2F1TA

Outer membrane protein ompw
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
191
structure length
183
Chain Sequence
EAGEFFMRAGSATVRPTEGGGFSVTNNTQLGLTFTYMATDNIGVELLAATPFRHKIGTRATGDIATVHHLPPTLMAQWYFGDASSKFRPYVGAGINYTTFFDNGFNDHGKEAGLSDLSLKDSWGAAGQVGVDYLINRDWLVNMSVWYMDIDTTANYKLGGAQQHDSVRLDPWVFMFSAGYRFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The outer membrane protein OmpW forms an eight-stranded beta-barrel with a hydrophobic channel.
pubmed doi rcsb
molecule keywords Outer membrane protein W
molecule tags Membrane protein
source organism Escherichia coli k12
total genus 45
structure length 183
sequence length 191
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03922 OmpW OmpW family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2f1tA00
2N2MA 1ORMA 2X27X 2F1VA 1MM5A 2F1TA 1Q9GA 1MM4A 2N2LA 2GE4A 2LHFA 2MHLA 1BXWA 2JMMA 3QRAA 1THQA 1Q9FA 1QJ8A 1QJ9A 4PUXA 2M07A 2MNHA 1P4TA 1QJPA 2K0LA 4RLCA 1G90A 2ERVA 3G7GA 3QRCA 2M06A 3GP6A 3C5OA
chains in the Genus database with same CATH superfamily
2N2MA 4O49A 1GFMA 3POXA 1MM5A 3AA0B 4E1TA 2R4OA 4FSPA 5G38A 4K3BA 2R88A 1PHOA 4LSIA 4PJ0O 3WI5A 4O4UA 2QTKA 3POUA 3TZGA 1BXWA 2JMMA 3EMNX 1T16A 2XTRA 4N75A 4XNKA 5T5FA 1QJ9A 3HW9A 4GCSA 4RJXA 5JDPA 4PUXA 2M07A 4FZMA 4N59A 3SY9A 1P4TA 1QJPA 3UU2A 4AYMC 2LFUA 2K0LA 2YNKA 1S5LO 2XE2A 3POQA 2XTQA 5ADXL 3DWNA 2PRNA 4GCPA 4JFBA 1HXUA 5DL8A 3AA7B 3HOEA 3A2SX 1PRNA 2W81C 3AAEB 4UB8O 4AFKA 4O3XB 1IZNB 3BS0A 1GFQA 2R89A 3LK3B 7PRNA 3UPGA 2KDYA 4FRXA 4U9CA 2WJRA 4N74A 2XE5A 3BRYA 4RL9A 3PRNA 1MPFA 2N2LA 2GE4A 4PR7A 3T20A 4RJWA 2MHLA 1ZHZA 2YPVA 4AUIA 4C4VB 1GFOA 1BH3A 3QRAA 4GHBA 3JTYA 2Y7SA 5GTHO 3KVDD 3PQSA 5G3AA 3AA6B 3VZTX 4AYEC 5D5DA 3T24A 1ZHYA 4GF4A 1HXTA 2R4PA 3DA3A 5H2FO 4LSEA 3AAAB 3VY8X 2J4UP 4AYID 3LK2A 5B5EO 4FSOA 4RLCA 5EE2A 3WI4A 1G90A 2ERVA 4FZLA 2ZFGA 4AYNA 8PRNA 2R4LA 3FYXA 4O4XA 4FRTA 4AKRA 2X9KA 3BRZA 2ZLDA 3HOLA 5DL6A 2IWVA 4KR4A 3AA1A 2WJQA 3T0SA 4FT6A 3SZVA 2R4NA 1ORMA 1GFPA 2IWWA 4JCHA 4F4BA 4FQEA 2WVPA 4FZNA 4AZLA 3NJTA 2XE3A 2XE1A 3AA0A 4C69X 2FGRA 3UAQA 2KZ7A 2LHFA 4RLBA 3A0BO 3PQUA 1OSMA 2XMXA 4KRAA 1THQA 1Q9FA 1QJ8A 2K4TA 3DA4A 3SYBA 1T1LA 3VZWX 3SYSA 4CTDA 4FESA 2MNHA 2XG6A 1E54A 3DZMA 4B61A 1YS5A 3O0EA 3PGUA 3V8UA 4AKMA 5KAFO 3RBHA 1GFNA 2Y0KA 3G7GA 4LSHA 6PRNA 4FUVA 4E1SA 2PORA 5AFUK 1H6S1 2O4VA 5G39A 3VY9X 4UB6O 3AA7A 5AFUL 3AAEA 2W80C 3GP6A 5GTIO 3NSGA 1IZNA 3A0HO 3LK3A 4KR8A 2KXPA 5E79O 2KC0A 5TISO 5IYUA 2X27X 4G75A 2F1VA 2F1TA 3KZIO 3WU2O 1Q9GA 2KZ7B 1MM4A 5DL5A 2F1CX 3VE1A 5GV0A 3HWBA 4AYDC 1ZHWA 2Y2XA 3PGSA 4C00A 3LK42 1BT9A 4G76A 2R8AA 3K19A 4IL6O 3SZDA 2OMFA 3VE2A 1HXXA 3LK41 4BUMX 4D65A 4FMSA 5B66O 4N58A 4C4VA 4O3ZA 4O3WA 3JCUO 4O3YA 4QQ1A 2JQYA 2ODJA 5G26A 3AA6A 3LK2B 3PORA 4XNLA 5KAIO 5ADXK 4LSFA 5FVNA 4D5UA 5PRNA 4D64A 3AAAA 3DWOX 4K3CA 2Y0HA 5DL7A 3QRCA 4GCQA 3VZUX 4AKRB 4Z3TA 1OPFA 2AXTO 3AA1B 4FOZA 3SY7A 2KXPB 2J1NA 2FGQX 2M06A 3PGRA 1ZHTA 2Y0LA 3PF1A 1ZHXA 3C5OA
chains in the Genus database with same CATH topology
2N2MA 4O49A 1GFMA 3POXA 1MM5A 3AA0B 4E1TA 4FSPA 3WI5A 1PHOA 4LSIA 4O4UA 2QTKA 3POUA 3TZGA 1BXWA 2JMMA 3EMNX 2XTRA 4XNKA 5T5FA 1QJ9A 3HW9A 4GCSA 4RJXA 5JDPA 4PUXA 2M07A 4FZMA 4N59A 3SY9A 1P4TA 1QJPA 3UU2A 4AYMC 2LFUA 2K0LA 2YNKA 2XE2A 3POQA 2XTQA 5ADXL 2PRNA 4GCPA 4JFBA 1HXUA 5DL8A 3AA7B 3HOEA 3A2SX 1PRNA 2W81C 3AAEB 4AFKA 4O3XB 1IZNB 3LK3B 1GFQA 7PRNA 3UPGA 2KDYA 4U9CA 2XE5A 4RL9A 3PRNA 1MPFA 2N2LA 2GE4A 3T20A 4RJWA 2MHLA 1ZHZA 2YPVA 4AUIA 1GFOA 1BH3A 3QRAA 4GHBA 3JTYA 2Y7SA 3KVDD 3PQSA 3VZTX 3AA6B 4AYEC 5D5DA 3T24A 1ZHYA 4GF4A 1HXTA 3DA3A 4LSEA 3AAAB 3VY8X 2J4UP 4AYID 3LK2A 4FSOA 4RLCA 5EE2A 3WI4A 1G90A 2ERVA 4FZLA 2ZFGA 4AYNA 8PRNA 3FYXA 4O4XA 4FRTA 4AKRA 2ZLDA 3HOLA 5DL6A 4KR4A 3AA1A 3T0SA 4FT6A 3SZVA 1ORMA 1GFPA 4JCHA 4F4BA 4FZNA 4AZLA 2XE3A 2XE1A 3AA0A 4C69X 2FGRA 3UAQA 2KZ7A 2LHFA 4RLBA 3PQUA 1OSMA 2XMXA 4KRAA 1THQA 1Q9FA 1QJ8A 2K4TA 3DA4A 3SYBA 3VZWX 3SYSA 4FESA 2MNHA 2XG6A 1E54A 4B61A 1YS5A 3O0EA 3V8UA 4AKMA 3RBHA 1GFNA 2Y0KA 3G7GA 4LSHA 6PRNA 4FUVA 4E1SA 2PORA 5AFUK 1H6S1 2O4VA 3VY9X 5AFUL 3AA7A 3AAEA 2W80C 3GP6A 3NSGA 1IZNA 3LK3A 4KR8A 5IYUA 2KXPA 2KC0A 2X27X 4G75A 2F1VA 2F1TA 4BUMX 1Q9GA 2KZ7B 1MM4A 5DL5A 3VE1A 5GV0A 3HWBA 4AYDC 1ZHWA 2Y2XA 3LK42 1BT9A 4G76A 3K19A 3SZDA 3VE2A 2OMFA 4D65A 1HXXA 3LK41 4FMSA 4N58A 4O3ZA 4O3WA 4O3YA 4QQ1A 5G26A 2ODJA 3AA6A 3LK2B 3PORA 4XNLA 5ADXK 4LSFA 5FVNA 4D5UA 5PRNA 4D64A 3AAAA 2Y0HA 5DL7A 3QRCA 4GCQA 3VZUX 4AKRB 4Z3TA 1OPFA 3AA1B 4FOZA 3SY7A 2KXPB 2J1NA 2FGQX 2M06A 1ZHTA 2Y0LA 4FRXA 1ZHXA 3C5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N2M A;  1ORM A;  2X27 X;  2F1V A;  1MM5 A;  2F1T A;  1Q9G A;  1MM4 A;  2N2L A;  2GE4 A;  2LHF A;  2MHL A;  1BXW A;  2JMM A;  3QRA A;  1THQ A;  1Q9F A;  1QJ8 A;  1QJ9 A;  4PUX A;  2M07 A;  2MNH A;  1P4T A;  1QJP A;  2K0L A;  4RLC A;  1G90 A;  2ERV A;  3G7G A;  3QRC A;  2M06 A;  3GP6 A;  3C5O A; 
#chains in the Genus database with same CATH topology
 2N2M A;  4O49 A;  1GFM A;  3POX A;  1MM5 A;  3AA0 B;  4E1T A;  2R4O A;  4FSP A;  5G38 A;  4K3B A;  2R88 A;  1PHO A;  4LSI A;  4PJ0 O;  3WI5 A;  4O4U A;  2QTK A;  3POU A;  3TZG A;  1BXW A;  2JMM A;  3EMN X;  1T16 A;  2XTR A;  4N75 A;  4XNK A;  5T5F A;  1QJ9 A;  3HW9 A;  4GCS A;  4RJX A;  5JDP A;  4PUX A;  2M07 A;  4FZM A;  4N59 A;  3SY9 A;  1P4T A;  1QJP A;  3UU2 A;  4AYM C;  2LFU A;  2K0L A;  2YNK A;  1S5L O;  2XE2 A;  3POQ A;  2XTQ A;  5ADX L;  3DWN A;  2PRN A;  4GCP A;  4JFB A;  1HXU A;  5DL8 A;  3AA7 B;  3HOE A;  3A2S X;  1PRN A;  2W81 C;  3AAE B;  4UB8 O;  4AFK A;  4O3X B;  1IZN B;  3BS0 A;  1GFQ A;  2R89 A;  3LK3 B;  7PRN A;  3UPG A;  2KDY A;  4FRX A;  4U9C A;  2WJR A;  4N74 A;  2XE5 A;  3BRY A;  4RL9 A;  3PRN A;  1MPF A;  2N2L A;  2GE4 A;  4PR7 A;  3T20 A;  4RJW A;  2MHL A;  1ZHZ A;  2YPV A;  4AUI A;  4C4V B;  1GFO A;  1BH3 A;  3QRA A;  4GHB A;  3JTY A;  2Y7S A;  5GTH O;  3KVD D;  3PQS A;  5G3A A;  3AA6 B;  3VZT X;  4AYE C;  5D5D A;  3T24 A;  1ZHY A;  4GF4 A;  1HXT A;  2R4P A;  3DA3 A;  5H2F O;  4LSE A;  3AAA B;  3VY8 X;  2J4U P;  4AYI D;  3LK2 A;  5B5E O;  4FSO A;  4RLC A;  5EE2 A;  3WI4 A;  1G90 A;  2ERV A;  4FZL A;  2ZFG A;  4AYN A;  8PRN A;  2R4L A;  3FYX A;  4O4X A;  4FRT A;  4AKR A;  2X9K A;  3BRZ A;  2ZLD A;  3HOL A;  5DL6 A;  2IWV A;  4KR4 A;  3AA1 A;  2WJQ A;  3T0S A;  4FT6 A;  3SZV A;  2R4N A;  1ORM A;  1GFP A;  2IWW A;  4JCH A;  4F4B A;  4FQE A;  2WVP A;  4FZN A;  4AZL A;  3NJT A;  2XE3 A;  2XE1 A;  3AA0 A;  4C69 X;  2FGR A;  3UAQ A;  2KZ7 A;  2LHF A;  4RLB A;  3A0B O;  3PQU A;  1OSM A;  2XMX A;  4KRA A;  1THQ A;  1Q9F A;  1QJ8 A;  2K4T A;  3DA4 A;  3SYB A;  1T1L A;  3VZW X;  3SYS A;  4CTD A;  4FES A;  2MNH A;  2XG6 A;  1E54 A;  3DZM A;  4B61 A;  1YS5 A;  3O0E A;  3PGU A;  3V8U A;  4AKM A;  5KAF O;  3RBH A;  1GFN A;  2Y0K A;  3G7G A;  4LSH A;  6PRN A;  4FUV A;  4E1S A;  2POR A;  5AFU K;  1H6S 1;  2O4V A;  5G39 A;  3VY9 X;  4UB6 O;  3AA7 A;  5AFU L;  3AAE A;  2W80 C;  3GP6 A;  5GTI O;  3NSG A;  1IZN A;  3A0H O;  3LK3 A;  4KR8 A;  2KXP A;  5E79 O;  2KC0 A;  5TIS O;  5IYU A;  2X27 X;  4G75 A;  2F1V A;  2F1T A;  3KZI O;  3WU2 O;  1Q9G A;  2KZ7 B;  1MM4 A;  5DL5 A;  2F1C X;  3VE1 A;  5GV0 A;  3HWB A;  4AYD C;  1ZHW A;  2Y2X A;  3PGS A;  4C00 A;  3LK4 2;  1BT9 A;  4G76 A;  2R8A A;  3K19 A;  4IL6 O;  3SZD A;  2OMF A;  3VE2 A;  1HXX A;  3LK4 1;  4BUM X;  4D65 A;  4FMS A;  5B66 O;  4N58 A;  4C4V A;  4O3Z A;  4O3W A;  3JCU O;  4O3Y A;  4QQ1 A;  2JQY A;  2ODJ A;  5G26 A;  3AA6 A;  3LK2 B;  3POR A;  4XNL A;  5KAI O;  5ADX K;  4LSF A;  5FVN A;  4D5U A;  5PRN A;  4D64 A;  3AAA A;  3DWO X;  4K3C A;  2Y0H A;  5DL7 A;  3QRC A;  4GCQ A;  3VZU X;  4AKR B;  4Z3T A;  1OPF A;  2AXT O;  3AA1 B;  4FOZ A;  3SY7 A;  2KXP B;  2J1N A;  2FGQ X;  2M06 A;  3PGR A;  1ZHT A;  2Y0L A;  3PF1 A;  1ZHX A;  3C5O A; 
#chains in the Genus database with same CATH homology
 2N2M A;  4O49 A;  1GFM A;  3POX A;  1MM5 A;  3AA0 B;  4E1T A;  4FSP A;  3WI5 A;  1PHO A;  4LSI A;  4O4U A;  2QTK A;  3POU A;  3TZG A;  1BXW A;  2JMM A;  3EMN X;  2XTR A;  4XNK A;  5T5F A;  1QJ9 A;  3HW9 A;  4GCS A;  4RJX A;  5JDP A;  4PUX A;  2M07 A;  4FZM A;  4N59 A;  3SY9 A;  1P4T A;  1QJP A;  3UU2 A;  4AYM C;  2LFU A;  2K0L A;  2YNK A;  2XE2 A;  3POQ A;  2XTQ A;  5ADX L;  2PRN A;  4GCP A;  4JFB A;  1HXU A;  5DL8 A;  3AA7 B;  3HOE A;  3A2S X;  1PRN A;  2W81 C;  3AAE B;  4AFK A;  4O3X B;  1IZN B;  3LK3 B;  1GFQ A;  7PRN A;  3UPG A;  2KDY A;  4U9C A;  2XE5 A;  4RL9 A;  3PRN A;  1MPF A;  2N2L A;  2GE4 A;  3T20 A;  4RJW A;  2MHL A;  1ZHZ A;  2YPV A;  4AUI A;  1GFO A;  1BH3 A;  3QRA A;  4GHB A;  3JTY A;  2Y7S A;  3KVD D;  3PQS A;  3VZT X;  3AA6 B;  4AYE C;  5D5D A;  3T24 A;  1ZHY A;  4GF4 A;  1HXT A;  3DA3 A;  4LSE A;  3AAA B;  3VY8 X;  2J4U P;  4AYI D;  3LK2 A;  4FSO A;  4RLC A;  5EE2 A;  3WI4 A;  1G90 A;  2ERV A;  4FZL A;  2ZFG A;  4AYN A;  8PRN A;  3FYX A;  4O4X A;  4FRT A;  4AKR A;  2ZLD A;  3HOL A;  5DL6 A;  4KR4 A;  3AA1 A;  3T0S A;  4FT6 A;  3SZV A;  1ORM A;  1GFP A;  4JCH A;  4F4B A;  4FZN A;  4AZL A;  2XE3 A;  2XE1 A;  3AA0 A;  4C69 X;  2FGR A;  3UAQ A;  2KZ7 A;  2LHF A;  4RLB A;  3PQU A;  1OSM A;  2XMX A;  4KRA A;  1THQ A;  1Q9F A;  1QJ8 A;  2K4T A;  3DA4 A;  3SYB A;  3VZW X;  3SYS A;  4FES A;  2MNH A;  2XG6 A;  1E54 A;  4B61 A;  1YS5 A;  3O0E A;  3V8U A;  4AKM A;  3RBH A;  1GFN A;  2Y0K A;  3G7G A;  4LSH A;  6PRN A;  4FUV A;  4E1S A;  2POR A;  5AFU K;  1H6S 1;  2O4V A;  3VY9 X;  5AFU L;  3AA7 A;  3AAE A;  2W80 C;  3GP6 A;  3NSG A;  1IZN A;  3LK3 A;  4KR8 A;  5IYU A;  2KXP A;  2KC0 A;  2X27 X;  4G75 A;  2F1V A;  2F1T A;  4BUM X;  1Q9G A;  2KZ7 B;  1MM4 A;  5DL5 A;  3VE1 A;  5GV0 A;  3HWB A;  4AYD C;  1ZHW A;  2Y2X A;  3LK4 2;  1BT9 A;  4G76 A;  3K19 A;  3SZD A;  3VE2 A;  2OMF A;  4D65 A;  1HXX A;  3LK4 1;  4FMS A;  4N58 A;  4O3Z A;  4O3W A;  4O3Y A;  4QQ1 A;  5G26 A;  2ODJ A;  3AA6 A;  3LK2 B;  3POR A;  4XNL A;  5ADX K;  4LSF A;  5FVN A;  4D5U A;  5PRN A;  4D64 A;  3AAA A;  2Y0H A;  5DL7 A;  3QRC A;  4GCQ A;  3VZU X;  4AKR B;  4Z3T A;  1OPF A;  3AA1 B;  4FOZ A;  3SY7 A;  2KXP B;  2J1N A;  2FGQ X;  2M06 A;  1ZHT A;  2Y0L A;  4FRX A;  1ZHX A;  3C5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...