2F1CX

Crystal structure of the monomeric porin ompg
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
280
structure length
252
Chain Sequence
NDWHFNIGAMYEIENVGLAEPSVYFNAANGPWRIALAYYQEGPVDYSKRGTWFDRPELEVHYQFLENDDFSFGLTGGFRNYGYHYVDEPGKDTANMQRWKIAPDWDVKLTDDLRFNGWLSMYKFANDLNTTGYADTRVETETGLQYTFNETVALRVNYYLERGFNMDDSRNNGEFSTQEIRAYLPLTLGNHSVTPYTRIGLDRWSNDFNRVGLFYGYDFQNGLSVSLEYAFEWQDDKFHYAGVGVNYSFHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein G
publication title Crystal Structure of the Monomeric Porin OmpG.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 65
structure length 252
sequence length 280
ec nomenclature
pdb deposition date 2005-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF09381 Porin_OmpG Outer membrane protein G (OmpG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 2f1cX00
2F1CX 4PR7A 2WJRA 2IWVA 2WVPA 2IWWA 2WJQA 2X9KA 4FQEA 2JQYA 4CTDA
chains in the Genus database with same CATH superfamily
4LSFA 2M07A 4LSHA 3VE1A 5IYUA 4D5UA 2R4OA 4XNKA 3DA4A 4FUVA 3A0HO 4GF4A 2PRNA 3DWNA 3JCUO 5G26A 2JQYA 3UPGA 1IZNB 4O4UA 3C5OA 1QJ9A 4PUXA 5DL5A 5GTIO 2X27X 3A2SX 4N58A 3TZGA 3AAEB 4G75A 3LK3A 4AUIA 4FZNA 3LK2B 5FVNA 5DL6A 4AYNA 4BUMX 2K0LA 2AXTO 3AA6A 1MPFA 2Y0HA 1GFNA 4AKRA 2R89A 4K3CA 4RL9A 1Q9FA 4UB6O 2ODJA 4FESA 4LSEA 4FSPA 4AZLA 2JMMA 1ZHYA 1QJ8A 3VZTX 1HXTA 2N2MA 3AA1B 4FRTA 3PQSA 3VY9X 3VZWX 4AKMA 4C00A 3PGSA 3PQUA 3NSGA 2O4VA 4C4VB 3POUA 2ERVA 2W81C 1YS5A 5G38A 3VE2A 1G90A 2ZFGA 4RLCA 4O3XB 1ZHTA 5GV0A 1Q9GA 1IZNA 5KAIO 3PGRA 4JCHA 5KAFO 3PRNA 4O3ZA 2FGQX 2WJRA 3V8UA 4E1TA 3LK2A 2LHFA 2IWWA 4KR4A 4QQ1A 3POXA 5DL8A 2R4PA 5AFUK 4G76A 4FT6A 1GFMA 4K3BA 5AFUL 8PRNA 1OPFA 4PR7A 2XMXA 2MHLA 3RBHA 4U9CA 1GFPA 2WVPA 1BT9A 4E1SA 3AA1A 3G7GA 3JTYA 3VY8X 5EE2A 2OMFA 4B61A 2XG6A 2PORA 3GP6A 5T5FA 2R88A 4C4VA 5H2FO 4O4XA 3SZDA 4RJXA 3UU2A 3HOLA 2R8AA 2MNHA 1QJPA 3WI4A 2M06A 2KZ7B 1P4TA 4FQEA 4FSOA 4O3WA 1PHOA 4PJ0O 3T24A 1MM4A 4CTDA 3LK42 4FRXA 1ORMA 1BH3A 3KVDD 3POQA 4N74A 5TISO 5JDPA 3A0BO 2R4LA 1MM5A 1T16A 3AA0B 2XTRA 4Z3TA 4KR8A 3FYXA 3SY9A 1S5LO 5GTHO 4N75A 3DZMA 2KDYA 2W80C 2IWVA 1PRNA 3AAEA 3HWBA 3PGUA 3PORA 2N2LA 4GCPA 3WI5A 1H6S1 2X9KA 3AA7B 1HXXA 4AYEC 2Y0LA 5B66O 5ADXL 2YNKA 2Y7SA 4AYDC 3T20A 3DWOX 1ZHZA 3AA6B 4RLBA 3SY7A 2YPVA 2KXPB 1GFQA 4AKRB 3AAAB 2ZLDA 5DL7A 3BRZA 5ADXK 4FZLA 1ZHWA 3LK41 2J1NA 1OSMA 1HXUA 3AA0A 1ZHXA 5G39A 5E79O 4O49A 1GFOA 2XE3A 2Y2XA 3QRAA 5G3AA 5B5EO 3BRYA 3SYBA 7PRNA 4AYID 3KZIO 2GE4A 3SZVA 4D65A 4FMSA 4O3YA 5D5DA 4GHBA 4JFBA 3AA7A 4C69X 2K4TA 2J4UP 4AFKA 3O0EA 3BS0A 2XE2A 2WJQA 4FOZA 1T1LA 3HW9A 4RJWA 4XNLA 4D64A 3PF1A 3WU2O 4GCQA 4IL6O 3DA3A 5PRNA 2FGRA 2LFUA 4GCSA 2F1CX 2KXPA 3LK3B 3T0SA 3HOEA 4KRAA 2F1VA 2QTKA 2XE1A 2Y0KA 3AAAA 4UB8O 2KC0A 2R4NA 2XE5A 2F1TA 4LSIA 3SYSA 4N59A 4AYMC 2XTQA 2KZ7A 3EMNX 3VZUX 3K19A 4FZMA 1THQA 3UAQA 1E54A 1BXWA 3QRCA 4F4BA 6PRNA 3NJTA
chains in the Genus database with same CATH topology
2F1CX 4PR7A 2WJRA 2IWVA 2WVPA 2IWWA 2WJQA 2X9KA 4FQEA 2JQYA 4CTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F1C X;  4PR7 A;  2WJR A;  2IWV A;  2WVP A;  2IWW A;  2WJQ A;  2X9K A;  4FQE A;  2JQY A;  4CTD A; 
#chains in the Genus database with same CATH topology
 4LSF A;  2M07 A;  4LSH A;  3VE1 A;  5IYU A;  4D5U A;  2R4O A;  4XNK A;  3DA4 A;  4FUV A;  3A0H O;  4GF4 A;  2PRN A;  3DWN A;  3JCU O;  5G26 A;  2JQY A;  3UPG A;  1IZN B;  4O4U A;  3C5O A;  1QJ9 A;  4PUX A;  5DL5 A;  5GTI O;  2X27 X;  3A2S X;  4N58 A;  3TZG A;  3AAE B;  4G75 A;  3LK3 A;  4AUI A;  4FZN A;  3LK2 B;  5FVN A;  5DL6 A;  4AYN A;  4BUM X;  2K0L A;  2AXT O;  3AA6 A;  1MPF A;  2Y0H A;  1GFN A;  4AKR A;  2R89 A;  4K3C A;  4RL9 A;  1Q9F A;  4UB6 O;  2ODJ A;  4FES A;  4LSE A;  4FSP A;  4AZL A;  2JMM A;  1ZHY A;  1QJ8 A;  3VZT X;  1HXT A;  2N2M A;  3AA1 B;  4FRT A;  3PQS A;  3VY9 X;  3VZW X;  4AKM A;  4C00 A;  3PGS A;  3PQU A;  3NSG A;  2O4V A;  4C4V B;  3POU A;  2ERV A;  2W81 C;  1YS5 A;  5G38 A;  3VE2 A;  1G90 A;  2ZFG A;  4RLC A;  4O3X B;  1ZHT A;  5GV0 A;  1Q9G A;  1IZN A;  5KAI O;  3PGR A;  4JCH A;  5KAF O;  3PRN A;  4O3Z A;  2FGQ X;  2WJR A;  3V8U A;  4E1T A;  3LK2 A;  2LHF A;  2IWW A;  4KR4 A;  4QQ1 A;  3POX A;  5DL8 A;  2R4P A;  5AFU K;  4G76 A;  4FT6 A;  1GFM A;  4K3B A;  5AFU L;  8PRN A;  1OPF A;  4PR7 A;  2XMX A;  2MHL A;  3RBH A;  4U9C A;  1GFP A;  2WVP A;  1BT9 A;  4E1S A;  3AA1 A;  3G7G A;  3JTY A;  3VY8 X;  5EE2 A;  2OMF A;  4B61 A;  2XG6 A;  2POR A;  3GP6 A;  5T5F A;  2R88 A;  4C4V A;  5H2F O;  4O4X A;  3SZD A;  4RJX A;  3UU2 A;  3HOL A;  2R8A A;  2MNH A;  1QJP A;  3WI4 A;  2M06 A;  2KZ7 B;  1P4T A;  4FQE A;  4FSO A;  4O3W A;  1PHO A;  4PJ0 O;  3T24 A;  1MM4 A;  4CTD A;  3LK4 2;  4FRX A;  1ORM A;  1BH3 A;  3KVD D;  3POQ A;  4N74 A;  5TIS O;  5JDP A;  3A0B O;  2R4L A;  1MM5 A;  1T16 A;  3AA0 B;  2XTR A;  4Z3T A;  4KR8 A;  3FYX A;  3SY9 A;  1S5L O;  5GTH O;  4N75 A;  3DZM A;  2KDY A;  2W80 C;  2IWV A;  1PRN A;  3AAE A;  3HWB A;  3PGU A;  3POR A;  2N2L A;  4GCP A;  3WI5 A;  1H6S 1;  2X9K A;  3AA7 B;  1HXX A;  4AYE C;  2Y0L A;  5B66 O;  5ADX L;  2YNK A;  2Y7S A;  4AYD C;  3T20 A;  3DWO X;  1ZHZ A;  3AA6 B;  4RLB A;  3SY7 A;  2YPV A;  2KXP B;  1GFQ A;  4AKR B;  3AAA B;  2ZLD A;  5DL7 A;  3BRZ A;  5ADX K;  4FZL A;  1ZHW A;  3LK4 1;  2J1N A;  1OSM A;  1HXU A;  3AA0 A;  1ZHX A;  5G39 A;  5E79 O;  4O49 A;  1GFO A;  2XE3 A;  2Y2X A;  3QRA A;  5G3A A;  5B5E O;  3BRY A;  3SYB A;  7PRN A;  4AYI D;  3KZI O;  2GE4 A;  3SZV A;  4D65 A;  4FMS A;  4O3Y A;  5D5D A;  4GHB A;  4JFB A;  3AA7 A;  4C69 X;  2K4T A;  2J4U P;  4AFK A;  3O0E A;  3BS0 A;  2XE2 A;  2WJQ A;  4FOZ A;  1T1L A;  3HW9 A;  4RJW A;  4XNL A;  4D64 A;  3PF1 A;  3WU2 O;  4GCQ A;  4IL6 O;  3DA3 A;  5PRN A;  2FGR A;  2LFU A;  4GCS A;  2F1C X;  2KXP A;  3LK3 B;  3T0S A;  3HOE A;  4KRA A;  2F1V A;  2QTK A;  2XE1 A;  2Y0K A;  3AAA A;  4UB8 O;  2KC0 A;  2R4N A;  2XE5 A;  2F1T A;  4LSI A;  3SYS A;  4N59 A;  4AYM C;  2XTQ A;  2KZ7 A;  3EMN X;  3VZU X;  3K19 A;  4FZM A;  1THQ A;  3UAQ A;  1E54 A;  1BXW A;  3QRC A;  4F4B A;  6PRN A;  3NJT A; 
#chains in the Genus database with same CATH homology
 2F1C X;  4PR7 A;  2WJR A;  2IWV A;  2WVP A;  2IWW A;  2WJQ A;  2X9K A;  4FQE A;  2JQY A;  4CTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...