2F1CX

Crystal structure of the monomeric porin ompg
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
280
structure length
252
Chain Sequence
b'NDWHFNIGAMYEIENVGLAEPSVYFNAANGPWRIALAYYQEGPVDYSKRGTWFDRPELEVHYQFLENDDFSFGLTGGFRNYGYHYVDEPGKDTANMQRWKIAPDWDVKLTDDLRFNGWLSMYKFANDLNTTGYADTRVETETGLQYTFNETVALRVNYYLERGFNMDDSRNNGEFSTQEIRAYLPLTLGNHSVTPYTRIGLDRWSNDFNRVGLFYGYDFQNGLSVSLEYAFEWQDDKFHYAGVGVNYSFHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein G
publication title Crystal Structure of the Monomeric Porin OmpG.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 65
structure length 252
sequence length 280
ec nomenclature
pdb deposition date 2005-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF09381 Porin_OmpG Outer membrane protein G (OmpG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.40 Mainly Beta Beta Barrel Porin monomeric porin ompg 2f1cX00
2JQYA 4CTDA 2WVPA 2X9KA 2IWWA 2IWVA 4FQEA 2WJQA 4PR7A 2WJRA 2F1CX
chains in the Genus database with same CATH superfamily
5G26A 5KAFO 2N2LA 4FRTA 4AKRA 3AA6B 4O4UA 3T24A 5GTHO 4D65A 2KZ7B 4FMSA 2Y2XA 2XE1A 2R4PA 4FZMA 5DL6A 1ZHXA 2LFUA 1ZHTA 4JFBA 3WU2O 2YNKA 3HW9A 2R88A 4UB8O 4C00A 2JMMA 2MNHA 4UB6O 1ZHWA 1YS5A 2XG6A 3PGUA 3VZTX 2KXPB 3AAEA 3VE1A 4G75A 5AFUL 4IL6O 4F4BA 3O0EA 5PRNA 2FGQX 5B66O 4O3WA 3POXA 8PRNA 5DL8A 3JTYA 3DWNA 2MHLA 1IZNA 2FGRA 3AA1A 2XE2A 1GFMA 3GP6A 3AA0B 2IWWA 3AA6A 3SYBA 4JCHA 2R4OA 3LK2B 2LHFA 3HOEA 2K4TA 2WJRA 4FSPA 4FRXA 3DA4A 3PRNA 2Y0LA 4QQ1A 3HWBA 3EMNX 5GTIO 4D64A 5DL7A 5T5FA 4RL9A 3AA7B 4GCPA 2XE3A 3SZVA 1MM5A 4FT6A 5IYUA 3VZUX 1GFOA 3AAAA 1PHOA 3BRYA 2XTQA 3C5OA 1HXUA 4PJ0O 2KXPA 1THQA 4FZNA 1OSMA 4O3ZA 2XMXA 2M06A 3WI5A 3POQA 3G7GA 2X27X 4AYID 4BUMX 4E1SA 2YPVA 6PRNA 3BS0A 2JQYA 2WVPA 1Q9GA 1P4TA 3KVDD 4GHBA 1HXXA 1ZHZA 4LSIA 2WJQA 1BXWA 1ORMA 3LK2A 3LK42 4FOZA 4C4VB 5GV0A 3RBHA 1ZHYA 1E54A 4AZLA 1PRNA 2Y0HA 4LSEA 3UAQA 3T20A 2K0LA 3QRAA 4AFKA 1OPFA 2PORA 3AA7A 5ADXL 2XE5A 4XNKA 4PUXA 3TZGA 7PRNA 4KRAA 4FSOA 2KZ7A 2GE4A 5G3AA 5AFUK 3DZMA 4AKRB 2M07A 2Y7SA 4C69X 4KR8A 3PGRA 3JCUO 2QTKA 5KAIO 1GFQA 1QJ8A 2J4UP 2R89A 2OMFA 2J1NA 2X9KA 3WI4A 4K3BA 3VY9X 3T0SA 2ZFGA 2O4VA 4GCQA 4LSFA 3A0BO 4FZLA 4LSHA 4GCSA 3A2SX 4AYMC 5TISO 1QJ9A 4KR4A 1T1LA 4CTDA 5JDPA 1HXTA 3PF1A 1Q9FA 4N75A 3VY8X 3AA0A 1BT9A 3LK3B 3PORA 3QRCA 3VE2A 4E1TA 5D5DA 5B5EO 5H2FO 2KC0A 3BRZA 2ODJA 1IZNB 2F1TA 2IWVA 2R4LA 3PQUA 4RJWA 5DL5A 1T16A 3AA1B 4N74A 4O4XA 4PR7A 4K3CA 4O49A 2AXTO 1QJPA 3LK41 4U9CA 5FVNA 3VZWX 4AUIA 5E79O 3V8UA 1BH3A 1GFPA 2N2MA 4AYDC 2ZLDA 3SYSA 2Y0KA 1MM4A 3NJTA 4RLCA 1G90A 4AYEC 1GFNA 2F1CX 3PQSA 4O3XB 4O3YA 1H6S1 4FESA 4AKMA 4FUVA 3PGSA 4AYNA 2W81C 3AAAB 4N59A 2KDYA 3SY9A 2ERVA 2F1VA 3POUA 3A0HO 5ADXK 3LK3A 3HOLA 3NSGA 4RLBA 3DA3A 4C4VA 3KZIO 3K19A 4GF4A 1MPFA 4N58A 1S5LO 3AAEB 3UPGA 3UU2A 2W80C 4RJXA 4XNLA 5G38A 3SY7A 4B61A 5G39A 5EE2A 2R8AA 4G76A 4D5UA 3DWOX 2XTRA 4FQEA 3SZDA 2PRNA 3FYXA 2R4NA 4Z3TA
chains in the Genus database with same CATH topology
2JQYA 4CTDA 2WVPA 2X9KA 2IWWA 2IWVA 4FQEA 2WJQA 4PR7A 2WJRA 2F1CX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQY A;  4CTD A;  2WVP A;  2X9K A;  2IWW A;  2IWV A;  4FQE A;  2WJQ A;  4PR7 A;  2WJR A;  2F1C X; 
#chains in the Genus database with same CATH topology
 5G26 A;  5KAF O;  2N2L A;  4FRT A;  4AKR A;  3AA6 B;  4O4U A;  3T24 A;  5GTH O;  4D65 A;  2KZ7 B;  4FMS A;  2Y2X A;  2XE1 A;  2R4P A;  4FZM A;  5DL6 A;  1ZHX A;  2LFU A;  1ZHT A;  4JFB A;  3WU2 O;  2YNK A;  3HW9 A;  2R88 A;  4UB8 O;  4C00 A;  2JMM A;  2MNH A;  4UB6 O;  1ZHW A;  1YS5 A;  2XG6 A;  3PGU A;  3VZT X;  2KXP B;  3AAE A;  3VE1 A;  4G75 A;  5AFU L;  4IL6 O;  4F4B A;  3O0E A;  5PRN A;  2FGQ X;  5B66 O;  4O3W A;  3POX A;  8PRN A;  5DL8 A;  3JTY A;  3DWN A;  2MHL A;  1IZN A;  2FGR A;  3AA1 A;  2XE2 A;  1GFM A;  3GP6 A;  3AA0 B;  2IWW A;  3AA6 A;  3SYB A;  4JCH A;  2R4O A;  3LK2 B;  2LHF A;  3HOE A;  2K4T A;  2WJR A;  4FSP A;  4FRX A;  3DA4 A;  3PRN A;  2Y0L A;  4QQ1 A;  3HWB A;  3EMN X;  5GTI O;  4D64 A;  5DL7 A;  5T5F A;  4RL9 A;  3AA7 B;  4GCP A;  2XE3 A;  3SZV A;  1MM5 A;  4FT6 A;  5IYU A;  3VZU X;  1GFO A;  3AAA A;  1PHO A;  3BRY A;  2XTQ A;  3C5O A;  1HXU A;  4PJ0 O;  2KXP A;  1THQ A;  4FZN A;  1OSM A;  4O3Z A;  2XMX A;  2M06 A;  3WI5 A;  3POQ A;  3G7G A;  2X27 X;  4AYI D;  4BUM X;  4E1S A;  2YPV A;  6PRN A;  3BS0 A;  2JQY A;  2WVP A;  1Q9G A;  1P4T A;  3KVD D;  4GHB A;  1HXX A;  1ZHZ A;  4LSI A;  2WJQ A;  1BXW A;  1ORM A;  3LK2 A;  3LK4 2;  4FOZ A;  4C4V B;  5GV0 A;  3RBH A;  1ZHY A;  1E54 A;  4AZL A;  1PRN A;  2Y0H A;  4LSE A;  3UAQ A;  3T20 A;  2K0L A;  3QRA A;  4AFK A;  1OPF A;  2POR A;  3AA7 A;  5ADX L;  2XE5 A;  4XNK A;  4PUX A;  3TZG A;  7PRN A;  4KRA A;  4FSO A;  2KZ7 A;  2GE4 A;  5G3A A;  5AFU K;  3DZM A;  4AKR B;  2M07 A;  2Y7S A;  4C69 X;  4KR8 A;  3PGR A;  3JCU O;  2QTK A;  5KAI O;  1GFQ A;  1QJ8 A;  2J4U P;  2R89 A;  2OMF A;  2J1N A;  2X9K A;  3WI4 A;  4K3B A;  3VY9 X;  3T0S A;  2ZFG A;  2O4V A;  4GCQ A;  4LSF A;  3A0B O;  4FZL A;  4LSH A;  4GCS A;  3A2S X;  4AYM C;  5TIS O;  1QJ9 A;  4KR4 A;  1T1L A;  4CTD A;  5JDP A;  1HXT A;  3PF1 A;  1Q9F A;  4N75 A;  3VY8 X;  3AA0 A;  1BT9 A;  3LK3 B;  3POR A;  3QRC A;  3VE2 A;  4E1T A;  5D5D A;  5B5E O;  5H2F O;  2KC0 A;  3BRZ A;  2ODJ A;  1IZN B;  2F1T A;  2IWV A;  2R4L A;  3PQU A;  4RJW A;  5DL5 A;  1T16 A;  3AA1 B;  4N74 A;  4O4X A;  4PR7 A;  4K3C A;  4O49 A;  2AXT O;  1QJP A;  3LK4 1;  4U9C A;  5FVN A;  3VZW X;  4AUI A;  5E79 O;  3V8U A;  1BH3 A;  1GFP A;  2N2M A;  4AYD C;  2ZLD A;  3SYS A;  2Y0K A;  1MM4 A;  3NJT A;  4RLC A;  1G90 A;  4AYE C;  1GFN A;  2F1C X;  3PQS A;  4O3X B;  4O3Y A;  1H6S 1;  4FES A;  4AKM A;  4FUV A;  3PGS A;  4AYN A;  2W81 C;  3AAA B;  4N59 A;  2KDY A;  3SY9 A;  2ERV A;  2F1V A;  3POU A;  3A0H O;  5ADX K;  3LK3 A;  3HOL A;  3NSG A;  4RLB A;  3DA3 A;  4C4V A;  3KZI O;  3K19 A;  4GF4 A;  1MPF A;  4N58 A;  1S5L O;  3AAE B;  3UPG A;  3UU2 A;  2W80 C;  4RJX A;  4XNL A;  5G38 A;  3SY7 A;  4B61 A;  5G39 A;  5EE2 A;  2R8A A;  4G76 A;  4D5U A;  3DWO X;  2XTR A;  4FQE A;  3SZD A;  2PRN A;  3FYX A;  2R4N A;  4Z3T A; 
#chains in the Genus database with same CATH homology
 2JQY A;  4CTD A;  2WVP A;  2X9K A;  2IWW A;  2IWV A;  4FQE A;  2WJQ A;  4PR7 A;  2WJR A;  2F1C X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...