2F0OA

Crystal structure of staphylococcal nuclease mutant v66i/i72v
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMIENAKKVEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0oA00
5JOBA 1STYA 2EXZA 2PZWA 2EY5A 5J39A 1EZ8A 4KHVA 5ISRA 3EJIA 4F7XA 3C1FA 1SNQA 1SNOA 2EYMA 2WACA 3OWFA 5CV5A 4K5WA 2F0GA 1SNPA 1TT2A 3T16A 1A2TA 5KEEA 3SK4A 5I9OA 1SYCA 2F0JA 4K5VA 5EKLA 5K5PA 4NMZA 1EY0A 4EQOA 5HURA 3BDLA 1NUCA 3P75A 4K14A 5IODA 4YIJA 3P1HA 1RKNA 3PMFA 4K2KA 5CV4A 5CGKA 4EQNA 1STNA 1SNCA 3MEHA 3OMGA 4B9XA 2M00A 2HQEA 5KIXA 2F3VA 3SK8A 3VA5A 5IIFA 5JAVA 4WRDA 5KRUA 1NSNS 1JORA 2EYOA 2SOBA 1ENCA 1STBA 1EYDA 4KY5A 1U9RA 3QOJA 4PMCA 4PNYA 4S3SA 3DMUA 4QB4A 5EGTA 3TP7A 4F8MA 5I6YA 5IGDA 1JOKA 4RKBA 1EY5A 4LAAA 1EY4A 1F2MA 1JOOA 2F0KA 3MVVA 2F0EA 3D8GA 3C1EA 1AEXA 2F0HA 1TR5A 2F0TA 1STGA 4KJNA 2EYPA 1SYDA 3NP8A 4ZQ3A 3EROA 1EYCA 5M9OA 1SYFA 2RKSA 4K6DA 2F0SA 3ITPA 5C5LA 3LX0A 4B9WA 4WORA 5E3FA 5I9PA 3MHBA 5KYLA 5CR3A 3NXWA 1ENAA 4KY7A 2OEOA 3TP8A 3V2TA 4K8IA 4KV6A 5C4HA 5HGTA 2PW5A 3D4DA 2F0IA 2F0UA 1KDBA 3SHLA 2SNSA 3R3OA 2PW7A 5KGUA 2OXPA 4J1MA 1EY6A 3SXHA 4DF7A 1STAA 3D4WA 4DGZA 3S9WA 2F0FA 3NK9A 4KY6A 5IGEA 5DEHA 3E5SA 2PZUA 3QB3A 3OSOA 4IZ8A 5CV9A 3OMCA 4EVOA 4EQPA 5IGGA 4G57A 5J22A 5CV6A 3MZ5A 4HMIA 4KTAA 3D6CA 3QOLA 5IGFA 5KYIA 4RKLA 5E1FA 1SNDA 2F0OA 5I6WA 3H6MA 2QDBA 4H7BA 2KQ3A 2ENBA 5C6AA 4HMJA 3SR1A 1KDAA 3TP5A 4E6IA 1IHZA 4R8NA 2EYJA 3HEJA 4ID6A 2EYHA 2SNMA 3ERQA 4QF4A 4TRDA 4ODGA 3EVQA 5IGCA 2OF1A 4K5XA 1EY8A 1EYAA 5IOCA 4OL7A 5IGBA 4K8JA 5CC4A 1KAAA 2PYKA 1EZ6A 1A3VA 4N9PA 4NP5A 1KABA 3TP6A 2RBMA 4N9TA 4ZUIA 3U9OA 4J6HA 1EY7A 4MIUA 4KJOA 4DFAA 4HTHA 2F0NA 2LKVA 4K2LA 4ZUJA 2EY6A 2EY2A 5NUCA 4KD4A 5C4ZA 4PMBA 5CV8A 1F2ZA 1STHA 1A2UA 2EY1A 2PZTA 3DHQA 1SYBA 2EYFA 2NUCA 2F0MA 4IALA 5CV7A 2F0WA 3NQTA 4ME5A 3SK5A 5EKKA 1SYGA 4NKLA 1SYEA 1TQOA 1II3A 4NDXA 5C3XA 3T13A 3TMEA 1EQVA 2F0QA 2F0DA 1SNMA 1EY9A 2RDFA 2F0LA 2F3WA 4QMGA 5F2DA 3MXPA 5C5MA 2O4XA 1F2YA 3SK6A 1A3TA 4IUNA 5C3WA 4DU9A 5J1ZA 2KHSA 5DAUA 2F0PA 3RUZA 4KD3A 2EYLA 2PQEA 3HZXA 1KDCA 3NHHA 3NUCA 2F0VA 3BDCA 1A3UA 4I65A 1JOQA
chains in the Genus database with same CATH superfamily
4LNQA 3HP3A 2AUJD 4GOPB 4F7XA 1LTGD 4DR7L 5CV5A 3CW2C 2B2WA 1CI3M 1LUZA 4RFBA 1VQIA 1XPOA 2CH4W 1RODA 5K5PA 5EBCA 3GTOB 1PV4A 2N49A 1EYGA 2RSNA 4A3BG 2H5XA 1LT3D 1SNCA 1XXGA 1J5EL 1HZ9A 5C4XB 4RHSA 1C4QA 1F9SA 1W3SA 2A6ED 5TSSA 1EU4A 1ENCA 3SR1A 2NVTB 2B2VA 2NVQB 1X65A 3G6JB 2JN4A 4X62Q 1XMOL 4UDUC 3F2BA 1AN8A 1GKHA 3UE1A 4PV1C 2VUMG 4FXKC 4KN7C 2RKSA 1SFOH 1I6VC 4ALPA 5KYLA 3S2HH 3TZDA 5C3EG 1VQ6A 4IJLA 4CJ0B 1PH3A 1SJED 3MFYA 5JEAJ 4AYBE 4EX5A 1V1PA 2K5NA 2K05A 4JI5L 3X3NA 1FGBD 1FNUA 2JA5G 4OO1G 1UEAB 1YIJA 3TDQA 1XX8A 5IP9H 3T1HL 2EDGA 2CQAA 4FF2A 1BBUA 1FNWA 1SE3A 3HOZG 4A93H 3EVQA 3S16H 5C4XG 1OTCA 1IYUA 3E6ZX 1KAAA 4IPCA 3J7YW 2DNCA 5ELDA 2CW0C 3GTLH 4OHJA 4DV2Q 4POGA 2UUBL 4OIKA 4N8FA 1A63A 1YEZA 1SYBA 1DGSA 2C9OA 1QB5D 4GLVB 5FO9B 5C4XH 2L11A 3GTMB 4X65Q 1SDFA 2OTJA 1GM5A 1PRTD 1X3EA 2EJMA 1R9TH 1E7ZA 4JI6L 1CZWA 4RG1A 2H1EA 4GN4B 4DK3C 3PIPA 3NELA 1XPRA 5EQ0A 4KKTA 1WD0A 5GAGC 5GQOA 3FMCA 2PQAA 2UUBQ 2QILA 1STYA 1VQAA 1EZ8A 1JWSD 1EQQA 1TVXA 1TWCH 3HRZC 4X3UA 4A3DH 1QZHA 4DAYB 1HHVA 4GZYC 4LUZA 4C3IH 3BU2A 1EY0A 1VQGA 1HZCA 3KF8B 2VW9A 3PV0A 2HCIA 1XNQL 1ASYA 1LM0A 4K2KA 3KLSA 3P20A 4IPDA 1ZYRC 4LFCL 3QIAA 2PI2E 1X3PA 4HIKA 4B3MQ 2QA4A 1YNXA 2SOBA 3SE0A 3CCVA 2I46A 5I4DA 3QOJA 4QB4A 1S72A 4GNXB 4RA8A 1EY4A 1F2MA 3CRLC 4LF5L 2I5MX 4RGMA 1CSQA 2FMMA 1TXYA 4JI7L 2BDNA 5KNDA 5IP9G 3Q6SA 4K6DA 5M9OA 4BY7G 1NE3A 1I6HH 1LV9A 3FP9A 1V1OA 3K7UC 1PA6A 3NXWA 5BN4A 4A3BH 1N32Q 2EQSA 2E74C 1AP0A 1B9NA 2GA4B 2N3SA 5C3EH 1JWUD 4C3HB 1HUMA 2CHBD 4DV5L 3HFZB 1X54A 1LT6D 2GN5A 2IX0A 4KTAA 3D6CA 5KYIA 4GNXA 4BBSG 4YWMA 1B1ZA 4ULLA 2RDHA 3NEMA 3HOYH 4DR6Q 3H15A 2PMZE 3A8KE 3E9IA 1Z9FA 3HEJA 3DUZA 4ZK9B 1TY2A 2AWNA 1SLJA 2OTLA 5I2YA 1IYJB 4NP5A 4DR1L 3T1HQ 2K28A 4OO1I 1AZQA 1CKOA 1U4MA 2HDMA 4GS3A 2M2LA 2ES2A 2V4DA 4DK1A 5C4JB 1EUJA 1EFID 3Q23A 2EJFC 4NKLA 4BY7B 2UXCQ 1VQ8A 3E9HA 1EY9A 1OXUA 1TWGH 3HOXB 1OXTA 5M5XH 4I7AA 1VDZA 1S5ED 1KDCA 2R92B 4JI3Q 3J81j 3U50C 3UE0A 3G4SA 2NB0A 3KF8A 5JPMC 2JA5H 1SNQA 3UI2A 1YJWA 4FO2A 2E75C 4LW1A 3NSWA 4DV5Q 1RIPA 1SYCA 5EKLA 1SJHD 1VF5C 1D5MC 4GN5A 2B63H 2N88A 1SE4A 3CC7A 3A56A 3OMGA 1OXSC 3CF5A 2VUMH 2G5DA 1GUWA 1QUQB 3ERSX 3BVMA 2R7ZB 3FKIB 2EYOA 4BBSH 1NR4A 3RMHA 1JOKA 2HIXA 3VR5A 3FEWX 1Q3LA 4UP8A 2QEXA 1E0BA 2F0KA 3AEVA 3H0GB 1J8IA 1SYDA 4ZQ3A 1DOMA 1E1OA 4QY7A 3U9SA 3EN2A 4DK0A 3OW7A 1MJEA 1PZID 3J81E 4NB3A 5KGUA 1YITA 5C4JH 3D4WA 4L5TA 4IQZA 2N8NA 3QB3A 4V0BA 3OMCA 1Y1VG 4G57A 4P72A 4AQYQ 3T51B 4DUZL 5LL6S 2Z6KC 4A3LG 4I7ZC 2YYZA 1SNDA 2AMCB 2UUCQ 2HQLA 3BDOA 1LACA 2NVYH 1HA6A 2LS01 4IURA 3I7FA 1QCBD 5JVH3 1MD2D 3GV3A 3ICEA 4JV5L 1PMRA 5C44B 3CHBD 2HD3A 1ET9A 1X3QA 2AQ1B 1RL2A 1EY8A 1XPUA 4QCLA 1E22A 4DUYQ 4XIGS 1A3VA 3VR3A 4R4OA 4DV4L 1VQDA 1N33Q 3HOZH 1WTXA 2K33A 1TS2A 4K0KL 5CV7A 1RJTA 2VZAA 3DHQA 2F0WA 4GOPA 1J5EQ 4XYOA 2VUMB 3W3AA 1ILQA 2WB1B 1II3A 3S1QH 5C3XA 3T13A 3J81L 2PO4A 4AH6A 4JBMA 1MKHA 1TWCB 2ID0A 3JAMi 5J1ZA 3KK7A 1GJXA 2RCFA 1MBYA 2QF7A 3NK9A 1JJCB 2AHOB 5J39A 3C1FA 2R3ZA 1IKLA 5G3LD 5AFWA 1WTOA 5AJ3L 1A2TA 4R1JA 5FJ8G 1I4PA 1H9JA 1BBWA 3MXUA 3CCEA 3I4MG 4JI5Q 4LK1C 2PQAB 1UE7A 3MEHA 2NVQH 3EQLC 5C44G 1H9MA 2D62A 1Z47A 1C0AA 1P16A 1X55A 4CGYB 3AFPA 1X3FA 1XTCD 3M85A 4S3SA 2EOTA 1EOTA 1K83B 3CCRA 2PNHA 4DV6L 4LUOA 4OONA 1X32A 4DAPA 3C1EA 4J8QA 2NVYB 4A3GB 2F0TA 1EL0A 4H0LC 2LXJA 4RHRA 5E3FA 2ZXRA 2XSCA 3HGBA 2Z9HA 3ONAB 2OQKA 1SN8A 2D5DA 4MZ9A 1C8CA 4FXGC 3HOYB 3K8AA 2KHJA 4A3EB 1X3GA 3FVQA 3DWQA 3MXNB 2DGYA 2B39A 1EY6A 4Q0FA 1U4PA 1OO9B 2NBFA 4TSSA 4LFCQ 3S9WA 1IBMQ 3PF5A 2ZM6L 3BZDB 4A3IB 2A68C 3CCLA 1L0WA 3GTQB 3HKZG 4XQJA 3GTLB 1V43A 3OPOA 3S24A 2PMZB 2F0OA 3H6MA 5GAEC 1GUGA 2VB2X 2BDOA 5C6AA 3PUYA 2YTXA 1IHZA 2WAQE 2EYHA 3PUWA 2JA7H 1EYAA 5IE8A 2PYKA 4N9TA 1EY7A 1ZEQX 4MIUA 1PH5A 1SXTA 3JAML 3U58A 5NUCA 1TKWB 5L37A 4PMBA 1DJRD 3TSSA 1GUNA 1EEFD 1I4GA 4OXPA 1F9PA 1RTOA 1TQOA 4NDXA 1KIXA 3TN2A 3V96A 3GTGH 3HOYG 1T9HA 4KHZA 3D31A 5DNFA 3A54A 1ICWA 4EQ5A 4A3EG 3FHWA 2JSOA 5IYDG 3NHHA 4A3FH 1QVFA 5JOBA 3R2IA 4DAVA 3CXCA 2L12A 1IL2A 2MNAA 5BN5A 1YJNA 4P75A 3O13A 4KK7A 3W1BA 1YNJC 1L0YB 2MFIA 3PMFA 4R8IA 2F03A 5C0XG 2HQEA 4LF6Q 1Z7TA 2V1CC 1I50B 1MGSA 1HA5A 1JQYD 1B3QA 1EYDA 1U9RA 2MUYA 4Y52H 4F8MA 1W6JA 1A6XA 1VQBA 3T4AC 1VQ5A 1V9PA 1L1OC 3H3VC 2A69C 4DXFA 3I4MH 3S17H 2I0QA 1HR0W 5FJ8H 2NTSA 4ZAIA 1KRTA 4KLKA 4DA2A 3I4NH 5C4HA 4X62L 1MIUA 2Y0SB 2HDLA 1XYIA 2F4IA 4QUFA 2EJGC 3R3OA 1G6ZA 3J7AF 2MQHA 2RHQB 3HS0C 2IWHA 1CA6A 2F0FA 1Y8NB 4IZ8A 2PZUA 1R9TB 3KF6A 4EQPA 2UU9Q 2KVMA 2Z8LA 4DR2L 3MZ5A 3Q24A 2QCPX 4B08A 4CKBA 4RKLA 5E1FA 4JI4Q 3S1RB 4IUPA 2IX3A 1QWYA 5LMNQ 1PH9A 4R8NA 3HOUB 3PO2H 4BY1G 4A3KG 2MPMA 1CM9A 1ML0D 1K8OA 4JOIA 2KOLA 1EWIA 3M4PA 1XWEA 4ZUJA 3URYA 3J80E 2XWJB 1SR3A 3OTOL 2IT1A 2CVRA 5D3DA 3QO2A 2CWAA 1YNJD 1NR2A 5IYCH 1AE3A 2AKWB 2F0LA 3ULJA 2O4XA 4R4IA 1PTOC 3GV6A 1DYQA 2DY7A 1Y1WB 1D2BA 3NUCA 4G7ZC 1D5XC 2B3GA 1TU2B 3AU7A 3MA2B 1MI2A 1A0IA 1SNPA 2JYOA 3FRPB 2GVAA 1EOVA 4EQNA 1STNA 4PZ8A 3NWTA 1I5FA 4A3JH 1ICFB 2KBNA 5IIFA 1NSNS 4R9WA 3CKIB 2WKDA 2IHFA 3H3VI 4L8JA 2ZTCA 1CK1A 2F3IA 3DM3A 4RKBA 3JAMc 4BBRB 2L15A 1N9WA 4GOPC 2F0HA 3MXGA 2E5LL 2B63G 4HAEA 2EYPA 3EROA 4JBWA 4QQBX 4C1NI 2F4VQ 4WORA 1GHJA 2B8GA 5E4WC 2A74C 1KD1C 4K6LA 2WFWA 1HFNA 2OXPA 3UDXA 1GVPA 1WTRA 2D2CC 1XMQL 3H91A 4FNFA 3WDNA 1YVCA 5IGGA 1PFBA 4Q5VA 3I8ZA 4C1NK 2ZJPA 3CP0A 3GD7A 4IUQA 1D6EC 3I4MB 2ENBA 3M7NA 1EFWA 1VQEA 3FDTA 3BVZA 2D0PA 4K5XA 2K5QA 2MO0A 4CDDC 3X3MA 3S1RH 1I4HA 4M1UB 2B2YC 2SDFA 4N8X1 3PO3B 3K58A 4DV7Q 2J7ZA 4A3KH 4BY1H 3ULLA 2WIIB 2JE6I 2K4KA 3J80i 1X56A 3AFQA 4BBRG 2ASBA 2B63B 2NUCA 1LABA 1T5XD 4CDCC 4A3MH 2HHHL 1JC7A 1XNRQ 3TMEA 2WAQG 5H1SE 3A7LA 4YCUA 1IBLL 1CKNA 1F2YA 2LXKA 3ND8A 5C3EB 5C3WA 1PRTF 5AJ3Q 1CKMA 1Y1WH 3HKZE 1Y14B 4DR3L 2E2JH 4DR4L 2EYMA 1M90C 5BN3A 2KECA 2ZT9C 3EA6A 4JVZA 4JI8L 3HKZB 5LMUQ 5I9OA 1WCMH 1I50H 2NN6H 4A3GH 2JA6G 4X3TA 2R6GA 4DV0Q 5JJKA 4GLXA 1NUCA 4YIJA 4XYQA 3L0OA 2E5LQ 1K83H 4JC0A 2F3VA 5D3IB 3T53B 2NN6I 3LWEA 1UAPA 4DR3Q 1YHBA 3PO3G 4ILWA 1BQQT 4CKCA 5A2QL 3ULPA 3W5OA 4TKOB 2Q2HA 3K0XA 5ELCA 4C3IB 1NY4A 2DJGC 3I72A 1O80A 3GTQH 1NNXA 2HHHQ 3B6YA 4A3DG 2MJ8A 3KOJA 1S5CD 3TP8A 4K8IA 4LF7L 5HGTA 1G8ZD 5IWAQ 5ELNA 4OEMB 2L55A 3A55A 4J1MA 4XT1B 2AUKA 4OWTB 3Q0AA 2KA7A 1RHPA 4IJHA 5J3BA 4EVOA 3OSOA 5CBAE 1YI2A 5COYA 5EPKA 1TWFB 4HMIA 5FLXc 2JA8G 5CORA 4E6IA 2Z6BA 1M8AA 3OHXC 2SNMA 5EJWA 1G2SA 3CMEA 4C56C 1LTSD 4OX9Q 1CQVA 4N9PA 4IOCA 3H0GH 2JXMB 2RBMA 2JA7G 4KJOA 3F2CA 3HOVH 4K2LA 3KLWA 2EY2A 1XNQQ 1IL8A 4HSVA 1STHA 2JK8A 5I6YA 5IGDA 4HSPA 1B44D 1FR3A 2K1BA 1SYEA 1M1KC 3S1NB 1WYDA 4A3DB 1B53A 2F3WA 2JJQA 3RLOA 1KAWA 3NQIA 2JA9A 1YNND 2EPBA 3OIQA 2RDGA 1JB7A 5C0XI 3RUZA 2FINB 4KD3A 2PQEA 4OGQC 4XQNA 2XN9C 4DV1L 1K28A 1K0SA 1V1QA 1S5FD 4DKAC 4GKKL 1IW7C 3ZYYX 1HR0L 1NJIC 5CMDA 1YBYA 4K5WA 2KCMA 5EAYA 3A74A 4NMZA 4HR7B 5M5WH 3BDLA 3MXNA 5IODA 3P1HA 5CGKA 1HJPA 5IYBH 3HOUG 1ENFA 4L5RC 2M00A 3QJYA 3S15H 4A3MB 1HR0Q 1MSGA 1VQ7A 2BOSA 1PTOH 1DOLA 5DLQE 3KFUA 4XDXA 1KTKA 2NZHA 2Z1CA 1K3BC 1KLGD 4MN3A 4JBJA 2M9VA 5EKIA 1JMCA 5K36G 3VYRA 1VS0A 3BJUA 2K14A 1N34L 4A4IA 5M3MH 2PNRC 3I70A 3N6RA 3MHBA 1F9RA 4CJ1B 4RGTA 1HPCA 2OEOA 2F0IA 1ONLA 1UE1A 4NXNL 1LTAD 1PFMA 3SXHA 3JC66 1PH4A 1O7LA 3CCUA 1EWCA 1EWHA 5IGEA 4C2MH 2HIVA 1UE5A 2KCNA 5ELFA 4RH6A 1VMCA 2QDBA 4H7BA 4HJ8A 2NZ1D 4HMJA 1CA5A 2CQOA 1GOZA 5A35A 2EYJA 3G48A 1PVOA 1RDPD 3STBD 3KBXA 3STBC 3CCSA 1WVLA 4OL7A 1DOKA 4PQXA 5M3FH 3FKIG 3U9OA 4ZUIA 4AYBG 2RCNA 1K8MA 3CC4A 2LKVA 2I5HA 2UU9L 4RCNA 2K50A 5I2XA 3H0GG 2UXDL 2F0MA 3J81i 4ZYSA 5CYUA 3S15B 3WWVA 1RF2D 4DAMA 1VQOA 4X64L 2KCCA 4C3JH 3P7JA 5M5WB 5DAUA 2EYLA 4YCVA 1FL0A 2CW0D 1QILA 2K03A 3C2PA 2Q2IA 2QW7A 3RN5A 4UHVA 3VYTA 2WP8J 2I07B 3T1YQ 2F52A 1TT2A 5GAHC 1HNZL 2E2HH 3F2UA 2RVLA 2IHEA 1PH6A 1HFGA 1PRTC 3KDFB 1SMYD 3HOVG 1LTID 2HT1A 5JAVA 5KRUA 1Q12A 1K8AC 5HY6A 3GTOH 2Z4IA 4P73A 3NBIA 4YWKA 1VQHA 3S14B 1F77A 2K52A 2D9UA 1RCVD 1FNVA 4NXMQ 2ALYB 3D6WA 2XGTA 3CPWA 3EFXD 1CKNB 4JV5Q 1ASZA 1G2TA 2EIFA 4A75A 2WAQB 2ZJQA 5CR3A 4RGNA 2IX1A 1TWHH 4B3TQ 3CCQA 3UDFA 3AQQA 4Z9CB 2PW7A 3RZDH 3LGJA 5CBEE 1L1OB 2YTVA 3V05A 1JWMD 2UXCL 1STAA 1D7QA 1TWAB 1HQMC 1CTMA 1QUQA 4J15A 4JI7Q 5J22A 2E2DC 1BKBA 1B9MA 3K81C 3T1YL 1E2WA 1BCPD 4Y7NH 1TWHB 1LT4D 3I73A 3TP5A 3HOVB 3RZOB 5LL6X 2QGQA 4ID6A 3W2DA 4DR4Q 2VB3X 5LHY1 4FXDA 1I4QA 5D14A 2CCZA 4JI6Q 2K5WA 2NVXH 2ZTDA 2FXQA 2UUAQ 4A93B 4HN7A 1CZGA 1NAPA 3PUVA 1QOHA 3FPPA 2EE1A 2A73B 5LMNL 1GUTA 3E0EA 2A68D 3CD6A 1XNRL 1KXLA 2RA4A 3AYHB 4R4QA 1SYGA 4YY3L 1FGUA 2N78A 2UXDQ 2A19A 1VQ4A 4JI2L 1HRJA 3F2DA 4NPSA 2F0QA 2N55A 3WOEA 5C5MA 3VYSA 3MXPA 1PZKD 4DNTB 3IKJA 3OOCA 4DV1Q 1IXRA 3A0JA 1N36Q 1WCMB 1AH9A 1KL9A 3BYYB 1G6PA 1JB3A 1G291 4CBVA 1BNZA 4DV6Q 2JA5B 1AW7A 1N34Q 1U4RA 2ICEC 4C3HG 2A8VA 4APVA 4O42A 4L6TB 1KNAA 1A15A 1SE2A 3S1NH 4WFN3 3SK4A 5FLXL 4DV3Q 2KCTA 3KBGA 2FJ2A 4M8AA 1HNXL 4U673 4K14A 4KKUA 3HOZB 3NTIA 5HGQA 2NVTH 4QL5A 2NZOA 4MTKA 2K7VA 3FPUB 1I4RA 1HCZA 1QJOA 1GO3E 1AE2A 1LTTD 3PSIA 3DXJC 1G51A 1B4OA 1ET6A 3MVVA 3RZOH 1MSHA 2R93H 3TS0A 4B3SQ 4XQQA 2EXDA 2KHIA 1JCKB 1SYFA 3BZKA 3I3CA 3L9AX 3JAME 1MJCA 1TWFH 3K5LA 3W1GA 5FO7B 4YY3Q 4QGUA 5C0XJ 3RNUA 2SEBD 1IZ6A 1SEBD 2IL8A 2XWBB 2BH8A 1FYCA 3D4DA 1VQLA 3KUPA 4LF9Q 3K5MA 1AZPA 5BR8L 3L2PA 2R92G 4XTCS 1N33L 2AQ3B 1YHQA 1PTOF 1XTDA 4C3HH 1SE8A 3S2HB 4G7OC 4CJ2C 3NTHA 1R4PB 1N32L 1WTWA 1FJGQ 4OWWB 1YZ6A 1CT1D 2K32A 3QOLA 3CRKC 4DV4Q 5I6WA 1EQRA 5G3LF 3I56A 1UEBA 1YJ9A 4RAUC 2ZJRA 5BR8Q 4X66L 1SBBB 2K5VA 3TS2A 1O7IA 4CKEA 1U5KA 3R2TA 3DEOA 4A3CH 1JE5A 1D1IA 3DWPA 1KC8C 3SVMA 2G9HD 3M7GA 3HOWH 1QE6A 1H95A 4ZKCB 2IW3A 4KMUC 1WI5A 4XT3B 2DN8A 1Q1BA 3L7ZC 2IJ0A 4AIMA 4ME5A 3NQTA 1JJ2A 3CU7A 1IBKL 4OWXB 3OTOQ 1F9QA 1T5EA 4O1NA 3RLFA 1HNXQ 2ZM6Q 1PYBA 3F8TA 4LWCA 4P2CB 5GROA 4NXML 5IYDH 4HJAA 4A3EH 1UNSA 3I4OA 2R92H 3I55A 3K5NA 1TS3A 2PZWA 5M5XB 4L63B 3GTPB 4HJ7A 2OT2A 3BYTB 4DN4M 3K0YA 1BCPF 4R4TA 1Y1VB 3D3RA 1BF4A 4LF8L 2F0JA 4K5VA 5HURA 2R7ZH 4JG2A 4YHHL 4IFDG 4B3RL 1CFMA 1DM0B 4O2DA 4X65L 4JI2Q 3G71A 3RN2A 1YNNC 1VQ9A 4YWLA 1PYWD 3I91A 4A3KB 4BY1B 3VA5A 1JORA 1NTGA 4KY5A 4PNYA 5ELBA 1S5DD 3L3OC 3DMUA 1QG7A 5EGTA 3H94A 3CQZH 3M4OB 1EIHA 4LAAA 1BUVT 3K5OA 1V1PB 4NXNQ 1AEXA 2Z0SA 3BG3A 1WFQA 4PZ6A 3TEHB 1P8LA 1J6QA 2O5IC 2LFNA 4CDFC 1CHQD 1XMQQ 3J80L 3QR8A 3A5UA 5GADC 3AB9A 2C35B 1IYVA 4UP9A 2B2YA 5IYBG 3HOXH 3AMUA 1M4VA 1WD1A 1TS4A 4Y7NB 1LTLA 2L0CA 4RCOA 3S2DH 4KKSA 2QDLA 2FFKB 4FF4A 3CPFA 1D1KA 1SMXA 3DLLA 1S40A 1AFPA 4CDEC 5D65A 4X66Q 1C7YA 4UPAA 3HKSA 4WJ4A 2XNAC 4UY8C 4JI8Q 3M3YB 3GP7A 2A6HC 2KQ3A 1KDAA 2R93B 3G7LA 3VYUA 1N36L 4JYAQ 4RWSC 2OF1A 1B2TA 1PYSB 4KN4C 1I4XA 2FMCA 2K75A 1Y69U 4B3TL 5CC4A 2CFMA 3K6OA 3TP6A 1KABA 2MHVA 1SAPA 5C44H 5ELEA 3K59A 2F0NA 1BOSA 1Q8KA 5JEAH 5C4ZA 1WTPA 2L5TA 2VNUD 2PZTA 3I2ZA 1B70B 4KHPL 3K57A 1QVGA 3QG1A 1E2VA 3IAYA 4LFAL 4IN3A 1PHJA 3ZJYC 4YHHQ 4H02A 2RDFA 2JEBI 1JT8A 4FF3A 3DM1A 2K6AA 4DU9A 4BA2I 2F0PA 4LF5Q 3KF6B 2A6EC 4LJZC 4DK6C 1JOQA 1BXTA 1F2LA 4L5SA 3EJIA 1SNOA 1HNZQ 4A3IG 4FVMA 2X6GA 2F0GA 1KNEA 2BH2A 4QUCA 4LFBL 1L2FA 1RKNA 3PO2G 3PGZA 1PZJD 4B3ML 5M3MG 4DNRB 1HNWL 1ZYRD 3VR4A 1U4LA 4UAIA 1CQFA 4LUVA 1DD2A 4U68A 4QIWB 4G4KA 1D8LA 1EY5A 4IO9A 1FVIA 3D8GA 3TQYA 1EU3A 4GNXC 4A3LH 2NTTA 4DUZQ 4B9WA 4QIWE 2K01A 1Y1VH 1Q90A 3ITPA 4NW2A 1NMFA 3NE5B 3GO5A 1HXYD 2ZTEA 4KV6A 2DUDA 3A5ZB 1KLUD 1WCMG 2NN6G 1E24A 4ZLTF 1BBXC 1KDBA 4IUTA 3S1QB 3A8IE 3E3XA 4WJWA 4C2MB 5K36H 5IY0A 3M4YA 4DF7A 3VDYA 2XRSD 3UDIA 1NMGA 1E1TA 4F88A 4FDBA 4KI0A 3ER0A 4DV2L 1XJVA 4BXXG 1U0LA 3S16B 1S4ZA 3PO2B 2NWGA 2PI2A 2JQOA 3ERQA 5IGCA 5FLXE 4HIMA 1VCIA 3TREA 3M3YH 3FKIH 1Q1EA 4JW0A 1JE4A 1GXDC 2D0OA 2HUGA 2RF4A 2WV6D 4A3GG 3SK6A 5FKAC 3H3VH 4IALA 4A3CG 5FO8B 4A3FG 3D4RA 2EVBA 1L0XB 1IBLQ 2Z6KA 3SDZA 1NBWA 4IUUA 1SNMA 2KJXA 3KJPA 1Q86C 1PRTB 2B2TA 4IUNA 2Y0SG 3I4NB 2G9DA 4JI3L 3BS1A 2B2WC 1Q82C 3S1MB 1HNWQ 3K7AB 3IL8A 2F0VA 3BDCA 1A3UA 1EYCA 2EXZA 4HIDA 1YHAA 5JEAG 2Q8IB 1WTHA 2L9HA 1GD7A 2PCFB 3T16A 3MC0B 3J7A5 4H44C 4BBSB 2JA8B 4DR2Q 3P75A 1ILPA 4FP5D 1GUSA 2DJFC 3R93A 4EGVA 4FYDA 1TS5A 3TBIB 1KQSA 2NYZD 1DCZA 2K5HA 5KIXA 3SK8A 4HCSA 4DR7Q 4WRDA 2WINB 1PXUA 3GDEA 4A3JB 1HQRD 2B29A 3TP7A 5FLMH 2Y0SE 2JEAI 4JCVE 3NBHA 3VA7A 1TR5A 4JK1C 1STGA 2VXWA 4A3FB 5EPLA 3IFDA 2B8FA 5C5LA 1ZKOA 3K7AH 4WJ3M 4X3SA 4IFDJ 2HCCA 3CAMA 2E76C 4DR5Q 4JI0Q 2A1AA 3I4LA 2RHSB 3HOXG 2JA6H 4BWGB 1PTOD 2F0UA 4BA1I 2VQFQ 2SNSA 4DR1Q 3MAQA 1I94Q 1IW7D 1LYLA 1QVCA 2YV5A 3PF4A 1QNKA 2B2UA 1Q8IA 2CWPA 4JPBW 3HOWB 4LFAQ 3HG9A 3KYHC 2VQEQ 1H9SB 4DV7L 1BR9A 5M3FB 3J7AV 4DR5L 4JI0L 2P5ZX 3BVGA 4OELB 4TRDA 2VQFL 2Q8RE 1RD9D 4GKJL 4IFDH 4K8JA 2R7ZG 4A3JG 1EIGA 3GTJB 4ZRZA 4DFAA 4HTHA 1VF7A 2AWOA 2LY7A 2EYFA 3SK5A 3Q8DA 3N52A 5EKKA 3G6EA 3UDGA 1A3TA 1VQPA 2MGSA 4LF6L 1EQTA 3HZXA 1W6KA 1CSPA 1HZBA 3CC2A 1WOCA 3ND9A 5LMNW 4KHVA 5IYCG 2H4OA 1RTNA 5LMUL 1SFOB 1O7YA 2CH4A 2DNEA 3S1MH 3HOWG 5KEEA 3K80C 2IY5B 1V8QA 5T1IA 4ABNA 3F1ZA 2R7DA 4ME3A 2R93G 5CV4A 1K3RA 1PH8A 1B8AA 1VQCA 4O0AA 1N8RC 2ZXOA 2OQ0A 1X6OA 4AYBB 1A62A 1CHPD 2RSOA 1JR0D 3Q22A 3D0FA 5IT9E 3NENA 1B3AA 4DXGA 3NP8A 4LMQD 3OWEB 2E2HB 5JVG3 5JJZA 1SSOA 2WB1G 4IPHA 5M5YH 5C0XH 1IKMA 4JOIC 1LTBD 1ENAA 3GTPH 1SMYC 3NWSA 3IRBA 1TWAH 3J81c 2E2IB 2YTYA 2B2TC 3CMAA 1UE6A 1HUNA 2C5CA 1BVSA 3GTMH 2PPBC 5E4XA 1S3OA 1PH2A 1FD7D 1O7ZA 1Y1WG 3QWNA 1TWGB 1STEA 3GQBA 4DGZA 5KNCA 1K0RA 4HEDA 5DEHA 3E5SA 3PUXA 3J80c 4X64Q 4H13C 5IGFA 3U4ZA 2XVSA 2K5DA 3A7AB 3OW2A 1J9OA 4IPGA 4DUYL 1O78A 4ODGA 5M3MB 2FHTA 1I6HB 5IOCA 2R7FA 5DM73 5A2QE 4JI4L 3U4VA 3PIO3 4L5QA 3LWUA 5IWAL 2TMPA 4LF4L 2EY1A 1A2UA 5IT9c 1PDQA 1S5BD 2OCEA 4C3IG 1Y8OB 2KENA 3RZDB 3M4QA 4JI1L 1I94L 2XIWA 3VR2A 2F0DA 1HTPA 1Z6HA 3MFGA 4QMGA 1EIYB 3WOFA 5DM63 2F1MA 2KHSA 2VS1A 1XMOQ 2UXBL 3KJOA 1VQKA 4LF4Q 1JJGA 3CCMA 1DONA 3OIPA 4I65A 3KDFA 2EY5A 2YU9H 4XXEA 1LLRD 4C3JB 2QEJC 2E8GA 3M9BA 4A76A 4IUVA 4PMWA 1IBKQ 3KLRA 1VMPA 3MWYW 4P74A 4AQYL 2Z4HA 4PG3A 5FOBB 5JJIA 1H9SA 2L1BA 3PUZA 2KEDA 1HH2P 2B2UC 2O2LD 2LSSA 4IOAA 4A93G 2JA7B 5KNBA 3PCOB 4LF7Q 4DR6L 4KHPQ 2YU9B 4QJFA 3LNNA 1A8VA 1LO5D 3J7ZC 1E3PA 5I9PA 2UUAL 5ELOA 3V2TA 3GTKB 3I4NG 3GTGB 4DPGA 4TVAB 3T56B 4DAYA 4HJ9A 3NBHB 4GKKQ 4BY7H 2KEEA 1OXVA 4LF9L 3RLNA 1DZ1A 3OYYA 4MHEA 1K73C 1X9NA 1K9MC 1PLFA 4KY6A 2J4XA 1EIFA 4C3JG 1HTLD 1VQNA 2LMCB 4DV0L 2B2VC 1Q7YC 5M5YB 2CKZB 2VY3A 4ZKBB 2JA6B 4HIOA 3GTKH 1L1OA 3NPPA 3R8BA 5EBDA 2Q2UA 5IP7H 1B7YB 5FLMG 2X69A 1IBML 1EZ6A 4R4CA 3MTSA 2Q2TA 1I3QB 3MEFA 1PH7A 2R61A 4TQUS 5JPNC 4V190 1KRSA 2EY6A 1GHKA 2A69D 2OWOA 2JP1A 4DV3L 2AQ2B 2WB1E 1H9RA 4POFA 4FF1A 2VQEL 3H09A 1UUPA 3C46A 5F2DA 4YCWA 2X6LA 4LF8Q 3DWAA 2ICIA 3C3LA 3IFTA 1ESFA 4K0KQ 1ESRA 1W2BA 2I5LX 5ISRA 2XTIA 2E2JB 3OWFA 1TY0A 2WACA 2MO1A 1GUOA 1BCPC 1PTOB 3SEBA 4OIJA 5M3FG 1PH1A 2J0TD 2BE5D 1B50A 2QKIC 4B9XA 1G91A 3E0JA 3I90A 4CHTB 2RQXA 1LT5D 2NVXB 1STBA 4EQOA 4PMCA 2MP1A 2BA0A 5IP7G 4LFBQ 3EIVA 1CUKA 1JOOA 2DY8A 4P71A 2F0EA 1Q81C 4BXXH 1C9OA 3PO3H 4OO1H 1C48A 1E2ZA 4KJNA 4MTNA 2F0SA 3PIP3 4IFDI 3LX0A 1D5ZC 4MNOA 3TRZA 3EBEA 5E7NA 4KY7A 1JICA 4G7HC 2O5JC 2PW5A 2VL6A 5FK9C 4GLAC 4RGOS 1WTQA 4HCEA 5JJLA 3CCJA 3SHLA 4F87A 1MHWC 3KLSX 4HJ5A 5EPJA 1WTVA 3SGIA 1K8GA 4JBKA 2ATWA 1Q46A 3S2DB 2EZVA 1TIID 1PFNA 1FJGL 4GKJQ 5CV9A 3BZCA 1BDOA 1H9KA 1WJJA 5CV6A 1Y8PB 1LTRD 3GTJH 4JI1Q 3DEPA 1I3QH 4X3KA 3NTKA 2XRQD 2E2IH 1SROA 2BCOA 3RD4A 1NCVA 2BA1A 3VR6A 2F4VL 4A3BB 1R4QB 2L4NA 1BCPB 2GVBA 3HOUH 1PFSA 4QF4A 4B3SL 4A3MG 1ZXTA 1QNUA 3CQZB 3M4OH 3S14H 5IGBA 3PIOA 4JYAL 1EEID 2K04A 4BS9A 2ZXPA 4J6HA 1VQFA 1VQJA 4BBRH 2UUCL 4PZ7A 1HZAA 3RR5A 1UWVA 3PQIA 4B3RQ 1VQMA 4UP7A 4KD4A 5CV8A 1F2ZA 2KUMA 1OXXK 1QZGA 1BO0A 3A8JE 4DNIA 5T1GA 1SRUA 2A6HD 2IPKD 2JA8H 5IT9L 2TSSA 4A3IH 4GN3B 3TZUA 1EQVA 1DXMA 1KHIA 2BE5C 4X6AH 4RMFA 2WKCA 2Q8TA 4OX9L 2UXBQ 3S17B 2A5HA 4ZCKA
chains in the Genus database with same CATH topology
3HP3A 2AUJD 4F7XA 1LTGD 5CV5A 2B2WA 1CI3M 4RFBA 1RODA 5K5PA 5EBCA 3GTOB 2RSNA 1LT3D 1SNCA 1XXGA 5C4XB 4RHSA 1C4QA 1F9SA 2A6ED 5TSSA 1EU4A 1ENCA 3SR1A 2NVTB 2B2VA 2NVQB 3G6JB 4UDUC 1AN8A 4PV1C 4FXKC 4KN7C 2RKSA 1I6VC 5KYLA 3TZDA 4CJ0B 1SJED 3MFYA 5JEAJ 1V1PA 2K05A 3X3NA 1FGBD 1FNUA 4OO1G 1UEAB 3TDQA 1XX8A 2EDGA 2CQAA 4FF2A 1FNWA 1SE3A 3EVQA 1IYUA 3E6ZX 1KAAA 3J7YW 2DNCA 5ELDA 2CW0C 4OHJA 4OIKA 1SYBA 2C9OA 1QB5D 5FO9B 2L11A 3GTMB 1SDFA 1PRTD 2EJMA 1CZWA 2H1EA 5EQ0A 4KKTA 1WD0A 3FMCA 2QILA 1STYA 1EZ8A 1JWSD 1TVXA 3HRZC 4X3UA 1HHVA 4GZYC 1EY0A 3PV0A 2HCIA 4K2KA 3KLSA 3P20A 1ZYRC 3QIAA 1X3PA 2SOBA 3SE0A 2I46A 5I4DA 3QOJA 4QB4A 4RA8A 1EY4A 1F2MA 3CRLC 4RGMA 2FMMA 2BDNA 5KNDA 3Q6SA 4K6DA 5M9OA 1LV9A 1V1OA 3NXWA 5BN4A 2E74C 1AP0A 1B9NA 2GA4B 1JWUD 4C3HB 1HUMA 2CHBD 1LT6D 2IX0A 4KTAA 3D6CA 5KYIA 1B1ZA 4ULLA 2RDHA 3A8KE 3HEJA 3DUZA 4ZK9B 1TY2A 2AWNA 5I2YA 4NP5A 2K28A 4OO1I 1AZQA 1U4MA 2HDMA 2M2LA 2V4DA 4DK1A 5C4JB 1EFID 3Q23A 2EJFC 4NKLA 4BY7B 1EY9A 1OXUA 3HOXB 1OXTA 1VDZA 1S5ED 1KDCA 2R92B 2NB0A 3KF8A 5JPMC 1SNQA 3UI2A 2E75C 3NSWA 4FO2A 1SYCA 5EKLA 1SJHD 1VF5C 1D5MC 2N88A 1SE4A 3A56A 3OMGA 1OXSC 1GUWA 3BVMA 2R7ZB 3FKIB 2EYOA 1NR4A 3RMHA 1JOKA 3VR5A 3FEWX 1Q3LA 1E0BA 2F0KA 3H0GB 1J8IA 1SYDA 4ZQ3A 1DOMA 3U9SA 4DK0A 3OW7A 1PZID 3J81E 5KGUA 3D4WA 4IQZA 3QB3A 4V0BA 3OMCA 4G57A 3T51B 5LL6S 4I7ZC 2YYZA 1SNDA 3BDOA 1LACA 1HA6A 2LS01 4IURA 1QCBD 5JVH3 1MD2D 3GV3A 1PMRA 5C44B 3CHBD 1ET9A 1X3QA 2AQ1B 4QCLA 1EY8A 4XIGS 1A3VA 3VR3A 1WTXA 2K33A 1TS2A 5CV7A 1RJTA 3DHQA 2F0WA 4XYOA 2VUMB 3W3AA 1ILQA 2WB1B 1II3A 5C3XA 3T13A 3J81L 2PO4A 1TWCB 2ID0A 5J1ZA 3KK7A 1GJXA 1MBYA 2QF7A 3NK9A 5J39A 3C1FA 2R3ZA 1IKLA 5G3LD 5AFWA 1WTOA 1A2TA 1I4PA 1H9JA 3MXUA 4LK1C 3MEHA 3EQLC 1H9MA 2D62A 1Z47A 4CGYB 1XTCD 3M85A 4S3SA 2EOTA 1EOTA 1K83B 1X32A 4DAPA 3C1EA 4J8QA 2NVYB 4A3GB 2F0TA 1EL0A 4H0LC 4RHRA 5E3FA 2ZXRA 2XSCA 3HGBA 3ONAB 2D5DA 1C8CA 4FXGC 3HOYB 4A3EB 3FVQA 3DWQA 2B39A 1EY6A 4Q0FA 1U4PA 1OO9B 2NBFA 4TSSA 3S9WA 4A3IB 3BZDB 2A68C 3GTQB 3GTLB 4XQJA 1V43A 3OPOA 2PMZB 2F0OA 3H6MA 1GUGA 5C6AA 2BDOA 2VB2X 3PUYA 1IHZA 2EYHA 3PUWA 1EYAA 2PYKA 4N9TA 1EY7A 1ZEQX 4MIUA 1SXTA 3JAML 5NUCA 1TKWB 4PMBA 1DJRD 3TSSA 1GUNA 1EEFD 1I4GA 1F9PA 1RTOA 1TQOA 4NDXA 3TN2A 3V96A 4KHZA 3D31A 5DNFA 3A54A 1ICWA 2JSOA 3NHHA 5JOBA 3R2IA 4DAVA 2L12A 5BN5A 3O13A 4KK7A 1YNJC 1L0YB 4R8IA 3PMFA 2F03A 5C0XG 2HQEA 1Z7TA 1I50B 1MGSA 1HA5A 1JQYD 1EYDA 2MUYA 1U9RA 1A6XA 4F8MA 1W6JA 3T4AC 3H3VC 2A69C 4DXFA 2NTSA 4ZAIA 4DA2A 5C4HA 2Y0SB 2HDLA 1XYIA 2F4IA 4QUFA 2EJGC 3R3OA 1G6ZA 3J7AF 3HS0C 2IWHA 1CA6A 2F0FA 1Y8NB 4IZ8A 2PZUA 1R9TB 4EQPA 2KVMA 2Z8LA 3MZ5A 3Q24A 2QCPX 4B08A 4CKBA 4RKLA 5E1FA 3S1RB 4IUPA 2IX3A 1QWYA 4R8NA 3HOUB 2MPMA 1CM9A 1ML0D 1K8OA 2KOLA 1XWEA 4ZUJA 3URYA 3J80E 2XWJB 2IT1A 2CVRA 5D3DA 3QO2A 1YNJD 1NR2A 2F0LA 2O4XA 1PTOC 3GV6A 1DYQA 2DY7A 1D2BA 3NUCA 4G7ZC 1D5XC 1TU2B 3AU7A 3MA2B 1MI2A 1SNPA 2JYOA 3FRPB 4EQNA 1STNA 3NWTA 5IIFA 1NSNS 4R9WA 3CKIB 2WKDA 4L8JA 1CK1A 4RKBA 4BBRB 2F0HA 3MXGA 4HAEA 2EYPA 3EROA 4JBWA 4C1NI 4WORA 1GHJA 2B8GA 5E4WC 2A74C 4K6LA 1HFNA 2OXPA 1WTRA 2D2CC 3H91A 4FNFA 3WDNA 5IGGA 1PFBA 4Q5VA 3I8ZA 4C1NK 3GD7A 4IUQA 1D6EC 3I4MB 2ENBA 3M7NA 3FDTA 3BVZA 4K5XA 2K5QA 3X3MA 1I4HA 4M1UB 2B2YC 2SDFA 3PO3B 3K58A 2J7ZA 2WIIB 2JE6I 2B63B 2NUCA 1LABA 1T5XD 1JC7A 3TMEA 3A7LA 1F2YA 3ND8A 5C3EB 5C3WA 1PRTF 2EYMA 5BN3A 2KECA 2ZT9C 3EA6A 3HKZB 5I9OA 2NN6H 4X3TA 2R6GA 1NUCA 4YIJA 4XYQA 2F3VA 5D3IB 3T53B 2NN6I 3LWEA 1UAPA 4ILWA 1BQQT 4CKCA 5A2QL 4TKOB 5ELCA 4C3IB 3I72A 1O80A 2MJ8A 1S5CD 3TP8A 4K8IA 5HGTA 1G8ZD 2L55A 3A55A 4J1MA 4XT1B 2AUKA 3Q0AA 2KA7A 1RHPA 4EVOA 3OSOA 5CBAE 5COYA 5EPKA 1TWFB 4HMIA 5CORA 4E6IA 1M8AA 3OHXC 2SNMA 5EJWA 1G2SA 4C56C 1LTSD 1CQVA 4N9PA 2JXMB 2RBMA 4KJOA 4K2LA 2EY2A 1IL8A 4HSVA 1STHA 5I6YA 5IGDA 4HSPA 1B44D 1FR3A 2K1BA 1SYEA 3S1NB 4A3DB 1B53A 2F3WA 3NQIA 1YNND 2EPBA 3OIQA 2RDGA 5C0XI 3RUZA 2FINB 4KD3A 2PQEA 4OGQC 4XQNA 2XN9C 1S5FD 1IW7C 3ZYYX 5CMDA 4K5WA 4NMZA 4HR7B 3BDLA 3MXNA 5IODA 3P1HA 5CGKA 1ENFA 2M00A 3QJYA 4A3MB 1MSGA 2BOSA 1PTOH 1DOLA 4XDXA 1KTKA 2Z1CA 1KLGD 4MN3A 2M9VA 5EKIA 5K36G 3VYRA 2PNRC 3I70A 3N6RA 3MHBA 1F9RA 4CJ1B 4RGTA 1HPCA 2OEOA 2F0IA 1ONLA 1LTAD 1PFMA 3SXHA 1O7LA 1EWCA 1EWHA 5IGEA 2KCNA 5ELFA 4RH6A 1VMCA 2QDBA 4H7BA 2NZ1D 4HMJA 1CA5A 1GOZA 5A35A 2EYJA 1RDPD 3KBXA 1WVLA 4OL7A 1DOKA 4PQXA 3U9OA 4ZUIA 1K8MA 2LKVA 4RCNA 5I2XA 2F0MA 4ZYSA 5CYUA 3S15B 1RF2D 2KCCA 3P7JA 5M5WB 5DAUA 2EYLA 2CW0D 1QILA 2K03A 3C2PA 3VYTA 2WP8J 2I07B 1TT2A 3F2UA 2RVLA 1HFGA 1PRTC 1SMYD 1LTID 5JAVA 5KRUA 1Q12A 2Z4IA 3NBIA 3S14B 1F77A 2D9UA 1RCVD 1FNVA 3D6WA 3EFXD 1G2TA 2WAQB 5CR3A 4RGNA 2IX1A 4Z9CB 2PW7A 5CBEE 3V05A 1JWMD 1STAA 1TWAB 1HQMC 1CTMA 5J22A 2E2DC 1B9MA 1E2WA 1BCPD 1TWHB 1LT4D 3I73A 3TP5A 3HOVB 3RZOB 5LL6X 4ID6A 3W2DA 2VB3X 5LHY1 4FXDA 1I4QA 5D14A 2K5WA 4A93B 4HN7A 1CZGA 1NAPA 3PUVA 1QOHA 3FPPA 2EE1A 2A73B 1GUTA 2A68D 2RA4A 1SYGA 1HRJA 2F0QA 2N55A 3WOEA 5C5MA 3VYSA 3MXPA 1PZKD 4DNTB 3IKJA 3OOCA 1WCMB 3BYYB 1JB3A 1G291 4CBVA 1BNZA 2JA5B 1AW7A 1U4RA 2ICEC 4C3HG 4O42A 4L6TB 1KNAA 1A15A 1SE2A 4WFN3 3SK4A 5FLXL 3KBGA 2FJ2A 4M8AA 4U673 4K14A 4KKUA 3HOZB 3NTIA 2K7VA 3FPUB 1I4RA 1HCZA 1QJOA 1LTTD 3DXJC 1B4OA 1ET6A 3MVVA 1MSHA 4XQQA 3L9AX 1JCKB 1SYFA 3I3CA 3JAME 3K5LA 5FO7B 5C0XJ 2SEBD 1SEBD 2XWBB 2IL8A 1FYCA 3D4DA 3KUPA 3K5MA 1AZPA 4XTCS 2AQ3B 1PTOF 3S2HB 4G7OC 4CJ2C 3NTHA 1R4PB 1WTWA 3QOLA 1CT1D 2K32A 3CRKC 5I6WA 5G3LF 4RAUC 1SBBB 4CKEA 3R2TA 3DEOA 1D1IA 3DWPA 3SVMA 2G9HD 3M7GA 1QE6A 4ZKCB 2IW3A 4KMUC 4XT3B 2DN8A 1Q1BA 3L7ZC 2IJ0A 3NQTA 4ME5A 3CU7A 1F9QA 1T5EA 4O1NA 3RLFA 4P2CB 1UNSA 3K5NA 1TS3A 2PZWA 5M5XB 4L63B 3GTPB 2OT2A 3BYTB 4DN4M 3K0YA 1BCPF 1Y1VB 3D3RA 1BF4A 2F0JA 4K5VA 5HURA 4IFDG 1CFMA 1DM0B 1YNNC 4A3KB 1PYWD 3I91A 4BY1B 3VA5A 1JORA 4KY5A 4PNYA 5ELBA 1S5DD 3L3OC 3DMUA 1QG7A 5EGTA 3H94A 3M4OB 1EIHA 4LAAA 1BUVT 3K5OA 1V1PB 1AEXA 3BG3A 2O5IC 2LFNA 1CHQD 3J80L 3AB9A 1IYVA 2B2YA 3AMUA 1M4VA 1WD1A 1TS4A 4Y7NB 2L0CA 4RCOA 4KKSA 2FFKB 4FF4A 1D1KA 2A5HA 1AFPA 5D65A 2XNAC 3M3YB 3GP7A 2A6HC 2KQ3A 1KDAA 2R93B 3G7LA 3VYUA 4RWSC 2OF1A 1B2TA 4KN4C 1I4XA 2FMCA 1Y69U 5CC4A 3K6OA 3TP6A 1KABA 2MHVA 1SAPA 5ELEA 3K59A 2F0NA 1BOSA 5JEAH 5C4ZA 1WTPA 2L5TA 2VNUD 2PZTA 3K57A 3QG1A 1E2VA 3IAYA 4IN3A 2RDFA 2JEBI 4FF3A 4DU9A 2K6AA 3DM1A 4BA2I 2F0PA 2A6EC 4LJZC 1JOQA 1BXTA 1F2LA 3EJIA 1SNOA 4FVMA 2X6GA 2F0GA 1KNEA 4QUCA 1RKNA 1PZJD 4DNRB 1ZYRD 3VR4A 1U4LA 4UAIA 1CQFA 1DD2A 4U68A 4QIWB 4G4KA 1EY5A 3D8GA 1EU3A 2NTTA 4B9WA 2K01A 3ITPA 1Q90A 4NW2A 3NE5B 3GO5A 1HXYD 4KV6A 1KLUD 2NN6G 4ZLTF 1BBXC 1KDBA 4IUTA 3S1QB 3A8IE 4WJWA 4C2MB 5K36H 3M4YA 4DF7A 2XRSD 4F88A 4KI0A 3S16B 1S4ZA 3PO2B 2NWGA 3ERQA 5IGCA 5FLXE 1VCIA 1Q1EA 1JE4A 1GXDC 2HUGA 2WV6D 3SK6A 5FKAC 4IALA 5FO8B 3D4RA 2EVBA 1L0XB 3SDZA 4IUUA 1SNMA 2KJXA 1PRTB 2B2TA 4IUNA 3I4NB 2G9DA 3BS1A 2B2WC 3S1MB 3K7AB 3IL8A 2F0VA 3BDCA 1A3UA 1EYCA 2EXZA 5JEAG 2Q8IB 2L9HA 2PCFB 3T16A 3MC0B 4H44C 4BBSB 2JA8B 3P75A 1ILPA 4FP5D 1GUSA 4FYDA 3R93A 4EGVA 1TS5A 3TBIB 2NYZD 1DCZA 5KIXA 3SK8A 4HCSA 4WRDA 2WINB 1PXUA 4A3JB 1HQRD 3TP7A 2JEAI 3NBHA 3VA7A 1TR5A 4JK1C 1STGA 2VXWA 4A3FB 5EPLA 3IFDA 2B8FA 5C5LA 1ZKOA 4X3SA 4IFDJ 2HCCA 2E76C 3I4LA 4BWGB 1PTOD 2F0UA 4BA1I 2SNSA 3MAQA 1IW7D 1QNKA 2B2UA 1Q8IA 3HOWB 3HG9A 1H9SB 1BR9A 5M3FB 3J7AV 3BVGA 4TRDA 2Q8RE 1RD9D 4IFDH 4K8JA 1EIGA 3GTJB 4ZRZA 4DFAA 4HTHA 1VF7A 2AWOA 2LY7A 2EYFA 3SK5A 3N52A 5EKKA 1A3TA 2MGSA 1EQTA 3HZXA 1W6KA 3ND9A 4KHVA 2H4OA 1RTNA 1SFOB 1O7YA 2DNEA 5KEEA 1V8QA 5T1IA 4ABNA 5CV4A 2ZXOA 4AYBB 1CHPD 2RSOA 1JR0D 3Q22A 5IT9E 1B3AA 4DXGA 3NP8A 4LMQD 3OWEB 2E2HB 5JVG3 5JJZA 1SSOA 5C0XH 1IKMA 1LTBD 1ENAA 1SMYC 3NWSA 2E2IB 2B2TC 1HUNA 2C5CA 2PPBC 5E4XA 1FD7D 1O7ZA 3QWNA 1TWGB 1STEA 3GQBA 4DGZA 5KNCA 4HEDA 5DEHA 3E5SA 3PUXA 4H13C 5IGFA 2XVSA 2K5DA 3A7AB 1J9OA 1O78A 4ODGA 5M3MB 2FHTA 1I6HB 5IOCA 5DM73 5A2QE 3PIO3 3LWUA 2TMPA 2EY1A 1A2UA 1PDQA 1S5BD 4C3IG 1Y8OB 3RZDB 2XIWA 3VR2A 2F0DA 1HTPA 1Z6HA 3MFGA 4QMGA 3WOFA 5DM63 2F1MA 2KHSA 1DONA 3OIPA 4I65A 2EY5A 4XXEA 1LLRD 4C3JB 2QEJC 4IUVA 4PMWA 3KLRA 1VMPA 3MWYW 2Z4HA 5FOBB 1H9SA 2L1BA 3PUZA 2KEDA 2B2UC 2O2LD 2JA7B 5KNBA 2YU9B 3LNNA 1LO5D 5I9PA 3V2TA 3GTKB 3GTGB 3T56B 4DAYA 2KEEA 1OXVA 1DZ1A 4MHEA 1PLFA 4KY6A 2J4XA 4C3JG 1HTLD 2LMCB 2B2VC 5M5YB 4ZKBB 2JA6B 3NPPA 3R8BA 5EBDA 2X69A 1EZ6A 3MTSA 1I3QB 2R61A 4TQUS 5JPNC 4V190 2EY6A 1GHKA 2A69D 2JP1A 2AQ2B 1H9RA 4FF1A 3H09A 1UUPA 3C46A 5F2DA 2X6LA 3DWAA 2ICIA 3C3LA 3IFTA 1ESFA 1ESRA 5ISRA 2E2JB 3OWFA 1TY0A 2WACA 1GUOA 1BCPC 1PTOB 3SEBA 4OIJA 2J0TD 2BE5D 1B50A 2QKIC 4B9XA 1G91A 3E0JA 3I90A 4CHTB 2RQXA 1LT5D 2NVXB 1STBA 4EQOA 4PMCA 2MP1A 2BA0A 1JOOA 2DY8A 2F0EA 4OO1H 1C48A 1E2ZA 4KJNA 2F0SA 3PIP3 4IFDI 3LX0A 1D5ZC 4KY7A 1JICA 4G7HC 2O5JC 2PW5A 5FK9C 4RGOS 1WTQA 4HCEA 3SHLA 4F87A 3KLSX 1WTVA 5EPJA 3S2DB 2EZVA 1TIID 1PFNA 5CV9A 1BDOA 1H9KA 5CV6A 1Y8PB 1LTRD 3DEPA 4X3KA 3NTKA 2XRQD 2BCOA 3RD4A 1NCVA 2BA1A 3VR6A 4A3BB 1R4QB 2L4NA 1BCPB 4QF4A 1ZXTA 1QNUA 3CQZB 5IGBA 1EEID 2K04A 4BS9A 2ZXPA 4J6HA 4KD4A 5CV8A 1F2ZA 2KUMA 1OXXK 1BO0A 3A8JE 5T1GA 2IPKD 2A6HD 5IT9L 2TSSA 3TZUA 1EQVA 1DXMA 2BE5C 2WKCA 2Q8TA 3S17B 1Y1WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JOB A;  1STY A;  2EXZ A;  2PZW A;  2EY5 A;  5J39 A;  1EZ8 A;  4KHV A;  5ISR A;  3EJI A;  4F7X A;  3C1F A;  1SNQ A;  1SNO A;  2EYM A;  2WAC A;  3OWF A;  5CV5 A;  4K5W A;  2F0G A;  1SNP A;  1TT2 A;  3T16 A;  1A2T A;  5KEE A;  3SK4 A;  5I9O A;  1SYC A;  2F0J A;  4K5V A;  5EKL A;  5K5P A;  4NMZ A;  1EY0 A;  4EQO A;  5HUR A;  3BDL A;  1NUC A;  3P75 A;  4K14 A;  5IOD A;  4YIJ A;  3P1H A;  1RKN A;  3PMF A;  4K2K A;  5CV4 A;  5CGK A;  4EQN A;  1STN A;  1SNC A;  3MEH A;  3OMG A;  4B9X A;  2M00 A;  2HQE A;  5KIX A;  2F3V A;  3SK8 A;  3VA5 A;  5IIF A;  5JAV A;  4WRD A;  5KRU A;  1NSN S;  1JOR A;  2EYO A;  2SOB A;  1ENC A;  1STB A;  1EYD A;  4KY5 A;  1U9R A;  3QOJ A;  4PMC A;  4PNY A;  4S3S A;  3DMU A;  4QB4 A;  5EGT A;  3TP7 A;  4F8M A;  5I6Y A;  5IGD A;  1JOK A;  4RKB A;  1EY5 A;  4LAA A;  1EY4 A;  1F2M A;  1JOO A;  2F0K A;  3MVV A;  2F0E A;  3D8G A;  3C1E A;  1AEX A;  2F0H A;  1TR5 A;  2F0T A;  1STG A;  4KJN A;  2EYP A;  1SYD A;  3NP8 A;  4ZQ3 A;  3ERO A;  1EYC A;  5M9O A;  1SYF A;  2RKS A;  4K6D A;  2F0S A;  3ITP A;  5C5L A;  3LX0 A;  4B9W A;  4WOR A;  5E3F A;  5I9P A;  3MHB A;  5KYL A;  5CR3 A;  3NXW A;  1ENA A;  4KY7 A;  2OEO A;  3TP8 A;  3V2T A;  4K8I A;  4KV6 A;  5C4H A;  5HGT A;  2PW5 A;  3D4D A;  2F0I A;  2F0U A;  1KDB A;  3SHL A;  2SNS A;  3R3O A;  2PW7 A;  5KGU A;  2OXP A;  4J1M A;  1EY6 A;  3SXH A;  4DF7 A;  1STA A;  3D4W A;  4DGZ A;  3S9W A;  2F0F A;  3NK9 A;  4KY6 A;  5IGE A;  5DEH A;  3E5S A;  2PZU A;  3QB3 A;  3OSO A;  4IZ8 A;  5CV9 A;  3OMC A;  4EVO A;  4EQP A;  5IGG A;  4G57 A;  5J22 A;  5CV6 A;  3MZ5 A;  4HMI A;  4KTA A;  3D6C A;  3QOL A;  5IGF A;  5KYI A;  4RKL A;  5E1F A;  1SND A;  2F0O A;  5I6W A;  3H6M A;  2QDB A;  4H7B A;  2KQ3 A;  2ENB A;  5C6A A;  4HMJ A;  3SR1 A;  1KDA A;  3TP5 A;  4E6I A;  1IHZ A;  4R8N A;  2EYJ A;  3HEJ A;  4ID6 A;  2EYH A;  2SNM A;  3ERQ A;  4QF4 A;  4TRD A;  4ODG A;  3EVQ A;  5IGC A;  2OF1 A;  4K5X A;  1EY8 A;  1EYA A;  5IOC A;  4OL7 A;  5IGB A;  4K8J A;  5CC4 A;  1KAA A;  2PYK A;  1EZ6 A;  1A3V A;  4N9P A;  4NP5 A;  1KAB A;  3TP6 A;  2RBM A;  4N9T A;  4ZUI A;  3U9O A;  4J6H A;  1EY7 A;  4MIU A;  4KJO A;  4DFA A;  4HTH A;  2F0N A;  2LKV A;  4K2L A;  4ZUJ A;  2EY6 A;  2EY2 A;  5NUC A;  4KD4 A;  5C4Z A;  4PMB A;  5CV8 A;  1F2Z A;  1STH A;  1A2U A;  2EY1 A;  2PZT A;  3DHQ A;  1SYB A;  2EYF A;  2NUC A;  2F0M A;  4IAL A;  5CV7 A;  2F0W A;  3NQT A;  4ME5 A;  3SK5 A;  5EKK A;  1SYG A;  4NKL A;  1SYE A;  1TQO A;  1II3 A;  4NDX A;  5C3X A;  3T13 A;  3TME A;  1EQV A;  2F0Q A;  2F0D A;  1SNM A;  1EY9 A;  2RDF A;  2F0L A;  2F3W A;  4QMG A;  5F2D A;  3MXP A;  5C5M A;  2O4X A;  1F2Y A;  3SK6 A;  1A3T A;  4IUN A;  5C3W A;  4DU9 A;  5J1Z A;  2KHS A;  5DAU A;  2F0P A;  3RUZ A;  4KD3 A;  2EYL A;  2PQE A;  3HZX A;  1KDC A;  3NHH A;  3NUC A;  2F0V A;  3BDC A;  1A3U A;  4I65 A;  1JOQ A; 
#chains in the Genus database with same CATH topology
 4LNQ A;  3HP3 A;  2AUJ D;  4GOP B;  4F7X A;  1LTG D;  4DR7 L;  5CV5 A;  3CW2 C;  2B2W A;  1CI3 M;  1LUZ A;  4RFB A;  1VQI A;  1XPO A;  2CH4 W;  1ROD A;  5K5P A;  5EBC A;  3GTO B;  1PV4 A;  2N49 A;  1EYG A;  2RSN A;  4A3B G;  2H5X A;  1LT3 D;  1SNC A;  1XXG A;  1J5E L;  1HZ9 A;  5C4X B;  4RHS A;  1C4Q A;  1F9S A;  1W3S A;  2A6E D;  5TSS A;  1EU4 A;  1ENC A;  3SR1 A;  2NVT B;  2B2V A;  2NVQ B;  1X65 A;  3G6J B;  2JN4 A;  4X62 Q;  1XMO L;  4UDU C;  3F2B A;  1AN8 A;  1GKH A;  3UE1 A;  4PV1 C;  2VUM G;  4FXK C;  4KN7 C;  2RKS A;  1SFO H;  1I6V C;  4ALP A;  5KYL A;  3S2H H;  3TZD A;  5C3E G;  1VQ6 A;  4IJL A;  4CJ0 B;  1PH3 A;  1SJE D;  3MFY A;  5JEA J;  4AYB E;  4EX5 A;  1V1P A;  2K5N A;  2K05 A;  4JI5 L;  3X3N A;  1FGB D;  1FNU A;  2JA5 G;  4OO1 G;  1UEA B;  1YIJ A;  3TDQ A;  1XX8 A;  5IP9 H;  3T1H L;  2EDG A;  2CQA A;  4FF2 A;  1BBU A;  1FNW A;  1SE3 A;  3HOZ G;  4A93 H;  3EVQ A;  3S16 H;  5C4X G;  1OTC A;  1IYU A;  3E6Z X;  1KAA A;  4IPC A;  3J7Y W;  2DNC A;  5ELD A;  2CW0 C;  3GTL H;  4OHJ A;  4DV2 Q;  4POG A;  2UUB L;  4OIK A;  4N8F A;  1A63 A;  1YEZ A;  1SYB A;  1DGS A;  2C9O A;  1QB5 D;  4GLV B;  5FO9 B;  5C4X H;  2L11 A;  3GTM B;  4X65 Q;  1SDF A;  2OTJ A;  1GM5 A;  1PRT D;  1X3E A;  2EJM A;  1R9T H;  1E7Z A;  4JI6 L;  1CZW A;  4RG1 A;  2H1E A;  4GN4 B;  4DK3 C;  3PIP A;  3NEL A;  1XPR A;  5EQ0 A;  4KKT A;  1WD0 A;  5GAG C;  5GQO A;  3FMC A;  2PQA A;  2UUB Q;  2QIL A;  1STY A;  1VQA A;  1EZ8 A;  1JWS D;  1EQQ A;  1TVX A;  1TWC H;  3HRZ C;  4X3U A;  4A3D H;  1QZH A;  4DAY B;  1HHV A;  4GZY C;  4LUZ A;  4C3I H;  3BU2 A;  1EY0 A;  1VQG A;  1HZC A;  3KF8 B;  2VW9 A;  3PV0 A;  2HCI A;  1XNQ L;  1ASY A;  1LM0 A;  4K2K A;  3KLS A;  3P20 A;  4IPD A;  1ZYR C;  4LFC L;  3QIA A;  2PI2 E;  1X3P A;  4HIK A;  4B3M Q;  2QA4 A;  1YNX A;  2SOB A;  3SE0 A;  3CCV A;  2I46 A;  5I4D A;  3QOJ A;  4QB4 A;  1S72 A;  4GNX B;  4RA8 A;  1EY4 A;  1F2M A;  3CRL C;  4LF5 L;  2I5M X;  4RGM A;  1CSQ A;  2FMM A;  1TXY A;  4JI7 L;  2BDN A;  5KND A;  5IP9 G;  3Q6S A;  4K6D A;  5M9O A;  4BY7 G;  1NE3 A;  1I6H H;  1LV9 A;  3FP9 A;  1V1O A;  3K7U C;  1PA6 A;  3NXW A;  5BN4 A;  4A3B H;  1N32 Q;  2EQS A;  2E74 C;  1AP0 A;  1B9N A;  2GA4 B;  2N3S A;  5C3E H;  1JWU D;  4C3H B;  1HUM A;  2CHB D;  4DV5 L;  3HFZ B;  1X54 A;  1LT6 D;  2GN5 A;  2IX0 A;  4KTA A;  3D6C A;  5KYI A;  4GNX A;  4BBS G;  4YWM A;  1B1Z A;  4ULL A;  2RDH A;  3NEM A;  3HOY H;  4DR6 Q;  3H15 A;  2PMZ E;  3A8K E;  3E9I A;  1Z9F A;  3HEJ A;  3DUZ A;  4ZK9 B;  1TY2 A;  2AWN A;  1SLJ A;  2OTL A;  5I2Y A;  1IYJ B;  4NP5 A;  4DR1 L;  3T1H Q;  2K28 A;  4OO1 I;  1AZQ A;  1CKO A;  1U4M A;  2HDM A;  4GS3 A;  2M2L A;  2ES2 A;  2V4D A;  4DK1 A;  5C4J B;  1EUJ A;  1EFI D;  3Q23 A;  2EJF C;  4NKL A;  4BY7 B;  2UXC Q;  1VQ8 A;  3E9H A;  1EY9 A;  1OXU A;  1TWG H;  3HOX B;  1OXT A;  5M5X H;  4I7A A;  1VDZ A;  1S5E D;  1KDC A;  2R92 B;  4JI3 Q;  3J81 j;  3U50 C;  3UE0 A;  3G4S A;  2NB0 A;  3KF8 A;  5JPM C;  2JA5 H;  1SNQ A;  3UI2 A;  1YJW A;  4FO2 A;  2E75 C;  4LW1 A;  3NSW A;  4DV5 Q;  1RIP A;  1SYC A;  5EKL A;  1SJH D;  1VF5 C;  1D5M C;  4GN5 A;  2B63 H;  2N88 A;  1SE4 A;  3CC7 A;  3A56 A;  3OMG A;  1OXS C;  3CF5 A;  2VUM H;  2G5D A;  1GUW A;  1QUQ B;  3ERS X;  3BVM A;  2R7Z B;  3FKI B;  2EYO A;  4BBS H;  1NR4 A;  3RMH A;  1JOK A;  2HIX A;  3VR5 A;  3FEW X;  1Q3L A;  4UP8 A;  2QEX A;  1E0B A;  2F0K A;  3AEV A;  3H0G B;  1J8I A;  1SYD A;  4ZQ3 A;  1DOM A;  1E1O A;  4QY7 A;  3U9S A;  3EN2 A;  4DK0 A;  3OW7 A;  1MJE A;  1PZI D;  3J81 E;  4NB3 A;  5KGU A;  1YIT A;  5C4J H;  3D4W A;  4L5T A;  4IQZ A;  2N8N A;  3QB3 A;  4V0B A;  3OMC A;  1Y1V G;  4G57 A;  4P72 A;  4AQY Q;  3T51 B;  4DUZ L;  5LL6 S;  2Z6K C;  4A3L G;  4I7Z C;  2YYZ A;  1SND A;  2AMC B;  2UUC Q;  2HQL A;  3BDO A;  1LAC A;  2NVY H;  1HA6 A;  2LS0 1;  4IUR A;  3I7F A;  1QCB D;  5JVH 3;  1MD2 D;  3GV3 A;  3ICE A;  4JV5 L;  1PMR A;  5C44 B;  3CHB D;  2HD3 A;  1ET9 A;  1X3Q A;  2AQ1 B;  1RL2 A;  1EY8 A;  1XPU A;  4QCL A;  1E22 A;  4DUY Q;  4XIG S;  1A3V A;  3VR3 A;  4R4O A;  4DV4 L;  1VQD A;  1N33 Q;  3HOZ H;  1WTX A;  2K33 A;  1TS2 A;  4K0K L;  5CV7 A;  1RJT A;  2VZA A;  3DHQ A;  2F0W A;  4GOP A;  1J5E Q;  4XYO A;  2VUM B;  3W3A A;  1ILQ A;  2WB1 B;  1II3 A;  3S1Q H;  5C3X A;  3T13 A;  3J81 L;  2PO4 A;  4AH6 A;  4JBM A;  1MKH A;  1TWC B;  2ID0 A;  3JAM i;  5J1Z A;  3KK7 A;  1GJX A;  2RCF A;  1MBY A;  2QF7 A;  3NK9 A;  1JJC B;  2AHO B;  5J39 A;  3C1F A;  2R3Z A;  1IKL A;  5G3L D;  5AFW A;  1WTO A;  5AJ3 L;  1A2T A;  4R1J A;  5FJ8 G;  1I4P A;  1H9J A;  1BBW A;  3MXU A;  3CCE A;  3I4M G;  4JI5 Q;  4LK1 C;  2PQA B;  1UE7 A;  3MEH A;  2NVQ H;  3EQL C;  5C44 G;  1H9M A;  2D62 A;  1Z47 A;  1C0A A;  1P16 A;  1X55 A;  4CGY B;  3AFP A;  1X3F A;  1XTC D;  3M85 A;  4S3S A;  2EOT A;  1EOT A;  1K83 B;  3CCR A;  2PNH A;  4DV6 L;  4LUO A;  4OON A;  1X32 A;  4DAP A;  3C1E A;  4J8Q A;  2NVY B;  4A3G B;  2F0T A;  1EL0 A;  4H0L C;  2LXJ A;  4RHR A;  5E3F A;  2ZXR A;  2XSC A;  3HGB A;  2Z9H A;  3ONA B;  2OQK A;  1SN8 A;  2D5D A;  4MZ9 A;  1C8C A;  4FXG C;  3HOY B;  3K8A A;  2KHJ A;  4A3E B;  1X3G A;  3FVQ A;  3DWQ A;  3MXN B;  2DGY A;  2B39 A;  1EY6 A;  4Q0F A;  1U4P A;  1OO9 B;  2NBF A;  4TSS A;  4LFC Q;  3S9W A;  1IBM Q;  3PF5 A;  2ZM6 L;  3BZD B;  4A3I B;  2A68 C;  3CCL A;  1L0W A;  3GTQ B;  3HKZ G;  4XQJ A;  3GTL B;  1V43 A;  3OPO A;  3S24 A;  2PMZ B;  2F0O A;  3H6M A;  5GAE C;  1GUG A;  2VB2 X;  2BDO A;  5C6A A;  3PUY A;  2YTX A;  1IHZ A;  2WAQ E;  2EYH A;  3PUW A;  2JA7 H;  1EYA A;  5IE8 A;  2PYK A;  4N9T A;  1EY7 A;  1ZEQ X;  4MIU A;  1PH5 A;  1SXT A;  3JAM L;  3U58 A;  5NUC A;  1TKW B;  5L37 A;  4PMB A;  1DJR D;  3TSS A;  1GUN A;  1EEF D;  1I4G A;  4OXP A;  1F9P A;  1RTO A;  1TQO A;  4NDX A;  1KIX A;  3TN2 A;  3V96 A;  3GTG H;  3HOY G;  1T9H A;  4KHZ A;  3D31 A;  5DNF A;  3A54 A;  1ICW A;  4EQ5 A;  4A3E G;  3FHW A;  2JSO A;  5IYD G;  3NHH A;  4A3F H;  1QVF A;  5JOB A;  3R2I A;  4DAV A;  3CXC A;  2L12 A;  1IL2 A;  2MNA A;  5BN5 A;  1YJN A;  4P75 A;  3O13 A;  4KK7 A;  3W1B A;  1YNJ C;  1L0Y B;  2MFI A;  3PMF A;  4R8I A;  2F03 A;  5C0X G;  2HQE A;  4LF6 Q;  1Z7T A;  2V1C C;  1I50 B;  1MGS A;  1HA5 A;  1JQY D;  1B3Q A;  1EYD A;  1U9R A;  2MUY A;  4Y52 H;  4F8M A;  1W6J A;  1A6X A;  1VQB A;  3T4A C;  1VQ5 A;  1V9P A;  1L1O C;  3H3V C;  2A69 C;  4DXF A;  3I4M H;  3S17 H;  2I0Q A;  1HR0 W;  5FJ8 H;  2NTS A;  4ZAI A;  1KRT A;  4KLK A;  4DA2 A;  3I4N H;  5C4H A;  4X62 L;  1MIU A;  2Y0S B;  2HDL A;  1XYI A;  2F4I A;  4QUF A;  2EJG C;  3R3O A;  1G6Z A;  3J7A F;  2MQH A;  2RHQ B;  3HS0 C;  2IWH A;  1CA6 A;  2F0F A;  1Y8N B;  4IZ8 A;  2PZU A;  1R9T B;  3KF6 A;  4EQP A;  2UU9 Q;  2KVM A;  2Z8L A;  4DR2 L;  3MZ5 A;  3Q24 A;  2QCP X;  4B08 A;  4CKB A;  4RKL A;  5E1F A;  4JI4 Q;  3S1R B;  4IUP A;  2IX3 A;  1QWY A;  5LMN Q;  1PH9 A;  4R8N A;  3HOU B;  3PO2 H;  4BY1 G;  4A3K G;  2MPM A;  1CM9 A;  1ML0 D;  1K8O A;  4JOI A;  2KOL A;  1EWI A;  3M4P A;  1XWE A;  4ZUJ A;  3URY A;  3J80 E;  2XWJ B;  1SR3 A;  3OTO L;  2IT1 A;  2CVR A;  5D3D A;  3QO2 A;  2CWA A;  1YNJ D;  1NR2 A;  5IYC H;  1AE3 A;  2AKW B;  2F0L A;  3ULJ A;  2O4X A;  4R4I A;  1PTO C;  3GV6 A;  1DYQ A;  2DY7 A;  1Y1W B;  1D2B A;  3NUC A;  4G7Z C;  1D5X C;  2B3G A;  1TU2 B;  3AU7 A;  3MA2 B;  1MI2 A;  1A0I A;  1SNP A;  2JYO A;  3FRP B;  2GVA A;  1EOV A;  4EQN A;  1STN A;  4PZ8 A;  3NWT A;  1I5F A;  4A3J H;  1ICF B;  2KBN A;  5IIF A;  1NSN S;  4R9W A;  3CKI B;  2WKD A;  2IHF A;  3H3V I;  4L8J A;  2ZTC A;  1CK1 A;  2F3I A;  3DM3 A;  4RKB A;  3JAM c;  4BBR B;  2L15 A;  1N9W A;  4GOP C;  2F0H A;  3MXG A;  2E5L L;  2B63 G;  4HAE A;  2EYP A;  3ERO A;  4JBW A;  4QQB X;  4C1N I;  2F4V Q;  4WOR A;  1GHJ A;  2B8G A;  5E4W C;  2A74 C;  1KD1 C;  4K6L A;  2WFW A;  1HFN A;  2OXP A;  3UDX A;  1GVP A;  1WTR A;  2D2C C;  1XMQ L;  3H91 A;  4FNF A;  3WDN A;  1YVC A;  5IGG A;  1PFB A;  4Q5V A;  3I8Z A;  4C1N K;  2ZJP A;  3CP0 A;  3GD7 A;  4IUQ A;  1D6E C;  3I4M B;  2ENB A;  3M7N A;  1EFW A;  1VQE A;  3FDT A;  3BVZ A;  2D0P A;  4K5X A;  2K5Q A;  2MO0 A;  4CDD C;  3X3M A;  3S1R H;  1I4H A;  4M1U B;  2B2Y C;  2SDF A;  4N8X 1;  3PO3 B;  3K58 A;  4DV7 Q;  2J7Z A;  4A3K H;  4BY1 H;  3ULL A;  2WII B;  2JE6 I;  2K4K A;  3J80 i;  1X56 A;  3AFQ A;  4BBR G;  2ASB A;  2B63 B;  2NUC A;  1LAB A;  1T5X D;  4CDC C;  4A3M H;  2HHH L;  1JC7 A;  1XNR Q;  3TME A;  2WAQ G;  5H1S E;  3A7L A;  4YCU A;  1IBL L;  1CKN A;  1F2Y A;  2LXK A;  3ND8 A;  5C3E B;  5C3W A;  1PRT F;  5AJ3 Q;  1CKM A;  1Y1W H;  3HKZ E;  1Y14 B;  4DR3 L;  2E2J H;  4DR4 L;  2EYM A;  1M90 C;  5BN3 A;  2KEC A;  2ZT9 C;  3EA6 A;  4JVZ A;  4JI8 L;  3HKZ B;  5LMU Q;  5I9O A;  1WCM H;  1I50 H;  2NN6 H;  4A3G H;  2JA6 G;  4X3T A;  2R6G A;  4DV0 Q;  5JJK A;  4GLX A;  1NUC A;  4YIJ A;  4XYQ A;  3L0O A;  2E5L Q;  1K83 H;  4JC0 A;  2F3V A;  5D3I B;  3T53 B;  2NN6 I;  3LWE A;  1UAP A;  4DR3 Q;  1YHB A;  3PO3 G;  4ILW A;  1BQQ T;  4CKC A;  5A2Q L;  3ULP A;  3W5O A;  4TKO B;  2Q2H A;  3K0X A;  5ELC A;  4C3I B;  1NY4 A;  2DJG C;  3I72 A;  1O80 A;  3GTQ H;  1NNX A;  2HHH Q;  3B6Y A;  4A3D G;  2MJ8 A;  3KOJ A;  1S5C D;  3TP8 A;  4K8I A;  4LF7 L;  5HGT A;  1G8Z D;  5IWA Q;  5ELN A;  4OEM B;  2L55 A;  3A55 A;  4J1M A;  4XT1 B;  2AUK A;  4OWT B;  3Q0A A;  2KA7 A;  1RHP A;  4IJH A;  5J3B A;  4EVO A;  3OSO A;  5CBA E;  1YI2 A;  5COY A;  5EPK A;  1TWF B;  4HMI A;  5FLX c;  2JA8 G;  5COR A;  4E6I A;  2Z6B A;  1M8A A;  3OHX C;  2SNM A;  5EJW A;  1G2S A;  3CME A;  4C56 C;  1LTS D;  4OX9 Q;  1CQV A;  4N9P A;  4IOC A;  3H0G H;  2JXM B;  2RBM A;  2JA7 G;  4KJO A;  3F2C A;  3HOV H;  4K2L A;  3KLW A;  2EY2 A;  1XNQ Q;  1IL8 A;  4HSV A;  1STH A;  2JK8 A;  5I6Y A;  5IGD A;  4HSP A;  1B44 D;  1FR3 A;  2K1B A;  1SYE A;  1M1K C;  3S1N B;  1WYD A;  4A3D B;  1B53 A;  2F3W A;  2JJQ A;  3RLO A;  1KAW A;  3NQI A;  2JA9 A;  1YNN D;  2EPB A;  3OIQ A;  2RDG A;  1JB7 A;  5C0X I;  3RUZ A;  2FIN B;  4KD3 A;  2PQE A;  4OGQ C;  4XQN A;  2XN9 C;  4DV1 L;  1K28 A;  1K0S A;  1V1Q A;  1S5F D;  4DKA C;  4GKK L;  1IW7 C;  3ZYY X;  1HR0 L;  1NJI C;  5CMD A;  1YBY A;  4K5W A;  2KCM A;  5EAY A;  3A74 A;  4NMZ A;  4HR7 B;  5M5W H;  3BDL A;  3MXN A;  5IOD A;  3P1H A;  5CGK A;  1HJP A;  5IYB H;  3HOU G;  1ENF A;  4L5R C;  2M00 A;  3QJY A;  3S15 H;  4A3M B;  1HR0 Q;  1MSG A;  1VQ7 A;  2BOS A;  1PTO H;  1DOL A;  5DLQ E;  3KFU A;  4XDX A;  1KTK A;  2NZH A;  2Z1C A;  1K3B C;  1KLG D;  4MN3 A;  4JBJ A;  2M9V A;  5EKI A;  1JMC A;  5K36 G;  3VYR A;  1VS0 A;  3BJU A;  2K14 A;  1N34 L;  4A4I A;  5M3M H;  2PNR C;  3I70 A;  3N6R A;  3MHB A;  1F9R A;  4CJ1 B;  4RGT A;  1HPC A;  2OEO A;  2F0I A;  1ONL A;  1UE1 A;  4NXN L;  1LTA D;  1PFM A;  3SXH A;  3JC6 6;  1PH4 A;  1O7L A;  3CCU A;  1EWC A;  1EWH A;  5IGE A;  4C2M H;  2HIV A;  1UE5 A;  2KCN A;  5ELF A;  4RH6 A;  1VMC A;  2QDB A;  4H7B A;  4HJ8 A;  2NZ1 D;  4HMJ A;  1CA5 A;  2CQO A;  1GOZ A;  5A35 A;  2EYJ A;  3G48 A;  1PVO A;  1RDP D;  3STB D;  3KBX A;  3STB C;  3CCS A;  1WVL A;  4OL7 A;  1DOK A;  4PQX A;  5M3F H;  3FKI G;  3U9O A;  4ZUI A;  4AYB G;  2RCN A;  1K8M A;  3CC4 A;  2LKV A;  2I5H A;  2UU9 L;  4RCN A;  2K50 A;  5I2X A;  3H0G G;  2UXD L;  2F0M A;  3J81 i;  4ZYS A;  5CYU A;  3S15 B;  3WWV A;  1RF2 D;  4DAM A;  1VQO A;  4X64 L;  2KCC A;  4C3J H;  3P7J A;  5M5W B;  5DAU A;  2EYL A;  4YCV A;  1FL0 A;  2CW0 D;  1QIL A;  2K03 A;  3C2P A;  2Q2I A;  2QW7 A;  3RN5 A;  4UHV A;  3VYT A;  2WP8 J;  2I07 B;  3T1Y Q;  2F52 A;  1TT2 A;  5GAH C;  1HNZ L;  2E2H H;  3F2U A;  2RVL A;  2IHE A;  1PH6 A;  1HFG A;  1PRT C;  3KDF B;  1SMY D;  3HOV G;  1LTI D;  2HT1 A;  5JAV A;  5KRU A;  1Q12 A;  1K8A C;  5HY6 A;  3GTO H;  2Z4I A;  4P73 A;  3NBI A;  4YWK A;  1VQH A;  3S14 B;  1F77 A;  2K52 A;  2D9U A;  1RCV D;  1FNV A;  4NXM Q;  2ALY B;  3D6W A;  2XGT A;  3CPW A;  3EFX D;  1CKN B;  4JV5 Q;  1ASZ A;  1G2T A;  2EIF A;  4A75 A;  2WAQ B;  2ZJQ A;  5CR3 A;  4RGN A;  2IX1 A;  1TWH H;  4B3T Q;  3CCQ A;  3UDF A;  3AQQ A;  4Z9C B;  2PW7 A;  3RZD H;  3LGJ A;  5CBE E;  1L1O B;  2YTV A;  3V05 A;  1JWM D;  2UXC L;  1STA A;  1D7Q A;  1TWA B;  1HQM C;  1CTM A;  1QUQ A;  4J15 A;  4JI7 Q;  5J22 A;  2E2D C;  1BKB A;  1B9M A;  3K81 C;  3T1Y L;  1E2W A;  1BCP D;  4Y7N H;  1TWH B;  1LT4 D;  3I73 A;  3TP5 A;  3HOV B;  3RZO B;  5LL6 X;  2QGQ A;  4ID6 A;  3W2D A;  4DR4 Q;  2VB3 X;  5LHY 1;  4FXD A;  1I4Q A;  5D14 A;  2CCZ A;  4JI6 Q;  2K5W A;  2NVX H;  2ZTD A;  2FXQ A;  2UUA Q;  4A93 B;  4HN7 A;  1CZG A;  1NAP A;  3PUV A;  1QOH A;  3FPP A;  2EE1 A;  2A73 B;  5LMN L;  1GUT A;  3E0E A;  2A68 D;  3CD6 A;  1XNR L;  1KXL A;  2RA4 A;  3AYH B;  4R4Q A;  1SYG A;  4YY3 L;  1FGU A;  2N78 A;  2UXD Q;  2A19 A;  1VQ4 A;  4JI2 L;  1HRJ A;  3F2D A;  4NPS A;  2F0Q A;  2N55 A;  3WOE A;  5C5M A;  3VYS A;  3MXP A;  1PZK D;  4DNT B;  3IKJ A;  3OOC A;  4DV1 Q;  1IXR A;  3A0J A;  1N36 Q;  1WCM B;  1AH9 A;  1KL9 A;  3BYY B;  1G6P A;  1JB3 A;  1G29 1;  4CBV A;  1BNZ A;  4DV6 Q;  2JA5 B;  1AW7 A;  1N34 Q;  1U4R A;  2ICE C;  4C3H G;  2A8V A;  4APV A;  4O42 A;  4L6T B;  1KNA A;  1A15 A;  1SE2 A;  3S1N H;  4WFN 3;  3SK4 A;  5FLX L;  4DV3 Q;  2KCT A;  3KBG A;  2FJ2 A;  4M8A A;  1HNX L;  4U67 3;  4K14 A;  4KKU A;  3HOZ B;  3NTI A;  5HGQ A;  2NVT H;  4QL5 A;  2NZO A;  4MTK A;  2K7V A;  3FPU B;  1I4R A;  1HCZ A;  1QJO A;  1GO3 E;  1AE2 A;  1LTT D;  3PSI A;  3DXJ C;  1G51 A;  1B4O A;  1ET6 A;  3MVV A;  3RZO H;  1MSH A;  2R93 H;  3TS0 A;  4B3S Q;  4XQQ A;  2EXD A;  2KHI A;  1JCK B;  1SYF A;  3BZK A;  3I3C A;  3L9A X;  3JAM E;  1MJC A;  1TWF H;  3K5L A;  3W1G A;  5FO7 B;  4YY3 Q;  4QGU A;  5C0X J;  3RNU A;  2SEB D;  1IZ6 A;  1SEB D;  2IL8 A;  2XWB B;  2BH8 A;  1FYC A;  3D4D A;  1VQL A;  3KUP A;  4LF9 Q;  3K5M A;  1AZP A;  5BR8 L;  3L2P A;  2R92 G;  4XTC S;  1N33 L;  2AQ3 B;  1YHQ A;  1PTO F;  1XTD A;  4C3H H;  1SE8 A;  3S2H B;  4G7O C;  4CJ2 C;  3NTH A;  1R4P B;  1N32 L;  1WTW A;  1FJG Q;  4OWW B;  1YZ6 A;  1CT1 D;  2K32 A;  3QOL A;  3CRK C;  4DV4 Q;  5I6W A;  1EQR A;  5G3L F;  3I56 A;  1UEB A;  1YJ9 A;  4RAU C;  2ZJR A;  5BR8 Q;  4X66 L;  1SBB B;  2K5V A;  3TS2 A;  1O7I A;  4CKE A;  1U5K A;  3R2T A;  3DEO A;  4A3C H;  1JE5 A;  1D1I A;  3DWP A;  1KC8 C;  3SVM A;  2G9H D;  3M7G A;  3HOW H;  1QE6 A;  1H95 A;  4ZKC B;  2IW3 A;  4KMU C;  1WI5 A;  4XT3 B;  2DN8 A;  1Q1B A;  3L7Z C;  2IJ0 A;  4AIM A;  4ME5 A;  3NQT A;  1JJ2 A;  3CU7 A;  1IBK L;  4OWX B;  3OTO Q;  1F9Q A;  1T5E A;  4O1N A;  3RLF A;  1HNX Q;  2ZM6 Q;  1PYB A;  3F8T A;  4LWC A;  4P2C B;  5GRO A;  4NXM L;  5IYD H;  4HJA A;  4A3E H;  1UNS A;  3I4O A;  2R92 H;  3I55 A;  3K5N A;  1TS3 A;  2PZW A;  5M5X B;  4L63 B;  3GTP B;  4HJ7 A;  2OT2 A;  3BYT B;  4DN4 M;  3K0Y A;  1BCP F;  4R4T A;  1Y1V B;  3D3R A;  1BF4 A;  4LF8 L;  2F0J A;  4K5V A;  5HUR A;  2R7Z H;  4JG2 A;  4YHH L;  4IFD G;  4B3R L;  1CFM A;  1DM0 B;  4O2D A;  4X65 L;  4JI2 Q;  3G71 A;  3RN2 A;  1YNN C;  1VQ9 A;  4YWL A;  1PYW D;  3I91 A;  4A3K B;  4BY1 B;  3VA5 A;  1JOR A;  1NTG A;  4KY5 A;  4PNY A;  5ELB A;  1S5D D;  3L3O C;  3DMU A;  1QG7 A;  5EGT A;  3H94 A;  3CQZ H;  3M4O B;  1EIH A;  4LAA A;  1BUV T;  3K5O A;  1V1P B;  4NXN Q;  1AEX A;  2Z0S A;  3BG3 A;  1WFQ A;  4PZ6 A;  3TEH B;  1P8L A;  1J6Q A;  2O5I C;  2LFN A;  4CDF C;  1CHQ D;  1XMQ Q;  3J80 L;  3QR8 A;  3A5U A;  5GAD C;  3AB9 A;  2C35 B;  1IYV A;  4UP9 A;  2B2Y A;  5IYB G;  3HOX H;  3AMU A;  1M4V A;  1WD1 A;  1TS4 A;  4Y7N B;  1LTL A;  2L0C A;  4RCO A;  3S2D H;  4KKS A;  2QDL A;  2FFK B;  4FF4 A;  3CPF A;  1D1K A;  1SMX A;  3DLL A;  1S40 A;  1AFP A;  4CDE C;  5D65 A;  4X66 Q;  1C7Y A;  4UPA A;  3HKS A;  4WJ4 A;  2XNA C;  4UY8 C;  4JI8 Q;  3M3Y B;  3GP7 A;  2A6H C;  2KQ3 A;  1KDA A;  2R93 B;  3G7L A;  3VYU A;  1N36 L;  4JYA Q;  4RWS C;  2OF1 A;  1B2T A;  1PYS B;  4KN4 C;  1I4X A;  2FMC A;  2K75 A;  1Y69 U;  4B3T L;  5CC4 A;  2CFM A;  3K6O A;  3TP6 A;  1KAB A;  2MHV A;  1SAP A;  5C44 H;  5ELE A;  3K59 A;  2F0N A;  1BOS A;  1Q8K A;  5JEA H;  5C4Z A;  1WTP A;  2L5T A;  2VNU D;  2PZT A;  3I2Z A;  1B70 B;  4KHP L;  3K57 A;  1QVG A;  3QG1 A;  1E2V A;  3IAY A;  4LFA L;  4IN3 A;  1PHJ A;  3ZJY C;  4YHH Q;  4H02 A;  2RDF A;  2JEB I;  1JT8 A;  4FF3 A;  3DM1 A;  2K6A A;  4DU9 A;  4BA2 I;  2F0P A;  4LF5 Q;  3KF6 B;  2A6E C;  4LJZ C;  4DK6 C;  1JOQ A;  1BXT A;  1F2L A;  4L5S A;  3EJI A;  1SNO A;  1HNZ Q;  4A3I G;  4FVM A;  2X6G A;  2F0G A;  1KNE A;  2BH2 A;  4QUC A;  4LFB L;  1L2F A;  1RKN A;  3PO2 G;  3PGZ A;  1PZJ D;  4B3M L;  5M3M G;  4DNR B;  1HNW L;  1ZYR D;  3VR4 A;  1U4L A;  4UAI A;  1CQF A;  4LUV A;  1DD2 A;  4U68 A;  4QIW B;  4G4K A;  1D8L A;  1EY5 A;  4IO9 A;  1FVI A;  3D8G A;  3TQY A;  1EU3 A;  4GNX C;  4A3L H;  2NTT A;  4DUZ Q;  4B9W A;  4QIW E;  2K01 A;  1Y1V H;  1Q90 A;  3ITP A;  4NW2 A;  1NMF A;  3NE5 B;  3GO5 A;  1HXY D;  2ZTE A;  4KV6 A;  2DUD A;  3A5Z B;  1KLU D;  1WCM G;  2NN6 G;  1E24 A;  4ZLT F;  1BBX C;  1KDB A;  4IUT A;  3S1Q B;  3A8I E;  3E3X A;  4WJW A;  4C2M B;  5K36 H;  5IY0 A;  3M4Y A;  4DF7 A;  3VDY A;  2XRS D;  3UDI A;  1NMG A;  1E1T A;  4F88 A;  4FDB A;  4KI0 A;  3ER0 A;  4DV2 L;  1XJV A;  4BXX G;  1U0L A;  3S16 B;  1S4Z A;  3PO2 B;  2NWG A;  2PI2 A;  2JQO A;  3ERQ A;  5IGC A;  5FLX E;  4HIM A;  1VCI A;  3TRE A;  3M3Y H;  3FKI H;  1Q1E A;  4JW0 A;  1JE4 A;  1GXD C;  2D0O A;  2HUG A;  2RF4 A;  2WV6 D;  4A3G G;  3SK6 A;  5FKA C;  3H3V H;  4IAL A;  4A3C G;  5FO8 B;  4A3F G;  3D4R A;  2EVB A;  1L0X B;  1IBL Q;  2Z6K A;  3SDZ A;  1NBW A;  4IUU A;  1SNM A;  2KJX A;  3KJP A;  1Q86 C;  1PRT B;  2B2T A;  4IUN A;  2Y0S G;  3I4N B;  2G9D A;  4JI3 L;  3BS1 A;  2B2W C;  1Q82 C;  3S1M B;  1HNW Q;  3K7A B;  3IL8 A;  2F0V A;  3BDC A;  1A3U A;  1EYC A;  2EXZ A;  4HID A;  1YHA A;  5JEA G;  2Q8I B;  1WTH A;  2L9H A;  1GD7 A;  2PCF B;  3T16 A;  3MC0 B;  3J7A 5;  4H44 C;  4BBS B;  2JA8 B;  4DR2 Q;  3P75 A;  1ILP A;  4FP5 D;  1GUS A;  2DJF C;  3R93 A;  4EGV A;  4FYD A;  1TS5 A;  3TBI B;  1KQS A;  2NYZ D;  1DCZ A;  2K5H A;  5KIX A;  3SK8 A;  4HCS A;  4DR7 Q;  4WRD A;  2WIN B;  1PXU A;  3GDE A;  4A3J B;  1HQR D;  2B29 A;  3TP7 A;  5FLM H;  2Y0S E;  2JEA I;  4JCV E;  3NBH A;  3VA7 A;  1TR5 A;  4JK1 C;  1STG A;  2VXW A;  4A3F B;  5EPL A;  3IFD A;  2B8F A;  5C5L A;  1ZKO A;  3K7A H;  4WJ3 M;  4X3S A;  4IFD J;  2HCC A;  3CAM A;  2E76 C;  4DR5 Q;  4JI0 Q;  2A1A A;  3I4L A;  2RHS B;  3HOX G;  2JA6 H;  4BWG B;  1PTO D;  2F0U A;  4BA1 I;  2VQF Q;  2SNS A;  4DR1 Q;  3MAQ A;  1I94 Q;  1IW7 D;  1LYL A;  1QVC A;  2YV5 A;  3PF4 A;  1QNK A;  2B2U A;  1Q8I A;  2CWP A;  4JPB W;  3HOW B;  4LFA Q;  3HG9 A;  3KYH C;  2VQE Q;  1H9S B;  4DV7 L;  1BR9 A;  5M3F B;  3J7A V;  4DR5 L;  4JI0 L;  2P5Z X;  3BVG A;  4OEL B;  4TRD A;  2VQF L;  2Q8R E;  1RD9 D;  4GKJ L;  4IFD H;  4K8J A;  2R7Z G;  4A3J G;  1EIG A;  3GTJ B;  4ZRZ A;  4DFA A;  4HTH A;  1VF7 A;  2AWO A;  2LY7 A;  2EYF A;  3SK5 A;  3Q8D A;  3N52 A;  5EKK A;  3G6E A;  3UDG A;  1A3T A;  1VQP A;  2MGS A;  4LF6 L;  1EQT A;  3HZX A;  1W6K A;  1CSP A;  1HZB A;  3CC2 A;  1WOC A;  3ND9 A;  5LMN W;  4KHV A;  5IYC G;  2H4O A;  1RTN A;  5LMU L;  1SFO B;  1O7Y A;  2CH4 A;  2DNE A;  3S1M H;  3HOW G;  5KEE A;  3K80 C;  2IY5 B;  1V8Q A;  5T1I A;  4ABN A;  3F1Z A;  2R7D A;  4ME3 A;  2R93 G;  5CV4 A;  1K3R A;  1PH8 A;  1B8A A;  1VQC A;  4O0A A;  1N8R C;  2ZXO A;  2OQ0 A;  1X6O A;  4AYB B;  1A62 A;  1CHP D;  2RSO A;  1JR0 D;  3Q22 A;  3D0F A;  5IT9 E;  3NEN A;  1B3A A;  4DXG A;  3NP8 A;  4LMQ D;  3OWE B;  2E2H B;  5JVG 3;  5JJZ A;  1SSO A;  2WB1 G;  4IPH A;  5M5Y H;  5C0X H;  1IKM A;  4JOI C;  1LTB D;  1ENA A;  3GTP H;  1SMY C;  3NWS A;  3IRB A;  1TWA H;  3J81 c;  2E2I B;  2YTY A;  2B2T C;  3CMA A;  1UE6 A;  1HUN A;  2C5C A;  1BVS A;  3GTM H;  2PPB C;  5E4X A;  1S3O A;  1PH2 A;  1FD7 D;  1O7Z A;  1Y1W G;  3QWN A;  1TWG B;  1STE A;  3GQB A;  4DGZ A;  5KNC A;  1K0R A;  4HED A;  5DEH A;  3E5S A;  3PUX A;  3J80 c;  4X64 Q;  4H13 C;  5IGF A;  3U4Z A;  2XVS A;  2K5D A;  3A7A B;  3OW2 A;  1J9O A;  4IPG A;  4DUY L;  1O78 A;  4ODG A;  5M3M B;  2FHT A;  1I6H B;  5IOC A;  2R7F A;  5DM7 3;  5A2Q E;  4JI4 L;  3U4V A;  3PIO 3;  4L5Q A;  3LWU A;  5IWA L;  2TMP A;  4LF4 L;  2EY1 A;  1A2U A;  5IT9 c;  1PDQ A;  1S5B D;  2OCE A;  4C3I G;  1Y8O B;  2KEN A;  3RZD B;  3M4Q A;  4JI1 L;  1I94 L;  2XIW A;  3VR2 A;  2F0D A;  1HTP A;  1Z6H A;  3MFG A;  4QMG A;  1EIY B;  3WOF A;  5DM6 3;  2F1M A;  2KHS A;  2VS1 A;  1XMO Q;  2UXB L;  3KJO A;  1VQK A;  4LF4 Q;  1JJG A;  3CCM A;  1DON A;  3OIP A;  4I65 A;  3KDF A;  2EY5 A;  2YU9 H;  4XXE A;  1LLR D;  4C3J B;  2QEJ C;  2E8G A;  3M9B A;  4A76 A;  4IUV A;  4PMW A;  1IBK Q;  3KLR A;  1VMP A;  3MWY W;  4P74 A;  4AQY L;  2Z4H A;  4PG3 A;  5FOB B;  5JJI A;  1H9S A;  2L1B A;  3PUZ A;  2KED A;  1HH2 P;  2B2U C;  2O2L D;  2LSS A;  4IOA A;  4A93 G;  2JA7 B;  5KNB A;  3PCO B;  4LF7 Q;  4DR6 L;  4KHP Q;  2YU9 B;  4QJF A;  3LNN A;  1A8V A;  1LO5 D;  3J7Z C;  1E3P A;  5I9P A;  2UUA L;  5ELO A;  3V2T A;  3GTK B;  3I4N G;  3GTG B;  4DPG A;  4TVA B;  3T56 B;  4DAY A;  4HJ9 A;  3NBH B;  4GKK Q;  4BY7 H;  2KEE A;  1OXV A;  4LF9 L;  3RLN A;  1DZ1 A;  3OYY A;  4MHE A;  1K73 C;  1X9N A;  1K9M C;  1PLF A;  4KY6 A;  2J4X A;  1EIF A;  4C3J G;  1HTL D;  1VQN A;  2LMC B;  4DV0 L;  2B2V C;  1Q7Y C;  5M5Y B;  2CKZ B;  2VY3 A;  4ZKB B;  2JA6 B;  4HIO A;  3GTK H;  1L1O A;  3NPP A;  3R8B A;  5EBD A;  2Q2U A;  5IP7 H;  1B7Y B;  5FLM G;  2X69 A;  1IBM L;  1EZ6 A;  4R4C A;  3MTS A;  2Q2T A;  1I3Q B;  3MEF A;  1PH7 A;  2R61 A;  4TQU S;  5JPN C;  4V19 0;  1KRS A;  2EY6 A;  1GHK A;  2A69 D;  2OWO A;  2JP1 A;  4DV3 L;  2AQ2 B;  2WB1 E;  1H9R A;  4POF A;  4FF1 A;  2VQE L;  3H09 A;  1UUP A;  3C46 A;  5F2D A;  4YCW A;  2X6L A;  4LF8 Q;  3DWA A;  2ICI A;  3C3L A;  3IFT A;  1ESF A;  4K0K Q;  1ESR A;  1W2B A;  2I5L X;  5ISR A;  2XTI A;  2E2J B;  3OWF A;  1TY0 A;  2WAC A;  2MO1 A;  1GUO A;  1BCP C;  1PTO B;  3SEB A;  4OIJ A;  5M3F G;  1PH1 A;  2J0T D;  2BE5 D;  1B50 A;  2QKI C;  4B9X A;  1G91 A;  3E0J A;  3I90 A;  4CHT B;  2RQX A;  1LT5 D;  2NVX B;  1STB A;  4EQO A;  4PMC A;  2MP1 A;  2BA0 A;  5IP7 G;  4LFB Q;  3EIV A;  1CUK A;  1JOO A;  2DY8 A;  4P71 A;  2F0E A;  1Q81 C;  4BXX H;  1C9O A;  3PO3 H;  4OO1 H;  1C48 A;  1E2Z A;  4KJN A;  4MTN A;  2F0S A;  3PIP 3;  4IFD I;  3LX0 A;  1D5Z C;  4MNO A;  3TRZ A;  3EBE A;  5E7N A;  4KY7 A;  1JIC A;  4G7H C;  2O5J C;  2PW5 A;  2VL6 A;  5FK9 C;  4GLA C;  4RGO S;  1WTQ A;  4HCE A;  5JJL A;  3CCJ A;  3SHL A;  4F87 A;  1MHW C;  3KLS X;  4HJ5 A;  5EPJ A;  1WTV A;  3SGI A;  1K8G A;  4JBK A;  2ATW A;  1Q46 A;  3S2D B;  2EZV A;  1TII D;  1PFN A;  1FJG L;  4GKJ Q;  5CV9 A;  3BZC A;  1BDO A;  1H9K A;  1WJJ A;  5CV6 A;  1Y8P B;  1LTR D;  3GTJ H;  4JI1 Q;  3DEP A;  1I3Q H;  4X3K A;  3NTK A;  2XRQ D;  2E2I H;  1SRO A;  2BCO A;  3RD4 A;  1NCV A;  2BA1 A;  3VR6 A;  2F4V L;  4A3B B;  1R4Q B;  2L4N A;  1BCP B;  2GVB A;  3HOU H;  1PFS A;  4QF4 A;  4B3S L;  4A3M G;  1ZXT A;  1QNU A;  3CQZ B;  3M4O H;  3S14 H;  5IGB A;  3PIO A;  4JYA L;  1EEI D;  2K04 A;  4BS9 A;  2ZXP A;  4J6H A;  1VQF A;  1VQJ A;  4BBR H;  2UUC L;  4PZ7 A;  1HZA A;  3RR5 A;  1UWV A;  3PQI A;  4B3R Q;  1VQM A;  4UP7 A;  4KD4 A;  5CV8 A;  1F2Z A;  2KUM A;  1OXX K;  1QZG A;  1BO0 A;  3A8J E;  4DNI A;  5T1G A;  1SRU A;  2A6H D;  2IPK D;  2JA8 H;  5IT9 L;  2TSS A;  4A3I H;  4GN3 B;  3TZU A;  1EQV A;  1DXM A;  1KHI A;  2BE5 C;  4X6A H;  4RMF A;  2WKC A;  2Q8T A;  4OX9 L;  2UXB Q;  3S17 B;  2A5H A;  4ZCK A; 
#chains in the Genus database with same CATH homology
 3HP3 A;  2AUJ D;  4F7X A;  1LTG D;  5CV5 A;  2B2W A;  1CI3 M;  4RFB A;  1ROD A;  5K5P A;  5EBC A;  3GTO B;  2RSN A;  1LT3 D;  1SNC A;  1XXG A;  5C4X B;  4RHS A;  1C4Q A;  1F9S A;  2A6E D;  5TSS A;  1EU4 A;  1ENC A;  3SR1 A;  2NVT B;  2B2V A;  2NVQ B;  3G6J B;  4UDU C;  1AN8 A;  4PV1 C;  4FXK C;  4KN7 C;  2RKS A;  1I6V C;  5KYL A;  3TZD A;  4CJ0 B;  1SJE D;  3MFY A;  5JEA J;  1V1P A;  2K05 A;  3X3N A;  1FGB D;  1FNU A;  4OO1 G;  1UEA B;  3TDQ A;  1XX8 A;  2EDG A;  2CQA A;  4FF2 A;  1FNW A;  1SE3 A;  3EVQ A;  1IYU A;  3E6Z X;  1KAA A;  3J7Y W;  2DNC A;  5ELD A;  2CW0 C;  4OHJ A;  4OIK A;  1SYB A;  2C9O A;  1QB5 D;  5FO9 B;  2L11 A;  3GTM B;  1SDF A;  1PRT D;  2EJM A;  1CZW A;  2H1E A;  5EQ0 A;  4KKT A;  1WD0 A;  3FMC A;  2QIL A;  1STY A;  1EZ8 A;  1JWS D;  1TVX A;  3HRZ C;  4X3U A;  1HHV A;  4GZY C;  1EY0 A;  3PV0 A;  2HCI A;  4K2K A;  3KLS A;  3P20 A;  1ZYR C;  3QIA A;  1X3P A;  2SOB A;  3SE0 A;  2I46 A;  5I4D A;  3QOJ A;  4QB4 A;  4RA8 A;  1EY4 A;  1F2M A;  3CRL C;  4RGM A;  2FMM A;  2BDN A;  5KND A;  3Q6S A;  4K6D A;  5M9O A;  1LV9 A;  1V1O A;  3NXW A;  5BN4 A;  2E74 C;  1AP0 A;  1B9N A;  2GA4 B;  1JWU D;  4C3H B;  1HUM A;  2CHB D;  1LT6 D;  2IX0 A;  4KTA A;  3D6C A;  5KYI A;  1B1Z A;  4ULL A;  2RDH A;  3A8K E;  3HEJ A;  3DUZ A;  4ZK9 B;  1TY2 A;  2AWN A;  5I2Y A;  4NP5 A;  2K28 A;  4OO1 I;  1AZQ A;  1U4M A;  2HDM A;  2M2L A;  2V4D A;  4DK1 A;  5C4J B;  1EFI D;  3Q23 A;  2EJF C;  4NKL A;  4BY7 B;  1EY9 A;  1OXU A;  3HOX B;  1OXT A;  1VDZ A;  1S5E D;  1KDC A;  2R92 B;  2NB0 A;  3KF8 A;  5JPM C;  1SNQ A;  3UI2 A;  2E75 C;  3NSW A;  4FO2 A;  1SYC A;  5EKL A;  1SJH D;  1VF5 C;  1D5M C;  2N88 A;  1SE4 A;  3A56 A;  3OMG A;  1OXS C;  1GUW A;  3BVM A;  2R7Z B;  3FKI B;  2EYO A;  1NR4 A;  3RMH A;  1JOK A;  3VR5 A;  3FEW X;  1Q3L A;  1E0B A;  2F0K A;  3H0G B;  1J8I A;  1SYD A;  4ZQ3 A;  1DOM A;  3U9S A;  4DK0 A;  3OW7 A;  1PZI D;  3J81 E;  5KGU A;  3D4W A;  4IQZ A;  3QB3 A;  4V0B A;  3OMC A;  4G57 A;  3T51 B;  5LL6 S;  4I7Z C;  2YYZ A;  1SND A;  3BDO A;  1LAC A;  1HA6 A;  2LS0 1;  4IUR A;  1QCB D;  5JVH 3;  1MD2 D;  3GV3 A;  1PMR A;  5C44 B;  3CHB D;  1ET9 A;  1X3Q A;  2AQ1 B;  4QCL A;  1EY8 A;  4XIG S;  1A3V A;  3VR3 A;  1WTX A;  2K33 A;  1TS2 A;  5CV7 A;  1RJT A;  3DHQ A;  2F0W A;  4XYO A;  2VUM B;  3W3A A;  1ILQ A;  2WB1 B;  1II3 A;  5C3X A;  3T13 A;  3J81 L;  2PO4 A;  1TWC B;  2ID0 A;  5J1Z A;  3KK7 A;  1GJX A;  1MBY A;  2QF7 A;  3NK9 A;  5J39 A;  3C1F A;  2R3Z A;  1IKL A;  5G3L D;  5AFW A;  1WTO A;  1A2T A;  1I4P A;  1H9J A;  3MXU A;  4LK1 C;  3MEH A;  3EQL C;  1H9M A;  2D62 A;  1Z47 A;  4CGY B;  1XTC D;  3M85 A;  4S3S A;  2EOT A;  1EOT A;  1K83 B;  1X32 A;  4DAP A;  3C1E A;  4J8Q A;  2NVY B;  4A3G B;  2F0T A;  1EL0 A;  4H0L C;  4RHR A;  5E3F A;  2ZXR A;  2XSC A;  3HGB A;  3ONA B;  2D5D A;  1C8C A;  4FXG C;  3HOY B;  4A3E B;  3FVQ A;  3DWQ A;  2B39 A;  1EY6 A;  4Q0F A;  1U4P A;  1OO9 B;  2NBF A;  4TSS A;  3S9W A;  4A3I B;  3BZD B;  2A68 C;  3GTQ B;  3GTL B;  4XQJ A;  1V43 A;  3OPO A;  2PMZ B;  2F0O A;  3H6M A;  1GUG A;  5C6A A;  2BDO A;  2VB2 X;  3PUY A;  1IHZ A;  2EYH A;  3PUW A;  1EYA A;  2PYK A;  4N9T A;  1EY7 A;  1ZEQ X;  4MIU A;  1SXT A;  3JAM L;  5NUC A;  1TKW B;  4PMB A;  1DJR D;  3TSS A;  1GUN A;  1EEF D;  1I4G A;  1F9P A;  1RTO A;  1TQO A;  4NDX A;  3TN2 A;  3V96 A;  4KHZ A;  3D31 A;  5DNF A;  3A54 A;  1ICW A;  2JSO A;  3NHH A;  5JOB A;  3R2I A;  4DAV A;  2L12 A;  5BN5 A;  3O13 A;  4KK7 A;  1YNJ C;  1L0Y B;  4R8I A;  3PMF A;  2F03 A;  5C0X G;  2HQE A;  1Z7T A;  1I50 B;  1MGS A;  1HA5 A;  1JQY D;  1EYD A;  2MUY A;  1U9R A;  1A6X A;  4F8M A;  1W6J A;  3T4A C;  3H3V C;  2A69 C;  4DXF A;  2NTS A;  4ZAI A;  4DA2 A;  5C4H A;  2Y0S B;  2HDL A;  1XYI A;  2F4I A;  4QUF A;  2EJG C;  3R3O A;  1G6Z A;  3J7A F;  3HS0 C;  2IWH A;  1CA6 A;  2F0F A;  1Y8N B;  4IZ8 A;  2PZU A;  1R9T B;  4EQP A;  2KVM A;  2Z8L A;  3MZ5 A;  3Q24 A;  2QCP X;  4B08 A;  4CKB A;  4RKL A;  5E1F A;  3S1R B;  4IUP A;  2IX3 A;  1QWY A;  4R8N A;  3HOU B;  2MPM A;  1CM9 A;  1ML0 D;  1K8O A;  2KOL A;  1XWE A;  4ZUJ A;  3URY A;  3J80 E;  2XWJ B;  2IT1 A;  2CVR A;  5D3D A;  3QO2 A;  1YNJ D;  1NR2 A;  2F0L A;  2O4X A;  1PTO C;  3GV6 A;  1DYQ A;  2DY7 A;  1D2B A;  3NUC A;  4G7Z C;  1D5X C;  1TU2 B;  3AU7 A;  3MA2 B;  1MI2 A;  1SNP A;  2JYO A;  3FRP B;  4EQN A;  1STN A;  3NWT A;  5IIF A;  1NSN S;  4R9W A;  3CKI B;  2WKD A;  4L8J A;  1CK1 A;  4RKB A;  4BBR B;  2F0H A;  3MXG A;  4HAE A;  2EYP A;  3ERO A;  4JBW A;  4C1N I;  4WOR A;  1GHJ A;  2B8G A;  5E4W C;  2A74 C;  4K6L A;  1HFN A;  2OXP A;  1WTR A;  2D2C C;  3H91 A;  4FNF A;  3WDN A;  5IGG A;  1PFB A;  4Q5V A;  3I8Z A;  4C1N K;  3GD7 A;  4IUQ A;  1D6E C;  3I4M B;  2ENB A;  3M7N A;  3FDT A;  3BVZ A;  4K5X A;  2K5Q A;  3X3M A;  1I4H A;  4M1U B;  2B2Y C;  2SDF A;  3PO3 B;  3K58 A;  2J7Z A;  2WII B;  2JE6 I;  2B63 B;  2NUC A;  1LAB A;  1T5X D;  1JC7 A;  3TME A;  3A7L A;  1F2Y A;  3ND8 A;  5C3E B;  5C3W A;  1PRT F;  2EYM A;  5BN3 A;  2KEC A;  2ZT9 C;  3EA6 A;  3HKZ B;  5I9O A;  2NN6 H;  4X3T A;  2R6G A;  1NUC A;  4YIJ A;  4XYQ A;  2F3V A;  5D3I B;  3T53 B;  2NN6 I;  3LWE A;  1UAP A;  4ILW A;  1BQQ T;  4CKC A;  5A2Q L;  4TKO B;  5ELC A;  4C3I B;  3I72 A;  1O80 A;  2MJ8 A;  1S5C D;  3TP8 A;  4K8I A;  5HGT A;  1G8Z D;  2L55 A;  3A55 A;  4J1M A;  4XT1 B;  2AUK A;  3Q0A A;  2KA7 A;  1RHP A;  4EVO A;  3OSO A;  5CBA E;  5COY A;  5EPK A;  1TWF B;  4HMI A;  5COR A;  4E6I A;  1M8A A;  3OHX C;  2SNM A;  5EJW A;  1G2S A;  4C56 C;  1LTS D;  1CQV A;  4N9P A;  2JXM B;  2RBM A;  4KJO A;  4K2L A;  2EY2 A;  1IL8 A;  4HSV A;  1STH A;  5I6Y A;  5IGD A;  4HSP A;  1B44 D;  1FR3 A;  2K1B A;  1SYE A;  3S1N B;  4A3D B;  1B53 A;  2F3W A;  3NQI A;  1YNN D;  2EPB A;  3OIQ A;  2RDG A;  5C0X I;  3RUZ A;  2FIN B;  4KD3 A;  2PQE A;  4OGQ C;  4XQN A;  2XN9 C;  1S5F D;  1IW7 C;  3ZYY X;  5CMD A;  4K5W A;  4NMZ A;  4HR7 B;  3BDL A;  3MXN A;  5IOD A;  3P1H A;  5CGK A;  1ENF A;  2M00 A;  3QJY A;  4A3M B;  1MSG A;  2BOS A;  1PTO H;  1DOL A;  4XDX A;  1KTK A;  2Z1C A;  1KLG D;  4MN3 A;  2M9V A;  5EKI A;  5K36 G;  3VYR A;  2PNR C;  3I70 A;  3N6R A;  3MHB A;  1F9R A;  4CJ1 B;  4RGT A;  1HPC A;  2OEO A;  2F0I A;  1ONL A;  1LTA D;  1PFM A;  3SXH A;  1O7L A;  1EWC A;  1EWH A;  5IGE A;  2KCN A;  5ELF A;  4RH6 A;  1VMC A;  2QDB A;  4H7B A;  2NZ1 D;  4HMJ A;  1CA5 A;  1GOZ A;  5A35 A;  2EYJ A;  1RDP D;  3KBX A;  1WVL A;  4OL7 A;  1DOK A;  4PQX A;  3U9O A;  4ZUI A;  1K8M A;  2LKV A;  4RCN A;  5I2X A;  2F0M A;  4ZYS A;  5CYU A;  3S15 B;  1RF2 D;  2KCC A;  3P7J A;  5M5W B;  5DAU A;  2EYL A;  2CW0 D;  1QIL A;  2K03 A;  3C2P A;  3VYT A;  2WP8 J;  2I07 B;  1TT2 A;  3F2U A;  2RVL A;  1HFG A;  1PRT C;  1SMY D;  1LTI D;  5JAV A;  5KRU A;  1Q12 A;  2Z4I A;  3NBI A;  3S14 B;  1F77 A;  2D9U A;  1RCV D;  1FNV A;  3D6W A;  3EFX D;  1G2T A;  2WAQ B;  5CR3 A;  4RGN A;  2IX1 A;  4Z9C B;  2PW7 A;  5CBE E;  3V05 A;  1JWM D;  1STA A;  1TWA B;  1HQM C;  1CTM A;  5J22 A;  2E2D C;  1B9M A;  1E2W A;  1BCP D;  1TWH B;  1LT4 D;  3I73 A;  3TP5 A;  3HOV B;  3RZO B;  5LL6 X;  4ID6 A;  3W2D A;  2VB3 X;  5LHY 1;  4FXD A;  1I4Q A;  5D14 A;  2K5W A;  4A93 B;  4HN7 A;  1CZG A;  1NAP A;  3PUV A;  1QOH A;  3FPP A;  2EE1 A;  2A73 B;  1GUT A;  2A68 D;  2RA4 A;  1SYG A;  1HRJ A;  2F0Q A;  2N55 A;  3WOE A;  5C5M A;  3VYS A;  3MXP A;  1PZK D;  4DNT B;  3IKJ A;  3OOC A;  1WCM B;  3BYY B;  1JB3 A;  1G29 1;  4CBV A;  1BNZ A;  2JA5 B;  1AW7 A;  1U4R A;  2ICE C;  4C3H G;  4O42 A;  4L6T B;  1KNA A;  1A15 A;  1SE2 A;  4WFN 3;  3SK4 A;  5FLX L;  3KBG A;  2FJ2 A;  4M8A A;  4U67 3;  4K14 A;  4KKU A;  3HOZ B;  3NTI A;  2K7V A;  3FPU B;  1I4R A;  1HCZ A;  1QJO A;  1LTT D;  3DXJ C;  1B4O A;  1ET6 A;  3MVV A;  1MSH A;  4XQQ A;  3L9A X;  1JCK B;  1SYF A;  3I3C A;  3JAM E;  3K5L A;  5FO7 B;  5C0X J;  2SEB D;  1SEB D;  2XWB B;  2IL8 A;  1FYC A;  3D4D A;  3KUP A;  3K5M A;  1AZP A;  4XTC S;  2AQ3 B;  1PTO F;  3S2H B;  4G7O C;  4CJ2 C;  3NTH A;  1R4P B;  1WTW A;  3QOL A;  1CT1 D;  2K32 A;  3CRK C;  5I6W A;  5G3L F;  4RAU C;  1SBB B;  4CKE A;  3R2T A;  3DEO A;  1D1I A;  3DWP A;  3SVM A;  2G9H D;  3M7G A;  1QE6 A;  4ZKC B;  2IW3 A;  4KMU C;  4XT3 B;  2DN8 A;  1Q1B A;  3L7Z C;  2IJ0 A;  3NQT A;  4ME5 A;  3CU7 A;  1F9Q A;  1T5E A;  4O1N A;  3RLF A;  4P2C B;  1UNS A;  3K5N A;  1TS3 A;  2PZW A;  5M5X B;  4L63 B;  3GTP B;  2OT2 A;  3BYT B;  4DN4 M;  3K0Y A;  1BCP F;  1Y1V B;  3D3R A;  1BF4 A;  2F0J A;  4K5V A;  5HUR A;  4IFD G;  1CFM A;  1DM0 B;  1YNN C;  4A3K B;  1PYW D;  3I91 A;  4BY1 B;  3VA5 A;  1JOR A;  4KY5 A;  4PNY A;  5ELB A;  1S5D D;  3L3O C;  3DMU A;  1QG7 A;  5EGT A;  3H94 A;  3M4O B;  1EIH A;  4LAA A;  1BUV T;  3K5O A;  1V1P B;  1AEX A;  3BG3 A;  2O5I C;  2LFN A;  1CHQ D;  3J80 L;  3AB9 A;  1IYV A;  2B2Y A;  3AMU A;  1M4V A;  1WD1 A;  1TS4 A;  4Y7N B;  2L0C A;  4RCO A;  4KKS A;  2FFK B;  4FF4 A;  1D1K A;  2A5H A;  1AFP A;  5D65 A;  2XNA C;  3M3Y B;  3GP7 A;  2A6H C;  2KQ3 A;  1KDA A;  2R93 B;  3G7L A;  3VYU A;  4RWS C;  2OF1 A;  1B2T A;  4KN4 C;  1I4X A;  2FMC A;  1Y69 U;  5CC4 A;  3K6O A;  3TP6 A;  1KAB A;  2MHV A;  1SAP A;  5ELE A;  3K59 A;  2F0N A;  1BOS A;  5JEA H;  5C4Z A;  1WTP A;  2L5T A;  2VNU D;  2PZT A;  3K57 A;  3QG1 A;  1E2V A;  3IAY A;  4IN3 A;  2RDF A;  2JEB I;  4FF3 A;  4DU9 A;  2K6A A;  3DM1 A;  4BA2 I;  2F0P A;  2A6E C;  4LJZ C;  1JOQ A;  1BXT A;  1F2L A;  3EJI A;  1SNO A;  4FVM A;  2X6G A;  2F0G A;  1KNE A;  4QUC A;  1RKN A;  1PZJ D;  4DNR B;  1ZYR D;  3VR4 A;  1U4L A;  4UAI A;  1CQF A;  1DD2 A;  4U68 A;  4QIW B;  4G4K A;  1EY5 A;  3D8G A;  1EU3 A;  2NTT A;  4B9W A;  2K01 A;  3ITP A;  1Q90 A;  4NW2 A;  3NE5 B;  3GO5 A;  1HXY D;  4KV6 A;  1KLU D;  2NN6 G;  4ZLT F;  1BBX C;  1KDB A;  4IUT A;  3S1Q B;  3A8I E;  4WJW A;  4C2M B;  5K36 H;  3M4Y A;  4DF7 A;  2XRS D;  4F88 A;  4KI0 A;  3S16 B;  1S4Z A;  3PO2 B;  2NWG A;  3ERQ A;  5IGC A;  5FLX E;  1VCI A;  1Q1E A;  1JE4 A;  1GXD C;  2HUG A;  2WV6 D;  3SK6 A;  5FKA C;  4IAL A;  5FO8 B;  3D4R A;  2EVB A;  1L0X B;  3SDZ A;  4IUU A;  1SNM A;  2KJX A;  1PRT B;  2B2T A;  4IUN A;  3I4N B;  2G9D A;  3BS1 A;  2B2W C;  3S1M B;  3K7A B;  3IL8 A;  2F0V A;  3BDC A;  1A3U A;  1EYC A;  2EXZ A;  5JEA G;  2Q8I B;  2L9H A;  2PCF B;  3T16 A;  3MC0 B;  4H44 C;  4BBS B;  2JA8 B;  3P75 A;  1ILP A;  4FP5 D;  1GUS A;  4FYD A;  3R93 A;  4EGV A;  1TS5 A;  3TBI B;  2NYZ D;  1DCZ A;  5KIX A;  3SK8 A;  4HCS A;  4WRD A;  2WIN B;  1PXU A;  4A3J B;  1HQR D;  3TP7 A;  2JEA I;  3NBH A;  3VA7 A;  1TR5 A;  4JK1 C;  1STG A;  2VXW A;  4A3F B;  5EPL A;  3IFD A;  2B8F A;  5C5L A;  1ZKO A;  4X3S A;  4IFD J;  2HCC A;  2E76 C;  3I4L A;  4BWG B;  1PTO D;  2F0U A;  4BA1 I;  2SNS A;  3MAQ A;  1IW7 D;  1QNK A;  2B2U A;  1Q8I A;  3HOW B;  3HG9 A;  1H9S B;  1BR9 A;  5M3F B;  3J7A V;  3BVG A;  4TRD A;  2Q8R E;  1RD9 D;  4IFD H;  4K8J A;  1EIG A;  3GTJ B;  4ZRZ A;  4DFA A;  4HTH A;  1VF7 A;  2AWO A;  2LY7 A;  2EYF A;  3SK5 A;  3N52 A;  5EKK A;  1A3T A;  2MGS A;  1EQT A;  3HZX A;  1W6K A;  3ND9 A;  4KHV A;  2H4O A;  1RTN A;  1SFO B;  1O7Y A;  2DNE A;  5KEE A;  1V8Q A;  5T1I A;  4ABN A;  5CV4 A;  2ZXO A;  4AYB B;  1CHP D;  2RSO A;  1JR0 D;  3Q22 A;  5IT9 E;  1B3A A;  4DXG A;  3NP8 A;  4LMQ D;  3OWE B;  2E2H B;  5JVG 3;  5JJZ A;  1SSO A;  5C0X H;  1IKM A;  1LTB D;  1ENA A;  1SMY C;  3NWS A;  2E2I B;  2B2T C;  1HUN A;  2C5C A;  2PPB C;  5E4X A;  1FD7 D;  1O7Z A;  3QWN A;  1TWG B;  1STE A;  3GQB A;  4DGZ A;  5KNC A;  4HED A;  5DEH A;  3E5S A;  3PUX A;  4H13 C;  5IGF A;  2XVS A;  2K5D A;  3A7A B;  1J9O A;  1O78 A;  4ODG A;  5M3M B;  2FHT A;  1I6H B;  5IOC A;  5DM7 3;  5A2Q E;  3PIO 3;  3LWU A;  2TMP A;  2EY1 A;  1A2U A;  1PDQ A;  1S5B D;  4C3I G;  1Y8O B;  3RZD B;  2XIW A;  3VR2 A;  2F0D A;  1HTP A;  1Z6H A;  3MFG A;  4QMG A;  3WOF A;  5DM6 3;  2F1M A;  2KHS A;  1DON A;  3OIP A;  4I65 A;  2EY5 A;  4XXE A;  1LLR D;  4C3J B;  2QEJ C;  4IUV A;  4PMW A;  3KLR A;  1VMP A;  3MWY W;  2Z4H A;  5FOB B;  1H9S A;  2L1B A;  3PUZ A;  2KED A;  2B2U C;  2O2L D;  2JA7 B;  5KNB A;  2YU9 B;  3LNN A;  1LO5 D;  5I9P A;  3V2T A;  3GTK B;  3GTG B;  3T56 B;  4DAY A;  2KEE A;  1OXV A;  1DZ1 A;  4MHE A;  1PLF A;  4KY6 A;  2J4X A;  4C3J G;  1HTL D;  2LMC B;  2B2V C;  5M5Y B;  4ZKB B;  2JA6 B;  3NPP A;  3R8B A;  5EBD A;  2X69 A;  1EZ6 A;  3MTS A;  1I3Q B;  2R61 A;  4TQU S;  5JPN C;  4V19 0;  2EY6 A;  1GHK A;  2A69 D;  2JP1 A;  2AQ2 B;  1H9R A;  4FF1 A;  3H09 A;  1UUP A;  3C46 A;  5F2D A;  2X6L A;  3DWA A;  2ICI A;  3C3L A;  3IFT A;  1ESF A;  1ESR A;  5ISR A;  2E2J B;  3OWF A;  1TY0 A;  2WAC A;  1GUO A;  1BCP C;  1PTO B;  3SEB A;  4OIJ A;  2J0T D;  2BE5 D;  1B50 A;  2QKI C;  4B9X A;  1G91 A;  3E0J A;  3I90 A;  4CHT B;  2RQX A;  1LT5 D;  2NVX B;  1STB A;  4EQO A;  4PMC A;  2MP1 A;  2BA0 A;  1JOO A;  2DY8 A;  2F0E A;  4OO1 H;  1C48 A;  1E2Z A;  4KJN A;  2F0S A;  3PIP 3;  4IFD I;  3LX0 A;  1D5Z C;  4KY7 A;  1JIC A;  4G7H C;  2O5J C;  2PW5 A;  5FK9 C;  4RGO S;  1WTQ A;  4HCE A;  3SHL A;  4F87 A;  3KLS X;  1WTV A;  5EPJ A;  3S2D B;  2EZV A;  1TII D;  1PFN A;  5CV9 A;  1BDO A;  1H9K A;  5CV6 A;  1Y8P B;  1LTR D;  3DEP A;  4X3K A;  3NTK A;  2XRQ D;  2BCO A;  3RD4 A;  1NCV A;  2BA1 A;  3VR6 A;  4A3B B;  1R4Q B;  2L4N A;  1BCP B;  4QF4 A;  1ZXT A;  1QNU A;  3CQZ B;  5IGB A;  1EEI D;  2K04 A;  4BS9 A;  2ZXP A;  4J6H A;  4KD4 A;  5CV8 A;  1F2Z A;  2KUM A;  1OXX K;  1BO0 A;  3A8J E;  5T1G A;  2IPK D;  2A6H D;  5IT9 L;  2TSS A;  3TZU A;  1EQV A;  1DXM A;  2BE5 C;  2WKC A;  2Q8T A;  3S17 B;  1Y1W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...