2F1TA

Outer membrane protein ompw
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
191
structure length
183
Chain Sequence
EAGEFFMRAGSATVRPTEGGGFSVTNNTQLGLTFTYMATDNIGVELLAATPFRHKIGTRATGDIATVHHLPPTLMAQWYFGDASSKFRPYVGAGINYTTFFDNGFNDHGKEAGLSDLSLKDSWGAAGQVGVDYLINRDWLVNMSVWYMDIDTTANYKLGGAQQHDSVRLDPWVFMFSAGYRFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The outer membrane protein OmpW forms an eight-stranded beta-barrel with a hydrophobic channel.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Membrane protein
molecule keywords Outer membrane protein W
total genus 45
structure length 183
sequence length 191
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03922 OmpW OmpW family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2f1tA00
1Q9FA 2MNHA 1ORMA 1Q9GA 2N2MA 1MM5A 2ERVA 1QJPA 2N2LA 4RLCA 2LHFA 3GP6A 1P4TA 2X27X 1G90A 2F1VA 1QJ8A 1MM4A 2GE4A 2K0LA 2M07A 2MHLA 2F1TA 1QJ9A 3QRCA 2M06A 4PUXA 1BXWA 2JMMA 1THQA 3C5OA 3G7GA 3QRAA
chains in the Genus database with same CATH superfamily
3SZDA 1Q9FA 2YNKA 4XNKA 2MNHA 5G26A 4AKRA 4AYNA 2Y0HA 3VE1A 4Z3TA 5AFUL 2J1NA 5FVNA 1ZHZA 4AYID 3DA4A 4AKRB 1QJPA 2N2LA 4PR7A 3POQA 4FRTA 4RJXA 2LHFA 3EMNX 4RL9A 3VZUX 3T0SA 3SY9A 2Y7SA 1OSMA 3DWOX 3A0BO 2QTKA 4N59A 1QJ8A 5PRNA 4BUMX 1MM4A 2WVPA 2XG6A 3AAEB 3AAAB 2KZ7A 2GE4A 4KR4A 4AYMC 2XTQA 3HWBA 4C4VA 5KAFO 4AZLA 8PRNA 3SYBA 4AYDC 3HW9A 2KC0A 2IWWA 7PRNA 3NJTA 1T16A 3UPGA 1PRNA 2IWVA 1YS5A 1QJ9A 1ZHWA 4C4VB 4AKMA 5G38A 2F1CX 4FESA 2R4PA 1THQA 2Y0KA 4E1SA 2W80C 2YPVA 3T24A 2R89A 1GFPA 4K3BA 3VY8X 4E1TA 2XE1A 1Q9GA 3O0EA 3AA1B 3SY7A 3BRYA 1MM5A 3JTYA 2ERVA 4FT6A 4PJ0O 3RBHA 3WI4A 3GP6A 4D5UA 1GFOA 1IZNB 4FUVA 1G90A 4GCQA 1H6S1 2F1VA 3K19A 3V8UA 3AA7B 2JQYA 2OMFA 3NSGA 2X9KA 3PGSA 4AUIA 4GHBA 3LK3B 1GFMA 1GFQA 2M07A 4B61A 1BT9A 2MHLA 4JCHA 3AA6B 5GV0A 4AYEC 3KVDD 4N58A 5DL6A 2LFUA 3VE2A 1HXUA 3AAAA 2R4NA 3SZVA 3LK3A 5DL5A 2Y2XA 5EE2A 2M06A 3AA0A 2XMXA 5T5FA 3AA7A 5H2FO 3HOEA 2KXPA 3C5OA 3BS0A 3QRAA 4FMSA 3DA3A 3HOLA 3PRNA 4LSFA 1ZHTA 4CTDA 1HXTA 3DZMA 5D5DA 3SYSA 3WU2O 4F4BA 5E79O 2R88A 3LK2B 1ZHXA 5ADXL 3LK42 4AFKA 1BH3A 4O3WA 2Y0LA 6PRNA 5GTHO 3UAQA 3VY9X 3POUA 1E54A 3PORA 4FOZA 4IL6O 1ZHYA 3FYXA 4N74A 3PQSA 4UB8O 2PRNA 5B5EO 3AAEA 4RLBA 3PQUA 4C69X 2KDYA 2R4LA 3UU2A 1IZNA 4GCSA 4FSOA 2XTRA 5JDPA 2F1TA 2ODJA 4G75A 4O3XB 2FGRA 3A0HO 4G76A 3LK41 4JFBA 4O4XA 4O4UA 5DL8A 1PHOA 5B66O 4XNLA 2R8AA 1S5LO 3PGRA 4FRXA 4KR8A 4N75A 4KRAA 3JCUO 4QQ1A 1T1LA 3VZWX 2XE2A 4O49A 2XE3A 5DL7A 5TISO 3PF1A 2WJRA 4LSEA 5G3AA 4K3CA 3WI5A 5IYUA 1ORMA 1GFNA 4U9CA 1OPFA 2PORA 2R4OA 3AA0B 3LK2A 2N2MA 2AXTO 2W81C 4RLCA 3VZTX 2FGQX 1HXXA 2K4TA 4LSHA 4FZLA 1P4TA 2KZ7B 2X27X 2O4VA 2KXPB 4LSIA 3DWNA 4GF4A 4O3ZA 2J4UP 2XE5A 1MPFA 2K0LA 3KZIO 5GTIO 5AFUK 3TZGA 4UB6O 4FZNA 5KAIO 4RJWA 3PGUA 4FSPA 3AA6A 4D65A 5G39A 4C00A 3BRZA 4FZMA 3QRCA 4GCPA 2WJQA 3A2SX 2ZLDA 3AA1A 2ZFGA 3POXA 4FQEA 1BXWA 4PUXA 2JMMA 4D64A 5ADXK 3G7GA 4O3YA 3T20A
chains in the Genus database with same CATH topology
3SZDA 1Q9FA 2YNKA 4XNKA 2MNHA 5G26A 4AKRA 4AYNA 2Y0HA 3VE1A 4Z3TA 5AFUL 2J1NA 5FVNA 1ZHZA 4AYID 3DA4A 4AKRB 1QJPA 2N2LA 4RJXA 3POQA 4FRTA 2LHFA 3EMNX 4RL9A 3VZUX 3T0SA 3SY9A 2Y7SA 1OSMA 2QTKA 4N59A 1QJ8A 5PRNA 4BUMX 1MM4A 2XG6A 3AAEB 3AAAB 2KZ7A 2GE4A 4KR4A 4AYMC 2XTQA 3HWBA 4AZLA 8PRNA 3SYBA 4AYDC 3HW9A 2KC0A 7PRNA 3UPGA 1PRNA 1YS5A 1QJ9A 1ZHWA 4AKMA 4FESA 1THQA 2Y0KA 4E1SA 2W80C 2YPVA 3T24A 1GFPA 3VY8X 4E1TA 2XE1A 1Q9GA 3O0EA 3AA1B 3SY7A 1MM5A 3JTYA 2ERVA 4FT6A 3RBHA 3WI4A 3GP6A 4D5UA 1GFOA 1IZNB 4FUVA 1G90A 4GCQA 1H6S1 2F1VA 3K19A 3V8UA 3AA7B 2OMFA 3NSGA 4AUIA 4GHBA 3LK3B 1GFMA 1GFQA 2M07A 4B61A 1BT9A 2MHLA 4JCHA 3AA6B 5GV0A 4AYEC 3KVDD 4N58A 5DL6A 2LFUA 3VE2A 1HXUA 3AAAA 3SZVA 3LK3A 5DL5A 2Y2XA 5EE2A 2M06A 3AA0A 2XMXA 5T5FA 3AA7A 3HOEA 2KXPA 3C5OA 3QRAA 4FMSA 4LSFA 3DA3A 3HOLA 3PRNA 1ZHTA 1HXTA 5D5DA 3SYSA 4F4BA 3LK2B 1ZHXA 5ADXL 3LK42 4AFKA 1BH3A 4O3WA 2Y0LA 6PRNA 3UAQA 3VY9X 3POUA 1E54A 3PORA 4FOZA 1ZHYA 3FYXA 3PQSA 2PRNA 3AAEA 4RLBA 3PQUA 4C69X 2KDYA 3UU2A 1IZNA 4GCSA 4FSOA 2XTRA 5JDPA 2F1TA 2ODJA 4G75A 4O3XB 2FGRA 4JFBA 4G76A 3LK41 4O4XA 4O4UA 5DL8A 1PHOA 4XNLA 4FRXA 4KR8A 4QQ1A 4KRAA 3VZWX 2XE2A 4O49A 2XE3A 5DL7A 4LSEA 3WI5A 5IYUA 1ORMA 1GFNA 4U9CA 1OPFA 2PORA 3AA0B 3LK2A 2N2MA 2W81C 4RLCA 3VZTX 2FGQX 1HXXA 2K4TA 4LSHA 4FZLA 1P4TA 2KZ7B 2X27X 2O4VA 2KXPB 4LSIA 4GF4A 4O3ZA 2J4UP 2XE5A 1MPFA 2K0LA 5AFUK 3TZGA 4FZNA 4RJWA 4FSPA 3AA6A 4D65A 4FZMA 3QRCA 4GCPA 3POXA 3A2SX 2ZLDA 3AA1A 2ZFGA 4PUXA 4D64A 1BXWA 2JMMA 5ADXK 3G7GA 4O3YA 3T20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9F A;  2MNH A;  1ORM A;  1Q9G A;  2N2M A;  1MM5 A;  2ERV A;  1QJP A;  2N2L A;  4RLC A;  2LHF A;  3GP6 A;  1P4T A;  2X27 X;  1G90 A;  2F1V A;  1QJ8 A;  1MM4 A;  2GE4 A;  2K0L A;  2M07 A;  2MHL A;  2F1T A;  1QJ9 A;  3QRC A;  2M06 A;  4PUX A;  1BXW A;  2JMM A;  1THQ A;  3C5O A;  3G7G A;  3QRA A; 
#chains in the Genus database with same CATH topology
 3SZD A;  1Q9F A;  2YNK A;  4XNK A;  2MNH A;  5G26 A;  4AKR A;  4AYN A;  2Y0H A;  3VE1 A;  4Z3T A;  5AFU L;  2J1N A;  5FVN A;  1ZHZ A;  4AYI D;  3DA4 A;  4AKR B;  1QJP A;  2N2L A;  4PR7 A;  3POQ A;  4FRT A;  4RJX A;  2LHF A;  3EMN X;  4RL9 A;  3VZU X;  3T0S A;  3SY9 A;  2Y7S A;  1OSM A;  3DWO X;  3A0B O;  2QTK A;  4N59 A;  1QJ8 A;  5PRN A;  4BUM X;  1MM4 A;  2WVP A;  2XG6 A;  3AAE B;  3AAA B;  2KZ7 A;  2GE4 A;  4KR4 A;  4AYM C;  2XTQ A;  3HWB A;  4C4V A;  5KAF O;  4AZL A;  8PRN A;  3SYB A;  4AYD C;  3HW9 A;  2KC0 A;  2IWW A;  7PRN A;  3NJT A;  1T16 A;  3UPG A;  1PRN A;  2IWV A;  1YS5 A;  1QJ9 A;  1ZHW A;  4C4V B;  4AKM A;  5G38 A;  2F1C X;  4FES A;  2R4P A;  1THQ A;  2Y0K A;  4E1S A;  2W80 C;  2YPV A;  3T24 A;  2R89 A;  1GFP A;  4K3B A;  3VY8 X;  4E1T A;  2XE1 A;  1Q9G A;  3O0E A;  3AA1 B;  3SY7 A;  3BRY A;  1MM5 A;  3JTY A;  2ERV A;  4FT6 A;  4PJ0 O;  3RBH A;  3WI4 A;  3GP6 A;  4D5U A;  1GFO A;  1IZN B;  4FUV A;  1G90 A;  4GCQ A;  1H6S 1;  2F1V A;  3K19 A;  3V8U A;  3AA7 B;  2JQY A;  2OMF A;  3NSG A;  2X9K A;  3PGS A;  4AUI A;  4GHB A;  3LK3 B;  1GFM A;  1GFQ A;  2M07 A;  4B61 A;  1BT9 A;  2MHL A;  4JCH A;  3AA6 B;  5GV0 A;  4AYE C;  3KVD D;  4N58 A;  5DL6 A;  2LFU A;  3VE2 A;  1HXU A;  3AAA A;  2R4N A;  3SZV A;  3LK3 A;  5DL5 A;  2Y2X A;  5EE2 A;  2M06 A;  3AA0 A;  2XMX A;  5T5F A;  3AA7 A;  5H2F O;  3HOE A;  2KXP A;  3C5O A;  3BS0 A;  3QRA A;  4FMS A;  3DA3 A;  3HOL A;  3PRN A;  4LSF A;  1ZHT A;  4CTD A;  1HXT A;  3DZM A;  5D5D A;  3SYS A;  3WU2 O;  4F4B A;  5E79 O;  2R88 A;  3LK2 B;  1ZHX A;  5ADX L;  3LK4 2;  4AFK A;  1BH3 A;  4O3W A;  2Y0L A;  6PRN A;  5GTH O;  3UAQ A;  3VY9 X;  3POU A;  1E54 A;  3POR A;  4FOZ A;  4IL6 O;  1ZHY A;  3FYX A;  4N74 A;  3PQS A;  4UB8 O;  2PRN A;  5B5E O;  3AAE A;  4RLB A;  3PQU A;  4C69 X;  2KDY A;  2R4L A;  3UU2 A;  1IZN A;  4GCS A;  4FSO A;  2XTR A;  5JDP A;  2F1T A;  2ODJ A;  4G75 A;  4O3X B;  2FGR A;  3A0H O;  4G76 A;  3LK4 1;  4JFB A;  4O4X A;  4O4U A;  5DL8 A;  1PHO A;  5B66 O;  4XNL A;  2R8A A;  1S5L O;  3PGR A;  4FRX A;  4KR8 A;  4N75 A;  4KRA A;  3JCU O;  4QQ1 A;  1T1L A;  3VZW X;  2XE2 A;  4O49 A;  2XE3 A;  5DL7 A;  5TIS O;  3PF1 A;  2WJR A;  4LSE A;  5G3A A;  4K3C A;  3WI5 A;  5IYU A;  1ORM A;  1GFN A;  4U9C A;  1OPF A;  2POR A;  2R4O A;  3AA0 B;  3LK2 A;  2N2M A;  2AXT O;  2W81 C;  4RLC A;  3VZT X;  2FGQ X;  1HXX A;  2K4T A;  4LSH A;  4FZL A;  1P4T A;  2KZ7 B;  2X27 X;  2O4V A;  2KXP B;  4LSI A;  3DWN A;  4GF4 A;  4O3Z A;  2J4U P;  2XE5 A;  1MPF A;  2K0L A;  3KZI O;  5GTI O;  5AFU K;  3TZG A;  4UB6 O;  4FZN A;  5KAI O;  4RJW A;  3PGU A;  4FSP A;  3AA6 A;  4D65 A;  5G39 A;  4C00 A;  3BRZ A;  4FZM A;  3QRC A;  4GCP A;  2WJQ A;  3A2S X;  2ZLD A;  3AA1 A;  2ZFG A;  3POX A;  4FQE A;  1BXW A;  4PUX A;  2JMM A;  4D64 A;  5ADX K;  3G7G A;  4O3Y A;  3T20 A; 
#chains in the Genus database with same CATH homology
 3SZD A;  1Q9F A;  2YNK A;  4XNK A;  2MNH A;  5G26 A;  4AKR A;  4AYN A;  2Y0H A;  3VE1 A;  4Z3T A;  5AFU L;  2J1N A;  5FVN A;  1ZHZ A;  4AYI D;  3DA4 A;  4AKR B;  1QJP A;  2N2L A;  4RJX A;  3POQ A;  4FRT A;  2LHF A;  3EMN X;  4RL9 A;  3VZU X;  3T0S A;  3SY9 A;  2Y7S A;  1OSM A;  2QTK A;  4N59 A;  1QJ8 A;  5PRN A;  4BUM X;  1MM4 A;  2XG6 A;  3AAE B;  3AAA B;  2KZ7 A;  2GE4 A;  4KR4 A;  4AYM C;  2XTQ A;  3HWB A;  4AZL A;  8PRN A;  3SYB A;  4AYD C;  3HW9 A;  2KC0 A;  7PRN A;  3UPG A;  1PRN A;  1YS5 A;  1QJ9 A;  1ZHW A;  4AKM A;  4FES A;  1THQ A;  2Y0K A;  4E1S A;  2W80 C;  2YPV A;  3T24 A;  1GFP A;  3VY8 X;  4E1T A;  2XE1 A;  1Q9G A;  3O0E A;  3AA1 B;  3SY7 A;  1MM5 A;  3JTY A;  2ERV A;  4FT6 A;  3RBH A;  3WI4 A;  3GP6 A;  4D5U A;  1GFO A;  1IZN B;  4FUV A;  1G90 A;  4GCQ A;  1H6S 1;  2F1V A;  3K19 A;  3V8U A;  3AA7 B;  2OMF A;  3NSG A;  4AUI A;  4GHB A;  3LK3 B;  1GFM A;  1GFQ A;  2M07 A;  4B61 A;  1BT9 A;  2MHL A;  4JCH A;  3AA6 B;  5GV0 A;  4AYE C;  3KVD D;  4N58 A;  5DL6 A;  2LFU A;  3VE2 A;  1HXU A;  3AAA A;  3SZV A;  3LK3 A;  5DL5 A;  2Y2X A;  5EE2 A;  2M06 A;  3AA0 A;  2XMX A;  5T5F A;  3AA7 A;  3HOE A;  2KXP A;  3C5O A;  3QRA A;  4FMS A;  4LSF A;  3DA3 A;  3HOL A;  3PRN A;  1ZHT A;  1HXT A;  5D5D A;  3SYS A;  4F4B A;  3LK2 B;  1ZHX A;  5ADX L;  3LK4 2;  4AFK A;  1BH3 A;  4O3W A;  2Y0L A;  6PRN A;  3UAQ A;  3VY9 X;  3POU A;  1E54 A;  3POR A;  4FOZ A;  1ZHY A;  3FYX A;  3PQS A;  2PRN A;  3AAE A;  4RLB A;  3PQU A;  4C69 X;  2KDY A;  3UU2 A;  1IZN A;  4GCS A;  4FSO A;  2XTR A;  5JDP A;  2F1T A;  2ODJ A;  4G75 A;  4O3X B;  2FGR A;  4JFB A;  4G76 A;  3LK4 1;  4O4X A;  4O4U A;  5DL8 A;  1PHO A;  4XNL A;  4FRX A;  4KR8 A;  4QQ1 A;  4KRA A;  3VZW X;  2XE2 A;  4O49 A;  2XE3 A;  5DL7 A;  4LSE A;  3WI5 A;  5IYU A;  1ORM A;  1GFN A;  4U9C A;  1OPF A;  2POR A;  3AA0 B;  3LK2 A;  2N2M A;  2W81 C;  4RLC A;  3VZT X;  2FGQ X;  1HXX A;  2K4T A;  4LSH A;  4FZL A;  1P4T A;  2KZ7 B;  2X27 X;  2O4V A;  2KXP B;  4LSI A;  4GF4 A;  4O3Z A;  2J4U P;  2XE5 A;  1MPF A;  2K0L A;  5AFU K;  3TZG A;  4FZN A;  4RJW A;  4FSP A;  3AA6 A;  4D65 A;  4FZM A;  3QRC A;  4GCP A;  3POX A;  3A2S X;  2ZLD A;  3AA1 A;  2ZFG A;  4PUX A;  4D64 A;  1BXW A;  2JMM A;  5ADX K;  3G7G A;  4O3Y A;  3T20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...