2F1TA

Outer membrane protein ompw
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
191
structure length
183
Chain Sequence
b'EAGEFFMRAGSATVRPTEGGGFSVTNNTQLGLTFTYMATDNIGVELLAATPFRHKIGTRATGDIATVHHLPPTLMAQWYFGDASSKFRPYVGAGINYTTFFDNGFNDHGKEAGLSDLSLKDSWGAAGQVGVDYLINRDWLVNMSVWYMDIDTTANYKLGGAQQHDSVRLDPWVFMFSAGYRFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein W
publication title The outer membrane protein OmpW forms an eight-stranded beta-barrel with a hydrophobic channel.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Membrane protein
total genus 45
structure length 183
sequence length 191
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03922 OmpW OmpW family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2f1tA00
1QJ9A 1QJ8A 2MHLA 1BXWA 2N2LA 2GE4A 2MNHA 1MM5A 2X27X 3GP6A 1QJPA 3QRCA 2K0LA 3C5OA 2M06A 2F1VA 1Q9GA 2F1TA 1Q9FA 4RLCA 2M07A 3G7GA 2JMMA 4PUXA 2LHFA 1MM4A 2ERVA 2N2MA 3QRAA 1THQA 1G90A 1ORMA 1P4TA
chains in the Genus database with same CATH superfamily
4FZLA 1T16A 4AYDC 5ADXK 3LK2B 3T24A 4GCPA 5ADXL 1QJ8A 2MHLA 2Y2XA 4O3XB 4AKRA 2QTKA 5JDPA 2PRNA 1HXTA 2K4TA 3SZDA 1OPFA 2XTQA 3AA0A 3GP6A 2FGQX 2X9KA 4N74A 5FVNA 2PORA 2WJRA 5H2FO 5IYUA 2F1TA 3NSGA 2R4OA 4K3CA 3DA4A 3WU2O 3AA1A 4D5UA 2XE1A 5B66O 2R4NA 2J1NA 3G7GA 5AFUK 1ZHWA 3LK3A 2JMMA 1ZHZA 2XTRA 4FZNA 4PUXA 4XNLA 5DL5A 3SY9A 3UAQA 4AYEC 5AFUL 4PR7A 4AFKA 2LFUA 4QQ1A 4O4XA 1THQA 1HXUA 3RBHA 1G90A 3DWOX 2O4VA 2R4LA 4C4VB 5B5EO 2OMFA 2Y0KA 3JTYA 4E1TA 4XNKA 3VE2A 2KZ7A 2XE5A 1HXXA 2KXPA 3PF1A 3UPGA 1H6S1 4O3WA 4N75A 2N2LA 2AXTO 2XMXA 2YNKA 3AA7A 5KAIO 3AAAB 2R8AA 3A0BO 4FOZA 3LK41 2X27X 3QRCA 2XG6A 4JFBA 3EMNX 3AAEA 3C5OA 2FGRA 5TISO 2WJQA 7PRNA 4JCHA 3PGRA 2Y0HA 3LK2A 8PRNA 4AUIA 5GTHO 5KAFO 4FRXA 1IZNB 4IL6O 2ZLDA 1GFOA 3O0EA 4O49A 3SY7A 5GV0A 3SZVA 5EE2A 1S5LO 3A2SX 3BS0A 3POUA 4N58A 4CTDA 1GFNA 6PRNA 3LK42 1BT9A 2ERVA 4F4BA 4O4UA 5DL6A 3T0SA 3VZUX 3BRZA 4KR8A 4G76A 5D5DA 5G26A 4FQEA 3UU2A 4AYMC 1E54A 3WI4A 1P4TA 4FRTA 5DL7A 4AYID 4B61A 1QJ9A 4GCQA 4FESA 3WI5A 4C00A 3NJTA 4D65A 3PGSA 3HW9A 3PQSA 3KVDD 2XE2A 1BXWA 2W81C 5E79O 3VY8X 2GE4A 2MNHA 3BRYA 1YS5A 4C4VA 1QJPA 4UB8O 2K0LA 3V8UA 2M06A 2XE3A 2IWWA 1MPFA 4LSFA 3TZGA 4K3BA 1Q9GA 4KR4A 4UB6O 3AA6B 3PORA 3DWNA 4G75A 1GFPA 2R4PA 4KRAA 1OSMA 4C69X 2KZ7B 3AAAA 4RLBA 3JCUO 5G38A 4O3ZA 5DL8A 4D64A 4AKRB 1BH3A 3QRAA 3VE1A 1GFQA 2R88A 4FT6A 1IZNA 1T1LA 2W80C 1ORMA 1ZHTA 3AAEB 2Y7SA 3AA0B 3DA3A 4FSPA 4GCSA 4LSHA 5PRNA 2KDYA 4RJWA 5G39A 1PRNA 3HWBA 1ZHXA 4O3YA 3POXA 1ZHYA 2YPVA 3FYXA 3AA1B 3A0HO 3SYBA 1PHOA 3T20A 4AYNA 3VZWX 2F1CX 3HOLA 1MM5A 3PQUA 3LK3B 4GF4A 4LSIA 3SYSA 2KC0A 3K19A 2Y0LA 3PGUA 2F1VA 4FZMA 5GTIO 5T5FA 4BUMX 2J4UP 1GFMA 1Q9FA 4GHBA 3DZMA 2ZFGA 4RLCA 4N59A 4AZLA 2M07A 4LSEA 2ODJA 3KZIO 4FMSA 3VZTX 1MM4A 2JQYA 2KXPB 2LHFA 2R89A 4PJ0O 4FSOA 4RJXA 4RL9A 4U9CA 2N2MA 4AKMA 3VY9X 4E1SA 4Z3TA 2WVPA 3AA7B 3AA6A 5G3AA 2IWVA 3HOEA 3PRNA 3POQA 4FUVA
chains in the Genus database with same CATH topology
4FZLA 4AYDC 5ADXK 3LK2B 3T24A 4GCPA 5ADXL 1QJ8A 2MHLA 2Y2XA 4O3XB 4AKRA 2QTKA 5JDPA 2PRNA 1HXTA 2K4TA 3SZDA 1OPFA 2XTQA 3AA0A 3GP6A 2FGQX 5FVNA 2PORA 5IYUA 2F1TA 3NSGA 4D5UA 3DA4A 3AA1A 2XE1A 2J1NA 3G7GA 5AFUK 1ZHWA 3LK3A 2JMMA 1ZHZA 2XTRA 4FZNA 4PUXA 4XNLA 5DL5A 3SY9A 3UAQA 4AYEC 5AFUL 4AFKA 2LFUA 4QQ1A 4O4XA 1THQA 1HXUA 3RBHA 1G90A 2O4VA 2OMFA 2Y0KA 3JTYA 4E1TA 4XNKA 3VE2A 2KZ7A 2XE5A 1HXXA 2KXPA 3UPGA 1H6S1 4O3WA 2N2LA 2XMXA 2YNKA 3AA7A 3AAAB 4FOZA 3LK41 2X27X 3QRCA 2XG6A 4JFBA 3EMNX 3AAEA 3C5OA 2FGRA 7PRNA 4JCHA 2Y0HA 3LK2A 8PRNA 4AUIA 4FRXA 1IZNB 2ZLDA 1GFOA 3O0EA 4O49A 3SY7A 5GV0A 3SZVA 5EE2A 3A2SX 4N58A 3POUA 1GFNA 6PRNA 3LK42 1BT9A 2ERVA 4F4BA 4O4UA 5DL6A 3T0SA 3VZUX 4KR8A 5D5DA 4G76A 5G26A 3UU2A 4AYMC 1E54A 3WI4A 1P4TA 4FRTA 5DL7A 4AYID 1QJ9A 4GCQA 4FESA 3WI5A 4D65A 3HW9A 3PQSA 3KVDD 2XE2A 1BXWA 2W81C 3VY8X 2GE4A 2MNHA 1YS5A 1QJPA 2K0LA 3V8UA 2M06A 2XE3A 1MPFA 4LSFA 1Q9GA 4KR4A 3AA6B 3PORA 4G75A 1GFPA 4KRAA 4C69X 1OSMA 2KZ7B 3AAAA 4RLBA 4O3ZA 5DL8A 4D64A 4AKRB 1BH3A 3QRAA 3VE1A 1GFQA 4FT6A 1IZNA 2W80C 4GCSA 1ORMA 1ZHTA 3AAEB 2Y7SA 3AA0B 3DA3A 4FSPA 3TZGA 4LSHA 5PRNA 2KDYA 4RJWA 1PRNA 3HWBA 1ZHXA 4O3YA 3POXA 1ZHYA 2YPVA 3FYXA 3AA1B 3SYBA 1PHOA 3T20A 4AYNA 3VZWX 3HOLA 1MM5A 3PQUA 3LK3B 4GF4A 4LSIA 3SYSA 2KC0A 3K19A 2Y0LA 2F1VA 4FZMA 5T5FA 2J4UP 4BUMX 1GFMA 1Q9FA 4GHBA 4RLCA 2ZFGA 4N59A 4AZLA 2M07A 4LSEA 2ODJA 4FMSA 3VZTX 1MM4A 2KXPB 2LHFA 4RJXA 4B61A 4AKMA 4FSOA 4U9CA 4RL9A 2N2MA 3VY9X 4E1SA 4Z3TA 3AA7B 3AA6A 3HOEA 3PRNA 3POQA 4FUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QJ9 A;  1QJ8 A;  2MHL A;  1BXW A;  2N2L A;  2GE4 A;  2MNH A;  1MM5 A;  2X27 X;  3GP6 A;  1QJP A;  3QRC A;  2K0L A;  3C5O A;  2M06 A;  2F1V A;  1Q9G A;  2F1T A;  1Q9F A;  4RLC A;  2M07 A;  3G7G A;  2JMM A;  4PUX A;  2LHF A;  1MM4 A;  2ERV A;  2N2M A;  3QRA A;  1THQ A;  1G90 A;  1ORM A;  1P4T A; 
#chains in the Genus database with same CATH topology
 4FZL A;  1T16 A;  4AYD C;  5ADX K;  3LK2 B;  3T24 A;  4GCP A;  5ADX L;  1QJ8 A;  2MHL A;  2Y2X A;  4O3X B;  4AKR A;  2QTK A;  5JDP A;  2PRN A;  1HXT A;  2K4T A;  3SZD A;  1OPF A;  2XTQ A;  3AA0 A;  3GP6 A;  2FGQ X;  2X9K A;  4N74 A;  5FVN A;  2POR A;  2WJR A;  5H2F O;  5IYU A;  2F1T A;  3NSG A;  2R4O A;  4K3C A;  3DA4 A;  3WU2 O;  3AA1 A;  4D5U A;  2XE1 A;  5B66 O;  2R4N A;  2J1N A;  3G7G A;  5AFU K;  1ZHW A;  3LK3 A;  2JMM A;  1ZHZ A;  2XTR A;  4FZN A;  4PUX A;  4XNL A;  5DL5 A;  3SY9 A;  3UAQ A;  4AYE C;  5AFU L;  4PR7 A;  4AFK A;  2LFU A;  4QQ1 A;  4O4X A;  1THQ A;  1HXU A;  3RBH A;  1G90 A;  3DWO X;  2O4V A;  2R4L A;  4C4V B;  5B5E O;  2OMF A;  2Y0K A;  3JTY A;  4E1T A;  4XNK A;  3VE2 A;  2KZ7 A;  2XE5 A;  1HXX A;  2KXP A;  3PF1 A;  3UPG A;  1H6S 1;  4O3W A;  4N75 A;  2N2L A;  2AXT O;  2XMX A;  2YNK A;  3AA7 A;  5KAI O;  3AAA B;  2R8A A;  3A0B O;  4FOZ A;  3LK4 1;  2X27 X;  3QRC A;  2XG6 A;  4JFB A;  3EMN X;  3AAE A;  3C5O A;  2FGR A;  5TIS O;  2WJQ A;  7PRN A;  4JCH A;  3PGR A;  2Y0H A;  3LK2 A;  8PRN A;  4AUI A;  5GTH O;  5KAF O;  4FRX A;  1IZN B;  4IL6 O;  2ZLD A;  1GFO A;  3O0E A;  4O49 A;  3SY7 A;  5GV0 A;  3SZV A;  5EE2 A;  1S5L O;  3A2S X;  3BS0 A;  3POU A;  4N58 A;  4CTD A;  1GFN A;  6PRN A;  3LK4 2;  1BT9 A;  2ERV A;  4F4B A;  4O4U A;  5DL6 A;  3T0S A;  3VZU X;  3BRZ A;  4KR8 A;  4G76 A;  5D5D A;  5G26 A;  4FQE A;  3UU2 A;  4AYM C;  1E54 A;  3WI4 A;  1P4T A;  4FRT A;  5DL7 A;  4AYI D;  4B61 A;  1QJ9 A;  4GCQ A;  4FES A;  3WI5 A;  4C00 A;  3NJT A;  4D65 A;  3PGS A;  3HW9 A;  3PQS A;  3KVD D;  2XE2 A;  1BXW A;  2W81 C;  5E79 O;  3VY8 X;  2GE4 A;  2MNH A;  3BRY A;  1YS5 A;  4C4V A;  1QJP A;  4UB8 O;  2K0L A;  3V8U A;  2M06 A;  2XE3 A;  2IWW A;  1MPF A;  4LSF A;  3TZG A;  4K3B A;  1Q9G A;  4KR4 A;  4UB6 O;  3AA6 B;  3POR A;  3DWN A;  4G75 A;  1GFP A;  2R4P A;  4KRA A;  1OSM A;  4C69 X;  2KZ7 B;  3AAA A;  4RLB A;  3JCU O;  5G38 A;  4O3Z A;  5DL8 A;  4D64 A;  4AKR B;  1BH3 A;  3QRA A;  3VE1 A;  1GFQ A;  2R88 A;  4FT6 A;  1IZN A;  1T1L A;  2W80 C;  1ORM A;  1ZHT A;  3AAE B;  2Y7S A;  3AA0 B;  3DA3 A;  4FSP A;  4GCS A;  4LSH A;  5PRN A;  2KDY A;  4RJW A;  5G39 A;  1PRN A;  3HWB A;  1ZHX A;  4O3Y A;  3POX A;  1ZHY A;  2YPV A;  3FYX A;  3AA1 B;  3A0H O;  3SYB A;  1PHO A;  3T20 A;  4AYN A;  3VZW X;  2F1C X;  3HOL A;  1MM5 A;  3PQU A;  3LK3 B;  4GF4 A;  4LSI A;  3SYS A;  2KC0 A;  3K19 A;  2Y0L A;  3PGU A;  2F1V A;  4FZM A;  5GTI O;  5T5F A;  4BUM X;  2J4U P;  1GFM A;  1Q9F A;  4GHB A;  3DZM A;  2ZFG A;  4RLC A;  4N59 A;  4AZL A;  2M07 A;  4LSE A;  2ODJ A;  3KZI O;  4FMS A;  3VZT X;  1MM4 A;  2JQY A;  2KXP B;  2LHF A;  2R89 A;  4PJ0 O;  4FSO A;  4RJX A;  4RL9 A;  4U9C A;  2N2M A;  4AKM A;  3VY9 X;  4E1S A;  4Z3T A;  2WVP A;  3AA7 B;  3AA6 A;  5G3A A;  2IWV A;  3HOE A;  3PRN A;  3POQ A;  4FUV A; 
#chains in the Genus database with same CATH homology
 4FZL A;  4AYD C;  5ADX K;  3LK2 B;  3T24 A;  4GCP A;  5ADX L;  1QJ8 A;  2MHL A;  2Y2X A;  4O3X B;  4AKR A;  2QTK A;  5JDP A;  2PRN A;  1HXT A;  2K4T A;  3SZD A;  1OPF A;  2XTQ A;  3AA0 A;  3GP6 A;  2FGQ X;  5FVN A;  2POR A;  5IYU A;  2F1T A;  3NSG A;  4D5U A;  3DA4 A;  3AA1 A;  2XE1 A;  2J1N A;  3G7G A;  5AFU K;  1ZHW A;  3LK3 A;  2JMM A;  1ZHZ A;  2XTR A;  4FZN A;  4PUX A;  4XNL A;  5DL5 A;  3SY9 A;  3UAQ A;  4AYE C;  5AFU L;  4AFK A;  2LFU A;  4QQ1 A;  4O4X A;  1THQ A;  1HXU A;  3RBH A;  1G90 A;  2O4V A;  2OMF A;  2Y0K A;  3JTY A;  4E1T A;  4XNK A;  3VE2 A;  2KZ7 A;  2XE5 A;  1HXX A;  2KXP A;  3UPG A;  1H6S 1;  4O3W A;  2N2L A;  2XMX A;  2YNK A;  3AA7 A;  3AAA B;  4FOZ A;  3LK4 1;  2X27 X;  3QRC A;  2XG6 A;  4JFB A;  3EMN X;  3AAE A;  3C5O A;  2FGR A;  7PRN A;  4JCH A;  2Y0H A;  3LK2 A;  8PRN A;  4AUI A;  4FRX A;  1IZN B;  2ZLD A;  1GFO A;  3O0E A;  4O49 A;  3SY7 A;  5GV0 A;  3SZV A;  5EE2 A;  3A2S X;  4N58 A;  3POU A;  1GFN A;  6PRN A;  3LK4 2;  1BT9 A;  2ERV A;  4F4B A;  4O4U A;  5DL6 A;  3T0S A;  3VZU X;  4KR8 A;  5D5D A;  4G76 A;  5G26 A;  3UU2 A;  4AYM C;  1E54 A;  3WI4 A;  1P4T A;  4FRT A;  5DL7 A;  4AYI D;  1QJ9 A;  4GCQ A;  4FES A;  3WI5 A;  4D65 A;  3HW9 A;  3PQS A;  3KVD D;  2XE2 A;  1BXW A;  2W81 C;  3VY8 X;  2GE4 A;  2MNH A;  1YS5 A;  1QJP A;  2K0L A;  3V8U A;  2M06 A;  2XE3 A;  1MPF A;  4LSF A;  1Q9G A;  4KR4 A;  3AA6 B;  3POR A;  4G75 A;  1GFP A;  4KRA A;  4C69 X;  1OSM A;  2KZ7 B;  3AAA A;  4RLB A;  4O3Z A;  5DL8 A;  4D64 A;  4AKR B;  1BH3 A;  3QRA A;  3VE1 A;  1GFQ A;  4FT6 A;  1IZN A;  2W80 C;  4GCS A;  1ORM A;  1ZHT A;  3AAE B;  2Y7S A;  3AA0 B;  3DA3 A;  4FSP A;  3TZG A;  4LSH A;  5PRN A;  2KDY A;  4RJW A;  1PRN A;  3HWB A;  1ZHX A;  4O3Y A;  3POX A;  1ZHY A;  2YPV A;  3FYX A;  3AA1 B;  3SYB A;  1PHO A;  3T20 A;  4AYN A;  3VZW X;  3HOL A;  1MM5 A;  3PQU A;  3LK3 B;  4GF4 A;  4LSI A;  3SYS A;  2KC0 A;  3K19 A;  2Y0L A;  2F1V A;  4FZM A;  5T5F A;  2J4U P;  4BUM X;  1GFM A;  1Q9F A;  4GHB A;  4RLC A;  2ZFG A;  4N59 A;  4AZL A;  2M07 A;  4LSE A;  2ODJ A;  4FMS A;  3VZT X;  1MM4 A;  2KXP B;  2LHF A;  4RJX A;  4B61 A;  4AKM A;  4FSO A;  4U9C A;  4RL9 A;  2N2M A;  3VY9 X;  4E1S A;  4Z3T A;  3AA7 B;  3AA6 A;  3HOE A;  3PRN A;  3POQ A;  4FUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...