2F1EA

Solution structure of apag protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
116
structure length
116
Chain Sequence
RYRVEVEVSPRFLAHQSTPDEGRYAFAYSIRIQNAGAVPARLVARHWQITDGNGRTEQVDGEGVVGEQPWLRPGEAFHYTSGVLLETEQGQMQGHYDMVADDGTEFIAPIAAFVLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein apaG
publication title Solution structure of ApaG from Xanthomonas axonopodis pv. citri reveals a fibronectin-3 fold.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Structural genomics, unknown function
total genus 18
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04379 DUF525 ApaG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1470 Mainly Beta Sandwich Immunoglobulin-like ApaG domain 2f1eA00
2F1EA 1TZAA 1XQ4A 5HDWA 1XVSA
chains in the Genus database with same CATH superfamily
1AD0B 5T1JA 3KLLA 1JAEA 3NQKA 4JJ5B 3BGFC 5DWUH 5GRUH 1DVTA 3TA3B 3W81A 4ZUUA 1WISA 4FQXA 1QPXA 4J7RA 4UDUA 5DJ6A 5IVNA 3T3PF 1EDYA 1W0WB 3VXSE 2FEEI 4OLEA 1HQRA 2J8OA 3NGBB 4E42A 2LLGA 2YD6A 1NFIB 2AQQA 1URLA 2GY7B 3FT0A 35C8L 4MD4B 2BNUB 4U6TA 2VN6A 4WWKC 3RFZC 5ESVA 1CTOA 3HC0A 1YEHH 4PCSA 1QWUA 4G3YL 1PIFA 5B8CC 1U8JB 3H54A 2J12B 4H0LC 1NIFA 3Q48A 2DQHH 3MNVA 2FZ3A 5E94A 3IRPX 3BVNB 3C6SB 2NOYA 2XQBH 4QI3A 2NY4C 4M5YL 3MNMA 1JP5A 2UXTA 2F5BH 3TBYB 4IKKA 4MA8L 3WKYA 2Y2TA 2AV7A 3OLEA 4H8PA 2DI7A 4A7GF 1QFUH 4HCGA 4P4KC 4TVPE 1HC1A 1WBZB 2D3NA 3QCTL 4KI5C 4BFKA 3V0VA 1LP9F 2NY6C 3PYCA 4TSBH 3LH2H 3MRHA 1J48A 3L3KA 3MRQB 4IJTA 2EVJA 2NTFB 3HZMA 3MLPA 5EU3B 1Z7JA 2W91A 4TUOA 1NGZB 2JJVA 3HMWH 1A14H 1J5OH 3DO7A 1OT4A 2XN1A 1F6AA 1RFDL 1PLGL 2GBAA 3R7RA 3QIBB 5IREA 4TNGA 2Y9RT 4W6WB 2X87A 2G30A 1PY0A 4Q74A 1AGCA 4TPRL 2NR6D 1S7QA 5I8CB 1W16A 4LBAA 5D7JA 2EIDA 3KLHD 3U7WH 2XV3A 1I8MA 2AQ3A 4WU7A 5D9SA 5D5MB 5I1EH 5M94B 2QQKL 1HEJC 1XGYL 4M3KB 4X5LA 1QACA 1JPGA 3MV9A 1E8ZA 2NY2C 4NRXA 2NXZB 3RNQA 4G6AC 5CN2A 3BYTA 2J55A 5EZPA 4JDTL 2KYIA 2CUMA 4GT0A 1EERB 1F58H 2FQDA 5I6PA 4X6DA 4QXWA 1A7QH 5E9DB 2R4RL 3KXFD 3C6LA 3F3HA 2DMBA 1X4ZA 4GAYB 4H8HA 3ECVA 4OV6F 5KUMA 3WDIA 4Z3HA 2NZIA 4HEPA 3FFCD 1WZLA 4PCTA 2MMXA 4BUQA 4IBWA 4MDJB 4ZPVA 1TVHB 1F11B 1Z32X 2GJ6E 5I75C 5SWZB 2AEPH 4TN9A 3JZYA 4YL9A 3Q8FA 3L45A 3ZO0A 4NHCH 1OGAD 1N26A 2OZNA 5AW9B 2BIMA 4X80L 2DS4A 4EI5A 2DM2A 2WSDA 2R4SH 3MV8E 2EXWC 3VAEA 5JXEA 5MEND 1DL7L 1KF9B 2ZJSL 3FB7A 4C59B 1ZANH 4K73A 5EOTB 2V5TA 4AH2B 1SVZA 3SJVB 3RGVC 4LCUB 3ZGHA 4CBPA 1ZXKA 3I85A 4ZMWA 4DAGH 4V1DB 1GGCL 3TN0A 1ONQA 1NBZA 4Y4HC 2FJGB 2ITEA 2DN7A 2ZAHA 2AK4D 3H9SB 5JYMA 1O9VA 2O5ZL 2F54E 1SY6A 5IVZB 3T4AB 2GY5A 2Y0SA 4ETYA 4HOXA 1LDSA 2YUVA 1CK0L 2A7BA 2AJVL 5DHDA 3EYSL 3W1ZA 3CZJA 2QQNL 1DFBL 3S48A 1RUPL 3QQ9C 1KLFB 5EO9B 2K3HA 2VERN 3HB3D 4BQ8A 2IH3A 4Y7MA 4DEWA 3PNRB 3KZ8A 1CDJA 3WN5C 1BBDL 3SDCB 3P0YH 2PABA 3IBEA 2WVUA 5J12C 2DWXA 3E2HB 4BH8B 3BLKA 3MGOB 1DUZB 2RGSA 1G7PB 1KIPB 2X6AA 3DYPA 3INUH 4PGEA 3UZQA 4AYFB 2RQ8A 1IAKB 3FAXA 1FNEB 3GF8A 3JBG7 1G5GA 1L5GA 4JPQA 3ZZ1A 3BHBB 4F7TA 2QQLH 4ONFH 4P5SA 2VLKE 4FQIL 4AE0A 1S9KC 3CFKB 4P48A 1N10A 2J1YA 1MSPA 4PRPE 1QEXA 4JM2B 3AWGA 3PGFL 1YJDH 4PJ8D 4BCYA 4GUPB 2JB6A 4AQEB 3VGBA 2OMXA 4NNYA 1SOXA 2HP4A 1T20B 4K9EC 3IGLA 3ZL4H 1MDAA 2VXSH 2P28B 4YHPA 4QLWA 3IMTA 5IB5B 4A68A 4P2RA 4IGBB 4IBLT 4UZSA 4KXDA 4ACTA 2ATKA 1PZ5B 3PGDB 4KY1L 4GP8B 3IEAA 2Z31A 3QCVL 2HTLD 2JNZA 1QBLL 1YN7A 4OIFA 4YEEA 43CAB 4F8QA 6PAZA 1ANUA 2MCMA 4IRSD 3QUKB 4IS6B 3IGKA 3VE0A 3NJLA 2Q8AL 5TF1H 2Z4QA 1IT9L 5EPMB 3S3SA 4UWQB 3SGJC 1HZHH 4PHZA 4J3BA 3ARBA 1HOEA 1HQ4A 2DZEA 4NEHB 1P7QB 4LSSL 1D5MA 5B7MA 2NNXA 3Q3GB 4GP4B 3PV6B 4LCCC 1O6VA 4LHUB 4HBCH 3U7YH 5DVNA 4UQBA 1MREL 4P5KB 2C3HA 2H2SD 4P57A 3ZTCC 1ZLWH 4J2QA 3QCUL 3AC0A 3QO1A 2HLFC 4M1GL 4JB9H 4Y19A 3TEXA 2DPKA 2VSKB 3QI9D 2ENSA 3KHOA 5DZVA 5IMLA 4UI2A 1FFPB 1BZDA 1MOEA 4OF0A 4ILDA 3EUDA 1JD7A 3TO2B 4PJXA 2DTSA 1RURL 3MJ6A 2WQAA 4O5LH 2N59A 4XWGH 1SQ2N 2BNQA 5D7LE 1AQDB 4UT9L 3RVWD 2G0KA 5EU6D 4ZMPA 1FYTE 2NQCA 4JKMA 4NO3A 1D5ZB 3RIFK 1KB5H 5GS1B 1KCUH 3ARFB 3TIDA 1J87A 3PGCB 2UZIH 3BKMH 4HT1L 4UM9A 3HZVA 3L08A 1HJBC 3CN1A 4A2HA 1C8PA 3GFUA 5IMMA 3D48R 5EMYA 5F9OH 3SKNA 2D31B 4OB5H 1TG8A 5ID1A 3TO4A 3TVMD 2E4TA 2FSDA 4RSYA 4MRCA 4DUXA 4M6NH 1R3JB 4Y89A 4WUUB 2GIMA 4Z7NF 2DLHA 2F8VA 2E7DA 1KJ2L 1N64H 1XXDC 3QEUB 4H4NA 4HAGA 2PXYC 3HKFA 2AV1B 3S3CB 1SQMA 4IBQA 3WHXA 1T66C 2AJ3B 3KS0J 3AY2A 2R69A 3BPCB 4BQ6A 1PMYA 3GPSA 3OQRA 4QJ4B 3GJFB 4PJIF 1DQTA 1BVLA 4LCYA 3I6SA 4RZKA 3OB0K 3MACH 1CICA 1XFPA 5C0AD 1RUQL 3BLPX 4YPGB 3WIHH 2Z8SA 1ZMYA 4EBQL 1FFOB 3B2UC 4UANA 4XWOC 3GLEA 1N67A 2VR8A 3VFOA 3KDMA 3MSPA 1C5DA 3RWJA 3SKOA 2EYSA 3MUUA 4G1EB 4G8IA 2FYYB 3KWWB 4BCZA 1E27A 4MX7B 3UTSB 1NWOA 4KMTH 1JCKA 3NACH 4H2AA 4QRRA 5FO9A 2X9WA 3KM2A 4G9FD 4HQQH 1W72B 2CUHA 1CLYL 2VDMH 3N04A 4M6OL 4BE5A 5DRWB 5IY5B 3ULVD 1YMMB 4HFWB 1L4IA 4OZHF 2WNWA 5ESQB 2DTML 1CFTB 1RH8A 4WHYH 3JWNC 1PZBA 4XVTH 1HCYA 3PY9A 4YGVA 1M57B 1UWEH 3LEYH 5K1NA 2YR3A 1JV2B 4U1LA 2E7CA 3VFVA 4F37K 1B90A 5AW0B 4ZW5A 1A1MA 1BG1A 4MVBD 1BAFL 2CGRH 3LPGA 3A6BH 4M1CD 1X5FA 3N85L 5IV2B 3ISYA 3QEQB 4OQTH 4DP4X 4R97B 2X4TB 4FD0A 1FGNL 3FSZA 1XGQA 1G84A 4H0HB 2NY3B 1QHQA 4MLIA 5FV1L 4ONOA 1F4XH 5DJYA 3S34H 1TKWB 2IDTA 3VXMA 1A3ZA 5JUEH 4OAWB 3V4VB 3STZB 2DWDB 3RJDA 3TJEH 3IXTA 3QDGD 4XC1L 1EDHA 5DYOB 5JO5A 4WJ5B 1PSKH 3QXUA 3C60B 4G82A 3PNWA 1ZLVH 3HC4H 2VLRE 4GAJH 3Q7JA 5D1QA 1WIOA 4RX4A 3GRGA 9CGTA 3LKRB 1FJ1A 3JTTB 3W9DB 1XEDA 1F4WL 5LXGL 2WM0A 1I7TA 1IGJB 2VXUH 2L7QA 3BVXA 4URTB 3LZFH 3K6IA 4BM7A 4YHIB 1GZPA 5K39A 2V2WA 1YY9D 4NWTL 3OF6D 4ONGL 1T6WA 4QT5A 4ETQB 1RJYB 5CGMA 3G9AB 3PQYE 2E6QA 1UJ3B 1YPZA 2EO1A 4NJAH 1BEYL 4R2GD 4RGNE 3AREA 5GRVL 4OV5A 1K2DB 3GEWB 3DVGA 3HZYB 1FL6B 2P5EA 1RZIA 4L23A 1YNKH 4BGLA 2XRAH 1MJJA 1AGBA 2YGOA 3UTZA 2NW3A 5I66B 5LBSA 4MMZB 5I1JL 1DO6A 1U8KA 3SDAB 1CXLA 2F19L 2FHCA 1HKLL 1RZ8A 1SDYA 2OMVA 4E9SA 2NUTA 2KLSA 2B77A 2JCWA 1VADA 1RZJH 5HVFB 3BZEB 1COBA 4DTGH 3HG4A 4OLUL 4Z7UF 1YN6A 4OSUH 2QMKA 3SYQA 3PWPA 2IADB 1OE1A 3AAZB 5B21A 2A74A 1WWCA 4MDRA 1GGIL 1S7SA 2YAPA 5EOCH 2WAHA 4EDWH 1FO0H 4Z7OB 1QRKA 2QMJA 2A0LC 1R3HB 3GXMA 4NAMA 3CQQA 5DD6B 2OL3H 4QXTB 2H9GB 4H1LB 4NZTL 5ICYA 3WS3A 4B0MB 3QQDA 3BFWA 3PXLA 1VFBA 3OZ9L 4MJ2A 5JHDE 5CUSL 4U49A 1NGPH 4G6FD 2QSQA 1HHGB 1ZPLA 3BGFB 1AYOA 2WTRB 1FDLH 4PRBB 4PR5B 1FF5A 4FQHA 2ITCB 2FECL 5IK3A 4HOMA 2VN7A 3T65A 2Z92A 3H56A 4C4KO 1T5WA 3BE1L 5KS9A 4N2AA 4CVWA 4YZWA 4BRVA 1J0HA 5FLUA 3RFZB 5B1BB 2P24A 3RFRA 3P9LA 4NGHH 5HHQB 5IW6B 5GGTL 3S3DB 3FU6A 3TFBA 4Z3FA 5EUKA 5JZ7D 2OR8A 4J3OD 5DMGC 2OXHA 1GW0A 2OSLB 1U8CA 3K74B 3FT3A 3CFQA 4W4OC 3LD8C 1DQJA 1KNOB 4NYLA 4B9YA 5LJYH 1RIHH 1V7NL 2VDPB 3R06B 1A9BA 1RXLA 1FVEA 3UABA 2X9YA 1AZZC 3UMTA 1JGUH 5C0ND 4MJHA 2WKOA 4DK6A 5KSBA 1F4YL 4FQ2H 3RA7L 2Q3AA 4E36A 2YXMA 1RVFH 1LDPL 2VQUA 5FO7B 1AS8A 2FT6A 3LSOA 1PYWA 3VA6A 5LAXA 3IDGA 2R2BA 1SHMA 5HY9A 2GEQA 2O61A 3EOYG 2Y4SA 4H20H 4Q52A 4XVSH 2X1OA 4XCYB 1YEIH 2WC7A 5BQ7A 4HH9B 1ZHLB 4DGYL 5AKRA 1XF3B 5AUMA 4EIBA 4R90L 1JGVL 2A83A 4XBGB 2QTVA 4GT7A 1FAKT 4OIIH 1NUNB 2JJTA 2NY2B 5G5DB 5HHPB 1HIML 2QBWA 3FTWA 4CKQA 1JZ3A 2X0UA 2H26B 3MRDA 3RWHB 1KOAA 5L2KB 2RCSH 1QHOA 4MCNA 4XMLL 2YK1L 5GHWH 1G6RA 5TGBB 4HIJB 2ZG3A 1AY1H 1BQLL 1M7IB 2P8LA 3SIKA 3ARDB 4KTYA 5AOIA 2QKIB 4HIQA 3VGEA 3QUZA 3QJZA 5J06A 1N7ML 1MHPH 4OF7A 3BN9D 2AMUA 3R1GH 1DQQA 3VRLF 3OAYH 32C2A 1JDCA 4HUWB 5I75B 1ITCA 3AG1B 1B4TA 3GZPA 4HV8B 3EJRA 5DMIL 1NGWA 4ENZA 3DETC 4APQB 1XTMA 5C8JB 5HJ3A 2YOCA 5E8OA 4EVNA 4EOWL 4OUUA 3MLUL 1E4HA 2NPLX 3GNML 5KJ4A 5I5RA 4NLHA 2BS71 3A67L 5H94A 1SUHA 3CZKA 2CKBB 2MPAL 3IAPA 2KZBA 1OVZA 3AM8C 4UTBL 1E50A 4TOYH 4ODWA 1WA0X 3EFFA 3RTLA 2Y36H 1XX9C 5KOMC 1T2QH 4FL4C 4ICXA 2XN2A 3GSXA 1BX2B 3RVTD 5EO0A 3P4MA 3VRIA 4HIXH 4QEGA 4DQAA 4LL9A 1BJ1H 4UBDC 1NL0L 3F5WA 3OWRA 1AR1B 1QR1B 3DUUB 3U6RA 1TSRA 3DK0A 3GB7A 1XSOA 1GYWA 5DJAA 4UF7C 3L7FA 4BQBA 3F05A 4UUJB 5EBMA 3OXRB 3FDWA 4RA0C 5D7IE 5J12B 1MCFA 1QFOA 4LOUD 2H0EA 1BZQK 2EYTB 3NSYA 5AAWA 5CBAA 2X41A 4R96A 3CZNA 2WZ6A 1MCQA 5BS0D 4KJPD 1OW0A 4U1SA 3TWYA 3VFSB 4JRYE 5ISZA 1ZJAA 2BOLA 4RDBA 5LCVH 3QJFB 3IVKA 2JFCA 3B9KC 2IQAB 2OZ4A 5E99H 4IMLB 2OQJB 2P5WD 2CDEB 4RNRA 4YDVA 3WEXB 3T6VA 1A1NA 4LLYA 1QLEB 4J8RA 2NX5E 4PJGE 4GS7C 2ZICA 4ZUVB 5G55A 2X4UA 2ED8A 5HDRA 4D0DA 3A4DA 3V2AR 1TZHA 3CVBA 1UB5B 1WHPA 4MNQD 2F53A 2I60H 2EYRB 3QZPA 4UV4H 4ZODA 4JUTA 2IV9A 4N9GB 5JHLH 1GTFA 1Q94B 2KZKA 4FTVD 5F1KC 3TLRA 1JMZA 5IQOA 1BM3H 4JANA 2CGYA 1OD9A 3LZPA 4RAVA 4WI3A 4ALAC 1Z5LB 3V0EA 1KGWA 2XQ0A 1E67A 4YL4A 3ETBF 3D25A 1C7TA 4MD5A 3PHQA 3L2LA 2OJZH 3MRMB 4HS3A 4QRAA 2VABB 1WC7A 2QPUA 3UO1L 3D85D 4QO1A 2R1XB 3MLSH 2HFFA 2BP8A 4PRDA 5FYKD 4NM4L 1BIIA 2Z35B 4HHAA 4TNWF 5BUPA 1U21A 3K2KA 4S1DD 1E9OB 1OZTG 1ZA6B 1C5BL 4LCCB 4QHUB 3GINA 4ORGB 3PWVA 4LCWA 1DO5A 3GWJA 5GGRA 3WAJA 1CD0A 1ZAGA 2X0VA 1YHPA 3NCCB 1WSST 1I9JH 4L4TA 2C9VA 5D2NC 2DQIL 1HXMA 3IDIA 3LYRA 1K8DB 4QRPA 4GI9A 1IVTA 3CU1A 3SPCA 3BIAX 5AW7B 3VO0A 2J72A 3WFHA 4MJIB 3SGEI 1Q0XL 3LMJH 4GRMB 5E2UH 2VITB 5DLMH 3ZE1B 4CVZA 1YJDC 5I0WA 1WFUA 3N41B 1RSFA 1HOCA 4L3EE 2Z7ZA 2GC4C 2QT6A 3WI9A 1TTFA 4LOEA 5TQ0H 5IVXF 1QUNA 3UTTD 1OF0A 1TZAA 5LXVA 5FKAB 4PRHE 1VSCA 3D30A 3H3BC 5K9KA 3Q9PA 4R5TA 3GKZA 2AHIA 1P6FA 3O0LA 4RFOH 1ZRUA 4PRNB 3CMOH 3CLEL 1CFVL 4GMTL 5PAZA 3VFWB 3V6FA 3SKJL 4O2CB 4AIZA 4HG4K 3EFOA 3PABA 4F24A 5IQMA 2P80A 1CDBA 1IAII 2PXYB 4YBQC 5KUKA 2PCFB 1INQB 3HS0A 4F33A 4P9MH 4G71B 4PHXA 2IMNA 3BUBA 4ANXA 4X5RA 1JI1A 2MTAA 4EN3A 3QJQB 5K9KB 1NUDA 2ZONA 2DIEA 4M7ZC 4WI4A 2BIPA 4N5EC 5JW4N 1CL7I 5H4ZA 4HYTB 4J3VA 4GRWB 4AMKL 4UT6A 5DVOA 4UV7H 3RNKB 3SYPA 4EUPH 1LEGB 2BNRA 3FUHA 1BGXL 3O4OC 5CZXC 3RWIB 4NWUL 5I30H 3T1WA 1RSYA 4NAJA 3UGUA 3ROLB 4N2LA 3B56A 1NAMA 3ZZQA 3RX8A 4YDIH 4X4KA 5DVLA 4XOAA 4F92B 3MXVH 4NQQA 1OAUH 3TBTB 3IJYB 5DFAA 4CILA 4UM8A 1Y07A 2HT2C 1D5XB 2WLHA 4XPAL 4FN0A 2QPDB 2K6YA 5F7DB 3TBVA 2ZXQA 5HYSA 5JXAL 1U30A 2H5UA 3QO0B 5HDBF 4ATTA 5JOPD 4Y4FA 5JHAA 1J0JA 3QR1A 4X6BA 2R2EA 3CVDA 3QB7C 5DF0A 5FX3A 4B0MM 4GG8A 5IFHH 4U1IA 3T0AA 1QPPA 3LPPA 2RACA 3A0OA 4JHWH 5I1LB 3HE7D 1SVCP 2BY3A 4X2UA 4E41E 1LE5A 1NCBH 4XOCA 1MUJB 4RVBA 3U36A 2H1LM 5EU4A 2FX7H 3PWJB 5LLIC 4F7PB 4GBXD 1MHHB 4LHUG 4R4FL 4N8VA 4UDTA 5BJTA 3C9NB 4RSVA 1U3JA 4KTGA 1GPOL 2BCKA 2XA3A 3K71B 3ZQXA 2VDOL 1ZT7B 2I9TB 3KPQB 2F18A 3ZDYB 5HYJB 3EH2A 3EJQA 4JRXD 4X7SL 3X13B 1D9KA 1FNGA 4KKLD 1FZOB 3GBEA 2ODIA 1S7UB 2BWIA 3D3VE 1B88A 3UJJL 1MI5E 3P9MB 4TULH 2KLTA 4N0CD 3X11B 5E8PB 2Z8RA 4PV8B 2Q10A 1PZSA 1OAZH 4KUCF 3AADB 2H0PA 3BP4A 3OMNB 4JJOA 4LIQH 4YN3A 2BP0B 4DW2L 3S8GB 4MYWB 4I3SH 3MLTA 4D3CL 1V55B 3PWNA 1NUGA 3EW3B 4R3SA 1MJ7H 2AANA 5DZAA 4UOJA 3MROB 4NRZA 2ZKMX 4GFXA 4Q6KA 3HNTH 4H44C 1YYLH 3QNZB 2WWMD 3D39D 2PF6A 4YFDB 1P4IL 3O3UN 4HD9A 1EXUB 4RBPH 1RMFH 4CN6A 4AM0A 4M8VA 3GSWB 3PCYA 2VDRH 2FDBP 1DSYA 1NBVH 1F00I 4Z3TA 5FW7A 3O2DA 4FAAB 4URKA 2OX5B 1QFWL 3X1NA 5TD4A 3QZNA 4AW7A 1KPUA 4X9FA 4ZFOL 2EO9A 4X4ME 2VXQH 4CNIB 1FBIH 3WUWB 1NFDF 1O9ZA 4FRWA 3LZOA 4S10A 3MFFB 3MV7D 5DD5L 3K2MC 3N91A 2BHZA 5D4HA 1WA2X 2XTJC 1IEAB 3V6FB 3PE9A 5KSAC 2HFTA 2IDSA 3VFMA 4GAGL 5C09B 1ZHKA 1CU4H 1TQBC 2WO4A 3D1MC 2HWZH 3SY0B 1YYCA 2J88H 3AW5A 5AW2B 1HZLA 4DCQB 4XP6L 3VXSD 3DOSA 3MJ7B 2X6UA 1NGYA 3A6CL 1FFNA 1N3NB 5I6LA 1M71B 3R4DA 2E9JA 1ZIAA 3LNHA 5BVPL 4X9IA 2ETWA 3AQZA 2YLHA 3D12B 3BEWB 1IV8A 4GMSL 3G6JF 3SDXE 1ZE3H 1EV2E 2AI0L 2ESVE 2YPKB 4U7MA 4XP4H 5BZDB 3V0JA 4R6UA 2OK0H 2AQSA 4L9LC 2VM9A 3FCSB 4Z7VA 4ENED 4U7KA 2WJ5A 3N9GH 1MFNA 3GKWL 3H42L 4XGZB 5EIQA 4QOKE 4E9RA 2AGJL 5HI5D 2ISDA 3LEXB 2FUQA 5FHBL 3PL6D 2WXPA 4E5XA 2GI7A 3LQAC 4AGLA 1A2YB 4TVPD 1U3HD 5DC0A 3KLKA 4IBVA 4MSWB 2YAOA 2XG4B 4W9IC 4Z7QB 1F8TH 4YXKL 2UZYA 1NQBA 5L6YH 3LD8B 3OKNB 1HL9A 2VL5B 3H3PL 4BGDA 3MO1B 1E4KC 3JT2A 3MRKB 1NBQA 3MJ9A 1BD2B 1R34A 3BUIA 5AYUL 2B59A 1V8HA 3DJTA 2ZOWA 1KPRA 1XR8B 4WLCA 5C6TH 4GYBA 3VFUA 4OZFH 4NUPA 3LAFA 3SEPA 3ENEA 4OCYH 1FVCB 5CJOL 5DJ2B 5TE6L 1LVEA 3O8XB 1UQSA 3DX6A 5AVXB 5B39A 4OFQA 3VD7A 3VXTA 5E6RB 2IQ9H 2NR6C 3FO1A 2IALB 3GMNA 2IDFA 1DEEB 2YRPA 3KLHC 4IIQC 5DCCA 5H35A 4J1UB 4XNMB 4B9CA 2X2HA 3ARQA 3SHSA 3LIZH 1NCWH 1D5RA 2G0LA 1ET8A 3DHJA 3NCFB 1KCBA 4OGXH 4FFYA 3KG5A 2MCAA 2IPKA 4LKCA 4K7FA 2VN4A 5I24A 4HWZA 3L4UA 4NOFA 3IU3A 1A7RL 3NCYP 4MTMA 2LVCA 2QEJA 3BSZA 4LBEA 3EH4B 3NZUA 3PP3K 1OP5H 3C5ZB 3K2UH 5ETUB 4E9QA 2GJ6D 1TZ8A 4L4VA 3V5HB 4Z6AT 5LGJA 3OJVC 3CFCL 4M4RA 3UYPA 4RFNC 4DP8X 7PCYA 4IK7A 3FQWB 1MFEL 2O6EA 2DOCA 2WZ0A 3K6DA 4M02A 3S4SB 4DH2A 4I9XA 3S7GA 4KHXL 3B4NA 3MV8D 3HEIB 1IE5A 5TDOA 1CFQA 1CT8B 4JFXB 3KPSE 4OY9A 3DGGB 2AJSL 1ECYA 4LEXL 4MMYB 5HGBA 1NC4A 1L6XA 2ZXDA 4OD2A 2XVBA 4XNUH 5ECJE 2HX7A 3TYGL 3IJSB 4EAEA 4PJCE 4ZX6A 1YEWA 1PCSA 1OQOA 2BVEA 2G9HB 2WTPA 3FTGA 1AANA 4DIXA 2F54D 1SY6L 3ZSSA 4AXWB 4D9LL 4Q9RH 3MRFA 3EXLA 5FCUL 1E3ZA 1TVBB 2CBTA 3VI4B 3C5JB 5DUML 5E4AA 1EBPA 1N59B 3IF1B 1A0QH 1OQXA 3K72B 4XP5L 2EVGA 3EADA 1KBGH 2I32A 5EC2B 1QSFB 5LGHH 4XE0A 4HF5L 1UM4H 3UTQB 5FYKH 3HB3C 3WXWL 4IBZA 4AKPA 1P84J 4IMKC 4N8CH 4FC3E 4Y4KA 3IDNB 1WCBB 3QRBA 3KPOB 3P11H 5EORL 1RL1A 3HE6D 1ES0B 1L7IL 4I9WE 3S2AA 5CZKA 3PHOB 3MRGA 4FA8A 1ERNA 2X3AA 3FT4A 1AKJA 1XSJA 3FXIC 2VLKD 1NMBL 1VF5C 1YMHB 5C2UB 3KPRE 3DJ9A 5ILTL 4WKZA 1JWSB 3WD5L 3BLBA 3QQ4B 4PRPD 4NNXA 5CF3A 5I8KL 2YD7A 4LLUA 3L4XA 5B3NA 3Q2LA 4PW3A 5F6IC 4WI9A 3WIIH 4PJ8C 2GTZB 3CFJB 1CF8L 1IFHH 1W72L 3BQUA 2Z0UA 3P77B 5MEPB 3B9KB 3KD4A 3ZE0F 2RBLA 3V0WL 3Q6FA 4M5ZL 1C08A 1KIUB 3C12A 4GKZA 2FX8H 4Q9QL 1T83C 4FNUA 1RZFL 2R83A 3L5JA 3VI3F 1S9VB 1IM9D 4GS7B 2X89D 2FTAA 3CLFL 2R0ZL 1N6QH 4NSKA 4P99A 1MCOH 3BD4A 3MBEB 5G4OA 2OSWA 3VXNB 1SEQH 3B37A 3O81A 1HL8A 3WE6A 1E8WA 3N0AA 4F2MB 4GIOA 5K5YA 1JPTH 4JQIL 3QFDA 1F1AA 4IRSC 3VGFA 1HHKB 3S36L 2AJYL 4BDVB 3S35H 5LN8A 2CHWA 3REWB 3FQXA 2N4IA 5DS8A 4ZTPH 3MPCA 1AGEA 4NC2B 3G5YA 5DJXA 5JQIB 4IOIA 1CN4A 1KJ3H 4ZFGH 4KZDL 1DQLH 4JKNA 1BECA 2OJEB 4JO1H 4PCKA 2PP9A 1QPKA 4W4NA 3KH3A 4TMPA 2H2SC 3EBIA 3Q43A 2XWJA 1SXBA 4MAYC 3K4DA 3MRLA 1KELH 4HDIA 3EO1B 3QI9C 4DP7X 1AGFA 4YHZL 4QAMB 2V17L 1A6UL 4UOQA 2E6PA 5D7LD 5ESAA 5D2NB 5CKGA 1M4KA 5HYEA 1FYTD 5H2BB 2Y23A 4BZ2L 1PEZA 2QFPA 1FV1B 3RVWC 1VGEH 1AD0A 4JO4L 5E2VH 3LS5H 2QPEB 3I2CH 1NFKA 1NCCL 2F5AH 3ZE2B 3BESR 3NIFB 3DVNA 3TA3A 4CADB 3UGEA 4NI6A 1Q1JL 2BRQA 4PS4L 3I75B 4FYQA 3CDGA 2FHFA 1W0WA 3J07A 4P2OC 5GS0D 5IJVB 3FO2B 1NFIA 2CHNA 4K3DH 1OK0A 4MQTB 1G7QB 3MTXA 5B3SB 4LF3A 4HJJL 1DSFH 3NP4A 1CCZA 1XIWD 5E6ID 5LHDA 1C16A 2Q3ZA 2JIXB 5GZNC 2R69L 1U8JA 3APFA 4Q14A 4TQIA 2WP3O 5LQBL 2EKSB 5EUOF 4F37F 2CMRL 1J9SA 5KVEH 3C6SA 5AB9A 4AQOA 4PJDF 2XY2A 4A7GA 4JKWA 5FXCH 4MCZA 5ECGA 3KR3L 1RUAL 4KOCA 2ZNWA 3P30L 3UACA 2FYVA 1LP9A 3G5VB 5FB8A 5F7UA 1A1OB 1BMZA 3D33A 5C0GB 3CH1B 3O3DB 2F1EA 3MRQA 3LTVA 4M7ZB 4WTZA 3G6DL 4YE4L 4ISVB 3AT9A 2NTFA 4BXVA 3BUYA 3FU8A 4FULA 4HK3N 5AKSA 5EU3A 2Z91B 1LK2B 2JI1A 3CVCA 5SWSB 2DIJA 4YOKA 3DHPA 2P47B 3O4OB 1S9XB 4EIZC 4FFTA 3ULVC 3QIBA 5A2LH 3ULAB 1I7ZB 5IQ7H 2YJLA 1P1ZA 5AKVA 4AEIL 4PB9L 5I8CA 3UBXB 1IKFH 1FHNA 1JV5A 1QBMH 3VUAA 1G7JA 1LEKA 5HHVH 4YSQA 1I8LA 4CDHA 3GXUB 2GK2A 5KYWB 4PD4K 2KDGA 3S88L 2HH0L 3AMLA 4WW2F 1OTSC 4C54A 4YO0A 5DA4A 2R0LH 4MVBC 4NQEA 4M1CC 4DUVA 4ELME 1KB5B 4YPJA 4BKLB 4R7DB 2VDPL 2MRYA 3GSNH 2YPVH 4JFSA 4Y8DC 4QHKJ 1A6ZA 4H5SB 4IK6A 1IBGH 5E2TL 4JKLA 2FK9A 5E8EA 4DHLA 4FNPA 4NQCE 3MV9E 4BFRA 3HI6H 4GAYA 3VRJB 3NJFA 3JT0A 5CCHE 3WSQL 1F3RB 3MNWA 4NFCA 1FYHB 2VLRD 4TQEH 4GG6F 4DFIA 3FSOA 5KVFL 1CGSL 4LQFL 3SBWC 3QA3A 4YBLC 4MDJA 3VG9B 3WS6A 1PFOA 1TVHA 2BSSB 4P2QB 4KRPD 2LLLA 4HWBA 4JVWA 4XPTL 4ZW7A 5SWZA 4DN3L 4MD0B 1WRFA 4G2AA 5I1KL 4JG1L 4Z18A 1OK8A 4WZ9A 5MP6H 3HG0A 1CFNB 3PQYD 4ZMLA 1K6QL 5I1GL 4RRPM 2EDQA 5INCB 3MLWH 2O6DA 2YN5A 3WLWD 4OJFH 4KTDL 5F70A 4RGND 3RIKA 2BSEA 4AH2A 3SJVA 4LCUA 3RRQA 4EKXA 1HILA 3ECWA 4L18A 3FB5A 2I26N 4Z7AA 2XXMB 1JZHA 1PQZB 1UOKA 1RU9H 2FJGA 3RVVD 1DJHA 3VJ6B 3FN0L 3H9SA 4K2UL 3DBXA 3T4AA 1FAIL 1JGDB 4JY5L 2ZXCA 3QORD 1JNLH 3ESMA 1CB4A 1IBFA 2VDMB 3NK3A 4XO3A 1VCAA 3GBNH 5D2LE 3TPUB 4FQCH 2ENYA 5HHNB 2EIJB 1KLFA 3C09C 1EXHA 4PRAB 2EUZA 3LY6A 1MWAL 4UU9B 3FPYA 4AMWA 1E4WH 4XBEL 3CXDL 4WGKA 2AW2A 1UXMA 4JS7A 5EF2A 4G6MH 5EWIH 5IBLD 4JFFE 1OSPH 1DUZA 1BVNT 1QNZH 1ZT4A 3FBKA 4ODSL 4KK8D 4DP0X 1Q0YL 3S35X 3FHEA 4AYFA 5KJ7E 5JHDD 1FNEA 1S3KL 4OLXH 2F8IA 3AG2B 4ODUB 5KSAB 3IYLW 1QBAA 2CKBL 3SGKA 1I53A 1TQBB 4L37B 3O6ML 2IDUA 4JM2A 4LCIH 1Z5YD 3L95B 4OZIB 4PS7A 3EJZD 4GUPA 1JFQL 4RISH 4HUUB 4AQEA 4N8UA 2DQDH 4F58H 2L04A 1T20A 5I82A 3EIFA 1AMYA 1YA5A 2YXFA 4AW4A 4IGBA 2DKUA 1W8NA 4XBMA 4XAWH 3PGDA 3NZ8B 3CVIH 2DQGH 2YA1A 4FS0A 4J3OC 1MFBH 5KSVA 5HYFA 2BX5A 2CCWA 4OLZL 5DDHB 4ZFZB 1F6LL 1JTPA 2NYYD 43CAA 4ZO8A 3SDDD 2G60L 1JJUA 4IS6A 5E1AB 5T1DH 2ADJA 4N1CA 3OC5A 1C12B 3GS4A 3L5WA 3K6NA 2L7JA 4HLJA 1A02N 1BXUA 3HCVB 1WWBX 4JE0A 4RWYL 2P8PB 4AG4L 2R8SL 1KTRL 3W11D 1V10A 3Q3GA 5CCGE 5IJKA 1MFUA 5L4IA 2GK0B 3IFNL 1U2YA 4X5XA 4AEHH 4FYTA 3V0DA 4QR7A 3EZ8A 4AE1A 2P46B 4P5KA 4QCIB 5I15H 2Q2EB 2QSCL 4RAHA 3K6OA 3T0XA 3C08L 3AT8A 3M45A 4MA7L 4R8WH 4F57H 2JJWA 2WOYA 1RIUL 1GXEA 3KBEA 1EFQA 1TEGA 1FFPA 3HR5A 1R33A 2V3FA 3BH4A 4Y1SA 3TO2A 2AJZB 2OR9L 4FHKA 3HTLX 1A6VH 5KANG 1X5XA 2OL3B 1FL3A 3B2VH 1KTCA 2XCMC 3OJDB 3LDBB 3EXJA 1MCNA 2UXFA 1EO8L 5GS1A 1D5ZA 5IIEA 3EYVB 4U33A 1D7CA 1X9RA 4AQ1C 5C0IA 2A1WH 5L9DL 1G6RL 1T0NB 4AQAB 5EU7E 5KBMA 6FABH 3WIFA 2EXYD 2GABA 1UM6L 5FA4A 4HWEH 1A7NH 2HG5B 3TCXA 3KXFB 1AQKH 2HRPL 5CO1A 1OARH 2ORBH 1KXQE 1R3JA 5AW1B 3PFQA 4AEFA 4MXQC 5AVZB 2EIZA 3GSVB 3FFCB 3QEUA 1QW8A 2GBUA 3BN9C 4GO6B 2AV1A 5BOJA 3OB0H 4HC1A 1HKFA 1ZEAH 2AJ3A 4ATWA 5ACMA 3PAVA 3BPCA 1K5NB 4OKDA 3H7BB 1OGAB 4GXFA 1NJ9B 3MLRH 4R7NB 4WO4C 3DSNB 1FG2A 4YPGA 2JV6A 1FFOA 2HSIA 5MENB 1XVSA 2H32A 4MAUH 5CD5D 1CYXA 3U4BL 1A9VA 5IMOB 5ABZA 1NEZB 4ZMTA 3US9A 2IPUG 4LASL 1Y1DA 4G1EA 3WHE1 1M3IA 4MX7A 1EZLA 2Z6FA 3F7VB 3BFQG 2ENJA 2OA9A 3MCLH 4LLDA 4WU5B 1J8RA 2DEXX 3HPJA 4OZHA 3LRGA 2VXTH 3U2JA 2OULB 2NQ3A 4M7KL 2X05A 4N2GA 5GS3A 1BMWA 4G7YL 1CE6B 3GRBA 1YMMA 1CZ8L 3CE1A 5ESQA 1MRDH 1X4XA 5F89B 5HGHB 5F1IA 3KEHA 5A1AA 1MHCB 4QRRE 4A55A 3HB3B 4GUCA 2C9UA 2BO0A 3QNYB 1JV2A 3NJXA 3FS9A 4DGIH 2H1PH 3WNOA 2WB7A 5E9NA 5EN2B 1BPVA 4FQJH 5IESL 4I1RA 4RRPG 3TT3H 4YHLL 4LOUC 2WXQA 4PG9A 3VWJC 1ADQH 3VB9A 4JRYD 4X7EC 2X1WL 5CJBA 3UC2A 5FO8A 2VDQH 4OZGB 2X4TA 3GI8L 5I0XA 4KPHH 4BJLA 4OAWA 3V4VA 1QTSA 5J11C 2CRYA 3BW9A 4TF4A 3DPBA 1DHKA 1UT2A 3OR7A 2NX5D 4DVRH 2YPLE 3VXPB 4WJ5A 3ZX1A 4XCFL 1IC1A 4PJ8B 4U1NA 1CGXA 4DN4H 3ZBMA 5T3XL 3T2OA 3V4PL 4LDLB 3VXME 3GZKA 5GS0H 3BX7C 4QIRA 3E6FA 1RQ5A 1IGJA 3SCMD 4ZX3A 5E6UB 5CEXB 1AAJA 1HYSD 4M8QB 4YSTA 3TBBA 1RJYA 1KTBA 2FGZA 3JVFC 4FXKB 5D1QE 5KVFE 3UPRA 1GGUA 4W81A 4JPKL 4R7LA 1LO2H 1FFQA 1TNNA 1K2DA 2JTDA 1O7SA 4HMCA 1YSOA 4K55A 4PGDA 3F62A 1BCIA 3HZYA 4AQ8A 4IRSB 2YMXL 4RA3A 4G3YH 1OHZA 4NKIL 2O6FA 1BXXA 4YHML 3ZMRA 5I66A 1YEEL 1ZVSB 4MMZA 1L7TL 3SDAA 4RH4A 4AYMC 2FCBA 1X4YA 3K6SB 3OG6B 4M5YH 3MRBB 3RZWA 1BZ9A 1MHEA 2Q86B 2QGBA 3V7AG 3KLQA 5CEZL 2KC0A 1N5AA 3B43A 4MNGB 2GG1A 5BV7L 4LSRL 3D09A 3KJ4B 4K07A 1R9FA 2IG2L 3AAZA 2WSPA 1SMAA 3RE0A 4OCWL 3QI9B 3KCPB 4TSAL 4K7PY 4TSCL 4U1GC 2VZOA 1R3HA 1HHJB 1MCEA 4N3TA 3OG4B 4UNIA 4L3ED 2X42A 3PWPE 4OCLC 5HGAB 2H9GA 4H1LA 2M83A 4GSQA 4PJHB 4KO7A 2A4ZA 4A6YH 4PRHD 5BZWA 3LZLA 5EU6B 3VXQB 4EXPX 4X6CB 4DF9A 3EYUL 1S8DB 2V5YA 1GGTA 3M46A 4N6RB 3M1CA 2NY5L 3FUIA 4X7FC 4PRBA 4BWTA 4PR5A 3QZWB 2YD1A 5FHAH 1X5AA 4IDJL 3C5XA 5IHBA 2ITCA 1M7XA 1N19A 4L1DA 1IBBA 1XGYH 2A6DB 3TVMB 4ZYKB 5IBUB 4DT2A 1KYOJ 4PJAE 4WWKA 1SYSA 3RFZA 4WGVB 1BJ8A 3TT1L 5HHQA 5E5LA 3QRFM 1KG0A 1PD6A 5B8CA 5IW6A 4G8AC 3IFLL 5HDOA 2R4RH 1B0RA 4D9RE 1J5DA 2OSLA 3H6AA 3SBRA 3VVVA 4DKTA 1ACYL 1SZNA 4R84A 5F3BB 3P0GB 3PJNA 2JLPA 4N6QA 2EECA 3BP7A 3QDJA 5C0AB 2QVMA 3BSGA 3R06A 5CR8A 2Q6WB 2W88A 4P4KA 1EGJL 4YDKL 3UJTL 2V5MA 2O5XL 1L0XA 3EO9H 4H8WC 1UZ6F 2BS9A 4HKZB 5FO7A 1Y0LB 2V7NB 2KQMA 4V33A 1BYPA 3UXFA 1DR9A 2WBKA 5I1HL 1DL7H 5D55A 3WY4A 1A3RL 1MCWM 4G9FB 4Z7WF 1OGTA 2WB1A 1DQVA 5FLVA 5KSBE 3QR0A 1KJVA 4E2OA 2QVTA 1ZLUK 1YNLH 4JO8A 2BP5M 4NIYE 3R8QA 4HOWA 4HZ1A 4HH9A 1MIML 4LU5L 4E41D 4Q8BA 1T1ZA 4WEUD 1XF3A 4MB5A 2DQMA 3GM0A 4XBGA 2GJRA 3HE7C 4HIPA 3EYSH 3LKSB 5AZEL 2FO4B 1OPGL 1HAUA 3H4HA 4F2FA 2QQNH 5G5DA 3A6OA 1DFBH 3WEOA 5HHPA 1RUPH 2EIBA 1YQVL 2E3VA 4UZUA 2H26A 3FFOA 3VYNA 2NNAB 5IZ7A 4FP8L 3VU2A 2YXVA 4GBXC 4H88L 3NH7L 1BBDH 2F1BA 1KFAL 4HIJA 1JXJA 1AJ7L 5JW3L 4OT1L 3V52L 5IVOA 1UATA 4D0CB 4JLRA 3QDGB 3BUTA 1ZY9A 3D3VD 1GRWA 1MI5D 2WO2B 3L9RB 4YBLB 5JPMC 1OCWL 3EUUA 2EEBA 1M53A 1VFAB 4FLRA 3VWKD 1SDDB 2X10A 2YZ8A 2B2XL 4HV8A 1G7HB 3O6FD 4N0CC 4KZEH 4G8FB 4U6HB 5DQDL 1ZGLB 3FMGL 5C8JA 2A77H 3GXIA 5GRUL 1WFIA 5KG9A 3RGVA 3GS7A 4EUPB 4HUCA 1BVKA 3MRNB 4R2GB 3T08A 1M9WA 2WWMC 4Y4HA 4XMKH 3MKGA 4K8RL 3TIEB 4LLQB 1OCZB 4EN2A 4GW4A 4KY1H 5KWYC 3RWDB 1XAUA 1E5ZA 1JN6A 1YEHL 3B3IB 4ODBD 3ASOB 3QCVH 3BZFB 3ZE1E 3WY3A 3HS9A 3UZVB 4JR9H 4ZUTA 3UP1A 1QR1A 3DUUA 1FZMB 2Q8AH 4CMMB 3C09B 4O2EB 4D0BB 3CUPB 1NAKL 1IT9H 3CD4A 5K1VA 4KDVA 4UTAH 1F90L 1J8HA 4B6ZA 4UUJA 2AQRA 3WN5A 1XL4A 4OCRL 3OXRA 4BBWA 3NCMA 1JZ6A 4WFGE 1QFUL 4QHMB 2EYTA 4MXVE 5C70A 4Y0GA 2YEQA 1U2CA 3MCYA 4PWGA 1B0GB 3Q2NA 4KJWD 1R3KB 5JIQA 1M9SA 1E90A 4L8BB 2RAMA 3QCUH 2YQ2A 4JEGB 1QLRB 4ONHB 4R9HA 4M1GH 4MB1A 3F7LA 4JFYB 2FAUA 3I3DA 4N0UB 4NENB 2ESVD 4IMLA 1D2PA 2OQJA 4IRJD 2CDEA 3QSKB 2IWGA 5EV7A 5DK2B 4L05A 3D18B 2PWEA 3Q8AA 3UBXG 3N44F 1RURH 4AV5A 2NNRA 3BH8B 3FQ1A 2X1QA 4L8DB 4MS6A 2XKSA 3P2TA 4UT9H 4FHBD 4QOKD 2XKNB 2DLFL 5DJDA 4XCEA 2FWLB 2CNZA 3EGXB 3QXAA 4NBXB 4E9XA 1OGPA 5HI5C 7TAAA 4N9GA 3PL6C 1Q94A 3FOLB 3QP3A 1F58L 1U3HC 3HC2A 2CLVB 3DMMD 4LLWB 5T3XE 2E86A 1BQRA 2F8OA 1A7QL 3D2TA 4LB8A 1VENA 5DMYA 3ZDZB 1KJ2H 1P53A 3MRMA 5FUOL 5TFSL 2DM7A 5HPMA 2VABA 2GJJA 3F7RA 3MREA 3QVAA 2R1XA 3BZDA 3SGJA 2Z35A 1U8MA 2VDRB 4GSXA 4LP5A 5ERWB 2AEPL 5BO0D 1F3DH 1HYRC 4LCCA 1RUQH 4OGAC 1KBWA 5EDXA 4EBQH 2CUAA 1TZOA 3L3JB 4JJHA 1BXAA 4Z3JA 1AOHA 2R2HB 1MCSA 4LOVA 5TQ2H 3ARRA 3B8SA 4TNVF 3D69A 1JXFA 5TH2B 1XGRB 4K4KA 1ZANL 4TUUA 5DUBB 2GUOB 1S5HA 1VJSA 2YWYA 4G70B 1WUZA 2X4OA 3RI5K 4N0RA 1OWRM 3WE1A 1CG9B 2W8CA 2WOBA 5HYJE 4MJIA 3WGUB 3QFJE 1HDMA 4GRMA 3ZUCA 3RJQB 5CEZE 5J7CC 3LS4H 1F0LA 1K4CA 3AG3B 1E40A 2DTMH 1CDHA 5I5MA 1D5BA 3D05A 5ELIA 4KV5F 2DJUA 4KGJA 1J11A 4ZMAT 5FKAA 2QKSA 4I0KA 3UJIH 3MGTA 4G80A 1TNMA 3BT2L 1ZT1A 1S78D 2B9AA 4PRNA 4LT7A 4AGMA 3VFWA 2YFOA 1BAFH 1P7KB 2DF3A 5C0FB 1DVFD 3B2PA 5CJXC 1E5BA 2YN3A 4O2CA 1XZ0B 3KPSD 1SXSA 1WBYA 1FGNH 2PXYA 2J44A 3CZEA 4PJEF 2PCFA 3WG7B 2MHAA 3QHZL 1XCQB 4S0TD 3DPDA 2WY3B 3ZLQC 2FGWH 4POZC 3VMNA 5DWPA 3RQ3A 1OB0A 4MBOA 5E1HB 2W0KA 2WZAA 4WFHE 1KENH 2HJLB 1UZGA 3LHPL 4WDIB 3OVUB 2A9BA 4HS6A 3T09A 1U6AL 2PCPA 3PHSA 1XD0A 3TXAA 1O75A 5LXGH 3RNKA 4UQ2A 1FG9C 2PPEA 4OZFB 3WXVH 1UCTA 3JVGC 1BF5A 2SEBB 5E2JA 2JCCE 4DKAA 1ZWIB 4QHNB 4YS4A 5I6OA 3ZL4L 4ONGH 5BQDA 2QLYA 1AQ8A 4D7PA 3IJYA 4BWWA 4BFOA 3VD5A 4QAWA 3KYKH 1GJUA 1BEYH 1GA2A 2BNRE 3IJHA 5F7DA 4Y5VC 2G3MA 3QO0A 2EDMA 3B9EA 4I9WD 4I2XB 2BSRA 3RUGE 2H2PD 2VDKB 1E28B 2A9ML 1C7SA 4F8NA 7PAZA 2AEWA 3HE6C 3G04B 3NPSC 1TEFA 3KPRD 4P9HC 2F19H 5EC1B 1ASPA 2WBJD 4FFZL 3ZY7A 3OKEB 3VM7A 3T3MF 3GZOA 2H41A 3MA7A 1MUJA 3SE3C 2IPTH 4OLUH 1Y6NR 3RBGA 1XDTT 5FIEA 3ARPA 4F7PA 4X99B 2Y22A 5BS0B 1CDGA 1MHHA 3U7YL 4HBCL 3C9NA 3B3BA 3FB8A 5D6CB 4BK4A 3N42B 3K71A 1ZT7A 1GGIH 3L1FA 1SJXA 1WCQA 5J11B 2I9TA 3N50A 3KPQA 4GQQA 2DIAA 4TNFA 2AVFA 2P5WB 5KBDA 3X13A 5AB0A 1T7ZA 1CFSB 3FH8A 1UD4A 4N1EA 1FZOA 4OD1L 3VFTB 1S7UA 4NJ9H 3WNKA 4ZQTA 2O6CA 2CCLA 3OZ9H 3P9MA 4K94L 4F20A 5CUSH 4XWGL 1TO5A 4NKOB 1MNUH 3BJ91 3NIGE 4PV8A 3L8QA 1TQCC 4MNQB 1DQDH 3V6ZB 1ZGLP 4QTIH 4MB3A 1EO5A 3BKML 1JSYA 4DK5A 4FTVB 3QJTB 3MROA 1SFHA 1T21A 4WTWA 5BZXA 4OB5L 3L5IA 1VEPA 3GSUB 4MQ7B 2DMKA 4CU8A 2Q76B 3MGAA 1AZRA 3NSXA 2AC0A 3D85B 4ZS7L 4PCYA 2R56H 3U2IA 4U6XB 1ZLDA 3HRZC 2Q7NA 4XN4A 3IS0X 1U92A 2VN3A 4PJBB 4M7LL 3BEVB 1RJLA 1IO4C 4YLBA 1B2WH 1SM3L 2OX5A 5F7YC 1V7NH 1M7DB 3MNZA 3O6LH 4Y7OC 1L9QA 2CJSA 3WIHL 4CNIA 3WUWA 3O0RH 3ZYJA 4DJMA 1F4YH 3RA7H 3JTSB 4PV9B 5CGTA 3HZKB 4PJFB 1B6DA 4MGXA 4U6YB 5CZRA 1LDPH 1NEZG 1F41A 3BIKB 1MCJA 3LH8A 5FDYA 3IK2A 3W38A 1F97A 4EI6B 5BW7C 2XVLA 3UYRL 4U1GB 5KYYB 4I89A 4O02H 1CGVA 3WTVA 5GGRY 1H8LA 1GC1C 3SY0A 1U8IB 2IANE 2YQBA 3V7AE 1FSKC 3WNIA 4DCQA 3NACL 3QRGH 1PCXA 4K5MA 5EB9A 2C1OB 3MUGB 1N3NA 1M71A 1B2YA 1OIOA 1Z9MA 4O9HL 4HQQL 4F9PC 3N1FC 3G6JA 4I4WB 2YC1A 1DDTA 1I7UB 1IKNC 1YLBB 2YUZA 4DZBB 3BEWA 4OZ4B 4M7LT 3UTTB 3DGCR 3NP3A 2I25N 4JREC 4DGYH 5D6DC 4XVTL 4PWFA 2YPKA 1JGVH 5BZDA 2RA1A 1XIWC 2L7UA 1FC2D 1WUNT 1TMQA 3FCSA 1WH0A 5DZNA 3ZDXE 1HIMH 1HNGA 2AQNA 4YHOH 5AD0B 4KK5D 3MV11 4P0DA 4XGZA 4XO9A 4Z95L 4EZMA 3A4FA 2WQUA 4YXHL 3K8LA 4Z23A 3TURA 2E8ZA 2FO1A 3O4LA 3V5DB 2G5BB 1BQLH 2JXMB 3KPPB 2XG4A 1F4XL 4W4OA 5HHOA 1LK3L 2VL5A 3MO1A 1T3FB 3TCLA 4W9KC 1BD2A 4PVMA 4LLVA 3QJUB 4U4BA 3HC4L 4FF9A 1QTPA 2LU3A 1FVCA 1SJEA 5DJ2A 4LPWA 3EDEA 1AE6H 4M56A 1P2CA 2BVQA 3T5WA 1OEZW 3GDCA 3GO1L 4YDZA 2IOOA 5GSRB 4CN1A 4EOWH 3MLUH 1CVRA 1YEFL 2C4FU 5ANMB 2IALA 3LZQA 3A67H 1EZVY 2MPAH 1IE4A 2VXVH 3ALXA 1IGYB 5DK0B 4NJAL 4UTBH 4U6VL 1N8ZA 3L4WA 3B5TA 3CJJA 4L2LA 4CC1A 1WAPA 1OB1B 3QUXD 4XBPB 3CCHA 1YNKL 1MQ8A 3FONA 4O00A 1ZVHA 4IJ3C 3OD3A 1NL0H 4NQCD 3HE7B 3MV9D 3PP3H 2DWEB 2LAGB 3GJEB 3EF4A 4HWUA 2VR6A 1A4KA 1T2JA 3BI9X 1RZJL 2H7WA 1NANH 3Q5TA 4GBXB 4OF5A 4DTGL 3V5HA 2PR4L 4Z9KB 5L4MA 2XWXA 2WXLA 5E0FA 3MHZA 2UWEB 2LQRA 3LRHA 2D7PA 3UPCA 4ZPTB 4LKXB 2C9PA 1P7QD 2B1HH 3S4SA 2A9AA 3WFZA 3B5HA 2XBDA 2VMFA 4BK5C 2J6EA 1CDYA 4F8LA 1FO0L 4JFXA 5JPMB 3D6GA 5MEQB 3IN2A 3DGGA 3IGAA 1T0OA 1NIBA 2AJUL 4MMYA 5J6HA 3WLWC 1XR9A 1OM3L 3IJSA 4BCXA 1KWKA 1JOIA 4AENB 4EI5D 3EH1A 4QNPF 2CRZA 1NGPL 1ET7A 3EJJX 2FUTA 4Y16B 2IXQA 5F93C 1YEDB 2ZPKL 1K8IA 4AXWA 4HLEA 3VD2A 3QZWG 3RVVC 3RY6C 1ZHNB 4PW9A 3T0WA 5B3JF 4FJYA 4OFYA 5DO2D 2PTVA 3IXAA 3QORC 2E47A 4NP4H 3AM8A 1U8HB 3D39B 3VTAA 4AL8H 2K45A 5EC2A 4DKDC 2YGVA 2XYBA 3OKMA 1U91B 4KAQH 3NDYE 5IQ9B 1V3MA 2QSTA 4GKNB 1BAGA 4JFFD 1X5JA 1WCBA 5FWQA 4X6DF 4MBRA 1E9QB 5IBLC 3UO1H 1NUFA 1R5WB 2MCPH 4AZUA 3RL2B 4NM4H 3PHOA 3U83A 4KK8C 3GSNB 3TWCL 3E80A 2L0DA 1GY1A 3MV7B 3OB8A 4G1MA 1YMHA 3GUTB 1KCRL 5ICXB 3QYNA 2F8XC 1C5BH 1JWSA 3Q1EA 4J23A 4OM0L 3QQ4A 3QUMH 1NMAL 2ITDB 2ZF8A 4HJUA 4KTEH 4XNDA 3FSVA 3DV6A 4HCFA 2O5YL 5FEBA 1U8PB 3VXSB 3S96B 5DZPA 2DQIH 3CFJA 4JZJC 3P77A 3VFNB 1ULVA 3EJZC 3FULA 2B7DT 3B9KA 5KBKA 5MEPA 4Q56A 2BSBA 3VI3A 5I2IB 3CZSA 1KIUA 2JJSC 3NVQA 1GCYA 1E4XL 2OMBA 1Q0XH 3LV3B 4XVSL 4KNSA 2A38A 1S9VA 3X1GA 1UXWB 1JRHH 4LVHC 2DEWX 3KM1A 2X4SA 4PLKD 3OLGA 1G7MB 1V7MH 4P23C 4NUGL 4F2MA 1YEGH 3F01A 5GGVH 4HAKA 1KTLB 1EAOA 3SDDC 1H8SA 3SO5A 3BD5A 3PL6B 4KKRA 2Z31D 3CLEH 1I82A 1CFVH 3S98A 1AP2B 3BOVA 3MYJB 1U3HB 4GMTH 4YEFA 2W65A 5DHVH 3HJEA 4AV4A 3SKJH 2JSFA 5SX4H 1AY1L 2J6WA 3C5SB 5DURD 2P45B 8FABB 2FECI 3W11C 1G1CA 3FQTB 3D07A 2O93L 5C0DA 5KAQF 3KPMB 2P42B 2PUQT 2WUBH 3BSHA 3ZPDA 4Z77B 5DEJA 2ADGA 1UADC 2Y72A 1I75A 2AJXH 4XMTA 1T6VN 3IGUA 5EIIB 1H5BB 3EO1A 1I1FB 3LX9A 3V9FA 4LEOA 1U36A 3C60D 4AMKH 3TCTA 3MLYL 3CNKA 1BGXH 5MERB 4NWUH 5D2NA 1WGOA 4NQSB 4EUPG 1CTNA 1P6AB 2IGFH 3BPOC 4ES9A 5EZOL 3NEEA 5F2FA 5DZJA 3ZRCC 3Q05A 2HX9A 3RX7A 3UBHA 4IKJA 1V05A 5IOPB 5DRNB 4XCNB 4XPAH 4QHLB 2DI9A 1UA6L 4CADA 1NLBH 3I75A 3V8CA 5JXAH 3FBQA 1XCXA 2NUPA 4ADJA 5IJVA 3FO2A 2EXYC 5FFOA 5GJTH 1DANT 2XQYA 3S3BB 4WEEA 3T3PE 2CA3A 3MYZA 2J73A 5B38G 5EZJB 2GJ6B 3T8VA 4HC1L 4Z3IA 1EFXD 3Q2VA 1QFPA 5CCJA 3MXWL 1TZIB 2VB5A 2EKSA 4JW3A 4BFGA 3K8KA 2ZWSA 5F8RC 1FZJB 3MV8B 2X4RB 2X4NB 1AH1A 3JYBA 4HD5A 2R15A 5GXBB 2DYPB 2PR9A 3T2PA 3OKOB 3KPTA 1T1YB 1JWMB 4IU3A 2VDOH 3ORJA 3G5VA 5LCVL 1A1OA 4QRUB 4UOW1 4AGQA 3AACA 4X7SH 1T04B 2XBTA 4Y2OA 5E99L 2YIHA 3CH1A 3O3DA 4XRCB 5C0GA 2F54B 1NMCC 3POCA 2XV0A 3QXWA 4ISVA 1H3GA 1MFCH 4WWNA 2Z91A 5IEHA 1LK2A 1R3IL 2Y3AA 1ZXQA 1XGTB 1LP9E 1S9XA 2ATPA 1P7BA 2WXHA 2XHNA 3S9DB 5JNYA 3U1QA 1I7RA 4PJXF 4QRRD 2JH2A 1I7ZA 1TTUA 1HCFX 4D3CH 4HWNA 2HG0A 3V0HA 4I0PC 4UV4L 1QTYT 4PAZA 5DHEA 4WQOA 4YH6A 1MAKA 5KYWA 1MFVA 2YBRB 1BM3L 4GRLD 1P4IH 3W2DL 2CHZA 3D9AL 3ZIYA 2MKLC 1YECL 3CH8A 2OJZL 5JHBA 4PB0H 3HE6B 3NPSB 2FT8A 1X3DA 4QYOA 2CLRB 4JY4A 4R7DA 1URIA 1T5XB 2VLKB 4PI2A 2VRKA 5LKNA 2YPLD 3ZU8A 4PRPB 3HZ3A 2QHLA 4NQEE 4EZKA 2FR4B 5AAMC 4NX0A 3U6XA 3RILA 2V5RA 2CR3A 1OL0A 5DD5H 2VAJA 3KVQA 3T0BA 3VXMD 3FQRB 4LZKA 3X12B 1TT6A 2AXGB 4P2QA 1FNAA 5IHZB 4MD0A 4GAGH 4B9IA 3D4CA 3IRZA 4JBSA 4A7UA 5FYLL 2J1WA 3KE0A 2AQ1A 2IWFA 5DD0H 1NOLA 1NGXA 1ZSDA 3FTZA 3SCMC 5L8JB 2RH0A 5D1QD 1KDJA 1WWWX 3ZXAC 2GKIA 4DETA 5D71H 5INCA 1IM9B 1YZZA 1PS3A 1HYSC 5BVPH 2OAAA 4ZMNA 4JFHE 4JG9A 4BFFA 4L0YA 4GMSH 2NDFA 2HFEA 1TQCB 3ZZSA 2XWBA 4BHUI 5HHME 1PQZA 2AI0H 5TQ0L 1DVYA 2IOMA 1N4XL 5C0CB 5GISH 2VUOA 3VJ6A 2HFGH 3LRLA 2FATH 5EBGA 4WKXA 5GGUB 5AZUA 4ELDA 5C97A 3IBOA 2PW1B 1JGDA 4LL1A 3H42H 3DO4A 3HG5A 3BAIA 2AGJH 5DD1L 5D4JA 3TPUA 4C4KT 2AAVA 4P2CG 4UCFA 4HSCX 3T04D 4QJ5B 1XV8A 5HHNA 4Z3GA 4PRAA 1TU2B 3L4CA 4XI5D 4KKPA 3OKKB 5ACZB 3HRZB 5DVMA 4UU9A 3SYOA 1LQSR 4YXKH 2P8MB 4GKLA 4P9ML 1WZMA 2WIMA 2EXTA 1DBML 4JFDE 1NDGB 5E9AA 5FGBC 2X7LB 4JHAL 3OTTA 5EOCJ 5AYUH 3WYRA 1N18A 2YFNA 5AALA 3PWPD 5DSCB 4OQTA 2ILLA 3FC8A 4DQOH 2VDQB 4PP1D 4GSDL 4JY6B 5D7LB 2VKWA 3KNBB 4ODUA 2OMWA 1FYTB 5KSAA 4F7MB 1XZWA 2E7MA 4UQDA 4CAGA 2ZSVB 1KACB 5I30L 3M17B 3VMOA 3ZSTA 4L37A 3ES6B 3QK0A 5HHXL 1UWXK 1HTYA 1J9CT 1OAUL 4QRSA 3L95A 3A47A 2J8UF 4OZIA 4G43B 5DI8B 4XX5A 2OM5A 2OMYB 2VAAB 1F1GA 3N55A 1WIUA 3H9HB 1EZSA 1YPZF 4JREB 4UTCA 4G7QB 4FJZA 1LL1A 1UUSA 2Y1ZA 4CBZA 5IFHL 3ULSB 4FXTA 1XIWB 4D9RD 2ZAGA 1NCTA 5E6IB 4OH2A 1A7BA 4L9LA 4JHWL 4GI6A 3NZ8A 4CKVX 1A7RH 1FZKB 1TXKA 4PSPA 4XNZB 1AR1D 5DDHA 4ZFZA 2BDNL 1NCBL 4CVXB 3KLAA 5IF0A 3LKNB 5E1AA 1PG7H 3DIFA 1JK9B 1C12A 4Q6IC 2V33A 2WAQA 3CFCH 3EYOB 4X98B 4RMVA 3E3QE 2D0FA 3FH5A 4XX1E 3UX9B 4MJ5B 3S6CA 1MFEH 4GG6B 3FKUS 3HCVA 3DX8A 4KHXH 1NGQL 2P8PA 3EJSA 3ALWA 4FXGC 1E4KA 3MBWB 2HCZX 2WCSA 4N0FB 4PGBB 3GRWA 4S1RL 4JFWA 3U25A 2AJSH 4LEXH 6TAAA 1TQSA 4WVRA 4ZXBD 3L2MA 3TYGH 4QCIA 3NDZE 3OLIA 4HUNB 2R7EB 4KJYA 2C4FT 2CIIA 4I85A 4WSJA 1Q4NX 1TFPA 2CIKB 2EEAA 1SY6H 4HUMB 2FIRT 4LIQL 3QUGA 1J5IA 5FCUH 1IM3D 4ZDHB 2YEZB 4DNLA 4I3SL 4WI7A 1CPUA 1YC7A 3EJPA 3CFDA 2WNGA 4IIQA 2GTQA 2NXYB 5DUMH 2OL3A 1MJ7L 2BP3A 4XP5H 2F7IA 3OJDA 5D1ZD 1PZDA 2EDLA 3HNTL 1YYLL 3EYVA 3ARTA 3WBDA 1JZFA 5KS9F 4L8CA 1MG3C 4IJ3B 1T0NA 1PFCA 2LTQC 4PJ5E 3Q06A 1NPJA 1F2XK 3COOA 4AM0Q 2FEDD 2VDRL 3FT2A 4UYQA 5EORH 2HG5A 3BJLA 3KXFA 3LNDA 3D0AA 1L7IH 2CO6B 4HALA 2WXNA 2F61A 3BPNC 3NAAL 1KSRA 2VLRB 3MOBL 2APWA 1BMGA 1FBIL 5ILTH 3EZJB 4KRPB 3WD5H 4Z7NE 2X3BA 3THMH 1HS6A 3QUZD 4JGMA 3VWKC 4H8VA 2AFNA 1OGAA 2VQTA 2QTEA 3VQ1C 1BOGB 2WKOF 2ZOKA 4LPUA 4R7NA 4AYEC 5GGSB 4A2EA 3OWEA 3PQYB 2HWZL 3GBDA 3TBWB 4PJIE 1CF8H 4NUMA 3TM6A 5A6LA 5MENA 4YHNA 1NM4A 1SN2A 3V0WH 4RGNB 1JG9A 5IMOA 5K1JA 2F9BT 2JQZA 4Q9QH 1RZFH 4LMQE 1J8SA 4ZJ9A 2J1KA 2PYEB 4WU5A 1EH9A 3CLFH 2AK4A 1OM9A 4XP4L 1T0MB 4Y5XC 1MCWW 3QORB 1N6VA 1KGXA 4O51B 1GTNA 1BJ1J 1ZA3A 2VR3A 5F89A 3SYAA 4AIOA 3NIDF 3ET9F 1QVOB 3S36H 4OZHE 5IJCC 4G11A 4IMKA 3DX9B 3CX5J 4WFGD 1PDKB 2DQJH 3FRUB 5EN2A 2O26U 5C71A 3ZTNH 4KRLB 1EZUA 1OWWA 5J5EA 1F8TL 3PLYA 4G7RB 4YSAA 2WLJA 5L6YL 1T1XA 2DM4A 4ZW6A 2X6CA 3CPLB 4N2BA 2QPFA 1L0YA 4GFTB 1FLRL 4WRLA 5JHDB 2MFNA 1NDMB 2G3NA 4IM8A 5C6TL 1OSYA 5EEWA 4AGNA 2WPGA 2JTYA 4HH8A 2DD8L 5HVWA 4YHZH 1WFMA 2V17H 2R1WB 1A6UH 3K4AA 3VXPA 3IKCB 5EFIA 2IQ9L 4PJ8A 4QTHB 4JZJB 5T1LB 4EZJA 3BZ4B 1QFWI 3ZT6A 3RDTD 1YUKB 2OSYA 4XPFL 5IB2A 3HAEA 1Q8MA 4HX1B 3DC0A 4JO4H 3IU4H 1T83A 1H8OA 2WVTA 1ORQB 3N0PB 4Z78B 4PS4H 3RI5F 1NCWL 4NXKA 4LVHB 2AABH 4M8QA 5T3XD 1JUFA 5AVWB 1HZKA 1FI8C 4OGXL 1O6SA 1BM7A 3GIVB 1ZVNA 2FL5B 5T1MB 3DMMC 2DQEH 1JYVA 2FIKB 1JHTB 4XPGH 3EH5B 5FYLE 3SDDB 2DQUL 1WD9A 3GXTA 4IRSA 3IWUA 4BFEA 3EH3B 1Q9OB 4RMTA 3K3QA 1T03H 2R69H 5C0BB 1CJYA 3VFPB 4LP4A 5CIPA 1H9VA 3HVDA 2IFGA 3K6SA 2G3XA 2XX0A 2UX6A 2XC8A 3CSTA 3G5XA 5IG7A 3MRBA 4GLRI 2EC9T 2UZXA 2XZAL 2EH7L 3KR3H 3P54A 1QI5A 2AEOA 1KEML 1VFUA 2X28A 3LKPA 1R46A 2FEEL 4X6FB 2BK8A 4FTDA 4Z7UE 4MAYA 1UH4A 5HYJD 2AXJA 1LEIB 3QI9A 3KCPA 3G6DH 4YE4H 2B20A 1PG7X 3QFJD 1KULA 5CEZD 3LQZB 5F1NA 1HHJA 5KSUB 3U30C 2VZTA 1KXHA 1Q90A 3VGAC 3N2JA 1DSWA 1X5LA 2R27A 2NNFA 4PJHA 4B5ZA 5K9JH 5EU6A 4HIEA 3OPUA 3VXQA 4X6CA 4EJ1C 3RWEB 2X4PB 4AEIH 4PB9H 2ZX5A 2PO6C 1MFMA 4U0RC 5LGHL 2OTUB 1UM4L 3QZWA 1MCLA 4N2NA 5D7KE 4C56A 5CJ5A 5CEYA 3TTSA 1NICA 3S88H 2HH0H 2ZOLA 1S78C 4P2OA 4LEEA 5T33L 2HVKA 3V6BR 1W0VB 2B4CH 2A6DA 1KGUA 1DVFC 4B9JA 2UUDH 3CXHJ 5L4JA 3G3LA 3RG1C 1MCIA 3EJCA 5GZNA 3ZKMD 1GHFL 1CFBA 4L0PB 2GW5A 4KX7A 2OXGA 5E4EB 4ES8A 4WFHD 3HUJF 5F3BA 3ZKSD 3V55A 3E8UL 5JOFB 4F7CB 1Q9KB 3WSQH 3L3HA 3FB6B 5GQBA 1KJ2B 5KVFH 3U7AA 1CGSH 1IAMA 2VC2H 2R29L 4LQFH 3F6JA 4MRBA 3BWAB 4DN3H 1UTDA 4XPTH 3H0TB 1L6PA 4EN3D 3BWZA 3WIIL 4IKLA 2XPYA 1BWWA 3H2PA 1OE2A 2CE6A 1IFHL 4EQ2A 1P4LB 1J9RA 4H25A 1J10A 3HN5A 2WTOA 4MJ4A 1I9EA 2ARJB 3OAWA 1EMTL 2V7NA 5I1GH 2GSGB 1E3XA 3QDJE 4Z7WA 2EDFA 1TUPA 2BNRD 3NABH 2VMCA 3DX0A 4G9DB 4QLRA 4DEPC 4JFEE 4G9FA 4QHPA 2FD6L 1L3NA 5D70H 3MFGB 1OOWA 1DVQA 1MY7A 3WKNA 2PWFA 2CHDA 1LO3L 1MJ8L 5LBSH 3FN0H 2GT9B 3NMEA 4ERSL 5LUMA 5IFJB 1THCA 1TF4A 1FAIH 5D7IB 2VUKA 1QSEA 3K46A 1ZLSL 2CO7B 4BZ1A 2YQGA 3ARYA 4ZTOH 2WBJC 5C9KA 1G4RA 1MN4A 5EH1A 3DARA 3O3EB 1KJ3L 1TR7A 3BVTA 4GIAA 2EDRA 3W39B 1GW6A 4ZMVA 4TVUA 2NNAA 1MWAH 1A47A 1D3CA 4JRYB 3CC5B 4LIQE 4MFHA 1GS8A 3CXDH 4KX8A 4ANUA 1HL4A 5ADOL 5ID0B 2VR9A 3UBGA 4LVNC 5I18H 4LK4A 15C8L 1X6NA 1U42A 4ODSH 3FRPB 1VKXB 1Z6JT 2OI9C 1S9WB 3MLZL 2PW2B 3QDGA 2NX5B 4PJGB 1Q0YH 5C0EB 3SBWA 2WZPA 3L9RA 1S3KH 3FO0H 4WI6A 1UKTA 2EEXA 3HOGA 5IB3A 1LNUB 1INEL 5I0DA 4X9BA 4K7PX 3VRLE 1D9KD 1IC4L 3SCMB 3QYMA 3RPIB 3MCKB 4G8FA 3GLDA 1ZGLA 5E2VL 3LS5L 3I2CL 3B34A 3PG2A 3HBZA 4NI3A 2IH8A 4DVBA 1VPOH 3VXOA 3FSWA 4IEFB 3TNNB 4IOSD 4D94A 3MRNA 5J0BA 2ZUXA 3KYMB 1JZ4A 4ZMYA 4IRZA 4MQXD 2LU5A 2HKAA 3L1EA 4LLQA 4EPSA 1QRNA 2EEFA 4C8XA 4UIMA 2I07A 3BZFA 2V2XA 4OLZH 3FCBA 1A66A 4E9WA 4QKXB 1E4JA 1FWXA 2G60H 1U2HA 1VZGA 2HLEB 4XN5A 4CMMA 1QBBA 4K8RD 4O2EA 4BFJA 5I9QC 1PIGA 1EJOH 1DBJH 2C3XA 2DQFA 2Y5TB 2XNAA 4OFIA 4LSUL 3ZZLA 4P46D 3FF7A 3PU7A 4XP9L 1N0XL 4WNSA 4TLTA 4RWYH 3BAEL 3FOMB 4JFTA 1T4KB 2G2RA 4GEIA 2ZYHA 4WO0A 3WJJC 4QHMA 3IDYC 3ULUF 3LRMA 3MN8A 3ZHDA 2CAKA 2IAND 3R8BB 3ZJAA 1L9TA 2HRLA 3IFNH 1WPCA 4Z8FL 2YHGA 4AGOA 1J8HE 1B0GA 2N3JA 1OGSA 2X2YA 1EAPB 1OV8A 2QSCH 1XT5A 3C08H 1UD8A 4L3EB 4L8BA 4ONHA 1QLRA 2B1AH 2LU4A 2NZ1A 3RY4A 4MA7H 1ETA1 5DJ0A 2GHWB 4J6RL 3VD1A 1TSHA 4PRHB 5DEFB 2X88A 1BFOB 3L3IB 1X5HA 4Z1PA 5EOQL 1JGEB 4WV1C 3PJLA 3D18A 1DQML 2OR9H 4A7QA 4PJ7B 5K59F 4QRQB 2EE0A 2HPTA 2XKNA 3HMXL 1M6UA 3LOWA 3M8OL 2XBZA 4KRNA 4CSPA 3WTXA 1G6RH 4ZUSB 2DLEA 4HJGA 4K5LA 3FZUD 5FGRA 3TH3T 1FL5B 4ODTH 5IUCA 4HGWA 1UM6H 5HD8C 1TQVA 2CLVA 3KVPA 2HRPH 4LLWA 3SDCC 4WK0B 4LO9A 4NRYB 5DJZB 4M48H 1Q9LA 4L8SC 4NZJA 3HI6L 5E70A 1H6FA 4BSJA 1QI4A 3APDA 1M6OB 5CS7A 2VISB 3NEOA 4G42B 4JM4H 2ZF9A 3OJMB 4YDJB 3WOVA 3SY6A 3EOAA 1I9RH 3Q2CA 5I0YA 3KBHE 4KMQA 1SHSA 2QDVA 5BVJB 4PP2B 3RTQD 1MVUB 3L3JA 4TVSa 2R2HA 3ARGD 3CBJB 4HETA 2O1AA 4QRTB 3U4BH 1MCHA 4PVLA 1S5IL 3ECBB 2IDCA 5TH2A 1XGRA 1P9MC 5DUBA 1KC5H 1AIFB 4FNLH 3X3GL 5DFVC 2W38A 4C58B 1G9ML 3ZL2A 1TJIH 3TEUA 2I85A 2ZSWB 3IE9A 4O02B 5LO7A 3QUXC 5ABAA 5E2WL 3JYCA 5AENA 4E41B 3L7EB 4G7YH 4HKJB 2VM4A 4AZ8A 1CZ8H 1DLHA 1JNLL 3FU7B 3QC5X 1F42A 3F85A 2HJKB 3PJSB 4ODHH 4LRNL 1FA4A 3FH7A 4Z7VF 4G8GB 4AQ1A 2J5LC 3UP6A 2LTQB 2W0FB 5K93A 3QPXH 2Y7NA 1TTAA 5IVXE 5SV3A 5IESH 3JZ7A 3CFBA 4R7VA 1E4WL 3W9EB 1P7KA 1SOQA 4YHLH 5C0FA 2A4CA 1XZ0A 4PJEA 1UGKA 4M8RA 5JQ6H 5C0JB 1QNZL 1X5YA 3D3VB 3GC3A 1MI5B 4BWUA 4ZS6D 3GI8H 1AS6A 1PZ2A 3OKLB 3NJMA 2OZ4H 1XCQA 1ZIBA 4OLXL 3HBGA 3VWKB 2BZCA 2YOAA 4XZ4A 1UKSA 3O6FB 4QY8B 4WO4A 4X9HA 5FA3B 2HJLA 4N4YB 4XCFH 1NC4D 1SOKA 4WDIA 5J3HC 2D03L 5T3XH 1GYCA 3V4PH 3ESVF 4LCIL 4FA6A 2UVFA 3INOA 3T2QA 4MWFB 1AG6A 5DO2C 4OZFA 3B8YA 1IC7L 1ZWIA 3O45B 1UASA 3V6OE 4K5OA 3EOBB 3QC6X 4NO2A 4BXSV 3ARFC 3CIQA 2X09A 2VW7A 3QDMA 3CVHA 1G7LB 1KN4L 1KXVC 2OYMA 3IFPB 4JPKH 4YSUA 4Y5XB 5F6HI 2VDNH 1OHQA 5E51A 4BH7B 1WBXB 3US0A 3RKDC 2WIIB 2DQGL 2YUXA 3CVIL 3P1VA 4GSUA 1MFBL 2AXFB 2TAAA 3K8MA 4P5MA 2YMXH 4RMSA 3RAJL 3BWUF 5EF1A 1G9NH 2GPZA 1E28A 3IM1A 1INDL 5T1DL 5L2JB 3ZT7A 2JIXD 1UH3A 4Y4KD 5HDBE 4F2EA 1KCSL 1YEEH 3DROA 5TDNB 3I6KB 4PN6A 5EC1A 3WAKA 2G4GA 3R7QA 3OKEA 3KWTA 1JBJA 4LAJH 3T71A 3JWDL 3T8MA 1CI5A 1R24B 3JWNE 1I8KB 3QIUD 3VWJA 1AKJD 1I8IB 1T0PB 3UDWC 4X99A 4EDXB 2APSA 1UVQB 5BV7H 4AEHL 5I15L 4XB8A 2WMPA 3DUSB 2IG2H 1MCBA 4OCWH 3SDXB 4TSCH 2L4OA 1JZJA 2ESVB 4NDMA 4R8WL 2P5WA 4IRJB 1SOSA 2WXGA 3F6IA 1IB5A 3P4OA 5DQ9B 1A6VL 3GS0A 3SYCA 1ORSB 2A73B 1VLXA 1U58B 2G75B 2IH1A 3O41A 4QOKB 4U1JB 4NKOA 5GRYA 3W57A 2WYHA 3B2VL 1KIQB 4X8GA 2VLJA 2NY5H 1CE1H 1MQKL 5M95B 4IDJH 3EGDB 2ZZUT 3TONA 4QWWD 4JFQB 1LO4L 3QEGL 5IW1A 3ALPA 3DMMB 4JM0A 1IFRA 6FABL 1EEYB 1JF1B 3BAXA 3L3DA 1U8NA 3EO0B 3NSCA 1F13A 4M93B 4AC4A 4MQ7A 1KZYA 1UH2A 1AQKL 2Q76A 1JIBA 3TT1H 3JV4B 4CDGC 3D85A 3IFLH 4RZCB 3RY5A 5IMKB 2NY3C 2NTSP 1ACYH 3IPFA 1ZEAL 4MJ6A 1I1YB 2WP3T 3EBGA 4NZFA 3U9WA 4UT6H 1M7DA 1AZVA 4FABL 2FJHB 3V0GA 4XT1C 3U9PL 1WK0A 2VW6A 3C60C 5K9OB 1PKQE 1NAMH 4YDKH 2DBJA 3JTSA 3UJTH 4PV9A 2X70B 3Q1SL 5AL0A 3BIKA 1F45A 1TCRB 2QJDA 1I1AD 2ZP0T 1NFDE 4AI7A 2P1YA 4WIQA 1JCVA 4TL4A 1FPTL 1RJZB 1U8IA 4YIQB 2A6KB 5EU7C 1A3RH 3U30B 3LCYA 5KN5B 2C1OA 3AB0B 3N06B 3P3TA 1J18A 3VGAB 3MUGA 1J5CA 1FLTX 1A8ZA 2VR7A 1UJ3C 1WO2A 4AY0A 3N6YA 2E27H 1QG3A 4KKZA 1SLXA 3KYNB 1I7UA 1S7TA 1MCCA 1OAXH 5IJDC 3D0LA 1MRDL 3UTTA 3TFKD 3ILQC 4PPTA 1XF4B 1MIMH 4KMLB 4U0RB 1A4BA 1K85A 2DLGA 1SYVA 2EQDA 4B9KC 5D1ZI 4HS8H 4DGIL 1QFHA 3G6JE 4KQ3L 1DVFB 3KHQA 1A4JA 1YQVH 5AB1A 1JDDA 1U9KA 3HPLB 3KPSB 3GXNA 2XOTA 4H88H 4DK3A 1ADQL 4AUUA 2KKQA 1JF5A 3KYOB 1KFAH 3NG5A 2VDQL 4PJCB 4KK6D 4YNYB 3V5DA 3VYPA 4AITA 3BO8A 1HVXA 2G5BA 1AJ7H 5DHVB 3UAJA 4XVUD 3KPPA 2AVGA 1YVLA 2WQXA 4RGMC 4KPHL 3V52H 1H15B 3ILPB 4P2YA 5AOZA 3RWGB 5EF0A 2YAQA 1FN4B 1NINA 1OXYA 1T3FA 2QL1A 4DVRL 4F7EB 1USZA 3O4LE 3CSGA 4YSPA 4P3WA 5ICUA 2H0JA 4C83A 5CR1A 2B2XH 2YKLL 4AJVA 3CV5A 4AC2A 5C2BL 1MH5A 2EIKB 5F1OB 3T1FB 1SMDA 5HHOE 3LNEA 5DQDH 1BZ8A 2A6IA 1RHHB 2G4EA 3FMGH 2GAZB 4BUGA 3LPWA 1KCLA 3GUFA 3MJGX 5H37A 2Y3NA 4A7VA 4DEPB 4JPSA 5A16B 3W56A 1VACB 4ADGA 4JO2H 3RVUD 1EXGA 2MKWA 1IGCL 5LGYA 1XCTB 3CZFB 1LO2L 4TRPH 5DK0A 1JNHB 3VGDA 1XBDA 4GRLC 2ZX7A 1HEZA 4W6XB 4K8RH 1Q9WA 1UYWH 1WAEA 3ML8A 4KXZH 3S0PA 5CMAB 3I84A 4WSKA 3KPRB 3O2DH 3ESUF 3HE7A 1VZIA 3GJEA 4HKBB 2WBJB 3BH9B 4LL4A 4NQED 1Y18B 2ZUQC 4OCXH 2BVPB 1EEQA 1NAKH 3QG6B 4XNAA 5FW6A 4LSDA 3UYOD 1F90H 4PY8J 4NO5B 3KGTA 4GBXA 3EYQD 1JNNH 4OCRH 2HN7A 1UUNA 5CFAA 2UWEA 4LVNB 3ZQ9A 4U1MB 1FVDB 4UB0H 5JW4R 2XG5B 2OI9B 3UZEC 5DZOA 1N70A 4GB9A 3W0WE 3MRRB 4JRXA 3KPNA 4QPEA 5JPMA 5MEQA 4JFHD 3VYOA 1SEBA 4X5QA 3S5YA 4PMFA 1M56B 3T0EE 5EDSA 2VDOB 4L3CB 4N2IA 5HHMD 3KDPB 5I1IH 1W8OA 4YAQB 4A6YL 4CU7A 1MLCA 3RWFB 4AQZA 3LVEA 3QS3A 4XMPL 2BSED 2VE6B 1OP3K 3QPQC 4WI0B 3E1ZA 5FHAL 1IL1B 3RWCA 1E30A 1SXNA 2DLFH 2NLJB 1VERA 4WW1A 5TF0A 2F1AA 1M1XB 1U8HA 3D39A 2LAAA 5D5MF 5T5NG 4LNVA 4CC4C 4HEMA 5IP4A 4XI5C 2DKSA 4JFDD 5IQ9A 2KPNA 2E75C 3FTVA 5KYXB 3IAQA 4IQHA 4I88A 3MJ9H 5FUOH 2FWOB 5TFSH 4H0GA 1DDHB 5I9QB 1E9QA 1JZ7A 3ARDC 5E5MB 3GSQA 2QKIC 2ZT9C 4NT6B 3APCA 4HZLB 3RL2A 4TXVB 3VTMA 1YUHB 2Q0ZX 3QXVA 1OF2A 3GSNA 3QQ3B 2YPVA 4WEMB 3O3BB 1EEZB 3MV7A 4WTXA 2WQRA 2GITB 1GOGA 5DHMC 2XYCA 3IDYB 3IJ7A 3GTNA 2ITDA 3EO9L 1EX0A 4O2FB 2C8NA 2YZ1A 3LN9A 4ZFOB 4APQC 3LHAA 3P0VL 1U3YA 3ZKXC 3TEZA 2AQTA 1XTLA 2V3EA 3VFNA 4R4BB 4HHGA 4HOZA 1Q72L 3M1OA 5A3ID 5I2IA 1OOAA 3KL3A 1EA9C 3KGSA 3HHMA 4WV1B 1P5UC 1YNLL 1SJVA 4UDUB 3T6ZA 3ZE0E 2EDYA 3IMSA 1UXWA 3B83A 5B7FA 1HQRB 1WFTA 4E42B 3WO4B 2EE3A 4NB7A 2VM3A 2H47C 3A21A 1QWNA 4J4PC 2RQEA 1G7MA 3CSBA 3VI3E 1JFHA 5DTFB 4JAMA 5ESVB 3HC0B 1AR1C 5JORB 3N40P 5KANI 1WV7T 3BVWA 1NOAA 3BT2H 1OSEA 3PL6A 4W9EC 5E6ZA 1G9EA 1AP2A 4PEEA 3MNVB 1U3HA 4LNRB 5E94B 2IDQA 1FHGA 1JMXA 2XA8L 2VDLH 5CFHA 5EZIH 1IGIH 4WGWB 4MNHB 4HXBH 4L8SB 1XBRA 3BIBX 1J86A 3FRPG 4I5BB 8FABA 4OIBA 3FQTA 2AV7B 5DRXB 1IC5H 3QHZH 2BCMA 1UKQA 4ZXBC 4UNVA 5MEOB 3I50H 3V0VB 2BRRL 3EJYC 4MS8C 2XN9E 1TTRA 4N25A 1R3LB 1BLNB 2ERJB 3LHPH 1SBSH 1EHNA 5EIIA 4G7SB 1SDAB 4KZEL 4LHQB 5C3TA 1I1FA 1U6AH 4JPWH 1PX8A 2ZIDA 1FE8H 2A77L 2R1YB 3DO7B 3I9PA 4R4NC 4Y1AA 5INDB 4JM2F 2HUHA 4NQSA 1WP6A 5J13C 1AGCB 2XU9A 1BW8A 1QLFB 1ZV5A 1S7QB 3LEVL 5CP3H 5D1ZC 3ISRA 4ELMB 3BFOA 3QUXB 1I8MB 5IOPA 4PJ5D 4XMKL 5DRNA 1HCVA 2ODHA 4QHLA 1GZHC 1IAIL 1BLIA 4ZMQA 2DMGA 1JPGB 3MV9B 4NQCB 5J89A 4PUBH 3KLDA 1EHLH 2FEDC 4KNQA 5BRZE 2YSSB 3PP4L 3I6LE 4JR9L 2A9MH 4JG5A 2J5LB 3GT6A 1Z2KA 3TNMB 2COVD 2CNYA 5EZJA 3MODL 3NFPA 2EKJA 4LLMB 4UTAL 4KK9C 5C0CE 4FFZH 4M1DH 1CL7L 3PPSA 4H13C