2F1TA

Outer membrane protein ompw
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
191
structure length
183
Chain Sequence
EAGEFFMRAGSATVRPTEGGGFSVTNNTQLGLTFTYMATDNIGVELLAATPFRHKIGTRATGDIATVHHLPPTLMAQWYFGDASSKFRPYVGAGINYTTFFDNGFNDHGKEAGLSDLSLKDSWGAAGQVGVDYLINRDWLVNMSVWYMDIDTTANYKLGGAQQHDSVRLDPWVFMFSAGYRFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein W
publication title The outer membrane protein OmpW forms an eight-stranded beta-barrel with a hydrophobic channel.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Membrane protein
total genus 45
structure length 183
sequence length 191
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03922 OmpW OmpW family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2f1tA00
1Q9FA 3QRCA 3C5OA 1QJ8A 2K0LA 2ERVA 1G90A 2X27X 1QJ9A 2GE4A 1ORMA 3G7GA 2F1VA 2MNHA 2LHFA 2MHLA 1MM4A 1THQA 2M06A 1BXWA 3QRAA 1MM5A 4RLCA 1QJPA 1P4TA 2M07A 2N2MA 2JMMA 2F1TA 4PUXA 1Q9GA 2N2LA 3GP6A
chains in the Genus database with same CATH superfamily
5E79O 2FGQX 1Q9FA 4O4XA 5GTHO 4O4UA 2KDYA 1ZHXA 5ADXL 1IZNB 3AA0A 3AA6A 4AZLA 2IWWA 4O3ZA 4LSEA 2XG6A 3SYSA 1QJ9A 4FOZA 1ZHTA 3WI4A 4K3BA 2LFUA 3PGSA 4JCHA 3SYBA 3AAEA 4FRTA 3A0BO 4N74A 5G3AA 1HXTA 2O4VA 3HW9A 4FUVA 3AA6B 2F1VA 4Z3TA 5JDPA 1GFNA 1ZHZA 3PGUA 4GHBA 4AKRA 4GF4A 4GCSA 4IL6O 4FQEA 5D5DA 1BXWA 1BH3A 1HXUA 4C4VA 3AAEB 4CTDA 3LK42 1PHOA 2PORA 3BS0A 4RLCA 4KR4A 1PRNA 2XE5A 4UB6O 5DL5A 3VE2A 3PF1A 4GCQA 5G39A 4N58A 4AYDC 5AFUK 4AKRB 3UPGA 3PRNA 2M07A 2XMXA 1GFMA 4C4VB 4PR7A 3AAAA 4E1SA 3AA7A 2XTRA 1T16A 3KZIO 1HXXA 4FZMA 1Q9GA 5KAIO 3SY7A 3GP6A 3UU2A 1GFOA 3WU2O 4FESA 5GV0A 5T5FA 3DWOX 5ADXK 3A0HO 3DWNA 1QJ8A 2AXTO 4RJXA 3VZUX 5B5EO 1G90A 3DZMA 3AA1A 5EE2A 8PRNA 2YPVA 3AAAB 3AA7B 3EMNX 4FSOA 4LSHA 2R4LA 2R88A 1OPFA 1ORMA 4FMSA 4G76A 2FGRA 3AA0B 3AA1B 4FZLA 5TISO 2KXPA 2W80C 1THQA 2XE2A 3VZWX 4AFKA 4B61A 2R89A 3KVDD 2JQYA 4N75A 5H2FO 3HWBA 1QJPA 3K19A 2R4NA 3PQUA 5DL7A 2R4PA 3LK41 3BRYA 4K3CA 2F1CX 1P4TA 2KXPB 4RLBA 4XNKA 4G75A 3T0SA 2R8AA 3POUA 4KR8A 4AYID 3DA4A 2N2MA 2R4OA 2N2LA 2XE1A 2OMFA 5G38A 3WI5A 2Y0KA 4LSFA 4FZNA 1BT9A 2GE4A 2PRNA 2XE3A 3NJTA 3VE1A 4E1TA 1S5LO 2MNHA 2LHFA 3TZGA 2KC0A 2KZ7A 4N59A 2WJRA 1H6S1 3SZVA 4LSIA 2WVPA 4O3YA 1MM5A 1E54A 2K4TA 2QTKA 3BRZA 4JFBA 4PJ0O 3UAQA 4KRAA 4FRXA 1GFQA 5GTIO 3V8UA 5IYUA 4FSPA 5PRNA 3RBHA 3HOLA 2XTQA 2ZFGA 4RJWA 2JMMA 7PRNA 3T24A 4BUMX 4GCPA 4O3WA 3SY9A 6PRNA 4QQ1A 5DL8A 3QRCA 4D65A 1ZHWA 3T20A 3C5OA 3SZDA 5B66O 2IWVA 2Y0HA 2K0LA 2ERVA 4FT6A 4AYEC 3JCUO 3LK3A 4O3XB 2J4UP 4AYNA 3PORA 1YS5A 3A2SX 2X27X 4UB8O 1ZHYA 3PGRA 3O0EA 4RL9A 2WJQA 2J1NA 3NSGA 5DL6A 3VZTX 4XNLA 3FYXA 3G7GA 3HOEA 2Y7SA 3POQA 3LK3B 3VY8X 3LK2A 3VY9X 4AUIA 2MHLA 5FVNA 3DA3A 1MM4A 4U9CA 4C00A 4F4BA 2M06A 4D64A 3QRAA 3PQSA 4C69X 2X9KA 5KAFO 4AKMA 4D5UA 5AFUL 1GFPA 2ODJA 4AYMC 2YNKA 5G26A 3LK2B 3JTYA 1IZNA 1T1LA 2KZ7B 2Y2XA 1MPFA 3POXA 2F1TA 4O49A 4PUXA 2Y0LA 2W81C 2ZLDA 1OSMA
chains in the Genus database with same CATH topology
2FGQX 1Q9FA 4O4XA 4O4UA 2KDYA 1ZHXA 5ADXL 1IZNB 3AA0A 3AA6A 4AZLA 4O3ZA 4LSEA 2XG6A 3SYSA 1QJ9A 4FOZA 1ZHTA 3WI4A 2LFUA 4JCHA 3SYBA 3AAEA 4FRTA 1HXTA 2O4VA 3HW9A 4FUVA 3AA6B 2F1VA 4Z3TA 5JDPA 1GFNA 1ZHZA 4GHBA 4AKRA 4GF4A 4GCSA 5D5DA 1BXWA 1BH3A 1HXUA 3AAEB 3LK42 1PHOA 2PORA 3VE2A 4RLCA 4KR4A 1PRNA 2XE5A 5DL5A 5AFUK 4AYDC 4GCQA 4N58A 4AKRB 3UPGA 3PRNA 2M07A 2XMXA 1GFMA 4E1SA 3AAAA 3AA7A 4FZMA 4AYEC 3SY7A 1HXXA 1Q9GA 3UU2A 3GP6A 1GFOA 4FESA 5GV0A 5T5FA 5ADXK 1QJ8A 4RJXA 3VZUX 1G90A 3AA1A 5EE2A 8PRNA 2YPVA 3AAAB 3AA7B 3EMNX 4FSOA 4LSHA 4FMSA 1OPFA 1ORMA 4G76A 2FGRA 3AA0B 3AA1B 4FZLA 2KXPA 2W80C 1THQA 2XE2A 3VZWX 4AFKA 4B61A 3KVDD 3HWBA 1QJPA 3K19A 3PQUA 5DL7A 3LK41 4RLBA 1P4TA 2KXPB 4XNKA 4G75A 3T0SA 3POUA 4KR8A 4AYID 3DA4A 2N2MA 2N2LA 2XE1A 2OMFA 2Y0KA 4LSFA 4FZNA 1BT9A 2GE4A 2PRNA 2XE3A 3VE1A 4E1TA 2MNHA 2LHFA 3TZGA 2KC0A 2KZ7A 4N59A 1H6S1 3SZVA 4LSIA 4O3YA 3WI5A 1MM5A 1E54A 2K4TA 2QTKA 2W81C 4JFBA 3UAQA 3V8UA 4KRAA 4FRXA 1GFQA 5IYUA 4FSPA 5PRNA 3RBHA 3HOLA 2XTQA 2ZFGA 4RJWA 2JMMA 7PRNA 3T24A 4BUMX 4GCPA 4O3WA 3SY9A 6PRNA 4QQ1A 5DL8A 3QRCA 4D65A 1ZHWA 3T20A 3C5OA 3SZDA 2Y0HA 2K0LA 2ERVA 4FT6A 2J4UP 3LK3A 4O3XB 4AYNA 3PORA 1YS5A 3A2SX 2X27X 1ZHYA 3O0EA 4RL9A 3NSGA 2J1NA 5DL6A 3VZTX 4XNLA 3FYXA 3G7GA 3HOEA 2Y7SA 3POQA 3LK3B 3VY8X 3LK2A 3VY9X 4AUIA 2MHLA 5FVNA 3DA3A 1MM4A 4U9CA 4F4BA 2M06A 4D64A 3QRAA 3PQSA 4C69X 4AKMA 4D5UA 5AFUL 1GFPA 2ODJA 4AYMC 2YNKA 5G26A 3LK2B 3JTYA 1IZNA 2KZ7B 2Y2XA 1MPFA 3POXA 2F1TA 4O49A 4PUXA 2Y0LA 2XTRA 2ZLDA 1OSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9F A;  3QRC A;  3C5O A;  1QJ8 A;  2K0L A;  2ERV A;  1G90 A;  2X27 X;  1QJ9 A;  2GE4 A;  1ORM A;  3G7G A;  2F1V A;  2MNH A;  2LHF A;  2MHL A;  1MM4 A;  1THQ A;  2M06 A;  1BXW A;  3QRA A;  1MM5 A;  4RLC A;  1QJP A;  1P4T A;  2M07 A;  2N2M A;  2JMM A;  2F1T A;  4PUX A;  1Q9G A;  2N2L A;  3GP6 A; 
#chains in the Genus database with same CATH topology
 5E79 O;  2FGQ X;  1Q9F A;  4O4X A;  5GTH O;  4O4U A;  2KDY A;  1ZHX A;  5ADX L;  1IZN B;  3AA0 A;  3AA6 A;  4AZL A;  2IWW A;  4O3Z A;  4LSE A;  2XG6 A;  3SYS A;  1QJ9 A;  4FOZ A;  1ZHT A;  3WI4 A;  4K3B A;  2LFU A;  3PGS A;  4JCH A;  3SYB A;  3AAE A;  4FRT A;  3A0B O;  4N74 A;  5G3A A;  1HXT A;  2O4V A;  3HW9 A;  4FUV A;  3AA6 B;  2F1V A;  4Z3T A;  5JDP A;  1GFN A;  1ZHZ A;  3PGU A;  4GHB A;  4AKR A;  4GF4 A;  4GCS A;  4IL6 O;  4FQE A;  5D5D A;  1BXW A;  1BH3 A;  1HXU A;  4C4V A;  3AAE B;  4CTD A;  3LK4 2;  1PHO A;  2POR A;  3BS0 A;  4RLC A;  4KR4 A;  1PRN A;  2XE5 A;  4UB6 O;  5DL5 A;  3VE2 A;  3PF1 A;  4GCQ A;  5G39 A;  4N58 A;  4AYD C;  5AFU K;  4AKR B;  3UPG A;  3PRN A;  2M07 A;  2XMX A;  1GFM A;  4C4V B;  4PR7 A;  3AAA A;  4E1S A;  3AA7 A;  2XTR A;  1T16 A;  3KZI O;  1HXX A;  4FZM A;  1Q9G A;  5KAI O;  3SY7 A;  3GP6 A;  3UU2 A;  1GFO A;  3WU2 O;  4FES A;  5GV0 A;  5T5F A;  3DWO X;  5ADX K;  3A0H O;  3DWN A;  1QJ8 A;  2AXT O;  4RJX A;  3VZU X;  5B5E O;  1G90 A;  3DZM A;  3AA1 A;  5EE2 A;  8PRN A;  2YPV A;  3AAA B;  3AA7 B;  3EMN X;  4FSO A;  4LSH A;  2R4L A;  2R88 A;  1OPF A;  1ORM A;  4FMS A;  4G76 A;  2FGR A;  3AA0 B;  3AA1 B;  4FZL A;  5TIS O;  2KXP A;  2W80 C;  1THQ A;  2XE2 A;  3VZW X;  4AFK A;  4B61 A;  2R89 A;  3KVD D;  2JQY A;  4N75 A;  5H2F O;  3HWB A;  1QJP A;  3K19 A;  2R4N A;  3PQU A;  5DL7 A;  2R4P A;  3LK4 1;  3BRY A;  4K3C A;  2F1C X;  1P4T A;  2KXP B;  4RLB A;  4XNK A;  4G75 A;  3T0S A;  2R8A A;  3POU A;  4KR8 A;  4AYI D;  3DA4 A;  2N2M A;  2R4O A;  2N2L A;  2XE1 A;  2OMF A;  5G38 A;  3WI5 A;  2Y0K A;  4LSF A;  4FZN A;  1BT9 A;  2GE4 A;  2PRN A;  2XE3 A;  3NJT A;  3VE1 A;  4E1T A;  1S5L O;  2MNH A;  2LHF A;  3TZG A;  2KC0 A;  2KZ7 A;  4N59 A;  2WJR A;  1H6S 1;  3SZV A;  4LSI A;  2WVP A;  4O3Y A;  1MM5 A;  1E54 A;  2K4T A;  2QTK A;  3BRZ A;  4JFB A;  4PJ0 O;  3UAQ A;  4KRA A;  4FRX A;  1GFQ A;  5GTI O;  3V8U A;  5IYU A;  4FSP A;  5PRN A;  3RBH A;  3HOL A;  2XTQ A;  2ZFG A;  4RJW A;  2JMM A;  7PRN A;  3T24 A;  4BUM X;  4GCP A;  4O3W A;  3SY9 A;  6PRN A;  4QQ1 A;  5DL8 A;  3QRC A;  4D65 A;  1ZHW A;  3T20 A;  3C5O A;  3SZD A;  5B66 O;  2IWV A;  2Y0H A;  2K0L A;  2ERV A;  4FT6 A;  4AYE C;  3JCU O;  3LK3 A;  4O3X B;  2J4U P;  4AYN A;  3POR A;  1YS5 A;  3A2S X;  2X27 X;  4UB8 O;  1ZHY A;  3PGR A;  3O0E A;  4RL9 A;  2WJQ A;  2J1N A;  3NSG A;  5DL6 A;  3VZT X;  4XNL A;  3FYX A;  3G7G A;  3HOE A;  2Y7S A;  3POQ A;  3LK3 B;  3VY8 X;  3LK2 A;  3VY9 X;  4AUI A;  2MHL A;  5FVN A;  3DA3 A;  1MM4 A;  4U9C A;  4C00 A;  4F4B A;  2M06 A;  4D64 A;  3QRA A;  3PQS A;  4C69 X;  2X9K A;  5KAF O;  4AKM A;  4D5U A;  5AFU L;  1GFP A;  2ODJ A;  4AYM C;  2YNK A;  5G26 A;  3LK2 B;  3JTY A;  1IZN A;  1T1L A;  2KZ7 B;  2Y2X A;  1MPF A;  3POX A;  2F1T A;  4O49 A;  4PUX A;  2Y0L A;  2W81 C;  2ZLD A;  1OSM A; 
#chains in the Genus database with same CATH homology
 2FGQ X;  1Q9F A;  4O4X A;  4O4U A;  2KDY A;  1ZHX A;  5ADX L;  1IZN B;  3AA0 A;  3AA6 A;  4AZL A;  4O3Z A;  4LSE A;  2XG6 A;  3SYS A;  1QJ9 A;  4FOZ A;  1ZHT A;  3WI4 A;  2LFU A;  4JCH A;  3SYB A;  3AAE A;  4FRT A;  1HXT A;  2O4V A;  3HW9 A;  4FUV A;  3AA6 B;  2F1V A;  4Z3T A;  5JDP A;  1GFN A;  1ZHZ A;  4GHB A;  4AKR A;  4GF4 A;  4GCS A;  5D5D A;  1BXW A;  1BH3 A;  1HXU A;  3AAE B;  3LK4 2;  1PHO A;  2POR A;  3VE2 A;  4RLC A;  4KR4 A;  1PRN A;  2XE5 A;  5DL5 A;  5AFU K;  4AYD C;  4GCQ A;  4N58 A;  4AKR B;  3UPG A;  3PRN A;  2M07 A;  2XMX A;  1GFM A;  4E1S A;  3AAA A;  3AA7 A;  4FZM A;  4AYE C;  3SY7 A;  1HXX A;  1Q9G A;  3UU2 A;  3GP6 A;  1GFO A;  4FES A;  5GV0 A;  5T5F A;  5ADX K;  1QJ8 A;  4RJX A;  3VZU X;  1G90 A;  3AA1 A;  5EE2 A;  8PRN A;  2YPV A;  3AAA B;  3AA7 B;  3EMN X;  4FSO A;  4LSH A;  4FMS A;  1OPF A;  1ORM A;  4G76 A;  2FGR A;  3AA0 B;  3AA1 B;  4FZL A;  2KXP A;  2W80 C;  1THQ A;  2XE2 A;  3VZW X;  4AFK A;  4B61 A;  3KVD D;  3HWB A;  1QJP A;  3K19 A;  3PQU A;  5DL7 A;  3LK4 1;  4RLB A;  1P4T A;  2KXP B;  4XNK A;  4G75 A;  3T0S A;  3POU A;  4KR8 A;  4AYI D;  3DA4 A;  2N2M A;  2N2L A;  2XE1 A;  2OMF A;  2Y0K A;  4LSF A;  4FZN A;  1BT9 A;  2GE4 A;  2PRN A;  2XE3 A;  3VE1 A;  4E1T A;  2MNH A;  2LHF A;  3TZG A;  2KC0 A;  2KZ7 A;  4N59 A;  1H6S 1;  3SZV A;  4LSI A;  4O3Y A;  3WI5 A;  1MM5 A;  1E54 A;  2K4T A;  2QTK A;  2W81 C;  4JFB A;  3UAQ A;  3V8U A;  4KRA A;  4FRX A;  1GFQ A;  5IYU A;  4FSP A;  5PRN A;  3RBH A;  3HOL A;  2XTQ A;  2ZFG A;  4RJW A;  2JMM A;  7PRN A;  3T24 A;  4BUM X;  4GCP A;  4O3W A;  3SY9 A;  6PRN A;  4QQ1 A;  5DL8 A;  3QRC A;  4D65 A;  1ZHW A;  3T20 A;  3C5O A;  3SZD A;  2Y0H A;  2K0L A;  2ERV A;  4FT6 A;  2J4U P;  3LK3 A;  4O3X B;  4AYN A;  3POR A;  1YS5 A;  3A2S X;  2X27 X;  1ZHY A;  3O0E A;  4RL9 A;  3NSG A;  2J1N A;  5DL6 A;  3VZT X;  4XNL A;  3FYX A;  3G7G A;  3HOE A;  2Y7S A;  3POQ A;  3LK3 B;  3VY8 X;  3LK2 A;  3VY9 X;  4AUI A;  2MHL A;  5FVN A;  3DA3 A;  1MM4 A;  4U9C A;  4F4B A;  2M06 A;  4D64 A;  3QRA A;  3PQS A;  4C69 X;  4AKM A;  4D5U A;  5AFU L;  1GFP A;  2ODJ A;  4AYM C;  2YNK A;  5G26 A;  3LK2 B;  3JTY A;  1IZN A;  2KZ7 B;  2Y2X A;  1MPF A;  3POX A;  2F1T A;  4O49 A;  4PUX A;  2Y0L A;  2XTR A;  2ZLD A;  1OSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...