A 1SNOA 4K8JA 3BDLA 4TRDA 4ZQ3A
chains in the Genus database with same CATH superfamily
4DUYQ 2KA7A 3C1FA 3GQBA 4HIDA 4DV4L 4UP7A 1UEAB 1ILQA 1I4HA 1UNSA 3F2DA 2ES2A 1EYAA 2GA4B 1LT3D 5AJ3Q 1QVFA 2A68C 1KC8C 2CCZA 1JB3A 2F0DA 3AU7A 3CAMA 4LF4L 1A62A 1A3UA 4BXXH 2L1BA 2DY7A 1EY9A 1C0AA 4KHPL 1DJRD 5JPMC 1J5EQ 1KLGD 1TS4A 1EQTA 3RNUA 1VQ4A 4OO1I 3PO2H 3HOUG 2WB1B 5J22A 1LTTD 1CM9A 1H9SA 2B63G 4YWKA 2F0JA 1EY4A 1TWGH 2X6GA 3R3OA 1LTID 1PRTB 2OT2A 2MNAA 1N34L 1S72A 3K5LA 2B2YC 1ICFB 3RN5A 3CCSA 1LTGD 1EY7A 2E5LL 5FLXL 4GLVB 2NB0A 4KK7A 3I91A 3OSOA 3S15H 1HHVA 4FNFA 3DHQA 2D62A 1A2TA 3PUZA 1EQQA 1G2TA 2LXKA 3HG9A 2RHQB 3V2TA 4LF8L 4GN3B 3BZCA 3I70A 5A2QL 4JI5Q 2DUDA 1T5EA 3C2PA 2ZXPA 1PH1A 4CJ0B 1BCPF 1P8LA 1U9RA 3L9AX 5DM73 4CJ2C 2QKIC 3GTLB 3GV6A 1L2FA 1D6EC 2QDLA 4LAAA 3NK9A 5GAGC 5IGBA 5C3EH 3EIVA 1XJVA 3M4OH 2UXDQ 3GD7A 3KF8B 4HEDA 3NELA 4IJHA 1EFWA 2IHEA 2KQ3A 1M4VA 1WD1A 1TWAB 3R93A 4GKJL 5D14A 4ALPA 4A3JH 5IYDG 1CKNA 4RHRA 1CTMA 1PFBA 4QL5A 3S1MH 1BCPC 4DV6Q 2SOBA 4DR5L 2Q2TA 1IBKL 3URYA 1SEBD 4V190 4X62L 4NXMQ 3S1QB 2EY5A 3MEHA 3KJOA 4Q5VA 3J81L 1LTLA 1SE3A 2R7ZH 5C3WA 5LL6X 4FF2A 5KEEA 2XWBB 3CCJA 2BE5C 4UP9A 4APVA 4G7ZC 2O5JC 3GP7A 4DF7A 1YZ6A 1S5FD 2IPKD 1I6VC 2Z0SA 5IP9H 2CVRA 4O0AA 1QOHA 2PNRC 2B63H 5CORA 5ELDA 1EWCA 1M8AA 2LY7A 4OXPA 4WJWA 4AH6A 1HRJA 3S1NB 3KBGA 1LTSD 2CHBD 2NVTH 1YI2A 1MSHA 1GXDC 4JOIA 1L0WA 4DK1A 3NTIA 5AJ3L 4MHEA 1E24A 2WAQB 1AN8A 3CCLA 2ZM6L 2BDOA 2LFNA 3J80c 2MO1A 5LMNQ 3E5SA 3M4OB 3UDIA 2I0QA 1LUZA 2MHVA 3J81i 5C5MA 4RKBA 2NZOA 1STHA 1I6HB 4U673 1OXTA 1A63A 2ZJRA 5JAVA 1G2SA 4B3TQ 4KD3A 2A5HA 1B4OA 4CDDC 2HHHL 4QMGA 2A1AA 1YNJD 3CC4A 1VQCA 4HN7A 4RGTA 2F0GA 4GNXB 1NR2A 2AQ3B 2Q8RE 1S5BD 5E3FA 4X62Q 3STBD 3SE0A 1MKHA 3ULPA 3HOZB 1JR0D 2SNMA 4LUOA 1K9MC 3PO3B 4C2MB 4BY1B 2XNAC 2JA6H 1FR3A 4A3GH 2CQOA 4RKLA 2RA4A 5KYLA 2DNCA 2A6ED 4A3JG 4I7ZC 4DV2Q 3PV0A 3KYHC 4WORA 4ZKBB 1YITA 3HOYH 3D4RA 1PH3A 1A0IA 2JEBI 2PZWA 4JI6L 1JJGA 2L9HA 2EPBA 5C5LA 4Z9CB 4YY3Q 3S1RH 5IYBH 3HP3A 3K58A 4C1NI 4DK6C 2HD3A 2E5LQ 2F52A 4DXGA 4X6AH 3CCMA 3NQTA 1R4PB 2PCFB 2WB1G 1B70B 1EWHA 5JJZA 3OWEB 4G4KA 4LNQA 4JI8L 4LF6Q 3JAML 5IGGA 1SFOH 3R2IA 4IZ8A 3K7AH 3KLRA 4P72A 4JI6Q 5CR3A 4X64L 4DAYA 2RSOA 1RHPA 3S2DB 1VQHA 4KLKA 2E75C 3SK6A 4JG2A 4A3BH 2WACA 2Y0SE 1UE6A 2MGSA 5EQ0A 1G6PA 2BA1A 2GVBA 3NQIA 4GOPB 1DZ1A 1OXVA 5IE8A 3M85A 3NPPA 3PCOB 2JEAI 1GJXA 2NTTA 3LNNA 1I94L 4DFAA 3TDQA 2J0TD 2VQFQ 2ASBA 1D2BA 1BBUA 4C3HG 4H02A 4P71A 1PH7A 4CJ1B 2XIWA 3S1NH 4NW2A 4QCLA 3AFQA 4JK1C 2Y0SG 4ZKCB 3G48A 1RKNA 5DM63 2B2YA 1NE3A 2M00A 1ESFA 1AFPA 2KECA 4KV6A 2UUCL 3X3NA 1QJOA 3U4VA 1JORA 3IFDA 1E0BA 2WKCA 2AUJD 3VYRA 4YCWA 4JI0Q 1V43A 1RIPA 3TP8A 3DWQA 5FKAC 4NXML 3J81c 1KAAA 1G91A 3PIO3 1YHQA 2UXCL 1A3VA 2EYJA 1ENAA 1Z7TA 1M90C 1K8MA 1CK1A 1VQJA 3I4MG 3MHBA 2OTJA 3TREA 3I8ZA 2QW7A 3GO5A 3OIQA 1Y8NB 2QDBA 1JMCA 4Y7NB 4BBSB 1C7YA 2M2LA 4A3KB 4FF3A 1V9PA 5EKIA 2IX3A 4A93B 1UE5A 4DAMA 2K28A 1R4QB 5JPNC 4KMUC 4ZQ3A 2JA8H 4QQBX 1EIYB 3WWVA 2PW7A 1XMQL 2V4DA 4K14A 3P20A 5CYUA 2OCEA 4LF9Q 1RJTA 5IT9L 2OQKA 2KENA 3CXCA 1PZID 5EPLA 3VR3A 4GN5A 2NVYB 3A5UA 4LF8Q 5K36H 1Y8PB 4HCSA 4XT1B 1UUPA 1KIXA 1F77A 1E1TA 2XWJB 3OWFA 5EKKA 5C0XG 3HOVG 2K33A 1PRTD 4A3MH 1WTHA 2K4KA 3PO3G 5M5XH 3K7UC 2HIXA 5JJKA 3NE5B 1F2LA 1JE5A 4DUZL 4DR6L 4OEMB 1UE1A 4DKAC 5C4XG 4JOIC 4DNRB 2K5QA 1XNQL 3LWEA 4A3IB 2F0VA 5M3MB 1SSOA 1V1QA 3X3MA 1VQ6A 3S16H 2L11A 3F2BA 4KHPQ 1P16A 3A7AB 1CKOA 2H5XA 3DUZA 1K3RA 1OXSC 4L5TA 2QA4A 3BYTB 1E22A 1GM5A 1E2ZA 5ELNA 2CFMA 2F4VQ 3M9BA 3D4DA 3K0XA 1XX8A 2LS01 2Q2HA 5DLQE 4X65Q 1A15A 2ZJQA 1O7IA 4EQNA 1XTCD 3I4LA 3K59A 2F0KA 1S40A 2K14A 1PH8A 4QUCA 1SJHD 2E74C 2AHOB 4J8QA 1ZYRD 3AB9A 4KKSA 4E6IA 1ET9A 1K8GA 2F3WA 3Q24A 2J4XA 1TKWB 2F0PA 1SNPA 4GN4B 2ZM6Q 2R92G 3AFPA 3T13A 1B2TA 3NXWA 3QJYA 3VDYA 2Q2UA 2KVMA 2AQ1B 4DR1Q 1YNXA 2LXJA 2RF4A 2JJQA 2RSNA 2EYPA 5D65A 4QIWB 1PTOF 5JEAH 4ABNA 3NBIA 1TS2A 2N8NA 4UY8C 2IX0A 3OYYA 1E2WA 1Q1BA 1GKHA 1VQGA 1NTGA 5M3MH 4A3DG 4G7HC 2KCMA 2QILA 2F0NA 4K2LA 2HDLA 3U4ZA 1UWVA 3TBIB 4C1NK 5IGCA 3G71A 4JYAL 3IAYA 3L0OA 1EY5A 3OMGA 1KXLA 2WFWA 1IZ6A 4A3IG 2JA7H 3D4WA 3DM1A 3PO3H 2XN9C 3VYSA 1Q1EA 4Q0FA 1SMYD 4F87A 1SMXA 4FXDA 1NCVA 4OHJA 2KHSA 3PO2G 4WFN3 3IKJA 1KDAA 5M3FH 2JA7B 3HOVB 4R4TA 1U4LA 1TXYA 3CRKC 4IPDA 1PTOB 4DK3C 2PPBC 4EQPA 1B7YB 2I5LX 3EFXD 4FXGC 1JCKB 1CI3M 1HUNA 2Z4HA 1XPOA 1AH9A 5C4HA 1YJNA 1DOKA 3BG3A 1X32A 3UE0A 4X65L 1Y69U 5E4WC 2F0FA 3DXJC 4HJ9A 5C3EB 2IT1A 3W5OA 4H7BA 1HZ9A 1Y1WB 1RL2A 4DNIA 2EZVA 3CMEA 4JI5L 2IHFA 3HGBA 2N49A 1TY2A 2ENBA 3KDFA 4LF5L 4BBSG 1Y1VB 3I4NB 4NB3A 2K75A 2VQEQ 2K52A 3I4NH 3DWAA 3KJPA 3HOUB 1H9MA 1XNQQ 5KIXA 4GKKL 1VS0A 4DR7L 1X65A 1N34Q 5JEAG 4OIJA 5IWAL 4RGOS 4R4QA 5IWAQ 1VQEA 4IJLA 1U4PA 3GTPH 3HKSA 2O4XA 2ZTDA 3BDCA 3K80C 1F9QA 3AQQA 5I9PA 3T1HL 2MO0A 4ODGA 4AYBG 1L1OB 1NBWA 1SROA 1AEXA 3HOYB 4LF7L 3BVZA 3HFZB 5I2XA 1R9TB 2XSCA 1I5FA 2PQAB 3I4OA 5EBDA 3H0GB 5IP7H 1Z6HA 1X55A 2IW3A 3CP0A 4HIOA 1Q8KA 2K5VA 3QB3A 1O7ZA 1RDPD 3QOLA 4JI3L 2JA5B 1YHBA 4GNXC 2YYZA 3FHWA 4PQXA 1FGUA 5M3FG 3OHXC 1ENCA 1Q81C 3M3YB 1YNNC 4JYAQ 3N6RA 5ELEA 4IUPA 2BCOA 3A74A 3T53B 3HOUH 1QG7A 3CF5A 1H95A 2LKVA 4NXNQ 3LX0A 1LTRD 5C3XA 1H9KA 2EYOA 5K5PA 1KD1C 5BR8Q 3CHBD 3D6CA 1F2MA 1RODA 5JJLA 2KHIA 2OXPA 1VQ5A 1PDQA 1Q86C 5AFWA 2R3ZA 2I5HA 4S3SA 3MXPA 1II3A 1RTOA 1HCZA 4IUTA 3QG1A 4POGA 1VQMA 1EZ8A 3TSSA 2F0LA 3KLSX 2Q8IB 1T5XD 1IBMQ 1GUOA 4BBSH 1GD7A 3D3RA 3H0GH 4UDUC 3I4NG 1PTOD 4JI2Q 1LABA 4J15A 5M5WB 1BXTA 4RHSA 5CBEE 2H4OA 1PZJD 1J6QA 4MTKA 2B63B 3GTMH 2JA6G 2RDFA 3BS1A 3K57A 3K5MA 1A3TA 3ER0A 1X3FA 4A3GG 2UXBQ 5C3EG 2NTSA 2L0CA 4L5QA 2KCTA 2E2IH 2BH2A 1K73C 4X3SA 4OIKA 3VA5A 4CGYB 3S1MB 1IKLA 2XGTA 4M1UB 5IGFA 4O42A 1Q90A 2WAQE 3J7A5 4AQYQ 3S16B 4LWCA 5J1ZA 5JEAJ 2QGQA 4ZK9B 4AQYL 1IW7C 3GTGH 3G7LA 3PSIA 2PZUA 5LMUQ 1D5ZC 1D5XC 3KK7A 4LF6L 4UP8A 1I50H 4UHVA 1GHJA 4HCEA 5LHY1 1N8RC 3RLFA 2VW9A 3GTPB 3CKIB 1U4RA 2WAQG 4IOAA 5ELFA 3HOWH 3GV3A 2G5DA 1HR0L 3GTLH 5I2YA 4HSVA 1I4RA 2B2VC 4ULLA 5FO9B 4R9WA 5I4DA 3EVQA 2WINB 4R8IA 1CA5A 2A8VA 3EBEA 2R7ZB 1YVCA 4LUVA 1BDOA 4QF4A 1SFOB 4N8FA 1EQVA 1HNXQ 3HOWB 3J80i 4P73A 3MXNB 4KY6A 3RUZA 2YV5A 2WV6D 1HZAA 4DR2Q 1EY6A 3RZOB 1HQMC 2KHJA 2QEXA 3FKIH 4LUZA 1Y1WH 3DLLA 1JJ2A 2F0SA 1ENFA 3SR1A 3M4QA 5C6AA 1QWYA 1EIHA 4XDXA 3CCQA 3SXHA 3W3AA 2K05A 3GTOB 1Y1VG 4R4OA 1D7QA 5LL6S 5GADC 3C1EA 3MEFA 1PXUA 3KLSA 2B3GA 4TVAB 1MSGA 1G6ZA 1XTDA 4BWGB 4L5RC 3N52A 2XRQD 2UXCQ 3A54A 3NTKA 5I9OA 1BNZA 4DR4L 4MN3A 4C2MH 1OO9B 2NVQH 2HQEA 1ESRA 1QUQA 3K8AA 2EIFA 2HDMA 2DN8A 3SGIA 3T16A 4BA1I 3OIPA 1NR4A 1N32Q 1NUCA 4B3RQ 4JVZA 4HAEA 3E9HA 4GZYC 2F0QA 4K2KA 5JOBA 2QF7A 3PIP3 2IY5B 4DN4M 5GQOA 3VR5A 4FP5D 3K81C 2NN6H 1PFSA 1WFQA 2F3IA 3RN2A 3S2HH 4RGMA 1HUMA 3WDNA 4IFDJ 3C3LA 2L55A 2A73B 3I3CA 1STNA 1CQVA 4YCVA 3BDLA 1B9MA 3PQIA 5FLXc 1PYWD 1WOCA 2RCNA 2NBFA 1Z47A 3NSWA 3V05A 1SYGA 5T1GA 1SYEA 1SNCA 2R61A 2PMZE 2RCFA 2YU9B 1EY0A 5BN4A 4A3BG 3CD6A 4GNXA 5C4ZA 1PA6A 1Q12A 1PHJA 1I4GA 1TWFB 4GKJQ 3DEPA 1XPUA 3FMCA 5FLMH 3FEWX 3HEJA 1SDFA 5M9OA 4JI8Q 2B2WC 2F0HA 4KN7C 3HKZG 4MZ9A 2E8GA 1ZEQX 4U68A 3J7YW 2K01A 1PRTC 3FVQA 1WCMG 3RZDB 1W6KA 1FL0A 2YTYA 3A8KE 2R92B 1TWGB 4YY3L 4LK1C 2R93H 2VNUD 1SE8A 2NWGA 5C44G 2EY6A 2JK8A 2VQEL 4DR3L 4RGNA 2B2UC 5L37A 1R9TH 4IUVA 4MNOA 2HT1A 4QUFA 3H94A 5C0XI 2A6EC 2HUGA 2Q2IA 2C9OA 3ICEA 3NWTA 1VQ8A 1GVPA 2MFIA 1VQDA 1VQ7A 2RBMA 5CV8A 1XMOL 1BVSA 4IALA 1VQAA 3ND8A 5ELCA 2NN6I 5HURA 4CKEA 4YCUA 1L0YB 1T9HA 1X3GA 2FHTA 5HGQA 1MD2D 1HZBA 3A55A 1MBYA 1Q7YC 3J81E 1KDCA 4YWLA 1ET6A 1QCBD 5CGKA 1EYDA 3KBXA 1CZGA 4C3HB 4C3JG 2TSSA 4PV1C 2F03A 3KF6B 3OTOL 4C3IB 4B9WA 1UE7A 5LMNL 4ZYSA 4A93H 4WJ3M 4DAYB 1Z9FA 2CWPA 1B8AA 1I50B 3QR8A 1RTNA 1GUSA 3JAMi 3PGZA 1RD9D 3H6MA 3HOZG 4A4IA 3I72A 4TRDA 3S24A 1WCMB 4DV4Q 4O1NA 3SK4A 3VA7A 5IYCH 3H3VH 2VB3X 3AYHB 3A0JA 1S3OA 3PF4A 5CV4A 1NNXA 1DM0B 3BYYB 5FK9C 2RDHA 4DV5Q 5EBCA 3NENA 3HOXG 2LMCB 4ME3A 5M5XB 2UUBL 4JI4L 4LFAL 1VF5C 3O13A 1Q46A 1E2VA 2DY8A 3E0EA 3HOVH 3PMFA 4JV5L 4DR1L 1VQFA 2NUCA 4GLAC 2Z6KC 4JI0L 2F4VL 1FYCA 4G7OC 1SR3A 3EN2A 1CSQA 1V1OA 1MIUA 4FYDA 1PH6A 4LW1A 3S2DH 4A3KG 4DAVA 4V0BA 3CCEA 5C44H 1E3PA 5IT9c 2UUAQ 4XQJA 1PVOA 2EYHA 1LTBD 2K03A 4L5SA 4XT3B 1I3QH 1ZYRC 5FLXE 1GUWA 2AWNA 5CV7A 1PH9A 5A35A 1X56A 4A3JB 3T1HQ 3DMUA 3NHHA 1PTOC 5DAUA 2OEOA 3CCVA 2B8GA 1TT2A 2G9DA 4B3SQ 3FRPB 2JA8B 2X69A 4KY7A 3UI2A 3SDZA 1B53A 2F4IA 3MVVA 1I94Q 2VXWA 4HJ5A 1IBKQ 3F2UA 4C3JB 1YBYA 4F8MA 1HJPA 2NYZD 2XRSD 3S2HB 1PV4A 1QB5D 5FOBB 3GTQB 2FMCA 2O5IC 3CC2A 2OF1A 4Y52H 3VYTA 1XPRA 2ZXRA 3FPUB 4XTCS 1J8IA 3CCUA 1L1OC 1SRUA 3H3VC 2R92H 1N9WA 2A69D 1LM0A 5T1IA 5ISRA 4A93G 2V1CC 1V1PB 1SAPA 4P2CB 1F9PA 2B2VA 2JA5H 1XNRQ 1HH2P 1SE4A 5IYDH 1QE6A 3P75A 4GOPA 4XIGS 1XXGA 2K1BA 4KI0A 2E2HB 5IYCG 2AMCB 3H91A 3Q0AA 5COYA 3I55A 3RLNA 4BY7H 2B8FA 1HZCA 5CBAE 4ID6A 2PMZB 1QNUA 4K8JA 1HFGA 1I6HH 4HIMA 1BOSA 1NAPA 1XMQQ 3CRLC 1PFMA 2OWOA 4KJOA 1WD0A 2JQOA 3BJUA 4IPGA 4RWSC 3GTJB 1XYIA 1IYVA 2R7ZG 4K6DA 2FXQA 3Q8DA 1SE2A 4A3KH 1WTXA 3TS0A 4A3GB 2SDFA 2KCCA 2MPMA 4JV5Q 1LT5D 2GN5A 2JA6B 3RMHA 4PMWA 4N9TA 2VS1A 1SYCA 3NWSA 1XWEA 1NY4A 4JI4Q 3NBHB 2JE6I 1HR0W 1FD7D 5FO8B 1JC7A 2PNHA 3EQLC 3I7FA 5J39A 4KJNA 2G9HD 1VMPA 1LT6D 3U50C 1N32L 2EJMA 1ZKOA 3NBHA 3HOXB 4WJ4A 4KKUA 1K0SA 4OL7A 3OW2A 3ERQA 2HCIA 2F0WA 1WTOA 5IP9G 1VF7A 5IT9E 3ITPA 2I5MX 1HQRD 2B2UA 1FNWA 2ICIA 4KTAA 3G4SA 3PIPA 4BS9A 3L2PA 4B9XA 3TZDA 4JI7Q 4DV6L 2K6AA 2PQEA 2L4NA 3UDFA 4TSSA 2F0EA 5LMNW 4IPCA 1PRTF 4NPSA 3U9SA 2FJ2A 1HNWQ 3KLWA 2EOTA 4XQNA 1F9RA 2EE1A 3L3OC 2F3VA 2H1EA 3W1BA 3ERSX 5EKLA 3W1GA 2VQFL 1S5CD 2JA5G 4QY7A 2SEBD 1CHPD 1CKNB 3S1QH 1YEZA 4C56C 2A68D 2N88A 1X9NA 2Z1CA 4DR5Q 5EPJA 1WYDA 2IJ0A 3OMCA 2F0IA 1GUNA 3OTOQ 2F0TA 1EIGA 1X3EA 3M4PA 3LWUA 4DV1Q 2B2WA 2K5HA 3M7GA 3J81j 5NUCA 1GUGA 2R7FA 1I4XA 2D9UA 1DYQA 3EROA 5M5WH 1S4ZA 1K0RA 1Q8IA 2AKWB 4MIUA 3J80L 1BQQT 3U58A 3K0YA 2L15A 3EJIA 1WTPA 2WIIB 1BO0A 4IFDI 3HOWG 3A56A 4YHHQ 4LJZC 1HXYD 3VR2A 1SYDA 4JCVE 2K7VA 3PIOA 1B44D 3IRBA 4NMZA 3S1RB 1LYLA 1BUVT 1HNZQ 3PUXA 2N3SA 2BOSA 2KEDA 4J6HA 1W3SA 3D31A 1OTCA 2EYLA 2I07B 2R7DA 5DNFA 3MAQA 3OPOA 2ZTCA 1CZWA 1EY8A 3SHLA 3VR4A 3UDGA 3P1HA 1YJWA 1ASZA 1DCZA 2B2TA 1F2ZA 2EY2A 3K7AB 3PF5A 1Y1WG 1CKMA 4JI7L 1H9JA 1WTRA 3CC7A 1JICA 4LF4Q 2JN4A 3ZJYC 3JAME 3KF6A 4DXFA 4A3EB 2NVYH 3NEMA 3GTMB 2VUMB 2CH4W 2E2JB 1VMCA 4CDFC 3T1YL 4B3TL 1KDBA 4CDEC 1FGBD 1J5EL 2ZJPA 1B3QA 2FMMA 4PZ8A 3DWPA 3DM3A 1SXTA 1HTPA 1U4MA 1SLJA 4MTNA 2RKSA 4UAIA 1CA6A 1KQSA 4KHZA 4FXKC 1IBML 1KL9A 4DNTB 3S9WA 5IIFA 1I4PA 1V8QA 4R8NA 4YIJA 4A3MB 1QNKA 5FO7B 4JI1L 1BR9A 4AYBE 3QWNA 5H1SE 3ND9A 5CMDA 2L12A 2EVBA 2VL6A 1NMGA 1SN8A 3IFTA 3SVMA 3PUYA 3MTSA 1TIID 3QOJA 1EU3A 2O2LD 4JW0A 3E6ZX 2B39A 1C9OA 2Z6KA 1YIJA 1JJCB 2K04A 1O80A 4NXNL 4IUQA 1QUQB 4DV7L 4PZ7A 1VQKA 1MHWC 2Q8TA 1G51A 1FVIA 2PZTA 2VUMH 2SNSA 4PMBA 4DV0L 1CQFA 3I4MH 4X3TA 1IL2A 1GHKA 2K32A 5ELOA 3KDFB 4DR4Q 4HR7B 3F2CA 2UXDL 1PYSB 4IQZA 1MJCA 1DOMA 4OONA 1K83H 1GUTA 1W6JA 4QJFA 4IN3A 3I4MB 1D5MC 2NVTB 3E0JA 1V1PA 5CV6A 4LFBQ 1K3BC 2ZTEA 5D3IB 4OO1H 4X64Q 2CW0D 1KTKA 1JOQA 2Z8LA 5KNBA 3ONAB 4IO9A 1N36L 3OW7A 2F0OA 1PLFA 4EQ5A 5M3FB 3TN2A 1W2BA 5G3LF 2MQHA 2YTVA 1JWSD 4P74A 4CKBA 4JBKA 4N8X1 1RF2D 1KNAA 1EYCA 1XNRL 1GO3E 2YU9H 5GAHC 1SMYC 2KBNA 1LTAD 1L0XB 1EYGA 1YHAA 5K36G 2ICEC 2RQXA 1S5DD 3STBC 4GLXA 2F1MA 3U9OA 1KNEA 4B3SL 1FJGL 2HQLA 5GAEC 3RR5A 3ZYYX 3GTKB 4K6LA 4AYBB 3TEHB 2E76C 3HS0C 1Y1VH 4A3MG 4QIWE 2C5CA 4K5XA 2MUYA 2R6GA 3P7JA 2NVXB 4DU9A 4GOPC 4B08A 1STEA 5EGTA 3CCRA 2KOLA 1JWUD 2D2CC 5CV5A 2K5NA 4RCOA 4KY5A 3KOJA 3ULLA 4L63B 4CHTB 1TWHH 4XXEA 1A2UA 2OTLA 4KD4A 4F7XA 1OXXK 3R8BA 5KRUA 3I73A 1PMRA 2ZT9C 1QZGA 2HHHQ 3UE1A 1JB7A 3Q22A 1O78A 1D1KA 1Q82C 3JAMc 4DV5L 5I6WA 3TP5A 2R93B 3MFYA 3OOCA 4ZCKA 2MP1A 4HJ8A 1DD2A 4DUYL 4K8IA 1STGA 3K6OA 4FDBA 5C4JH 4EQOA 4WRDA 2BDNA 3CPWA 4K0KQ 4LFCL 4ZUIA 5A2QE 4UPAA 1EOTA 2B29A 2KEEA 3T51B 2DNEA 3AEVA 4BA2I 5M3MG 1X3PA 3FDTA 4BBRB 4RMFA 3H15A 4BBRH 2QCPX 4LFAQ 3FKIB 2J7ZA 1RCVD 2UUBQ 3JC66 1EIFA 2JXMB 2XTIA 4OO1G 5FJ8G 3HOXH 1WTVA 1G291 3KUPA 1VQOA 3J7AV 4ZRZA 1QZHA 2X6LA 4JBWA 2MJ8A 4A3IH 5JVG3 5KYIA 2JA7G 1IBLL 1LLRD 4B3RL 5FLMG 4OELB 2K5DA 1JE4A 4RFBA 1IBLQ 3PO2B 1ML0D 1ICWA 5EJWA 3CW2C 3I90A 4H13C 1EFID 4Y7NH 1AW7A 1F9SA 4PG3A 1NMFA 4X66Q 1BBWA 4RCNA 4JI3Q 5GROA 4HTHA 4JPBW 4FVMA 2B2TC 3MFGA 3G6JB 3EA6A 1PFNA 2Z6BA 3CMAA 4LFCQ 3C46A 1B1ZA 2JA9A 1QVCA 5IGEA 2D0OA 4IUUA 2N78A 2PI2A 5DEHA 4FF4A 4A3FB 3VYUA 3D8GA 4QB4A 4EVOA 5KGUA 1EU4A 3CQZB 1TWCH 3BZDB 4R1JA 5E7NA 4KN4C 2E2HH 5JVH3 4JBMA 5IOCA 2RHSB 3S14B 1HPCA 4HJAA 1LT4D 2K50A 4G57A 5TSSA 1IXRA 1U5KA 4TKOB 3UDXA 4L8JA 4H44C 4OWWB 5D3DA 1BBXC 1NSNS 2EQSA 4IFDG 3DEOA 1TWAH 4NKLA 4OGQC 2VY3A 1KAWA 4N9PA 3HRZC 2EDGA 1VDZA 1KRSA 3S17H 4RH6A 1QVGA 1AE2A 1HR0Q 4BY1H 4LF5Q 2K5WA 1TQOA 4IOCA 4LMQD 4DR6Q 1KHIA 1Y8OB 2EXZA 4DA2A 2A6HC 2OQ0A 2IX1A 2WP8J 2PW5A 1STYA 1AE3A 4BY7G 4A3BB 1CT1D 4DGZA 1K83B 1ZXTA 3B6YA 3HOZH 4DR7Q 4DAPA 3A8JE 3RLOA 4CBVA 4HIKA 1J9OA 1YNJC 3WOEA 2IWHA 3GTJH 1SYBA 2E2DC 2ATWA 3MXGA 2F0MA 1KRTA 3TP7A 5BN5A 4IPHA 3KF8A 3ULJA 1WTWA 1MGSA 1LACA 4JI2L 1K28A 5ELBA 3T56B 1I4QA 1X54A 1JWMD 1KABA 1IL8A 2D5DA 5EPKA 1CHQD 4A76A 1JOOA 3E3XA 4A75A 4A3CH 1YJ9A 1IYJB 4X66L 2A6HD 4KHVA 2EYFA 2PQAA 2XVSA 3NTHA 4P75A 3BU2A 4A3EG 5IP7G 1Y14B 2RVLA 1LO5D 5HY6A 4A3LG 4FO2A 3K5NA 4C3IG 1EOVA 2I46A 1WJJA 3SK5A 3R2TA 2WKDA 4JC0A 5EAYA 5IGDA 3GTOH 2E2IB 1K8OA 1N33L 4EGVA 1X6OA 4A3FG 3Q6SA 2Z4IA 1HA6A 1KLUD 1FNUA 4OWXB 4BY7B 1C48A 2NZHA 3H0GG 4DV3Q 2BA0A 2QEJC 4NP5A 4HSPA 1B3AA 3QIAA 1GOZA 1BCPD 1SBBB 4IFDH 1STAA 2VZAA 3MXNA 1N33Q 3CQZH 5F2DA 1LV9A 1IW7D 1STBA 2ALYB 2ID0A 4BY1G 4I65A 2CH4A 3H09A 2UUCQ 1B9NA 4RAUC 3PUWA 4X3UA 4JBJA 1ASYA 1M1KC 1PH4A 3T1YQ 3BVMA 3QO2A 1VQNA 1OXUA 4X3KA 5E4XA 4OX9L 4HJ7A 5C44B 4F88A 1O7LA 4XYOA 1E1OA 4PNYA 1XMOQ 3CU7A 1TS5A 4R4IA 1HNXL 4QGUA 2UU9Q 2AQ2B 4OWTB 4ZUJA 1CUKA 1EUJA 4K0KL 2Y0SB 1NJIC 4ME5A 1JQYD 4NDXA 2DGYA 1PYBA 3T4AC 4DR3Q 3TMEA 2JSOA 3H3VI 1TVXA 4XYQA 3GTGB 1ONLA 3LGJA 2F0UA 2IL8A 4H0LC 3GTKH 5HGTA 4O2DA 3HKZE 4A3CG 1SNOA 1C8CA 3HOYG 3K5OA 2E2JH 2A74C 4FF1A 3BZKA 2UU9L 2CWAA 2LSSA 2JP1A 3L7ZC 4A3EH 1EQRA 3TS2A 2DJGC 1HA5A 2DJFC 4A3LH 5M5YB 1TU2B 2EXDA 5IYBG 4PZ6A 3TZUA 5E1FA 1H9SB 1Q3LA 5LMUL 4C3IH 3I56A 4R4CA 5G3LD 3MA2B 1E7ZA 1O7YA 4A3FH 1SNMA 1S5ED 4EX5A 4B3MQ 3SEBA 1YNND 4DUZQ 3GTQH 4LFBL 5I6YA 1TY0A 3FKIG 1CFMA 1L1OA 1VQPA 2N55A 1EZ6A 3SK8A 4PMCA 1G8ZD 2UXBL 4RG1A 4DV3L 5C0XH 1QILA 3Q23A 2CKZB 4CKCA 5KNDA 3V96A 1A6XA 1WTQA 4DV7Q 3J7ZC 1I3QB 1SNQA 1CSPA 3F1ZA 4LF9L 2AWOA 2C35B 1HNWL 4C3HH 1WI5A 5JJIA 1SJED 3KFUA 2BH8A 2A19A 3M3YH 1UEBA 1C4QA 1X3QA 1FNVA 1PH2A 1AP0A 4JI1Q 1H9RA 2PYKA 2HIVA 5BR8L 1HFNA 1PZKD 2PO4A 4ZAIA 3M4YA 2NZ1D 2FINB 1PTOH 3VR6A 5CC4A 3D0FA 4DK0A 1VQBA 4KKTA 3TQYA 3BDOA 1IHZA 3M7NA 1DOLA 3TP6A 5CV9A 5M5YH 1K8AC 2P5ZX 2YTXA 5KNCA 1DXMA 1VCIA 4YWMA 4XQQA 1SYFA 4DR2L 5BN3A 2L5TA 2EYMA 3RZOH 3G6EA 3S14H 5C0XJ 1UAPA 1D8LA 3RD4A 3J80E 2AUKA 2NN6G 3E9IA 4RA8A 1EEID 1VQIA 2JYOA 3MXUA 3A8IE 4K5WA 3A5ZB 4B3ML 5C4XB 2Z9HA 1BF4A 1AZPA 4LF7Q 3IL8A 2PI2E 2JA8G 4A3DH 2FFKB 3AMUA 4I7AA 4L6TB 1VQLA 4CDCC 3A7LA 4GS3A 1PH5A 1AZQA 1TWHB 3BVGA 4POFA 4ILWA 5J3BA 2NVQB 1HTLD 4IUNA 5IODA 4J1MA 3CPFA 2CQAA 2NVXH 3HKZB 4GKKQ 1MI2A 2VB2X 4BXXG 1U0LA 1IYUA 4M8AA 2RDGA 2M9VA 1WVLA 2D0PA 4K5VA 1B50A 1WCMH 1EEFD 3I2ZA 3TRZA 4HMJA 3FP9A 1DGSA 1FJGQ 2HCCA 3S15B 1BCPB 4DV2L 2R93G 1A8VA 3RZDH 1HNZL 4AIMA 5C4XH 4HMIA 1ILPA 3WOFA 2KCNA 4YHHL 5IY0A 1JOKA 4OX9Q 1TWCB 5C4JB 4DV0Q 3D6WA 3NP8A 1DONA 2WB1E 3W2DA 3PUVA 1N36Q 2A69C 1TS3A 3MZ5A 1VQ9A 1F2YA 3NUCA 3F8TA 2CW0C 2BE5D 2EJGC 1MJEA 3S17B 2VUMG 3J7AF 2EJFC 1TWFH 1JT8A 3MWYW 4BBRG 4DV1L 2ZXOA 2KJXA 2UUAL 1TR5A 2KUMA 5FJ8H 1D1IA 1SNDA 3HZXA 4ZLTF 4IURA 3FPPA 2EY1A 4C3JH 4TQUS 2TMPA 4A3DB 1BKBA 3GDEA 1EWIA 2GVAA 1EL0A 3MC0B 4DPGA 1IKMA
chains in the Genus database with same CATH topology
2KA7A 3C1FA 3GQBA 1UEAB 1ILQA 1I4HA 1UNSA 1EYAA 2GA4B 1LT3D 2A68C 1JB3A 2F0DA 3AU7A 1A3UA 2L1BA 2DY7A 1EY9A 1DJRD 5JPMC 1KLGD 1TS4A 1EQTA 4OO1I 2WB1B 5J22A 1LTTD 1CM9A 1H9SA 2F0JA 1EY4A 2X6GA 3R3OA 1LTID 1PRTB 2OT2A 3K5LA 2B2YC 1LTGD 1EY7A 5FLXL 2NB0A 4KK7A 3I91A 3OSOA 1HHVA 4FNFA 3DHQA 2D62A 1A2TA 3PUZA 1G2TA 3HG9A 3V2TA 3I70A 5A2QL 3C2PA 1T5EA 2ZXPA 4CJ0B 1BCPF 5DM73 1U9RA 3L9AX 4CJ2C 2QKIC 3GTLB 3GV6A 1D6EC 4LAAA 3NK9A 5IGBA 3GD7A 4HEDA 2KQ3A 1M4VA 1WD1A 1TWAB 3R93A 5D14A 4RHRA 1CTMA 1PFBA 1BCPC 2SOBA 3URYA 1SEBD 4V190 3S1QB 2EY5A 3MEHA 4Q5VA 3J81L 1SE3A 5C3WA 5LL6X 4FF2A 5KEEA 2XWBB 2BE5C 4G7ZC 2O5JC 3GP7A 4DF7A 1S5FD 2IPKD 1I6VC 2CVRA 1QOHA 2PNRC 5CORA 5ELDA 1EWCA 1M8AA 2LY7A 4WJWA 1HRJA 3S1NB 3KBGA 1LTSD 2CHBD 1MSHA 1GXDC 4DK1A 3NTIA 4MHEA 2WAQB 1AN8A 2BDOA 2LFNA 3E5SA 3M4OB 2MHVA 5C5MA 4RKBA 1STHA 1I6HB 4U673 1OXTA 5JAVA 1G2SA 4KD3A 2A5HA 1B4OA 4QMGA 1YNJD 4HN7A 4RGTA 2F0GA 1NR2A 2AQ3B 2Q8RE 1S5BD 5E3FA 3SE0A 3HOZB 1JR0D 2SNMA 3PO3B 4C2MB 4BY1B 2XNAC 1FR3A 4RKLA 2RA4A 5KYLA 2DNCA 2A6ED 4I7ZC 3PV0A 4WORA 4ZKBB 3D4RA 2JEBI 2PZWA 2L9HA 2EPBA 5C5LA 4Z9CB 3HP3A 3K58A 4C1NI 4DXGA 3NQTA 1R4PB 2PCFB 1EWHA 5JJZA 3OWEB 4G4KA 3JAML 5IGGA 3R2IA 4IZ8A 3KLRA 5CR3A 4DAYA 2RSOA 1RHPA 3S2DB 2E75C 3SK6A 2WACA 5EQ0A 2MGSA 2BA1A 3NQIA 1DZ1A 1OXVA 3M85A 3NPPA 2JEAI 1GJXA 2NTTA 3LNNA 4DFAA 3TDQA 2J0TD 1D2BA 4C3HG 4CJ1B 2XIWA 4NW2A 4QCLA 4JK1C 4ZKCB 5DM63 1RKNA 2B2YA 2M00A 1ESFA 1AFPA 2KECA 4KV6A 3X3NA 1QJOA 1JORA 3IFDA 1E0BA 2WKCA 2AUJD 3VYRA 1V43A 3TP8A 3DWQA 5FKAC 1KAAA 1G91A 3PIO3 1A3VA 2EYJA 1ENAA 1Z7TA 1K8MA 1CK1A 3MHBA 3I8ZA 3GO5A 3OIQA 1Y8NB 2QDBA 4Y7NB 4BBSB 2M2LA 4A3KB 4FF3A 5EKIA 2IX3A 4A93B 2K28A 1R4QB 5JPNC 4KMUC 4ZQ3A 2PW7A 2V4DA 4K14A 3P20A 5CYUA 1RJTA 5IT9L 1PZID 5EPLA 3VR3A 2NVYB 5K36H 1Y8PB 4HCSA 4XT1B 1UUPA 1F77A 3OWFA 2XWJB 5EKKA 5C0XG 2K33A 1PRTD 3NE5B 1F2LA 4DNRB 2K5QA 3LWEA 4A3IB 2F0VA 5M3MB 1SSOA 3X3MA 2L11A 3A7AB 3DUZA 1OXSC 3BYTB 1E2ZA 3D4DA 1XX8A 2LS01 1A15A 4EQNA 1XTCD 3I4LA 3K59A 2F0KA 4QUCA 1SJHD 2E74C 4J8QA 1ZYRD 3AB9A 4KKSA 4E6IA 1ET9A 2F3WA 3Q24A 2J4XA 1TKWB 2F0PA 1SNPA 3T13A 1B2TA 3NXWA 3QJYA 2KVMA 2AQ1B 2RSNA 5D65A 2EYPA 4QIWB 1PTOF 5JEAH 4ABNA 3NBIA 1TS2A 2IX0A 1E2WA 1Q1BA 4G7HC 2QILA 2F0NA 4K2LA 2HDLA 5IGCA 4C1NK 3TBIB 3IAYA 1EY5A 3OMGA 3D4WA 3DM1A 2XN9C 3VYSA 1Q1EA 4Q0FA 1SMYD 4F87A 4FXDA 1NCVA 4OHJA 2KHSA 4WFN3 3IKJA 1KDAA 2JA7B 3HOVB 1U4LA 3CRKC 1PTOB 2PPBC 4EQPA 3EFXD 4FXGC 1JCKB 1CI3M 1HUNA 2Z4HA 5C4HA 1DOKA 3BG3A 1X32A 1Y69U 5E4WC 2F0FA 3DXJC 5C3EB 2IT1A 4H7BA 1Y1WB 2EZVA 3HGBA 1TY2A 2ENBA 1Y1VB 3I4NB 3DWAA 3HOUB 1H9MA 5KIXA 5JEAG 4OIJA 4RGOS 1U4PA 2O4XA 3BDCA 1F9QA 5I9PA 4ODGA 1AEXA 3HOYB 3BVZA 5I2XA 1R9TB 2XSCA 5EBDA 3H0GB 1Z6HA 2IW3A 3QB3A 1O7ZA 1RDPD 3QOLA 2JA5B 2YYZA 4PQXA 3OHXC 1ENCA 3M3YB 1YNNC 3N6RA 5ELEA 4IUPA 2BCOA 3T53B 1QG7A 2LKVA 3LX0A 1LTRD 5C3XA 1H9KA 2EYOA 5K5PA 3CHBD 3D6CA 1F2MA 1RODA 2OXPA 1PDQA 5AFWA 2R3ZA 4S3SA 3MXPA 1II3A 1RTOA 1HCZA 4IUTA 3QG1A 1EZ8A 3TSSA 2F0LA 3KLSX 2Q8IB 1T5XD 1GUOA 3D3RA 4UDUC 1PTOD 1LABA 5M5WB 1BXTA 4RHSA 5CBEE 2H4OA 1PZJD 2B63B 2RDFA 3BS1A 3K57A 3K5MA 1A3TA 2NTSA 2L0CA 4X3SA 4OIKA 3VA5A 4CGYB 3S1MB 1IKLA 4M1UB 5IGFA 4O42A 1Q90A 3S16B 5J1ZA 5JEAJ 4ZK9B 1IW7C 3G7LA 2PZUA 1D5ZC 1D5XC 3KK7A 1GHJA 4HCEA 5LHY1 3RLFA 3GTPB 3CKIB 1U4RA 5ELFA 3GV3A 5I2YA 4HSVA 1I4RA 2B2VC 4ULLA 5FO9B 4R9WA 5I4DA 3EVQA 2WINB 4R8IA 1CA5A 2R7ZB 1BDOA 4QF4A 1SFOB 1EQVA 3HOWB 4KY6A 3RUZA 2WV6D 1EY6A 3RZOB 1HQMC 2F0SA 1ENFA 3SR1A 5C6AA 1QWYA 1EIHA 4XDXA 3SXHA 2K05A 3W3AA 3GTOB 5LL6S 3C1EA 1PXUA 3KLSA 1MSGA 1G6ZA 4BWGB 3N52A 2XRQD 3A54A 5I9OA 3NTKA 1BNZA 4MN3A 1OO9B 2HQEA 1ESRA 2HDMA 2DN8A 3T16A 4BA1I 3OIPA 1NR4A 1NUCA 4HAEA 4GZYC 2F0QA 4K2KA 5JOBA 2QF7A 3PIP3 4DN4M 3VR5A 4FP5D 2NN6H 4IFDJ 4RGMA 1HUMA 3WDNA 3C3LA 2L55A 2A73B 3I3CA 1STNA 1CQVA 3BDLA 1B9MA 1PYWD 2NBFA 1Z47A 3NSWA 3V05A 1SYGA 5T1GA 1SYEA 1SNCA 2R61A 2YU9B 1EY0A 5BN4A 5C4ZA 1Q12A 1I4GA 1TWFB 3DEPA 3FMCA 3FEWX 3HEJA 1SDFA 5M9OA 2B2WC 2F0HA 4KN7C 1ZEQX 4U68A 3J7YW 2K01A 1PRTC 3FVQA 3RZDB 1W6KA 3A8KE 2R92B 1TWGB 4LK1C 2VNUD 2NWGA 2EY6A 4RGNA 2B2UC 4IUVA 4QUFA 3H94A 5C0XI 2A6EC 2HUGA 2C9OA 3NWTA 2RBMA 5CV8A 4IALA 3ND8A 5ELCA 2NN6I 5HURA 4CKEA 1L0YB 2FHTA 1MD2D 3A55A 1MBYA 3J81E 1KDCA 1ET6A 1QCBD 5CGKA 1EYDA 3KBXA 1CZGA 4C3HB 4C3JG 2TSSA 4PV1C 2F03A 4C3IB 4B9WA 4ZYSA 1I50B 1RTNA 1GUSA 1RD9D 3H6MA 3I72A 4TRDA 1WCMB 4O1NA 3SK4A 3VA7A 2VB3X 5CV4A 1DM0B 3BYYB 5FK9C 2RDHA 5EBCA 2LMCB 5M5XB 1VF5C 3O13A 2DY8A 1E2VA 3PMFA 2NUCA 1FYCA 4G7OC 1V1OA 4FYDA 4DAVA 4V0BA 4XQJA 2EYHA 1LTBD 2K03A 4XT3B 5FLXE 1ZYRC 1GUWA 2AWNA 5CV7A 5A35A 4A3JB 3DMUA 3NHHA 1PTOC 5DAUA 2OEOA 2B8GA 1TT2A 2G9DA 2JA8B 3FRPB 2X69A 4KY7A 3UI2A 3SDZA 1B53A 2F4IA 3MVVA 2VXWA 3F2UA 4C3JB 4F8MA 2NYZD 2XRSD 3S2HB 1QB5D 5FOBB 3GTQB 2FMCA 2O5IC 2OF1A 3VYTA 2ZXRA 3FPUB 4XTCS 1J8IA 3H3VC 2A69D 5T1IA 5ISRA 1V1PB 1SAPA 4P2CB 1F9PA 2B2VA 1SE4A 1QE6A 3P75A 4XIGS 1XXGA 2K1BA 4KI0A 2E2HB 3H91A 3Q0AA 5COYA 2B8FA 5CBAE 4ID6A 2PMZB 1QNUA 4K8JA 1HFGA 1BOSA 1NAPA 3CRLC 1PFMA 4KJOA 1WD0A 4RWSC 3GTJB 1IYVA 1XYIA 4K6DA 1SE2A 1WTXA 4A3GB 2SDFA 2KCCA 2MPMA 1LT5D 2JA6B 3RMHA 4PMWA 4N9TA 1SYCA 3NWSA 1XWEA 2JE6I 1FD7D 5FO8B 1JC7A 3EQLC 5J39A 4KJNA 2G9HD 1VMPA 1LT6D 2EJMA 1ZKOA 3NBHA 3HOXB 4KKUA 4OL7A 3ERQA 2HCIA 2F0WA 1WTOA 1VF7A 5IT9E 3ITPA 1HQRD 2B2UA 1FNWA 2ICIA 4KTAA 4BS9A 4B9XA 3TZDA 2K6AA 2PQEA 2L4NA 4TSSA 2F0EA 1PRTF 3U9SA 2FJ2A 2EOTA 4XQNA 1F9RA 2EE1A 3L3OC 2F3VA 2H1EA 5EKLA 1S5CD 2SEBD 1CHPD 4C56C 2A68D 2N88A 2Z1CA 5EPJA 2IJ0A 3OMCA 2F0IA 1GUNA 2F0TA 1EIGA 3LWUA 2B2WA 3M7GA 5NUCA 1GUGA 1I4XA 2D9UA 1DYQA 3EROA 1S4ZA 1Q8IA 4MIUA 3J80L 1BQQT 3K0YA 3EJIA 1WTPA 2WIIB 1BO0A 4IFDI 3A56A 4LJZC 1HXYD 3VR2A 1SYDA 2K7VA 3S1RB 1B44D 4NMZA 1BUVT 3PUXA 2BOSA 2KEDA 4J6HA 3D31A 2EYLA 2I07B 3MAQA 5DNFA 3OPOA 1CZWA 1EY8A 3SHLA 3VR4A 3P1HA 1DCZA 2B2TA 1F2ZA 2EY2A 3K7AB 1H9JA 1WTRA 1JICA 3JAME 4DXFA 4A3EB 3GTMB 2VUMB 2E2JB 1VMCA 1KDBA 1FGBD 2FMMA 3DWPA 1SXTA 1HTPA 1U4MA 2RKSA 4UAIA 1CA6A 4KHZA 4FXKC 4DNTB 3S9WA 5IIFA 1I4PA 1V8QA 4R8NA 4YIJA 4A3MB 1QNKA 5FO7B 1BR9A 3QWNA 3ND9A 5CMDA 2L12A 2EVBA 3IFTA 3SVMA 3PUYA 3MTSA 1TIID 3QOJA 1EU3A 2O2LD 3E6ZX 2B39A 2K04A 1O80A 4IUQA 2Q8TA 2PZTA 2SNSA 4PMBA 1CQFA 4X3TA 1GHKA 2K32A 4HR7B 4IQZA 1DOMA 1GUTA 1W6JA 4IN3A 3I4MB 1D5MC 2NVTB 3E0JA 1V1PA 5CV6A 4OO1H 5D3IB 2CW0D 1KTKA 1JOQA 2Z8LA 5KNBA 3ONAB 3OW7A 2F0OA 1PLFA 5M3FB 3TN2A 5G3LF 1JWSD 4CKBA 1RF2D 1KNAA 1EYCA 1SMYC 1LTAD 1L0XB 5K36G 2ICEC 2RQXA 1S5DD 2F1MA 3U9OA 1KNEA 3ZYYX 3GTKB 4K6LA 4AYBB 2E76C 3HS0C 2C5CA 4K5XA 2MUYA 2R6GA 3P7JA 2NVXB 4DU9A 4B08A 1STEA 5EGTA 2KOLA 1JWUD 2D2CC 5CV5A 4RCOA 4KY5A 4L63B 4CHTB 4XXEA 1A2UA 4KD4A 4F7XA 1OXXK 3R8BA 5KRUA 3I73A 1PMRA 2ZT9C 3Q22A 1O78A 1D1KA 5I6WA 3TP5A 2R93B 3MFYA 3OOCA 2MP1A 1DD2A 4K8IA 1STGA 3K6OA 4EQOA 4WRDA 2BDNA 4ZUIA 5A2QE 1EOTA 2KEEA 3T51B 2DNEA 4BA2I 1X3PA 3FDTA 4BBRB 2QCPX 3FKIB 2J7ZA 1RCVD 2JXMB 4OO1G 1WTVA 1G291 3KUPA 3J7AV 4ZRZA 2X6LA 4JBWA 2MJ8A 5JVG3 5KYIA 1LLRD 3PO2B 2K5DA 1JE4A 4RFBA 1ML0D 1ICWA 5EJWA 3I90A 4H13C 1EFID 1AW7A 1F9SA 4RCNA 4HTHA 4FVMA 2B2TC 3MFGA 3G6JB 3EA6A 1PFNA 3C46A 1B1ZA 5IGEA 4IUUA 5DEHA 4FF4A 4A3FB 3VYUA 3D8GA 4QB4A 4EVOA 5KGUA 1EU4A 3CQZB 3BZDB 4KN4C 5JVH3 5IOCA 3S14B 1HPCA 1LT4D 4G57A 5TSSA 4TKOB 4L8JA 4H44C 5D3DA 1BBXC 1NSNS 4IFDG 3DEOA 4OGQC 4NKLA 4N9PA 3HRZC 2EDGA 1VDZA 4RH6A 2K5WA 1TQOA 4LMQD 1Y8OB 2EXZA 4DA2A 2A6HC 2IX1A 2WP8J 2PW5A 1STYA 4A3BB 1CT1D 4DGZA 1K83B 1ZXTA 4DAPA 3A8JE 4CBVA 1J9OA 1YNJC 3WOEA 2IWHA 1SYBA 2E2DC 3MXGA 2F0MA 3TP7A 5BN5A 3KF8A 1WTWA 1MGSA 1LACA 5ELBA 3T56B 1I4QA 1JWMD 1KABA 1IL8A 2D5DA 5EPKA 1CHQD 1JOOA 2A6HD 4KHVA 2EYFA 2XVSA 3NTHA 2RVLA 1LO5D 4FO2A 3K5NA 4C3IG 2I46A 3SK5A 3R2TA 2WKDA 5IGDA 2E2IB 1K8OA 4EGVA 3Q6SA 2Z4IA 1HA6A 1KLUD 1FNUA 4BY7B 1C48A 2BA0A 2QEJC 4NP5A 4HSPA 1B3AA 3QIAA 1GOZA 1BCPD 1SBBB 4IFDH 1STAA 3MXNA 5F2DA 1LV9A 1IW7D 1STBA 2ID0A 4I65A 3H09A 1B9NA 4RAUC 3PUWA 4X3UA 3BVMA 3QO2A 1OXUA 4X3KA 5E4XA 5C44B 4F88A 1O7LA 4XYOA 4PNYA 3CU7A 1TS5A 2AQ2B 4ZUJA 2Y0SB 4ME5A 1JQYD 4NDXA 3T4AC 3TMEA 2JSOA 1TVXA 4XYQA 3GTGB 1ONLA 2F0UA 2IL8A 4H0LC 5HGTA 1SNOA 1C8CA 3K5OA 2A74C 4FF1A 2JP1A 3L7ZC 1HA5A 5M5YB 1TU2B 3TZUA 5E1FA 1H9SB 1Q3LA 5G3LD 3MA2B 1O7YA 1SNMA 1S5ED 3SEBA 1YNND 5I6YA 1TY0A 1CFMA 2N55A 1EZ6A 3SK8A 4PMCA 1G8ZD 5C0XH 1QILA 3Q23A 4CKCA 5KNDA 3V96A 1A6XA 1WTQA 1I3QB 1SNQA 2AWOA 1SJED 1C4QA 1X3QA 1FNVA 1AP0A 1H9RA 2PYKA 1HFNA 1PZKD 2PO4A 4ZAIA 3M4YA 2NZ1D 2FINB 1PTOH 3VR6A 5CC4A 4DK0A 4KKTA 3BDOA 1IHZA 3M7NA 1DOLA 3TP6A 5CV9A 5KNCA 1DXMA 1VCIA 4XQQA 1SYFA 5BN3A 2L5TA 2EYMA 5C0XJ 1UAPA 3RD4A 3J80E 2AUKA 2NN6G 4RA8A 1EEID 2JYOA 3MXUA 3A8IE 4K5WA 5C4XB 1BF4A 1AZPA 3IL8A 2FFKB 3AMUA 4L6TB 3A7LA 1AZQA 1TWHB 3BVGA 4ILWA 2NVQB 1HTLD 4IUNA 5IODA 4J1MA 2CQAA 3HKZB 1MI2A 2VB2X 1IYUA 4M8AA 2RDGA 2M9VA 1WVLA 4K5VA 1B50A 1EEFD 4HMJA 2HCCA 3S15B 1BCPB 4HMIA 1ILPA 3WOFA 2KCNA 1JOKA 1TWCB 5C4JB 3D6WA 3NP8A 1DONA 3W2DA 3PUVA 2A69C 1TS3A 3MZ5A 1F2YA 3NUCA 2CW0C 2BE5D 2EJGC 3S17B 3J7AF 2EJFC 3MWYW 2ZXOA 2KJXA 1TR5A 2KUMA 1D1IA 1SNDA 3HZXA 4ZLTF 4IURA 3FPPA 2EY1A 4TQUS 2TMPA 4A3DB 1EL0A 3MC0B 1IKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SK4 A;  2PW7 A;  4KJO A;  5KYI A;  3NQT A;  1KAB A;  4K14 A;  4K5W A;  1SYG A;  2F0N A;  1SYD A;  1SYE A;  2SOB A;  3C1F A;  4K2L A;  5CV4 A;  5IGC A;  5CV6 A;  4K6D A;  1SNC A;  1JOO A;  1EY0 A;  4NMZ A;  3QB3 A;  5E1F A;  3QOL A;  2EY5 A;  1EYA A;  1EY5 A;  3MEH A;  3OMG A;  5C4Z A;  1JOQ A;  4KHV A;  2EYF A;  3VA5 A;  5IGG A;  4IZ8 A;  2F0O A;  3PMF A;  4J6H A;  5CR3 A;  3D4W A;  4N9T A;  1ENC A;  3HEJ A;  1SYC A;  2EYL A;  2NUC A;  5C3W A;  5M9O A;  5KEE A;  2F0H A;  1SNM A;  2F0D A;  1EYC A;  3SHL A;  1EY8 A;  4DF7 A;  3SK6 A;  4HTH A;  3EVQ A;  2KHS A;  1A3U A;  2WAC A;  3OWF A;  3P1H A;  5EKK A;  5I6Y A;  1KDA A;  1F2Z A;  2EY2 A;  1EY9 A;  2LKV A;  3SK5 A;  5J39 A;  3LX0 A;  4KJN A;  4QF4 A;  4IUN A;  5IGD A;  1EQV A;  2EYH A;  4EQO A;  4J1M A;  5IOD A;  5C3X A;  2EYO A;  3U9O A;  4EQP A;  5IGE A;  5K5P A;  4KY6 A;  4DFA A;  5CV7 A;  3RUZ A;  5DEH A;  1EZ6 A;  3SK8 A;  3D6C A;  1F2M A;  3D8G A;  4QB4 A;  4OL7 A;  1EY6 A;  4PMC A;  2OXP A;  3DMU A;  3NHH A;  3ERQ A;  5DAU A;  4EVO A;  2F0W A;  2EY6 A;  5J22 A;  2OEO A;  5KGU A;  2F0V A;  5C4H A;  3ITP A;  1TT2 A;  4S3S A;  3MXP A;  4K5X A;  1II3 A;  4K5V A;  2F0S A;  4F8M A;  2F0J A;  4NP5 A;  4KY7 A;  4KTA A;  1KDB A;  1EZ8 A;  1EY4 A;  4HMJ A;  3SR1 A;  2F0L A;  3R3O A;  4B9X A;  5IOC A;  1STA A;  2F0F A;  5C6A A;  3E5S A;  4DU9 A;  3MVV A;  1SNQ A;  5EGT A;  4H7B A;  2PQE A;  1RKN A;  3SXH A;  2M00 A;  2F0E A;  4HMI A;  5F2D A;  2RBM A;  4G57 A;  4KV6 A;  5C5M A;  4RKB A;  1STB A;  5CV5 A;  1EY7 A;  1STH A;  3C1E A;  5CV8 A;  4I65 A;  4KY5 A;  2RKS A;  4IAL A;  1A2U A;  3OSO A;  1JOR A;  1NSN S;  4KD4 A;  1JOK A;  3DHQ A;  4F7X A;  5JAV A;  1A2T A;  3D4D A;  2OF1 A;  5HUR A;  4KD3 A;  3V2T A;  5KRU A;  2ENB A;  4NKL A;  3S9W A;  5IIF A;  4QMG A;  4R8N A;  5I9O A;  2F3V A;  2RDF A;  4N9P A;  4YIJ A;  3NP8 A;  3TP8 A;  1A3T A;  4EQN A;  5EKL A;  1KAA A;  2HQE A;  2F0G A;  5I6W A;  2F0K A;  2PYK A;  3TP5 A;  3MZ5 A;  5KIX A;  1A3V A;  1F2Y A;  4PNY A;  5E3F A;  2EYJ A;  1ENA A;  1TQO A;  3NUC A;  1U9R A;  1KDC A;  5ISR A;  2SNM A;  3T16 A;  4E6I A;  5CGK A;  1EYD A;  2EXZ A;  5CC4 A;  4K8I A;  1STG A;  3QOJ A;  4ZUJ A;  1NUC A;  2F3W A;  3OMC A;  2F0I A;  3MHB A;  2PW5 A;  4RKL A;  4WRD A;  2F0T A;  1IHZ A;  2F0Q A;  1STY A;  2F0P A;  3NK9 A;  1SNP A;  4K2K A;  4LAA A;  5JOB A;  4ME5 A;  4DGZ A;  5IGB A;  4ZUI A;  1TR5 A;  5CV9 A;  3TP6 A;  4B9W A;  5KYL A;  4NDX A;  4WOR A;  5NUC A;  3T13 A;  5IGF A;  3NXW A;  1SND A;  3P75 A;  3HZX A;  3ERO A;  3TME A;  2O4X A;  2PZW A;  3BDC A;  2PZT A;  2EYP A;  2EY1 A;  2SNS A;  4MIU A;  4PMB A;  2QDB A;  5J1Z A;  2KQ3 A;  5I9P A;  1SYF A;  4ODG A;  1SYB A;  2F0U A;  2PZU A;  1STN A;  3H6M A;  1AEX A;  2EYM A;  3EJI A;  2F0M A;  5C5L A;  5HGT A;  4ID6 A;  3TP7 A;  1SNO A;  4K8J A;  3BDL A;  4TRD A;  4ZQ3 A; 
#chains in the Genus database with same CATH topology
 4DUY Q;  2KA7 A;  3C1F A;  3GQB A;  4HID A;  4DV4 L;  4UP7 A;  1UEA B;  1ILQ A;  1I4H A;  1UNS A;  3F2D A;  2ES2 A;  1EYA A;  2GA4 B;  1LT3 D;  5AJ3 Q;  1QVF A;  2A68 C;  1KC8 C;  2CCZ A;  1JB3 A;  2F0D A;  3AU7 A;  3CAM A;  4LF4 L;  1A62 A;  1A3U A;  4BXX H;  2L1B A;  2DY7 A;  1EY9 A;  1C0A A;  4KHP L;  1DJR D;  5JPM C;  1J5E Q;  1KLG D;  1TS4 A;  1EQT A;  3RNU A;  1VQ4 A;  4OO1 I;  3PO2 H;  3HOU G;  2WB1 B;  5J22 A;  1LTT D;  1CM9 A;  1H9S A;  2B63 G;  4YWK A;  2F0J A;  1EY4 A;  1TWG H;  2X6G A;  3R3O A;  1LTI D;  1PRT B;  2OT2 A;  2MNA A;  1N34 L;  1S72 A;  3K5L A;  2B2Y C;  1ICF B;  3RN5 A;  3CCS A;  1LTG D;  1EY7 A;  2E5L L;  5FLX L;  4GLV B;  2NB0 A;  4KK7 A;  3I91 A;  3OSO A;  3S15 H;  1HHV A;  4FNF A;  3DHQ A;  2D62 A;  1A2T A;  3PUZ A;  1EQQ A;  1G2T A;  2LXK A;  3HG9 A;  2RHQ B;  3V2T A;  4LF8 L;  4GN3 B;  3BZC A;  3I70 A;  5A2Q L;  4JI5 Q;  2DUD A;  1T5E A;  3C2P A;  2ZXP A;  1PH1 A;  4CJ0 B;  1BCP F;  1P8L A;  1U9R A;  3L9A X;  5DM7 3;  4CJ2 C;  2QKI C;  3GTL B;  3GV6 A;  1L2F A;  1D6E C;  2QDL A;  4LAA A;  3NK9 A;  5GAG C;  5IGB A;  5C3E H;  3EIV A;  1XJV A;  3M4O H;  2UXD Q;  3GD7 A;  3KF8 B;  4HED A;  3NEL A;  4IJH A;  1EFW A;  2IHE A;  2KQ3 A;  1M4V A;  1WD1 A;  1TWA B;  3R93 A;  4GKJ L;  5D14 A;  4ALP A;  4A3J H;  5IYD G;  1CKN A;  4RHR A;  1CTM A;  1PFB A;  4QL5 A;  3S1M H;  1BCP C;  4DV6 Q;  2SOB A;  4DR5 L;  2Q2T A;  1IBK L;  3URY A;  1SEB D;  4V19 0;  4X62 L;  4NXM Q;  3S1Q B;  2EY5 A;  3MEH A;  3KJO A;  4Q5V A;  3J81 L;  1LTL A;  1SE3 A;  2R7Z H;  5C3W A;  5LL6 X;  4FF2 A;  5KEE A;  2XWB B;  3CCJ A;  2BE5 C;  4UP9 A;  4APV A;  4G7Z C;  2O5J C;  3GP7 A;  4DF7 A;  1YZ6 A;  1S5F D;  2IPK D;  1I6V C;  2Z0S A;  5IP9 H;  2CVR A;  4O0A A;  1QOH A;  2PNR C;  2B63 H;  5COR A;  5ELD A;  1EWC A;  1M8A A;  2LY7 A;  4OXP A;  4WJW A;  4AH6 A;  1HRJ A;  3S1N B;  3KBG A;  1LTS D;  2CHB D;  2NVT H;  1YI2 A;  1MSH A;  1GXD C;  4JOI A;  1L0W A;  4DK1 A;  3NTI A;  5AJ3 L;  4MHE A;  1E24 A;  2WAQ B;  1AN8 A;  3CCL A;  2ZM6 L;  2BDO A;  2LFN A;  3J80 c;  2MO1 A;  5LMN Q;  3E5S A;  3M4O B;  3UDI A;  2I0Q A;  1LUZ A;  2MHV A;  3J81 i;  5C5M A;  4RKB A;  2NZO A;  1STH A;  1I6H B;  4U67 3;  1OXT A;  1A63 A;  2ZJR A;  5JAV A;  1G2S A;  4B3T Q;  4KD3 A;  2A5H A;  1B4O A;  4CDD C;  2HHH L;  4QMG A;  2A1A A;  1YNJ D;  3CC4 A;  1VQC A;  4HN7 A;  4RGT A;  2F0G A;  4GNX B;  1NR2 A;  2AQ3 B;  2Q8R E;  1S5B D;  5E3F A;  4X62 Q;  3STB D;  3SE0 A;  1MKH A;  3ULP A;  3HOZ B;  1JR0 D;  2SNM A;  4LUO A;  1K9M C;  3PO3 B;  4C2M B;  4BY1 B;  2XNA C;  2JA6 H;  1FR3 A;  4A3G H;  2CQO A;  4RKL A;  2RA4 A;  5KYL A;  2DNC A;  2A6E D;  4A3J G;  4I7Z C;  4DV2 Q;  3PV0 A;  3KYH C;  4WOR A;  4ZKB B;  1YIT A;  3HOY H;  3D4R A;  1PH3 A;  1A0I A;  2JEB I;  2PZW A;  4JI6 L;  1JJG A;  2L9H A;  2EPB A;  5C5L A;  4Z9C B;  4YY3 Q;  3S1R H;  5IYB H;  3HP3 A;  3K58 A;  4C1N I;  4DK6 C;  2HD3 A;  2E5L Q;  2F52 A;  4DXG A;  4X6A H;  3CCM A;  3NQT A;  1R4P B;  2PCF B;  2WB1 G;  1B70 B;  1EWH A;  5JJZ A;  3OWE B;  4G4K A;  4LNQ A;  4JI8 L;  4LF6 Q;  3JAM L;  5IGG A;  1SFO H;  3R2I A;  4IZ8 A;  3K7A H;  3KLR A;  4P72 A;  4JI6 Q;  5CR3 A;  4X64 L;  4DAY A;  2RSO A;  1RHP A;  3S2D B;  1VQH A;  4KLK A;  2E75 C;  3SK6 A;  4JG2 A;  4A3B H;  2WAC A;  2Y0S E;  1UE6 A;  2MGS A;  5EQ0 A;  1G6P A;  2BA1 A;  2GVB A;  3NQI A;  4GOP B;  1DZ1 A;  1OXV A;  5IE8 A;  3M85 A;  3NPP A;  3PCO B;  2JEA I;  1GJX A;  2NTT A;  3LNN A;  1I94 L;  4DFA A;  3TDQ A;  2J0T D;  2VQF Q;  2ASB A;  1D2B A;  1BBU A;  4C3H G;  4H02 A;  4P71 A;  1PH7 A;  4CJ1 B;  2XIW A;  3S1N H;  4NW2 A;  4QCL A;  3AFQ A;  4JK1 C;  2Y0S G;  4ZKC B;  3G48 A;  1RKN A;  5DM6 3;  2B2Y A;  1NE3 A;  2M00 A;  1ESF A;  1AFP A;  2KEC A;  4KV6 A;  2UUC L;  3X3N A;  1QJO A;  3U4V A;  1JOR A;  3IFD A;  1E0B A;  2WKC A;  2AUJ D;  3VYR A;  4YCW A;  4JI0 Q;  1V43 A;  1RIP A;  3TP8 A;  3DWQ A;  5FKA C;  4NXM L;  3J81 c;  1KAA A;  1G91 A;  3PIO 3;  1YHQ A;  2UXC L;  1A3V A;  2EYJ A;  1ENA A;  1Z7T A;  1M90 C;  1K8M A;  1CK1 A;  1VQJ A;  3I4M G;  3MHB A;  2OTJ A;  3TRE A;  3I8Z A;  2QW7 A;  3GO5 A;  3OIQ A;  1Y8N B;  2QDB A;  1JMC A;  4Y7N B;  4BBS B;  1C7Y A;  2M2L A;  4A3K B;  4FF3 A;  1V9P A;  5EKI A;  2IX3 A;  4A93 B;  1UE5 A;  4DAM A;  2K28 A;  1R4Q B;  5JPN C;  4KMU C;  4ZQ3 A;  2JA8 H;  4QQB X;  1EIY B;  3WWV A;  2PW7 A;  1XMQ L;  2V4D A;  4K14 A;  3P20 A;  5CYU A;  2OCE A;  4LF9 Q;  1RJT A;  5IT9 L;  2OQK A;  2KEN A;  3CXC A;  1PZI D;  5EPL A;  3VR3 A;  4GN5 A;  2NVY B;  3A5U A;  4LF8 Q;  5K36 H;  1Y8P B;  4HCS A;  4XT1 B;  1UUP A;  1KIX A;  1F77 A;  1E1T A;  2XWJ B;  3OWF A;  5EKK A;  5C0X G;  3HOV G;  2K33 A;  1PRT D;  4A3M H;  1WTH A;  2K4K A;  3PO3 G;  5M5X H;  3K7U C;  2HIX A;  5JJK A;  3NE5 B;  1F2L A;  1JE5 A;  4DUZ L;  4DR6 L;  4OEM B;  1UE1 A;  4DKA C;  5C4X G;  4JOI C;  4DNR B;  2K5Q A;  1XNQ L;  3LWE A;  4A3I B;  2F0V A;  5M3M B;  1SSO A;  1V1Q A;  3X3M A;  1VQ6 A;  3S16 H;  2L11 A;  3F2B A;  4KHP Q;  1P16 A;  3A7A B;  1CKO A;  2H5X A;  3DUZ A;  1K3R A;  1OXS C;  4L5T A;  2QA4 A;  3BYT B;  1E22 A;  1GM5 A;  1E2Z A;  5ELN A;  2CFM A;  2F4V Q;  3M9B A;  3D4D A;  3K0X A;  1XX8 A;  2LS0 1;  2Q2H A;  5DLQ E;  4X65 Q;  1A15 A;  2ZJQ A;  1O7I A;  4EQN A;  1XTC D;  3I4L A;  3K59 A;  2F0K A;  1S40 A;  2K14 A;  1PH8 A;  4QUC A;  1SJH D;  2E74 C;  2AHO B;  4J8Q A;  1ZYR D;  3AB9 A;  4KKS A;  4E6I A;  1ET9 A;  1K8G A;  2F3W A;  3Q24 A;  2J4X A;  1TKW B;  2F0P A;  1SNP A;  4GN4 B;  2ZM6 Q;  2R92 G;  3AFP A;  3T13 A;  1B2T A;  3NXW A;  3QJY A;  3VDY A;  2Q2U A;  2KVM A;  2AQ1 B;  4DR1 Q;  1YNX A;  2LXJ A;  2RF4 A;  2JJQ A;  2RSN A;  2EYP A;  5D65 A;  4QIW B;  1PTO F;  5JEA H;  4ABN A;  3NBI A;  1TS2 A;  2N8N A;  4UY8 C;  2IX0 A;  3OYY A;  1E2W A;  1Q1B A;  1GKH A;  1VQG A;  1NTG A;  5M3M H;  4A3D G;  4G7H C;  2KCM A;  2QIL A;  2F0N A;  4K2L A;  2HDL A;  3U4Z A;  1UWV A;  3TBI B;  4C1N K;  5IGC A;  3G71 A;  4JYA L;  3IAY A;  3L0O A;  1EY5 A;  3OMG A;  1KXL A;  2WFW A;  1IZ6 A;  4A3I G;  2JA7 H;  3D4W A;  3DM1 A;  3PO3 H;  2XN9 C;  3VYS A;  1Q1E A;  4Q0F A;  1SMY D;  4F87 A;  1SMX A;  4FXD A;  1NCV A;  4OHJ A;  2KHS A;  3PO2 G;  4WFN 3;  3IKJ A;  1KDA A;  5M3F H;  2JA7 B;  3HOV B;  4R4T A;  1U4L A;  1TXY A;  3CRK C;  4IPD A;  1PTO B;  4DK3 C;  2PPB C;  4EQP A;  1B7Y B;  2I5L X;  3EFX D;  4FXG C;  1JCK B;  1CI3 M;  1HUN A;  2Z4H A;  1XPO A;  1AH9 A;  5C4H A;  1YJN A;  1DOK A;  3BG3 A;  1X32 A;  3UE0 A;  4X65 L;  1Y69 U;  5E4W C;  2F0F A;  3DXJ C;  4HJ9 A;  5C3E B;  2IT1 A;  3W5O A;  4H7B A;  1HZ9 A;  1Y1W B;  1RL2 A;  4DNI A;  2EZV A;  3CME A;  4JI5 L;  2IHF A;  3HGB A;  2N49 A;  1TY2 A;  2ENB A;  3KDF A;  4LF5 L;  4BBS G;  1Y1V B;  3I4N B;  4NB3 A;  2K75 A;  2VQE Q;  2K52 A;  3I4N H;  3DWA A;  3KJP A;  3HOU B;  1H9M A;  1XNQ Q;  5KIX A;  4GKK L;  1VS0 A;  4DR7 L;  1X65 A;  1N34 Q;  5JEA G;  4OIJ A;  5IWA L;  4RGO S;  4R4Q A;  5IWA Q;  1VQE A;  4IJL A;  1U4P A;  3GTP H;  3HKS A;  2O4X A;  2ZTD A;  3BDC A;  3K80 C;  1F9Q A;  3AQQ A;  5I9P A;  3T1H L;  2MO0 A;  4ODG A;  4AYB G;  1L1O B;  1NBW A;  1SRO A;  1AEX A;  3HOY B;  4LF7 L;  3BVZ A;  3HFZ B;  5I2X A;  1R9T B;  2XSC A;  1I5F A;  2PQA B;  3I4O A;  5EBD A;  3H0G B;  5IP7 H;  1Z6H A;  1X55 A;  2IW3 A;  3CP0 A;  4HIO A;  1Q8K A;  2K5V A;  3QB3 A;  1O7Z A;  1RDP D;  3QOL A;  4JI3 L;  2JA5 B;  1YHB A;  4GNX C;  2YYZ A;  3FHW A;  4PQX A;  1FGU A;  5M3F G;  3OHX C;  1ENC A;  1Q81 C;  3M3Y B;  1YNN C;  4JYA Q;  3N6R A;  5ELE A;  4IUP A;  2BCO A;  3A74 A;  3T53 B;  3HOU H;  1QG7 A;  3CF5 A;  1H95 A;  2LKV A;  4NXN Q;  3LX0 A;  1LTR D;  5C3X A;  1H9K A;  2EYO A;  5K5P A;  1KD1 C;  5BR8 Q;  3CHB D;  3D6C A;  1F2M A;  1ROD A;  5JJL A;  2KHI A;  2OXP A;  1VQ5 A;  1PDQ A;  1Q86 C;  5AFW A;  2R3Z A;  2I5H A;  4S3S A;  3MXP A;  1II3 A;  1RTO A;  1HCZ A;  4IUT A;  3QG1 A;  4POG A;  1VQM A;  1EZ8 A;  3TSS A;  2F0L A;  3KLS X;  2Q8I B;  1T5X D;  1IBM Q;  1GUO A;  4BBS H;  1GD7 A;  3D3R A;  3H0G H;  4UDU C;  3I4N G;  1PTO D;  4JI2 Q;  1LAB A;  4J15 A;  5M5W B;  1BXT A;  4RHS A;  5CBE E;  2H4O A;  1PZJ D;  1J6Q A;  4MTK A;  2B63 B;  3GTM H;  2JA6 G;  2RDF A;  3BS1 A;  3K57 A;  3K5M A;  1A3T A;  3ER0 A;  1X3F A;  4A3G G;  2UXB Q;  5C3E G;  2NTS A;  2L0C A;  4L5Q A;  2KCT A;  2E2I H;  2BH2 A;  1K73 C;  4X3S A;  4OIK A;  3VA5 A;  4CGY B;  3S1M B;  1IKL A;  2XGT A;  4M1U B;  5IGF A;  4O42 A;  1Q90 A;  2WAQ E;  3J7A 5;  4AQY Q;  3S16 B;  4LWC A;  5J1Z A;  5JEA J;  2QGQ A;  4ZK9 B;  4AQY L;  1IW7 C;  3GTG H;  3G7L A;  3PSI A;  2PZU A;  5LMU Q;  1D5Z C;  1D5X C;  3KK7 A;  4LF6 L;  4UP8 A;  1I50 H;  4UHV A;  1GHJ A;  4HCE A;  5LHY 1;  1N8R C;  3RLF A;  2VW9 A;  3GTP B;  3CKI B;  1U4R A;  2WAQ G;  4IOA A;  5ELF A;  3HOW H;  3GV3 A;  2G5D A;  1HR0 L;  3GTL H;  5I2Y A;  4HSV A;  1I4R A;  2B2V C;  4ULL A;  5FO9 B;  4R9W A;  5I4D A;  3EVQ A;  2WIN B;  4R8I A;  1CA5 A;  2A8V A;  3EBE A;  2R7Z B;  1YVC A;  4LUV A;  1BDO A;  4QF4 A;  1SFO B;  4N8F A;  1EQV A;  1HNX Q;  3HOW B;  3J80 i;  4P73 A;  3MXN B;  4KY6 A;  3RUZ A;  2YV5 A;  2WV6 D;  1HZA A;  4DR2 Q;  1EY6 A;  3RZO B;  1HQM C;  2KHJ A;  2QEX A;  3FKI H;  4LUZ A;  1Y1W H;  3DLL A;  1JJ2 A;  2F0S A;  1ENF A;  3SR1 A;  3M4Q A;  5C6A A;  1QWY A;  1EIH A;  4XDX A;  3CCQ A;  3SXH A;  3W3A A;  2K05 A;  3GTO B;  1Y1V G;  4R4O A;  1D7Q A;  5LL6 S;  5GAD C;  3C1E A;  3MEF A;  1PXU A;  3KLS A;  2B3G A;  4TVA B;  1MSG A;  1G6Z A;  1XTD A;  4BWG B;  4L5R C;  3N52 A;  2XRQ D;  2UXC Q;  3A54 A;  3NTK A;  5I9O A;  1BNZ A;  4DR4 L;  4MN3 A;  4C2M H;  1OO9 B;  2NVQ H;  2HQE A;  1ESR A;  1QUQ A;  3K8A A;  2EIF A;  2HDM A;  2DN8 A;  3SGI A;  3T16 A;  4BA1 I;  3OIP A;  1NR4 A;  1N32 Q;  1NUC A;  4B3R Q;  4JVZ A;  4HAE A;  3E9H A;  4GZY C;  2F0Q A;  4K2K A;  5JOB A;  2QF7 A;  3PIP 3;  2IY5 B;  4DN4 M;  5GQO A;  3VR5 A;  4FP5 D;  3K81 C;  2NN6 H;  1PFS A;  1WFQ A;  2F3I A;  3RN2 A;  3S2H H;  4RGM A;  1HUM A;  3WDN A;  4IFD J;  3C3L A;  2L55 A;  2A73 B;  3I3C A;  1STN A;  1CQV A;  4YCV A;  3BDL A;  1B9M A;  3PQI A;  5FLX c;  1PYW D;  1WOC A;  2RCN A;  2NBF A;  1Z47 A;  3NSW A;  3V05 A;  1SYG A;  5T1G A;  1SYE A;  1SNC A;  2R61 A;  2PMZ E;  2RCF A;  2YU9 B;  1EY0 A;  5BN4 A;  4A3B G;  3CD6 A;  4GNX A;  5C4Z A;  1PA6 A;  1Q12 A;  1PHJ A;  1I4G A;  1TWF B;  4GKJ Q;  3DEP A;  1XPU A;  3FMC A;  5FLM H;  3FEW X;  3HEJ A;  1SDF A;  5M9O A;  4JI8 Q;  2B2W C;  2F0H A;  4KN7 C;  3HKZ G;  4MZ9 A;  2E8G A;  1ZEQ X;  4U68 A;  3J7Y W;  2K01 A;  1PRT C;  3FVQ A;  1WCM G;  3RZD B;  1W6K A;  1FL0 A;  2YTY A;  3A8K E;  2R92 B;  1TWG B;  4YY3 L;  4LK1 C;  2R93 H;  2VNU D;  1SE8 A;  2NWG A;  5C44 G;  2EY6 A;  2JK8 A;  2VQE L;  4DR3 L;  4RGN A;  2B2U C;  5L37 A;  1R9T H;  4IUV A;  4MNO A;  2HT1 A;  4QUF A;  3H94 A;  5C0X I;  2A6E C;  2HUG A;  2Q2I A;  2C9O A;  3ICE A;  3NWT A;  1VQ8 A;  1GVP A;  2MFI A;  1VQD A;  1VQ7 A;  2RBM A;  5CV8 A;  1XMO L;  1BVS A;  4IAL A;  1VQA A;  3ND8 A;  5ELC A;  2NN6 I;  5HUR A;  4CKE A;  4YCU A;  1L0Y B;  1T9H A;  1X3G A;  2FHT A;  5HGQ A;  1MD2 D;  1HZB A;  3A55 A;  1MBY A;  1Q7Y C;  3J81 E;  1KDC A;  4YWL A;  1ET6 A;  1QCB D;  5CGK A;  1EYD A;  3KBX A;  1CZG A;  4C3H B;  4C3J G;  2TSS A;  4PV1 C;  2F03 A;  3KF6 B;  3OTO L;  4C3I B;  4B9W A;  1UE7 A;  5LMN L;  4ZYS A;  4A93 H;  4WJ3 M;  4DAY B;  1Z9F A;  2CWP A;  1B8A A;  1I50 B;  3QR8 A;  1RTN A;  1GUS A;  3JAM i;  3PGZ A;  1RD9 D;  3H6M A;  3HOZ G;  4A4I A;  3I72 A;  4TRD A;  3S24 A;  1WCM B;  4DV4 Q;  4O1N A;  3SK4 A;  3VA7 A;  5IYC H;  3H3V H;  2VB3 X;  3AYH B;  3A0J A;  1S3O A;  3PF4 A;  5CV4 A;  1NNX A;  1DM0 B;  3BYY B;  5FK9 C;  2RDH A;  4DV5 Q;  5EBC A;  3NEN A;  3HOX G;  2LMC B;  4ME3 A;  5M5X B;  2UUB L;  4JI4 L;  4LFA L;  1VF5 C;  3O13 A;  1Q46 A;  1E2V A;  2DY8 A;  3E0E A;  3HOV H;  3PMF A;  4JV5 L;  4DR1 L;  1VQF A;  2NUC A;  4GLA C;  2Z6K C;  4JI0 L;  2F4V L;  1FYC A;  4G7O C;  1SR3 A;  3EN2 A;  1CSQ A;  1V1O A;  1MIU A;  4FYD A;  1PH6 A;  4LW1 A;  3S2D H;  4A3K G;  4DAV A;  4V0B A;  3CCE A;  5C44 H;  1E3P A;  5IT9 c;  2UUA Q;  4XQJ A;  1PVO A;  2EYH A;  1LTB D;  2K03 A;  4L5S A;  4XT3 B;  1I3Q H;  1ZYR C;  5FLX E;  1GUW A;  2AWN A;  5CV7 A;  1PH9 A;  5A35 A;  1X56 A;  4A3J B;  3T1H Q;  3DMU A;  3NHH A;  1PTO C;  5DAU A;  2OEO A;  3CCV A;  2B8G A;  1TT2 A;  2G9D A;  4B3S Q;  3FRP B;  2JA8 B;  2X69 A;  4KY7 A;  3UI2 A;  3SDZ A;  1B53 A;  2F4I A;  3MVV A;  1I94 Q;  2VXW A;  4HJ5 A;  1IBK Q;  3F2U A;  4C3J B;  1YBY A;  4F8M A;  1HJP A;  2NYZ D;  2XRS D;  3S2H B;  1PV4 A;  1QB5 D;  5FOB B;  3GTQ B;  2FMC A;  2O5I C;  3CC2 A;  2OF1 A;  4Y52 H;  3VYT A;  1XPR A;  2ZXR A;  3FPU B;  4XTC S;  1J8I A;  3CCU A;  1L1O C;  1SRU A;  3H3V C;  2R92 H;  1N9W A;  2A69 D;  1LM0 A;  5T1I A;  5ISR A;  4A93 G;  2V1C C;  1V1P B;  1SAP A;  4P2C B;  1F9P A;  2B2V A;  2JA5 H;  1XNR Q;  1HH2 P;  1SE4 A;  5IYD H;  1QE6 A;  3P75 A;  4GOP A;  4XIG S;  1XXG A;  2K1B A;  4KI0 A;  2E2H B;  5IYC G;  2AMC B;  3H91 A;  3Q0A A;  5COY A;  3I55 A;  3RLN A;  4BY7 H;  2B8F A;  1HZC A;  5CBA E;  4ID6 A;  2PMZ B;  1QNU A;  4K8J A;  1HFG A;  1I6H H;  4HIM A;  1BOS A;  1NAP A;  1XMQ Q;  3CRL C;  1PFM A;  2OWO A;  4KJO A;  1WD0 A;  2JQO A;  3BJU A;  4IPG A;  4RWS C;  3GTJ B;  1XYI A;  1IYV A;  2R7Z G;  4K6D A;  2FXQ A;  3Q8D A;  1SE2 A;  4A3K H;  1WTX A;  3TS0 A;  4A3G B;  2SDF A;  2KCC A;  2MPM A;  4JV5 Q;  1LT5 D;  2GN5 A;  2JA6 B;  3RMH A;  4PMW A;  4N9T A;  2VS1 A;  1SYC A;  3NWS A;  1XWE A;  1NY4 A;  4JI4 Q;  3NBH B;  2JE6 I;  1HR0 W;  1FD7 D;  5FO8 B;  1JC7 A;  2PNH A;  3EQL C;  3I7F A;  5J39 A;  4KJN A;  2G9H D;  1VMP A;  1LT6 D;  3U50 C;  1N32 L;  2EJM A;  1ZKO A;  3NBH A;  3HOX B;  4WJ4 A;  4KKU A;  1K0S A;  4OL7 A;  3OW2 A;  3ERQ A;  2HCI A;  2F0W A;  1WTO A;  5IP9 G;  1VF7 A;  5IT9 E;  3ITP A;  2I5M X;  1HQR D;  2B2U A;  1FNW A;  2ICI A;  4KTA A;  3G4S A;  3PIP A;  4BS9 A;  3L2P A;  4B9X A;  3TZD A;  4JI7 Q;  4DV6 L;  2K6A A;  2PQE A;  2L4N A;  3UDF A;  4TSS A;  2F0E A;  5LMN W;  4IPC A;  1PRT F;  4NPS A;  3U9S A;  2FJ2 A;  1HNW Q;  3KLW A;  2EOT A;  4XQN A;  1F9R A;  2EE1 A;  3L3O C;  2F3V A;  2H1E A;  3W1B A;  3ERS X;  5EKL A;  3W1G A;  2VQF L;  1S5C D;  2JA5 G;  4QY7 A;  2SEB D;  1CHP D;  1CKN B;  3S1Q H;  1YEZ A;  4C56 C;  2A68 D;  2N88 A;  1X9N A;  2Z1C A;  4DR5 Q;  5EPJ A;  1WYD A;  2IJ0 A;  3OMC A;  2F0I A;  1GUN A;  3OTO Q;  2F0T A;  1EIG A;  1X3E A;  3M4P A;  3LWU A;  4DV1 Q;  2B2W A;  2K5H A;  3M7G A;  3J81 j;  5NUC A;  1GUG A;  2R7F A;  1I4X A;  2D9U A;  1DYQ A;  3ERO A;  5M5W H;  1S4Z A;  1K0R A;  1Q8I A;  2AKW B;  4MIU A;  3J80 L;  1BQQ T;  3U58 A;  3K0Y A;  2L15 A;  3EJI A;  1WTP A;  2WII B;  1BO0 A;  4IFD I;  3HOW G;  3A56 A;  4YHH Q;  4LJZ C;  1HXY D;  3VR2 A;  1SYD A;  4JCV E;  2K7V A;  3PIO A;  1B44 D;  3IRB A;  4NMZ A;  3S1R B;  1LYL A;  1BUV T;  1HNZ Q;  3PUX A;  2N3S A;  2BOS A;  2KED A;  4J6H A;  1W3S A;  3D31 A;  1OTC A;  2EYL A;  2I07 B;  2R7D A;  5DNF A;  3MAQ A;  3OPO A;  2ZTC A;  1CZW A;  1EY8 A;  3SHL A;  3VR4 A;  3UDG A;  3P1H A;  1YJW A;  1ASZ A;  1DCZ A;  2B2T A;  1F2Z A;  2EY2 A;  3K7A B;  3PF5 A;  1Y1W G;  1CKM A;  4JI7 L;  1H9J A;  1WTR A;  3CC7 A;  1JIC A;  4LF4 Q;  2JN4 A;  3ZJY C;  3JAM E;  3KF6 A;  4DXF A;  4A3E B;  2NVY H;  3NEM A;  3GTM B;  2VUM B;  2CH4 W;  2E2J B;  1VMC A;  4CDF C;  3T1Y L;  4B3T L;  1KDB A;  4CDE C;  1FGB D;  1J5E L;  2ZJP A;  1B3Q A;  2FMM A;  4PZ8 A;  3DWP A;  3DM3 A;  1SXT A;  1HTP A;  1U4M A;  1SLJ A;  4MTN A;  2RKS A;  4UAI A;  1CA6 A;  1KQS A;  4KHZ A;  4FXK C;  1IBM L;  1KL9 A;  4DNT B;  3S9W A;  5IIF A;  1I4P A;  1V8Q A;  4R8N A;  4YIJ A;  4A3M B;  1QNK A;  5FO7 B;  4JI1 L;  1BR9 A;  4AYB E;  3QWN A;  5H1S E;  3ND9 A;  5CMD A;  2L12 A;  2EVB A;  2VL6 A;  1NMG A;  1SN8 A;  3IFT A;  3SVM A;  3PUY A;  3MTS A;  1TII D;  3QOJ A;  1EU3 A;  2O2L D;  4JW0 A;  3E6Z X;  2B39 A;  1C9O A;  2Z6K A;  1YIJ A;  1JJC B;  2K04 A;  1O80 A;  4NXN L;  4IUQ A;  1QUQ B;  4DV7 L;  4PZ7 A;  1VQK A;  1MHW C;  2Q8T A;  1G51 A;  1FVI A;  2PZT A;  2VUM H;  2SNS A;  4PMB A;  4DV0 L;  1CQF A;  3I4M H;  4X3T A;  1IL2 A;  1GHK A;  2K32 A;  5ELO A;  3KDF B;  4DR4 Q;  4HR7 B;  3F2C A;  2UXD L;  1PYS B;  4IQZ A;  1MJC A;  1DOM A;  4OON A;  1K83 H;  1GUT A;  1W6J A;  4QJF A;  4IN3 A;  3I4M B;  1D5M C;  2NVT B;  3E0J A;  1V1P A;  5CV6 A;  4LFB Q;  1K3B C;  2ZTE A;  5D3I B;  4OO1 H;  4X64 Q;  2CW0 D;  1KTK A;  1JOQ A;  2Z8L A;  5KNB A;  3ONA B;  4IO9 A;  1N36 L;  3OW7 A;  2F0O A;  1PLF A;  4EQ5 A;  5M3F B;  3TN2 A;  1W2B A;  5G3L F;  2MQH A;  2YTV A;  1JWS D;  4P74 A;  4CKB A;  4JBK A;  4N8X 1;  1RF2 D;  1KNA A;  1EYC A;  1XNR L;  1GO3 E;  2YU9 H;  5GAH C;  1SMY C;  2KBN A;  1LTA D;  1L0X B;  1EYG A;  1YHA A;  5K36 G;  2ICE C;  2RQX A;  1S5D D;  3STB C;  4GLX A;  2F1M A;  3U9O A;  1KNE A;  4B3S L;  1FJG L;  2HQL A;  5GAE C;  3RR5 A;  3ZYY X;  3GTK B;  4K6L A;  4AYB B;  3TEH B;  2E76 C;  3HS0 C;  1Y1V H;  4A3M G;  4QIW E;  2C5C A;  4K5X A;  2MUY A;  2R6G A;  3P7J A;  2NVX B;  4DU9 A;  4GOP C;  4B08 A;  1STE A;  5EGT A;  3CCR A;  2KOL A;  1JWU D;  2D2C C;  5CV5 A;  2K5N A;  4RCO A;  4KY5 A;  3KOJ A;  3ULL A;  4L63 B;  4CHT B;  1TWH H;  4XXE A;  1A2U A;  2OTL A;  4KD4 A;  4F7X A;  1OXX K;  3R8B A;  5KRU A;  3I73 A;  1PMR A;  2ZT9 C;  1QZG A;  2HHH Q;  3UE1 A;  1JB7 A;  3Q22 A;  1O78 A;  1D1K A;  1Q82 C;  3JAM c;  4DV5 L;  5I6W A;  3TP5 A;  2R93 B;  3MFY A;  3OOC A;  4ZCK A;  2MP1 A;  4HJ8 A;  1DD2 A;  4DUY L;  4K8I A;  1STG A;  3K6O A;  4FDB A;  5C4J H;  4EQO A;  4WRD A;  2BDN A;  3CPW A;  4K0K Q;  4LFC L;  4ZUI A;  5A2Q E;  4UPA A;  1EOT A;  2B29 A;  2KEE A;  3T51 B;  2DNE A;  3AEV A;  4BA2 I;  5M3M G;  1X3P A;  3FDT A;  4BBR B;  4RMF A;  3H15 A;  4BBR H;  2QCP X;  4LFA Q;  3FKI B;  2J7Z A;  1RCV D;  2UUB Q;  3JC6 6;  1EIF A;  2JXM B;  2XTI A;  4OO1 G;  5FJ8 G;  3HOX H;  1WTV A;  1G29 1;  3KUP A;  1VQO A;  3J7A V;  4ZRZ A;  1QZH A;  2X6L A;  4JBW A;  2MJ8 A;  4A3I H;  5JVG 3;  5KYI A;  2JA7 G;  1IBL L;  1LLR D;  4B3R L;  5FLM G;  4OEL B;  2K5D A;  1JE4 A;  4RFB A;  1IBL Q;  3PO2 B;  1ML0 D;  1ICW A;  5EJW A;  3CW2 C;  3I90 A;  4H13 C;  1EFI D;  4Y7N H;  1AW7 A;  1F9S A;  4PG3 A;  1NMF A;  4X66 Q;  1BBW A;  4RCN A;  4JI3 Q;  5GRO A;  4HTH A;  4JPB W;  4FVM A;  2B2T C;  3MFG A;  3G6J B;  3EA6 A;  1PFN A;  2Z6B A;  3CMA A;  4LFC Q;  3C46 A;  1B1Z A;  2JA9 A;  1QVC A;  5IGE A;  2D0O A;  4IUU A;  2N78 A;  2PI2 A;  5DEH A;  4FF4 A;  4A3F B;  3VYU A;  3D8G A;  4QB4 A;  4EVO A;  5KGU A;  1EU4 A;  3CQZ B;  1TWC H;  3BZD B;  4R1J A;  5E7N A;  4KN4 C;  2E2H H;  5JVH 3;  4JBM A;  5IOC A;  2RHS B;  3S14 B;  1HPC A;  4HJA A;  1LT4 D;  2K50 A;  4G57 A;  5TSS A;  1IXR A;  1U5K A;  4TKO B;  3UDX A;  4L8J A;  4H44 C;  4OWW B;  5D3D A;  1BBX C;  1NSN S;  2EQS A;  4IFD G;  3DEO A;  1TWA H;  4NKL A;  4OGQ C;  2VY3 A;  1KAW A;  4N9P A;  3HRZ C;  2EDG A;  1VDZ A;  1KRS A;  3S17 H;  4RH6 A;  1QVG A;  1AE2 A;  1HR0 Q;  4BY1 H;  4LF5 Q;  2K5W A;  1TQO A;  4IOC A;  4LMQ D;  4DR6 Q;  1KHI A;  1Y8O B;  2EXZ A;  4DA2 A;  2A6H C;  2OQ0 A;  2IX1 A;  2WP8 J;  2PW5 A;  1STY A;  1AE3 A;  4BY7 G;  4A3B B;  1CT1 D;  4DGZ A;  1K83 B;  1ZXT A;  3B6Y A;  3HOZ H;  4DR7 Q;  4DAP A;  3A8J E;  3RLO A;  4CBV A;  4HIK A;  1J9O A;  1YNJ C;  3WOE A;  2IWH A;  3GTJ H;  1SYB A;  2E2D C;  2ATW A;  3MXG A;  2F0M A;  1KRT A;  3TP7 A;  5BN5 A;  4IPH A;  3KF8 A;  3ULJ A;  1WTW A;  1MGS A;  1LAC A;  4JI2 L;  1K28 A;  5ELB A;  3T56 B;  1I4Q A;  1X54 A;  1JWM D;  1KAB A;  1IL8 A;  2D5D A;  5EPK A;  1CHQ D;  4A76 A;  1JOO A;  3E3X A;  4A75 A;  4A3C H;  1YJ9 A;  1IYJ B;  4X66 L;  2A6H D;  4KHV A;  2EYF A;  2PQA A;  2XVS A;  3NTH A;  4P75 A;  3BU2 A;  4A3E G;  5IP7 G;  1Y14 B;  2RVL A;  1LO5 D;  5HY6 A;  4A3L G;  4FO2 A;  3K5N A;  4C3I G;  1EOV A;  2I46 A;  1WJJ A;  3SK5 A;  3R2T A;  2WKD A;  4JC0 A;  5EAY A;  5IGD A;  3GTO H;  2E2I B;  1K8O A;  1N33 L;  4EGV A;  1X6O A;  4A3F G;  3Q6S A;  2Z4I A;  1HA6 A;  1KLU D;  1FNU A;  4OWX B;  4BY7 B;  1C48 A;  2NZH A;  3H0G G;  4DV3 Q;  2BA0 A;  2QEJ C;  4NP5 A;  4HSP A;  1B3A A;  3QIA A;  1GOZ A;  1BCP D;  1SBB B;  4IFD H;  1STA A;  2VZA A;  3MXN A;  1N33 Q;  3CQZ H;  5F2D A;  1LV9 A;  1IW7 D;  1STB A;  2ALY B;  2ID0 A;  4BY1 G;  4I65 A;  2CH4 A;  3H09 A;  2UUC Q;  1B9N A;  4RAU C;  3PUW A;  4X3U A;  4JBJ A;  1ASY A;  1M1K C;  1PH4 A;  3T1Y Q;  3BVM A;  3QO2 A;  1VQN A;  1OXU A;  4X3K A;  5E4X A;  4OX9 L;  4HJ7 A;  5C44 B;  4F88 A;  1O7L A;  4XYO A;  1E1O A;  4PNY A;  1XMO Q;  3CU7 A;  1TS5 A;  4R4I A;  1HNX L;  4QGU A;  2UU9 Q;  2AQ2 B;  4OWT B;  4ZUJ A;  1CUK A;  1EUJ A;  4K0K L;  2Y0S B;  1NJI C;  4ME5 A;  1JQY D;  4NDX A;  2DGY A;  1PYB A;  3T4A C;  4DR3 Q;  3TME A;  2JSO A;  3H3V I;  1TVX A;  4XYQ A;  3GTG B;  1ONL A;  3LGJ A;  2F0U A;  2IL8 A;  4H0L C;  3GTK H;  5HGT A;  4O2D A;  3HKZ E;  4A3C G;  1SNO A;  1C8C A;  3HOY G;  3K5O A;  2E2J H;  2A74 C;  4FF1 A;  3BZK A;  2UU9 L;  2CWA A;  2LSS A;  2JP1 A;  3L7Z C;  4A3E H;  1EQR A;  3TS2 A;  2DJG C;  1HA5 A;  2DJF C;  4A3L H;  5M5Y B;  1TU2 B;  2EXD A;  5IYB G;  4PZ6 A;  3TZU A;  5E1F A;  1H9S B;  1Q3L A;  5LMU L;  4C3I H;  3I56 A;  4R4C A;  5G3L D;  3MA2 B;  1E7Z A;  1O7Y A;  4A3F H;  1SNM A;  1S5E D;  4EX5 A;  4B3M Q;  3SEB A;  1YNN D;  4DUZ Q;  3GTQ H;  4LFB L;  5I6Y A;  1TY0 A;  3FKI G;  1CFM A;  1L1O A;  1VQP A;  2N55 A;  1EZ6 A;  3SK8 A;  4PMC A;  1G8Z D;  2UXB L;  4RG1 A;  4DV3 L;  5C0X H;  1QIL A;  3Q23 A;  2CKZ B;  4CKC A;  5KND A;  3V96 A;  1A6X A;  1WTQ A;  4DV7 Q;  3J7Z C;  1I3Q B;  1SNQ A;  1CSP A;  3F1Z A;  4LF9 L;  2AWO A;  2C35 B;  1HNW L;  4C3H H;  1WI5 A;  5JJI A;  1SJE D;  3KFU A;  2BH8 A;  2A19 A;  3M3Y H;  1UEB A;  1C4Q A;  1X3Q A;  1FNV A;  1PH2 A;  1AP0 A;  4JI1 Q;  1H9R A;  2PYK A;  2HIV A;  5BR8 L;  1HFN A;  1PZK D;  2PO4 A;  4ZAI A;  3M4Y A;  2NZ1 D;  2FIN B;  1PTO H;  3VR6 A;  5CC4 A;  3D0F A;  4DK0 A;  1VQB A;  4KKT A;  3TQY A;  3BDO A;  1IHZ A;  3M7N A;  1DOL A;  3TP6 A;  5CV9 A;  5M5Y H;  1K8A C;  2P5Z X;  2YTX A;  5KNC A;  1DXM A;  1VCI A;  4YWM A;  4XQQ A;  1SYF A;  4DR2 L;  5BN3 A;  2L5T A;  2EYM A;  3RZO H;  3G6E A;  3S14 H;  5C0X J;  1UAP A;  1D8L A;  3RD4 A;  3J80 E;  2AUK A;  2NN6 G;  3E9I A;  4RA8 A;  1EEI D;  1VQI A;  2JYO A;  3MXU A;  3A8I E;  4K5W A;  3A5Z B;  4B3M L;  5C4X B;  2Z9H A;  1BF4 A;  1AZP A;  4LF7 Q;  3IL8 A;  2PI2 E;  2JA8 G;  4A3D H;  2FFK B;  3AMU A;  4I7A A;  4L6T B;  1VQL A;  4CDC C;  3A7L A;  4GS3 A;  1PH5 A;  1AZQ A;  1TWH B;  3BVG A;  4POF A;  4ILW A;  5J3B A;  2NVQ B;  1HTL D;  4IUN A;  5IOD A;  4J1M A;  3CPF A;  2CQA A;  2NVX H;  3HKZ B;  4GKK Q;  1MI2 A;  2VB2 X;  4BXX G;  1U0L A;  1IYU A;  4M8A A;  2RDG A;  2M9V A;  1WVL A;  2D0P A;  4K5V A;  1B50 A;  1WCM H;  1EEF D;  3I2Z A;  3TRZ A;  4HMJ A;  3FP9 A;  1DGS A;  1FJG Q;  2HCC A;  3S15 B;  1BCP B;  4DV2 L;  2R93 G;  1A8V A;  3RZD H;  1HNZ L;  4AIM A;  5C4X H;  4HMI A;  1ILP A;  3WOF A;  2KCN A;  4YHH L;  5IY0 A;  1JOK A;  4OX9 Q;  1TWC B;  5C4J B;  4DV0 Q;  3D6W A;  3NP8 A;  1DON A;  2WB1 E;  3W2D A;  3PUV A;  1N36 Q;  2A69 C;  1TS3 A;  3MZ5 A;  1VQ9 A;  1F2Y A;  3NUC A;  3F8T A;  2CW0 C;  2BE5 D;  2EJG C;  1MJE A;  3S17 B;  2VUM G;  3J7A F;  2EJF C;  1TWF H;  1JT8 A;  3MWY W;  4BBR G;  4DV1 L;  2ZXO A;  2KJX A;  2UUA L;  1TR5 A;  2KUM A;  5FJ8 H;  1D1I A;  1SND A;  3HZX A;  4ZLT F;  4IUR A;  3FPP A;  2EY1 A;  4C3J H;  4TQU S;  2TMP A;  4A3D B;  1BKB A;  3GDE A;  1EWI A;  2GVA A;  1EL0 A;  3MC0 B;  4DPG A;  1IKM A; 
#chains in the Genus database with same CATH homology
 2KA7 A;  3C1F A;  3GQB A;  1UEA B;  1ILQ A;  1I4H A;  1UNS A;  1EYA A;  2GA4 B;  1LT3 D;  2A68 C;  1JB3 A;  2F0D A;  3AU7 A;  1A3U A;  2L1B A;  2DY7 A;  1EY9 A;  1DJR D;  5JPM C;  1KLG D;  1TS4 A;  1EQT A;  4OO1 I;  2WB1 B;  5J22 A;  1LTT D;  1CM9 A;  1H9S A;  2F0J A;  1EY4 A;  2X6G A;  3R3O A;  1LTI D;  1PRT B;  2OT2 A;  3K5L A;  2B2Y C;  1LTG D;  1EY7 A;  5FLX L;  2NB0 A;  4KK7 A;  3I91 A;  3OSO A;  1HHV A;  4FNF A;  3DHQ A;  2D62 A;  1A2T A;  3PUZ A;  1G2T A;  3HG9 A;  3V2T A;  3I70 A;  5A2Q L;  3C2P A;  1T5E A;  2ZXP A;  4CJ0 B;  1BCP F;  5DM7 3;  1U9R A;  3L9A X;  4CJ2 C;  2QKI C;  3GTL B;  3GV6 A;  1D6E C;  4LAA A;  3NK9 A;  5IGB A;  3GD7 A;  4HED A;  2KQ3 A;  1M4V A;  1WD1 A;  1TWA B;  3R93 A;  5D14 A;  4RHR A;  1CTM A;  1PFB A;  1BCP C;  2SOB A;  3URY A;  1SEB D;  4V19 0;  3S1Q B;  2EY5 A;  3MEH A;  4Q5V A;  3J81 L;  1SE3 A;  5C3W A;  5LL6 X;  4FF2 A;  5KEE A;  2XWB B;  2BE5 C;  4G7Z C;  2O5J C;  3GP7 A;  4DF7 A;  1S5F D;  2IPK D;  1I6V C;  2CVR A;  1QOH A;  2PNR C;  5COR A;  5ELD A;  1EWC A;  1M8A A;  2LY7 A;  4WJW A;  1HRJ A;  3S1N B;  3KBG A;  1LTS D;  2CHB D;  1MSH A;  1GXD C;  4DK1 A;  3NTI A;  4MHE A;  2WAQ B;  1AN8 A;  2BDO A;  2LFN A;  3E5S A;  3M4O B;  2MHV A;  5C5M A;  4RKB A;  1STH A;  1I6H B;  4U67 3;  1OXT A;  5JAV A;  1G2S A;  4KD3 A;  2A5H A;  1B4O A;  4QMG A;  1YNJ D;  4HN7 A;  4RGT A;  2F0G A;  1NR2 A;  2AQ3 B;  2Q8R E;  1S5B D;  5E3F A;  3SE0 A;  3HOZ B;  1JR0 D;  2SNM A;  3PO3 B;  4C2M B;  4BY1 B;  2XNA C;  1FR3 A;  4RKL A;  2RA4 A;  5KYL A;  2DNC A;  2A6E D;  4I7Z C;  3PV0 A;  4WOR A;  4ZKB B;  3D4R A;  2JEB I;  2PZW A;  2L9H A;  2EPB A;  5C5L A;  4Z9C B;  3HP3 A;  3K58 A;  4C1N I;  4DXG A;  3NQT A;  1R4P B;  2PCF B;  1EWH A;  5JJZ A;  3OWE B;  4G4K A;  3JAM L;  5IGG A;  3R2I A;  4IZ8 A;  3KLR A;  5CR3 A;  4DAY A;  2RSO A;  1RHP A;  3S2D B;  2E75 C;  3SK6 A;  2WAC A;  5EQ0 A;  2MGS A;  2BA1 A;  3NQI A;  1DZ1 A;  1OXV A;  3M85 A;  3NPP A;  2JEA I;  1GJX A;  2NTT A;  3LNN A;  4DFA A;  3TDQ A;  2J0T D;  1D2B A;  4C3H G;  4CJ1 B;  2XIW A;  4NW2 A;  4QCL A;  4JK1 C;  4ZKC B;  5DM6 3;  1RKN A;  2B2Y A;  2M00 A;  1ESF A;  1AFP A;  2KEC A;  4KV6 A;  3X3N A;  1QJO A;  1JOR A;  3IFD A;  1E0B A;  2WKC A;  2AUJ D;  3VYR A;  1V43 A;  3TP8 A;  3DWQ A;  5FKA C;  1KAA A;  1G91 A;  3PIO 3;  1A3V A;  2EYJ A;  1ENA A;  1Z7T A;  1K8M A;  1CK1 A;  3MHB A;  3I8Z A;  3GO5 A;  3OIQ A;  1Y8N B;  2QDB A;  4Y7N B;  4BBS B;  2M2L A;  4A3K B;  4FF3 A;  5EKI A;  2IX3 A;  4A93 B;  2K28 A;  1R4Q B;  5JPN C;  4KMU C;  4ZQ3 A;  2PW7 A;  2V4D A;  4K14 A;  3P20 A;  5CYU A;  1RJT A;  5IT9 L;  1PZI D;  5EPL A;  3VR3 A;  2NVY B;  5K36 H;  1Y8P B;  4HCS A;  4XT1 B;  1UUP A;  1F77 A;  3OWF A;  2XWJ B;  5EKK A;  5C0X G;  2K33 A;  1PRT D;  3NE5 B;  1F2L A;  4DNR B;  2K5Q A;  3LWE A;  4A3I B;  2F0V A;  5M3M B;  1SSO A;  3X3M A;  2L11 A;  3A7A B;  3DUZ A;  1OXS C;  3BYT B;  1E2Z A;  3D4D A;  1XX8 A;  2LS0 1;  1A15 A;  4EQN A;  1XTC D;  3I4L A;  3K59 A;  2F0K A;  4QUC A;  1SJH D;  2E74 C;  4J8Q A;  1ZYR D;  3AB9 A;  4KKS A;  4E6I A;  1ET9 A;  2F3W A;  3Q24 A;  2J4X A;  1TKW B;  2F0P A;  1SNP A;  3T13 A;  1B2T A;  3NXW A;  3QJY A;  2KVM A;  2AQ1 B;  2RSN A;  5D65 A;  2EYP A;  4QIW B;  1PTO F;  5JEA H;  4ABN A;  3NBI A;  1TS2 A;  2IX0 A;  1E2W A;  1Q1B A;  4G7H C;  2QIL A;  2F0N A;  4K2L A;  2HDL A;  5IGC A;  4C1N K;  3TBI B;  3IAY A;  1EY5 A;  3OMG A;  3D4W A;  3DM1 A;  2XN9 C;  3VYS A;  1Q1E A;  4Q0F A;  1SMY D;  4F87 A;  4FXD A;  1NCV A;  4OHJ A;  2KHS A;  4WFN 3;  3IKJ A;  1KDA A;  2JA7 B;  3HOV B;  1U4L A;  3CRK C;  1PTO B;  2PPB C;  4EQP A;  3EFX D;  4FXG C;  1JCK B;  1CI3 M;  1HUN A;  2Z4H A;  5C4H A;  1DOK A;  3BG3 A;  1X32 A;  1Y69 U;  5E4W C;  2F0F A;  3DXJ C;  5C3E B;  2IT1 A;  4H7B A;  1Y1W B;  2EZV A;  3HGB A;  1TY2 A;  2ENB A;  1Y1V B;  3I4N B;  3DWA A;  3HOU B;  1H9M A;  5KIX A;  5JEA G;  4OIJ A;  4RGO S;  1U4P A;  2O4X A;  3BDC A;  1F9Q A;  5I9P A;  4ODG A;  1AEX A;  3HOY B;  3BVZ A;  5I2X A;  1R9T B;  2XSC A;  5EBD A;  3H0G B;  1Z6H A;  2IW3 A;  3QB3 A;  1O7Z A;  1RDP D;  3QOL A;  2JA5 B;  2YYZ A;  4PQX A;  3OHX C;  1ENC A;  3M3Y B;  1YNN C;  3N6R A;  5ELE A;  4IUP A;  2BCO A;  3T53 B;  1QG7 A;  2LKV A;  3LX0 A;  1LTR D;  5C3X A;  1H9K A;  2EYO A;  5K5P A;  3CHB D;  3D6C A;  1F2M A;  1ROD A;  2OXP A;  1PDQ A;  5AFW A;  2R3Z A;  4S3S A;  3MXP A;  1II3 A;  1RTO A;  1HCZ A;  4IUT A;  3QG1 A;  1EZ8 A;  3TSS A;  2F0L A;  3KLS X;  2Q8I B;  1T5X D;  1GUO A;  3D3R A;  4UDU C;  1PTO D;  1LAB A;  5M5W B;  1BXT A;  4RHS A;  5CBE E;  2H4O A;  1PZJ D;  2B63 B;  2RDF A;  3BS1 A;  3K57 A;  3K5M A;  1A3T A;  2NTS A;  2L0C A;  4X3S A;  4OIK A;  3VA5 A;  4CGY B;  3S1M B;  1IKL A;  4M1U B;  5IGF A;  4O42 A;  1Q90 A;  3S16 B;  5J1Z A;  5JEA J;  4ZK9 B;  1IW7 C;  3G7L A;  2PZU A;  1D5Z C;  1D5X C;  3KK7 A;  1GHJ A;  4HCE A;  5LHY 1;  3RLF A;  3GTP B;  3CKI B;  1U4R A;  5ELF A;  3GV3 A;  5I2Y A;  4HSV A;  1I4R A;  2B2V C;  4ULL A;  5FO9 B;  4R9W A;  5I4D A;  3EVQ A;  2WIN B;  4R8I A;  1CA5 A;  2R7Z B;  1BDO A;  4QF4 A;  1SFO B;  1EQV A;  3HOW B;  4KY6 A;  3RUZ A;  2WV6 D;  1EY6 A;  3RZO B;  1HQM C;  2F0S A;  1ENF A;  3SR1 A;  5C6A A;  1QWY A;  1EIH A;  4XDX A;  3SXH A;  2K05 A;  3W3A A;  3GTO B;  5LL6 S;  3C1E A;  1PXU A;  3KLS A;  1MSG A;  1G6Z A;  4BWG B;  3N52 A;  2XRQ D;  3A54 A;  5I9O A;  3NTK A;  1BNZ A;  4MN3 A;  1OO9 B;  2HQE A;  1ESR A;  2HDM A;  2DN8 A;  3T16 A;  4BA1 I;  3OIP A;  1NR4 A;  1NUC A;  4HAE A;  4GZY C;  2F0Q A;  4K2K A;  5JOB A;  2QF7 A;  3PIP 3;  4DN4 M;  3VR5 A;  4FP5 D;  2NN6 H;  4IFD J;  4RGM A;  1HUM A;  3WDN A;  3C3L A;  2L55 A;  2A73 B;  3I3C A;  1STN A;  1CQV A;  3BDL A;  1B9M A;  1PYW D;  2NBF A;  1Z47 A;  3NSW A;  3V05 A;  1SYG A;  5T1G A;  1SYE A;  1SNC A;  2R61 A;  2YU9 B;  1EY0 A;  5BN4 A;  5C4Z A;  1Q12 A;  1I4G A;  1TWF B;  3DEP A;  3FMC A;  3FEW X;  3HEJ A;  1SDF A;  5M9O A;  2B2W C;  2F0H A;  4KN7 C;  1ZEQ X;  4U68 A;  3J7Y W;  2K01 A;  1PRT C;  3FVQ A;  3RZD B;  1W6K A;  3A8K E;  2R92 B;  1TWG B;  4LK1 C;  2VNU D;  2NWG A;  2EY6 A;  4RGN A;  2B2U C;  4IUV A;  4QUF A;  3H94 A;  5C0X I;  2A6E C;  2HUG A;  2C9O A;  3NWT A;  2RBM A;  5CV8 A;  4IAL A;  3ND8 A;  5ELC A;  2NN6 I;  5HUR A;  4CKE A;  1L0Y B;  2FHT A;  1MD2 D;  3A55 A;  1MBY A;  3J81 E;  1KDC A;  1ET6 A;  1QCB D;  5CGK A;  1EYD A;  3KBX A;  1CZG A;  4C3H B;  4C3J G;  2TSS A;  4PV1 C;  2F03 A;  4C3I B;  4B9W A;  4ZYS A;  1I50 B;  1RTN A;  1GUS A;  1RD9 D;  3H6M A;  3I72 A;  4TRD A;  1WCM B;  4O1N A;  3SK4 A;  3VA7 A;  2VB3 X;  5CV4 A;  1DM0 B;  3BYY B;  5FK9 C;  2RDH A;  5EBC A;  2LMC B;  5M5X B;  1VF5 C;  3O13 A;  2DY8 A;  1E2V A;  3PMF A;  2NUC A;  1FYC A;  4G7O C;  1V1O A;  4FYD A;  4DAV A;  4V0B A;  4XQJ A;  2EYH A;  1LTB D;  2K03 A;  4XT3 B;  5FLX E;  1ZYR C;  1GUW A;  2AWN A;  5CV7 A;  5A35 A;  4A3J B;  3DMU A;  3NHH A;  1PTO C;  5DAU A;  2OEO A;  2B8G A;  1TT2 A;  2G9D A;  2JA8 B;  3FRP B;  2X69 A;  4KY7 A;  3UI2 A;  3SDZ A;  1B53 A;  2F4I A;  3MVV A;  2VXW A;  3F2U A;  4C3J B;  4F8M A;  2NYZ D;  2XRS D;  3S2H B;  1QB5 D;  5FOB B;  3GTQ B;  2FMC A;  2O5I C;  2OF1 A;  3VYT A;  2ZXR A;  3FPU B;  4XTC S;  1J8I A;  3H3V C;  2A69 D;  5T1I A;  5ISR A;  1V1P B;  1SAP A;  4P2C B;  1F9P A;  2B2V A;  1SE4 A;  1QE6 A;  3P75 A;  4XIG S;  1XXG A;  2K1B A;  4KI0 A;  2E2H B;  3H91 A;  3Q0A A;  5COY A;  2B8F A;  5CBA E;  4ID6 A;  2PMZ B;  1QNU A;  4K8J A;  1HFG A;  1BOS A;  1NAP A;  3CRL C;  1PFM A;  4KJO A;  1WD0 A;  4RWS C;  3GTJ B;  1IYV A;  1XYI A;  4K6D A;  1SE2 A;  1WTX A;  4A3G B;  2SDF A;  2KCC A;  2MPM A;  1LT5 D;  2JA6 B;  3RMH A;  4PMW A;  4N9T A;  1SYC A;  3NWS A;  1XWE A;  2JE6 I;  1FD7 D;  5FO8 B;  1JC7 A;  3EQL C;  5J39 A;  4KJN A;  2G9H D;  1VMP A;  1LT6 D;  2EJM A;  1ZKO A;  3NBH A;  3HOX B;  4KKU A;  4OL7 A;  3ERQ A;  2HCI A;  2F0W A;  1WTO A;  1VF7 A;  5IT9 E;  3ITP A;  1HQR D;  2B2U A;  1FNW A;  2ICI A;  4KTA A;  4BS9 A;  4B9X A;  3TZD A;  2K6A A;  2PQE A;  2L4N A;  4TSS A;  2F0E A;  1PRT F;  3U9S A;  2FJ2 A;  2EOT A;  4XQN A;  1F9R A;  2EE1 A;  3L3O C;  2F3V A;  2H1E A;  5EKL A;  1S5C D;  2SEB D;  1CHP D;  4C56 C;  2A68 D;  2N88 A;  2Z1C A;  5EPJ A;  2IJ0 A;  3OMC A;  2F0I A;  1GUN A;  2F0T A;  1EIG A;  3LWU A;  2B2W A;  3M7G A;  5NUC A;  1GUG A;  1I4X A;  2D9U A;  1DYQ A;  3ERO A;  1S4Z A;  1Q8I A;  4MIU A;  3J80 L;  1BQQ T;  3K0Y A;  3EJI A;  1WTP A;  2WII B;  1BO0 A;  4IFD I;  3A56 A;  4LJZ C;  1HXY D;  3VR2 A;  1SYD A;  2K7V A;  3S1R B;  1B44 D;  4NMZ A;  1BUV T;  3PUX A;  2BOS A;  2KED A;  4J6H A;  3D31 A;  2EYL A;  2I07 B;  3MAQ A;  5DNF A;  3OPO A;  1CZW A;  1EY8 A;  3SHL A;  3VR4 A;  3P1H A;  1DCZ A;  2B2T A;  1F2Z A;  2EY2 A;  3K7A B;  1H9J A;  1WTR A;  1JIC A;  3JAM E;  4DXF A;  4A3E B;  3GTM B;  2VUM B;  2E2J B;  1VMC A;  1KDB A;  1FGB D;  2FMM A;  3DWP A;  1SXT A;  1HTP A;  1U4M A;  2RKS A;  4UAI A;  1CA6 A;  4KHZ A;  4FXK C;  4DNT B;  3S9W A;  5IIF A;  1I4P A;  1V8Q A;  4R8N A;  4YIJ A;  4A3M B;  1QNK A;  5FO7 B;  1BR9 A;  3QWN A;  3ND9 A;  5CMD A;  2L12 A;  2EVB A;  3IFT A;  3SVM A;  3PUY A;  3MTS A;  1TII D;  3QOJ A;  1EU3 A;  2O2L D;  3E6Z X;  2B39 A;  2K04 A;  1O80 A;  4IUQ A;  2Q8T A;  2PZT A;  2SNS A;  4PMB A;  1CQF A;  4X3T A;  1GHK A;  2K32 A;  4HR7 B;  4IQZ A;  1DOM A;  1GUT A;  1W6J A;  4IN3 A;  3I4M B;  1D5M C;  2NVT B;  3E0J A;  1V1P A;  5CV6 A;  4OO1 H;  5D3I B;  2CW0 D;  1KTK A;  1JOQ A;  2Z8L A;  5KNB A;  3ONA B;  3OW7 A;  2F0O A;  1PLF A;  5M3F B;  3TN2 A;  5G3L F;  1JWS D;  4CKB A;  1RF2 D;  1KNA A;  1EYC A;  1SMY C;  1LTA D;  1L0X B;  5K36 G;  2ICE C;  2RQX A;  1S5D D;  2F1M A;  3U9O A;  1KNE A;  3ZYY X;  3GTK B;  4K6L A;  4AYB B;  2E76 C;  3HS0 C;  2C5C A;  4K5X A;  2MUY A;  2R6G A;  3P7J A;  2NVX B;  4DU9 A;  4B08 A;  1STE A;  5EGT A;  2KOL A;  1JWU D;  2D2C C;  5CV5 A;  4RCO A;  4KY5 A;  4L63 B;  4CHT B;  4XXE A;  1A2U A;  4KD4 A;  4F7X A;  1OXX K;  3R8B A;  5KRU A;  3I73 A;  1PMR A;  2ZT9 C;  3Q22 A;  1O78 A;  1D1K A;  5I6W A;  3TP5 A;  2R93 B;  3MFY A;  3OOC A;  2MP1 A;  1DD2 A;  4K8I A;  1STG A;  3K6O A;  4EQO A;  4WRD A;  2BDN A;  4ZUI A;  5A2Q E;  1EOT A;  2KEE A;  3T51 B;  2DNE A;  4BA2 I;  1X3P A;  3FDT A;  4BBR B;  2QCP X;  3FKI B;  2J7Z A;  1RCV D;  2JXM B;  4OO1 G;  1WTV A;  1G29 1;  3KUP A;  3J7A V;  4ZRZ A;  2X6L A;  4JBW A;  2MJ8 A;  5JVG 3;  5KYI A;  1LLR D;  3PO2 B;  2K5D A;  1JE4 A;  4RFB A;  1ML0 D;  1ICW A;  5EJW A;  3I90 A;  4H13 C;  1EFI D;  1AW7 A;  1F9S A;  4RCN A;  4HTH A;  4FVM A;  2B2T C;  3MFG A;  3G6J B;  3EA6 A;  1PFN A;  3C46 A;  1B1Z A;  5IGE A;  4IUU A;  5DEH A;  4FF4 A;  4A3F B;  3VYU A;  3D8G A;  4QB4 A;  4EVO A;  5KGU A;  1EU4 A;  3CQZ B;  3BZD B;  4KN4 C;  5JVH 3;  5IOC A;  3S14 B;  1HPC A;  1LT4 D;  4G57 A;  5TSS A;  4TKO B;  4L8J A;  4H44 C;  5D3D A;  1BBX C;  1NSN S;  4IFD G;  3DEO A;  4OGQ C;  4NKL A;  4N9P A;  3HRZ C;  2EDG A;  1VDZ A;  4RH6 A;  2K5W A;  1TQO A;  4LMQ D;  1Y8O B;  2EXZ A;  4DA2 A;  2A6H C;  2IX1 A;  2WP8 J;  2PW5 A;  1STY A;  4A3B B;  1CT1 D;  4DGZ A;  1K83 B;  1ZXT A;  4DAP A;  3A8J E;  4CBV A;  1J9O A;  1YNJ C;  3WOE A;  2IWH A;  1SYB A;  2E2D C;  3MXG A;  2F0M A;  3TP7 A;  5BN5 A;  3KF8 A;  1WTW A;  1MGS A;  1LAC A;  5ELB A;  3T56 B;  1I4Q A;  1JWM D;  1KAB A;  1IL8 A;  2D5D A;  5EPK A;  1CHQ D;  1JOO A;  2A6H D;  4KHV A;  2EYF A;  2XVS A;  3NTH A;  2RVL A;  1LO5 D;  4FO2 A;  3K5N A;  4C3I G;  2I46 A;  3SK5 A;  3R2T A;  2WKD A;  5IGD A;  2E2I B;  1K8O A;  4EGV A;  3Q6S A;  2Z4I A;  1HA6 A;  1KLU D;  1FNU A;  4BY7 B;  1C48 A;  2BA0 A;  2QEJ C;  4NP5 A;  4HSP A;  1B3A A;  3QIA A;  1GOZ A;  1BCP D;  1SBB B;  4IFD H;  1STA A;  3MXN A;  5F2D A;  1LV9 A;  1IW7 D;  1STB A;  2ID0 A;  4I65 A;  3H09 A;  1B9N A;  4RAU C;  3PUW A;  4X3U A;  3BVM A;  3QO2 A;  1OXU A;  4X3K A;  5E4X A;  5C44 B;  4F88 A;  1O7L A;  4XYO A;  4PNY A;  3CU7 A;  1TS5 A;  2AQ2 B;  4ZUJ A;  2Y0S B;  4ME5 A;  1JQY D;  4NDX A;  3T4A C;  3TME A;  2JSO A;  1TVX A;  4XYQ A;  3GTG B;  1ONL A;  2F0U A;  2IL8 A;  4H0L C;  5HGT A;  1SNO A;  1C8C A;  3K5O A;  2A74 C;  4FF1 A;  2JP1 A;  3L7Z C;  1HA5 A;  5M5Y B;  1TU2 B;  3TZU A;  5E1F A;  1H9S B;  1Q3L A;  5G3L D;  3MA2 B;  1O7Y A;  1SNM A;  1S5E D;  3SEB A;  1YNN D;  5I6Y A;  1TY0 A;  1CFM A;  2N55 A;  1EZ6 A;  3SK8 A;  4PMC A;  1G8Z D;  5C0X H;  1QIL A;  3Q23 A;  4CKC A;  5KND A;  3V96 A;  1A6X A;  1WTQ A;  1I3Q B;  1SNQ A;  2AWO A;  1SJE D;  1C4Q A;  1X3Q A;  1FNV A;  1AP0 A;  1H9R A;  2PYK A;  1HFN A;  1PZK D;  2PO4 A;  4ZAI A;  3M4Y A;  2NZ1 D;  2FIN B;  1PTO H;  3VR6 A;  5CC4 A;  4DK0 A;  4KKT A;  3BDO A;  1IHZ A;  3M7N A;  1DOL A;  3TP6 A;  5CV9 A;  5KNC A;  1DXM A;  1VCI A;  4XQQ A;  1SYF A;  5BN3 A;  2L5T A;  2EYM A;  5C0X J;  1UAP A;  3RD4 A;  3J80 E;  2AUK A;  2NN6 G;  4RA8 A;  1EEI D;  2JYO A;  3MXU A;  3A8I E;  4K5W A;  5C4X B;  1BF4 A;  1AZP A;  3IL8 A;  2FFK B;  3AMU A;  4L6T B;  3A7L A;  1AZQ A;  1TWH B;  3BVG A;  4ILW A;  2NVQ B;  1HTL D;  4IUN A;  5IOD A;  4J1M A;  2CQA A;  3HKZ B;  1MI2 A;  2VB2 X;  1IYU A;  4M8A A;  2RDG A;  2M9V A;  1WVL A;  4K5V A;  1B50 A;  1EEF D;  4HMJ A;  2HCC A;  3S15 B;  1BCP B;  4HMI A;  1ILP A;  3WOF A;  2KCN A;  1JOK A;  1TWC B;  5C4J B;  3D6W A;  3NP8 A;  1DON A;  3W2D A;  3PUV A;  2A69 C;  1TS3 A;  3MZ5 A;  1F2Y A;  3NUC A;  2CW0 C;  2BE5 D;  2EJG C;  3S17 B;  3J7A F;  2EJF C;  3MWY W;  2ZXO A;  2KJX A;  1TR5 A;  2KUM A;  1D1I A;  1SND A;  3HZX A;  4ZLT F;  4IUR A;  3FPP A;  2EY1 A;  4TQU S;  2TMP A;  4A3D B;  1EL0 A;  3MC0 B;  1IKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...