2F0OA

Crystal structure of staphylococcal nuclease mutant v66i/i72v
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMIENAKKVEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0oA00
1JOKA 4J1MA 2QDBA 4N9TA 5KIXA 1NSNS 3EROA 3T16A 5HURA 4RKBA 5DEHA 5IGGA 3HZXA 1SYEA 4NKLA 1JOQA 1TR5A 2F3VA 1ENAA 3D6CA 3NK9A 1SYBA 4ZUJA 1KAAA 3D4DA 2PW7A 5IIFA 1A3VA 3NP8A 1EYCA 5KEEA 2EXZA 2EYFA 1RKNA 2EY6A 4KY5A 4EQPA 3SXHA 1STAA 1STYA 2F0QA 4KD4A 3TP8A 5K5PA 1A3TA 1JOOA 4WRDA 5KGUA 5CV6A 5CV4A 1F2MA 4KHVA 4ZQ3A 1II3A 1EY9A 2KQ3A 1EYAA 2F0MA 4K5VA 3QOJA 2F0UA 2F0LA 4KJOA 5J1ZA 3NHHA 1STHA 5IGEA 1IHZA 3R3OA 2HQEA 4DFAA 5JOBA 3SK8A 2F0TA 5F2DA 4TRDA 2EY1A 2F0EA 4DGZA 4IALA 2M00A 5I9PA 3MVVA 4ME5A 5IGDA 5C6AA 4R8NA 1EY6A 3OWFA 4QB4A 3TP5A 4IUNA 5EKKA 2F0NA 2F0SA 3OMCA 2EYHA 2RBMA 1TT2A 4KY6A 5C5MA 5M9OA 3ERQA 3PMFA 4J6HA 5KRUA 5CV8A 4EQNA 1SYCA 2PZUA 4QMGA 5DAUA 3MHBA 1KDCA 5I9OA 2F3WA 2EYOA 2OF1A 5E1FA 3SHLA 3U9OA 4DF7A 3E5SA 5I6WA 2OXPA 4K5XA 4ID6A 1EQVA 2NUCA 1EY0A 4B9XA 1U9RA 4HTHA 5CC4A 5IODA 3P75A 1STBA 4LAAA 3V2TA 2PZTA 3NXWA 3MXPA 2EYPA 4IZ8A 3S9WA 1A2TA 1SNCA 3OSOA 2KHSA 5J39A 5E3FA 3TMEA 4EVOA 5HGTA 5EGTA 2EY2A 2OEOA 3SK4A 3EJIA 4I65A 3BDCA 3D4WA 4DU9A 3SK6A 3TP6A 1F2YA 4ODGA 5C3WA 3D8GA 2F0VA 2F0IA 2F0PA 3C1EA 2PW5A 3DHQA 4K2LA 5I6YA 2LKVA 1SNQA 4E6IA 3QB3A 3SR1A 5EKLA 1STNA 4H7BA 5CR3A 3TP7A 1AEXA 4F7XA 1EZ8A 5IGCA 4K8IA 5C4HA 1ENCA 4KD3A 1KDBA 4YIJA 5C4ZA 5KYLA 1JORA 2SOBA 2ENBA 2WACA 1EY8A 4K14A 3SK5A 2EYJA 1EZ6A 2PYKA 5IGBA 2PZWA 4HMIA 4MIUA 1EYDA 2EY5A 4K6DA 3QOLA 5C3XA 5IOCA 3HEJA 1F2ZA 3H6MA 4OL7A 1SYDA 3NUCA 5CV7A 3LX0A 5C5LA 2F0DA 5NUCA 3RUZA 2EYLA 3ITPA 2F0JA 3C1FA 4K5WA 2F0HA 3MZ5A 4KV6A 2O4XA 2EYMA 3T13A 1SYGA 5ISRA 2F0KA 1SNMA 3DMUA 1SNPA 1A3UA 4PMCA 1EY7A 4K8JA 4S3SA 4QF4A 4F8MA 2SNSA 3VA5A 4G57A 4B9WA 5JAVA 4HMJA 1KABA 5CV9A 4K2KA 4PNYA 2F0OA 3BDLA 4NMZA 4KY7A 3OMGA 5CV5A 4EQOA 3NQTA 5CGKA 1EY4A 2SNMA 3MEHA 2RDFA 1STGA 1EY5A 4PMBA 2RKSA 1SNDA 3P1HA 4RKLA 2F0FA 5IGFA 1SNOA 4KJNA 5J22A 4N9PA 3EVQA 1A2UA 4ZUIA 5KYIA 4NDXA 1TQOA 1NUCA 2F0WA 1SYFA 4KTAA 4WORA 1KDAA 2F0GA 4NP5A 2PQEA
chains in the Genus database with same CATH superfamily
5GROA 1IBML 3S16B 3BJUA 4DV1Q 3HOXH 4DV3L 3S2HH 4DXGA 1TWCH 1JB7A 1EWCA 4C3JB 3GTLB 2DGYA 2DY7A 2L0CA 1ILPA 4DV5Q 3KLWA 4MHEA 3TS2A 4CJ1B 2R93H 3SK8A 4DR3Q 1VQKA 2XIWA 1V1PB 3TEHB 5I9PA 3S1NB 5C4JH 1C7YA 3H3VI 5M3MB 2K33A 1Z47A 2RBMA 5C5MA 1Q1BA 3ERQA 1YVCA 1TY0A 3FHWA 1C0AA 4PV1C 4YY3L 3J7ZC 1Y1VG 1NBWA 1EWHA 3UE0A 4DF7A 1EFWA 2NWGA 1E2VA 1UWVA 4HTHA 3PIP3 3E9HA 1HZCA 1QNKA 2NZ1D 3DWPA 3OSOA 4OGQC 3WDNA 1WD0A 1LTBD 4DR1L 1HQMC 2CQOA 5M3FG 2UUAQ 2UXCQ 1UUPA 4POGA 5C0XI 5LMNW 3S2DH 4AQYQ 2A68C 4UPAA 3G6EA 2JQOA 3H3VC 4K8IA 1N36Q 4OEMB 2VUMG 1G2SA 1BO0A 3RLFA 2OQKA 1HHVA 2BDNA 4DPGA 1D5MC 3I7FA 3K0YA 3LX0A 5C0XG 4MNOA 5IE8A 2PO4A 2FINB 1CT1D 1GHJA 2JXMB 2AWNA 2VL6A 2H4OA 2Z9HA 4PG3A 4F8MA 3A55A 5BN4A 1H9SB 3K5LA 1KLUD 4FVMA 1HR0W 5ELCA 1J5EL 3HP3A 4RA8A 4KHZA 1H9JA 1LYLA 3CC4A 3MXNB 3NWTA 4IURA 1SJED 3BVMA 4HCSA 2B29A 3CCLA 3GO5A 4CHTB 1M90C 4A76A 4LFBL 1M8AA 4LF6L 1SYEA 2K04A 2JN4A 2F3VA 3PSIA 4ZUJA 4BBRG 4UP7A 2MJ8A 1JWMD 1M4VA 3I4NG 4DR4Q 5K36H 1Y1WG 3NP8A 2VY3A 4G7OC 5KEEA 1QG7A 4ZK9B 1I4XA 2F0QA 3QWNA 5E7NA 2Q8IB 4BY1G 3X3NA 3R2TA 4K5VA 1L2FA 2F0UA 1VQEA 1CKNB 3RNUA 4B3ML 2MO1A 1SJHD 3F2UA 1UE1A 3HOWG 2PPBC 3EN2A 1AP0A 3RR5A 3ND9A 5C6AA 4C3IH 2R7ZB 2NBFA 1Q8IA 4DAMA 1IBMQ 2BH2A 1U5KA 3VYUA 1Y1WB 1NR2A 5FKAC 4DV3Q 5TSSA 1QVGA 4HJ8A 1X56A 3K7AH 4JI1L 3MA2B 2YTVA 3GTOH 4IPHA 2CWPA 1WCMH 1UE6A 3JAME 3HOWB 1SN8A 1ASZA 1HFNA 2WV6D 1NAPA 3GTPB 4WJ3M 2LKVA 3GTJH 3R93A 2K1BA 2ALYB 1E2ZA 3RZDH 2B63B 1EEFD 4HJAA 1JORA 4UDUC 5EPLA 3M3YH 4FDBA 4DV0L 3CPWA 2B2YA 2LY7A 4YY3Q 4XT1B 3FMCA 2AWOA 4OL7A 3BVGA 4DV4L 2N78A 1RDPD 5D3IB 1IL2A 2HD3A 4QQBX 3MZ5A 5FO7B 2EYMA 4AYBE 4DXFA 1EIHA 5M5YB 4R9WA 3T56B 1XXGA 2BH8A 4DR1Q 2B8GA 5AJ3L 3VR5A 4EQOA 3J80c 3Q24A 1VQOA 2MHVA 2NVYB 5ELBA 3HOYB 5LL6S 1H9SA 3Q6SA 2C35B 3S1RH 4C56C 5CYUA 2RF4A 3TMEA 2F0GA 1MKHA 1Q90A 2PQEA 4H02A 3GP7A 2WB1G 1KQSA 1SMXA 3HZXA 5T1GA 5FLXE 3MEFA 2MO0A 2D0OA 1N34L 1S5BD 3GQBA 2B2VC 4RGOS 1I4PA 5JEAH 4GNXC 4A3JH 1PYBA 1J5EQ 5C3EG 2ICIA 3CHBD 2ZJRA 3NELA 2L55A 1PTOH 1DOLA 2M00A 2B2UA 4LWCA 4QL5A 4A3MB 2K5HA 3K8AA 4GNXB 1CM9A 3BU2A 3A7LA 4JBKA 1V8QA 2VQFL 1U0LA 1SROA 2QEJC 4MZ9A 4LF5L 4LFBQ 4LF6Q 4Y52H 1XWEA 1MJCA 5DLQE 2MUYA 5C44G 4QIWE 4C1NI 4ID6A 3SVMA 3PO2G 3KLSX 4ZKBB 1SNCA 1X65A 2DJFC 4MTNA 4RMFA 4EVOA 1VQHA 1R9TB 4B3MQ 5M3MH 2EPBA 1H9MA 3DHQA 4QJFA 3ULJA 1SE3A 2EVBA 3EFXD 3ULLA 1SNQA 5I6YA 1JJGA 1JCKB 2Z4HA 1SMYC 3W2DA 4DK0A 2XVSA 5JPMC 3EQLC 2VNUD 4J8QA 3H94A 3J80L 1YBYA 1HXYD 3HEJA 3NUCA 4JI1Q 4JYAL 3PO2B 5CORA 5IP9H 2FFKB 2UU9L 2JA9A 1EL0A 5KNBA 4IUUA 2C9OA 5GAGC 4KY7A 3T4AC 3M7GA 4XQNA 3P7JA 2B3GA 5CMDA 3CXCA 4KN7C 3BDOA 1W2BA 5J3BA 1SNOA 4N9PA 5A2QE 1PH3A 1D5XC 1JICA 1GOZA 3A5ZB 4DV0Q 3NQIA 1B9NA 3W1BA 3HOXG 3TN2A 1VQ9A 3EIVA 1Z9FA 1SDFA 1J6QA 2CH4W 3LGJA 1GM5A 3N52A 4LJZC 5I2YA 1A3TA 5AJ3Q 2QGQA 4KHVA 4ZQ3A 2JA7H 5J1ZA 3J7YW 3NHHA 3DM1A 1QZGA 4TRDA 1Y69U 2A6HC 4IPDA 2KEDA 4ME5A 1CHPD 1TT2A 5I4DA 1RHPA 4JVZA 2BA1A 1IW7D 5IWAL 1I50H 3QO2A 1N34Q 2OF1A 4A3CH 4A3KH 3HOUB 2X69A 1SR3A 2B2TC 1I3QB 1X32A 1WVLA 4A3LH 1D2BA 4GKJL 1NMGA 1I94L 3FPPA 1XTCD 4PZ8A 4I65A 1PHJA 4WJWA 1S5DD 3VDYA 3SK6A 3VR6A 2CW0C 4L5SA 1YHQA 3I3CA 4BBSG 4L63B 1VCIA 4H7BA 1HFGA 3T53B 4BS9A 3TDQA 1C8CA 4LF5Q 3SK5A 1PH1A 1RTOA 1PDQA 5IGBA 1KAWA 2HIVA 2ZJQA 1H9KA 2PQAB 5NUCA 1TWGB 2IPKD 2V1CC 4JI4L 2O4XA 1SYGA 5FOBB 2F0KA 1E1TA 4C3HH 5C4XG 1LLRD 3PO3B 2A69D 3LNNA 1HA6A 2CH4A 1VQNA 1LUZA 1EOTA 2GVBA 2B63H 1ML0D 1F77A 2IL8A 1R4PB 3AU7A 4FP5D 5CGKA 2RDFA 3T51B 1BCPD 1MD2D 1O78A 4HN7A 4R4OA 1EQTA 3D3RA 3OOCA 2KOLA 1WFQA 3E9IA 4EQ5A 5ELOA 4X65L 1KRSA 1ZYRC 4IUQA 1WTOA 5JEAJ 2I5LX 1OXVA 1JOKA 4N9TA 2A19A 2H1EA 2MPMA 2GN5A 1KTKA 3CQZB 3STBD 1V1OA 1YI2A 4P74A 3PIOA 4TVAB 2UUCL 1TVXA 2UU9Q 3EBEA 1AN8A 4YWMA 1XMQL 3RMHA 1QWYA 4ZRZA 2Q8TA 3UDGA 2CQAA 3J7AF 2NVYH 2E5LL 1PH8A 3HOYH 5IGEA 1IHZA 3PIPA 1AW7A 4DA2A 3H0GH 5D14A 5FLMH 2EY1A 4C3IG 3M85A 4DGZA 1CSQA 1KHIA 2L12A 2F4IA 2ZXRA 2UXDL 3HOZH 1HNZL 1NTGA 4A93B 1NJIC 4JBMA 1MI2A 1O7LA 4K0KL 2N3SA 5EKIA 4JG2A 4CDEC 1U4RA 1VQMA 2AUKA 4A3EH 4RH6A 2MNAA 4BA2I 3U9OA 2EJGC 2Z6KC 3BYYB 4XT3B 5GADC 3PUYA 1EQVA 1ET6A 5IODA 2KUMA 1JC7A 3S9WA 3C3LA 1ENFA 4U673 2BOSA 1X6OA 4DAYB 3NWSA 3RZOH 5A35A 3HG9A 4A3MH 2KCNA 3KDFB 5FJ8H 2QDLA 4DU9A 1I4HA 1PH6A 4A3FH 2CKZB 5M5WB 4P73A 4A3GG 4AYBB 3QG1A 2B2WA 3SR1A 3L0OA 1O7ZA 1S5FD 4KD3A 3I55A 2EDGA 4A3IB 5IYDH 1G8ZD 1N32L 3N6RA 2ASBA 1TWHB 4LF7L 3SGIA 2B2TA 5IWAQ 2AQ1B 4CJ0B 2N88A 1DOMA 4K5WA 3GTGH 2WB1E 1TU2B 4YWKA 1YNXA 1VQAA 4GKJQ 1I94Q 2I0QA 3A8KE 3I8ZA 4S3SA 3FKIB 1GUOA 2PMZE 2SNSA 2HDLA 1KABA 4HMJA 4LUZA 2JSOA 1RD9D 3MEHA 4R4IA 4L5QA 3F2DA 5JJLA 1RL2A 3CKIB 5J22A 1B2TA 1PRTC 4V0BA 1DD2A 4TKOB 4O2DA 1JWSD 1EEID 2VB3X 1LTGD 1QUQA 4A3BB 5LMUL 2OTLA 3U4ZA 5IGGA 3UI2A 1YNNC 1XPUA 3H09A 1ET9A 4JI4Q 3NK9A 1HZAA 2HCCA 1PRTB 1QNUA 3M4OH 4KI0A 3S14B 1CSPA 3BYTB 3I4MG 4A3JG 4KY5A 1STYA 2XRSD 2IWHA 4ZYSA 1BBXC 3HOVB 3QOJA 2F0LA 3NPPA 1RIPA 1LO5D 1HUMA 2NN6H 1QB5D 4QIWB 3AMUA 2F0EA 2B39A 2A68D 1D8LA 1HJPA 1B1ZA 1Q46A 2JA5H 4X65Q 3KF8B 4IFDH 4C2MH 3HKZG 2QKIC 4LF4L 4O1NA 4J6HA 1PFBA 2PZUA 4HIOA 4A4IA 1B4OA 4KMUC 1GUWA 4LF9L 4XQQA 3S24A 1XNRL 2AQ3B 4JI7L 4OX9Q 3I4MB 2WP8J 1LT5D 4A3DB 3PV0A 1JQYD 2Y0SG 2AKWB 1XMQQ 2JA6G 3PF4A 5FO8B 1V43A 4R4CA 2JP1A 5E4XA 2E5LQ 2NZOA 4JI5L 3SK4A 3K0XA 1F2YA 2TMPA 1CTMA 4AH6A 1CQFA 2MGSA 2UXBL 3PIO3 1BXTA 2UXDQ 3HKZB 3KOJA 4DUYL 4IQZA 4K0KQ 3HOUH 3KDFA 2Z6KA 1I6HB 1MGSA 2PYKA 1VQFA 1I3QH 2PZWA 4BXXH 2JA6B 2F0DA 3F2CA 1O80A 2EYLA 2JEAI 1AFPA 1EQQA 4P2CB 2K50A 4F87A 4RGMA 3DMUA 1D1IA 4PMCA 4DNRB 1KC8C 3E0JA 4QF4A 1F9SA 4QGUA 4KKSA 5LMNL 3U4VA 2I07B 1E7ZA 1TS2A 1EY4A 3GTMB 3J80i 1YJWA 1L0XB 5EQ0A 2EIFA 1Y1VB 4XQJA 4JOIC 4UY8C 2IX0A 4HJ7A 2L11A 3OIPA 5ELDA 4IUPA 1N32Q 1B50A 4G7HC 4LF7Q 2E8GA 2K5NA 4KTAA 1FGBD 4LFCL 1UE5A 3GTKB 4XYQA 1MSGA 3PO3H 4GOPA 3W3AA 3D4DA 1A3VA 5M3FB 1Q1EA 2ATWA 1S5ED 2ZJPA 2JA7G 2JE6I 4JBJA 4OWXB 1HR0L 1HH2P 4WRDA 1DGSA 2Z4IA 2KQ3A 1G51A 2BDOA 4DAVA 1ICWA 2VUMB 1SAPA 1B3AA 1VQCA 1STEA 4GLVB 4R8NA 1HQRD 1S72A 5EKKA 2F0SA 3CQZH 3DWQA 3MFGA 3CRLC 4OIKA 3J7AV 4A3CG 3OYYA 4A3KG 3Q8DA 3D0FA 4EQNA 1SYCA 3RN5A 2PCFB 1K8OA 3V96A 2Z0SA 5E1FA 1AZQA 2IHEA 4WFN3 1ONLA 4K5XA 4FXDA 1E3PA 1S40A 4FF4A 3CW2C 3ZJYC 3GDEA 2XSCA 4IZ8A 3L7ZC 2NZHA 2AQ2B 5E3FA 3GV3A 1DXMA 2IHFA 4IO9A 3NEMA 1KL9A 2A8VA 4A93H 3TP6A 4LF8L 3I2ZA 1L0YB 4OXPA 2I5HA 1STNA 5CR3A 4OO1I 5IGCA 2IX3A 4BBRB 2K4KA 3I4NB 3S17B 4LF4Q 2F1MA 1V1PA 4IN3A 1Q86C 3U50C 2VZAA 3J81c 1W6JA 4LF9Q 2MFIA 3H6MA 2EOTA 2FMMA 4BY1B 1XNRQ 4JI7Q 2E2JH 5GAHC 4OO1G 4LMQD 1SNMA 1SNPA 1X3GA 3CCRA 1VMCA 3SEBA 1K3RA 5M5WH 1B9MA 1EQRA 1K83B 4JI5Q 1PZID 3PF5A 2IW3A 2CFMA 1BNZA 1T5XD 2UXBQ 4WJ4A 4DUYQ 3PUVA 1Q8KA 2KVMA 3I4LA 1D6EC 4BY7H 2F52A 4GKKL 2NB0A 5COYA 1YIJA 2R92H 1ESRA 1A6XA 2QILA 4J1MA 2YU9H 2JEBI 5EBDA 4RKBA 2XTIA 3FKIH 1JOQA 4B08A 2Z6BA 2IY5B 1KAAA 2JA8H 1LTTD 1AE3A 1LTLA 1RKNA 1STAA 5AFWA 4BWGB 1HUNA 4IFDJ 2FJ2A 2YTYA 1QOHA 4P72A 5FLMG 2HT1A 2EE1A 1CA5A 2R3ZA 3Q22A 2OTJA 3KJPA 4IJHA 5E4WC 5JOBA 3HOZG 4KKTA 2DNEA 4A3BH 4P71A 3S1QB 3OIQA 1DYQA 3GTQH 1SMYD 4GN4B 2A5HA 1VQIA 5BN3A 3OPOA 5M9OA 3J81j 3MXNA 1BF4A 2E2HH 4A3EG 4LFCQ 3FRPB 3GD7A 1WTRA 2V4DA 5DAUA 5JPNC 2QCPX 5GAEC 1K8AC 1X54A 4LK1C 3X3MA 3HOVH 5IT9c 2QA4A 1NE3A 2D0PA 3H91A 1DM0B 2LS01 3V2TA 1HZ9A 1HR0Q 5FJ8G 3NTKA 2E2IH 4A3FG 2K5WA 4FXKC 3A5UA 2A1AA 2OEOA 3A54A 1AE2A 2EJFC 1JT8A 5C3WA 2F0VA 3K59A 3S16H 4FF3A 2WB1B 1G91A 3QB3A 1CKNA 1TWAB 1RF2D 5C4ZA 5CBAE 2PMZB 4C3JH 3GTLH 4DKAC 1J9OA 1PH7A 1V9PA 4IPGA 1WTVA 5DM73 4MIUA 3URYA 5C3XA 4K6DA 5H1SE 3CCSA 4XYOA 1SSOA 5IYCH 3PCOB 3ITPA 2MP1A 4TSSA 3KF6B 5C3EB 1WOCA 3S1NH 1EY7A 3A74A 4JI2L 1OXXK 3DWAA 3NTHA 2HUGA 5ELFA 2YV5A 4LF8Q 5G3LF 2NVQB 3CCMA 1WJJA 3NQTA 1IKLA 2A6HD 1LV9A 1SNDA 2DN8A 1Q3LA 4RGTA 1HTLD 5C44B 2E74C 4UP8A 2R7DA 3FPUB 4X3KA 1PRTF 5EPJA 4R4TA 3A56A 3R2IA 4G4KA 2NN6I 2EXDA 4RG1A 5HURA 3HKZE 3KLRA 3HRZC 5M5XB 1ENAA 1SYBA 1PH5A 2PW7A 2K01A 2A73B 1EYCA 1V1QA 1HNWL 4ALPA 3MAQA 1K9MC 1TWFB 2K75A 2D62A 3ER0A 1S3OA 1ESFA 2VXWA 2YYZA 3TZDA 1SE8A 2Y0SE 4HJ9A 1Z6HA 2NN6G 2CW0D 4DFAA 2JA5G 5IT9L 3H3VH 3U58A 4IFDG 1A0IA 1PFNA 3PUWA 1FL0A 4DR6L 5IGDA 2RVLA 4GKKQ 1PMRA 3OMCA 1MSHA 4DV4Q 2PI2E 1LACA 4RAUC 5M3FH 5KRUA 3CAMA 5CV8A 1B3QA 1E1OA 1KNEA 1BDOA 3UE1A 1KDCA 2RCFA 1Y8NB 1I4RA 3F8TA 2NYZD 3NSWA 2R93G 1H95A 2FHTA 4Y7NB 4JC0A 5L37A 2PZTA 3G6JB 4J15A 5T1IA 1WTPA 1SFOB 3S1MB 4EGVA 5C0XH 3K80C 5DNFA 2K5VA 4ODGA 1XX8A 4CDDC 3HOXB 2WKDA 4E6IA 3I72A 4HIKA 3S2HB 4G7ZC 1TWCB 2WKCA 1L0WA 4Q5VA 2G9HD 3IFDA 1MJEA 3E6ZX 3KJOA 3ICEA 1EOVA 1ZYRD 2B2VA 1EUJA 1X3FA 2BA0A 2LXKA 4GNXA 3G4SA 5IOCA 2R93B 1IBLL 5CV7A 1HRJA 5EAYA 2F0JA 2F0HA 3CCQA 2XRQD 2D5DA 5C4JB 2QEXA 4CKEA 4DK6C 1QZHA 2R7ZH 3AYHB 1IKMA 5JAVA 1W3SA 4ABNA 3ONAB 2WFWA 3BDLA 2F3IA 1Y1WH 1ZKOA 3LWEA 4PMBA 3OWEB 2VQFQ 4MTKA 1K0RA 1JB3A 3KLSA 1LTAD 4BY1H 1A2UA 2CVRA 2ES2A 1F9RA 4JW0A 2OQ0A 1SYFA 2K05A 3ULPA 3HOWH 1RJTA 3T16A 4XTCS 1I6VC 3RLOA 3GTPH 1CKOA 1KNAA 4BBSB 4X3TA 2JYOA 4JBWA 4JI2Q 4L5TA 3W1GA 3TP8A 1E22A 5K5PA 4ZAIA 2D2CC 1QVCA 3JAMc 3VYSA 2IT1A 5ELEA 2JJQA 4JV5L 2D9UA 3PGZA 4DAPA 2O5IC 1DOKA 1OTCA 5M5YH 5K36G 1E2WA 5EPKA 2CCZA 4JYAQ 5C4XB 2ZXPA 1PFMA 1BVSA 2ZTDA 3T1YL 3IRBA 3J7A5 4V190 1AZPA 2XWJB 3SHLA 2OWOA 2AMCB 1PVOA 2OXPA 3KYHC 1WTXA 1HNWQ 1HZBA 5CC4A 1STBA 3HGBA 3S1QH 5G3LD 1L1OC 3DEOA 1DCZA 5CBEE 1GUSA 1D7QA 1G2TA 1TIID 3D4WA 3CMEA 1YZ6A 1YNJC 2KECA 4K2LA 3CF5A 1BKBA 4DR6Q 2I46A 1U4PA 1EZ8A 1L1OB 2B8FA 1PRTD 4I7AA 2AHOB 3TQYA 2E2DC 2M9VA 2WAQG 2R7FA 4K14A 2A74C 1WCMG 4ZCKA 1YNND 1F2ZA 4GN3B 4X6AH 2IX1A 2DUDA 3L9AX 5FLXc 1MHWC 1B53A 1C4QA 4JI6L 3T13A 5DM63 2G5DA 4DUZL 4QY7A 4Z9CB 4C3IB 4FF2A 4OELB 1PYSB 3DEPA 4Q0FA 5BR8L 4GLXA 5CV9A 3NE5B 4DR7L 3OMGA 1VQPA 4BY7G 4HR7B 1LTSD 3K7AB 2R92G 2KENA 3UDIA 1BUVT 1FNWA 1G6ZA 4EX5A 3JAML 1BCPC 2F0WA 4WORA 1R9TH 3DXJC 1IBLQ 2JA8G 2N55A 3IAYA 1N36L 2UUBL 5JVG3 3DM3A 1Y14B 2Q2TA 3IFTA 4R4QA 3TS0A 3GTJB 2NVQH 3O13A 1TS4A 3RZDB 2PQAA 2RHSB 3CPFA 4A3GB 4RWSC 2SDFA 1O7IA 4LW1A 3M3YB 4IPCA 1D5ZC 5CV4A 1GD7A 1MIUA 1EYAA 1CHQD 3UDXA 2A6EC 4X64L 3J80E 1XNQL 4PZ7A 3PO2H 1IXRA 3TBIB 1WTWA 1XMOL 3BG3A 3PMFA 4QMGA 5C0XJ 1CQVA 5JEAG 1TWFH 1Z7TA 4NPSA 5IP7H 1EIYB 1SE4A 2AUJD 4FXGC 1P16A 3WWVA 3VR3A 3MXPA 3S1RB 3CCUA 1IL8A 1I4GA 3A8IE 1VQ8A 4RFBA 5FLXL 2P5ZX 1BQQT 4LFAL 4JV5Q 2HCIA 2F0PA 3PQIA 4BA1I 4X62L 4C3JG 1EFID 1H9RA 1IZ6A 2KCTA 3SE0A 4DV6L 3MWYW 1G291 1PTOC 1NR4A 4DNTB 1WD1A 4XIGS 4LNQA 1CK1A 2WACA 3T1HL 5KNDA 2UUCQ 1RCVD 3T1YQ 4A3JB 3J81i 4AIMA 1VMPA 4DV2L 1Y8OB 3BZDB 1KIXA 5M3MG 1PTOB 3C1FA 1SFOH 3G48A 2GA4B 4DNIA 1X9NA 1PXUA 4ILWA 4JI0L 4KK7A 3VYRA 2NTTA 4KLKA 1IBKL 2QW7A 4JI3L 3BZCA 3BVZA 4PNYA 4P75A 2DY8A 2K28A 2L15A 4NMZA 1HNZQ 1DZ1A 2K03A 1N33L 4DAYA 3JC66 1NMFA 1SE2A 3EVQA 5IP9G 2I5MX 2XN9C 2Y0SB 3LWUA 5HY6A 3CCEA 1RODA 3EROA 1HNXL 3G71A 1I4QA 3D6CA 4POFA 4JI6Q 2VQEL 4DUZQ 5IIFA 2RA4A 2Q8RE 1CA6A 1BR9A 5BR8Q 2ZM6L 4X66L 1YITA 4HJ5A 2CWAA 5CV6A 4YHHL 1GUNA 1JE5A 1DONA 1EY9A 1S5CD 2B2YC 4DR7Q 4YCUA 2BE5C 4X3UA 3MC0B 2KA7A 4DR2L 1TWGH 3A0JA 3NTIA 4UAIA 1X3PA 3FP9A 2XGTA 3OWFA 1XPOA 4IUNA 4KKUA 4JK1C 2HHHL 4NB3A 4XXEA 4B3SL 2DJGC 3KBGA 4BBSH 2UUBQ 2F3WA 2K32A 4CBVA 2EYOA 3MFYA 1K0SA 1IYVA 4IUVA 5I6WA 3AFPA 3E5SA 3D4RA 2K52A 1J8IA 4FF1A 5A2QL 4DR5L 2NVTB 3KK7A 1VF5C 3TREA 1EYGA 5J39A 2KCMA 1UNSA 2LXJA 2EY2A 3DUZA 3S15B 2R6GA 4X64Q 1CUKA 1QJOA 1CZWA 1XNQQ 2F0IA 2OCEA 1K73C 4QUCA 5C4XH 1YJ9A 2RQXA 5LMUQ 1R4QB 1WI5A 1FJGL 1ENCA 5KYLA 3NBHB 1NY4A 4M1UB 1XMOQ 4IOCA 2ENBA 3CP0A 4A3LG 2H5XA 2JA7B 4C1NK 1EYDA 3KF8A 4YCWA 1BOSA 1EU3A 1W6KA 3KBXA 4IOAA 2B2UC 4GLAC 2R7ZG 4CDCC 1KXLA 1FGUA 1A3UA 1VDZA 1A8VA 4B9WA 1QVFA 3M4QA 3G7LA 4LFAQ 3L2PA 2VB2X 1I50B 2Q2UA 4X62Q 1X55A 2ZXOA 4A3KB 1STGA 1EY5A 2RKSA 4RKLA 4DV6Q 1VQ4A 3T1HQ 1ZEQX 4LUVA 4C3HG 1KDAA 4NP5A 1N8RC 3OHXC 1PLFA 3BZKA 4CKCA 5FO9B 5LL6X 4DV2Q 1I5FA 2B63G 4JI0Q 1OXSC 1S4ZA 2NVXB 3K57A 1IBKQ 4F88A 1UEBA 4A3IH 1JJCB 1LT6D 1FD7D 2ZTEA 1FNVA 4JI3Q 2G9DA 3UDFA 1TWHH 1F9QA 3D6WA 3D31A 1PYWD 1N33Q 1YEZA 1STHA 1PH9A 3QR8A 5F2DA 2M2LA 2PI2A 1QILA 1K3BC 1Q7YC 2Z8LA 3SDZA 4C3HB 3FEWX 4OONA 4HAEA 5IYBH 2F0NA 2LSSA 4KY6A 1F9PA 1XTDA 2RDHA 4RHRA 1VQ5A 5LHY1 1HNXQ 4A3GH 1SXTA 1TKWB 5I9OA 3CU7A 2WAQE 2VQEQ 4R1JA 1O7YA 3ND8A 1VF7A 3HOYG 2EJMA 1A62A 3H0GG 3CC2A 4HCEA 1E24A 3I90A 1EY0A 4X66Q 2ZM6Q 2Q2HA 5LMNQ 4LAAA 4JOIA 3NXWA 1LM0A 4YHHQ 3I91A 2RDGA 5EBCA 3OTOL 4GZYC 2HDMA 3EJIA 1HCZA 1QE6A 2K5DA 4DR2Q 4DK3C 2X6GA 2RSNA 4K6LA 2DNCA 3S14H 1ZXTA 4YIJA 1KDBA 2HHHQ 4B3SQ 1ICFB 1PZJD 1LABA 2EYJA 1EZ6A 3TRZA 3Q0AA 4DV7L 4HSVA 1GVPA 4A3MG 1CZGA 1PA6A 3H0GB 2J0TD 4PZ6A 3CRKC 4L6TB 1A63A 4KV6A 4DR5Q 3BS1A 3NBHA 3PUZA 3J81L 1FVIA 4QCLA 2KEEA 1SBBB 3HOZB 1A15A 2FXQA 1B8AA 3EA6A 2ZTCA 3CMAA 1ASYA 3VA5A 4G57A 3K5MA 4K2KA 3QJYA 5IYDG 4N8FA 3MXUA 1QCBD 3E3XA 4NW2A 5CV5A 4A3EB 4ZLTF 1JWUD 4DK1A 1U4MA 3I4MH 4QUFA 2RSOA 1VQLA 3U9SA 1FJGQ 4A3DH 4CDFC 2E75C 4PMWA 3HFZB 3RZOB 1Y8PB 1YJNA 1BCPF 1EU4A 5DEHA 4A3FB 3VA7A 1TR5A 2LMCB 1VS0A 3I4OA 1GUGA 3KFUA 1JR0D 2K6AA 4L8JA 2O2LD 2EXZA 2GVAA 4H0LC 2EY6A 2MQHA 4I7ZC 4EQPA 2J4XA 3K5NA 5KGUA 2RCNA 1F2MA 1UAPA 1TY2A 1I6HH 1II3A 2F0MA 4OWTB 3JAMi 3R3OA 5BN5A 2F0TA 2JA6H 3CCJA 3GTGB 5KNCA 4KHPL 3TP5A 1D1KA 2EYHA 5IY0A 4RGNA 3V05A 5IP7G 4HSPA 4IFDI 1OXUA 2L1BA 1XYIA 3GTMH 2Z1CA 2F4VL 2E76C 3I70A 2NUCA 1Y1VH 4B9XA 1SLJA 2EYPA 2KHSA 3L3OC 4HIDA 4APVA 3NENA 5HGTA 3WOFA 3GTKH 3BDCA 4ULLA 1FYCA 3HS0C 3D8GA 4B3TL 3ERSX 4IJLA 1JJ2A 3M4OB 4HEDA 2K14A 5EKLA 3R8BA 3TP7A 1JMCA 1AEXA 2K7VA 4JI8L 2CHBD 1LTRD 1PZKD 4NXML 1G6PA 2OT2A 1NNXA 1PTOF 3AB9A 4ME3A 1EY8A 3FDTA 2NVTH 2VUMH 2EY5A 5C5LA 3RLNA 3AEVA 3S15H 2X6LA 2JA5B 2KCCA 4K8JA 4C2MB 1PFSA 3VR4A 2C5CA 3OTOQ 1M1KC 2VS1A 3GV6A 2F0OA 1WYDA 3HOUG 1MBYA 1LT4D 1N9WA 4L5RC 2N49A 3CD6A 2SNMA 4BXXG 1SRUA 3P1HA 1E0BA 2YTXA 2IJ0A 1OXTA 2J7ZA 3K81C 1HPCA 2KBNA 4ZUIA 1TQOA 1NUCA 2HQLA 4PQXA 4DV7Q 1KLGD 1ILQA 3K6OA 2L4NA 4MN3A 4NKLA 1EIGA 3F1ZA 1K8GA 3I56A 5I2XA 3ZYYX 2B2WC 1DJRD 4XDXA 1XJVA 1YHAA 2EYFA 5JJIA 3SXHA 1SEBD 1VQGA 4KD4A 4YCVA 4BBRH 2NTSA 3I4NH 3WOEA 1JOOA 3S17H 3KF6A 4U68A 1C48A 2HQEA 1HA5A 1YNJD 4JCVE 4O0AA 4OIJA 1FR3A 3PO3G 3MVVA 3E0EA 1EY6A 2QF7A 4H13C 1IYJB 5GQOA 1K83H 3CCVA 3HKSA 3S2DB 2NVXH 3VYTA 3PUXA 1TXYA 3MHBA 2F03A 3H15A 5FK9C 1GJXA 4KN4C 3B6YA 1X3EA 1TS5A 4JPBW 2PNHA 1U9RA 4RCOA 1TS3A 4TQUS 1A2TA 1WTQA 2R61A 5JJKA 4B3RL 1GO3E 3A8JE 4LUOA 3OW7A 2O5JC 5D3DA 4OO1H 3C1EA 2PW5A 4KHPQ 1QUQB 2KHJA 4NXNL 1VQ6A 1Q82C 3K5OA 4CJ2C 3F2BA 2LFNA 3QOLA 2KHIA 2ZT9C 4OHJA 4HIMA 3RUZA 1SYDA 3C2PA 1IW7C 1EIFA 2F4VQ 4CKBA 4A93G 4DV1L 2ID0A 4GS3A 1RTNA 1PV4A 1OO9B 3I73A 4M8AA 4RHSA 3K58A 4OX9L 3NBIA 4DV5L 2A6ED 1B7YB 4B3TQ 3C46A 1GXDC 1FNUA 3FVQA 3RD4A 4DR3L 2F0FA 2ICEC 3M9BA 2PNRC 4JI8Q 4CGYB 1GHKA 4NXMQ 4IUTA 1AH9A 4X3SA 1VQBA 4NDXA 3IL8A 2VW9A 3J81E 2QDBA 5KIXA 4AYBG 2FMCA 1NSNS 4ZKCB 1GUTA 2EQSA 4A75A 4N8X1 4A3IG 2RHQB 4DN4M 1F2LA 3MTSA 4H44C 1X3QA 2XWBB 1TWAH 4UP9A 4OWWB 1BBUA 2A69C 1B70B 1YHBA 3KUPA 1LTID 2L9HA 1KD1C 3IKJA 4KJOA 1CFMA 2K5QA 3M7NA 2WAQB 3P20A 2UUAL 1B44D 1C9OA 3GTOB 2HIXA 5IYBG 2UXCL 2E2JB 1WCMB 3FKIG 4IALA 1U4LA 2EZVA 5C3EH 4AQYL 1PTOD 4QB4A 1Q12A 5HGQA 3Q23A 1BCPB 4R8IA 3QIAA 4FYDA 1CKMA 3STBC 1PH4A 1UE7A 1PH2A 1VQDA 4RCNA 4BY7B 2BCOA 4A3BG 3P75A 1UEAB 5C44H 3W5OA 1CI3M 2R92B 3M4PA 5EGTA 1BBWA 2YU9B 2WINB 4GOPC 3MXGA 5M5XH 1VQJA 4GN5A 2JA8B 1JE4A 1Q81C 4F7XA 1GKHA 1P8LA 2WIIB 1T9HA 5C4HA 3HOVG 2SOBA 4GOPB 1WTHA 5D65A 2XNAC 4HMIA 4FNFA 3A7AB 5JJZA 3VR2A 1K8MA 5IT9E 1K28A 2TSSA 4YWLA 5ISRA 1LT3D 3M4YA 3GTQB 2KJXA 4DR4L 3RN2A 3TSSA 3K7UC 2E2HB 4UHVA 4B3RQ 3AQQA 5JVH3 1NCVA 2N8NA 3AFQA 1EWIA 2Q2IA 2BE5D 4A3DG 2SEBD 5EJWA 4FO2A 1IYUA 3DLLA 2JK8A 5IGFA 1VQ7A 3TZUA 4NXNQ 4KJNA 1KRTA 1T5EA 5IYCG 4Y7NH 3CC7A 1XPRA 1HTPA 5ELNA 5KYIA 2E2IB 3OW2A 4O42A 3S1MH 2L5TA 1L1OA
chains in the Genus database with same CATH topology
3S16B 4DXGA 1EWCA 4C3JB 3GTLB 2DY7A 2L0CA 1ILPA 4MHEA 4CJ1B 3SK8A 2XIWA 5I9PA 1V1PB 3S1NB 5M3MB 2K33A 1Z47A 2RBMA 5C5MA 1Q1BA 3ERQA 1TY0A 4PV1C 1EWHA 4DF7A 2NWGA 1E2VA 4HTHA 3PIP3 1QNKA 2NZ1D 3DWPA 3OSOA 4OGQC 3WDNA 1WD0A 1LTBD 1HQMC 1UUPA 5C0XI 2A68C 3H3VC 4K8IA 1G2SA 1BO0A 3RLFA 1HHVA 2BDNA 1D5MC 3K0YA 3LX0A 5C0XG 2PO4A 2FINB 1CT1D 1GHJA 2JXMB 2AWNA 2H4OA 4F8MA 3A55A 5BN4A 1H9SB 3K5LA 1KLUD 4FVMA 5ELCA 3HP3A 4RA8A 4KHZA 1H9JA 4IURA 3NWTA 1SJED 3BVMA 4HCSA 3GO5A 4CHTB 1M8AA 1SYEA 2K04A 2F3VA 4ZUJA 2MJ8A 1JWMD 1M4VA 5K36H 3NP8A 4G7OC 5KEEA 1QG7A 4ZK9B 1I4XA 2F0QA 3QWNA 2Q8IB 3X3NA 3R2TA 4K5VA 2F0UA 1SJHD 3F2UA 2PPBC 1AP0A 3ND9A 5C6AA 2R7ZB 2NBFA 1Q8IA 3VYUA 1Y1WB 1NR2A 5FKAC 5TSSA 3MA2B 3JAME 3HOWB 1HFNA 2WV6D 1NAPA 3GTPB 2LKVA 3R93A 2K1BA 1E2ZA 2B63B 1EEFD 1JORA 4UDUC 5EPLA 2B2YA 2LY7A 4XT1B 3FMCA 2AWOA 4OL7A 3BVGA 5D3IB 1RDPD 3MZ5A 5FO7B 2EYMA 4DXFA 1EIHA 5M5YB 4R9WA 3T56B 1XXGA 2B8GA 3VR5A 4EQOA 3Q24A 2MHVA 2NVYB 5ELBA 3HOYB 5LL6S 1H9SA 3Q6SA 4C56C 5CYUA 3TMEA 2F0GA 1Q90A 2PQEA 3GP7A 3HZXA 5T1GA 5FLXE 1S5BD 3GQBA 2B2VC 4RGOS 1I4PA 5JEAH 2ICIA 3CHBD 2L55A 1PTOH 1DOLA 2M00A 2B2UA 4A3MB 1CM9A 3A7LA 1V8QA 2QEJC 1XWEA 2MUYA 4C1NI 4ID6A 3SVMA 3KLSX 4ZKBB 1SNCA 4EVOA 1R9TB 2EPBA 1H9MA 3DHQA 1SE3A 2EVBA 3EFXD 5I6YA 1SNQA 1JCKB 2Z4HA 1SMYC 3W2DA 4DK0A 2XVSA 5JPMC 3EQLC 2VNUD 4J8QA 3H94A 3J80L 1HXYD 3HEJA 3NUCA 3PO2B 5CORA 2FFKB 1EL0A 5KNBA 4IUUA 2C9OA 4KY7A 3T4AC 3M7GA 4XQNA 3P7JA 5CMDA 4KN7C 3BDOA 1SNOA 4N9PA 5A2QE 1D5XC 1JICA 1GOZA 3NQIA 1B9NA 3TN2A 1SDFA 3N52A 4LJZC 5I2YA 1A3TA 4KHVA 4ZQ3A 5J1ZA 3J7YW 3NHHA 3DM1A 4TRDA 1Y69U 2A6HC 2KEDA 4ME5A 1CHPD 1TT2A 5I4DA 1RHPA 2BA1A 1IW7D 3QO2A 2OF1A 3HOUB 2X69A 2B2TC 1I3QB 1X32A 1WVLA 1D2BA 3FPPA 1XTCD 4I65A 4WJWA 1S5DD 3SK6A 3VR6A 2CW0C 3I3CA 4L63B 1VCIA 4H7BA 1HFGA 3T53B 4BS9A 3TDQA 1C8CA 3SK5A 1RTOA 1PDQA 5IGBA 1H9KA 5NUCA 1TWGB 2IPKD 2O4XA 1SYGA 5FOBB 2F0KA 1LLRD 3PO3B 2A69D 3LNNA 1HA6A 1EOTA 1ML0D 1F77A 2IL8A 1R4PB 3AU7A 4FP5D 5CGKA 2RDFA 3T51B 1BCPD 1MD2D 1O78A 4HN7A 1EQTA 3D3RA 3OOCA 2KOLA 1ZYRC 4IUQA 1WTOA 5JEAJ 1OXVA 1JOKA 4N9TA 2H1EA 2MPMA 1KTKA 3CQZB 1V1OA 1TVXA 1AN8A 3RMHA 1QWYA 4ZRZA 2Q8TA 2CQAA 3J7AF 5IGEA 1IHZA 1AW7A 4DA2A 5D14A 2EY1A 4C3IG 3M85A 4DGZA 2L12A 2F4IA 2ZXRA 4A93B 1MI2A 1O7LA 5EKIA 1U4RA 2AUKA 4RH6A 4BA2I 3U9OA 2EJGC 3BYYB 4XT3B 3PUYA 1EQVA 1ET6A 5IODA 2KUMA 1JC7A 3S9WA 3C3LA 1ENFA 4U673 2BOSA 3NWSA 5A35A 3HG9A 2KCNA 4DU9A 1I4HA 5M5WB 4AYBB 3QG1A 2B2WA 3SR1A 1O7ZA 1S5FD 4KD3A 2EDGA 4A3IB 1G8ZD 3N6RA 1TWHB 2B2TA 2AQ1B 4CJ0B 2N88A 1DOMA 4K5WA 1TU2B 3A8KE 3I8ZA 4S3SA 3FKIB 1GUOA 2SNSA 2HDLA 1KABA 4HMJA 2JSOA 1RD9D 3MEHA 3CKIB 5J22A 1B2TA 1PRTC 4V0BA 1DD2A 4TKOB 1JWSD 1EEID 2VB3X 1LTGD 4A3BB 5IGGA 3UI2A 1YNNC 3H09A 1ET9A 3NK9A 2HCCA 1PRTB 1QNUA 4KI0A 3S14B 3BYTB 4KY5A 1STYA 2XRSD 2IWHA 4ZYSA 1BBXC 3HOVB 3QOJA 2F0LA 3NPPA 1LO5D 1HUMA 2NN6H 1QB5D 4QIWB 3AMUA 2F0EA 2B39A 2A68D 1B1ZA 4IFDH 2QKIC 4O1NA 4J6HA 1PFBA 2PZUA 1B4OA 4KMUC 1GUWA 4XQQA 2AQ3B 3I4MB 2WP8J 1LT5D 4A3DB 3PV0A 1JQYD 5FO8B 1V43A 2JP1A 5E4XA 3SK4A 1F2YA 2TMPA 1CTMA 1CQFA 2MGSA 3PIO3 1BXTA 3HKZB 4IQZA 1I6HB 1MGSA 2PYKA 2PZWA 2JA6B 2F0DA 1O80A 2EYLA 2JEAI 1AFPA 4P2CB 4F87A 4RGMA 3DMUA 1D1IA 4PMCA 4DNRB 3E0JA 4QF4A 1F9SA 4KKSA 2I07B 1TS2A 1EY4A 3GTMB 1L0XB 5EQ0A 1Y1VB 4XQJA 2IX0A 2L11A 3OIPA 5ELDA 4IUPA 1B50A 4G7HC 4KTAA 1FGBD 3GTKB 4XYQA 1MSGA 3W3AA 3D4DA 1A3VA 5M3FB 1Q1EA 1S5ED 2JE6I 4WRDA 2Z4IA 2KQ3A 2BDOA 4DAVA 1ICWA 2VUMB 1SAPA 1B3AA 1STEA 4R8NA 1HQRD 5EKKA 2F0SA 3DWQA 3MFGA 3CRLC 4OIKA 3J7AV 4EQNA 1SYCA 2PCFB 1K8OA 3V96A 5E1FA 1AZQA 4WFN3 1ONLA 4K5XA 4FXDA 4FF4A 2XSCA 4IZ8A 3L7ZC 2AQ2B 5E3FA 3GV3A 1DXMA 3TP6A 1L0YB 1STNA 5CR3A 4OO1I 5IGCA 2IX3A 4BBRB 3I4NB 3S17B 2F1MA 1V1PA 4IN3A 1W6JA 4BY1B 3H6MA 2EOTA 2FMMA 4OO1G 4LMQD 1SNMA 1SNPA 1VMCA 3SEBA 1B9MA 1K83B 1PZID 2IW3A 1BNZA 1T5XD 3PUVA 2KVMA 3I4LA 1D6EC 2NB0A 5COYA 1ESRA 1A6XA 2QILA 4J1MA 2JEBI 5EBDA 4RKBA 1JOQA 4B08A 1KAAA 1LTTD 1RKNA 1STAA 5AFWA 4BWGB 1HUNA 4IFDJ 2FJ2A 1QOHA 2EE1A 1CA5A 2R3ZA 3Q22A 5E4WC 5JOBA 4KKTA 2DNEA 3S1QB 3OIQA 1DYQA 1SMYD 2A5HA 5BN3A 3OPOA 5M9OA 1BF4A 3MXNA 3FRPB 3GD7A 1WTRA 2V4DA 5DAUA 5JPNC 2QCPX 4LK1C 3X3MA 3H91A 1DM0B 2LS01 3V2TA 3NTKA 2K5WA 4FXKC 2OEOA 3A54A 2EJFC 5C3WA 2F0VA 3K59A 4FF3A 2WB1B 1G91A 3QB3A 1TWAB 1RF2D 5C4ZA 5CBAE 2PMZB 1J9OA 1WTVA 5DM73 4MIUA 3URYA 5C3XA 4K6DA 4XYOA 1SSOA 3ITPA 2MP1A 4TSSA 5C3EB 1EY7A 1OXXK 3DWAA 3NTHA 2HUGA 5ELFA 5G3LF 2NVQB 3NQTA 1IKLA 2A6HD 1LV9A 1SNDA 2DN8A 1Q3LA 4RGTA 1HTLD 5C44B 2E74C 3FPUB 4X3KA 1PRTF 5EPJA 3A56A 3R2IA 4G4KA 2NN6I 5HURA 3KLRA 3HRZC 5M5XB 1ENAA 1SYBA 2PW7A 2K01A 2A73B 1EYCA 3MAQA 1TWFB 2D62A 2YYZA 1ESFA 2VXWA 3TZDA 1Z6HA 2NN6G 2CW0D 4DFAA 5IT9L 4IFDG 1PFNA 3PUWA 5IGDA 2RVLA 1PMRA 3OMCA 1MSHA 1LACA 4RAUC 5KRUA 5CV8A 1KNEA 1BDOA 1KDCA 1Y8NB 1I4RA 2NYZD 3NSWA 2FHTA 4Y7NB 2PZTA 3G6JB 5T1IA 1WTPA 1SFOB 3S1MB 4EGVA 5C0XH 5DNFA 4ODGA 1XX8A 3HOXB 2WKDA 4E6IA 3I72A 3S2HB 4G7ZC 1TWCB 2WKCA 4Q5VA 2G9HD 3IFDA 3E6ZX 1ZYRD 2B2VA 2BA0A 5IOCA 2R93B 5CV7A 1HRJA 2F0JA 2F0HA 2XRQD 2D5DA 5C4JB 4CKEA 1IKMA 5JAVA 4ABNA 3ONAB 3BDLA 1ZKOA 3LWEA 4PMBA 3OWEB 1JB3A 3KLSA 1LTAD 1A2UA 2CVRA 1F9RA 1SYFA 2K05A 1RJTA 3T16A 4XTCS 1I6VC 1KNAA 4BBSB 4X3TA 2JYOA 4JBWA 3TP8A 5K5PA 4ZAIA 2D2CC 3VYSA 2IT1A 5ELEA 2D9UA 4DAPA 2O5IC 1DOKA 5K36G 1E2WA 5EPKA 5C4XB 2ZXPA 1PFMA 4V190 1AZPA 2XWJB 3SHLA 2OXPA 1WTXA 5CC4A 1STBA 3HGBA 5G3LD 3DEOA 1DCZA 5CBEE 1GUSA 1G2TA 1TIID 3D4WA 1YNJC 2KECA 4K2LA 2I46A 1U4PA 1EZ8A 2B8FA 1PRTD 2E2DC 2M9VA 4K14A 2A74C 1YNND 1F2ZA 2IX1A 3L9AX 1B53A 1C4QA 3T13A 5DM63 4Z9CB 4C3IB 4FF2A 3DEPA 4Q0FA 5CV9A 3NE5B 3OMGA 4HR7B 1LTSD 3K7AB 1BUVT 1FNWA 1G6ZA 3JAML 1BCPC 2F0WA 4WORA 3DXJC 2N55A 3IAYA 5JVG3 3IFTA 3GTJB 3O13A 1TS4A 3RZDB 4A3GB 4RWSC 2SDFA 3M3YB 1D5ZC 5CV4A 1EYAA 1CHQD 2A6EC 3J80E 3TBIB 1WTWA 3BG3A 3PMFA 4QMGA 5C0XJ 1CQVA 5JEAG 1Z7TA 1SE4A 2AUJD 4FXGC 3VR3A 3MXPA 3S1RB 1IL8A 1I4GA 3A8IE 4RFBA 5FLXL 1BQQT 2HCIA 2F0PA 4BA1I 4C3JG 1EFID 1H9RA 3SE0A 3MWYW 1G291 1PTOC 1NR4A 4DNTB 1WD1A 4XIGS 1CK1A 2WACA 5KNDA 1RCVD 4A3JB 1VMPA 1Y8OB 3BZDB 1PTOB 3C1FA 2GA4B 1PXUA 4ILWA 4KK7A 3VYRA 2NTTA 3BVZA 4PNYA 2DY8A 2K28A 4NMZA 1DZ1A 2K03A 4DAYA 1SE2A 3EVQA 2XN9C 2Y0SB 3LWUA 1RODA 3EROA 1I4QA 3D6CA 5IIFA 2RA4A 2Q8RE 1CA6A 1BR9A 5CV6A 1GUNA 1DONA 1EY9A 1S5CD 2B2YC 2BE5C 4X3UA 3MC0B 2KA7A 3NTIA 4UAIA 1X3PA 3OWFA 4IUNA 4KKUA 4JK1C 4XXEA 3KBGA 2F3WA 2K32A 4CBVA 2EYOA 3MFYA 1IYVA 4IUVA 5I6WA 3E5SA 3D4RA 1J8IA 4FF1A 5A2QL 2NVTB 3KK7A 1VF5C 5J39A 1UNSA 2EY2A 3DUZA 3S15B 2R6GA 1QJOA 1CZWA 2F0IA 4QUCA 2RQXA 1R4QB 1ENCA 5KYLA 4M1UB 2ENBA 2JA7B 4C1NK 1EYDA 3KF8A 1BOSA 1EU3A 1W6KA 3KBXA 2B2UC 1A3UA 1VDZA 4B9WA 3G7LA 2VB2X 1I50B 2ZXOA 4A3KB 1STGA 1EY5A 2RKSA 4RKLA 1ZEQX 4C3HG 1KDAA 4NP5A 3OHXC 1PLFA 4CKCA 5FO9B 5LL6X 1OXSC 1S4ZA 2NVXB 3K57A 4F88A 1LT6D 1FD7D 1FNVA 2G9DA 1F9QA 3D6WA 3D31A 1PYWD 1STHA 5F2DA 2M2LA 1QILA 2Z8LA 3SDZA 4C3HB 3FEWX 4HAEA 2F0NA 4KY6A 1F9PA 2RDHA 4RHRA 5LHY1 1SXTA 1TKWB 5I9OA 3CU7A 1O7YA 3ND8A 1VF7A 2EJMA 4HCEA 3I90A 1EY0A 4LAAA 3NXWA 3I91A 2RDGA 5EBCA 4GZYC 2HDMA 3EJIA 1HCZA 1QE6A 2K5DA 2X6GA 2RSNA 4K6LA 2DNCA 1ZXTA 4YIJA 1KDBA 1PZJD 1LABA 2EYJA 1EZ6A 3Q0AA 4HSVA 1CZGA 3H0GB 2J0TD 3CRKC 4L6TB 4KV6A 3BS1A 3NBHA 3PUZA 3J81L 4QCLA 2KEEA 1SBBB 3HOZB 1A15A 3EA6A 3VA5A 4G57A 3K5MA 4K2KA 3QJYA 3MXUA 1QCBD 4NW2A 5CV5A 4A3EB 4ZLTF 1JWUD 4DK1A 1U4MA 4QUFA 2RSOA 3U9SA 2E75C 4PMWA 3RZOB 1Y8PB 1BCPF 1EU4A 5DEHA 4A3FB 3VA7A 1TR5A 2LMCB 1GUGA 1JR0D 2K6AA 4L8JA 2O2LD 2EXZA 4H0LC 2EY6A 4I7ZC 4EQPA 2J4XA 3K5NA 5KGUA 1F2MA 1UAPA 1TY2A 1II3A 2F0MA 3R3OA 5BN5A 2F0TA 3GTGB 5KNCA 3TP5A 1D1KA 2EYHA 4RGNA 3V05A 4HSPA 4IFDI 1OXUA 2L1BA 1XYIA 2Z1CA 2E76C 3I70A 2NUCA 4B9XA 2EYPA 2KHSA 3L3OC 5HGTA 3WOFA 3BDCA 4ULLA 1FYCA 3HS0C 3D8GA 3M4OB 4HEDA 5EKLA 3R8BA 3TP7A 1AEXA 2K7VA 2CHBD 1LTRD 1PZKD 2OT2A 1PTOF 3AB9A 1EY8A 3FDTA 2EY5A 5C5LA 2X6LA 2JA5B 4C2MB 2KCCA 4K8JA 3VR4A 2C5CA 3GV6A 2F0OA 1MBYA 1LT4D 2SNMA 3P1HA 1E0BA 2IJ0A 1OXTA 2J7ZA 1HPCA 4ZUIA 1TQOA 1NUCA 4PQXA 1KLGD 1ILQA 3K6OA 2L4NA 4MN3A 4NKLA 1EIGA 5I2XA 3ZYYX 2B2WC 1DJRD 4XDXA 2EYFA 3SXHA 1SEBD 4KD4A 2NTSA 3WOEA 1JOOA 4U68A 1C48A 2HQEA 1HA5A 1YNJD 4OIJA 1FR3A 3MVVA 1EY6A 2QF7A 4H13C 3S2DB 3VYTA 3PUXA 3MHBA 2F03A 5FK9C 1GJXA 4KN4C 1TS5A 1U9RA 4RCOA 1TS3A 4TQUS 1A2TA 1WTQA 2R61A 3A8JE 3OW7A 2O5JC 5D3DA 4OO1H 3C1EA 2PW5A 3K5OA 4CJ2C 2LFNA 3QOLA 4OHJA 2ZT9C 3C2PA 3RUZA 1SYDA 1IW7C 4CKBA 2ID0A 1RTNA 1OO9B 3I73A 4M8AA 4RHSA 3K58A 3NBIA 2A6ED 3C46A 1GXDC 1FNUA 3FVQA 3RD4A 2F0FA 2ICEC 2PNRC 4CGYB 1GHKA 4IUTA 4X3SA 4NDXA 3IL8A 3J81E 2QDBA 5KIXA 2FMCA 1NSNS 4ZKCB 1GUTA 4DN4M 1F2LA 3MTSA 4H44C 1X3QA 2XWBB 2A69C 2L9HA 3KUPA 1LTID 3IKJA 4KJOA 1CFMA 2K5QA 3M7NA 2WAQB 3P20A 1B44D 3GTOB 2E2JB 1WCMB 4IALA 1U4LA 2EZVA 1PTOD 4QB4A 1Q12A 3Q23A 1BCPB 4R8IA 3QIAA 4FYDA 4RCNA 4BY7B 2BCOA 3P75A 1UEAB 1CI3M 2R92B 5EGTA 2YU9B 2WINB 3MXGA 2JA8B 1JE4A 4F7XA 2WIIB 5C4HA 2SOBA 5D65A 2XNAC 4HMIA 4FNFA 3A7AB 5JJZA 3VR2A 1K8MA 5IT9E 2TSSA 5ISRA 1LT3D 3M4YA 3GTQB 2KJXA 3TSSA 2E2HB 5JVH3 1NCVA 2BE5D 2SEBD 5EJWA 4FO2A 1IYUA 5IGFA 3TZUA 4KJNA 1T5EA 1HTPA 5KYIA 2E2IB 4O42A 2L5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOK A;  4J1M A;  2QDB A;  4N9T A;  5KIX A;  1NSN S;  3ERO A;  3T16 A;  5HUR A;  4RKB A;  5DEH A;  5IGG A;  3HZX A;  1SYE A;  4NKL A;  1JOQ A;  1TR5 A;  2F3V A;  1ENA A;  3D6C A;  3NK9 A;  1SYB A;  4ZUJ A;  1KAA A;  3D4D A;  2PW7 A;  5IIF A;  1A3V A;  3NP8 A;  1EYC A;  5KEE A;  2EXZ A;  2EYF A;  1RKN A;  2EY6 A;  4KY5 A;  4EQP A;  3SXH A;  1STA A;  1STY A;  2F0Q A;  4KD4 A;  3TP8 A;  5K5P A;  1A3T A;  1JOO A;  4WRD A;  5KGU A;  5CV6 A;  5CV4 A;  1F2M A;  4KHV A;  4ZQ3 A;  1II3 A;  1EY9 A;  2KQ3 A;  1EYA A;  2F0M A;  4K5V A;  3QOJ A;  2F0U A;  2F0L A;  4KJO A;  5J1Z A;  3NHH A;  1STH A;  5IGE A;  1IHZ A;  3R3O A;  2HQE A;  4DFA A;  5JOB A;  3SK8 A;  2F0T A;  5F2D A;  4TRD A;  2EY1 A;  2F0E A;  4DGZ A;  4IAL A;  2M00 A;  5I9P A;  3MVV A;  4ME5 A;  5IGD A;  5C6A A;  4R8N A;  1EY6 A;  3OWF A;  4QB4 A;  3TP5 A;  4IUN A;  5EKK A;  2F0N A;  2F0S A;  3OMC A;  2EYH A;  2RBM A;  1TT2 A;  4KY6 A;  5C5M A;  5M9O A;  3ERQ A;  3PMF A;  4J6H A;  5KRU A;  5CV8 A;  4EQN A;  1SYC A;  2PZU A;  4QMG A;  5DAU A;  3MHB A;  1KDC A;  5I9O A;  2F3W A;  2EYO A;  2OF1 A;  5E1F A;  3SHL A;  3U9O A;  4DF7 A;  3E5S A;  5I6W A;  2OXP A;  4K5X A;  4ID6 A;  1EQV A;  2NUC A;  1EY0 A;  4B9X A;  1U9R A;  4HTH A;  5CC4 A;  5IOD A;  3P75 A;  1STB A;  4LAA A;  3V2T A;  2PZT A;  3NXW A;  3MXP A;  2EYP A;  4IZ8 A;  3S9W A;  1A2T A;  1SNC A;  3OSO A;  2KHS A;  5J39 A;  5E3F A;  3TME A;  4EVO A;  5HGT A;  5EGT A;  2EY2 A;  2OEO A;  3SK4 A;  3EJI A;  4I65 A;  3BDC A;  3D4W A;  4DU9 A;  3SK6 A;  3TP6 A;  1F2Y A;  4ODG A;  5C3W A;  3D8G A;  2F0V A;  2F0I A;  2F0P A;  3C1E A;  2PW5 A;  3DHQ A;  4K2L A;  5I6Y A;  2LKV A;  1SNQ A;  4E6I A;  3QB3 A;  3SR1 A;  5EKL A;  1STN A;  4H7B A;  5CR3 A;  3TP7 A;  1AEX A;  4F7X A;  1EZ8 A;  5IGC A;  4K8I A;  5C4H A;  1ENC A;  4KD3 A;  1KDB A;  4YIJ A;  5C4Z A;  5KYL A;  1JOR A;  2SOB A;  2ENB A;  2WAC A;  1EY8 A;  4K14 A;  3SK5 A;  2EYJ A;  1EZ6 A;  2PYK A;  5IGB A;  2PZW A;  4HMI A;  4MIU A;  1EYD A;  2EY5 A;  4K6D A;  3QOL A;  5C3X A;  5IOC A;  3HEJ A;  1F2Z A;  3H6M A;  4OL7 A;  1SYD A;  3NUC A;  5CV7 A;  3LX0 A;  5C5L A;  2F0D A;  5NUC A;  3RUZ A;  2EYL A;  3ITP A;  2F0J A;  3C1F A;  4K5W A;  2F0H A;  3MZ5 A;  4KV6 A;  2O4X A;  2EYM A;  3T13 A;  1SYG A;  5ISR A;  2F0K A;  1SNM A;  3DMU A;  1SNP A;  1A3U A;  4PMC A;  1EY7 A;  4K8J A;  4S3S A;  4QF4 A;  4F8M A;  2SNS A;  3VA5 A;  4G57 A;  4B9W A;  5JAV A;  4HMJ A;  1KAB A;  5CV9 A;  4K2K A;  4PNY A;  2F0O A;  3BDL A;  4NMZ A;  4KY7 A;  3OMG A;  5CV5 A;  4EQO A;  3NQT A;  5CGK A;  1EY4 A;  2SNM A;  3MEH A;  2RDF A;  1STG A;  1EY5 A;  4PMB A;  2RKS A;  1SND A;  3P1H A;  4RKL A;  2F0F A;  5IGF A;  1SNO A;  4KJN A;  5J22 A;  4N9P A;  3EVQ A;  1A2U A;  4ZUI A;  5KYI A;  4NDX A;  1TQO A;  1NUC A;  2F0W A;  1SYF A;  4KTA A;  4WOR A;  1KDA A;  2F0G A;  4NP5 A;  2PQE A; 
#chains in the Genus database with same CATH topology
 5GRO A;  1IBM L;  3S16 B;  3BJU A;  4DV1 Q;  3HOX H;  4DV3 L;  3S2H H;  4DXG A;  1TWC H;  1JB7 A;  1EWC A;  4C3J B;  3GTL B;  2DGY A;  2DY7 A;  2L0C A;  1ILP A;  4DV5 Q;  3KLW A;  4MHE A;  3TS2 A;  4CJ1 B;  2R93 H;  3SK8 A;  4DR3 Q;  1VQK A;  2XIW A;  1V1P B;  3TEH B;  5I9P A;  3S1N B;  5C4J H;  1C7Y A;  3H3V I;  5M3M B;  2K33 A;  1Z47 A;  2RBM A;  5C5M A;  1Q1B A;  3ERQ A;  1YVC A;  1TY0 A;  3FHW A;  1C0A A;  4PV1 C;  4YY3 L;  3J7Z C;  1Y1V G;  1NBW A;  1EWH A;  3UE0 A;  4DF7 A;  1EFW A;  2NWG A;  1E2V A;  1UWV A;  4HTH A;  3PIP 3;  3E9H A;  1HZC A;  1QNK A;  2NZ1 D;  3DWP A;  3OSO A;  4OGQ C;  3WDN A;  1WD0 A;  1LTB D;  4DR1 L;  1HQM C;  2CQO A;  5M3F G;  2UUA Q;  2UXC Q;  1UUP A;  4POG A;  5C0X I;  5LMN W;  3S2D H;  4AQY Q;  2A68 C;  4UPA A;  3G6E A;  2JQO A;  3H3V C;  4K8I A;  1N36 Q;  4OEM B;  2VUM G;  1G2S A;  1BO0 A;  3RLF A;  2OQK A;  1HHV A;  2BDN A;  4DPG A;  1D5M C;  3I7F A;  3K0Y A;  3LX0 A;  5C0X G;  4MNO A;  5IE8 A;  2PO4 A;  2FIN B;  1CT1 D;  1GHJ A;  2JXM B;  2AWN A;  2VL6 A;  2H4O A;  2Z9H A;  4PG3 A;  4F8M A;  3A55 A;  5BN4 A;  1H9S B;  3K5L A;  1KLU D;  4FVM A;  1HR0 W;  5ELC A;  1J5E L;  3HP3 A;  4RA8 A;  4KHZ A;  1H9J A;  1LYL A;  3CC4 A;  3MXN B;  3NWT A;  4IUR A;  1SJE D;  3BVM A;  4HCS A;  2B29 A;  3CCL A;  3GO5 A;  4CHT B;  1M90 C;  4A76 A;  4LFB L;  1M8A A;  4LF6 L;  1SYE A;  2K04 A;  2JN4 A;  2F3V A;  3PSI A;  4ZUJ A;  4BBR G;  4UP7 A;  2MJ8 A;  1JWM D;  1M4V A;  3I4N G;  4DR4 Q;  5K36 H;  1Y1W G;  3NP8 A;  2VY3 A;  4G7O C;  5KEE A;  1QG7 A;  4ZK9 B;  1I4X A;  2F0Q A;  3QWN A;  5E7N A;  2Q8I B;  4BY1 G;  3X3N A;  3R2T A;  4K5V A;  1L2F A;  2F0U A;  1VQE A;  1CKN B;  3RNU A;  4B3M L;  2MO1 A;  1SJH D;  3F2U A;  1UE1 A;  3HOW G;  2PPB C;  3EN2 A;  1AP0 A;  3RR5 A;  3ND9 A;  5C6A A;  4C3I H;  2R7Z B;  2NBF A;  1Q8I A;  4DAM A;  1IBM Q;  2BH2 A;  1U5K A;  3VYU A;  1Y1W B;  1NR2 A;  5FKA C;  4DV3 Q;  5TSS A;  1QVG A;  4HJ8 A;  1X56 A;  3K7A H;  4JI1 L;  3MA2 B;  2YTV A;  3GTO H;  4IPH A;  2CWP A;  1WCM H;  1UE6 A;  3JAM E;  3HOW B;  1SN8 A;  1ASZ A;  1HFN A;  2WV6 D;  1NAP A;  3GTP B;  4WJ3 M;  2LKV A;  3GTJ H;  3R93 A;  2K1B A;  2ALY B;  1E2Z A;  3RZD H;  2B63 B;  1EEF D;  4HJA A;  1JOR A;  4UDU C;  5EPL A;  3M3Y H;  4FDB A;  4DV0 L;  3CPW A;  2B2Y A;  2LY7 A;  4YY3 Q;  4XT1 B;  3FMC A;  2AWO A;  4OL7 A;  3BVG A;  4DV4 L;  2N78 A;  1RDP D;  5D3I B;  1IL2 A;  2HD3 A;  4QQB X;  3MZ5 A;  5FO7 B;  2EYM A;  4AYB E;  4DXF A;  1EIH A;  5M5Y B;  4R9W A;  3T56 B;  1XXG A;  2BH8 A;  4DR1 Q;  2B8G A;  5AJ3 L;  3VR5 A;  4EQO A;  3J80 c;  3Q24 A;  1VQO A;  2MHV A;  2NVY B;  5ELB A;  3HOY B;  5LL6 S;  1H9S A;  3Q6S A;  2C35 B;  3S1R H;  4C56 C;  5CYU A;  2RF4 A;  3TME A;  2F0G A;  1MKH A;  1Q90 A;  2PQE A;  4H02 A;  3GP7 A;  2WB1 G;  1KQS A;  1SMX A;  3HZX A;  5T1G A;  5FLX E;  3MEF A;  2MO0 A;  2D0O A;  1N34 L;  1S5B D;  3GQB A;  2B2V C;  4RGO S;  1I4P A;  5JEA H;  4GNX C;  4A3J H;  1PYB A;  1J5E Q;  5C3E G;  2ICI A;  3CHB D;  2ZJR A;  3NEL A;  2L55 A;  1PTO H;  1DOL A;  2M00 A;  2B2U A;  4LWC A;  4QL5 A;  4A3M B;  2K5H A;  3K8A A;  4GNX B;  1CM9 A;  3BU2 A;  3A7L A;  4JBK A;  1V8Q A;  2VQF L;  1U0L A;  1SRO A;  2QEJ C;  4MZ9 A;  4LF5 L;  4LFB Q;  4LF6 Q;  4Y52 H;  1XWE A;  1MJC A;  5DLQ E;  2MUY A;  5C44 G;  4QIW E;  4C1N I;  4ID6 A;  3SVM A;  3PO2 G;  3KLS X;  4ZKB B;  1SNC A;  1X65 A;  2DJF C;  4MTN A;  4RMF A;  4EVO A;  1VQH A;  1R9T B;  4B3M Q;  5M3M H;  2EPB A;  1H9M A;  3DHQ A;  4QJF A;  3ULJ A;  1SE3 A;  2EVB A;  3EFX D;  3ULL A;  1SNQ A;  5I6Y A;  1JJG A;  1JCK B;  2Z4H A;  1SMY C;  3W2D A;  4DK0 A;  2XVS A;  5JPM C;  3EQL C;  2VNU D;  4J8Q A;  3H94 A;  3J80 L;  1YBY A;  1HXY D;  3HEJ A;  3NUC A;  4JI1 Q;  4JYA L;  3PO2 B;  5COR A;  5IP9 H;  2FFK B;  2UU9 L;  2JA9 A;  1EL0 A;  5KNB A;  4IUU A;  2C9O A;  5GAG C;  4KY7 A;  3T4A C;  3M7G A;  4XQN A;  3P7J A;  2B3G A;  5CMD A;  3CXC A;  4KN7 C;  3BDO A;  1W2B A;  5J3B A;  1SNO A;  4N9P A;  5A2Q E;  1PH3 A;  1D5X C;  1JIC A;  1GOZ A;  3A5Z B;  4DV0 Q;  3NQI A;  1B9N A;  3W1B A;  3HOX G;  3TN2 A;  1VQ9 A;  3EIV A;  1Z9F A;  1SDF A;  1J6Q A;  2CH4 W;  3LGJ A;  1GM5 A;  3N52 A;  4LJZ C;  5I2Y A;  1A3T A;  5AJ3 Q;  2QGQ A;  4KHV A;  4ZQ3 A;  2JA7 H;  5J1Z A;  3J7Y W;  3NHH A;  3DM1 A;  1QZG A;  4TRD A;  1Y69 U;  2A6H C;  4IPD A;  2KED A;  4ME5 A;  1CHP D;  1TT2 A;  5I4D A;  1RHP A;  4JVZ A;  2BA1 A;  1IW7 D;  5IWA L;  1I50 H;  3QO2 A;  1N34 Q;  2OF1 A;  4A3C H;  4A3K H;  3HOU B;  2X69 A;  1SR3 A;  2B2T C;  1I3Q B;  1X32 A;  1WVL A;  4A3L H;  1D2B A;  4GKJ L;  1NMG A;  1I94 L;  3FPP A;  1XTC D;  4PZ8 A;  4I65 A;  1PHJ A;  4WJW A;  1S5D D;  3VDY A;  3SK6 A;  3VR6 A;  2CW0 C;  4L5S A;  1YHQ A;  3I3C A;  4BBS G;  4L63 B;  1VCI A;  4H7B A;  1HFG A;  3T53 B;  4BS9 A;  3TDQ A;  1C8C A;  4LF5 Q;  3SK5 A;  1PH1 A;  1RTO A;  1PDQ A;  5IGB A;  1KAW A;  2HIV A;  2ZJQ A;  1H9K A;  2PQA B;  5NUC A;  1TWG B;  2IPK D;  2V1C C;  4JI4 L;  2O4X A;  1SYG A;  5FOB B;  2F0K A;  1E1T A;  4C3H H;  5C4X G;  1LLR D;  3PO3 B;  2A69 D;  3LNN A;  1HA6 A;  2CH4 A;  1VQN A;  1LUZ A;  1EOT A;  2GVB A;  2B63 H;  1ML0 D;  1F77 A;  2IL8 A;  1R4P B;  3AU7 A;  4FP5 D;  5CGK A;  2RDF A;  3T51 B;  1BCP D;  1MD2 D;  1O78 A;  4HN7 A;  4R4O A;  1EQT A;  3D3R A;  3OOC A;  2KOL A;  1WFQ A;  3E9I A;  4EQ5 A;  5ELO A;  4X65 L;  1KRS A;  1ZYR C;  4IUQ A;  1WTO A;  5JEA J;  2I5L X;  1OXV A;  1JOK A;  4N9T A;  2A19 A;  2H1E A;  2MPM A;  2GN5 A;  1KTK A;  3CQZ B;  3STB D;  1V1O A;  1YI2 A;  4P74 A;  3PIO A;  4TVA B;  2UUC L;  1TVX A;  2UU9 Q;  3EBE A;  1AN8 A;  4YWM A;  1XMQ L;  3RMH A;  1QWY A;  4ZRZ A;  2Q8T A;  3UDG A;  2CQA A;  3J7A F;  2NVY H;  2E5L L;  1PH8 A;  3HOY H;  5IGE A;  1IHZ A;  3PIP A;  1AW7 A;  4DA2 A;  3H0G H;  5D14 A;  5FLM H;  2EY1 A;  4C3I G;  3M85 A;  4DGZ A;  1CSQ A;  1KHI A;  2L12 A;  2F4I A;  2ZXR A;  2UXD L;  3HOZ H;  1HNZ L;  1NTG A;  4A93 B;  1NJI C;  4JBM A;  1MI2 A;  1O7L A;  4K0K L;  2N3S A;  5EKI A;  4JG2 A;  4CDE C;  1U4R A;  1VQM A;  2AUK A;  4A3E H;  4RH6 A;  2MNA A;  4BA2 I;  3U9O A;  2EJG C;  2Z6K C;  3BYY B;  4XT3 B;  5GAD C;  3PUY A;  1EQV A;  1ET6 A;  5IOD A;  2KUM A;  1JC7 A;  3S9W A;  3C3L A;  1ENF A;  4U67 3;  2BOS A;  1X6O A;  4DAY B;  3NWS A;  3RZO H;  5A35 A;  3HG9 A;  4A3M H;  2KCN A;  3KDF B;  5FJ8 H;  2QDL A;  4DU9 A;  1I4H A;  1PH6 A;  4A3F H;  2CKZ B;  5M5W B;  4P73 A;  4A3G G;  4AYB B;  3QG1 A;  2B2W A;  3SR1 A;  3L0O A;  1O7Z A;  1S5F D;  4KD3 A;  3I55 A;  2EDG A;  4A3I B;  5IYD H;  1G8Z D;  1N32 L;  3N6R A;  2ASB A;  1TWH B;  4LF7 L;  3SGI A;  2B2T A;  5IWA Q;  2AQ1 B;  4CJ0 B;  2N88 A;  1DOM A;  4K5W A;  3GTG H;  2WB1 E;  1TU2 B;  4YWK A;  1YNX A;  1VQA A;  4GKJ Q;  1I94 Q;  2I0Q A;  3A8K E;  3I8Z A;  4S3S A;  3FKI B;  1GUO A;  2PMZ E;  2SNS A;  2HDL A;  1KAB A;  4HMJ A;  4LUZ A;  2JSO A;  1RD9 D;  3MEH A;  4R4I A;  4L5Q A;  3F2D A;  5JJL A;  1RL2 A;  3CKI B;  5J22 A;  1B2T A;  1PRT C;  4V0B A;  1DD2 A;  4TKO B;  4O2D A;  1JWS D;  1EEI D;  2VB3 X;  1LTG D;  1QUQ A;  4A3B B;  5LMU L;  2OTL A;  3U4Z A;  5IGG A;  3UI2 A;  1YNN C;  1XPU A;  3H09 A;  1ET9 A;  4JI4 Q;  3NK9 A;  1HZA A;  2HCC A;  1PRT B;  1QNU A;  3M4O H;  4KI0 A;  3S14 B;  1CSP A;  3BYT B;  3I4M G;  4A3J G;  4KY5 A;  1STY A;  2XRS D;  2IWH A;  4ZYS A;  1BBX C;  3HOV B;  3QOJ A;  2F0L A;  3NPP A;  1RIP A;  1LO5 D;  1HUM A;  2NN6 H;  1QB5 D;  4QIW B;  3AMU A;  2F0E A;  2B39 A;  2A68 D;  1D8L A;  1HJP A;  1B1Z A;  1Q46 A;  2JA5 H;  4X65 Q;  3KF8 B;  4IFD H;  4C2M H;  3HKZ G;  2QKI C;  4LF4 L;  4O1N A;  4J6H A;  1PFB A;  2PZU A;  4HIO A;  4A4I A;  1B4O A;  4KMU C;  1GUW A;  4LF9 L;  4XQQ A;  3S24 A;  1XNR L;  2AQ3 B;  4JI7 L;  4OX9 Q;  3I4M B;  2WP8 J;  1LT5 D;  4A3D B;  3PV0 A;  1JQY D;  2Y0S G;  2AKW B;  1XMQ Q;  2JA6 G;  3PF4 A;  5FO8 B;  1V43 A;  4R4C A;  2JP1 A;  5E4X A;  2E5L Q;  2NZO A;  4JI5 L;  3SK4 A;  3K0X A;  1F2Y A;  2TMP A;  1CTM A;  4AH6 A;  1CQF A;  2MGS A;  2UXB L;  3PIO 3;  1BXT A;  2UXD Q;  3HKZ B;  3KOJ A;  4DUY L;  4IQZ A;  4K0K Q;  3HOU H;  3KDF A;  2Z6K A;  1I6H B;  1MGS A;  2PYK A;  1VQF A;  1I3Q H;  2PZW A;  4BXX H;  2JA6 B;  2F0D A;  3F2C A;  1O80 A;  2EYL A;  2JEA I;  1AFP A;  1EQQ A;  4P2C B;  2K50 A;  4F87 A;  4RGM A;  3DMU A;  1D1I A;  4PMC A;  4DNR B;  1KC8 C;  3E0J A;  4QF4 A;  1F9S A;  4QGU A;  4KKS A;  5LMN L;  3U4V A;  2I07 B;  1E7Z A;  1TS2 A;  1EY4 A;  3GTM B;  3J80 i;  1YJW A;  1L0X B;  5EQ0 A;  2EIF A;  1Y1V B;  4XQJ A;  4JOI C;  4UY8 C;  2IX0 A;  4HJ7 A;  2L11 A;  3OIP A;  5ELD A;  4IUP A;  1N32 Q;  1B50 A;  4G7H C;  4LF7 Q;  2E8G A;  2K5N A;  4KTA A;  1FGB D;  4LFC L;  1UE5 A;  3GTK B;  4XYQ A;  1MSG A;  3PO3 H;  4GOP A;  3W3A A;  3D4D A;  1A3V A;  5M3F B;  1Q1E A;  2ATW A;  1S5E D;  2ZJP A;  2JA7 G;  2JE6 I;  4JBJ A;  4OWX B;  1HR0 L;  1HH2 P;  4WRD A;  1DGS A;  2Z4I A;  2KQ3 A;  1G51 A;  2BDO A;  4DAV A;  1ICW A;  2VUM B;  1SAP A;  1B3A A;  1VQC A;  1STE A;  4GLV B;  4R8N A;  1HQR D;  1S72 A;  5EKK A;  2F0S A;  3CQZ H;  3DWQ A;  3MFG A;  3CRL C;  4OIK A;  3J7A V;  4A3C G;  3OYY A;  4A3K G;  3Q8D A;  3D0F A;  4EQN A;  1SYC A;  3RN5 A;  2PCF B;  1K8O A;  3V96 A;  2Z0S A;  5E1F A;  1AZQ A;  2IHE A;  4WFN 3;  1ONL A;  4K5X A;  4FXD A;  1E3P A;  1S40 A;  4FF4 A;  3CW2 C;  3ZJY C;  3GDE A;  2XSC A;  4IZ8 A;  3L7Z C;  2NZH A;  2AQ2 B;  5E3F A;  3GV3 A;  1DXM A;  2IHF A;  4IO9 A;  3NEM A;  1KL9 A;  2A8V A;  4A93 H;  3TP6 A;  4LF8 L;  3I2Z A;  1L0Y B;  4OXP A;  2I5H A;  1STN A;  5CR3 A;  4OO1 I;  5IGC A;  2IX3 A;  4BBR B;  2K4K A;  3I4N B;  3S17 B;  4LF4 Q;  2F1M A;  1V1P A;  4IN3 A;  1Q86 C;  3U50 C;  2VZA A;  3J81 c;  1W6J A;  4LF9 Q;  2MFI A;  3H6M A;  2EOT A;  2FMM A;  4BY1 B;  1XNR Q;  4JI7 Q;  2E2J H;  5GAH C;  4OO1 G;  4LMQ D;  1SNM A;  1SNP A;  1X3G A;  3CCR A;  1VMC A;  3SEB A;  1K3R A;  5M5W H;  1B9M A;  1EQR A;  1K83 B;  4JI5 Q;  1PZI D;  3PF5 A;  2IW3 A;  2CFM A;  1BNZ A;  1T5X D;  2UXB Q;  4WJ4 A;  4DUY Q;  3PUV A;  1Q8K A;  2KVM A;  3I4L A;  1D6E C;  4BY7 H;  2F52 A;  4GKK L;  2NB0 A;  5COY A;  1YIJ A;  2R92 H;  1ESR A;  1A6X A;  2QIL A;  4J1M A;  2YU9 H;  2JEB I;  5EBD A;  4RKB A;  2XTI A;  3FKI H;  1JOQ A;  4B08 A;  2Z6B A;  2IY5 B;  1KAA A;  2JA8 H;  1LTT D;  1AE3 A;  1LTL A;  1RKN A;  1STA A;  5AFW A;  4BWG B;  1HUN A;  4IFD J;  2FJ2 A;  2YTY A;  1QOH A;  4P72 A;  5FLM G;  2HT1 A;  2EE1 A;  1CA5 A;  2R3Z A;  3Q22 A;  2OTJ A;  3KJP A;  4IJH A;  5E4W C;  5JOB A;  3HOZ G;  4KKT A;  2DNE A;  4A3B H;  4P71 A;  3S1Q B;  3OIQ A;  1DYQ A;  3GTQ H;  1SMY D;  4GN4 B;  2A5H A;  1VQI A;  5BN3 A;  3OPO A;  5M9O A;  3J81 j;  3MXN A;  1BF4 A;  2E2H H;  4A3E G;  4LFC Q;  3FRP B;  3GD7 A;  1WTR A;  2V4D A;  5DAU A;  5JPN C;  2QCP X;  5GAE C;  1K8A C;  1X54 A;  4LK1 C;  3X3M A;  3HOV H;  5IT9 c;  2QA4 A;  1NE3 A;  2D0P A;  3H91 A;  1DM0 B;  2LS0 1;  3V2T A;  1HZ9 A;  1HR0 Q;  5FJ8 G;  3NTK A;  2E2I H;  4A3F G;  2K5W A;  4FXK C;  3A5U A;  2A1A A;  2OEO A;  3A54 A;  1AE2 A;  2EJF C;  1JT8 A;  5C3W A;  2F0V A;  3K59 A;  3S16 H;  4FF3 A;  2WB1 B;  1G91 A;  3QB3 A;  1CKN A;  1TWA B;  1RF2 D;  5C4Z A;  5CBA E;  2PMZ B;  4C3J H;  3GTL H;  4DKA C;  1J9O A;  1PH7 A;  1V9P A;  4IPG A;  1WTV A;  5DM7 3;  4MIU A;  3URY A;  5C3X A;  4K6D A;  5H1S E;  3CCS A;  4XYO A;  1SSO A;  5IYC H;  3PCO B;  3ITP A;  2MP1 A;  4TSS A;  3KF6 B;  5C3E B;  1WOC A;  3S1N H;  1EY7 A;  3A74 A;  4JI2 L;  1OXX K;  3DWA A;  3NTH A;  2HUG A;  5ELF A;  2YV5 A;  4LF8 Q;  5G3L F;  2NVQ B;  3CCM A;  1WJJ A;  3NQT A;  1IKL A;  2A6H D;  1LV9 A;  1SND A;  2DN8 A;  1Q3L A;  4RGT A;  1HTL D;  5C44 B;  2E74 C;  4UP8 A;  2R7D A;  3FPU B;  4X3K A;  1PRT F;  5EPJ A;  4R4T A;  3A56 A;  3R2I A;  4G4K A;  2NN6 I;  2EXD A;  4RG1 A;  5HUR A;  3HKZ E;  3KLR A;  3HRZ C;  5M5X B;  1ENA A;  1SYB A;  1PH5 A;  2PW7 A;  2K01 A;  2A73 B;  1EYC A;  1V1Q A;  1HNW L;  4ALP A;  3MAQ A;  1K9M C;  1TWF B;  2K75 A;  2D62 A;  3ER0 A;  1S3O A;  1ESF A;  2VXW A;  2YYZ A;  3TZD A;  1SE8 A;  2Y0S E;  4HJ9 A;  1Z6H A;  2NN6 G;  2CW0 D;  4DFA A;  2JA5 G;  5IT9 L;  3H3V H;  3U58 A;  4IFD G;  1A0I A;  1PFN A;  3PUW A;  1FL0 A;  4DR6 L;  5IGD A;  2RVL A;  4GKK Q;  1PMR A;  3OMC A;  1MSH A;  4DV4 Q;  2PI2 E;  1LAC A;  4RAU C;  5M3F H;  5KRU A;  3CAM A;  5CV8 A;  1B3Q A;  1E1O A;  1KNE A;  1BDO A;  3UE1 A;  1KDC A;  2RCF A;  1Y8N B;  1I4R A;  3F8T A;  2NYZ D;  3NSW A;  2R93 G;  1H95 A;  2FHT A;  4Y7N B;  4JC0 A;  5L37 A;  2PZT A;  3G6J B;  4J15 A;  5T1I A;  1WTP A;  1SFO B;  3S1M B;  4EGV A;  5C0X H;  3K80 C;  5DNF A;  2K5V A;  4ODG A;  1XX8 A;  4CDD C;  3HOX B;  2WKD A;  4E6I A;  3I72 A;  4HIK A;  3S2H B;  4G7Z C;  1TWC B;  2WKC A;  1L0W A;  4Q5V A;  2G9H D;  3IFD A;  1MJE A;  3E6Z X;  3KJO A;  3ICE A;  1EOV A;  1ZYR D;  2B2V A;  1EUJ A;  1X3F A;  2BA0 A;  2LXK A;  4GNX A;  3G4S A;  5IOC A;  2R93 B;  1IBL L;  5CV7 A;  1HRJ A;  5EAY A;  2F0J A;  2F0H A;  3CCQ A;  2XRQ D;  2D5D A;  5C4J B;  2QEX A;  4CKE A;  4DK6 C;  1QZH A;  2R7Z H;  3AYH B;  1IKM A;  5JAV A;  1W3S A;  4ABN A;  3ONA B;  2WFW A;  3BDL A;  2F3I A;  1Y1W H;  1ZKO A;  3LWE A;  4PMB A;  3OWE B;  2VQF Q;  4MTK A;  1K0R A;  1JB3 A;  3KLS A;  1LTA D;  4BY1 H;  1A2U A;  2CVR A;  2ES2 A;  1F9R A;  4JW0 A;  2OQ0 A;  1SYF A;  2K05 A;  3ULP A;  3HOW H;  1RJT A;  3T16 A;  4XTC S;  1I6V C;  3RLO A;  3GTP H;  1CKO A;  1KNA A;  4BBS B;  4X3T A;  2JYO A;  4JBW A;  4JI2 Q;  4L5T A;  3W1G A;  3TP8 A;  1E22 A;  5K5P A;  4ZAI A;  2D2C C;  1QVC A;  3JAM c;  3VYS A;  2IT1 A;  5ELE A;  2JJQ A;  4JV5 L;  2D9U A;  3PGZ A;  4DAP A;  2O5I C;  1DOK A;  1OTC A;  5M5Y H;  5K36 G;  1E2W A;  5EPK A;  2CCZ A;  4JYA Q;  5C4X B;  2ZXP A;  1PFM A;  1BVS A;  2ZTD A;  3T1Y L;  3IRB A;  3J7A 5;  4V19 0;  1AZP A;  2XWJ B;  3SHL A;  2OWO A;  2AMC B;  1PVO A;  2OXP A;  3KYH C;  1WTX A;  1HNW Q;  1HZB A;  5CC4 A;  1STB A;  3HGB A;  3S1Q H;  5G3L D;  1L1O C;  3DEO A;  1DCZ A;  5CBE E;  1GUS A;  1D7Q A;  1G2T A;  1TII D;  3D4W A;  3CME A;  1YZ6 A;  1YNJ C;  2KEC A;  4K2L A;  3CF5 A;  1BKB A;  4DR6 Q;  2I46 A;  1U4P A;  1EZ8 A;  1L1O B;  2B8F A;  1PRT D;  4I7A A;  2AHO B;  3TQY A;  2E2D C;  2M9V A;  2WAQ G;  2R7F A;  4K14 A;  2A74 C;  1WCM G;  4ZCK A;  1YNN D;  1F2Z A;  4GN3 B;  4X6A H;  2IX1 A;  2DUD A;  3L9A X;  5FLX c;  1MHW C;  1B53 A;  1C4Q A;  4JI6 L;  3T13 A;  5DM6 3;  2G5D A;  4DUZ L;  4QY7 A;  4Z9C B;  4C3I B;  4FF2 A;  4OEL B;  1PYS B;  3DEP A;  4Q0F A;  5BR8 L;  4GLX A;  5CV9 A;  3NE5 B;  4DR7 L;  3OMG A;  1VQP A;  4BY7 G;  4HR7 B;  1LTS D;  3K7A B;  2R92 G;  2KEN A;  3UDI A;  1BUV T;  1FNW A;  1G6Z A;  4EX5 A;  3JAM L;  1BCP C;  2F0W A;  4WOR A;  1R9T H;  3DXJ C;  1IBL Q;  2JA8 G;  2N55 A;  3IAY A;  1N36 L;  2UUB L;  5JVG 3;  3DM3 A;  1Y14 B;  2Q2T A;  3IFT A;  4R4Q A;  3TS0 A;  3GTJ B;  2NVQ H;  3O13 A;  1TS4 A;  3RZD B;  2PQA A;  2RHS B;  3CPF A;  4A3G B;  4RWS C;  2SDF A;  1O7I A;  4LW1 A;  3M3Y B;  4IPC A;  1D5Z C;  5CV4 A;  1GD7 A;  1MIU A;  1EYA A;  1CHQ D;  3UDX A;  2A6E C;  4X64 L;  3J80 E;  1XNQ L;  4PZ7 A;  3PO2 H;  1IXR A;  3TBI B;  1WTW A;  1XMO L;  3BG3 A;  3PMF A;  4QMG A;  5C0X J;  1CQV A;  5JEA G;  1TWF H;  1Z7T A;  4NPS A;  5IP7 H;  1EIY B;  1SE4 A;  2AUJ D;  4FXG C;  1P16 A;  3WWV A;  3VR3 A;  3MXP A;  3S1R B;  3CCU A;  1IL8 A;  1I4G A;  3A8I E;  1VQ8 A;  4RFB A;  5FLX L;  2P5Z X;  1BQQ T;  4LFA L;  4JV5 Q;  2HCI A;  2F0P A;  3PQI A;  4BA1 I;  4X62 L;  4C3J G;  1EFI D;  1H9R A;  1IZ6 A;  2KCT A;  3SE0 A;  4DV6 L;  3MWY W;  1G29 1;  1PTO C;  1NR4 A;  4DNT B;  1WD1 A;  4XIG S;  4LNQ A;  1CK1 A;  2WAC A;  3T1H L;  5KND A;  2UUC Q;  1RCV D;  3T1Y Q;  4A3J B;  3J81 i;  4AIM A;  1VMP A;  4DV2 L;  1Y8O B;  3BZD B;  1KIX A;  5M3M G;  1PTO B;  3C1F A;  1SFO H;  3G48 A;  2GA4 B;  4DNI A;  1X9N A;  1PXU A;  4ILW A;  4JI0 L;  4KK7 A;  3VYR A;  2NTT A;  4KLK A;  1IBK L;  2QW7 A;  4JI3 L;  3BZC A;  3BVZ A;  4PNY A;  4P75 A;  2DY8 A;  2K28 A;  2L15 A;  4NMZ A;  1HNZ Q;  1DZ1 A;  2K03 A;  1N33 L;  4DAY A;  3JC6 6;  1NMF A;  1SE2 A;  3EVQ A;  5IP9 G;  2I5M X;  2XN9 C;  2Y0S B;  3LWU A;  5HY6 A;  3CCE A;  1ROD A;  3ERO A;  1HNX L;  3G71 A;  1I4Q A;  3D6C A;  4POF A;  4JI6 Q;  2VQE L;  4DUZ Q;  5IIF A;  2RA4 A;  2Q8R E;  1CA6 A;  1BR9 A;  5BR8 Q;  2ZM6 L;  4X66 L;  1YIT A;  4HJ5 A;  2CWA A;  5CV6 A;  4YHH L;  1GUN A;  1JE5 A;  1DON A;  1EY9 A;  1S5C D;  2B2Y C;  4DR7 Q;  4YCU A;  2BE5 C;  4X3U A;  3MC0 B;  2KA7 A;  4DR2 L;  1TWG H;  3A0J A;  3NTI A;  4UAI A;  1X3P A;  3FP9 A;  2XGT A;  3OWF A;  1XPO A;  4IUN A;  4KKU A;  4JK1 C;  2HHH L;  4NB3 A;  4XXE A;  4B3S L;  2DJG C;  3KBG A;  4BBS H;  2UUB Q;  2F3W A;  2K32 A;  4CBV A;  2EYO A;  3MFY A;  1K0S A;  1IYV A;  4IUV A;  5I6W A;  3AFP A;  3E5S A;  3D4R A;  2K52 A;  1J8I A;  4FF1 A;  5A2Q L;  4DR5 L;  2NVT B;  3KK7 A;  1VF5 C;  3TRE A;  1EYG A;  5J39 A;  2KCM A;  1UNS A;  2LXJ A;  2EY2 A;  3DUZ A;  3S15 B;  2R6G A;  4X64 Q;  1CUK A;  1QJO A;  1CZW A;  1XNQ Q;  2F0I A;  2OCE A;  1K73 C;  4QUC A;  5C4X H;  1YJ9 A;  2RQX A;  5LMU Q;  1R4Q B;  1WI5 A;  1FJG L;  1ENC A;  5KYL A;  3NBH B;  1NY4 A;  4M1U B;  1XMO Q;  4IOC A;  2ENB A;  3CP0 A;  4A3L G;  2H5X A;  2JA7 B;  4C1N K;  1EYD A;  3KF8 A;  4YCW A;  1BOS A;  1EU3 A;  1W6K A;  3KBX A;  4IOA A;  2B2U C;  4GLA C;  2R7Z G;  4CDC C;  1KXL A;  1FGU A;  1A3U A;  1VDZ A;  1A8V A;  4B9W A;  1QVF A;  3M4Q A;  3G7L A;  4LFA Q;  3L2P A;  2VB2 X;  1I50 B;  2Q2U A;  4X62 Q;  1X55 A;  2ZXO A;  4A3K B;  1STG A;  1EY5 A;  2RKS A;  4RKL A;  4DV6 Q;  1VQ4 A;  3T1H Q;  1ZEQ X;  4LUV A;  4C3H G;  1KDA A;  4NP5 A;  1N8R C;  3OHX C;  1PLF A;  3BZK A;  4CKC A;  5FO9 B;  5LL6 X;  4DV2 Q;  1I5F A;  2B63 G;  4JI0 Q;  1OXS C;  1S4Z A;  2NVX B;  3K57 A;  1IBK Q;  4F88 A;  1UEB A;  4A3I H;  1JJC B;  1LT6 D;  1FD7 D;  2ZTE A;  1FNV A;  4JI3 Q;  2G9D A;  3UDF A;  1TWH H;  1F9Q A;  3D6W A;  3D31 A;  1PYW D;  1N33 Q;  1YEZ A;  1STH A;  1PH9 A;  3QR8 A;  5F2D A;  2M2L A;  2PI2 A;  1QIL A;  1K3B C;  1Q7Y C;  2Z8L A;  3SDZ A;  4C3H B;  3FEW X;  4OON A;  4HAE A;  5IYB H;  2F0N A;  2LSS A;  4KY6 A;  1F9P A;  1XTD A;  2RDH A;  4RHR A;  1VQ5 A;  5LHY 1;  1HNX Q;  4A3G H;  1SXT A;  1TKW B;  5I9O A;  3CU7 A;  2WAQ E;  2VQE Q;  4R1J A;  1O7Y A;  3ND8 A;  1VF7 A;  3HOY G;  2EJM A;  1A62 A;  3H0G G;  3CC2 A;  4HCE A;  1E24 A;  3I90 A;  1EY0 A;  4X66 Q;  2ZM6 Q;  2Q2H A;  5LMN Q;  4LAA A;  4JOI A;  3NXW A;  1LM0 A;  4YHH Q;  3I91 A;  2RDG A;  5EBC A;  3OTO L;  4GZY C;  2HDM A;  3EJI A;  1HCZ A;  1QE6 A;  2K5D A;  4DR2 Q;  4DK3 C;  2X6G A;  2RSN A;  4K6L A;  2DNC A;  3S14 H;  1ZXT A;  4YIJ A;  1KDB A;  2HHH Q;  4B3S Q;  1ICF B;  1PZJ D;  1LAB A;  2EYJ A;  1EZ6 A;  3TRZ A;  3Q0A A;  4DV7 L;  4HSV A;  1GVP A;  4A3M G;  1CZG A;  1PA6 A;  3H0G B;  2J0T D;  4PZ6 A;  3CRK C;  4L6T B;  1A63 A;  4KV6 A;  4DR5 Q;  3BS1 A;  3NBH A;  3PUZ A;  3J81 L;  1FVI A;  4QCL A;  2KEE A;  1SBB B;  3HOZ B;  1A15 A;  2FXQ A;  1B8A A;  3EA6 A;  2ZTC A;  3CMA A;  1ASY A;  3VA5 A;  4G57 A;  3K5M A;  4K2K A;  3QJY A;  5IYD G;  4N8F A;  3MXU A;  1QCB D;  3E3X A;  4NW2 A;  5CV5 A;  4A3E B;  4ZLT F;  1JWU D;  4DK1 A;  1U4M A;  3I4M H;  4QUF A;  2RSO A;  1VQL A;  3U9S A;  1FJG Q;  4A3D H;  4CDF C;  2E75 C;  4PMW A;  3HFZ B;  3RZO B;  1Y8P B;  1YJN A;  1BCP F;  1EU4 A;  5DEH A;  4A3F B;  3VA7 A;  1TR5 A;  2LMC B;  1VS0 A;  3I4O A;  1GUG A;  3KFU A;  1JR0 D;  2K6A A;  4L8J A;  2O2L D;  2EXZ A;  2GVA A;  4H0L C;  2EY6 A;  2MQH A;  4I7Z C;  4EQP A;  2J4X A;  3K5N A;  5KGU A;  2RCN A;  1F2M A;  1UAP A;  1TY2 A;  1I6H H;  1II3 A;  2F0M A;  4OWT B;  3JAM i;  3R3O A;  5BN5 A;  2F0T A;  2JA6 H;  3CCJ A;  3GTG B;  5KNC A;  4KHP L;  3TP5 A;  1D1K A;  2EYH A;  5IY0 A;  4RGN A;  3V05 A;  5IP7 G;  4HSP A;  4IFD I;  1OXU A;  2L1B A;  1XYI A;  3GTM H;  2Z1C A;  2F4V L;  2E76 C;  3I70 A;  2NUC A;  1Y1V H;  4B9X A;  1SLJ A;  2EYP A;  2KHS A;  3L3O C;  4HID A;  4APV A;  3NEN A;  5HGT A;  3WOF A;  3GTK H;  3BDC A;  4ULL A;  1FYC A;  3HS0 C;  3D8G A;  4B3T L;  3ERS X;  4IJL A;  1JJ2 A;  3M4O B;  4HED A;  2K14 A;  5EKL A;  3R8B A;  3TP7 A;  1JMC A;  1AEX A;  2K7V A;  4JI8 L;  2CHB D;  1LTR D;  1PZK D;  4NXM L;  1G6P A;  2OT2 A;  1NNX A;  1PTO F;  3AB9 A;  4ME3 A;  1EY8 A;  3FDT A;  2NVT H;  2VUM H;  2EY5 A;  5C5L A;  3RLN A;  3AEV A;  3S15 H;  2X6L A;  2JA5 B;  2KCC A;  4K8J A;  4C2M B;  1PFS A;  3VR4 A;  2C5C A;  3OTO Q;  1M1K C;  2VS1 A;  3GV6 A;  2F0O A;  1WYD A;  3HOU G;  1MBY A;  1LT4 D;  1N9W A;  4L5R C;  2N49 A;  3CD6 A;  2SNM A;  4BXX G;  1SRU A;  3P1H A;  1E0B A;  2YTX A;  2IJ0 A;  1OXT A;  2J7Z A;  3K81 C;  1HPC A;  2KBN A;  4ZUI A;  1TQO A;  1NUC A;  2HQL A;  4PQX A;  4DV7 Q;  1KLG D;  1ILQ A;  3K6O A;  2L4N A;  4MN3 A;  4NKL A;  1EIG A;  3F1Z A;  1K8G A;  3I56 A;  5I2X A;  3ZYY X;  2B2W C;  1DJR D;  4XDX A;  1XJV A;  1YHA A;  2EYF A;  5JJI A;  3SXH A;  1SEB D;  1VQG A;  4KD4 A;  4YCV A;  4BBR H;  2NTS A;  3I4N H;  3WOE A;  1JOO A;  3S17 H;  3KF6 A;  4U68 A;  1C48 A;  2HQE A;  1HA5 A;  1YNJ D;  4JCV E;  4O0A A;  4OIJ A;  1FR3 A;  3PO3 G;  3MVV A;  3E0E A;  1EY6 A;  2QF7 A;  4H13 C;  1IYJ B;  5GQO A;  1K83 H;  3CCV A;  3HKS A;  3S2D B;  2NVX H;  3VYT A;  3PUX A;  1TXY A;  3MHB A;  2F03 A;  3H15 A;  5FK9 C;  1GJX A;  4KN4 C;  3B6Y A;  1X3E A;  1TS5 A;  4JPB W;  2PNH A;  1U9R A;  4RCO A;  1TS3 A;  4TQU S;  1A2T A;  1WTQ A;  2R61 A;  5JJK A;  4B3R L;  1GO3 E;  3A8J E;  4LUO A;  3OW7 A;  2O5J C;  5D3D A;  4OO1 H;  3C1E A;  2PW5 A;  4KHP Q;  1QUQ B;  2KHJ A;  4NXN L;  1VQ6 A;  1Q82 C;  3K5O A;  4CJ2 C;  3F2B A;  2LFN A;  3QOL A;  2KHI A;  2ZT9 C;  4OHJ A;  4HIM A;  3RUZ A;  1SYD A;  3C2P A;  1IW7 C;  1EIF A;  2F4V Q;  4CKB A;  4A93 G;  4DV1 L;  2ID0 A;  4GS3 A;  1RTN A;  1PV4 A;  1OO9 B;  3I73 A;  4M8A A;  4RHS A;  3K58 A;  4OX9 L;  3NBI A;  4DV5 L;  2A6E D;  1B7Y B;  4B3T Q;  3C46 A;  1GXD C;  1FNU A;  3FVQ A;  3RD4 A;  4DR3 L;  2F0F A;  2ICE C;  3M9B A;  2PNR C;  4JI8 Q;  4CGY B;  1GHK A;  4NXM Q;  4IUT A;  1AH9 A;  4X3S A;  1VQB A;  4NDX A;  3IL8 A;  2VW9 A;  3J81 E;  2QDB A;  5KIX A;  4AYB G;  2FMC A;  1NSN S;  4ZKC B;  1GUT A;  2EQS A;  4A75 A;  4N8X 1;  4A3I G;  2RHQ B;  4DN4 M;  1F2L A;  3MTS A;  4H44 C;  1X3Q A;  2XWB B;  1TWA H;  4UP9 A;  4OWW B;  1BBU A;  2A69 C;  1B70 B;  1YHB A;  3KUP A;  1LTI D;  2L9H A;  1KD1 C;  3IKJ A;  4KJO A;  1CFM A;  2K5Q A;  3M7N A;  2WAQ B;  3P20 A;  2UUA L;  1B44 D;  1C9O A;  3GTO B;  2HIX A;  5IYB G;  2UXC L;  2E2J B;  1WCM B;  3FKI G;  4IAL A;  1U4L A;  2EZV A;  5C3E H;  4AQY L;  1PTO D;  4QB4 A;  1Q12 A;  5HGQ A;  3Q23 A;  1BCP B;  4R8I A;  3QIA A;  4FYD A;  1CKM A;  3STB C;  1PH4 A;  1UE7 A;  1PH2 A;  1VQD A;  4RCN A;  4BY7 B;  2BCO A;  4A3B G;  3P75 A;  1UEA B;  5C44 H;  3W5O A;  1CI3 M;  2R92 B;  3M4P A;  5EGT A;  1BBW A;  2YU9 B;  2WIN B;  4GOP C;  3MXG A;  5M5X H;  1VQJ A;  4GN5 A;  2JA8 B;  1JE4 A;  1Q81 C;  4F7X A;  1GKH A;  1P8L A;  2WII B;  1T9H A;  5C4H A;  3HOV G;  2SOB A;  4GOP B;  1WTH A;  5D65 A;  2XNA C;  4HMI A;  4FNF A;  3A7A B;  5JJZ A;  3VR2 A;  1K8M A;  5IT9 E;  1K28 A;  2TSS A;  4YWL A;  5ISR A;  1LT3 D;  3M4Y A;  3GTQ B;  2KJX A;  4DR4 L;  3RN2 A;  3TSS A;  3K7U C;  2E2H B;  4UHV A;  4B3R Q;  3AQQ A;  5JVH 3;  1NCV A;  2N8N A;  3AFQ A;  1EWI A;  2Q2I A;  2BE5 D;  4A3D G;  2SEB D;  5EJW A;  4FO2 A;  1IYU A;  3DLL A;  2JK8 A;  5IGF A;  1VQ7 A;  3TZU A;  4NXN Q;  4KJN A;  1KRT A;  1T5E A;  5IYC G;  4Y7N H;  3CC7 A;  1XPR A;  1HTP A;  5ELN A;  5KYI A;  2E2I B;  3OW2 A;  4O42 A;  3S1M H;  2L5T A;  1L1O A; 
#chains in the Genus database with same CATH homology
 3S16 B;  4DXG A;  1EWC A;  4C3J B;  3GTL B;  2DY7 A;  2L0C A;  1ILP A;  4MHE A;  4CJ1 B;  3SK8 A;  2XIW A;  5I9P A;  1V1P B;  3S1N B;  5M3M B;  2K33 A;  1Z47 A;  2RBM A;  5C5M A;  1Q1B A;  3ERQ A;  1TY0 A;  4PV1 C;  1EWH A;  4DF7 A;  2NWG A;  1E2V A;  4HTH A;  3PIP 3;  1QNK A;  2NZ1 D;  3DWP A;  3OSO A;  4OGQ C;  3WDN A;  1WD0 A;  1LTB D;  1HQM C;  1UUP A;  5C0X I;  2A68 C;  3H3V C;  4K8I A;  1G2S A;  1BO0 A;  3RLF A;  1HHV A;  2BDN A;  1D5M C;  3K0Y A;  3LX0 A;  5C0X G;  2PO4 A;  2FIN B;  1CT1 D;  1GHJ A;  2JXM B;  2AWN A;  2H4O A;  4F8M A;  3A55 A;  5BN4 A;  1H9S B;  3K5L A;  1KLU D;  4FVM A;  5ELC A;  3HP3 A;  4RA8 A;  4KHZ A;  1H9J A;  4IUR A;  3NWT A;  1SJE D;  3BVM A;  4HCS A;  3GO5 A;  4CHT B;  1M8A A;  1SYE A;  2K04 A;  2F3V A;  4ZUJ A;  2MJ8 A;  1JWM D;  1M4V A;  5K36 H;  3NP8 A;  4G7O C;  5KEE A;  1QG7 A;  4ZK9 B;  1I4X A;  2F0Q A;  3QWN A;  2Q8I B;  3X3N A;  3R2T A;  4K5V A;  2F0U A;  1SJH D;  3F2U A;  2PPB C;  1AP0 A;  3ND9 A;  5C6A A;  2R7Z B;  2NBF A;  1Q8I A;  3VYU A;  1Y1W B;  1NR2 A;  5FKA C;  5TSS A;  3MA2 B;  3JAM E;  3HOW B;  1HFN A;  2WV6 D;  1NAP A;  3GTP B;  2LKV A;  3R93 A;  2K1B A;  1E2Z A;  2B63 B;  1EEF D;  1JOR A;  4UDU C;  5EPL A;  2B2Y A;  2LY7 A;  4XT1 B;  3FMC A;  2AWO A;  4OL7 A;  3BVG A;  5D3I B;  1RDP D;  3MZ5 A;  5FO7 B;  2EYM A;  4DXF A;  1EIH A;  5M5Y B;  4R9W A;  3T56 B;  1XXG A;  2B8G A;  3VR5 A;  4EQO A;  3Q24 A;  2MHV A;  2NVY B;  5ELB A;  3HOY B;  5LL6 S;  1H9S A;  3Q6S A;  4C56 C;  5CYU A;  3TME A;  2F0G A;  1Q90 A;  2PQE A;  3GP7 A;  3HZX A;  5T1G A;  5FLX E;  1S5B D;  3GQB A;  2B2V C;  4RGO S;  1I4P A;  5JEA H;  2ICI A;  3CHB D;  2L55 A;  1PTO H;  1DOL A;  2M00 A;  2B2U A;  4A3M B;  1CM9 A;  3A7L A;  1V8Q A;  2QEJ C;  1XWE A;  2MUY A;  4C1N I;  4ID6 A;  3SVM A;  3KLS X;  4ZKB B;  1SNC A;  4EVO A;  1R9T B;  2EPB A;  1H9M A;  3DHQ A;  1SE3 A;  2EVB A;  3EFX D;  5I6Y A;  1SNQ A;  1JCK B;  2Z4H A;  1SMY C;  3W2D A;  4DK0 A;  2XVS A;  5JPM C;  3EQL C;  2VNU D;  4J8Q A;  3H94 A;  3J80 L;  1HXY D;  3HEJ A;  3NUC A;  3PO2 B;  5COR A;  2FFK B;  1EL0 A;  5KNB A;  4IUU A;  2C9O A;  4KY7 A;  3T4A C;  3M7G A;  4XQN A;  3P7J A;  5CMD A;  4KN7 C;  3BDO A;  1SNO A;  4N9P A;  5A2Q E;  1D5X C;  1JIC A;  1GOZ A;  3NQI A;  1B9N A;  3TN2 A;  1SDF A;  3N52 A;  4LJZ C;  5I2Y A;  1A3T A;  4KHV A;  4ZQ3 A;  5J1Z A;  3J7Y W;  3NHH A;  3DM1 A;  4TRD A;  1Y69 U;  2A6H C;  2KED A;  4ME5 A;  1CHP D;  1TT2 A;  5I4D A;  1RHP A;  2BA1 A;  1IW7 D;  3QO2 A;  2OF1 A;  3HOU B;  2X69 A;  2B2T C;  1I3Q B;  1X32 A;  1WVL A;  1D2B A;  3FPP A;  1XTC D;  4I65 A;  4WJW A;  1S5D D;  3SK6 A;  3VR6 A;  2CW0 C;  3I3C A;  4L63 B;  1VCI A;  4H7B A;  1HFG A;  3T53 B;  4BS9 A;  3TDQ A;  1C8C A;  3SK5 A;  1RTO A;  1PDQ A;  5IGB A;  1H9K A;  5NUC A;  1TWG B;  2IPK D;  2O4X A;  1SYG A;  5FOB B;  2F0K A;  1LLR D;  3PO3 B;  2A69 D;  3LNN A;  1HA6 A;  1EOT A;  1ML0 D;  1F77 A;  2IL8 A;  1R4P B;  3AU7 A;  4FP5 D;  5CGK A;  2RDF A;  3T51 B;  1BCP D;  1MD2 D;  1O78 A;  4HN7 A;  1EQT A;  3D3R A;  3OOC A;  2KOL A;  1ZYR C;  4IUQ A;  1WTO A;  5JEA J;  1OXV A;  1JOK A;  4N9T A;  2H1E A;  2MPM A;  1KTK A;  3CQZ B;  1V1O A;  1TVX A;  1AN8 A;  3RMH A;  1QWY A;  4ZRZ A;  2Q8T A;  2CQA A;  3J7A F;  5IGE A;  1IHZ A;  1AW7 A;  4DA2 A;  5D14 A;  2EY1 A;  4C3I G;  3M85 A;  4DGZ A;  2L12 A;  2F4I A;  2ZXR A;  4A93 B;  1MI2 A;  1O7L A;  5EKI A;  1U4R A;  2AUK A;  4RH6 A;  4BA2 I;  3U9O A;  2EJG C;  3BYY B;  4XT3 B;  3PUY A;  1EQV A;  1ET6 A;  5IOD A;  2KUM A;  1JC7 A;  3S9W A;  3C3L A;  1ENF A;  4U67 3;  2BOS A;  3NWS A;  5A35 A;  3HG9 A;  2KCN A;  4DU9 A;  1I4H A;  5M5W B;  4AYB B;  3QG1 A;  2B2W A;  3SR1 A;  1O7Z A;  1S5F D;  4KD3 A;  2EDG A;  4A3I B;  1G8Z D;  3N6R A;  1TWH B;  2B2T A;  2AQ1 B;  4CJ0 B;  2N88 A;  1DOM A;  4K5W A;  1TU2 B;  3A8K E;  3I8Z A;  4S3S A;  3FKI B;  1GUO A;  2SNS A;  2HDL A;  1KAB A;  4HMJ A;  2JSO A;  1RD9 D;  3MEH A;  3CKI B;  5J22 A;  1B2T A;  1PRT C;  4V0B A;  1DD2 A;  4TKO B;  1JWS D;  1EEI D;  2VB3 X;  1LTG D;  4A3B B;  5IGG A;  3UI2 A;  1YNN C;  3H09 A;  1ET9 A;  3NK9 A;  2HCC A;  1PRT B;  1QNU A;  4KI0 A;  3S14 B;  3BYT B;  4KY5 A;  1STY A;  2XRS D;  2IWH A;  4ZYS A;  1BBX C;  3HOV B;  3QOJ A;  2F0L A;  3NPP A;  1LO5 D;  1HUM A;  2NN6 H;  1QB5 D;  4QIW B;  3AMU A;  2F0E A;  2B39 A;  2A68 D;  1B1Z A;  4IFD H;  2QKI C;  4O1N A;  4J6H A;  1PFB A;  2PZU A;  1B4O A;  4KMU C;  1GUW A;  4XQQ A;  2AQ3 B;  3I4M B;  2WP8 J;  1LT5 D;  4A3D B;  3PV0 A;  1JQY D;  5FO8 B;  1V43 A;  2JP1 A;  5E4X A;  3SK4 A;  1F2Y A;  2TMP A;  1CTM A;  1CQF A;  2MGS A;  3PIO 3;  1BXT A;  3HKZ B;  4IQZ A;  1I6H B;  1MGS A;  2PYK A;  2PZW A;  2JA6 B;  2F0D A;  1O80 A;  2EYL A;  2JEA I;  1AFP A;  4P2C B;  4F87 A;  4RGM A;  3DMU A;  1D1I A;  4PMC A;  4DNR B;  3E0J A;  4QF4 A;  1F9S A;  4KKS A;  2I07 B;  1TS2 A;  1EY4 A;  3GTM B;  1L0X B;  5EQ0 A;  1Y1V B;  4XQJ A;  2IX0 A;  2L11 A;  3OIP A;  5ELD A;  4IUP A;  1B50 A;  4G7H C;  4KTA A;  1FGB D;  3GTK B;  4XYQ A;  1MSG A;  3W3A A;  3D4D A;  1A3V A;  5M3F B;  1Q1E A;  1S5E D;  2JE6 I;  4WRD A;  2Z4I A;  2KQ3 A;  2BDO A;  4DAV A;  1ICW A;  2VUM B;  1SAP A;  1B3A A;  1STE A;  4R8N A;  1HQR D;  5EKK A;  2F0S A;  3DWQ A;  3MFG A;  3CRL C;  4OIK A;  3J7A V;  4EQN A;  1SYC A;  2PCF B;  1K8O A;  3V96 A;  5E1F A;  1AZQ A;  4WFN 3;  1ONL A;  4K5X A;  4FXD A;  4FF4 A;  2XSC A;  4IZ8 A;  3L7Z C;  2AQ2 B;  5E3F A;  3GV3 A;  1DXM A;  3TP6 A;  1L0Y B;  1STN A;  5CR3 A;  4OO1 I;  5IGC A;  2IX3 A;  4BBR B;  3I4N B;  3S17 B;  2F1M A;  1V1P A;  4IN3 A;  1W6J A;  4BY1 B;  3H6M A;  2EOT A;  2FMM A;  4OO1 G;  4LMQ D;  1SNM A;  1SNP A;  1VMC A;  3SEB A;  1B9M A;  1K83 B;  1PZI D;  2IW3 A;  1BNZ A;  1T5X D;  3PUV A;  2KVM A;  3I4L A;  1D6E C;  2NB0 A;  5COY A;  1ESR A;  1A6X A;  2QIL A;  4J1M A;  2JEB I;  5EBD A;  4RKB A;  1JOQ A;  4B08 A;  1KAA A;  1LTT D;  1RKN A;  1STA A;  5AFW A;  4BWG B;  1HUN A;  4IFD J;  2FJ2 A;  1QOH A;  2EE1 A;  1CA5 A;  2R3Z A;  3Q22 A;  5E4W C;  5JOB A;  4KKT A;  2DNE A;  3S1Q B;  3OIQ A;  1DYQ A;  1SMY D;  2A5H A;  5BN3 A;  3OPO A;  5M9O A;  1BF4 A;  3MXN A;  3FRP B;  3GD7 A;  1WTR A;  2V4D A;  5DAU A;  5JPN C;  2QCP X;  4LK1 C;  3X3M A;  3H91 A;  1DM0 B;  2LS0 1;  3V2T A;  3NTK A;  2K5W A;  4FXK C;  2OEO A;  3A54 A;  2EJF C;  5C3W A;  2F0V A;  3K59 A;  4FF3 A;  2WB1 B;  1G91 A;  3QB3 A;  1TWA B;  1RF2 D;  5C4Z A;  5CBA E;  2PMZ B;  1J9O A;  1WTV A;  5DM7 3;  4MIU A;  3URY A;  5C3X A;  4K6D A;  4XYO A;  1SSO A;  3ITP A;  2MP1 A;  4TSS A;  5C3E B;  1EY7 A;  1OXX K;  3DWA A;  3NTH A;  2HUG A;  5ELF A;  5G3L F;  2NVQ B;  3NQT A;  1IKL A;  2A6H D;  1LV9 A;  1SND A;  2DN8 A;  1Q3L A;  4RGT A;  1HTL D;  5C44 B;  2E74 C;  3FPU B;  4X3K A;  1PRT F;  5EPJ A;  3A56 A;  3R2I A;  4G4K A;  2NN6 I;  5HUR A;  3KLR A;  3HRZ C;  5M5X B;  1ENA A;  1SYB A;  2PW7 A;  2K01 A;  2A73 B;  1EYC A;  3MAQ A;  1TWF B;  2D62 A;  2YYZ A;  1ESF A;  2VXW A;  3TZD A;  1Z6H A;  2NN6 G;  2CW0 D;  4DFA A;  5IT9 L;  4IFD G;  1PFN A;  3PUW A;  5IGD A;  2RVL A;  1PMR A;  3OMC A;  1MSH A;  1LAC A;  4RAU C;  5KRU A;  5CV8 A;  1KNE A;  1BDO A;  1KDC A;  1Y8N B;  1I4R A;  2NYZ D;  3NSW A;  2FHT A;  4Y7N B;  2PZT A;  3G6J B;  5T1I A;  1WTP A;  1SFO B;  3S1M B;  4EGV A;  5C0X H;  5DNF A;  4ODG A;  1XX8 A;  3HOX B;  2WKD A;  4E6I A;  3I72 A;  3S2H B;  4G7Z C;  1TWC B;  2WKC A;  4Q5V A;  2G9H D;  3IFD A;  3E6Z X;  1ZYR D;  2B2V A;  2BA0 A;  5IOC A;  2R93 B;  5CV7 A;  1HRJ A;  2F0J A;  2F0H A;  2XRQ D;  2D5D A;  5C4J B;  4CKE A;  1IKM A;  5JAV A;  4ABN A;  3ONA B;  3BDL A;  1ZKO A;  3LWE A;  4PMB A;  3OWE B;  1JB3 A;  3KLS A;  1LTA D;  1A2U A;  2CVR A;  1F9R A;  1SYF A;  2K05 A;  1RJT A;  3T16 A;  4XTC S;  1I6V C;  1KNA A;  4BBS B;  4X3T A;  2JYO A;  4JBW A;  3TP8 A;  5K5P A;  4ZAI A;  2D2C C;  3VYS A;  2IT1 A;  5ELE A;  2D9U A;  4DAP A;  2O5I C;  1DOK A;  5K36 G;  1E2W A;  5EPK A;  5C4X B;  2ZXP A;  1PFM A;  4V19 0;  1AZP A;  2XWJ B;  3SHL A;  2OXP A;  1WTX A;  5CC4 A;  1STB A;  3HGB A;  5G3L D;  3DEO A;  1DCZ A;  5CBE E;  1GUS A;  1G2T A;  1TII D;  3D4W A;  1YNJ C;  2KEC A;  4K2L A;  2I46 A;  1U4P A;  1EZ8 A;  2B8F A;  1PRT D;  2E2D C;  2M9V A;  4K14 A;  2A74 C;  1YNN D;  1F2Z A;  2IX1 A;  3L9A X;  1B53 A;  1C4Q A;  3T13 A;  5DM6 3;  4Z9C B;  4C3I B;  4FF2 A;  3DEP A;  4Q0F A;  5CV9 A;  3NE5 B;  3OMG A;  4HR7 B;  1LTS D;  3K7A B;  1BUV T;  1FNW A;  1G6Z A;  3JAM L;  1BCP C;  2F0W A;  4WOR A;  3DXJ C;  2N55 A;  3IAY A;  5JVG 3;  3IFT A;  3GTJ B;  3O13 A;  1TS4 A;  3RZD B;  4A3G B;  4RWS C;  2SDF A;  3M3Y B;  1D5Z C;  5CV4 A;  1EYA A;  1CHQ D;  2A6E C;  3J80 E;  3TBI B;  1WTW A;  3BG3 A;  3PMF A;  4QMG A;  5C0X J;  1CQV A;  5JEA G;  1Z7T A;  1SE4 A;  2AUJ D;  4FXG C;  3VR3 A;  3MXP A;  3S1R B;  1IL8 A;  1I4G A;  3A8I E;  4RFB A;  5FLX L;  1BQQ T;  2HCI A;  2F0P A;  4BA1 I;  4C3J G;  1EFI D;  1H9R A;  3SE0 A;  3MWY W;  1G29 1;  1PTO C;  1NR4 A;  4DNT B;  1WD1 A;  4XIG S;  1CK1 A;  2WAC A;  5KND A;  1RCV D;  4A3J B;  1VMP A;  1Y8O B;  3BZD B;  1PTO B;  3C1F A;  2GA4 B;  1PXU A;  4ILW A;  4KK7 A;  3VYR A;  2NTT A;  3BVZ A;  4PNY A;  2DY8 A;  2K28 A;  4NMZ A;  1DZ1 A;  2K03 A;  4DAY A;  1SE2 A;  3EVQ A;  2XN9 C;  2Y0S B;  3LWU A;  1ROD A;  3ERO A;  1I4Q A;  3D6C A;  5IIF A;  2RA4 A;  2Q8R E;  1CA6 A;  1BR9 A;  5CV6 A;  1GUN A;  1DON A;  1EY9 A;  1S5C D;  2B2Y C;  2BE5 C;  4X3U A;  3MC0 B;  2KA7 A;  3NTI A;  4UAI A;  1X3P A;  3OWF A;  4IUN A;  4KKU A;  4JK1 C;  4XXE A;  3KBG A;  2F3W A;  2K32 A;  4CBV A;  2EYO A;  3MFY A;  1IYV A;  4IUV A;  5I6W A;  3E5S A;  3D4R A;  1J8I A;  4FF1 A;  5A2Q L;  2NVT B;  3KK7 A;  1VF5 C;  5J39 A;  1UNS A;  2EY2 A;  3DUZ A;  3S15 B;  2R6G A;  1QJO A;  1CZW A;  2F0I A;  4QUC A;  2RQX A;  1R4Q B;  1ENC A;  5KYL A;  4M1U B;  2ENB A;  2JA7 B;  4C1N K;  1EYD A;  3KF8 A;  1BOS A;  1EU3 A;  1W6K A;  3KBX A;  2B2U C;  1A3U A;  1VDZ A;  4B9W A;  3G7L A;  2VB2 X;  1I50 B;  2ZXO A;  4A3K B;  1STG A;  1EY5 A;  2RKS A;  4RKL A;  1ZEQ X;  4C3H G;  1KDA A;  4NP5 A;  3OHX C;  1PLF A;  4CKC A;  5FO9 B;  5LL6 X;  1OXS C;  1S4Z A;  2NVX B;  3K57 A;  4F88 A;  1LT6 D;  1FD7 D;  1FNV A;  2G9D A;  1F9Q A;  3D6W A;  3D31 A;  1PYW D;  1STH A;  5F2D A;  2M2L A;  1QIL A;  2Z8L A;  3SDZ A;  4C3H B;  3FEW X;  4HAE A;  2F0N A;  4KY6 A;  1F9P A;  2RDH A;  4RHR A;  5LHY 1;  1SXT A;  1TKW B;  5I9O A;  3CU7 A;  1O7Y A;  3ND8 A;  1VF7 A;  2EJM A;  4HCE A;  3I90 A;  1EY0 A;  4LAA A;  3NXW A;  3I91 A;  2RDG A;  5EBC A;  4GZY C;  2HDM A;  3EJI A;  1HCZ A;  1QE6 A;  2K5D A;  2X6G A;  2RSN A;  4K6L A;  2DNC A;  1ZXT A;  4YIJ A;  1KDB A;  1PZJ D;  1LAB A;  2EYJ A;  1EZ6 A;  3Q0A A;  4HSV A;  1CZG A;  3H0G B;  2J0T D;  3CRK C;  4L6T B;  4KV6 A;  3BS1 A;  3NBH A;  3PUZ A;  3J81 L;  4QCL A;  2KEE A;  1SBB B;  3HOZ B;  1A15 A;  3EA6 A;  3VA5 A;  4G57 A;  3K5M A;  4K2K A;  3QJY A;  3MXU A;  1QCB D;  4NW2 A;  5CV5 A;  4A3E B;  4ZLT F;  1JWU D;  4DK1 A;  1U4M A;  4QUF A;  2RSO A;  3U9S A;  2E75 C;  4PMW A;  3RZO B;  1Y8P B;  1BCP F;  1EU4 A;  5DEH A;  4A3F B;  3VA7 A;  1TR5 A;  2LMC B;  1GUG A;  1JR0 D;  2K6A A;  4L8J A;  2O2L D;  2EXZ A;  4H0L C;  2EY6 A;  4I7Z C;  4EQP A;  2J4X A;  3K5N A;  5KGU A;  1F2M A;  1UAP A;  1TY2 A;  1II3 A;  2F0M A;  3R3O A;  5BN5 A;  2F0T A;  3GTG B;  5KNC A;  3TP5 A;  1D1K A;  2EYH A;  4RGN A;  3V05 A;  4HSP A;  4IFD I;  1OXU A;  2L1B A;  1XYI A;  2Z1C A;  2E76 C;  3I70 A;  2NUC A;  4B9X A;  2EYP A;  2KHS A;  3L3O C;  5HGT A;  3WOF A;  3BDC A;  4ULL A;  1FYC A;  3HS0 C;  3D8G A;  3M4O B;  4HED A;  5EKL A;  3R8B A;  3TP7 A;  1AEX A;  2K7V A;  2CHB D;  1LTR D;  1PZK D;  2OT2 A;  1PTO F;  3AB9 A;  1EY8 A;  3FDT A;  2EY5 A;  5C5L A;  2X6L A;  2JA5 B;  4C2M B;  2KCC A;  4K8J A;  3VR4 A;  2C5C A;  3GV6 A;  2F0O A;  1MBY A;  1LT4 D;  2SNM A;  3P1H A;  1E0B A;  2IJ0 A;  1OXT A;  2J7Z A;  1HPC A;  4ZUI A;  1TQO A;  1NUC A;  4PQX A;  1KLG D;  1ILQ A;  3K6O A;  2L4N A;  4MN3 A;  4NKL A;  1EIG A;  5I2X A;  3ZYY X;  2B2W C;  1DJR D;  4XDX A;  2EYF A;  3SXH A;  1SEB D;  4KD4 A;  2NTS A;  3WOE A;  1JOO A;  4U68 A;  1C48 A;  2HQE A;  1HA5 A;  1YNJ D;  4OIJ A;  1FR3 A;  3MVV A;  1EY6 A;  2QF7 A;  4H13 C;  3S2D B;  3VYT A;  3PUX A;  3MHB A;  2F03 A;  5FK9 C;  1GJX A;  4KN4 C;  1TS5 A;  1U9R A;  4RCO A;  1TS3 A;  4TQU S;  1A2T A;  1WTQ A;  2R61 A;  3A8J E;  3OW7 A;  2O5J C;  5D3D A;  4OO1 H;  3C1E A;  2PW5 A;  3K5O A;  4CJ2 C;  2LFN A;  3QOL A;  4OHJ A;  2ZT9 C;  3C2P A;  3RUZ A;  1SYD A;  1IW7 C;  4CKB A;  2ID0 A;  1RTN A;  1OO9 B;  3I73 A;  4M8A A;  4RHS A;  3K58 A;  3NBI A;  2A6E D;  3C46 A;  1GXD C;  1FNU A;  3FVQ A;  3RD4 A;  2F0F A;  2ICE C;  2PNR C;  4CGY B;  1GHK A;  4IUT A;  4X3S A;  4NDX A;  3IL8 A;  3J81 E;  2QDB A;  5KIX A;  2FMC A;  1NSN S;  4ZKC B;  1GUT A;  4DN4 M;  1F2L A;  3MTS A;  4H44 C;  1X3Q A;  2XWB B;  2A69 C;  2L9H A;  3KUP A;  1LTI D;  3IKJ A;  4KJO A;  1CFM A;  2K5Q A;  3M7N A;  2WAQ B;  3P20 A;  1B44 D;  3GTO B;  2E2J B;  1WCM B;  4IAL A;  1U4L A;  2EZV A;  1PTO D;  4QB4 A;  1Q12 A;  3Q23 A;  1BCP B;  4R8I A;  3QIA A;  4FYD A;  4RCN A;  4BY7 B;  2BCO A;  3P75 A;  1UEA B;  1CI3 M;  2R92 B;  5EGT A;  2YU9 B;  2WIN B;  3MXG A;  2JA8 B;  1JE4 A;  4F7X A;  2WII B;  5C4H A;  2SOB A;  5D65 A;  2XNA C;  4HMI A;  4FNF A;  3A7A B;  5JJZ A;  3VR2 A;  1K8M A;  5IT9 E;  2TSS A;  5ISR A;  1LT3 D;  3M4Y A;  3GTQ B;  2KJX A;  3TSS A;  2E2H B;  5JVH 3;  1NCV A;  2BE5 D;  2SEB D;  5EJW A;  4FO2 A;  1IYU A;  5IGF A;  3TZU A;  4KJN A;  1T5E A;  1HTP A;  5KYI A;  2E2I B;  4O42 A;  2L5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...