2F1VA

Outer membrane protein ompw
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
191
structure length
182
Chain Sequence
b'EAGEFFMRAGSATVRPTEGGFSVTNNTQLGLTFTYMATDNIGVELLAATPFRHKIGTRATGDIATVHHLPPTLMAQWYFGDASSKFRPYVGAGINYTTFFDNGFNDHGKEAGLSDLSLKDSWGAAGQVGVDYLINRDWLVNMSVWYMDIDTTANYKLGGAQQHDSVRLDPWVFMFSAGYRFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein W
publication title The outer membrane protein OmpW forms an eight-stranded beta-barrel with a hydrophobic channel.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Membrane protein
total genus 43
structure length 182
sequence length 191
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03922 OmpW OmpW family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2f1vA00
1ORMA 2N2MA 2GE4A 2LHFA 4RLCA 1BXWA 1THQA 1P4TA 1QJ8A 2M07A 4PUXA 2ERVA 2X27X 2F1TA 2MNHA 1G90A 2JMMA 2N2LA 3G7GA 3GP6A 1QJ9A 1MM4A 1MM5A 2MHLA 2M06A 1Q9FA 3C5OA 1QJPA 2K0LA 3QRAA 3QRCA 2F1VA 1Q9GA
chains in the Genus database with same CATH superfamily
4GCPA 3AAAB 5DL6A 2O4VA 3POUA 5DL5A 1ZHXA 3HOLA 5DL7A 3PORA 4C69X 2KXPA 1ZHZA 4LSEA 2Y7SA 3VY9X 4RL9A 5IYUA 4GCSA 1OPFA 1HXTA 2KZ7A 2PRNA 3T20A 4G75A 3POQA 4AKRB 3WI4A 8PRNA 3EMNX 1ZHWA 1P4TA 2K4TA 4PUXA 1IZNA 2ERVA 4O3YA 3KZIO 4C4VA 4FESA 4KRAA 2XMXA 3V8UA 4FSPA 3UAQA 2JMMA 4KR8A 3WI5A 3G7GA 5E79O 1MM5A 2XG6A 6PRNA 3AA6A 4F4BA 2M06A 5ADXK 2X9KA 1HXXA 2XTRA 1GFQA 2QTKA 3AA7B 3POXA 3AAEA 4UB6O 1YS5A 4CTDA 2R88A 5DL8A 4LSHA 5G39A 3HW9A 3QRAA 3QRCA 3VZTX 3PGSA 3VZUX 2J4UP 2N2MA 2WJRA 1BH3A 1MPFA 2KC0A 2Y2XA 2Y0LA 2ZFGA 2LHFA 4AFKA 4RJWA 2W81C 3BS0A 4RLCA 5EE2A 2XE5A 5ADXL 4O3XB 5B5EO 5PRNA 3LK42 4GCQA 1THQA 3T24A 2M07A 2R8AA 2XE3A 2Y0KA 4FSOA 4JFBA 1GFNA 4U9CA 3RBHA 4D64A 4D5UA 1OSMA 3HWBA 3O0EA 4UB8O 2F1TA 3VZWX 3VE1A 1G90A 2R4LA 4FQEA 3A0HO 3HOEA 5D5DA 5AFUK 2KDYA 3NSGA 3SZDA 3LK2B 5TISO 4BUMX 4IL6O 3LK3B 4FT6A 3DWNA 4RJXA 3PQUA 1GFOA 4O49A 3A0BO 4K3BA 2OMFA 1GFPA 1PHOA 2XE1A 3DZMA 2R4OA 2KXPB 2R4PA 2J1NA 2IWWA 3SZVA 1ORMA 2KZ7B 3SY7A 4AYDC 2JQYA 1GFMA 3PGUA 4GHBA 2GE4A 3AA1B 4E1SA 4JCHA 3AAAA 1IZNB 4G76A 4AYEC 3NJTA 3DA3A 4AYID 3SYSA 2YPVA 4FMSA 4FOZA 4LSIA 3VY8X 3UU2A 4AUIA 4AKRA 1BT9A 4AYMC 2FGRA 2MNHA 2XE2A 3AA6B 2FGQX 3KVDD 4N59A 2N2LA 3PRNA 5G26A 2LFUA 2IWVA 3AA0B 2AXTO 2MHLA 4O3ZA 1S5LO 4AYNA 1T1LA 3AAEB 4D65A 1Q9FA 5KAIO 5T5FA 3VE2A 4QQ1A 1HXUA 4C00A 4XNKA 2YNKA 4FRTA 4O4UA 5G38A 3FYXA 2XTQA 2F1CX 2K0LA 5GTHO 2PORA 1ZHTA 4PJ0O 4FZMA 4AKMA 3A2SX 4N75A 3AA7A 5AFUL 4O3WA 5GV0A 2ZLDA 4N58A 2WVPA 3JCUO 2R4NA 4FZNA 3PGRA 3UPGA 1BXWA 5FVNA 3BRZA 4RLBA 3AA1A 3PF1A 4C4VB 3JTYA 1PRNA 1QJ8A 4N74A 5KAFO 1H6S1 2W80C 2X27X 5H2FO 4AZLA 4FRXA 4PR7A 3PQSA 3T0SA 4FZLA 2ODJA 3LK41 4B61A 1ZHYA 4O4XA 5G3AA 3TZGA 3GP6A 3SYBA 1QJ9A 4FUVA 1MM4A 4KR4A 1E54A 5GTIO 5B66O 3DWOX 4E1TA 1T16A 3AA0A 3C5OA 3DA4A 4LSFA 3WU2O 7PRNA 3BRYA 3LK2A 4XNLA 2WJQA 2Y0HA 1QJPA 2R89A 3SY9A 5JDPA 4GF4A 3LK3A 3K19A 4Z3TA 2F1VA 4K3CA 1Q9GA
chains in the Genus database with same CATH topology
4GCPA 3AAAB 5DL6A 2O4VA 3POUA 5DL5A 1ZHXA 3HOLA 5DL7A 3PORA 4C69X 2KXPA 1ZHZA 4LSEA 2Y7SA 3VY9X 4RL9A 5IYUA 4GCSA 1OPFA 1HXTA 2KZ7A 2PRNA 3T20A 4G75A 3POQA 4AKRB 3WI4A 8PRNA 3EMNX 1ZHWA 1P4TA 2K4TA 4PUXA 1IZNA 2ERVA 4O3YA 4FESA 4KRAA 2XMXA 3V8UA 4FSPA 3UAQA 2JMMA 4KR8A 3G7GA 1MM5A 2XG6A 6PRNA 3AA6A 4F4BA 2M06A 5ADXK 1HXXA 2XTRA 1GFQA 2QTKA 3AA7B 3POXA 3AAEA 1YS5A 5DL8A 4LSHA 3HW9A 3QRAA 3QRCA 3VZTX 3VZUX 2J4UP 2N2MA 1BH3A 1MPFA 2KC0A 2Y2XA 2Y0LA 2ZFGA 2LHFA 4AFKA 4RJWA 2W81C 4RLCA 5EE2A 2XE5A 5ADXL 5PRNA 3LK42 4GCQA 1THQA 3T24A 2M07A 2XE3A 2Y0KA 4FSOA 4JFBA 4U9CA 1GFNA 3RBHA 4D64A 4D5UA 1OSMA 3HWBA 3O0EA 2F1TA 3VZWX 3VE1A 1G90A 3HOEA 5D5DA 2KDYA 3NSGA 3SZDA 3LK2B 4BUMX 3LK3B 4FT6A 4RJXA 3PQUA 1GFOA 4O49A 2OMFA 1GFPA 1PHOA 2XE1A 2KXPB 2J1NA 3SZVA 1ORMA 2KZ7B 3SY7A 4AYDC 4GHBA 1GFMA 2GE4A 3AA1B 4E1SA 4JCHA 3AAAA 1IZNB 4G76A 4AYEC 3DA3A 4AYID 3SYSA 2YPVA 4FMSA 4FOZA 4LSIA 3VY8X 3UU2A 4AUIA 4AKRA 1BT9A 4AYMC 2FGRA 2MNHA 2XE2A 3AA6B 2FGQX 3KVDD 4N59A 2N2LA 3PRNA 5G26A 2LFUA 3AA0B 2MHLA 4O3ZA 4AYNA 3AAEB 4D65A 1Q9FA 5T5FA 3VE2A 4QQ1A 1HXUA 4XNKA 2YNKA 4FRTA 4O4UA 3FYXA 2XTQA 2K0LA 2PORA 1ZHTA 4FZMA 4AKMA 3A2SX 5AFUL 3AA7A 4O3WA 5GV0A 2ZLDA 4N58A 4FZNA 3UPGA 1BXWA 5FVNA 4RLBA 3AA1A 3JTYA 1PRNA 1QJ8A 1H6S1 2W80C 2X27X 4AZLA 4FRXA 4B61A 3PQSA 3T0SA 4FZLA 2ODJA 3LK41 5AFUK 1ZHYA 4O4XA 3WI5A 3TZGA 3GP6A 3SYBA 1QJ9A 4FUVA 1MM4A 4KR4A 1E54A 4E1TA 3AA0A 3C5OA 3DA4A 4LSFA 7PRNA 3LK2A 4XNLA 2Y0HA 1QJPA 3SY9A 5JDPA 4GF4A 3LK3A 3K19A 4Z3TA 2F1VA 4O3XB 1Q9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORM A;  2N2M A;  2GE4 A;  2LHF A;  4RLC A;  1BXW A;  1THQ A;  1P4T A;  1QJ8 A;  2M07 A;  4PUX A;  2ERV A;  2X27 X;  2F1T A;  2MNH A;  1G90 A;  2JMM A;  2N2L A;  3G7G A;  3GP6 A;  1QJ9 A;  1MM4 A;  1MM5 A;  2MHL A;  2M06 A;  1Q9F A;  3C5O A;  1QJP A;  2K0L A;  3QRA A;  3QRC A;  2F1V A;  1Q9G A; 
#chains in the Genus database with same CATH topology
 4GCP A;  3AAA B;  5DL6 A;  2O4V A;  3POU A;  5DL5 A;  1ZHX A;  3HOL A;  5DL7 A;  3POR A;  4C69 X;  2KXP A;  1ZHZ A;  4LSE A;  2Y7S A;  3VY9 X;  4RL9 A;  5IYU A;  4GCS A;  1OPF A;  1HXT A;  2KZ7 A;  2PRN A;  3T20 A;  4G75 A;  3POQ A;  4AKR B;  3WI4 A;  8PRN A;  3EMN X;  1ZHW A;  1P4T A;  2K4T A;  4PUX A;  1IZN A;  2ERV A;  4O3Y A;  3KZI O;  4C4V A;  4FES A;  4KRA A;  2XMX A;  3V8U A;  4FSP A;  3UAQ A;  2JMM A;  4KR8 A;  3WI5 A;  3G7G A;  5E79 O;  1MM5 A;  2XG6 A;  6PRN A;  3AA6 A;  4F4B A;  2M06 A;  5ADX K;  2X9K A;  1HXX A;  2XTR A;  1GFQ A;  2QTK A;  3AA7 B;  3POX A;  3AAE A;  4UB6 O;  1YS5 A;  4CTD A;  2R88 A;  5DL8 A;  4LSH A;  5G39 A;  3HW9 A;  3QRA A;  3QRC A;  3VZT X;  3PGS A;  3VZU X;  2J4U P;  2N2M A;  2WJR A;  1BH3 A;  1MPF A;  2KC0 A;  2Y2X A;  2Y0L A;  2ZFG A;  2LHF A;  4AFK A;  4RJW A;  2W81 C;  3BS0 A;  4RLC A;  5EE2 A;  2XE5 A;  5ADX L;  4O3X B;  5B5E O;  5PRN A;  3LK4 2;  4GCQ A;  1THQ A;  3T24 A;  2M07 A;  2R8A A;  2XE3 A;  2Y0K A;  4FSO A;  4JFB A;  1GFN A;  4U9C A;  3RBH A;  4D64 A;  4D5U A;  1OSM A;  3HWB A;  3O0E A;  4UB8 O;  2F1T A;  3VZW X;  3VE1 A;  1G90 A;  2R4L A;  4FQE A;  3A0H O;  3HOE A;  5D5D A;  5AFU K;  2KDY A;  3NSG A;  3SZD A;  3LK2 B;  5TIS O;  4BUM X;  4IL6 O;  3LK3 B;  4FT6 A;  3DWN A;  4RJX A;  3PQU A;  1GFO A;  4O49 A;  3A0B O;  4K3B A;  2OMF A;  1GFP A;  1PHO A;  2XE1 A;  3DZM A;  2R4O A;  2KXP B;  2R4P A;  2J1N A;  2IWW A;  3SZV A;  1ORM A;  2KZ7 B;  3SY7 A;  4AYD C;  2JQY A;  1GFM A;  3PGU A;  4GHB A;  2GE4 A;  3AA1 B;  4E1S A;  4JCH A;  3AAA A;  1IZN B;  4G76 A;  4AYE C;  3NJT A;  3DA3 A;  4AYI D;  3SYS A;  2YPV A;  4FMS A;  4FOZ A;  4LSI A;  3VY8 X;  3UU2 A;  4AUI A;  4AKR A;  1BT9 A;  4AYM C;  2FGR A;  2MNH A;  2XE2 A;  3AA6 B;  2FGQ X;  3KVD D;  4N59 A;  2N2L A;  3PRN A;  5G26 A;  2LFU A;  2IWV A;  3AA0 B;  2AXT O;  2MHL A;  4O3Z A;  1S5L O;  4AYN A;  1T1L A;  3AAE B;  4D65 A;  1Q9F A;  5KAI O;  5T5F A;  3VE2 A;  4QQ1 A;  1HXU A;  4C00 A;  4XNK A;  2YNK A;  4FRT A;  4O4U A;  5G38 A;  3FYX A;  2XTQ A;  2F1C X;  2K0L A;  5GTH O;  2POR A;  1ZHT A;  4PJ0 O;  4FZM A;  4AKM A;  3A2S X;  4N75 A;  3AA7 A;  5AFU L;  4O3W A;  5GV0 A;  2ZLD A;  4N58 A;  2WVP A;  3JCU O;  2R4N A;  4FZN A;  3PGR A;  3UPG A;  1BXW A;  5FVN A;  3BRZ A;  4RLB A;  3AA1 A;  3PF1 A;  4C4V B;  3JTY A;  1PRN A;  1QJ8 A;  4N74 A;  5KAF O;  1H6S 1;  2W80 C;  2X27 X;  5H2F O;  4AZL A;  4FRX A;  4PR7 A;  3PQS A;  3T0S A;  4FZL A;  2ODJ A;  3LK4 1;  4B61 A;  1ZHY A;  4O4X A;  5G3A A;  3TZG A;  3GP6 A;  3SYB A;  1QJ9 A;  4FUV A;  1MM4 A;  4KR4 A;  1E54 A;  5GTI O;  5B66 O;  3DWO X;  4E1T A;  1T16 A;  3AA0 A;  3C5O A;  3DA4 A;  4LSF A;  3WU2 O;  7PRN A;  3BRY A;  3LK2 A;  4XNL A;  2WJQ A;  2Y0H A;  1QJP A;  2R89 A;  3SY9 A;  5JDP A;  4GF4 A;  3LK3 A;  3K19 A;  4Z3T A;  2F1V A;  4K3C A;  1Q9G A; 
#chains in the Genus database with same CATH homology
 4GCP A;  3AAA B;  5DL6 A;  2O4V A;  3POU A;  5DL5 A;  1ZHX A;  3HOL A;  5DL7 A;  3POR A;  4C69 X;  2KXP A;  1ZHZ A;  4LSE A;  2Y7S A;  3VY9 X;  4RL9 A;  5IYU A;  4GCS A;  1OPF A;  1HXT A;  2KZ7 A;  2PRN A;  3T20 A;  4G75 A;  3POQ A;  4AKR B;  3WI4 A;  8PRN A;  3EMN X;  1ZHW A;  1P4T A;  2K4T A;  4PUX A;  1IZN A;  2ERV A;  4O3Y A;  4FES A;  4KRA A;  2XMX A;  3V8U A;  4FSP A;  3UAQ A;  2JMM A;  4KR8 A;  3G7G A;  1MM5 A;  2XG6 A;  6PRN A;  3AA6 A;  4F4B A;  2M06 A;  5ADX K;  1HXX A;  2XTR A;  1GFQ A;  2QTK A;  3AA7 B;  3POX A;  3AAE A;  1YS5 A;  5DL8 A;  4LSH A;  3HW9 A;  3QRA A;  3QRC A;  3VZT X;  3VZU X;  2J4U P;  2N2M A;  1BH3 A;  1MPF A;  2KC0 A;  2Y2X A;  2Y0L A;  2ZFG A;  2LHF A;  4AFK A;  4RJW A;  2W81 C;  4RLC A;  5EE2 A;  2XE5 A;  5ADX L;  5PRN A;  3LK4 2;  4GCQ A;  1THQ A;  3T24 A;  2M07 A;  2XE3 A;  2Y0K A;  4FSO A;  4JFB A;  4U9C A;  1GFN A;  3RBH A;  4D64 A;  4D5U A;  1OSM A;  3HWB A;  3O0E A;  2F1T A;  3VZW X;  3VE1 A;  1G90 A;  3HOE A;  5D5D A;  2KDY A;  3NSG A;  3SZD A;  3LK2 B;  4BUM X;  3LK3 B;  4FT6 A;  4RJX A;  3PQU A;  1GFO A;  4O49 A;  2OMF A;  1GFP A;  1PHO A;  2XE1 A;  2KXP B;  2J1N A;  3SZV A;  1ORM A;  2KZ7 B;  3SY7 A;  4AYD C;  4GHB A;  1GFM A;  2GE4 A;  3AA1 B;  4E1S A;  4JCH A;  3AAA A;  1IZN B;  4G76 A;  4AYE C;  3DA3 A;  4AYI D;  3SYS A;  2YPV A;  4FMS A;  4FOZ A;  4LSI A;  3VY8 X;  3UU2 A;  4AUI A;  4AKR A;  1BT9 A;  4AYM C;  2FGR A;  2MNH A;  2XE2 A;  3AA6 B;  2FGQ X;  3KVD D;  4N59 A;  2N2L A;  3PRN A;  5G26 A;  2LFU A;  3AA0 B;  2MHL A;  4O3Z A;  4AYN A;  3AAE B;  4D65 A;  1Q9F A;  5T5F A;  3VE2 A;  4QQ1 A;  1HXU A;  4XNK A;  2YNK A;  4FRT A;  4O4U A;  3FYX A;  2XTQ A;  2K0L A;  2POR A;  1ZHT A;  4FZM A;  4AKM A;  3A2S X;  5AFU L;  3AA7 A;  4O3W A;  5GV0 A;  2ZLD A;  4N58 A;  4FZN A;  3UPG A;  1BXW A;  5FVN A;  4RLB A;  3AA1 A;  3JTY A;  1PRN A;  1QJ8 A;  1H6S 1;  2W80 C;  2X27 X;  4AZL A;  4FRX A;  4B61 A;  3PQS A;  3T0S A;  4FZL A;  2ODJ A;  3LK4 1;  5AFU K;  1ZHY A;  4O4X A;  3WI5 A;  3TZG A;  3GP6 A;  3SYB A;  1QJ9 A;  4FUV A;  1MM4 A;  4KR4 A;  1E54 A;  4E1T A;  3AA0 A;  3C5O A;  3DA4 A;  4LSF A;  7PRN A;  3LK2 A;  4XNL A;  2Y0H A;  1QJP A;  3SY9 A;  5JDP A;  4GF4 A;  3LK3 A;  3K19 A;  4Z3T A;  2F1V A;  4O3X B;  1Q9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...