2F1TA

Outer membrane protein ompw
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
191
structure length
183
Chain Sequence
EAGEFFMRAGSATVRPTEGGGFSVTNNTQLGLTFTYMATDNIGVELLAATPFRHKIGTRATGDIATVHHLPPTLMAQWYFGDASSKFRPYVGAGINYTTFFDNGFNDHGKEAGLSDLSLKDSWGAAGQVGVDYLINRDWLVNMSVWYMDIDTTANYKLGGAQQHDSVRLDPWVFMFSAGYRFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The outer membrane protein OmpW forms an eight-stranded beta-barrel with a hydrophobic channel.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Membrane protein
molecule keywords Outer membrane protein W
total genus 45
structure length 183
sequence length 191
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03922 OmpW OmpW family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2f1tA00
1QJ9A 2K0LA 2GE4A 1QJPA 1ORMA 2LHFA 1MM5A 2ERVA 1Q9GA 2MHLA 2M07A 1MM4A 1P4TA 2F1TA 3G7GA 3QRCA 2F1VA 1THQA 2JMMA 3GP6A 2X27X 4PUXA 1QJ8A 1G90A 3C5OA 2M06A 2N2LA 2N2MA 1BXWA 3QRAA 2MNHA 4RLCA 1Q9FA
chains in the Genus database with same CATH superfamily
2K0LA 3AAEA 3A0BO 1IZNB 4E1TA 4KR8A 5AFUL 1IZNA 3DWOX 3LK42 4JFBA 4JCHA 4U9CA 3SY9A 4AKRA 4Z3TA 5GV0A 2LHFA 1PRNA 2XE2A 3SYBA 3K19A 1BH3A 5B5EO 4O3ZA 5ADXL 4FSOA 4K3BA 4KR4A 4O49A 3T24A 4N74A 1HXXA 3G7GA 3QRCA 4FZNA 5D5DA 3PF1A 3VZTX 3PORA 4O4UA 1HXTA 2XE1A 3HW9A 1OSMA 4GCQA 4AYID 2QTKA 5GTIO 4D5UA 2Y0LA 3SZVA 2J1NA 3FYXA 4RJWA 3DWNA 3VY8X 3LK3A 4FT6A 4AZLA 5JDPA 1BXWA 1GFNA 4BUMX 2ODJA 5TISO 5H2FO 3VE2A 4D64A 3HOEA 3POUA 3QRAA 2MNHA 1H6S1 2XMXA 3AA1B 4FZLA 4LSHA 2R4NA 4XNLA 5G39A 3POQA 2W80C 4PR7A 3KVDD 2GE4A 2PORA 4C69X 1MPFA 3PGRA 3RBHA 2ZLDA 1ZHXA 3LK41 5T5FA 3JCUO 2K4TA 3BRYA 2LFUA 2OMFA 2M07A 1HXUA 1P4TA 3T0SA 1GFPA 1GFMA 1OPFA 3POXA 2XTQA 2KZ7A 2WVPA 5AFUK 2F1VA 3VZUX 1GFOA 2JMMA 3GP6A 4G75A 2IWVA 4GCSA 4O3YA 4AKMA 5PRNA 3HOLA 2W81C 4AFKA 2R89A 3DZMA 3C5OA 3NSGA 3VY9X 5KAIO 2FGRA 2Y7SA 4G76A 3UU2A 2KZ7B 2R4PA 2Y0KA 4K3CA 4AYMC 2KDYA 2X9KA 5G26A 4PJ0O 3LK2A 4LSEA 4B61A 4RLCA 2FGQX 2JQYA 3EMNX 4RLBA 4FRTA 3PRNA 3WU2O 1E54A 4RL9A 1ZHZA 4RJXA 3HWBA 3JTYA 3WI5A 2J4UP 1Q9GA 3DA3A 5G38A 4FMSA 2PRNA 4FRXA 5DL8A 4N75A 3VZWX 5GTHO 3VE1A 3BRZA 4LSFA 3T20A 4O3XB 1THQA 2XE3A 2O4VA 3A2SX 3AA0A 4C00A 4O4XA 3AA7A 4GHBA 4IL6O 4C4VA 5KAFO 5DL5A 3UPGA 3AA6A 8PRNA 1GFQA 3AA1A 2KXPA 3AAAA 2N2LA 4D65A 2ZFGA 2R4OA 1PHOA 1T1LA 2XTRA 2Y0HA 3SYSA 3V8UA 2Y2XA 5B66O 1T16A 3O0EA 3TZGA 2R8AA 1MM4A 2WJQA 4FESA 4UB6O 2AXTO 1QJ9A 2KC0A 2YPVA 4XNKA 4AYDC 3PGUA 5IYUA 5DL6A 4AKRB 1QJPA 4QQ1A 1ORMA 4FUVA 2IWWA 3PQSA 1ZHWA 5E79O 1MM5A 4AYNA 2R88A 3AAEB 2ERVA 2XE5A 3AA0B 2MHLA 5FVNA 5G3AA 1S5LO 4E1SA 4GCPA 2F1TA 4N59A 3BS0A 3PQUA 4UB8O 4FZMA 5EE2A 3AA6B 3WI4A 4CTDA 3A0HO 2X27X 3KZIO 4PUXA 3AA7B 4GF4A 4C4VB 2WJRA 4AUIA 4LSIA 1QJ8A 7PRNA 4O3WA 1G90A 3SY7A 3UAQA 2M06A 4AYEC 6PRNA 2N2MA 2YNKA 1BT9A 1YS5A 2R4LA 1ZHTA 3LK2B 4FOZA 4N58A 5DL7A 3SZDA 3DA4A 2XG6A 3NJTA 4F4BA 2F1CX 3PGSA 1ZHYA 2KXPB 3AAAB 4FQEA 4FSPA 5ADXK 4KRAA 1Q9FA 3LK3B
chains in the Genus database with same CATH topology
2K0LA 3AAEA 1IZNB 4E1TA 4KR8A 5AFUL 1IZNA 3LK42 4JFBA 4JCHA 4U9CA 3SY9A 4AKRA 4Z3TA 5GV0A 2LHFA 1PRNA 2XE2A 3SYBA 3K19A 1BH3A 4O3ZA 5ADXL 4FSOA 4KR4A 4O49A 3T24A 5D5DA 1HXXA 3G7GA 3QRCA 4FZNA 3VZTX 3PORA 4O4UA 1HXTA 2XE1A 3HW9A 1OSMA 4GCQA 4AYID 2QTKA 4D5UA 2Y0LA 3SZVA 2J1NA 3FYXA 4RJWA 3VY8X 3LK3A 4FT6A 4AZLA 5JDPA 1BXWA 1GFNA 4BUMX 2ODJA 3VE2A 4D64A 3HOEA 3POUA 3QRAA 2MNHA 1H6S1 2XMXA 3AA1B 4FZLA 4LSHA 4XNLA 3WI5A 3POQA 2W80C 3KVDD 2GE4A 2PORA 4C69X 1MPFA 3RBHA 2ZLDA 1ZHXA 3LK41 5T5FA 2K4TA 2LFUA 2OMFA 2M07A 1HXUA 1P4TA 3T0SA 1GFPA 1GFMA 1OPFA 3POXA 2XTQA 2KZ7A 5AFUK 2F1VA 3VZUX 1GFOA 2JMMA 3GP6A 4G75A 4GCSA 4O3YA 4AKMA 5PRNA 3HOLA 2W81C 4AFKA 3C5OA 3NSGA 3VY9X 2FGRA 2Y7SA 4G76A 3UU2A 2KZ7B 4AYMC 2Y0KA 2KDYA 5G26A 3LK2A 4LSEA 4B61A 4RLCA 2FGQX 3EMNX 4RLBA 4FRTA 3PRNA 1E54A 4RL9A 1ZHZA 4RJXA 3HWBA 3JTYA 2J4UP 1Q9GA 3DA3A 4FMSA 2PRNA 4FRXA 5DL8A 3VZWX 3VE1A 4LSFA 3T20A 4O3XB 1THQA 2XE3A 2O4VA 3A2SX 3AA0A 4O4XA 3AA7A 4GHBA 5DL5A 3UPGA 3AA6A 8PRNA 1GFQA 3AA1A 2KXPA 3AAAA 2N2LA 4D65A 2ZFGA 1PHOA 2XTRA 2Y0HA 3SYSA 3V8UA 2Y2XA 3O0EA 3TZGA 1MM4A 4FESA 1QJ9A 2KC0A 2YPVA 4XNKA 4AYDC 5IYUA 5DL6A 4AKRB 1QJPA 4QQ1A 1ORMA 4FUVA 3PQSA 1ZHWA 1MM5A 4AYNA 3AAEB 3AA0B 2ERVA 2XE5A 5FVNA 2MHLA 4E1SA 4GCPA 2F1TA 4N59A 3PQUA 5EE2A 4FZMA 3AA6B 3WI4A 2X27X 4PUXA 3AA7B 4GF4A 4AUIA 4LSIA 1QJ8A 7PRNA 4O3WA 1G90A 3SY7A 3UAQA 2M06A 4AYEC 6PRNA 2N2MA 2YNKA 1BT9A 1YS5A 3LK2B 1ZHTA 4FOZA 4N58A 5DL7A 3SZDA 4F4BA 3DA4A 2XG6A 1ZHYA 2KXPB 3AAAB 4FSPA 5ADXK 4KRAA 1Q9FA 3LK3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QJ9 A;  2K0L A;  2GE4 A;  1QJP A;  1ORM A;  2LHF A;  1MM5 A;  2ERV A;  1Q9G A;  2MHL A;  2M07 A;  1MM4 A;  1P4T A;  2F1T A;  3G7G A;  3QRC A;  2F1V A;  1THQ A;  2JMM A;  3GP6 A;  2X27 X;  4PUX A;  1QJ8 A;  1G90 A;  3C5O A;  2M06 A;  2N2L A;  2N2M A;  1BXW A;  3QRA A;  2MNH A;  4RLC A;  1Q9F A; 
#chains in the Genus database with same CATH topology
 2K0L A;  3AAE A;  3A0B O;  1IZN B;  4E1T A;  4KR8 A;  5AFU L;  1IZN A;  3DWO X;  3LK4 2;  4JFB A;  4JCH A;  4U9C A;  3SY9 A;  4AKR A;  4Z3T A;  5GV0 A;  2LHF A;  1PRN A;  2XE2 A;  3SYB A;  3K19 A;  1BH3 A;  5B5E O;  4O3Z A;  5ADX L;  4FSO A;  4K3B A;  4KR4 A;  4O49 A;  3T24 A;  4N74 A;  1HXX A;  3G7G A;  3QRC A;  4FZN A;  5D5D A;  3PF1 A;  3VZT X;  3POR A;  4O4U A;  1HXT A;  2XE1 A;  3HW9 A;  1OSM A;  4GCQ A;  4AYI D;  2QTK A;  5GTI O;  4D5U A;  2Y0L A;  3SZV A;  2J1N A;  3FYX A;  4RJW A;  3DWN A;  3VY8 X;  3LK3 A;  4FT6 A;  4AZL A;  5JDP A;  1BXW A;  1GFN A;  4BUM X;  2ODJ A;  5TIS O;  5H2F O;  3VE2 A;  4D64 A;  3HOE A;  3POU A;  3QRA A;  2MNH A;  1H6S 1;  2XMX A;  3AA1 B;  4FZL A;  4LSH A;  2R4N A;  4XNL A;  5G39 A;  3POQ A;  2W80 C;  4PR7 A;  3KVD D;  2GE4 A;  2POR A;  4C69 X;  1MPF A;  3PGR A;  3RBH A;  2ZLD A;  1ZHX A;  3LK4 1;  5T5F A;  3JCU O;  2K4T A;  3BRY A;  2LFU A;  2OMF A;  2M07 A;  1HXU A;  1P4T A;  3T0S A;  1GFP A;  1GFM A;  1OPF A;  3POX A;  2XTQ A;  2KZ7 A;  2WVP A;  5AFU K;  2F1V A;  3VZU X;  1GFO A;  2JMM A;  3GP6 A;  4G75 A;  2IWV A;  4GCS A;  4O3Y A;  4AKM A;  5PRN A;  3HOL A;  2W81 C;  4AFK A;  2R89 A;  3DZM A;  3C5O A;  3NSG A;  3VY9 X;  5KAI O;  2FGR A;  2Y7S A;  4G76 A;  3UU2 A;  2KZ7 B;  2R4P A;  2Y0K A;  4K3C A;  4AYM C;  2KDY A;  2X9K A;  5G26 A;  4PJ0 O;  3LK2 A;  4LSE A;  4B61 A;  4RLC A;  2FGQ X;  2JQY A;  3EMN X;  4RLB A;  4FRT A;  3PRN A;  3WU2 O;  1E54 A;  4RL9 A;  1ZHZ A;  4RJX A;  3HWB A;  3JTY A;  3WI5 A;  2J4U P;  1Q9G A;  3DA3 A;  5G38 A;  4FMS A;  2PRN A;  4FRX A;  5DL8 A;  4N75 A;  3VZW X;  5GTH O;  3VE1 A;  3BRZ A;  4LSF A;  3T20 A;  4O3X B;  1THQ A;  2XE3 A;  2O4V A;  3A2S X;  3AA0 A;  4C00 A;  4O4X A;  3AA7 A;  4GHB A;  4IL6 O;  4C4V A;  5KAF O;  5DL5 A;  3UPG A;  3AA6 A;  8PRN A;  1GFQ A;  3AA1 A;  2KXP A;  3AAA A;  2N2L A;  4D65 A;  2ZFG A;  2R4O A;  1PHO A;  1T1L A;  2XTR A;  2Y0H A;  3SYS A;  3V8U A;  2Y2X A;  5B66 O;  1T16 A;  3O0E A;  3TZG A;  2R8A A;  1MM4 A;  2WJQ A;  4FES A;  4UB6 O;  2AXT O;  1QJ9 A;  2KC0 A;  2YPV A;  4XNK A;  4AYD C;  3PGU A;  5IYU A;  5DL6 A;  4AKR B;  1QJP A;  4QQ1 A;  1ORM A;  4FUV A;  2IWW A;  3PQS A;  1ZHW A;  5E79 O;  1MM5 A;  4AYN A;  2R88 A;  3AAE B;  2ERV A;  2XE5 A;  3AA0 B;  2MHL A;  5FVN A;  5G3A A;  1S5L O;  4E1S A;  4GCP A;  2F1T A;  4N59 A;  3BS0 A;  3PQU A;  4UB8 O;  4FZM A;  5EE2 A;  3AA6 B;  3WI4 A;  4CTD A;  3A0H O;  2X27 X;  3KZI O;  4PUX A;  3AA7 B;  4GF4 A;  4C4V B;  2WJR A;  4AUI A;  4LSI A;  1QJ8 A;  7PRN A;  4O3W A;  1G90 A;  3SY7 A;  3UAQ A;  2M06 A;  4AYE C;  6PRN A;  2N2M A;  2YNK A;  1BT9 A;  1YS5 A;  2R4L A;  1ZHT A;  3LK2 B;  4FOZ A;  4N58 A;  5DL7 A;  3SZD A;  3DA4 A;  2XG6 A;  3NJT A;  4F4B A;  2F1C X;  3PGS A;  1ZHY A;  2KXP B;  3AAA B;  4FQE A;  4FSP A;  5ADX K;  4KRA A;  1Q9F A;  3LK3 B; 
#chains in the Genus database with same CATH homology
 2K0L A;  3AAE A;  1IZN B;  4E1T A;  4KR8 A;  5AFU L;  1IZN A;  3LK4 2;  4JFB A;  4JCH A;  4U9C A;  3SY9 A;  4AKR A;  4Z3T A;  5GV0 A;  2LHF A;  1PRN A;  2XE2 A;  3SYB A;  3K19 A;  1BH3 A;  4O3Z A;  5ADX L;  4FSO A;  4KR4 A;  4O49 A;  3T24 A;  5D5D A;  1HXX A;  3G7G A;  3QRC A;  4FZN A;  3VZT X;  3POR A;  4O4U A;  1HXT A;  2XE1 A;  3HW9 A;  1OSM A;  4GCQ A;  4AYI D;  2QTK A;  4D5U A;  2Y0L A;  3SZV A;  2J1N A;  3FYX A;  4RJW A;  3VY8 X;  3LK3 A;  4FT6 A;  4AZL A;  5JDP A;  1BXW A;  1GFN A;  4BUM X;  2ODJ A;  3VE2 A;  4D64 A;  3HOE A;  3POU A;  3QRA A;  2MNH A;  1H6S 1;  2XMX A;  3AA1 B;  4FZL A;  4LSH A;  4XNL A;  3WI5 A;  3POQ A;  2W80 C;  3KVD D;  2GE4 A;  2POR A;  4C69 X;  1MPF A;  3RBH A;  2ZLD A;  1ZHX A;  3LK4 1;  5T5F A;  2K4T A;  2LFU A;  2OMF A;  2M07 A;  1HXU A;  1P4T A;  3T0S A;  1GFP A;  1GFM A;  1OPF A;  3POX A;  2XTQ A;  2KZ7 A;  5AFU K;  2F1V A;  3VZU X;  1GFO A;  2JMM A;  3GP6 A;  4G75 A;  4GCS A;  4O3Y A;  4AKM A;  5PRN A;  3HOL A;  2W81 C;  4AFK A;  3C5O A;  3NSG A;  3VY9 X;  2FGR A;  2Y7S A;  4G76 A;  3UU2 A;  2KZ7 B;  4AYM C;  2Y0K A;  2KDY A;  5G26 A;  3LK2 A;  4LSE A;  4B61 A;  4RLC A;  2FGQ X;  3EMN X;  4RLB A;  4FRT A;  3PRN A;  1E54 A;  4RL9 A;  1ZHZ A;  4RJX A;  3HWB A;  3JTY A;  2J4U P;  1Q9G A;  3DA3 A;  4FMS A;  2PRN A;  4FRX A;  5DL8 A;  3VZW X;  3VE1 A;  4LSF A;  3T20 A;  4O3X B;  1THQ A;  2XE3 A;  2O4V A;  3A2S X;  3AA0 A;  4O4X A;  3AA7 A;  4GHB A;  5DL5 A;  3UPG A;  3AA6 A;  8PRN A;  1GFQ A;  3AA1 A;  2KXP A;  3AAA A;  2N2L A;  4D65 A;  2ZFG A;  1PHO A;  2XTR A;  2Y0H A;  3SYS A;  3V8U A;  2Y2X A;  3O0E A;  3TZG A;  1MM4 A;  4FES A;  1QJ9 A;  2KC0 A;  2YPV A;  4XNK A;  4AYD C;  5IYU A;  5DL6 A;  4AKR B;  1QJP A;  4QQ1 A;  1ORM A;  4FUV A;  3PQS A;  1ZHW A;  1MM5 A;  4AYN A;  3AAE B;  3AA0 B;  2ERV A;  2XE5 A;  5FVN A;  2MHL A;  4E1S A;  4GCP A;  2F1T A;  4N59 A;  3PQU A;  5EE2 A;  4FZM A;  3AA6 B;  3WI4 A;  2X27 X;  4PUX A;  3AA7 B;  4GF4 A;  4AUI A;  4LSI A;  1QJ8 A;  7PRN A;  4O3W A;  1G90 A;  3SY7 A;  3UAQ A;  2M06 A;  4AYE C;  6PRN A;  2N2M A;  2YNK A;  1BT9 A;  1YS5 A;  3LK2 B;  1ZHT A;  4FOZ A;  4N58 A;  5DL7 A;  3SZD A;  4F4B A;  3DA4 A;  2XG6 A;  1ZHY A;  2KXP B;  3AAA B;  4FSP A;  5ADX K;  4KRA A;  1Q9F A;  3LK3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...