2F1VA

Outer membrane protein ompw
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
191
structure length
182
Chain Sequence
EAGEFFMRAGSATVRPTEGGFSVTNNTQLGLTFTYMATDNIGVELLAATPFRHKIGTRATGDIATVHHLPPTLMAQWYFGDASSKFRPYVGAGINYTTFFDNGFNDHGKEAGLSDLSLKDSWGAAGQVGVDYLINRDWLVNMSVWYMDIDTTANYKLGGAQQHDSVRLDPWVFMFSAGYRFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein W
publication title The outer membrane protein OmpW forms an eight-stranded beta-barrel with a hydrophobic channel.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Membrane protein
total genus 43
structure length 182
sequence length 191
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03922 OmpW OmpW family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2f1vA00
1BXWA 1Q9GA 2ERVA 1ORMA 2F1TA 2K0LA 1P4TA 2GE4A 2LHFA 2M07A 1QJPA 2N2LA 3C5OA 1QJ9A 1Q9FA 4RLCA 1THQA 3QRAA 2N2MA 4PUXA 2MNHA 2JMMA 2X27X 1MM5A 2M06A 1MM4A 1G90A 3QRCA 3GP6A 2F1VA 3G7GA 1QJ8A 2MHLA
chains in the Genus database with same CATH superfamily
3LK2B 3VY9X 3SYSA 1ZHZA 4AKMA 1ZHYA 2IWVA 3PGUA 1HXTA 5AFUL 3T20A 3UPGA 4FSPA 3VZUX 3JCUO 3SYBA 4XNKA 1HXXA 5KAIO 3PQSA 5T5FA 2OMFA 2GE4A 2JQYA 3HOEA 2YPVA 3SZDA 4N74A 5IYUA 2WJRA 5DL6A 1QJPA 3HWBA 4LSEA 4FZLA 4PJ0O 3VE2A 4RJXA 3PGRA 3VY8X 4E1SA 3HW9A 2XMXA 4KR4A 4F4BA 4BUMX 3T0SA 2N2MA 4O3WA 4AYNA 2MNHA 3HOLA 2KZ7B 2KDYA 3FYXA 4C4VA 4G76A 8PRNA 2PORA 4FRXA 1MM5A 2LFUA 3SY9A 4C4VB 4D5UA 1MM4A 5GV0A 5FVNA 2W81C 2XTRA 3WI4A 4O4UA 4RL9A 5B5EO 3DA4A 3O0EA 2KC0A 2XE2A 3QRCA 4K3BA 3G7GA 3KVDD 3PRNA 4GF4A 4CTDA 1PRNA 2WJQA 1T1LA 2YNKA 3WI5A 3A0BO 4JCHA 2O4VA 2Y0KA 3WU2O 3POQA 2XE5A 1ORMA 2F1TA 1PHOA 4FSOA 3SZVA 1GFMA 5G39A 4FRTA 2LHFA 4UB8O 4GHBA 1QJ9A 2Y0HA 4FUVA 4AKRA 2J1NA 1Q9FA 3AA6A 3BRYA 3DZMA 4FESA 3NSGA 4RLCA 4UB6O 4B61A 2J4UP 4RLBA 2R4OA 2R4NA 5G26A 1GFOA 6PRNA 7PRNA 3PQUA 5ADXK 2X27X 2XE1A 3A0HO 3PGSA 4AUIA 3UAQA 4QQ1A 4IL6O 1E54A 4LSIA 4G75A 2AXTO 1BH3A 2MHLA 3BRZA 4XNLA 1BXWA 3LK42 3VE1A 4N75A 4U9CA 3AA1A 4FT6A 3AA0A 4FOZA 4C00A 1S5LO 2ZFGA 5D5DA 3AA1B 4AZLA 3DWOX 3AA0B 2K0LA 1P4TA 2WVPA 4FZMA 3DWNA 3RBHA 5DL8A 5B66O 5G3AA 4KRAA 2M07A 1MPFA 3C5OA 3LK3A 1GFQA 4FQEA 4N59A 1T16A 1ZHTA 5G38A 4FMSA 4D64A 5AFUK 4O3YA 1HXUA 3NJTA 3QRAA 1H6S1 3LK3B 3SY7A 3TZGA 2JMMA 2QTKA 4K3CA 4AKRB 4AYDC 1IZNA 5EE2A 3PF1A 1ZHXA 3AA6B 4O49A 2KXPA 5DL5A 3AA7A 4N58A 4O4XA 2M06A 3EMNX 5PRNA 4Z3TA 5GTHO 1OPFA 1IZNB 3PORA 3VZTX 3A2SX 4C69X 3AAAA 2R4LA 2KXPB 4LSHA 3K19A 4FZNA 1G90A 2PRNA 3GP6A 2F1VA 1BT9A 3AAEA 3BS0A 2F1CX 3AAAB 2XTQA 2R8AA 2R88A 3AAEB 1ZHWA 4GCPA 2XE3A 4O3ZA 1Q9GA 2ERVA 1GFNA 3POUA 3DA3A 3VZWX 5ADXL 3POXA 4AYMC 5KAFO 2X9KA 2N2LA 2KZ7A 4O3XB 5TISO 3UU2A 2Y0LA 1THQA 2ODJA 2W80C 3LK41 1OSMA 4PUXA 4D65A 2R89A 3KZIO 5H2FO 2FGRA 2ZLDA 4GCQA 5GTIO 4AYID 2IWWA 2FGQX 2Y7SA 4PR7A 3V8UA 4AFKA 4E1TA 3T24A 2XG6A 3JTYA 5DL7A 4AYEC 3LK2A 2K4TA 1GFPA 1YS5A 4GCSA 4JFBA 4KR8A 4LSFA 5E79O 3AA7B 5JDPA 2R4PA 4RJWA 2Y2XA 1QJ8A
chains in the Genus database with same CATH topology
3LK2B 3VY9X 3SYSA 1ZHZA 4AKMA 1ZHYA 5AFUL 1HXTA 3UPGA 3T20A 4FSPA 3VZUX 3SYBA 4XNKA 1HXXA 3PQSA 5T5FA 2OMFA 2GE4A 3HOEA 3SZDA 2YPVA 5IYUA 5DL6A 1QJPA 3HWBA 4LSEA 4FZLA 3VE2A 4RJXA 3VY8X 4E1SA 3HW9A 2XMXA 4KR4A 4F4BA 4BUMX 3T0SA 2N2MA 4O3WA 4AYNA 2MNHA 3HOLA 2KZ7B 2KDYA 3FYXA 4G76A 8PRNA 2PORA 4FRXA 1MM5A 2LFUA 3SY9A 4D5UA 1MM4A 5GV0A 5FVNA 2W81C 2XTRA 3WI4A 4O4UA 4RL9A 3DA4A 3O0EA 2KC0A 2XE2A 3QRCA 3G7GA 3KVDD 3PRNA 4GF4A 1PRNA 3WI5A 2YNKA 4JCHA 2O4VA 2Y0KA 3POQA 2XE5A 1ORMA 2F1TA 1PHOA 4FSOA 1GFMA 4FRTA 2LHFA 4GHBA 1QJ9A 2Y0HA 4FUVA 4AKRA 2J1NA 1Q9FA 3AA6A 4FESA 4RLCA 4B61A 3NSGA 2J4UP 4RLBA 7PRNA 5G26A 1GFOA 6PRNA 3PQUA 5ADXK 2X27X 2XE1A 4AUIA 3UAQA 4QQ1A 1E54A 4LSIA 4G75A 1BH3A 2MHLA 4XNLA 1BXWA 3LK42 3VE1A 4U9CA 3AA1A 4FT6A 3AA0A 4FOZA 2ZFGA 5D5DA 3AA1B 4AZLA 3AA0B 2K0LA 1P4TA 4FZMA 3RBHA 5DL8A 4KRAA 2M07A 1MPFA 3C5OA 3LK3A 1GFQA 4N59A 3SZVA 1ZHTA 4D64A 5AFUK 4FMSA 4O3YA 1HXUA 3QRAA 3TZGA 1H6S1 3LK3B 3SY7A 2JMMA 2QTKA 4AKRB 4AYDC 1IZNA 5EE2A 1ZHXA 3AA6B 4O49A 2KXPA 5DL5A 3AA7A 4N58A 4O4XA 2M06A 3EMNX 5PRNA 4Z3TA 1OPFA 1IZNB 3PORA 3VZTX 3A2SX 4C69X 3AAAA 4LSHA 2KXPB 3K19A 4FZNA 1G90A 2PRNA 3GP6A 2F1VA 1BT9A 3AAEA 3AAAB 2XTQA 3AAEB 1ZHWA 4GCPA 2XE3A 4O3ZA 1Q9GA 2ERVA 1GFNA 3POUA 3DA3A 3VZWX 5ADXL 3POXA 4AYMC 2N2LA 2KZ7A 4O3XB 3UU2A 2Y0LA 1THQA 2ODJA 2W80C 3LK41 1OSMA 4PUXA 4D65A 2FGRA 2ZLDA 4GCQA 4AYID 2FGQX 2Y7SA 3V8UA 4AFKA 4E1TA 3T24A 2XG6A 3JTYA 5DL7A 4AYEC 3LK2A 2K4TA 1GFPA 1YS5A 4GCSA 4JFBA 4KR8A 4LSFA 5JDPA 3AA7B 4RJWA 2Y2XA 1QJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BXW A;  1Q9G A;  2ERV A;  1ORM A;  2F1T A;  2K0L A;  1P4T A;  2GE4 A;  2LHF A;  2M07 A;  1QJP A;  2N2L A;  3C5O A;  1QJ9 A;  1Q9F A;  4RLC A;  1THQ A;  3QRA A;  2N2M A;  4PUX A;  2MNH A;  2JMM A;  2X27 X;  1MM5 A;  2M06 A;  1MM4 A;  1G90 A;  3QRC A;  3GP6 A;  2F1V A;  3G7G A;  1QJ8 A;  2MHL A; 
#chains in the Genus database with same CATH topology
 3LK2 B;  3VY9 X;  3SYS A;  1ZHZ A;  4AKM A;  1ZHY A;  2IWV A;  3PGU A;  1HXT A;  5AFU L;  3T20 A;  3UPG A;  4FSP A;  3VZU X;  3JCU O;  3SYB A;  4XNK A;  1HXX A;  5KAI O;  3PQS A;  5T5F A;  2OMF A;  2GE4 A;  2JQY A;  3HOE A;  2YPV A;  3SZD A;  4N74 A;  5IYU A;  2WJR A;  5DL6 A;  1QJP A;  3HWB A;  4LSE A;  4FZL A;  4PJ0 O;  3VE2 A;  4RJX A;  3PGR A;  3VY8 X;  4E1S A;  3HW9 A;  2XMX A;  4KR4 A;  4F4B A;  4BUM X;  3T0S A;  2N2M A;  4O3W A;  4AYN A;  2MNH A;  3HOL A;  2KZ7 B;  2KDY A;  3FYX A;  4C4V A;  4G76 A;  8PRN A;  2POR A;  4FRX A;  1MM5 A;  2LFU A;  3SY9 A;  4C4V B;  4D5U A;  1MM4 A;  5GV0 A;  5FVN A;  2W81 C;  2XTR A;  3WI4 A;  4O4U A;  4RL9 A;  5B5E O;  3DA4 A;  3O0E A;  2KC0 A;  2XE2 A;  3QRC A;  4K3B A;  3G7G A;  3KVD D;  3PRN A;  4GF4 A;  4CTD A;  1PRN A;  2WJQ A;  1T1L A;  2YNK A;  3WI5 A;  3A0B O;  4JCH A;  2O4V A;  2Y0K A;  3WU2 O;  3POQ A;  2XE5 A;  1ORM A;  2F1T A;  1PHO A;  4FSO A;  3SZV A;  1GFM A;  5G39 A;  4FRT A;  2LHF A;  4UB8 O;  4GHB A;  1QJ9 A;  2Y0H A;  4FUV A;  4AKR A;  2J1N A;  1Q9F A;  3AA6 A;  3BRY A;  3DZM A;  4FES A;  3NSG A;  4RLC A;  4UB6 O;  4B61 A;  2J4U P;  4RLB A;  2R4O A;  2R4N A;  5G26 A;  1GFO A;  6PRN A;  7PRN A;  3PQU A;  5ADX K;  2X27 X;  2XE1 A;  3A0H O;  3PGS A;  4AUI A;  3UAQ A;  4QQ1 A;  4IL6 O;  1E54 A;  4LSI A;  4G75 A;  2AXT O;  1BH3 A;  2MHL A;  3BRZ A;  4XNL A;  1BXW A;  3LK4 2;  3VE1 A;  4N75 A;  4U9C A;  3AA1 A;  4FT6 A;  3AA0 A;  4FOZ A;  4C00 A;  1S5L O;  2ZFG A;  5D5D A;  3AA1 B;  4AZL A;  3DWO X;  3AA0 B;  2K0L A;  1P4T A;  2WVP A;  4FZM A;  3DWN A;  3RBH A;  5DL8 A;  5B66 O;  5G3A A;  4KRA A;  2M07 A;  1MPF A;  3C5O A;  3LK3 A;  1GFQ A;  4FQE A;  4N59 A;  1T16 A;  1ZHT A;  5G38 A;  4FMS A;  4D64 A;  5AFU K;  4O3Y A;  1HXU A;  3NJT A;  3QRA A;  1H6S 1;  3LK3 B;  3SY7 A;  3TZG A;  2JMM A;  2QTK A;  4K3C A;  4AKR B;  4AYD C;  1IZN A;  5EE2 A;  3PF1 A;  1ZHX A;  3AA6 B;  4O49 A;  2KXP A;  5DL5 A;  3AA7 A;  4N58 A;  4O4X A;  2M06 A;  3EMN X;  5PRN A;  4Z3T A;  5GTH O;  1OPF A;  1IZN B;  3POR A;  3VZT X;  3A2S X;  4C69 X;  3AAA A;  2R4L A;  2KXP B;  4LSH A;  3K19 A;  4FZN A;  1G90 A;  2PRN A;  3GP6 A;  2F1V A;  1BT9 A;  3AAE A;  3BS0 A;  2F1C X;  3AAA B;  2XTQ A;  2R8A A;  2R88 A;  3AAE B;  1ZHW A;  4GCP A;  2XE3 A;  4O3Z A;  1Q9G A;  2ERV A;  1GFN A;  3POU A;  3DA3 A;  3VZW X;  5ADX L;  3POX A;  4AYM C;  5KAF O;  2X9K A;  2N2L A;  2KZ7 A;  4O3X B;  5TIS O;  3UU2 A;  2Y0L A;  1THQ A;  2ODJ A;  2W80 C;  3LK4 1;  1OSM A;  4PUX A;  4D65 A;  2R89 A;  3KZI O;  5H2F O;  2FGR A;  2ZLD A;  4GCQ A;  5GTI O;  4AYI D;  2IWW A;  2FGQ X;  2Y7S A;  4PR7 A;  3V8U A;  4AFK A;  4E1T A;  3T24 A;  2XG6 A;  3JTY A;  5DL7 A;  4AYE C;  3LK2 A;  2K4T A;  1GFP A;  1YS5 A;  4GCS A;  4JFB A;  4KR8 A;  4LSF A;  5E79 O;  3AA7 B;  5JDP A;  2R4P A;  4RJW A;  2Y2X A;  1QJ8 A; 
#chains in the Genus database with same CATH homology
 3LK2 B;  3VY9 X;  3SYS A;  1ZHZ A;  4AKM A;  1ZHY A;  5AFU L;  1HXT A;  3UPG A;  3T20 A;  4FSP A;  3VZU X;  3SYB A;  4XNK A;  1HXX A;  3PQS A;  5T5F A;  2OMF A;  2GE4 A;  3HOE A;  3SZD A;  2YPV A;  5IYU A;  5DL6 A;  1QJP A;  3HWB A;  4LSE A;  4FZL A;  3VE2 A;  4RJX A;  3VY8 X;  4E1S A;  3HW9 A;  2XMX A;  4KR4 A;  4F4B A;  4BUM X;  3T0S A;  2N2M A;  4O3W A;  4AYN A;  2MNH A;  3HOL A;  2KZ7 B;  2KDY A;  3FYX A;  4G76 A;  8PRN A;  2POR A;  4FRX A;  1MM5 A;  2LFU A;  3SY9 A;  4D5U A;  1MM4 A;  5GV0 A;  5FVN A;  2W81 C;  2XTR A;  3WI4 A;  4O4U A;  4RL9 A;  3DA4 A;  3O0E A;  2KC0 A;  2XE2 A;  3QRC A;  3G7G A;  3KVD D;  3PRN A;  4GF4 A;  1PRN A;  3WI5 A;  2YNK A;  4JCH A;  2O4V A;  2Y0K A;  3POQ A;  2XE5 A;  1ORM A;  2F1T A;  1PHO A;  4FSO A;  1GFM A;  4FRT A;  2LHF A;  4GHB A;  1QJ9 A;  2Y0H A;  4FUV A;  4AKR A;  2J1N A;  1Q9F A;  3AA6 A;  4FES A;  4RLC A;  4B61 A;  3NSG A;  2J4U P;  4RLB A;  7PRN A;  5G26 A;  1GFO A;  6PRN A;  3PQU A;  5ADX K;  2X27 X;  2XE1 A;  4AUI A;  3UAQ A;  4QQ1 A;  1E54 A;  4LSI A;  4G75 A;  1BH3 A;  2MHL A;  4XNL A;  1BXW A;  3LK4 2;  3VE1 A;  4U9C A;  3AA1 A;  4FT6 A;  3AA0 A;  4FOZ A;  2ZFG A;  5D5D A;  3AA1 B;  4AZL A;  3AA0 B;  2K0L A;  1P4T A;  4FZM A;  3RBH A;  5DL8 A;  4KRA A;  2M07 A;  1MPF A;  3C5O A;  3LK3 A;  1GFQ A;  4N59 A;  3SZV A;  1ZHT A;  4D64 A;  5AFU K;  4FMS A;  4O3Y A;  1HXU A;  3QRA A;  3TZG A;  1H6S 1;  3LK3 B;  3SY7 A;  2JMM A;  2QTK A;  4AKR B;  4AYD C;  1IZN A;  5EE2 A;  1ZHX A;  3AA6 B;  4O49 A;  2KXP A;  5DL5 A;  3AA7 A;  4N58 A;  4O4X A;  2M06 A;  3EMN X;  5PRN A;  4Z3T A;  1OPF A;  1IZN B;  3POR A;  3VZT X;  3A2S X;  4C69 X;  3AAA A;  4LSH A;  2KXP B;  3K19 A;  4FZN A;  1G90 A;  2PRN A;  3GP6 A;  2F1V A;  1BT9 A;  3AAE A;  3AAA B;  2XTQ A;  3AAE B;  1ZHW A;  4GCP A;  2XE3 A;  4O3Z A;  1Q9G A;  2ERV A;  1GFN A;  3POU A;  3DA3 A;  3VZW X;  5ADX L;  3POX A;  4AYM C;  2N2L A;  2KZ7 A;  4O3X B;  3UU2 A;  2Y0L A;  1THQ A;  2ODJ A;  2W80 C;  3LK4 1;  1OSM A;  4PUX A;  4D65 A;  2FGR A;  2ZLD A;  4GCQ A;  4AYI D;  2FGQ X;  2Y7S A;  3V8U A;  4AFK A;  4E1T A;  3T24 A;  2XG6 A;  3JTY A;  5DL7 A;  4AYE C;  3LK2 A;  2K4T A;  1GFP A;  1YS5 A;  4GCS A;  4JFB A;  4KR8 A;  4LSF A;  5JDP A;  3AA7 B;  4RJW A;  2Y2X A;  1QJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...