2F0OA

Crystal structure of staphylococcal nuclease mutant v66i/i72v
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMIENAKKVEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0oA00
4PNYA 1SYEA 1EYDA 4MIUA 4K5WA 4NP5A 4RKBA 5KYIA 2RDFA 3E5SA 4ME5A 4ODGA 3NXWA 2SOBA 2M00A 2QDBA 4KV6A 4K8JA 2F0HA 4IUNA 2F3WA 3D6CA 4N9PA 4IZ8A 1U9RA 1KAAA 3U9OA 5CV5A 5CC4A 3BDCA 5CV6A 2NUCA 2PZWA 2F0UA 2PZUA 5KYLA 3R3OA 3SK6A 1JOQA 1F2MA 5IODA 1TR5A 4YIJA 4K8IA 4KY6A 3NK9A 4B9XA 5CV8A 1IHZA 5J39A 2F0IA 2F0GA 4IALA 3HEJA 1KDBA 3BDLA 2PW5A 2PZTA 4KJNA 4K14A 3D4WA 4E6IA 1NSNS 4NDXA 5C3XA 3OMCA 5KGUA 3NUCA 4S3SA 5EGTA 4DU9A 5HURA 1JORA 1KABA 3TP7A 3ERQA 3RUZA 1A2TA 1KDAA 4DFAA 2ENBA 4K5VA 5IGFA 2F0QA 5CV9A 2F0EA 1SNMA 3SHLA 5C4ZA 5I6WA 3H6MA 5IGCA 2EYJA 3TMEA 3SK5A 5IGEA 1A3UA 4EVOA 1TT2A 1EYAA 2HQEA 3MZ5A 3C1EA 4KJOA 1JOOA 4TRDA 5CV4A 2F0LA 4F8MA 5C3WA 3VA5A 5IGDA 2O4XA 4KY5A 2EYFA 5E1FA 2PYKA 4LAAA 2EYLA 1STGA 1SNCA 1SYFA 3P1HA 5CV7A 5E3FA 5EKLA 2F0FA 5NUCA 4EQPA 5C6AA 5IGGA 1AEXA 2WACA 3PMFA 2F0JA 2EY1A 5DAUA 1EY0A 3SXHA 1EY5A 1ENCA 4DF7A 4WRDA 1SNDA 2PW7A 3T16A 4EQNA 1STNA 1EY6A 1STAA 5I9OA 5ISRA 2F0TA 2RBMA 4ZQ3A 3V2TA 2F0NA 1SYGA 1STHA 1A2UA 1RKNA 3NHHA 2F0SA 2OF1A 4J1MA 5F2DA 4QMGA 4QF4A 5JOBA 2EYMA 4F7XA 2F0WA 3D8GA 5CR3A 4G57A 3DMUA 4K6DA 4WORA 5C5LA 3MHBA 1SNPA 4EQOA 1EY8A 5JAVA 4ZUJA 3OWFA 1NUCA 1SYDA 2RKSA 1II3A 4R8NA 4ZUIA 3NP8A 2EXZA 1A3TA 1EZ6A 3C1FA 3LX0A 1TQOA 4QB4A 1ENAA 3EJIA 1EY4A 1KDCA 2EY5A 4ID6A 2EY2A 3ITPA 4K2LA 4NMZA 5C4HA 4K5XA 4KTAA 3OSOA 1SYBA 2EYOA 2LKVA 5J1ZA 2PQEA 2F0VA 4KD4A 5DEHA 5K5PA 3EROA 2EYPA 2F0KA 4N9TA 2F0MA 4PMCA 3P75A 5IGBA 1SNQA 4J6HA 4HTHA 5I9PA 1SNOA 4KY7A 2F0DA 5C5MA 5KEEA 2F3VA 5I6YA 5HGTA 5J22A 1F2YA 3MEHA 3QB3A 3QOJA 2KQ3A 4KHVA 3NQTA 4PMBA 2KHSA 1F2ZA 3TP8A 5KIXA 3MVVA 4NKLA 2EY6A 3DHQA 3TP5A 3T13A 1EQVA 5CGKA 2OEOA 4B9WA 5IOCA 4K2KA 1STBA 1STYA 2SNSA 1EYCA 1EY7A 2EYHA 3QOLA 2OXPA 4HMIA 4OL7A 3D4DA 1EZ8A 2F0OA 3S9WA 1A3VA 3SR1A 3TP6A 1SYCA 3MXPA 2SNMA 4H7BA 5M9OA 4HMJA 4RKLA 5KRUA 3HZXA 5EKKA 1JOKA 3SK8A 4KD3A 3EVQA 5IIFA 3SK4A 2F0PA 1EY9A 3OMGA 4DGZA 4I65A
chains in the Genus database with same CATH superfamily
2NN6I 3QO2A 1V1PB 4FDBA 1GO3E 3G71A 4RMFA 3M4YA 4L8JA 3RLOA 2QDBA 4EGVA 3E9HA 3K5MA 5D14A 2HUGA 3K0XA 1QVCA 3NE5B 2VUMB 1JR0D 3X3NA 2ES2A 3NTIA 2PW5A 1Q1EA 3HOXH 3Q24A 2YV5A 3NUCA 3GO5A 1WYDA 3RUZA 1UE5A 1A15A 3M4OH 2VY3A 3UDFA 3PO3G 3KDFA 1NJIC 2JA8B 2F0LA 1S40A 2QA4A 1QVFA 2WAQE 1KLGD 1SE4A 1V1QA 4IPHA 5I2XA 4OO1I 5G3LF 1SYFA 4KN7C 5EKLA 4DV4L 2K75A 1EIGA 1B8AA 3KF6B 3DLLA 4OEMB 2VS1A 1WTWA 3P7JA 3S1NB 1EY5A 1XWEA 2PW7A 1MJCA 4YY3L 4IUVA 1A2UA 1XYIA 4DR4L 1HA6A 4JBJA 3VR4A 4DV1L 3GTMH 1KAWA 3EIVA 5C5LA 1HNZL 3MFGA 2JQOA 2K6AA 2D0PA 4JW0A 5JEAH 2E75C 2BDOA 2RKSA 2UUCL 2C9OA 3O13A 3LGJA 1RIPA 5FLXE 5C4HA 5IYBG 4HIDA 2VQFQ 5D3IB 4X3TA 3U4VA 2YTYA 3C2PA 3K7UC 1SNQA 3I73A 2R7FA 3J7AF 1SNOA 3PIOA 2F0DA 3NQIA 5I6YA 1GXDC 1PZID 4PMBA 2KQ3A 1NR4A 2D9UA 5CGKA 4DV6L 1GKHA 1A62A 1O7LA 3D4DA 3TP6A 3WWVA 4DAPA 2RCNA 1SRUA 1J8IA 3OMGA 3KF8B 4JBWA 2OTLA 4DAMA 3NTKA 1ML0D 3OHXC 1D5MC 2FINB 3D6CA 4A3KH 1EFID 1EQQA 2WP8J 2IT1A 4K0KQ 2ZJQA 4A3LG 4IFDH 2RQXA 4IPCA 2PI2A 3W1GA 2Z0SA 3MWYW 2K5DA 5CV8A 3I72A 1IKLA 1BCPD 3J7ZC 4LF8L 1B50A 2XWBB 1C4QA 3T56B 4A4IA 4BXXG 1I4PA 2N78A 1KNAA 3CMAA 1TS3A 2LSSA 4WJWA 4HJ5A 2ZXPA 2ENBA 2MQHA 4N8FA 4RFBA 2RSNA 3BZDB 1WTXA 2JSOA 5EBCA 4PZ6A 4BY1G 1KRSA 1D8LA 2ID0A 2QEXA 3DM1A 3CRLC 1TWGH 2EYLA 1STGA 1TWAB 3AFQA 3UDIA 3M7NA 3GTKB 5IGGA 3J7AV 2N3SA 2UU9L 1PTOD 3J81L 2AQ1B 1S5CD 1VQAA 4JG2A 4C3HB 5C4XH 2F0TA 1DCZA 3LNNA 4XT1B 2AUKA 2J4XA 3FDTA 1E1TA 3N52A 5JAVA 2JJQA 1X54A 2XVSA 4QIWE 2HCIA 3AU7A 1SROA 1PXUA 2EY5A 4DV4Q 4GNXA 4A3MB 4A3IG 1JB7A 2X6LA 1RTNA 5JPMC 4JI7Q 2JA6B 2LKVA 2KENA 1C8CA 4A3EB 2KHIA 3BJUA 3ZJYC 2F0MA 4PMCA 1I6HH 1D7QA 2XNAC 4YY3Q 4CGYB 1LM0A 4DR4Q 1Y1WG 3HKZG 1TIID 2F3VA 3PO3H 5C4JB 3QOJA 1HNZQ 4OIKA 5IYDG 1WCMH 4G7HC 3HOZB 4A3GG 1KHIA 5KNBA 2I07B 1O7YA 2WKDA 2EYHA 4G7ZC 1G6ZA 1BCPB 3PUYA 4ZKCB 4RHSA 5GADC 4C3JG 3KDFB 4KD3A 1CHPD 1X6OA 3I4NB 1EWHA 2BE5C 4A3FG 1PA6A 2QKIC 1PFNA 5DLQE 1UUPA 3N6RA 2OWOA 2A73B 4LF9Q 3BVZA 2PPBC 2VL6A 1LTAD 4FYDA 2B8GA 2NUCA 2F0UA 1XTCD 3I8ZA 3H09A 4JYAL 2G9DA 4NW2A 2IHEA 1PTOB 2WB1G 2XRQD 1A63A 2B29A 5IYBH 4NDXA 3TN2A 4B3ML 2ZXOA 2E5LL 2B2TA 1KDAA 1E7ZA 4DFAA 1JWMD 2CH4W 3GTQB 4OX9L 4DUYQ 1G291 1I4RA 1EYGA 5CV4A 1I4GA 1JOOA 1ICWA 3ND9A 2B2UA 1L2FA 3FP9A 3MAQA 1CSQA 4YWMA 1PMRA 4A3DG 5KNCA 3PMFA 4LF6Q 1EOTA 2C35B 4GKJL 4KKSA 4EQNA 2L9HA 2B63B 3K57A 1XMQL 4LUOA 2YU9B 3F2DA 3WDNA 1GOZA 4IJHA 4QMGA 1NBWA 2GA4B 2R92G 1J5EL 4A3BG 2HQLA 3A54A 2SDFA 4JC0A 1RHPA 4KKTA 1K8MA 1B9NA 3URYA 5GAHC 1MIUA 3LX0A 5D65A 1GUOA 5M3FH 2R93H 1AH9A 2AKWB 4A3LH 4YCVA 2EY2A 4NMZA 1IW7D 1LABA 1YJ9A 1JICA 4DK3C 2UU9Q 4POFA 1WTQA 3EA6A 5IT9L 4BXXH 1GVPA 2FMMA 3KLSA 3RLFA 4ZLTF 1GUNA 2VW9A 3PUZA 4ZYSA 1G51A 3JAML 5C5MA 4M8AA 3RZDH 1S5DD 2NTSA 4KHVA 3MA2B 1NNXA 3J80i 3TP8A 4BY1H 3K8AA 3T13A 1EQVA 1HTPA 1WTRA 1B53A 4P74A 3TZUA 3PV0A 1G2SA 1R9TB 5FLMH 1XNRL 4MN3A 5FO7B 3J7A5 3CCEA 1JT8A 3W3AA 2ICEC 3L2PA 4R4TA 4GLXA 1KLUD 1BF4A 4UP7A 5KYIA 1G2TA 3U4ZA 1LT5D 1JB3A 1J9OA 2L5TA 1F9SA 2B2WC 4HEDA 4C2MB 3I4LA 2XRSD 2CW0D 2A19A 3K5OA 5CV6A 4DAYA 5KYLA 3MC0B 1CZWA 1K73C 5FJ8G 1EEFD 2N8NA 4JI4L 1BOSA 4B9XA 3NK9A 2F0IA 1JE4A 1IYVA 4A3IH 2PNRC 2A5HA 1HUMA 4MHEA 2NYZD 1FNWA 1N34Q 1EU4A 1C48A 3HOUG 4QL5A 2RDHA 3J81E 1Y1WH 2MP1A 4HJAA 4FF3A 2E2DC 4GNXB 3CCRA 5JJKA 1Q86C 2HD3A 3PO2H 4KY5A 1ET6A 3AEVA 5IYDH 1TWCH 2K50A 4EQPA 4GN3B 4JYAQ 1KTKA 2Y0SE 1F77A 1OXUA 5EKIA 4C3JH 1BQQT 3CAMA 1CQFA 4B3MQ 4C56C 4JI2L 5GROA 2EYMA 5ELEA 3QWNA 3G4SA 2TMPA 1LTGD 1HJPA 3CPFA 2E2IH 3GTJH 3K0YA 1X3QA 2F03A 2NVTB 1V1PA 4JI6L 1A3TA 3FPUB 1I4XA 4PZ7A 4LF4L 2OT2A 3PIO3 2K5QA 1W3SA 2PQEA 1ESFA 1XTDA 3IKJA 4K6LA 3GV3A 2F4VQ 1XMQQ 4DKAC 1XPOA 4DV3Q 3NBHB 5HGTA 4A3CH 3S1RB 2KBNA 3TEHB 1J5EQ 4KK7A 5C3EH 2CCZA 4JOIA 3SGIA 5M3MG 2I5LX 3TP5A 5LMNL 2XN9C 2K5HA 2X6GA 4A3DH 1SN8A 1AZQA 2CFMA 1T9HA 5COYA 2K04A 1YNJD 1OTCA 2Q8TA 5FLXL 1B1ZA 4HN7A 2KCCA 2N49A 4IUUA 1E2ZA 2R92H 3R8BA 4A3BH 3CF5A 2AHOB 1O7ZA 1TY2A 1JJGA 3R3OA 1F2MA 3S1MH 1B70B 1F9PA 5IP9G 2NVYH 3KLSX 3RN2A 2MO0A 1X65A 4GLVB 1SFOB 1XNRQ 4LFAQ 4ZRZA 1VQJA 2IL8A 2AMCB 4DU9A 2N88A 3A56A 1N36Q 1IXRA 1VQ9A 4X66Q 1PFSA 5IGFA 1D1IA 3ICEA 4V0BA 3H6MA 2V1CC 4FF1A 4EVOA 4BY7H 1B3QA 4DR2L 4A3MG 1BXTA 2O4XA 2WINB 2BOSA 2JE6I 2LXKA 4DXFA 3H91A 2VZAA 5E3FA 4A3EG 4LF7L 2VB2X 5CV7A 2NVXH 3TDQA 4HIKA 2WV6D 3W2DA 1Q46A 2CHBD 5C3WA 4I7AA 1D5XC 4ZCKA 1VQ7A 4J1MA 1P8LA 3OOCA 4CKBA 1AZPA 4XXEA 4F7XA 1VQCA 2K01A 2XWJB 1SBBB 1JE5A 3J81j 4IUPA 4OWWB 5IT9E 1HRJA 2XIWA 1EWCA 3CQZH 4P73A 2PMZB 3F2BA 3RZOB 3OSOA 4BBRG 3JAME 1HPCA 3HOVG 4APVA 2QCPX 2F0VA 4B3SQ 5K5PA 4IOAA 1WTHA 3DEOA 4DAYB 1PYWD 4YCWA 4DNTB 2N55A 4JI2Q 1W2BA 3NENA 1BDOA 3ULLA 2L1BA 3HOUH 4CJ0B 2SEBD 3I7FA 3MEHA 4X65L 4LFBL 3S2HH 2EY6A 5BN5A 2Z4HA 4DAVA 1VQ6A 2SNSA 2DNEA 4YHHL 2B2VC 4HMIA 4HJ8A 2O5IC 5M9OA 4J8QA 1CT1D 5KNDA 1FYCA 3PUXA 1SEBD 3BZCA 1TS5A 2K05A 1E2VA 1Z47A 3BS1A 2WAQB 1XPUA 4X3KA 1SJHD 3CXCA 1UNSA 3HOWB 1U9RA 3HFZB 5CV5A 3PIPA 2PZUA 3F2CA 2BA1A 1SMYC 1TWHH 2R7ZB 1CI3M 3IL8A 3HKZE 3CPWA 2F1MA 1DOMA 4ZKBB 1X3PA 1K8GA 1M90C 1NE3A 2BH8A 1YITA 4DR5L 2IX3A 4AYBG 4R9WA 3ULJA 1BKBA 1A3UA 3RMHA 3AFPA 2HHHL 3NSWA 4FNFA 1HNWL 4TRDA 5IWAL 4OWTB 2AWOA 3TS2A 4P72A 5M3MH 1ZXTA 1EQRA 2B3GA 1CUKA 1JWUD 2H5XA 3NEMA 5HY6A 3CCVA 1PH3A 1VQ4A 1GJXA 2YYZA 3T16A 4A93G 3H0GB 1VQMA 1N33Q 4MZ9A 2IPKD 3DEPA 3AMUA 5C0XI 4QUCA 2WB1E 3CC4A 5JJZA 3DMUA 3S1QB 2NWGA 1UE6A 1HNXQ 4OXPA 5DNFA 2KCTA 3KJOA 1SYDA 4DR2Q 4ZUIA 1YEZA 2RCFA 1HTLD 1YHBA 3OYYA 3S24A 5C0XJ 2E76C 4QB4A 3RR5A 4ID6A 4LF7Q 3M3YB 3VDYA 2JA5B 2I46A 2NN6G 4CDEC 1SYBA 1V9PA 3G6EA 1TWFB 5IP9H 4BBSG 4QUFA 4DV5L 1IBKQ 1HR0W 5IP7G 1X3GA 2OQ0A 3NBIA 1CKNA 4UDUC 3HP3A 4KY7A 3ERSX 3CCLA 1F2YA 1RD9D 4JI1Q 2EJMA 2E2JH 4NKLA 4B08A 4IQZA 4UHVA 1STBA 1U5KA 3HOYH 1HA5A 3SEBA 4A3EH 2OXPA 2ATWA 3OWEB 4H7BA 1BR9A 1L0YB 3MEFA 5EKKA 3OTOL 2ZTCA 4I65A 5GAGC 1FGBD 3E6ZX 5CYUA 4RCOA 4JI0L 4L5TA 4MIUA 4DUZL 3MFYA 4X3UA 1XNQL 4OO1G 2K52A 2F0HA 4NXML 2RSOA 2A8VA 1OO9B 3UE1A 3QR8A 1L1OC 3MXUA 5BN4A 3L9AX 1K0RA 4LFBQ 2JYOA 2WIIB 1GUSA 2E8GA 3VA7A 4IALA 5BR8L 4BBRH 3HOVH 4RGNA 2HIVA 3I4MB 1UE1A 3PGZA 2Q8IB 4GOPC 4LNQA 5M5WB 4BA1I 1SNMA 5T1GA 2EYJA 1QZGA 1FL0A 1XXGA 3K7AB 4YCUA 1M4VA 1ONLA 4YWLA 2KA7A 2EYFA 4HSPA 1VQ5A 5NUCA 4KHPL 2NB0A 1SLJA 2CQOA 3GDEA 3UE0A 1KIXA 3S15B 1ICFB 1STHA 4V190 2CQAA 2JA7H 1B3AA 3RN5A 3DWQA 1Y8NB 5FO8B 1RDPD 2HHHQ 1ZKOA 2Z6KC 1HNWQ 1W6JA 1BBUA 2A6EC 4Y52H 5EPJA 5AJ3L 4FP5D 4DK6C 3WOEA 1U0LA 2E74C 3GTLH 5M5XH 4POGA 3S17H 3ITPA 4QCLA 3JAMi 5JVG3 1LO5D 1VS0A 3VR2A 2M9VA 1CKMA 1X3EA 3S14H 2L55A 4B3RL 3HOXB 1ET9A 1AN8A 1BVSA 2BDNA 4R4CA 2KJXA 3CC7A 2KECA 5KEEA 1WI5A 3UDGA 2FFKB 4X62L 3M4OB 2IW3A 3CC2A 3VR6A 2KHSA 4LFCL 1S5ED 3NWTA 3DHQA 1FGUA 2K28A 2HT1A 4ME3A 2NZHA 1STYA 2AQ2B 2RDGA 4OL7A 3BYYB 1EZ8A 1AFPA 3JC66 3SR1A 3I2ZA 2SNMA 5KRUA 3SK8A 4A93H 2HCCA 2EIFA 1DOLA 1Y1VG 1PRTC 4NP5A 1A8VA 3E5SA 2B8FA 3S2DH 2F3WA 4XDXA 5CC4A 4DV1Q 3GTMB 2RHSB 4JPBW 1R4PB 4YWKA 3TS0A 2E2HH 1UE7A 4YIJA 2UUCQ 3HEJA 4GN4B 2PO4A 1WTOA 2NN6H 4AIMA 3TZDA 3FKIG 5EGTA 4BBSH 3KFUA 1S5BD 4LK1C 3A7LA 1QOHA 4UP8A 5IP7H 4DR6L 4DPGA 4JI0Q 4DUZQ 1XNQQ 3LWEA 1TKWB 2H1EA 3STBD 5IGDA 1TVXA 1TS2A 5ELBA 1L0WA 3I70A 2ZM6L 2M2LA 4A3JG 3NBHA 1F9RA 2WACA 4DV6Q 1W6KA 1CKNB 2BE5D 4DR1L 1ENCA 4CDFC 4DF7A 3QJYA 1K8OA 1EY6A 5I9OA 1WVLA 5BR8Q 3E0JA 2UXDL 3H94A 1I5FA 2F0WA 3OIPA 1AP0A 4L6TB 1E1OA 4OO1H 2RHQB 1EU3A 2K33A 1SMXA 3BZKA 5CORA 2B2WA 2KEEA 3OWFA 4C3IG 4A3KB 2IX0A 1NUCA 1RF2D 2EJFC 3IRBA 2ASBA 5C44G 1ENAA 3EQLC 1YJNA 1F2LA 4KHPQ 1ENFA 1QILA 4LF8Q 1H9KA 2EYPA 2I0QA 3E9IA 3F1ZA 1N8RC 3KUPA 1K3BC 2A69C 2EJGC 4L5RC 4LJZC 3M4QA 3HGBA 3HRZC 3QOLA 5AJ3Q 5ELCA 1TWGB 1OXTA 1A3VA 3GTPH 1EOVA 1YZ6A 2HDMA 5A35A 3J80c 1RTOA 1NCVA 1IW7C 5IIFA 1H9SA 3EVQA 4L63B 3PIP3 5K36G 1PFMA 5E4WC 5C4XB 4K5WA 4UP9A 3R93A 1XMOL 1PH2A 1YHAA 1PRTF 4IZ8A 4CKCA 3BDCA 3GTGH 3H3VI 3U50C 2VUMG 2O2LD 3I90A 2Y0SB 5L37A 1PV4A 1B7YB 3SK6A 3ER0A 4LFCQ 1TR5A 5ELNA 2FJ2A 2R6GA 1ESRA 1GUTA 2G5DA 2AQ3B 2YTVA 1SDFA 4H02A 5KGUA 2R7DA 1OXSC 1PDQA 2Q8RE 3ERQA 4DA2A 4OELB 2JA8G 1JJ2A 2K5WA 5T1IA 1I6HB 1DZ1A 4JCVE 5M5YH 1C0AA 1CK1A 3MZ5A 4FF2A 1VQGA 3F8TA 2VXWA 1FD7D 4IJLA 4BA2I 3PO3B 2CW0C 2ZJRA 4LF5L 1NMFA 4Y7NB 1WCMB 2Z6BA 1A6XA 1DM0B 4ILWA 3QG1A 3S16H 4LUZA 5LMUL 4IOCA 1KD1C 4PZ8A 3SDZA 1YHQA 2IHFA 4WRDA 1V8QA 5JJLA 2KVMA 5ISRA 4R4OA 3V2TA 4O1NA 1K83H 1MHWC 1E3PA 2L0CA 3ND8A 1BO0A 4TQUS 1Y1VH 3NWSA 4DV0L 1KRTA 4U673 2Z8LA 1HCZA 1LTLA 1VQFA 1Z9FA 1U4PA 3EFXD 4A3GH 1PLFA 1F9QA 1VQEA 2ZM6Q 5IYCG 4AYBE 3HS0C 2C5CA 2L12A 3I3CA 2OQKA 1QE6A 1S3OA 4HCSA 3FKIH 1I50H 1LV9A 3P75A 4DK1A 3PF4A 1Q8IA 4A3FH 4L5SA 2E5LQ 3D0FA 4HIMA 4XT3B 4OX9Q 4HR7B 5KIXA 2PI2E 1DD2A 2NZOA 4RGTA 3H15A 1VQNA 1EYCA 1HZAA 1Y14B 4A3JH 3TSSA 1S72A 1KL9A 2EPBA 1JWSD 1RODA 2RVLA 4GKJQ 2JP1A 1SYEA 5I4DA 5J3BA 5CBAE 3P20A 1PHJA 3NXWA 3T1YL 1C7YA 1I3QH 1KAAA 2MPMA 2NVQH 2DGYA 4C3IH 3K59A 1QJOA 1IKMA 1SJED 2ICIA 3LWUA 4AQYL 5ELOA 5C44H 5M3FB 3KLWA 3ONAB 2EZVA 2R93B 1KDBA 3BDLA 4DNIA 3D4WA 2MUYA 2UUBL 2R3ZA 3OMCA 2A68C 2BCOA 1PVOA 3TP7A 1IYUA 3G6JB 1MGSA 2MJ8A 2R61A 1IL8A 2DUDA 1TT2A 3GTOH 1XMOQ 1PYBA 1PYSB 2D5DA 1TS4A 1KC8C 3OW2A 3RZDB 1LACA 4LAAA 3P1HA 4BY1B 4KMUC 4C3HG 1AEXA 1GHKA 2F0JA 3HOXG 2B2VA 3SXHA 1SSOA 4RHRA 4R4QA 5JEAJ 2F0NA 1QG7A 4XQNA 5K36H 2UXBL 5CR3A 3QIAA 1LLRD 1AE2A 1VMCA 4ZUJA 3IFDA 2VUMH 2JA6G 4NPSA 1H9SB 3EN2A 4M1UB 1TQOA 2J0TD 4HAEA 4LF5Q 4X6AH 1KDCA 1Q3LA 1PFBA 3W1BA 4JI4Q 2EYOA 3Q23A 1MSGA 1FNVA 3MXNA 4A3IB 3CRKC 3CKIB 1I94L 4P75A 5BN3A 3M7GA 3SE0A 1ZYRD 4HTHA 3HOZG 2JA8H 1PH8A 4Q0FA 4DV0Q 4KHZA 1Y1WB 1CTMA 1Z6HA 1Y8OB 4MNOA 4RCNA 1YIJA 4FXGC 3RD4A 3S1NH 3PO2B 1M1KC 5FJ8H 3I4NG 4IFDI 1TWCB 3FMCA 3MXPA 4FO2A 1D5ZC 1JOKA 1L0XB 4CKEA 3SK4A 1EIFA 4DGZA 4WJ4A 4LMQD 1MKHA 4IFDJ 4C3JB 5G3LD 1UAPA 4ME5A 2M00A 5DM63 3BU2A 4DR7L 2I5MX 3D6WA 1JOQA 2E2IB 3GTJB 4QGUA 3OPOA 4IN3A 2VQFL 4JI6Q 1B2TA 1T5EA 4H44C 3UDXA 4U68A 1TY0A 2GVBA 4E6IA 4LF4Q 2B39A 2WB1B 4BS9A 1Y69U 2DNCA 2ALYB 5D3DA 4JV5L 1DONA 5C4ZA 1YNNC 4X64L 4G7OC 4RAUC 2LXJA 2JEAI 1IBML 4NB3A 2A6HC 1S5FD 1GD7A 1CKOA 2B63G 5C3EB 3X3MA 4RA8A 4IUTA 2MHVA 1SE8A 1E0BA 1N32L 1NMGA 4WJ3M 5LMNQ 1B44D 1EY0A 4AQYQ 1JMCA 1B4OA 4A3DB 1VDZA 2UUBQ 1OXVA 2FXQA 4QF4A 3D8GA 4G57A 4CBVA 3J81i 1K28A 1LT6D 1SMYD 1HZBA 4QJFA 1EL0A 2R92B 4A3BB 1L1OA 2G9HD 3EJIA 1EY4A 2ZT9C 3S1MB 1Q90A 1Q82C 2NVYB 4O42A 1EEID 1HQRD 2F52A 4A76A 5JVH3 3AQQA 5EPKA 1EIHA 4X3SA 2Y0SG 4B3TL 3K6OA 4GOPA 1LTTD 2XTIA 3DUZA 2UXBQ 1UEBA 3I55A 3T1HL 1HZ9A 1TWAH 3GTKH 2KOLA 4BY7B 1DOKA 4OGQC 3CMEA 1IZ6A 4ULLA 1XPRA 1MD2D 2AUJD 1D2BA 4C3HH 2OCEA 2IY5B 2NVXB 1XX8A 2B2YC 4PV1C 3HZXA 2ZXRA 1QCBD 5EAYA 2DY8A 4DNRB 2QGQA 1EUJA 3PSIA 4AH6A 1I94Q 2F4IA 1ILPA 2CKZB 2SOBA 1WCMG 4K8JA 2RF4A 4KV6A 1V43A 1ASYA 5A2QL 4A3MH 2Z6KA 1QNKA 1H9RA 4JI7L 1JJCB 2JA6H 1VQDA 3CQZB 1Z7TA 4KJNA 5FK9C 5C0XG 5C3XA 4DV7L 1HFGA 5JJIA 1O80A 4S3SA 2UXCL 2P5ZX 3C3LA 2F0EA 3V96A 5I6WA 5C4JH 3CCSA 1LYLA 2HQEA 3HOZH 1EQTA 1VQPA 3I56A 1VQ8A 2K5VA 4IURA 3HOUB 1CQVA 4DR7Q 4MTNA 4X65Q 2DJGC 3S2HB 3MXNB 1TXYA 4PG3A 4YHHQ 1KQSA 3I4NH 1J6QA 3U9SA 3D4RA 1VMPA 2DJFC 4HJ7A 1IYJB 4G4KA 4H13C 4LF9L 1XJVA 4RG1A 1HH2P 3NELA 4IPGA 5EJWA 4JV5Q 1QNUA 2MFIA 3FRPB 4X64Q 1WD0A 4QIWB 4PMWA 3J80E 1EY8A 4JI8L 1KXLA 4DN4M 4RWSC 1HHVA 1PTOH 3A7AB 2EXZA 3PQIA 1TU2B 2K5NA 1IBMQ 3K80C 1QVGA 2D0OA 3BG3A 1TWHB 4K5XA 4KTAA 5IT9c 1N32Q 3CCJA 3K81C 4OONA 1BCPC 3GTQH 5EBDA 1WTPA 2QDLA 4DUYL 1CFMA 1NTGA 5IGBA 3Q8DA 3KLRA 3EBEA 3JAMc 2BH2A 1SE3A 1CA6A 5AFWA 4DR5Q 3TBIB 5J22A 1NY4A 2R93G 1O78A 5M3FG 3TQYA 1PH6A 3A5ZB 4O2DA 3AYHB 5IWAQ 4LF6L 1EY7A 2B63H 5M3MB 4OWXB 1GUGA 1I4HA 1U4LA 2Q2UA 2YU9H 1PTOC 1VCIA 3HG9A 3G7LA 4EQ5A 2NZ1D 5LL6X 2A74C 1CZGA 1C9OA 2RDFA 3A0JA 3C46A 3BVGA 2A6ED 4B3TQ 2K4KA 2Z4IA 3U9OA 2KCMA 2PZWA 4TSSA 3T1HQ 5FLMG 1RL2A 3NTHA 4K8IA 4KY6A 4OHJA 5J39A 4XIGS 1AW7A 3ULPA 2PZTA 1VQOA 3DWPA 2K32A 1R4QB 3FEWX 2ZJPA 1X55A 4HSVA 4UY8C 4RGMA 2VQEL 2QW7A 2HIXA 4K5VA 4DV5Q 1L1OB 1QB5D 4KJOA 2XGTA 1X3FA 2GN5A 2EOTA 1I4QA 1R9TH 2E2JB 3IAYA 3PUWA 1GM5A 5C6AA 3CP0A 2Z1CA 2EY1A 1V1OA 3HOYB 3T4AC 1JCKB 5DAUA 1MJEA 1SNDA 4GOPB 1PRTD 4NXNL 1X9NA 3NHHA 4DV7Q 1RKNA 3PCOB 4OIJA 1IL2A 3T53B 1H95A 4GLAC 1HR0L 3M85A 3OTOQ 4C2MH 2UXCQ 2OTJA 3GP7A 4GS3A 1PH1A 3PF5A 1D6EC 3PO2G 4Y7NH 3MHBA 1SNPA 3CD6A 1A0IA 4EQOA 2FMCA 1U4MA 3TREA 2LFNA 3STBC 2WFWA 4NXMQ 2A1AA 3NP8A 1QZHA 4CJ1B 4LW1A 1S4ZA 3GD7A 4L5QA 2D62A 2X69A 2F3IA 1P16A 5J1ZA 3E3XA 4DXGA 4CDCC 4WFN3 1PH4A 1N34L 5DM73 5C0XH 3EROA 2J7ZA 4BBRB 1WJJA 3HOVB 4P2CB 1BCPF 3U58A 4J6HA 3Q0AA 1UEAB 5LL6S 3IFTA 3D3RA 4CJ2C 4JI8Q 5IOCA 3KBGA 2CVRA 1T5XD 5IE8A 4XQJA 2EXDA 2LY7A 4FVMA 4HMJA 2Q2IA 1WFQA 2NTTA 1CM9A 2WAQG 2KCNA 3FPPA 3HKSA 4JI5L 2F0PA 3HOWG 1U4RA 5A2QE 1OXXK 1PTOF 5FLXc 1ASZA 4A3CG 1PZJD 1YVCA 3CW2C 2JA7B 1B9MA 5C3EG 2Q2HA 2NVTH 2R7ZG 5LMNW 5LHY1 4R1JA 4GKKL 4N8X1 3GV6A 4GNXC 5IODA 1EWIA 4FXKC 4TVAB 3AB9A 2FHTA 1Y8PB 1LUZA 3GTLB 3S17B 5M5XB 4JBKA 2F4VL 1PRTB 1WOCA 2UUAL 2A69D 1HXYD 3PUVA 4DV3L 2QEJC 2I5HA 3S14B 2IX1A 2F0QA 3S1RH 2K14A 4B3RQ 1D1KA 1E22A 5IGCA 3TMEA 5IGEA 5ELFA 4R4IA 3R2TA 4F8MA 3C1EA 1GHJA 2YTXA 2VNUD 4AYBB 4X62Q 2PYKA 3G48A 4HIOA 1BUVT 2F0FA 3DXJC 4IPDA 2EVBA 3H0GG 3VYSA 4ZAIA 3TRZA 1CHQD 4F88A 1STNA 2JEBI 4ZQ3A 4LWCA 4KI0A 2LMCB 2OF1A 4O0AA 4A93B 5JOBA 4H0LC 4BY7G 1KNEA 2VQEQ 2AWNA 2QF7A 4K6DA 3KYHC 3CHBD 1EFWA 3OW7A 1IBLL 3S2DB 2DN8A 2JA5G 4JVZA 1STEA 5FOBB 1Q81C 1FR3A 4K2LA 4R8IA 1SFOH 4LFAL 2E2HB 3KK7A 1N36L 4DK0A 4X66L 4EX5A 5DEHA 3NPPA 2B2TC 1PH9A 2QILA 1AE3A 3KBXA 2F0KA 1JQYD 4N9TA 4NXNQ 4ABNA 2L4NA 4BBSB 1YBYA 1ZEQX 2Z9HA 1HR0Q 2B2UC 5GAEC 1MI2A 2KUMA 4DR6Q 1WTVA 3CCMA 1F2ZA 2BA0A 1VF7A 2ZTEA 2OEOA 4B9WA 4GN5A 4DV2L 1Q7YC 2F0OA 3M4PA 1QUQA 2CH4A 2CWPA 1JC7A 3VYTA 1K8AC 4Q5VA 1PZKD 3R2IA 4DR1Q 4QQBX 5I2YA 4PNYA 4UPAA 1DYQA 2CWAA 3K5NA 1PH5A 4FXDA 1YI2A 4RKBA 2UXDQ 4ODGA 3CCQA 1Q12A 3Q6SA 3T51B 1LT4D 3D31A 3VR5A 4IUQA 1G8ZD 5EQ0A 2H4OA 2WKCA 3SVMA 3RZOH 4JI3L 1M8AA 3DM3A 4LUVA 5CMDA 4B3SL 2F0GA 3VR3A 3I4MG 2K03A 2D2CC 1WD1A 4K14A 3A5UA 3KJPA 5HURA 1H9JA 1KABA 1K0SA 2TSSA 1A2TA 4JI5Q 2LS01 4KKUA 3L0OA 3UI2A 4ZK9B 1NAPA 2PQAA 2MGSA 4QY7A 1EYAA 2MNAA 4J15A 4CDDC 3BVMA 2JN4A 2O5JC 3Q22A 4GKKQ 1BBXC 3A55A 2JA9A 2K7VA 1HQMC 1VF5C 3A8IE 3DWAA 4DR3L 5E7NA 1DGSA 3A8KE 3FVQA 3GTPB 1DXMA 1SYGA 2F0SA 4MTKA 2UUAQ 2EE1A 3HOWH 2NBFA 1VQIA 4RH6A 4CHTB 3J7YW 4WORA 1CA5A 1YNJC 1E2WA 2R7ZH 2IJ0A 1II3A 5HGQA 3GTGB 3KOJA 1FJGL 5JPNC 2EDGA 3BDOA 2HDLA 2A68D 2PCFB 1UWVA 4JK1C 3GQBA 2GVAA 4UAIA 4KD4A 3RLNA 3KF6A 1E24A 3VYUA 1K9MC 4GZYC 3L3OC 5IY0A 1BBWA 3QB3A 1X32A 4KN4C 5M5YB 3F2UA 1IBLQ 1H9MA 4K2KA 2L15A 4A75A 4XYOA 4PQXA 3ZYYX 4RGOS 1N33L 2V4DA 3H0GH 3OIQA 3S16B 1HFNA 3MXGA 3J80L 1VQKA 1LT3D 5H1SE 1EY9A 5LMUQ 3V05A 1SR3A 3A74A 1QWYA 1SAPA 1EYDA 3S1QH 4P71A 5GQOA 3VYRA 1BNZA 1HNXL 1K83B 2K1BA 4N9PA 3I91A 1ZYRC 4IUNA 3MTSA 5JEAG 1Y1VB 5FKAC 2DY7A 3HOYG 1X56A 3HKZB 3M3YH 2JA5H 1LTBD 5CBEE 3B6YA 1TWFH 1IHZA 1MSHA 2JXMB 4A3GB 4DV2Q 1IBKL 4HCEA 1NSNS 1GUWA 5TSSA 3L7ZC 1VQBA 4Z9CB 1LTRD 1JORA 3CU7A 5CV9A 4JBMA 1FVIA 3SHLA 1VQLA 3FKIB 1I50B 4JI1L 3H3VH 3SK5A 2KEDA 4A3FB 3KF8A 2L11A 4JOIC 3VA5A 1Q8KA 3E0EA 2IWHA 5E1FA 2JK8A 1SNCA 1EIYB 4C1NK 3BYTB 1Q1BA 4JI3Q 2Q2TA 1YNXA 5IYCH 3CCUA 1I6VC 4A3JB 1STAA 1ILQA 1O7IA 2RBMA 4ALPA 2B2YA 1FNUA 1LTSD 4XTCS 5F2DA 2MO1A 3K58A 4I7ZC 4IO9A 4F87A 4A3KG 1YJWA 1HZCA 1RJTA 3K5LA 1CSPA 1QUQB 4IFDG 3T1YQ 1I3QB 1RCVD 4R8NA 1EZ6A 3C1FA 3H3VC 3W5OA 2NVQB 1LTID 2EQSA 4TKOB 3J81c 4C3IB 5ELDA 4C1NI 1G91A 1HUNA 3A8JE 4DR3Q 4FF4A 5C44B 3I4MH 2JA7G 5M5WH 1PH7A 1YNND 1G6PA 5E4XA 2RA4A 1K3RA 3RNUA 3WOFA 1MBYA 3K7AH 5I9PA 2A6HD 2XSCA 1N9WA 4K0KL 3NQTA 3MVVA 1VQHA 3GTOB 3M9BA 3FHWA 4XYQA 2KHJA 4HJ9A 5FO9B 3S9WA 1FJGQ 1NR2A 2ZTDA 2VB3X 1SYCA 1DJRD 4RKLA 5EPLA 4KLKA 3S15H 5C4XG 2PQAB 4XQQA 1SXTA 2PMZE 3I4OA 2PNHA 1SE2A 4BWGB
chains in the Genus database with same CATH topology
2NN6I 3QO2A 1V1PB 3M4YA 4L8JA 2QDBA 4EGVA 3K5MA 5D14A 2HUGA 3NE5B 2VUMB 1JR0D 3X3NA 3NTIA 2PW5A 1Q1EA 3Q24A 3NUCA 3GO5A 3RUZA 1A15A 2JA8B 2F0LA 1KLGD 1SE4A 5I2XA 4OO1I 5G3LF 1SYFA 4KN7C 5EKLA 1EIGA 1WTWA 3P7JA 3S1NB 1EY5A 1XWEA 2PW7A 4IUVA 1A2UA 1XYIA 1HA6A 3VR4A 5C5LA 3MFGA 2K6AA 5JEAH 2E75C 2BDOA 2RKSA 2C9OA 3O13A 5FLXE 5C4HA 5D3IB 4X3TA 3C2PA 1SNQA 3I73A 3J7AF 1SNOA 2F0DA 3NQIA 5I6YA 1GXDC 1PZID 4PMBA 2KQ3A 1NR4A 2D9UA 5CGKA 1O7LA 3D4DA 3TP6A 4DAPA 1J8IA 3OMGA 4JBWA 3NTKA 1ML0D 3OHXC 1D5MC 2FINB 3D6CA 1EFID 2WP8J 2IT1A 4IFDH 2RQXA 3MWYW 2K5DA 5CV8A 3I72A 1IKLA 1BCPD 1B50A 2XWBB 1C4QA 3T56B 1I4PA 1KNAA 1TS3A 4WJWA 2ZXPA 2ENBA 4RFBA 2RSNA 3BZDB 1WTXA 2JSOA 5EBCA 2ID0A 3DM1A 3CRLC 3M7NA 2EYLA 1STGA 1TWAB 3GTKB 5IGGA 3J7AV 1PTOD 3J81L 2AQ1B 1S5CD 4C3HB 2F0TA 1DCZA 3LNNA 4XT1B 2AUKA 2J4XA 3FDTA 3N52A 5JAVA 2XVSA 2HCIA 3AU7A 1PXUA 2EY5A 4A3MB 2X6LA 1RTNA 5JPMC 2JA6B 2LKVA 1C8CA 4A3EB 2F0MA 4PMCA 2XNAC 4CGYB 1TIID 2F3VA 5C4JB 3QOJA 4OIKA 4G7HC 3HOZB 5KNBA 2I07B 1O7YA 2WKDA 2EYHA 4G7ZC 1G6ZA 1BCPB 3PUYA 4ZKCB 4RHSA 4C3JG 4KD3A 1CHPD 3I4NB 1EWHA 2BE5C 2QKIC 1PFNA 1UUPA 3N6RA 2A73B 3BVZA 2PPBC 1LTAD 4FYDA 2B8GA 2NUCA 2F0UA 1XTCD 3I8ZA 3H09A 2G9DA 4NW2A 1PTOB 2XRQD 4NDXA 3TN2A 2ZXOA 2B2TA 1KDAA 4DFAA 1JWMD 3GTQB 1G291 1I4RA 5CV4A 1I4GA 1JOOA 1ICWA 3ND9A 2B2UA 3MAQA 1PMRA 5KNCA 3PMFA 1EOTA 4KKSA 4EQNA 2L9HA 2B63B 3K57A 2YU9B 3WDNA 1GOZA 4QMGA 2GA4B 3A54A 2SDFA 1RHPA 4KKTA 1K8MA 1B9NA 3URYA 3LX0A 5D65A 1GUOA 2EY2A 4NMZA 1IW7D 1LABA 1JICA 1WTQA 3EA6A 5IT9L 2FMMA 3KLSA 3RLFA 4ZLTF 1GUNA 3PUZA 4ZYSA 3JAML 5C5MA 4M8AA 1S5DD 2NTSA 4KHVA 3MA2B 3TP8A 3T13A 1EQVA 1HTPA 1WTRA 1B53A 3TZUA 3PV0A 1G2SA 1R9TB 4MN3A 5FO7B 3W3AA 2ICEC 1KLUD 1BF4A 5KYIA 1G2TA 1LT5D 1JB3A 1J9OA 2L5TA 1F9SA 4C2MB 2B2WC 4HEDA 3I4LA 2XRSD 2CW0D 3K5OA 5CV6A 4DAYA 5KYLA 3MC0B 1CZWA 1EEFD 1BOSA 4B9XA 3NK9A 2F0IA 1JE4A 1IYVA 2PNRC 2A5HA 1HUMA 4MHEA 2NYZD 1FNWA 1EU4A 1C48A 2RDHA 3J81E 2MP1A 4FF3A 2E2DC 4KY5A 1ET6A 4EQPA 1KTKA 1F77A 1OXUA 5EKIA 1BQQT 1CQFA 4C56C 2EYMA 5ELEA 3QWNA 2TMPA 1LTGD 3K0YA 1X3QA 2F03A 2NVTB 1V1PA 1A3TA 3FPUB 1I4XA 2OT2A 3PIO3 2K5QA 2PQEA 1ESFA 3IKJA 4K6LA 3GV3A 5HGTA 3S1RB 4KK7A 3TP5A 2XN9C 2X6GA 1AZQA 5COYA 2K04A 1YNJD 2Q8TA 5FLXL 1B1ZA 4HN7A 2KCCA 4IUUA 1E2ZA 3R8BA 1O7ZA 1TY2A 3R3OA 1F2MA 1F9PA 3KLSX 1SFOB 4ZRZA 2IL8A 4DU9A 2N88A 3A56A 5IGFA 1D1IA 4V0BA 3H6MA 4FF1A 4EVOA 1BXTA 2O4XA 2WINB 2BOSA 2JE6I 4DXFA 3H91A 5E3FA 2VB2X 5CV7A 3TDQA 2WV6D 3W2DA 2CHBD 5C3WA 1D5XC 4J1MA 1AZPA 3OOCA 4CKBA 4XXEA 4F7XA 2K01A 2XWJB 1SBBB 4IUPA 5IT9E 1HRJA 2XIWA 1EWCA 2PMZB 3RZOB 3OSOA 3JAME 1HPCA 2QCPX 2F0VA 5K5PA 3DEOA 1PYWD 4DNTB 2N55A 1BDOA 2L1BA 4CJ0B 2SEBD 3MEHA 2EY6A 5BN5A 2Z4HA 4DAVA 2SNSA 2DNEA 2B2VC 4HMIA 2O5IC 5M9OA 4J8QA 1CT1D 5KNDA 1FYCA 3PUXA 1SEBD 1TS5A 2K05A 1E2VA 1Z47A 3BS1A 2WAQB 4X3KA 1SJHD 1UNSA 3HOWB 1U9RA 5CV5A 2PZUA 2BA1A 1SMYC 2R7ZB 1CI3M 3IL8A 2F1MA 1DOMA 4ZKBB 1X3PA 2IX3A 4R9WA 1A3UA 3RMHA 3NSWA 4FNFA 4TRDA 2AWOA 1ZXTA 1JWUD 1GJXA 2YYZA 3T16A 3H0GB 2IPKD 3DEPA 3AMUA 5C0XI 4QUCA 3S1QB 5JJZA 3DMUA 2NWGA 5DNFA 1SYDA 4ZUIA 5C0XJ 1HTLD 2E76C 4QB4A 4ID6A 3M3YB 2JA5B 2I46A 2NN6G 1SYBA 1TWFB 4QUFA 3NBIA 4UDUC 3HP3A 4KY7A 1F2YA 1RD9D 2EJMA 4NKLA 4B08A 4IQZA 1STBA 1HA5A 3SEBA 2OXPA 3OWEB 4H7BA 1BR9A 1L0YB 5EKKA 4I65A 1FGBD 3E6ZX 5CYUA 4RCOA 4MIUA 3MFYA 4X3UA 4OO1G 2F0HA 2RSOA 1OO9B 3MXUA 5BN4A 3L9AX 2JYOA 2WIIB 1GUSA 3VA7A 4IALA 4RGNA 3I4MB 2Q8IB 5M5WB 4BA1I 1SNMA 5T1GA 2EYJA 1XXGA 3K7AB 1M4VA 1ONLA 2KA7A 2EYFA 4HSPA 5NUCA 2NB0A 3S15B 1STHA 4V190 2CQAA 1B3AA 3DWQA 1Y8NB 5FO8B 1RDPD 1ZKOA 1W6JA 2A6EC 5EPJA 4FP5D 3WOEA 2E74C 3ITPA 4QCLA 5JVG3 1LO5D 3VR2A 2M9VA 2L55A 3HOXB 1ET9A 1AN8A 2BDNA 2KJXA 2KECA 5KEEA 2FFKB 3M4OB 2IW3A 3VR6A 2KHSA 1S5ED 3NWTA 3DHQA 2K28A 1STYA 2AQ2B 2RDGA 4OL7A 3BYYB 1EZ8A 1AFPA 3SR1A 2SNMA 5KRUA 3SK8A 2HCCA 1DOLA 1PRTC 4NP5A 3E5SA 2B8FA 2F3WA 4XDXA 5CC4A 3GTMB 1R4PB 4YIJA 3HEJA 2PO4A 1WTOA 2NN6H 3TZDA 5EGTA 1S5BD 4LK1C 3A7LA 1QOHA 3LWEA 1TKWB 2H1EA 5IGDA 1TVXA 1TS2A 5ELBA 3I70A 2M2LA 3NBHA 1F9RA 2WACA 1W6KA 2BE5D 1ENCA 4DF7A 1K8OA 3QJYA 1EY6A 5I9OA 1WVLA 3E0JA 3H94A 2F0WA 3OIPA 1AP0A 4L6TB 4OO1H 1EU3A 2K33A 5CORA 2B2WA 2KEEA 3OWFA 4C3IG 4A3KB 2IX0A 1NUCA 1RF2D 2EJFC 1ENAA 3EQLC 1F2LA 1ENFA 1QILA 1H9KA 2EYPA 3KUPA 2A69C 2EJGC 4LJZC 3HGBA 3HRZC 3QOLA 5ELCA 1TWGB 1OXTA 1A3VA 2HDMA 5A35A 1RTOA 1NCVA 1IW7C 5IIFA 1H9SA 3EVQA 4L63B 3PIP3 5K36G 1PFMA 5E4WC 5C4XB 4K5WA 3R93A 4IZ8A 1PRTF 4CKCA 3BDCA 2O2LD 3I90A 2Y0SB 3SK6A 1TR5A 2FJ2A 2R6GA 1ESRA 1GUTA 2AQ3B 1SDFA 5KGUA 1OXSC 1PDQA 2Q8RE 3ERQA 4DA2A 2K5WA 5T1IA 1I6HB 1DZ1A 1CK1A 3MZ5A 4FF2A 2VXWA 1FD7D 4BA2I 3PO3B 2CW0C 4Y7NB 1WCMB 1A6XA 1DM0B 4ILWA 3QG1A 3SDZA 4WRDA 1V8QA 2KVMA 5ISRA 3V2TA 4O1NA 2L0CA 3ND8A 1BO0A 4TQUS 3NWSA 4U673 2Z8LA 1HCZA 1U4PA 3EFXD 1PLFA 1F9QA 3HS0C 2C5CA 2L12A 3I3CA 1QE6A 4HCSA 1LV9A 3P75A 4DK1A 1Q8IA 4XT3B 4HR7B 5KIXA 1DD2A 4RGTA 1EYCA 3TSSA 2EPBA 1JWSD 1RODA 2RVLA 2JP1A 1SYEA 5I4DA 5CBAE 3P20A 3NXWA 1KAAA 2MPMA 3K59A 1QJOA 1IKMA 1SJED 2ICIA 3LWUA 2R93B 5M3FB 2EZVA 3ONAB 1KDBA 3BDLA 3D4WA 2MUYA 2R3ZA 3OMCA 2A68C 2BCOA 3TP7A 1IYUA 3G6JB 1MGSA 2MJ8A 2R61A 1IL8A 1TT2A 2D5DA 1TS4A 3RZDB 1LACA 4LAAA 3P1HA 4BY1B 4KMUC 4C3HG 1AEXA 1GHKA 2F0JA 2B2VA 3SXHA 1SSOA 4RHRA 5JEAJ 2F0NA 1QG7A 4XQNA 5K36H 5CR3A 3QIAA 1LLRD 1VMCA 4ZUJA 3IFDA 1H9SB 4M1UB 1TQOA 2J0TD 4HAEA 1KDCA 1Q3LA 1PFBA 2EYOA 3Q23A 1MSGA 1FNVA 3MXNA 4A3IB 3CRKC 3CKIB 5BN3A 3M7GA 3SE0A 1ZYRD 4HTHA 4Q0FA 4KHZA 1Y1WB 1CTMA 1Z6HA 1Y8OB 4RCNA 4FXGC 3RD4A 3PO2B 4IFDI 1TWCB 3FMCA 3MXPA 4FO2A 1D5ZC 1JOKA 1L0XB 4CKEA 3SK4A 4DGZA 4LMQD 4IFDJ 4C3JB 5G3LD 1UAPA 4ME5A 2M00A 5DM63 3D6WA 1JOQA 2E2IB 3GTJB 3OPOA 4IN3A 1B2TA 1T5EA 4H44C 4U68A 1TY0A 4E6IA 2B39A 2WB1B 4BS9A 1Y69U 2DNCA 5D3DA 1DONA 5C4ZA 1YNNC 4G7OC 4RAUC 2JEAI 2A6HC 1S5FD 5C3EB 3X3MA 4RA8A 4IUTA 2MHVA 1E0BA 1B44D 1EY0A 1B4OA 4A3DB 1VDZA 1OXVA 4QF4A 3D8GA 4G57A 4CBVA 1LT6D 1SMYD 1EL0A 2R92B 4A3BB 2G9HD 3EJIA 1EY4A 2ZT9C 3S1MB 1Q90A 2NVYB 4O42A 1EEID 1HQRD 5JVH3 5EPKA 1EIHA 4X3SA 3K6OA 1LTTD 3DUZA 2KOLA 4BY7B 1DOKA 4OGQC 4ULLA 1MD2D 2AUJD 1D2BA 2NVXB 1XX8A 2B2YC 4PV1C 3HZXA 2ZXRA 1QCBD 2DY8A 4DNRB 1ILPA 2F4IA 2SOBA 4KV6A 4K8JA 1V43A 5A2QL 1QNKA 1H9RA 3CQZB 1Z7TA 4KJNA 5FK9C 5C0XG 5C3XA 1HFGA 1O80A 4S3SA 3C3LA 2F0EA 3V96A 5I6WA 2HQEA 1EQTA 4IURA 3HOUB 1CQVA 3S2HB 3U9SA 3D4RA 1VMPA 4G4KA 4H13C 5EJWA 1QNUA 3FRPB 1WD0A 4QIWB 4PMWA 3J80E 1EY8A 4DN4M 4RWSC 1HHVA 1PTOH 3A7AB 2EXZA 1TU2B 3BG3A 1TWHB 4K5XA 4KTAA 1BCPC 5EBDA 1WTPA 1CFMA 5IGBA 3KLRA 1SE3A 1CA6A 5AFWA 3TBIB 5J22A 1O78A 1EY7A 5M3MB 1GUGA 1I4HA 1U4LA 1PTOC 1VCIA 3HG9A 3G7LA 2NZ1D 5LL6X 2A74C 1CZGA 2RDFA 3C46A 3BVGA 2A6ED 2Z4IA 3U9OA 2PZWA 4TSSA 3NTHA 4K8IA 4KY6A 4OHJA 5J39A 4XIGS 1AW7A 2PZTA 3DWPA 2K32A 1R4QB 3FEWX 4HSVA 4RGMA 4K5VA 1QB5D 4KJOA 2EOTA 1I4QA 2E2JB 3IAYA 3PUWA 5C6AA 2Z1CA 2EY1A 1V1OA 3HOYB 3T4AC 1JCKB 5DAUA 1SNDA 1PRTD 3NHHA 1RKNA 4OIJA 3T53B 3M85A 3GP7A 1D6EC 3MHBA 1SNPA 4EQOA 2FMCA 1U4MA 2LFNA 3NP8A 4CJ1B 1S4ZA 3GD7A 2D62A 2X69A 5J1ZA 4DXGA 4WFN3 5DM73 5C0XH 3EROA 2J7ZA 4BBRB 3HOVB 4P2CB 1BCPF 4J6HA 3Q0AA 1UEAB 5LL6S 3IFTA 3D3RA 4CJ2C 5IOCA 3KBGA 2CVRA 1T5XD 4XQJA 2LY7A 4FVMA 4HMJA 2NTTA 1CM9A 2KCNA 3FPPA 2F0PA 1U4RA 5A2QE 1OXXK 1PTOF 1PZJD 2JA7B 1B9MA 5LHY1 3GV6A 5IODA 4FXKC 3AB9A 2FHTA 1Y8PB 3GTLB 3S17B 5M5XB 1PRTB 2A69D 1HXYD 3PUVA 2QEJC 3S14B 2IX1A 2F0QA 1D1KA 5IGCA 3TMEA 5IGEA 5ELFA 3R2TA 4F8MA 3C1EA 1GHJA 2VNUD 4AYBB 2PYKA 1BUVT 2F0FA 3DXJC 2EVBA 3VYSA 4ZAIA 1CHQD 4F88A 1STNA 2JEBI 4ZQ3A 4KI0A 2LMCB 2OF1A 4A93B 5JOBA 4H0LC 1KNEA 2AWNA 2QF7A 4K6DA 3CHBD 3OW7A 3S2DB 2DN8A 1STEA 5FOBB 1FR3A 4K2LA 4R8IA 2E2HB 3KK7A 4DK0A 5DEHA 2B2TC 3NPPA 2QILA 3KBXA 2F0KA 1JQYD 4N9TA 4ABNA 2L4NA 4BBSB 1ZEQX 2B2UC 1MI2A 2KUMA 1WTVA 1F2ZA 2BA0A 1VF7A 2OEOA 4B9WA 2F0OA 1JC7A 3VYTA 4Q5VA 1PZKD 3R2IA 5I2YA 4PNYA 1DYQA 3K5NA 4FXDA 4RKBA 4ODGA 1Q12A 3Q6SA 3T51B 1LT4D 3D31A 3VR5A 4IUQA 1G8ZD 5EQ0A 2H4OA 2WKCA 3SVMA 1M8AA 5CMDA 2F0GA 3VR3A 2K03A 2D2CC 1WD1A 4K14A 5HURA 1H9JA 1KABA 2TSSA 1A2TA 2LS01 4KKUA 3UI2A 4ZK9B 1NAPA 2MGSA 1EYAA 3BVMA 2O5JC 3Q22A 1BBXC 3A55A 2K7VA 1HQMC 1VF5C 3A8IE 3DWAA 3A8KE 3FVQA 3GTPB 1DXMA 1SYGA 2F0SA 2EE1A 2NBFA 4CHTB 4RH6A 3J7YW 4WORA 1CA5A 1YNJC 1E2WA 2IJ0A 1II3A 3GTGB 5JPNC 2EDGA 3BDOA 2HDLA 2A68D 2PCFB 4JK1C 3GQBA 4UAIA 4KD4A 3VYUA 4GZYC 3L3OC 3QB3A 1X32A 4KN4C 5M5YB 3F2UA 1H9MA 4K2KA 4XYOA 4PQXA 3ZYYX 4RGOS 2V4DA 3OIQA 3S16B 1HFNA 3MXGA 3J80L 1LT3D 1EY9A 3V05A 1QWYA 1SAPA 1EYDA 3VYRA 1BNZA 1K83B 2K1BA 4N9PA 3I91A 4IUNA 1ZYRC 3MTSA 5JEAG 1Y1VB 5FKAC 2DY7A 3HKZB 1LTBD 5CBEE 1IHZA 1MSHA 2JXMB 4A3GB 4HCEA 1NSNS 1GUWA 5TSSA 3L7ZC 4Z9CB 1LTRD 1JORA 3CU7A 5CV9A 3SHLA 3FKIB 1I50B 3SK5A 2KEDA 4A3FB 3KF8A 2L11A 3VA5A 2IWHA 5E1FA 1SNCA 4C1NK 3BYTB 1Q1BA 1I6VC 4A3JB 1STAA 1ILQA 2RBMA 2B2YA 1FNUA 1LTSD 4XTCS 5F2DA 3K58A 4I7ZC 4F87A 1RJTA 3K5LA 4IFDG 1I3QB 1RCVD 4R8NA 1EZ6A 3C1FA 3H3VC 2NVQB 1LTID 4TKOB 4C3IB 5ELDA 4C1NI 1G91A 1HUNA 3A8JE 4FF4A 5C44B 1YNND 5E4XA 2RA4A 3WOFA 1MBYA 5I9PA 2A6HD 2XSCA 3NQTA 3MVVA 3GTOB 4XYQA 5FO9B 3S9WA 1NR2A 2VB3X 1SYCA 1DJRD 4RKLA 5EPLA 4XQQA 1SXTA 1SE2A 4BWGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNY A;  1SYE A;  1EYD A;  4MIU A;  4K5W A;  4NP5 A;  4RKB A;  5KYI A;  2RDF A;  3E5S A;  4ME5 A;  4ODG A;  3NXW A;  2SOB A;  2M00 A;  2QDB A;  4KV6 A;  4K8J A;  2F0H A;  4IUN A;  2F3W A;  3D6C A;  4N9P A;  4IZ8 A;  1U9R A;  1KAA A;  3U9O A;  5CV5 A;  5CC4 A;  3BDC A;  5CV6 A;  2NUC A;  2PZW A;  2F0U A;  2PZU A;  5KYL A;  3R3O A;  3SK6 A;  1JOQ A;  1F2M A;  5IOD A;  1TR5 A;  4YIJ A;  4K8I A;  4KY6 A;  3NK9 A;  4B9X A;  5CV8 A;  1IHZ A;  5J39 A;  2F0I A;  2F0G A;  4IAL A;  3HEJ A;  1KDB A;  3BDL A;  2PW5 A;  2PZT A;  4KJN A;  4K14 A;  3D4W A;  4E6I A;  1NSN S;  4NDX A;  5C3X A;  3OMC A;  5KGU A;  3NUC A;  4S3S A;  5EGT A;  4DU9 A;  5HUR A;  1JOR A;  1KAB A;  3TP7 A;  3ERQ A;  3RUZ A;  1A2T A;  1KDA A;  4DFA A;  2ENB A;  4K5V A;  5IGF A;  2F0Q A;  5CV9 A;  2F0E A;  1SNM A;  3SHL A;  5C4Z A;  5I6W A;  3H6M A;  5IGC A;  2EYJ A;  3TME A;  3SK5 A;  5IGE A;  1A3U A;  4EVO A;  1TT2 A;  1EYA A;  2HQE A;  3MZ5 A;  3C1E A;  4KJO A;  1JOO A;  4TRD A;  5CV4 A;  2F0L A;  4F8M A;  5C3W A;  3VA5 A;  5IGD A;  2O4X A;  4KY5 A;  2EYF A;  5E1F A;  2PYK A;  4LAA A;  2EYL A;  1STG A;  1SNC A;  1SYF A;  3P1H A;  5CV7 A;  5E3F A;  5EKL A;  2F0F A;  5NUC A;  4EQP A;  5C6A A;  5IGG A;  1AEX A;  2WAC A;  3PMF A;  2F0J A;  2EY1 A;  5DAU A;  1EY0 A;  3SXH A;  1EY5 A;  1ENC A;  4DF7 A;  4WRD A;  1SND A;  2PW7 A;  3T16 A;  4EQN A;  1STN A;  1EY6 A;  1STA A;  5I9O A;  5ISR A;  2F0T A;  2RBM A;  4ZQ3 A;  3V2T A;  2F0N A;  1SYG A;  1STH A;  1A2U A;  1RKN A;  3NHH A;  2F0S A;  2OF1 A;  4J1M A;  5F2D A;  4QMG A;  4QF4 A;  5JOB A;  2EYM A;  4F7X A;  2F0W A;  3D8G A;  5CR3 A;  4G57 A;  3DMU A;  4K6D A;  4WOR A;  5C5L A;  3MHB A;  1SNP A;  4EQO A;  1EY8 A;  5JAV A;  4ZUJ A;  3OWF A;  1NUC A;  1SYD A;  2RKS A;  1II3 A;  4R8N A;  4ZUI A;  3NP8 A;  2EXZ A;  1A3T A;  1EZ6 A;  3C1F A;  3LX0 A;  1TQO A;  4QB4 A;  1ENA A;  3EJI A;  1EY4 A;  1KDC A;  2EY5 A;  4ID6 A;  2EY2 A;  3ITP A;  4K2L A;  4NMZ A;  5C4H A;  4K5X A;  4KTA A;  3OSO A;  1SYB A;  2EYO A;  2LKV A;  5J1Z A;  2PQE A;  2F0V A;  4KD4 A;  5DEH A;  5K5P A;  3ERO A;  2EYP A;  2F0K A;  4N9T A;  2F0M A;  4PMC A;  3P75 A;  5IGB A;  1SNQ A;  4J6H A;  4HTH A;  5I9P A;  1SNO A;  4KY7 A;  2F0D A;  5C5M A;  5KEE A;  2F3V A;  5I6Y A;  5HGT A;  5J22 A;  1F2Y A;  3MEH A;  3QB3 A;  3QOJ A;  2KQ3 A;  4KHV A;  3NQT A;  4PMB A;  2KHS A;  1F2Z A;  3TP8 A;  5KIX A;  3MVV A;  4NKL A;  2EY6 A;  3DHQ A;  3TP5 A;  3T13 A;  1EQV A;  5CGK A;  2OEO A;  4B9W A;  5IOC A;  4K2K A;  1STB A;  1STY A;  2SNS A;  1EYC A;  1EY7 A;  2EYH A;  3QOL A;  2OXP A;  4HMI A;  4OL7 A;  3D4D A;  1EZ8 A;  2F0O A;  3S9W A;  1A3V A;  3SR1 A;  3TP6 A;  1SYC A;  3MXP A;  2SNM A;  4H7B A;  5M9O A;  4HMJ A;  4RKL A;  5KRU A;  3HZX A;  5EKK A;  1JOK A;  3SK8 A;  4KD3 A;  3EVQ A;  5IIF A;  3SK4 A;  2F0P A;  1EY9 A;  3OMG A;  4DGZ A;  4I65 A; 
#chains in the Genus database with same CATH topology
 2NN6 I;  3QO2 A;  1V1P B;  4FDB A;  1GO3 E;  3G71 A;  4RMF A;  3M4Y A;  4L8J A;  3RLO A;  2QDB A;  4EGV A;  3E9H A;  3K5M A;  5D14 A;  2HUG A;  3K0X A;  1QVC A;  3NE5 B;  2VUM B;  1JR0 D;  3X3N A;  2ES2 A;  3NTI A;  2PW5 A;  1Q1E A;  3HOX H;  3Q24 A;  2YV5 A;  3NUC A;  3GO5 A;  1WYD A;  3RUZ A;  1UE5 A;  1A15 A;  3M4O H;  2VY3 A;  3UDF A;  3PO3 G;  3KDF A;  1NJI C;  2JA8 B;  2F0L A;  1S40 A;  2QA4 A;  1QVF A;  2WAQ E;  1KLG D;  1SE4 A;  1V1Q A;  4IPH A;  5I2X A;  4OO1 I;  5G3L F;  1SYF A;  4KN7 C;  5EKL A;  4DV4 L;  2K75 A;  1EIG A;  1B8A A;  3KF6 B;  3DLL A;  4OEM B;  2VS1 A;  1WTW A;  3P7J A;  3S1N B;  1EY5 A;  1XWE A;  2PW7 A;  1MJC A;  4YY3 L;  4IUV A;  1A2U A;  1XYI A;  4DR4 L;  1HA6 A;  4JBJ A;  3VR4 A;  4DV1 L;  3GTM H;  1KAW A;  3EIV A;  5C5L A;  1HNZ L;  3MFG A;  2JQO A;  2K6A A;  2D0P A;  4JW0 A;  5JEA H;  2E75 C;  2BDO A;  2RKS A;  2UUC L;  2C9O A;  3O13 A;  3LGJ A;  1RIP A;  5FLX E;  5C4H A;  5IYB G;  4HID A;  2VQF Q;  5D3I B;  4X3T A;  3U4V A;  2YTY A;  3C2P A;  3K7U C;  1SNQ A;  3I73 A;  2R7F A;  3J7A F;  1SNO A;  3PIO A;  2F0D A;  3NQI A;  5I6Y A;  1GXD C;  1PZI D;  4PMB A;  2KQ3 A;  1NR4 A;  2D9U A;  5CGK A;  4DV6 L;  1GKH A;  1A62 A;  1O7L A;  3D4D A;  3TP6 A;  3WWV A;  4DAP A;  2RCN A;  1SRU A;  1J8I A;  3OMG A;  3KF8 B;  4JBW A;  2OTL A;  4DAM A;  3NTK A;  1ML0 D;  3OHX C;  1D5M C;  2FIN B;  3D6C A;  4A3K H;  1EFI D;  1EQQ A;  2WP8 J;  2IT1 A;  4K0K Q;  2ZJQ A;  4A3L G;  4IFD H;  2RQX A;  4IPC A;  2PI2 A;  3W1G A;  2Z0S A;  3MWY W;  2K5D A;  5CV8 A;  3I72 A;  1IKL A;  1BCP D;  3J7Z C;  4LF8 L;  1B50 A;  2XWB B;  1C4Q A;  3T56 B;  4A4I A;  4BXX G;  1I4P A;  2N78 A;  1KNA A;  3CMA A;  1TS3 A;  2LSS A;  4WJW A;  4HJ5 A;  2ZXP A;  2ENB A;  2MQH A;  4N8F A;  4RFB A;  2RSN A;  3BZD B;  1WTX A;  2JSO A;  5EBC A;  4PZ6 A;  4BY1 G;  1KRS A;  1D8L A;  2ID0 A;  2QEX A;  3DM1 A;  3CRL C;  1TWG H;  2EYL A;  1STG A;  1TWA B;  3AFQ A;  3UDI A;  3M7N A;  3GTK B;  5IGG A;  3J7A V;  2N3S A;  2UU9 L;  1PTO D;  3J81 L;  2AQ1 B;  1S5C D;  1VQA A;  4JG2 A;  4C3H B;  5C4X H;  2F0T A;  1DCZ A;  3LNN A;  4XT1 B;  2AUK A;  2J4X A;  3FDT A;  1E1T A;  3N52 A;  5JAV A;  2JJQ A;  1X54 A;  2XVS A;  4QIW E;  2HCI A;  3AU7 A;  1SRO A;  1PXU A;  2EY5 A;  4DV4 Q;  4GNX A;  4A3M B;  4A3I G;  1JB7 A;  2X6L A;  1RTN A;  5JPM C;  4JI7 Q;  2JA6 B;  2LKV A;  2KEN A;  1C8C A;  4A3E B;  2KHI A;  3BJU A;  3ZJY C;  2F0M A;  4PMC A;  1I6H H;  1D7Q A;  2XNA C;  4YY3 Q;  4CGY B;  1LM0 A;  4DR4 Q;  1Y1W G;  3HKZ G;  1TII D;  2F3V A;  3PO3 H;  5C4J B;  3QOJ A;  1HNZ Q;  4OIK A;  5IYD G;  1WCM H;  4G7H C;  3HOZ B;  4A3G G;  1KHI A;  5KNB A;  2I07 B;  1O7Y A;  2WKD A;  2EYH A;  4G7Z C;  1G6Z A;  1BCP B;  3PUY A;  4ZKC B;  4RHS A;  5GAD C;  4C3J G;  3KDF B;  4KD3 A;  1CHP D;  1X6O A;  3I4N B;  1EWH A;  2BE5 C;  4A3F G;  1PA6 A;  2QKI C;  1PFN A;  5DLQ E;  1UUP A;  3N6R A;  2OWO A;  2A73 B;  4LF9 Q;  3BVZ A;  2PPB C;  2VL6 A;  1LTA D;  4FYD A;  2B8G A;  2NUC A;  2F0U A;  1XTC D;  3I8Z A;  3H09 A;  4JYA L;  2G9D A;  4NW2 A;  2IHE A;  1PTO B;  2WB1 G;  2XRQ D;  1A63 A;  2B29 A;  5IYB H;  4NDX A;  3TN2 A;  4B3M L;  2ZXO A;  2E5L L;  2B2T A;  1KDA A;  1E7Z A;  4DFA A;  1JWM D;  2CH4 W;  3GTQ B;  4OX9 L;  4DUY Q;  1G29 1;  1I4R A;  1EYG A;  5CV4 A;  1I4G A;  1JOO A;  1ICW A;  3ND9 A;  2B2U A;  1L2F A;  3FP9 A;  3MAQ A;  1CSQ A;  4YWM A;  1PMR A;  4A3D G;  5KNC A;  3PMF A;  4LF6 Q;  1EOT A;  2C35 B;  4GKJ L;  4KKS A;  4EQN A;  2L9H A;  2B63 B;  3K57 A;  1XMQ L;  4LUO A;  2YU9 B;  3F2D A;  3WDN A;  1GOZ A;  4IJH A;  4QMG A;  1NBW A;  2GA4 B;  2R92 G;  1J5E L;  4A3B G;  2HQL A;  3A54 A;  2SDF A;  4JC0 A;  1RHP A;  4KKT A;  1K8M A;  1B9N A;  3URY A;  5GAH C;  1MIU A;  3LX0 A;  5D65 A;  1GUO A;  5M3F H;  2R93 H;  1AH9 A;  2AKW B;  4A3L H;  4YCV A;  2EY2 A;  4NMZ A;  1IW7 D;  1LAB A;  1YJ9 A;  1JIC A;  4DK3 C;  2UU9 Q;  4POF A;  1WTQ A;  3EA6 A;  5IT9 L;  4BXX H;  1GVP A;  2FMM A;  3KLS A;  3RLF A;  4ZLT F;  1GUN A;  2VW9 A;  3PUZ A;  4ZYS A;  1G51 A;  3JAM L;  5C5M A;  4M8A A;  3RZD H;  1S5D D;  2NTS A;  4KHV A;  3MA2 B;  1NNX A;  3J80 i;  3TP8 A;  4BY1 H;  3K8A A;  3T13 A;  1EQV A;  1HTP A;  1WTR A;  1B53 A;  4P74 A;  3TZU A;  3PV0 A;  1G2S A;  1R9T B;  5FLM H;  1XNR L;  4MN3 A;  5FO7 B;  3J7A 5;  3CCE A;  1JT8 A;  3W3A A;  2ICE C;  3L2P A;  4R4T A;  4GLX A;  1KLU D;  1BF4 A;  4UP7 A;  5KYI A;  1G2T A;  3U4Z A;  1LT5 D;  1JB3 A;  1J9O A;  2L5T A;  1F9S A;  2B2W C;  4HED A;  4C2M B;  3I4L A;  2XRS D;  2CW0 D;  2A19 A;  3K5O A;  5CV6 A;  4DAY A;  5KYL A;  3MC0 B;  1CZW A;  1K73 C;  5FJ8 G;  1EEF D;  2N8N A;  4JI4 L;  1BOS A;  4B9X A;  3NK9 A;  2F0I A;  1JE4 A;  1IYV A;  4A3I H;  2PNR C;  2A5H A;  1HUM A;  4MHE A;  2NYZ D;  1FNW A;  1N34 Q;  1EU4 A;  1C48 A;  3HOU G;  4QL5 A;  2RDH A;  3J81 E;  1Y1W H;  2MP1 A;  4HJA A;  4FF3 A;  2E2D C;  4GNX B;  3CCR A;  5JJK A;  1Q86 C;  2HD3 A;  3PO2 H;  4KY5 A;  1ET6 A;  3AEV A;  5IYD H;  1TWC H;  2K50 A;  4EQP A;  4GN3 B;  4JYA Q;  1KTK A;  2Y0S E;  1F77 A;  1OXU A;  5EKI A;  4C3J H;  1BQQ T;  3CAM A;  1CQF A;  4B3M Q;  4C56 C;  4JI2 L;  5GRO A;  2EYM A;  5ELE A;  3QWN A;  3G4S A;  2TMP A;  1LTG D;  1HJP A;  3CPF A;  2E2I H;  3GTJ H;  3K0Y A;  1X3Q A;  2F03 A;  2NVT B;  1V1P A;  4JI6 L;  1A3T A;  3FPU B;  1I4X A;  4PZ7 A;  4LF4 L;  2OT2 A;  3PIO 3;  2K5Q A;  1W3S A;  2PQE A;  1ESF A;  1XTD A;  3IKJ A;  4K6L A;  3GV3 A;  2F4V Q;  1XMQ Q;  4DKA C;  1XPO A;  4DV3 Q;  3NBH B;  5HGT A;  4A3C H;  3S1R B;  2KBN A;  3TEH B;  1J5E Q;  4KK7 A;  5C3E H;  2CCZ A;  4JOI A;  3SGI A;  5M3M G;  2I5L X;  3TP5 A;  5LMN L;  2XN9 C;  2K5H A;  2X6G A;  4A3D H;  1SN8 A;  1AZQ A;  2CFM A;  1T9H A;  5COY A;  2K04 A;  1YNJ D;  1OTC A;  2Q8T A;  5FLX L;  1B1Z A;  4HN7 A;  2KCC A;  2N49 A;  4IUU A;  1E2Z A;  2R92 H;  3R8B A;  4A3B H;  3CF5 A;  2AHO B;  1O7Z A;  1TY2 A;  1JJG A;  3R3O A;  1F2M A;  3S1M H;  1B70 B;  1F9P A;  5IP9 G;  2NVY H;  3KLS X;  3RN2 A;  2MO0 A;  1X65 A;  4GLV B;  1SFO B;  1XNR Q;  4LFA Q;  4ZRZ A;  1VQJ A;  2IL8 A;  2AMC B;  4DU9 A;  2N88 A;  3A56 A;  1N36 Q;  1IXR A;  1VQ9 A;  4X66 Q;  1PFS A;  5IGF A;  1D1I A;  3ICE A;  4V0B A;  3H6M A;  2V1C C;  4FF1 A;  4EVO A;  4BY7 H;  1B3Q A;  4DR2 L;  4A3M G;  1BXT A;  2O4X A;  2WIN B;  2BOS A;  2JE6 I;  2LXK A;  4DXF A;  3H91 A;  2VZA A;  5E3F A;  4A3E G;  4LF7 L;  2VB2 X;  5CV7 A;  2NVX H;  3TDQ A;  4HIK A;  2WV6 D;  3W2D A;  1Q46 A;  2CHB D;  5C3W A;  4I7A A;  1D5X C;  4ZCK A;  1VQ7 A;  4J1M A;  1P8L A;  3OOC A;  4CKB A;  1AZP A;  4XXE A;  4F7X A;  1VQC A;  2K01 A;  2XWJ B;  1SBB B;  1JE5 A;  3J81 j;  4IUP A;  4OWW B;  5IT9 E;  1HRJ A;  2XIW A;  1EWC A;  3CQZ H;  4P73 A;  2PMZ B;  3F2B A;  3RZO B;  3OSO A;  4BBR G;  3JAM E;  1HPC A;  3HOV G;  4APV A;  2QCP X;  2F0V A;  4B3S Q;  5K5P A;  4IOA A;  1WTH A;  3DEO A;  4DAY B;  1PYW D;  4YCW A;  4DNT B;  2N55 A;  4JI2 Q;  1W2B A;  3NEN A;  1BDO A;  3ULL A;  2L1B A;  3HOU H;  4CJ0 B;  2SEB D;  3I7F A;  3MEH A;  4X65 L;  4LFB L;  3S2H H;  2EY6 A;  5BN5 A;  2Z4H A;  4DAV A;  1VQ6 A;  2SNS A;  2DNE A;  4YHH L;  2B2V C;  4HMI A;  4HJ8 A;  2O5I C;  5M9O A;  4J8Q A;  1CT1 D;  5KND A;  1FYC A;  3PUX A;  1SEB D;  3BZC A;  1TS5 A;  2K05 A;  1E2V A;  1Z47 A;  3BS1 A;  2WAQ B;  1XPU A;  4X3K A;  1SJH D;  3CXC A;  1UNS A;  3HOW B;  1U9R A;  3HFZ B;  5CV5 A;  3PIP A;  2PZU A;  3F2C A;  2BA1 A;  1SMY C;  1TWH H;  2R7Z B;  1CI3 M;  3IL8 A;  3HKZ E;  3CPW A;  2F1M A;  1DOM A;  4ZKB B;  1X3P A;  1K8G A;  1M90 C;  1NE3 A;  2BH8 A;  1YIT A;  4DR5 L;  2IX3 A;  4AYB G;  4R9W A;  3ULJ A;  1BKB A;  1A3U A;  3RMH A;  3AFP A;  2HHH L;  3NSW A;  4FNF A;  1HNW L;  4TRD A;  5IWA L;  4OWT B;  2AWO A;  3TS2 A;  4P72 A;  5M3M H;  1ZXT A;  1EQR A;  2B3G A;  1CUK A;  1JWU D;  2H5X A;  3NEM A;  5HY6 A;  3CCV A;  1PH3 A;  1VQ4 A;  1GJX A;  2YYZ A;  3T16 A;  4A93 G;  3H0G B;  1VQM A;  1N33 Q;  4MZ9 A;  2IPK D;  3DEP A;  3AMU A;  5C0X I;  4QUC A;  2WB1 E;  3CC4 A;  5JJZ A;  3DMU A;  3S1Q B;  2NWG A;  1UE6 A;  1HNX Q;  4OXP A;  5DNF A;  2KCT A;  3KJO A;  1SYD A;  4DR2 Q;  4ZUI A;  1YEZ A;  2RCF A;  1HTL D;  1YHB A;  3OYY A;  3S24 A;  5C0X J;  2E76 C;  4QB4 A;  3RR5 A;  4ID6 A;  4LF7 Q;  3M3Y B;  3VDY A;  2JA5 B;  2I46 A;  2NN6 G;  4CDE C;  1SYB A;  1V9P A;  3G6E A;  1TWF B;  5IP9 H;  4BBS G;  4QUF A;  4DV5 L;  1IBK Q;  1HR0 W;  5IP7 G;  1X3G A;  2OQ0 A;  3NBI A;  1CKN A;  4UDU C;  3HP3 A;  4KY7 A;  3ERS X;  3CCL A;  1F2Y A;  1RD9 D;  4JI1 Q;  2EJM A;  2E2J H;  4NKL A;  4B08 A;  4IQZ A;  4UHV A;  1STB A;  1U5K A;  3HOY H;  1HA5 A;  3SEB A;  4A3E H;  2OXP A;  2ATW A;  3OWE B;  4H7B A;  1BR9 A;  1L0Y B;  3MEF A;  5EKK A;  3OTO L;  2ZTC A;  4I65 A;  5GAG C;  1FGB D;  3E6Z X;  5CYU A;  4RCO A;  4JI0 L;  4L5T A;  4MIU A;  4DUZ L;  3MFY A;  4X3U A;  1XNQ L;  4OO1 G;  2K52 A;  2F0H A;  4NXM L;  2RSO A;  2A8V A;  1OO9 B;  3UE1 A;  3QR8 A;  1L1O C;  3MXU A;  5BN4 A;  3L9A X;  1K0R A;  4LFB Q;  2JYO A;  2WII B;  1GUS A;  2E8G A;  3VA7 A;  4IAL A;  5BR8 L;  4BBR H;  3HOV H;  4RGN A;  2HIV A;  3I4M B;  1UE1 A;  3PGZ A;  2Q8I B;  4GOP C;  4LNQ A;  5M5W B;  4BA1 I;  1SNM A;  5T1G A;  2EYJ A;  1QZG A;  1FL0 A;  1XXG A;  3K7A B;  4YCU A;  1M4V A;  1ONL A;  4YWL A;  2KA7 A;  2EYF A;  4HSP A;  1VQ5 A;  5NUC A;  4KHP L;  2NB0 A;  1SLJ A;  2CQO A;  3GDE A;  3UE0 A;  1KIX A;  3S15 B;  1ICF B;  1STH A;  4V19 0;  2CQA A;  2JA7 H;  1B3A A;  3RN5 A;  3DWQ A;  1Y8N B;  5FO8 B;  1RDP D;  2HHH Q;  1ZKO A;  2Z6K C;  1HNW Q;  1W6J A;  1BBU A;  2A6E C;  4Y52 H;  5EPJ A;  5AJ3 L;  4FP5 D;  4DK6 C;  3WOE A;  1U0L A;  2E74 C;  3GTL H;  5M5X H;  4POG A;  3S17 H;  3ITP A;  4QCL A;  3JAM i;  5JVG 3;  1LO5 D;  1VS0 A;  3VR2 A;  2M9V A;  1CKM A;  1X3E A;  3S14 H;  2L55 A;  4B3R L;  3HOX B;  1ET9 A;  1AN8 A;  1BVS A;  2BDN A;  4R4C A;  2KJX A;  3CC7 A;  2KEC A;  5KEE A;  1WI5 A;  3UDG A;  2FFK B;  4X62 L;  3M4O B;  2IW3 A;  3CC2 A;  3VR6 A;  2KHS A;  4LFC L;  1S5E D;  3NWT A;  3DHQ A;  1FGU A;  2K28 A;  2HT1 A;  4ME3 A;  2NZH A;  1STY A;  2AQ2 B;  2RDG A;  4OL7 A;  3BYY B;  1EZ8 A;  1AFP A;  3JC6 6;  3SR1 A;  3I2Z A;  2SNM A;  5KRU A;  3SK8 A;  4A93 H;  2HCC A;  2EIF A;  1DOL A;  1Y1V G;  1PRT C;  4NP5 A;  1A8V A;  3E5S A;  2B8F A;  3S2D H;  2F3W A;  4XDX A;  5CC4 A;  4DV1 Q;  3GTM B;  2RHS B;  4JPB W;  1R4P B;  4YWK A;  3TS0 A;  2E2H H;  1UE7 A;  4YIJ A;  2UUC Q;  3HEJ A;  4GN4 B;  2PO4 A;  1WTO A;  2NN6 H;  4AIM A;  3TZD A;  3FKI G;  5EGT A;  4BBS H;  3KFU A;  1S5B D;  4LK1 C;  3A7L A;  1QOH A;  4UP8 A;  5IP7 H;  4DR6 L;  4DPG A;  4JI0 Q;  4DUZ Q;  1XNQ Q;  3LWE A;  1TKW B;  2H1E A;  3STB D;  5IGD A;  1TVX A;  1TS2 A;  5ELB A;  1L0W A;  3I70 A;  2ZM6 L;  2M2L A;  4A3J G;  3NBH A;  1F9R A;  2WAC A;  4DV6 Q;  1W6K A;  1CKN B;  2BE5 D;  4DR1 L;  1ENC A;  4CDF C;  4DF7 A;  3QJY A;  1K8O A;  1EY6 A;  5I9O A;  1WVL A;  5BR8 Q;  3E0J A;  2UXD L;  3H94 A;  1I5F A;  2F0W A;  3OIP A;  1AP0 A;  4L6T B;  1E1O A;  4OO1 H;  2RHQ B;  1EU3 A;  2K33 A;  1SMX A;  3BZK A;  5COR A;  2B2W A;  2KEE A;  3OWF A;  4C3I G;  4A3K B;  2IX0 A;  1NUC A;  1RF2 D;  2EJF C;  3IRB A;  2ASB A;  5C44 G;  1ENA A;  3EQL C;  1YJN A;  1F2L A;  4KHP Q;  1ENF A;  1QIL A;  4LF8 Q;  1H9K A;  2EYP A;  2I0Q A;  3E9I A;  3F1Z A;  1N8R C;  3KUP A;  1K3B C;  2A69 C;  2EJG C;  4L5R C;  4LJZ C;  3M4Q A;  3HGB A;  3HRZ C;  3QOL A;  5AJ3 Q;  5ELC A;  1TWG B;  1OXT A;  1A3V A;  3GTP H;  1EOV A;  1YZ6 A;  2HDM A;  5A35 A;  3J80 c;  1RTO A;  1NCV A;  1IW7 C;  5IIF A;  1H9S A;  3EVQ A;  4L63 B;  3PIP 3;  5K36 G;  1PFM A;  5E4W C;  5C4X B;  4K5W A;  4UP9 A;  3R93 A;  1XMO L;  1PH2 A;  1YHA A;  1PRT F;  4IZ8 A;  4CKC A;  3BDC A;  3GTG H;  3H3V I;  3U50 C;  2VUM G;  2O2L D;  3I90 A;  2Y0S B;  5L37 A;  1PV4 A;  1B7Y B;  3SK6 A;  3ER0 A;  4LFC Q;  1TR5 A;  5ELN A;  2FJ2 A;  2R6G A;  1ESR A;  1GUT A;  2G5D A;  2AQ3 B;  2YTV A;  1SDF A;  4H02 A;  5KGU A;  2R7D A;  1OXS C;  1PDQ A;  2Q8R E;  3ERQ A;  4DA2 A;  4OEL B;  2JA8 G;  1JJ2 A;  2K5W A;  5T1I A;  1I6H B;  1DZ1 A;  4JCV E;  5M5Y H;  1C0A A;  1CK1 A;  3MZ5 A;  4FF2 A;  1VQG A;  3F8T A;  2VXW A;  1FD7 D;  4IJL A;  4BA2 I;  3PO3 B;  2CW0 C;  2ZJR A;  4LF5 L;  1NMF A;  4Y7N B;  1WCM B;  2Z6B A;  1A6X A;  1DM0 B;  4ILW A;  3QG1 A;  3S16 H;  4LUZ A;  5LMU L;  4IOC A;  1KD1 C;  4PZ8 A;  3SDZ A;  1YHQ A;  2IHF A;  4WRD A;  1V8Q A;  5JJL A;  2KVM A;  5ISR A;  4R4O A;  3V2T A;  4O1N A;  1K83 H;  1MHW C;  1E3P A;  2L0C A;  3ND8 A;  1BO0 A;  4TQU S;  1Y1V H;  3NWS A;  4DV0 L;  1KRT A;  4U67 3;  2Z8L A;  1HCZ A;  1LTL A;  1VQF A;  1Z9F A;  1U4P A;  3EFX D;  4A3G H;  1PLF A;  1F9Q A;  1VQE A;  2ZM6 Q;  5IYC G;  4AYB E;  3HS0 C;  2C5C A;  2L12 A;  3I3C A;  2OQK A;  1QE6 A;  1S3O A;  4HCS A;  3FKI H;  1I50 H;  1LV9 A;  3P75 A;  4DK1 A;  3PF4 A;  1Q8I A;  4A3F H;  4L5S A;  2E5L Q;  3D0F A;  4HIM A;  4XT3 B;  4OX9 Q;  4HR7 B;  5KIX A;  2PI2 E;  1DD2 A;  2NZO A;  4RGT A;  3H15 A;  1VQN A;  1EYC A;  1HZA A;  1Y14 B;  4A3J H;  3TSS A;  1S72 A;  1KL9 A;  2EPB A;  1JWS D;  1ROD A;  2RVL A;  4GKJ Q;  2JP1 A;  1SYE A;  5I4D A;  5J3B A;  5CBA E;  3P20 A;  1PHJ A;  3NXW A;  3T1Y L;  1C7Y A;  1I3Q H;  1KAA A;  2MPM A;  2NVQ H;  2DGY A;  4C3I H;  3K59 A;  1QJO A;  1IKM A;  1SJE D;  2ICI A;  3LWU A;  4AQY L;  5ELO A;  5C44 H;  5M3F B;  3KLW A;  3ONA B;  2EZV A;  2R93 B;  1KDB A;  3BDL A;  4DNI A;  3D4W A;  2MUY A;  2UUB L;  2R3Z A;  3OMC A;  2A68 C;  2BCO A;  1PVO A;  3TP7 A;  1IYU A;  3G6J B;  1MGS A;  2MJ8 A;  2R61 A;  1IL8 A;  2DUD A;  1TT2 A;  3GTO H;  1XMO Q;  1PYB A;  1PYS B;  2D5D A;  1TS4 A;  1KC8 C;  3OW2 A;  3RZD B;  1LAC A;  4LAA A;  3P1H A;  4BY1 B;  4KMU C;  4C3H G;  1AEX A;  1GHK A;  2F0J A;  3HOX G;  2B2V A;  3SXH A;  1SSO A;  4RHR A;  4R4Q A;  5JEA J;  2F0N A;  1QG7 A;  4XQN A;  5K36 H;  2UXB L;  5CR3 A;  3QIA A;  1LLR D;  1AE2 A;  1VMC A;  4ZUJ A;  3IFD A;  2VUM H;  2JA6 G;  4NPS A;  1H9S B;  3EN2 A;  4M1U B;  1TQO A;  2J0T D;  4HAE A;  4LF5 Q;  4X6A H;  1KDC A;  1Q3L A;  1PFB A;  3W1B A;  4JI4 Q;  2EYO A;  3Q23 A;  1MSG A;  1FNV A;  3MXN A;  4A3I B;  3CRK C;  3CKI B;  1I94 L;  4P75 A;  5BN3 A;  3M7G A;  3SE0 A;  1ZYR D;  4HTH A;  3HOZ G;  2JA8 H;  1PH8 A;  4Q0F A;  4DV0 Q;  4KHZ A;  1Y1W B;  1CTM A;  1Z6H A;  1Y8O B;  4MNO A;  4RCN A;  1YIJ A;  4FXG C;  3RD4 A;  3S1N H;  3PO2 B;  1M1K C;  5FJ8 H;  3I4N G;  4IFD I;  1TWC B;  3FMC A;  3MXP A;  4FO2 A;  1D5Z C;  1JOK A;  1L0X B;  4CKE A;  3SK4 A;  1EIF A;  4DGZ A;  4WJ4 A;  4LMQ D;  1MKH A;  4IFD J;  4C3J B;  5G3L D;  1UAP A;  4ME5 A;  2M00 A;  5DM6 3;  3BU2 A;  4DR7 L;  2I5M X;  3D6W A;  1JOQ A;  2E2I B;  3GTJ B;  4QGU A;  3OPO A;  4IN3 A;  2VQF L;  4JI6 Q;  1B2T A;  1T5E A;  4H44 C;  3UDX A;  4U68 A;  1TY0 A;  2GVB A;  4E6I A;  4LF4 Q;  2B39 A;  2WB1 B;  4BS9 A;  1Y69 U;  2DNC A;  2ALY B;  5D3D A;  4JV5 L;  1DON A;  5C4Z A;  1YNN C;  4X64 L;  4G7O C;  4RAU C;  2LXJ A;  2JEA I;  1IBM L;  4NB3 A;  2A6H C;  1S5F D;  1GD7 A;  1CKO A;  2B63 G;  5C3E B;  3X3M A;  4RA8 A;  4IUT A;  2MHV A;  1SE8 A;  1E0B A;  1N32 L;  1NMG A;  4WJ3 M;  5LMN Q;  1B44 D;  1EY0 A;  4AQY Q;  1JMC A;  1B4O A;  4A3D B;  1VDZ A;  2UUB Q;  1OXV A;  2FXQ A;  4QF4 A;  3D8G A;  4G57 A;  4CBV A;  3J81 i;  1K28 A;  1LT6 D;  1SMY D;  1HZB A;  4QJF A;  1EL0 A;  2R92 B;  4A3B B;  1L1O A;  2G9H D;  3EJI A;  1EY4 A;  2ZT9 C;  3S1M B;  1Q90 A;  1Q82 C;  2NVY B;  4O42 A;  1EEI D;  1HQR D;  2F52 A;  4A76 A;  5JVH 3;  3AQQ A;  5EPK A;  1EIH A;  4X3S A;  2Y0S G;  4B3T L;  3K6O A;  4GOP A;  1LTT D;  2XTI A;  3DUZ A;  2UXB Q;  1UEB A;  3I55 A;  3T1H L;  1HZ9 A;  1TWA H;  3GTK H;  2KOL A;  4BY7 B;  1DOK A;  4OGQ C;  3CME A;  1IZ6 A;  4ULL A;  1XPR A;  1MD2 D;  2AUJ D;  1D2B A;  4C3H H;  2OCE A;  2IY5 B;  2NVX B;  1XX8 A;  2B2Y C;  4PV1 C;  3HZX A;  2ZXR A;  1QCB D;  5EAY A;  2DY8 A;  4DNR B;  2QGQ A;  1EUJ A;  3PSI A;  4AH6 A;  1I94 Q;  2F4I A;  1ILP A;  2CKZ B;  2SOB A;  1WCM G;  4K8J A;  2RF4 A;  4KV6 A;  1V43 A;  1ASY A;  5A2Q L;  4A3M H;  2Z6K A;  1QNK A;  1H9R A;  4JI7 L;  1JJC B;  2JA6 H;  1VQD A;  3CQZ B;  1Z7T A;  4KJN A;  5FK9 C;  5C0X G;  5C3X A;  4DV7 L;  1HFG A;  5JJI A;  1O80 A;  4S3S A;  2UXC L;  2P5Z X;  3C3L A;  2F0E A;  3V96 A;  5I6W A;  5C4J H;  3CCS A;  1LYL A;  2HQE A;  3HOZ H;  1EQT A;  1VQP A;  3I56 A;  1VQ8 A;  2K5V A;  4IUR A;  3HOU B;  1CQV A;  4DR7 Q;  4MTN A;  4X65 Q;  2DJG C;  3S2H B;  3MXN B;  1TXY A;  4PG3 A;  4YHH Q;  1KQS A;  3I4N H;  1J6Q A;  3U9S A;  3D4R A;  1VMP A;  2DJF C;  4HJ7 A;  1IYJ B;  4G4K A;  4H13 C;  4LF9 L;  1XJV A;  4RG1 A;  1HH2 P;  3NEL A;  4IPG A;  5EJW A;  4JV5 Q;  1QNU A;  2MFI A;  3FRP B;  4X64 Q;  1WD0 A;  4QIW B;  4PMW A;  3J80 E;  1EY8 A;  4JI8 L;  1KXL A;  4DN4 M;  4RWS C;  1HHV A;  1PTO H;  3A7A B;  2EXZ A;  3PQI A;  1TU2 B;  2K5N A;  1IBM Q;  3K80 C;  1QVG A;  2D0O A;  3BG3 A;  1TWH B;  4K5X A;  4KTA A;  5IT9 c;  1N32 Q;  3CCJ A;  3K81 C;  4OON A;  1BCP C;  3GTQ H;  5EBD A;  1WTP A;  2QDL A;  4DUY L;  1CFM A;  1NTG A;  5IGB A;  3Q8D A;  3KLR A;  3EBE A;  3JAM c;  2BH2 A;  1SE3 A;  1CA6 A;  5AFW A;  4DR5 Q;  3TBI B;  5J22 A;  1NY4 A;  2R93 G;  1O78 A;  5M3F G;  3TQY A;  1PH6 A;  3A5Z B;  4O2D A;  3AYH B;  5IWA Q;  4LF6 L;  1EY7 A;  2B63 H;  5M3M B;  4OWX B;  1GUG A;  1I4H A;  1U4L A;  2Q2U A;  2YU9 H;  1PTO C;  1VCI A;  3HG9 A;  3G7L A;  4EQ5 A;  2NZ1 D;  5LL6 X;  2A74 C;  1CZG A;  1C9O A;  2RDF A;  3A0J A;  3C46 A;  3BVG A;  2A6E D;  4B3T Q;  2K4K A;  2Z4I A;  3U9O A;  2KCM A;  2PZW A;  4TSS A;  3T1H Q;  5FLM G;  1RL2 A;  3NTH A;  4K8I A;  4KY6 A;  4OHJ A;  5J39 A;  4XIG S;  1AW7 A;  3ULP A;  2PZT A;  1VQO A;  3DWP A;  2K32 A;  1R4Q B;  3FEW X;  2ZJP A;  1X55 A;  4HSV A;  4UY8 C;  4RGM A;  2VQE L;  2QW7 A;  2HIX A;  4K5V A;  4DV5 Q;  1L1O B;  1QB5 D;  4KJO A;  2XGT A;  1X3F A;  2GN5 A;  2EOT A;  1I4Q A;  1R9T H;  2E2J B;  3IAY A;  3PUW A;  1GM5 A;  5C6A A;  3CP0 A;  2Z1C A;  2EY1 A;  1V1O A;  3HOY B;  3T4A C;  1JCK B;  5DAU A;  1MJE A;  1SND A;  4GOP B;  1PRT D;  4NXN L;  1X9N A;  3NHH A;  4DV7 Q;  1RKN A;  3PCO B;  4OIJ A;  1IL2 A;  3T53 B;  1H95 A;  4GLA C;  1HR0 L;  3M85 A;  3OTO Q;  4C2M H;  2UXC Q;  2OTJ A;  3GP7 A;  4GS3 A;  1PH1 A;  3PF5 A;  1D6E C;  3PO2 G;  4Y7N H;  3MHB A;  1SNP A;  3CD6 A;  1A0I A;  4EQO A;  2FMC A;  1U4M A;  3TRE A;  2LFN A;  3STB C;  2WFW A;  4NXM Q;  2A1A A;  3NP8 A;  1QZH A;  4CJ1 B;  4LW1 A;  1S4Z A;  3GD7 A;  4L5Q A;  2D62 A;  2X69 A;  2F3I A;  1P16 A;  5J1Z A;  3E3X A;  4DXG A;  4CDC C;  4WFN 3;  1PH4 A;  1N34 L;  5DM7 3;  5C0X H;  3ERO A;  2J7Z A;  4BBR B;  1WJJ A;  3HOV B;  4P2C B;  1BCP F;  3U58 A;  4J6H A;  3Q0A A;  1UEA B;  5LL6 S;  3IFT A;  3D3R A;  4CJ2 C;  4JI8 Q;  5IOC A;  3KBG A;  2CVR A;  1T5X D;  5IE8 A;  4XQJ A;  2EXD A;  2LY7 A;  4FVM A;  4HMJ A;  2Q2I A;  1WFQ A;  2NTT A;  1CM9 A;  2WAQ G;  2KCN A;  3FPP A;  3HKS A;  4JI5 L;  2F0P A;  3HOW G;  1U4R A;  5A2Q E;  1OXX K;  1PTO F;  5FLX c;  1ASZ A;  4A3C G;  1PZJ D;  1YVC A;  3CW2 C;  2JA7 B;  1B9M A;  5C3E G;  2Q2H A;  2NVT H;  2R7Z G;  5LMN W;  5LHY 1;  4R1J A;  4GKK L;  4N8X 1;  3GV6 A;  4GNX C;  5IOD A;  1EWI A;  4FXK C;  4TVA B;  3AB9 A;  2FHT A;  1Y8P B;  1LUZ A;  3GTL B;  3S17 B;  5M5X B;  4JBK A;  2F4V L;  1PRT B;  1WOC A;  2UUA L;  2A69 D;  1HXY D;  3PUV A;  4DV3 L;  2QEJ C;  2I5H A;  3S14 B;  2IX1 A;  2F0Q A;  3S1R H;  2K14 A;  4B3R Q;  1D1K A;  1E22 A;  5IGC A;  3TME A;  5IGE A;  5ELF A;  4R4I A;  3R2T A;  4F8M A;  3C1E A;  1GHJ A;  2YTX A;  2VNU D;  4AYB B;  4X62 Q;  2PYK A;  3G48 A;  4HIO A;  1BUV T;  2F0F A;  3DXJ C;  4IPD A;  2EVB A;  3H0G G;  3VYS A;  4ZAI A;  3TRZ A;  1CHQ D;  4F88 A;  1STN A;  2JEB I;  4ZQ3 A;  4LWC A;  4KI0 A;  2LMC B;  2OF1 A;  4O0A A;  4A93 B;  5JOB A;  4H0L C;  4BY7 G;  1KNE A;  2VQE Q;  2AWN A;  2QF7 A;  4K6D A;  3KYH C;  3CHB D;  1EFW A;  3OW7 A;  1IBL L;  3S2D B;  2DN8 A;  2JA5 G;  4JVZ A;  1STE A;  5FOB B;  1Q81 C;  1FR3 A;  4K2L A;  4R8I A;  1SFO H;  4LFA L;  2E2H B;  3KK7 A;  1N36 L;  4DK0 A;  4X66 L;  4EX5 A;  5DEH A;  3NPP A;  2B2T C;  1PH9 A;  2QIL A;  1AE3 A;  3KBX A;  2F0K A;  1JQY D;  4N9T A;  4NXN Q;  4ABN A;  2L4N A;  4BBS B;  1YBY A;  1ZEQ X;  2Z9H A;  1HR0 Q;  2B2U C;  5GAE C;  1MI2 A;  2KUM A;  4DR6 Q;  1WTV A;  3CCM A;  1F2Z A;  2BA0 A;  1VF7 A;  2ZTE A;  2OEO A;  4B9W A;  4GN5 A;  4DV2 L;  1Q7Y C;  2F0O A;  3M4P A;  1QUQ A;  2CH4 A;  2CWP A;  1JC7 A;  3VYT A;  1K8A C;  4Q5V A;  1PZK D;  3R2I A;  4DR1 Q;  4QQB X;  5I2Y A;  4PNY A;  4UPA A;  1DYQ A;  2CWA A;  3K5N A;  1PH5 A;  4FXD A;  1YI2 A;  4RKB A;  2UXD Q;  4ODG A;  3CCQ A;  1Q12 A;  3Q6S A;  3T51 B;  1LT4 D;  3D31 A;  3VR5 A;  4IUQ A;  1G8Z D;  5EQ0 A;  2H4O A;  2WKC A;  3SVM A;  3RZO H;  4JI3 L;  1M8A A;  3DM3 A;  4LUV A;  5CMD A;  4B3S L;  2F0G A;  3VR3 A;  3I4M G;  2K03 A;  2D2C C;  1WD1 A;  4K14 A;  3A5U A;  3KJP A;  5HUR A;  1H9J A;  1KAB A;  1K0S A;  2TSS A;  1A2T A;  4JI5 Q;  2LS0 1;  4KKU A;  3L0O A;  3UI2 A;  4ZK9 B;  1NAP A;  2PQA A;  2MGS A;  4QY7 A;  1EYA A;  2MNA A;  4J15 A;  4CDD C;  3BVM A;  2JN4 A;  2O5J C;  3Q22 A;  4GKK Q;  1BBX C;  3A55 A;  2JA9 A;  2K7V A;  1HQM C;  1VF5 C;  3A8I E;  3DWA A;  4DR3 L;  5E7N A;  1DGS A;  3A8K E;  3FVQ A;  3GTP B;  1DXM A;  1SYG A;  2F0S A;  4MTK A;  2UUA Q;  2EE1 A;  3HOW H;  2NBF A;  1VQI A;  4RH6 A;  4CHT B;  3J7Y W;  4WOR A;  1CA5 A;  1YNJ C;  1E2W A;  2R7Z H;  2IJ0 A;  1II3 A;  5HGQ A;  3GTG B;  3KOJ A;  1FJG L;  5JPN C;  2EDG A;  3BDO A;  2HDL A;  2A68 D;  2PCF B;  1UWV A;  4JK1 C;  3GQB A;  2GVA A;  4UAI A;  4KD4 A;  3RLN A;  3KF6 A;  1E24 A;  3VYU A;  1K9M C;  4GZY C;  3L3O C;  5IY0 A;  1BBW A;  3QB3 A;  1X32 A;  4KN4 C;  5M5Y B;  3F2U A;  1IBL Q;  1H9M A;  4K2K A;  2L15 A;  4A75 A;  4XYO A;  4PQX A;  3ZYY X;  4RGO S;  1N33 L;  2V4D A;  3H0G H;  3OIQ A;  3S16 B;  1HFN A;  3MXG A;  3J80 L;  1VQK A;  1LT3 D;  5H1S E;  1EY9 A;  5LMU Q;  3V05 A;  1SR3 A;  3A74 A;  1QWY A;  1SAP A;  1EYD A;  3S1Q H;  4P71 A;  5GQO A;  3VYR A;  1BNZ A;  1HNX L;  1K83 B;  2K1B A;  4N9P A;  3I91 A;  1ZYR C;  4IUN A;  3MTS A;  5JEA G;  1Y1V B;  5FKA C;  2DY7 A;  3HOY G;  1X56 A;  3HKZ B;  3M3Y H;  2JA5 H;  1LTB D;  5CBE E;  3B6Y A;  1TWF H;  1IHZ A;  1MSH A;  2JXM B;  4A3G B;  4DV2 Q;  1IBK L;  4HCE A;  1NSN S;  1GUW A;  5TSS A;  3L7Z C;  1VQB A;  4Z9C B;  1LTR D;  1JOR A;  3CU7 A;  5CV9 A;  4JBM A;  1FVI A;  3SHL A;  1VQL A;  3FKI B;  1I50 B;  4JI1 L;  3H3V H;  3SK5 A;  2KED A;  4A3F B;  3KF8 A;  2L11 A;  4JOI C;  3VA5 A;  1Q8K A;  3E0E A;  2IWH A;  5E1F A;  2JK8 A;  1SNC A;  1EIY B;  4C1N K;  3BYT B;  1Q1B A;  4JI3 Q;  2Q2T A;  1YNX A;  5IYC H;  3CCU A;  1I6V C;  4A3J B;  1STA A;  1ILQ A;  1O7I A;  2RBM A;  4ALP A;  2B2Y A;  1FNU A;  1LTS D;  4XTC S;  5F2D A;  2MO1 A;  3K58 A;  4I7Z C;  4IO9 A;  4F87 A;  4A3K G;  1YJW A;  1HZC A;  1RJT A;  3K5L A;  1CSP A;  1QUQ B;  4IFD G;  3T1Y Q;  1I3Q B;  1RCV D;  4R8N A;  1EZ6 A;  3C1F A;  3H3V C;  3W5O A;  2NVQ B;  1LTI D;  2EQS A;  4TKO B;  3J81 c;  4C3I B;  5ELD A;  4C1N I;  1G91 A;  1HUN A;  3A8J E;  4DR3 Q;  4FF4 A;  5C44 B;  3I4M H;  2JA7 G;  5M5W H;  1PH7 A;  1YNN D;  1G6P A;  5E4X A;  2RA4 A;  1K3R A;  3RNU A;  3WOF A;  1MBY A;  3K7A H;  5I9P A;  2A6H D;  2XSC A;  1N9W A;  4K0K L;  3NQT A;  3MVV A;  1VQH A;  3GTO B;  3M9B A;  3FHW A;  4XYQ A;  2KHJ A;  4HJ9 A;  5FO9 B;  3S9W A;  1FJG Q;  1NR2 A;  2ZTD A;  2VB3 X;  1SYC A;  1DJR D;  4RKL A;  5EPL A;  4KLK A;  3S15 H;  5C4X G;  2PQA B;  4XQQ A;  1SXT A;  2PMZ E;  3I4O A;  2PNH A;  1SE2 A;  4BWG B; 
#chains in the Genus database with same CATH homology
 2NN6 I;  3QO2 A;  1V1P B;  3M4Y A;  4L8J A;  2QDB A;  4EGV A;  3K5M A;  5D14 A;  2HUG A;  3NE5 B;  2VUM B;  1JR0 D;  3X3N A;  3NTI A;  2PW5 A;  1Q1E A;  3Q24 A;  3NUC A;  3GO5 A;  3RUZ A;  1A15 A;  2JA8 B;  2F0L A;  1KLG D;  1SE4 A;  5I2X A;  4OO1 I;  5G3L F;  1SYF A;  4KN7 C;  5EKL A;  1EIG A;  1WTW A;  3P7J A;  3S1N B;  1EY5 A;  1XWE A;  2PW7 A;  4IUV A;  1A2U A;  1XYI A;  1HA6 A;  3VR4 A;  5C5L A;  3MFG A;  2K6A A;  5JEA H;  2E75 C;  2BDO A;  2RKS A;  2C9O A;  3O13 A;  5FLX E;  5C4H A;  5D3I B;  4X3T A;  3C2P A;  1SNQ A;  3I73 A;  3J7A F;  1SNO A;  2F0D A;  3NQI A;  5I6Y A;  1GXD C;  1PZI D;  4PMB A;  2KQ3 A;  1NR4 A;  2D9U A;  5CGK A;  1O7L A;  3D4D A;  3TP6 A;  4DAP A;  1J8I A;  3OMG A;  4JBW A;  3NTK A;  1ML0 D;  3OHX C;  1D5M C;  2FIN B;  3D6C A;  1EFI D;  2WP8 J;  2IT1 A;  4IFD H;  2RQX A;  3MWY W;  2K5D A;  5CV8 A;  3I72 A;  1IKL A;  1BCP D;  1B50 A;  2XWB B;  1C4Q A;  3T56 B;  1I4P A;  1KNA A;  1TS3 A;  4WJW A;  2ZXP A;  2ENB A;  4RFB A;  2RSN A;  3BZD B;  1WTX A;  2JSO A;  5EBC A;  2ID0 A;  3DM1 A;  3CRL C;  3M7N A;  2EYL A;  1STG A;  1TWA B;  3GTK B;  5IGG A;  3J7A V;  1PTO D;  3J81 L;  2AQ1 B;  1S5C D;  4C3H B;  2F0T A;  1DCZ A;  3LNN A;  4XT1 B;  2AUK A;  2J4X A;  3FDT A;  3N52 A;  5JAV A;  2XVS A;  2HCI A;  3AU7 A;  1PXU A;  2EY5 A;  4A3M B;  2X6L A;  1RTN A;  5JPM C;  2JA6 B;  2LKV A;  1C8C A;  4A3E B;  2F0M A;  4PMC A;  2XNA C;  4CGY B;  1TII D;  2F3V A;  5C4J B;  3QOJ A;  4OIK A;  4G7H C;  3HOZ B;  5KNB A;  2I07 B;  1O7Y A;  2WKD A;  2EYH A;  4G7Z C;  1G6Z A;  1BCP B;  3PUY A;  4ZKC B;  4RHS A;  4C3J G;  4KD3 A;  1CHP D;  3I4N B;  1EWH A;  2BE5 C;  2QKI C;  1PFN A;  1UUP A;  3N6R A;  2A73 B;  3BVZ A;  2PPB C;  1LTA D;  4FYD A;  2B8G A;  2NUC A;  2F0U A;  1XTC D;  3I8Z A;  3H09 A;  2G9D A;  4NW2 A;  1PTO B;  2XRQ D;  4NDX A;  3TN2 A;  2ZXO A;  2B2T A;  1KDA A;  4DFA A;  1JWM D;  3GTQ B;  1G29 1;  1I4R A;  5CV4 A;  1I4G A;  1JOO A;  1ICW A;  3ND9 A;  2B2U A;  3MAQ A;  1PMR A;  5KNC A;  3PMF A;  1EOT A;  4KKS A;  4EQN A;  2L9H A;  2B63 B;  3K57 A;  2YU9 B;  3WDN A;  1GOZ A;  4QMG A;  2GA4 B;  3A54 A;  2SDF A;  1RHP A;  4KKT A;  1K8M A;  1B9N A;  3URY A;  3LX0 A;  5D65 A;  1GUO A;  2EY2 A;  4NMZ A;  1IW7 D;  1LAB A;  1JIC A;  1WTQ A;  3EA6 A;  5IT9 L;  2FMM A;  3KLS A;  3RLF A;  4ZLT F;  1GUN A;  3PUZ A;  4ZYS A;  3JAM L;  5C5M A;  4M8A A;  1S5D D;  2NTS A;  4KHV A;  3MA2 B;  3TP8 A;  3T13 A;  1EQV A;  1HTP A;  1WTR A;  1B53 A;  3TZU A;  3PV0 A;  1G2S A;  1R9T B;  4MN3 A;  5FO7 B;  3W3A A;  2ICE C;  1KLU D;  1BF4 A;  5KYI A;  1G2T A;  1LT5 D;  1JB3 A;  1J9O A;  2L5T A;  1F9S A;  4C2M B;  2B2W C;  4HED A;  3I4L A;  2XRS D;  2CW0 D;  3K5O A;  5CV6 A;  4DAY A;  5KYL A;  3MC0 B;  1CZW A;  1EEF D;  1BOS A;  4B9X A;  3NK9 A;  2F0I A;  1JE4 A;  1IYV A;  2PNR C;  2A5H A;  1HUM A;  4MHE A;  2NYZ D;  1FNW A;  1EU4 A;  1C48 A;  2RDH A;  3J81 E;  2MP1 A;  4FF3 A;  2E2D C;  4KY5 A;  1ET6 A;  4EQP A;  1KTK A;  1F77 A;  1OXU A;  5EKI A;  1BQQ T;  1CQF A;  4C56 C;  2EYM A;  5ELE A;  3QWN A;  2TMP A;  1LTG D;  3K0Y A;  1X3Q A;  2F03 A;  2NVT B;  1V1P A;  1A3T A;  3FPU B;  1I4X A;  2OT2 A;  3PIO 3;  2K5Q A;  2PQE A;  1ESF A;  3IKJ A;  4K6L A;  3GV3 A;  5HGT A;  3S1R B;  4KK7 A;  3TP5 A;  2XN9 C;  2X6G A;  1AZQ A;  5COY A;  2K04 A;  1YNJ D;  2Q8T A;  5FLX L;  1B1Z A;  4HN7 A;  2KCC A;  4IUU A;  1E2Z A;  3R8B A;  1O7Z A;  1TY2 A;  3R3O A;  1F2M A;  1F9P A;  3KLS X;  1SFO B;  4ZRZ A;  2IL8 A;  4DU9 A;  2N88 A;  3A56 A;  5IGF A;  1D1I A;  4V0B A;  3H6M A;  4FF1 A;  4EVO A;  1BXT A;  2O4X A;  2WIN B;  2BOS A;  2JE6 I;  4DXF A;  3H91 A;  5E3F A;  2VB2 X;  5CV7 A;  3TDQ A;  2WV6 D;  3W2D A;  2CHB D;  5C3W A;  1D5X C;  4J1M A;  1AZP A;  3OOC A;  4CKB A;  4XXE A;  4F7X A;  2K01 A;  2XWJ B;  1SBB B;  4IUP A;  5IT9 E;  1HRJ A;  2XIW A;  1EWC A;  2PMZ B;  3RZO B;  3OSO A;  3JAM E;  1HPC A;  2QCP X;  2F0V A;  5K5P A;  3DEO A;  1PYW D;  4DNT B;  2N55 A;  1BDO A;  2L1B A;  4CJ0 B;  2SEB D;  3MEH A;  2EY6 A;  5BN5 A;  2Z4H A;  4DAV A;  2SNS A;  2DNE A;  2B2V C;  4HMI A;  2O5I C;  5M9O A;  4J8Q A;  1CT1 D;  5KND A;  1FYC A;  3PUX A;  1SEB D;  1TS5 A;  2K05 A;  1E2V A;  1Z47 A;  3BS1 A;  2WAQ B;  4X3K A;  1SJH D;  1UNS A;  3HOW B;  1U9R A;  5CV5 A;  2PZU A;  2BA1 A;  1SMY C;  2R7Z B;  1CI3 M;  3IL8 A;  2F1M A;  1DOM A;  4ZKB B;  1X3P A;  2IX3 A;  4R9W A;  1A3U A;  3RMH A;  3NSW A;  4FNF A;  4TRD A;  2AWO A;  1ZXT A;  1JWU D;  1GJX A;  2YYZ A;  3T16 A;  3H0G B;  2IPK D;  3DEP A;  3AMU A;  5C0X I;  4QUC A;  3S1Q B;  5JJZ A;  3DMU A;  2NWG A;  5DNF A;  1SYD A;  4ZUI A;  5C0X J;  1HTL D;  2E76 C;  4QB4 A;  4ID6 A;  3M3Y B;  2JA5 B;  2I46 A;  2NN6 G;  1SYB A;  1TWF B;  4QUF A;  3NBI A;  4UDU C;  3HP3 A;  4KY7 A;  1F2Y A;  1RD9 D;  2EJM A;  4NKL A;  4B08 A;  4IQZ A;  1STB A;  1HA5 A;  3SEB A;  2OXP A;  3OWE B;  4H7B A;  1BR9 A;  1L0Y B;  5EKK A;  4I65 A;  1FGB D;  3E6Z X;  5CYU A;  4RCO A;  4MIU A;  3MFY A;  4X3U A;  4OO1 G;  2F0H A;  2RSO A;  1OO9 B;  3MXU A;  5BN4 A;  3L9A X;  2JYO A;  2WII B;  1GUS A;  3VA7 A;  4IAL A;  4RGN A;  3I4M B;  2Q8I B;  5M5W B;  4BA1 I;  1SNM A;  5T1G A;  2EYJ A;  1XXG A;  3K7A B;  1M4V A;  1ONL A;  2KA7 A;  2EYF A;  4HSP A;  5NUC A;  2NB0 A;  3S15 B;  1STH A;  4V19 0;  2CQA A;  1B3A A;  3DWQ A;  1Y8N B;  5FO8 B;  1RDP D;  1ZKO A;  1W6J A;  2A6E C;  5EPJ A;  4FP5 D;  3WOE A;  2E74 C;  3ITP A;  4QCL A;  5JVG 3;  1LO5 D;  3VR2 A;  2M9V A;  2L55 A;  3HOX B;  1ET9 A;  1AN8 A;  2BDN A;  2KJX A;  2KEC A;  5KEE A;  2FFK B;  3M4O B;  2IW3 A;  3VR6 A;  2KHS A;  1S5E D;  3NWT A;  3DHQ A;  2K28 A;  1STY A;  2AQ2 B;  2RDG A;  4OL7 A;  3BYY B;  1EZ8 A;  1AFP A;  3SR1 A;  2SNM A;  5KRU A;  3SK8 A;  2HCC A;  1DOL A;  1PRT C;  4NP5 A;  3E5S A;  2B8F A;  2F3W A;  4XDX A;  5CC4 A;  3GTM B;  1R4P B;  4YIJ A;  3HEJ A;  2PO4 A;  1WTO A;  2NN6 H;  3TZD A;  5EGT A;  1S5B D;  4LK1 C;  3A7L A;  1QOH A;  3LWE A;  1TKW B;  2H1E A;  5IGD A;  1TVX A;  1TS2 A;  5ELB A;  3I70 A;  2M2L A;  3NBH A;  1F9R A;  2WAC A;  1W6K A;  2BE5 D;  1ENC A;  4DF7 A;  1K8O A;  3QJY A;  1EY6 A;  5I9O A;  1WVL A;  3E0J A;  3H94 A;  2F0W A;  3OIP A;  1AP0 A;  4L6T B;  4OO1 H;  1EU3 A;  2K33 A;  5COR A;  2B2W A;  2KEE A;  3OWF A;  4C3I G;  4A3K B;  2IX0 A;  1NUC A;  1RF2 D;  2EJF C;  1ENA A;  3EQL C;  1F2L A;  1ENF A;  1QIL A;  1H9K A;  2EYP A;  3KUP A;  2A69 C;  2EJG C;  4LJZ C;  3HGB A;  3HRZ C;  3QOL A;  5ELC A;  1TWG B;  1OXT A;  1A3V A;  2HDM A;  5A35 A;  1RTO A;  1NCV A;  1IW7 C;  5IIF A;  1H9S A;  3EVQ A;  4L63 B;  3PIP 3;  5K36 G;  1PFM A;  5E4W C;  5C4X B;  4K5W A;  3R93 A;  4IZ8 A;  1PRT F;  4CKC A;  3BDC A;  2O2L D;  3I90 A;  2Y0S B;  3SK6 A;  1TR5 A;  2FJ2 A;  2R6G A;  1ESR A;  1GUT A;  2AQ3 B;  1SDF A;  5KGU A;  1OXS C;  1PDQ A;  2Q8R E;  3ERQ A;  4DA2 A;  2K5W A;  5T1I A;  1I6H B;  1DZ1 A;  1CK1 A;  3MZ5 A;  4FF2 A;  2VXW A;  1FD7 D;  4BA2 I;  3PO3 B;  2CW0 C;  4Y7N B;  1WCM B;  1A6X A;  1DM0 B;  4ILW A;  3QG1 A;  3SDZ A;  4WRD A;  1V8Q A;  2KVM A;  5ISR A;  3V2T A;  4O1N A;  2L0C A;  3ND8 A;  1BO0 A;  4TQU S;  3NWS A;  4U67 3;  2Z8L A;  1HCZ A;  1U4P A;  3EFX D;  1PLF A;  1F9Q A;  3HS0 C;  2C5C A;  2L12 A;  3I3C A;  1QE6 A;  4HCS A;  1LV9 A;  3P75 A;  4DK1 A;  1Q8I A;  4XT3 B;  4HR7 B;  5KIX A;  1DD2 A;  4RGT A;  1EYC A;  3TSS A;  2EPB A;  1JWS D;  1ROD A;  2RVL A;  2JP1 A;  1SYE A;  5I4D A;  5CBA E;  3P20 A;  3NXW A;  1KAA A;  2MPM A;  3K59 A;  1QJO A;  1IKM A;  1SJE D;  2ICI A;  3LWU A;  2R93 B;  5M3F B;  2EZV A;  3ONA B;  1KDB A;  3BDL A;  3D4W A;  2MUY A;  2R3Z A;  3OMC A;  2A68 C;  2BCO A;  3TP7 A;  1IYU A;  3G6J B;  1MGS A;  2MJ8 A;  2R61 A;  1IL8 A;  1TT2 A;  2D5D A;  1TS4 A;  3RZD B;  1LAC A;  4LAA A;  3P1H A;  4BY1 B;  4KMU C;  4C3H G;  1AEX A;  1GHK A;  2F0J A;  2B2V A;  3SXH A;  1SSO A;  4RHR A;  5JEA J;  2F0N A;  1QG7 A;  4XQN A;  5K36 H;  5CR3 A;  3QIA A;  1LLR D;  1VMC A;  4ZUJ A;  3IFD A;  1H9S B;  4M1U B;  1TQO A;  2J0T D;  4HAE A;  1KDC A;  1Q3L A;  1PFB A;  2EYO A;  3Q23 A;  1MSG A;  1FNV A;  3MXN A;  4A3I B;  3CRK C;  3CKI B;  5BN3 A;  3M7G A;  3SE0 A;  1ZYR D;  4HTH A;  4Q0F A;  4KHZ A;  1Y1W B;  1CTM A;  1Z6H A;  1Y8O B;  4RCN A;  4FXG C;  3RD4 A;  3PO2 B;  4IFD I;  1TWC B;  3FMC A;  3MXP A;  4FO2 A;  1D5Z C;  1JOK A;  1L0X B;  4CKE A;  3SK4 A;  4DGZ A;  4LMQ D;  4IFD J;  4C3J B;  5G3L D;  1UAP A;  4ME5 A;  2M00 A;  5DM6 3;  3D6W A;  1JOQ A;  2E2I B;  3GTJ B;  3OPO A;  4IN3 A;  1B2T A;  1T5E A;  4H44 C;  4U68 A;  1TY0 A;  4E6I A;  2B39 A;  2WB1 B;  4BS9 A;  1Y69 U;  2DNC A;  5D3D A;  1DON A;  5C4Z A;  1YNN C;  4G7O C;  4RAU C;  2JEA I;  2A6H C;  1S5F D;  5C3E B;  3X3M A;  4RA8 A;  4IUT A;  2MHV A;  1E0B A;  1B44 D;  1EY0 A;  1B4O A;  4A3D B;  1VDZ A;  1OXV A;  4QF4 A;  3D8G A;  4G57 A;  4CBV A;  1LT6 D;  1SMY D;  1EL0 A;  2R92 B;  4A3B B;  2G9H D;  3EJI A;  1EY4 A;  2ZT9 C;  3S1M B;  1Q90 A;  2NVY B;  4O42 A;  1EEI D;  1HQR D;  5JVH 3;  5EPK A;  1EIH A;  4X3S A;  3K6O A;  1LTT D;  3DUZ A;  2KOL A;  4BY7 B;  1DOK A;  4OGQ C;  4ULL A;  1MD2 D;  2AUJ D;  1D2B A;  2NVX B;  1XX8 A;  2B2Y C;  4PV1 C;  3HZX A;  2ZXR A;  1QCB D;  2DY8 A;  4DNR B;  1ILP A;  2F4I A;  2SOB A;  4KV6 A;  4K8J A;  1V43 A;  5A2Q L;  1QNK A;  1H9R A;  3CQZ B;  1Z7T A;  4KJN A;  5FK9 C;  5C0X G;  5C3X A;  1HFG A;  1O80 A;  4S3S A;  3C3L A;  2F0E A;  3V96 A;  5I6W A;  2HQE A;  1EQT A;  4IUR A;  3HOU B;  1CQV A;  3S2H B;  3U9S A;  3D4R A;  1VMP A;  4G4K A;  4H13 C;  5EJW A;  1QNU A;  3FRP B;  1WD0 A;  4QIW B;  4PMW A;  3J80 E;  1EY8 A;  4DN4 M;  4RWS C;  1HHV A;  1PTO H;  3A7A B;  2EXZ A;  1TU2 B;  3BG3 A;  1TWH B;  4K5X A;  4KTA A;  1BCP C;  5EBD A;  1WTP A;  1CFM A;  5IGB A;  3KLR A;  1SE3 A;  1CA6 A;  5AFW A;  3TBI B;  5J22 A;  1O78 A;  1EY7 A;  5M3M B;  1GUG A;  1I4H A;  1U4L A;  1PTO C;  1VCI A;  3HG9 A;  3G7L A;  2NZ1 D;  5LL6 X;  2A74 C;  1CZG A;  2RDF A;  3C46 A;  3BVG A;  2A6E D;  2Z4I A;  3U9O A;  2PZW A;  4TSS A;  3NTH A;  4K8I A;  4KY6 A;  4OHJ A;  5J39 A;  4XIG S;  1AW7 A;  2PZT A;  3DWP A;  2K32 A;  1R4Q B;  3FEW X;  4HSV A;  4RGM A;  4K5V A;  1QB5 D;  4KJO A;  2EOT A;  1I4Q A;  2E2J B;  3IAY A;  3PUW A;  5C6A A;  2Z1C A;  2EY1 A;  1V1O A;  3HOY B;  3T4A C;  1JCK B;  5DAU A;  1SND A;  1PRT D;  3NHH A;  1RKN A;  4OIJ A;  3T53 B;  3M85 A;  3GP7 A;  1D6E C;  3MHB A;  1SNP A;  4EQO A;  2FMC A;  1U4M A;  2LFN A;  3NP8 A;  4CJ1 B;  1S4Z A;  3GD7 A;  2D62 A;  2X69 A;  5J1Z A;  4DXG A;  4WFN 3;  5DM7 3;  5C0X H;  3ERO A;  2J7Z A;  4BBR B;  3HOV B;  4P2C B;  1BCP F;  4J6H A;  3Q0A A;  1UEA B;  5LL6 S;  3IFT A;  3D3R A;  4CJ2 C;  5IOC A;  3KBG A;  2CVR A;  1T5X D;  4XQJ A;  2LY7 A;  4FVM A;  4HMJ A;  2NTT A;  1CM9 A;  2KCN A;  3FPP A;  2F0P A;  1U4R A;  5A2Q E;  1OXX K;  1PTO F;  1PZJ D;  2JA7 B;  1B9M A;  5LHY 1;  3GV6 A;  5IOD A;  4FXK C;  3AB9 A;  2FHT A;  1Y8P B;  3GTL B;  3S17 B;  5M5X B;  1PRT B;  2A69 D;  1HXY D;  3PUV A;  2QEJ C;  3S14 B;  2IX1 A;  2F0Q A;  1D1K A;  5IGC A;  3TME A;  5IGE A;  5ELF A;  3R2T A;  4F8M A;  3C1E A;  1GHJ A;  2VNU D;  4AYB B;  2PYK A;  1BUV T;  2F0F A;  3DXJ C;  2EVB A;  3VYS A;  4ZAI A;  1CHQ D;  4F88 A;  1STN A;  2JEB I;  4ZQ3 A;  4KI0 A;  2LMC B;  2OF1 A;  4A93 B;  5JOB A;  4H0L C;  1KNE A;  2AWN A;  2QF7 A;  4K6D A;  3CHB D;  3OW7 A;  3S2D B;  2DN8 A;  1STE A;  5FOB B;  1FR3 A;  4K2L A;  4R8I A;  2E2H B;  3KK7 A;  4DK0 A;  5DEH A;  2B2T C;  3NPP A;  2QIL A;  3KBX A;  2F0K A;  1JQY D;  4N9T A;  4ABN A;  2L4N A;  4BBS B;  1ZEQ X;  2B2U C;  1MI2 A;  2KUM A;  1WTV A;  1F2Z A;  2BA0 A;  1VF7 A;  2OEO A;  4B9W A;  2F0O A;  1JC7 A;  3VYT A;  4Q5V A;  1PZK D;  3R2I A;  5I2Y A;  4PNY A;  1DYQ A;  3K5N A;  4FXD A;  4RKB A;  4ODG A;  1Q12 A;  3Q6S A;  3T51 B;  1LT4 D;  3D31 A;  3VR5 A;  4IUQ A;  1G8Z D;  5EQ0 A;  2H4O A;  2WKC A;  3SVM A;  1M8A A;  5CMD A;  2F0G A;  3VR3 A;  2K03 A;  2D2C C;  1WD1 A;  4K14 A;  5HUR A;  1H9J A;  1KAB A;  2TSS A;  1A2T A;  2LS0 1;  4KKU A;  3UI2 A;  4ZK9 B;  1NAP A;  2MGS A;  1EYA A;  3BVM A;  2O5J C;  3Q22 A;  1BBX C;  3A55 A;  2K7V A;  1HQM C;  1VF5 C;  3A8I E;  3DWA A;  3A8K E;  3FVQ A;  3GTP B;  1DXM A;  1SYG A;  2F0S A;  2EE1 A;  2NBF A;  4CHT B;  4RH6 A;  3J7Y W;  4WOR A;  1CA5 A;  1YNJ C;  1E2W A;  2IJ0 A;  1II3 A;  3GTG B;  5JPN C;  2EDG A;  3BDO A;  2HDL A;  2A68 D;  2PCF B;  4JK1 C;  3GQB A;  4UAI A;  4KD4 A;  3VYU A;  4GZY C;  3L3O C;  3QB3 A;  1X32 A;  4KN4 C;  5M5Y B;  3F2U A;  1H9M A;  4K2K A;  4XYO A;  4PQX A;  3ZYY X;  4RGO S;  2V4D A;  3OIQ A;  3S16 B;  1HFN A;  3MXG A;  3J80 L;  1LT3 D;  1EY9 A;  3V05 A;  1QWY A;  1SAP A;  1EYD A;  3VYR A;  1BNZ A;  1K83 B;  2K1B A;  4N9P A;  3I91 A;  4IUN A;  1ZYR C;  3MTS A;  5JEA G;  1Y1V B;  5FKA C;  2DY7 A;  3HKZ B;  1LTB D;  5CBE E;  1IHZ A;  1MSH A;  2JXM B;  4A3G B;  4HCE A;  1NSN S;  1GUW A;  5TSS A;  3L7Z C;  4Z9C B;  1LTR D;  1JOR A;  3CU7 A;  5CV9 A;  3SHL A;  3FKI B;  1I50 B;  3SK5 A;  2KED A;  4A3F B;  3KF8 A;  2L11 A;  3VA5 A;  2IWH A;  5E1F A;  1SNC A;  4C1N K;  3BYT B;  1Q1B A;  1I6V C;  4A3J B;  1STA A;  1ILQ A;  2RBM A;  2B2Y A;  1FNU A;  1LTS D;  4XTC S;  5F2D A;  3K58 A;  4I7Z C;  4F87 A;  1RJT A;  3K5L A;  4IFD G;  1I3Q B;  1RCV D;  4R8N A;  1EZ6 A;  3C1F A;  3H3V C;  2NVQ B;  1LTI D;  4TKO B;  4C3I B;  5ELD A;  4C1N I;  1G91 A;  1HUN A;  3A8J E;  4FF4 A;  5C44 B;  1YNN D;  5E4X A;  2RA4 A;  3WOF A;  1MBY A;  5I9P A;  2A6H D;  2XSC A;  3NQT A;  3MVV A;  3GTO B;  4XYQ A;  5FO9 B;  3S9W A;  1NR2 A;  2VB3 X;  1SYC A;  1DJR D;  4RKL A;  5EPL A;  4XQQ A;  1SXT A;  1SE2 A;  4BWG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...