2F24A

Crystal structure of the human sialidase neu2 e111q mutant
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
375
structure length
359
Chain Sequence
SLPVLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRAAELIVLRRGDYDAPTHQVQWQAQEVVAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTQQQQLQTRANVTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLNDRARSLVVPAYAYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRAQWLLYTHPTHSWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQAFPAEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human Sialidase Neu2 E111Q Mutant
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Sialidase 2
total genus 94
structure length 359
sequence length 375
ec nomenclature ec 3.2.1.18: Exo-alpha-sialidase.
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13088 BNR_2 BNR repeat-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.10 Mainly Beta 6 Propeller Neuraminidase Neuraminidase 2f24A00
2HTUA 1V2IA 1MS9A 4QN7A 1VCUA 2F12A 4H53A 4K1HA 2QWBA 2YDPA 2VSKA 2CMLA 1WCQA 2VW1A 4K1KA 2QWDA 1NCCN 3D12A 2YA7A 2XZJA 4HZVA 1MZ5A 4M3MA 3CKZA 4B7JA 4XJQA 1MS5A 2W38A 4YW2A 2BZDA 4YW1A 1INVA 1N1SA 2X9MA 4M4UA 1EUUA 5B2DA 2HU0A 4FPLA 4FPKA 4WA5A 3TI4A 4SLIA 1EURA 4WEFA 4XILA 4FJ6A 1INXA 1SLLA 2W5NA 3CYEA 4MWUA 4XJZA 4YW3A 2VK7A 4XJRA 2QWJA 1S0JA 1INFA 5HX0A 1NMAN 4QNPA 1NSDA 3TI5A 1E8TA 1B9VA 4MWWA 2YA8A 4FP3A 1USRA 4BBWA 2VK5A 1L7GA 3TIBA 2QWGA 1W8OA 1E8UA 4FP2A 1A14N 4YZ4A 1KITA 4XJWA 6NN9A 1INYA 2QWHA 4YZ5A 3CL2A 3ALXA 4GEZA 1NNBA 1Z4ZA 4FPFA 1XOEA 3SLIA 2B8HA 5NN9A 4HZXA 4XE9A 2C4LA 1IVDA 2F11A 4M4NA 4NCSA 1INHA 2FHRA 4MJVA 4CPLA 2F28A 4GZSA 1NSBA 4CPOA 4GJTA 1INWA 1W0OA 2HTRA 2BERA 1INGA 3OPZA 1MS1A 1NCDN 1NN2A 4B7NA 4GZQA 4MX0A 2AEQA 1V3BA 2F10A 4HZWA 1N1YA 1L7HA 2SLIA 4QN5A 4YW4A 1SLIA 1EUSA 4WA3A 1V0ZA 1W8NA 3BEQA 5F9TA 4FPOB 2HTYA 2HTWA 1A4GA 4GDJA 1Z4VA 2HU4A 3K36A 3B69A 1N1TA 4XOGA 1IVBA 2W20A 1DIMA 2XCYA 1E8VA 1IVGA 2SIMA 4GB1A 4NN9A 4XJUA 4B7RA 1W0PA 1IVCA 1USXA 1NNAA 4FOQA 1L7FA 4GZPA 4UF7A 3B7EA 1Z4XA 3NN9A 4FPGA 4CPMA 1SO7A 2SILA 4D8SA 1XOGA 2HTQA 1W21A 2ZB6A 3INBA 4HZYA 2QWCA 4MWQA 4XHBA 4MC7A 4B7MA 2VWDA 1MS8A 7NN9A 1Z4YA 4XJ9A 4MWYA 3H72A 3O9KA 4FPEA 2HT7A 2BF6A 3TI3A 4KS3A 4YZ2A 1S0IA 4QN3A 4MWVA 2XZIA 1W1XA 1N1VA 3A71A 1V0EA 1MR5A 4HIZA 1F8DA 3GVJA 4DGRA 3K37A 3SILA 5HUGA 3W09A 4MWRA 2F29A 4YZ1A 4FQ4A 4H52A 2W5OA 3K39A 3SANA 2AH2A 1DILA 4GDIA 4MWJA 1NCBN 1MS4A 4YW5A 4XJ8A 4FPYA 4X4AA 3TIAA 4FOVA 2YA4A 3TI6A 1F8EA 1IVFA 1SNTA 4J9TA 4MZAA 1W20A 4KS2A 4JF7A 2AEPA 2YA5A 4YZ3A 4FOWA 4CPNA 3H6JA 2JKBA 4GZOA 2VVZA 2VK6A 2VW0A 1MZ6A 5HUKA 2A75A 3O9JA 2QWEA 4NC5A 4GZTA 3GVKA 3T1EA 3K3AA 2XZKA 4MZEA 4FOYA 2C4AA 4MJUA 4FPCA 2QWAA 2QWFA 5B2CA 1F8CA 4K1JA 4K3YA 3SALA 4XMAA 1WCSA 5HUMA 2BATA 2HT5A 4CPZA 2VSMA 4XIOA 2HT8A 4KS5A 4GZXA 2AGSA 4MWLA 1NNCA 3TI8A 1A4QA 1NMCA 1EUTA 1NSCA 4QN4A 2VW2A 2F24A 4FPHA 2HTVA 4Q6KA 3H73A 3ALWA 4HZZA 2F25A 2YA6A 5M1ZA 3A72A 1NMBN 2F26A 4MWXA 4KS4A 4WEGA 1BJIA 4KS1A 4XJAA 3JU4A 3H71A 4M4VA 4I00A 1MWEA 1MS0A 2ZB5A 3D11A 2QWKA 2F13A 1NCAN 4GZWA 1B9TA 5JYYA 1Z4WA 3NSSA 1MS3A 4X49A 4QN6A 4X6KA 3GVLA 4FZHA 4B7QA 1V0FA 3TICA 4XYXA 1VCJA 4XIKA 1V3DA 4CPYA 1B9SA 1IVEA 1Z50A 4WA4A 4X47A 4XHXA 4XMIA 2F27A 2YDTA 1V3CA 4FPJA 1V3EA 2QWIA 4K1IA 5HUNA 1F8BA 4FVKA 3K38A 2RKCA 2F0ZA 3CL0A 3PJQA
chains in the Genus database with same CATH superfamily
1X2JA 2HTUA 2IAXA 1V2IA 1MS9A 4QN7A 3E5ZA 1VCUA 2F12A 4H53A 4K1HA 3P5BL 2QWBA 2GVXA 2IVZA 3V1SA 2YDPA 3HLIA 2VSKA 2CMLA 1WCQA 2VW1A 4K1KA 4GNCA 2QWDA 1NCCN 2FPCA 5EO7A 3D12A 2YA7A 4GN7A 1QLGA 2XZJA 4HZVA 3A9HA 1MZ5A 4M3MA 3CKZA 4B7JA 4IFNX 4XJQA 1MS5A 4CH9A 2W38A 4YW2A 2BZDA 4YW1A 2IAQA 1INVA 1CRZA 1N1SA 4N1BA 2X9MA 4M4UA 4O5TA 3SOBB 2IATA 5EX7A 1EUUA 5EO8A 5B2DA 2GVVA 2ZWAA 2IAPA 2HU0A 1WP5A 4FPLA 4FPKA 2VAQA 4WA5A 1N6EA 1N7DA 3TI4A 1Q7FA 4SLIA 1EURA 1NPEA 4WEFA 4C1YA 4XILA 5FNRA 1IJQA 2HQSA 4FJ6A 1INXA 3S94A 1SLLA 2W5NA 3CYEA 4MWUA 4XJZA 2H2UA 4GNAA 4YW3A 2VK7A 4AHAA 5FNUA 4XJRA 2QWJA 5GTQA 1S0JA 1INFA 5HX0A 4L7DA 5GX2A 3LI4A 1NMAN 4QNPA 1NSDA 2IAUA 1CRUA 1H6LA 1E8TA 3TI5A 1B9VA 4MWWA 3LI5A 2YA8A 4FP3A 3DR2A 4ZY3A 3UC1A 1USRA 3Q6PA 2FLUX 1ZI0A 4BBWA 1N6FA 3SRGA 2VK5A 4HHQA 4O5SA 1IUCA 1L7GA 3TIBA 2QWGA 3AMRA 1W8OA 1E8UA 4FP2A 4C1YB 1A14N 4YZ4A 1KITA 2FPBA 4GNBA 4XJWA 6NN9A 1INYA 4IMBA 3WDZA 4HW6A 2IAWA 3V64C 2XN4A 2QWHA 4YZ5A 4GN8A 3CL2A 3G4HA 3ALXA 4GEZA 1NNBA 1Z4ZA 2FP9A 4FPFA 1XOEA 1X2RA 2B8HA 3SLIA 5NN9A 4HZXA 4XE9A 5FZNA 2C4LA 1V04A 1IVDA 2VPJA 2GVUA 2F11A 4M4NA 4NCSA 2POOA 4CHBA 3KYAA 5D9BA 1INHA 2FHRA 4MJVA 4CPLA 2F28A 4IFLX 4GZSA 1NSBA 4CPOA 4GJTA 1INWA 1W0OA 2HTRA 4ASCA 2BERA 1INGA 1C9UA 3OPZA 1MS1A 1NCDN 1NN2A 4B7NA 4GZQA 4A0PA 4MX0A 1ZGKA 2DSOA 2AEQA 3VNHA 5GX4A 1V3BA 2F10A 3FW0A 5FNQA 4HZWA 1N1YA 1L7HA 2SLIA 4QN5A 4YW4A 1SLIA 1EUSA 4WA3A 1V0ZA 1W8NA 3BEQA 3BYCA 5F9TA 4FPOB 2HTYA 2HTWA 3TC9A 1A4GA 4GDJA 1Z4VA 4AGTA 3Q6KA 2HU4A 3K36A 3B69A 1N1TA 1S1DA 4XOGA 1IVBA 2W20A 1DIMA 2XCYA 1E8VA 3L6VA 1IVGA 2SIMA 4GB1A 4CSDA 4NN9A 4XJUA 3WN7A 1W0PA 4B7RA 1IVCA 1USXA 1N6DA 1NNAA 4FOQA 4XMBA 1L7FA 4GZPA 2DYHA 4UF7A 3B7EA 1Z4XA 3NN9A 4FPGA 4CPMA 5F72C 1SO7A 3HRPA 4IQKA 4DG6A 2SILA 4D8SA 1XOGA 2HTQA 1W21A 2ZB6A 2W8BB 3INBA 4HZYA 2ZZKA 2QWCA 1E1AA 4MWQA 4XHBA 2OJHA 4MC7A 4B7MA 2VWDA 1MS8A 4ZLRA 7NN9A 1Z4YA 4XJ9A 4MWYA 3H72A 3O9KA 4FPEA 2GHSA 2HT7A 2BF6A 3TI3A 5D9DA 3SOQA 3V65B 4D4UA 5GX3A 4KS3A 4YZ2A 5H47A 1S0IA 4QN3A 3II7A 4MWVA 2XZIA 1W1XA 1N1VA 3A71A 3I1CA 3FVZA 1V0EA 4IYGA 1MR5A 4YY8A 4HIZA 2GVWA 3IAXA 1F8DA 3GVJA 4DGRA 3K37A 3SILA 5HUGA 3W09A 5CGJA 4MWRA 2F29A 4AH4A 4YZ1A 4FQ4A 2ISMA 4H52A 2W5OA 3K39A 1CVMA 3SANA 2AH2A 1DILA 5FZJA 4GDIA 4MWJA 1NCBN 1MS4A 4YW5A 4G3NA 4XJ8A 2IASA 4FPYA 4X4AA 3ZGCA 3TIAA 3WW9A 4FOVA 2YA4A 3TI6A 1F8EA 1IVFA 1SNTA 4J9TA 4IFJA 4MZAA 1W20A 3S8VA 2V91A 4KS2A 4JF7A 2AEPA 2QE8A 1CQ1A 1SUUA 2YA5A 4YZ3A 4FOWA 3VNGA 4CPNA 3H6JA 2JKBA 4JMLA 3S2KA 4GZOA 2VVZA 2VK6A 2VW0A 1MZ6A 3ADEA 5HUKA 3S8ZA 2A75A 1S18A 5GX1A 3O9JA 2QWEA 4NC5A 4GZTA 3GVKA 4PWZA 2IAVA 3T1EA 3K3AA 2XZKA 3U0SA 4MZEA 4FOYA 4IN4A 3SREA 3DASA 2P4OA 1RWLA 2C4AA 4MJUA 4FPCA 2QWAA 3O4PA 2QWFA 4AGIA 5B2CA 1F8CA 4K1JA 5GX5A 2FP8A 4K3YA 3SALA 2DG1A 4XMAA 1WCSA 5HUMA 2BATA 2HT5A 4CPZA 2VSMA 4XIOA 2HT8A 4KS5A 4GZXA 2AGSA 4UOUA 4MWLA 3Q6TA 1NNCA 5D9CA 3TI8A 1A4QA 1NMCA 4HHOA 4ZGCA 4D52B 1EUTA 3A9GA 4L7CA 1NSCA 4QN4A 2VW2A 2F24A 4FPHA 5FNTA 2HTVA 4Q6KA 3LI3A 3H73A 2DG0A 3ALWA 3WWAA 4HZZA 2F25A 2W8BA 2YA6A 5M1ZA 3A72A 1NMBN 1U6DX 2F26A 4MWXA 5FNSA 4KS4A 4WEGA 1BJIA 4KS1A 2Z32A 3SOVA 4XJAA 3AMSA 3JU4A 3H71A 2ZW9A 4M4VA 4I00A 3NO0A 1MWEA 1MS0A 2ZB5A 3D11A 2QWKA 1RWIA 4L7BA 1PJXA 4Q1UA 2F13A 2H2NA 1NCAN 4GZWA 1IUBA 1B9TA 5JYYA 1POOA 1Z4WA 3NSSA 1MS3A 4X49A 3HLHA 2G8SA 2WOZA 4QN6A 4X6KA 3GVLA 3KGGA 4FZHA 4B7QA 4D52A 3G4EA 1C5KA 1V0FA 4R40A 3TICA 4XYXA 1VCJA 4XIKA 1K32A 1V3DA 4CPYA 1B9SA 1IVEA 2IARA 1Z50A 3ZGDA 4D52C 4WA4A 4X47A 5FWWA 4XHXA 4XMIA 2F27A 2YDTA 1OFZA 1QBIA 4FPJA 1V3CA 4GN9A 1V3EA 2QWIA 4K1IA 5HUNA 1F8BA 4FVKA 2IAOA 3K38A 2RKCA 2F0ZA 3CL0A 3PJQA
chains in the Genus database with same CATH topology
2HTUA 1V2IA 1MS9A 4QN7A 1VCUA 2F12A 4H53A 4K1HA 2QWBA 2YDPA 2VSKA 2CMLA 1WCQA 2VW1A 4K1KA 2QWDA 1NCCN 3D12A 2YA7A 2XZJA 4HZVA 1MZ5A 4M3MA 3CKZA 4B7JA 4XJQA 1MS5A 2W38A 4YW2A 2BZDA 4YW1A 1INVA 1N1SA 2X9MA 4M4UA 1EUUA 5B2DA 2HU0A 4FPLA 4FPKA 4WA5A 3TI4A 4SLIA 1EURA 4WEFA 4XILA 4FJ6A 1INXA 1SLLA 2W5NA 3CYEA 4MWUA 4XJZA 2H2UA 4YW3A 2VK7A 4XJRA 2QWJA 1S0JA 1INFA 5HX0A 1NMAN 4QNPA 1NSDA 3TI5A 1E8TA 1B9VA 4MWWA 2YA8A 4FP3A 1USRA 4BBWA 2VK5A 1L7GA 3TIBA 2QWGA 1W8OA 1E8UA 4FP2A 1A14N 4YZ4A 1KITA 4XJWA 6NN9A 1INYA 2QWHA 4YZ5A 3CL2A 3ALXA 4GEZA 1NNBA 1Z4ZA 4FPFA 1XOEA 3SLIA 2B8HA 5NN9A 4HZXA 4XE9A 2C4LA 1IVDA 2F11A 4M4NA 4NCSA 1INHA 2FHRA 4MJVA 4CPLA 2F28A 4GZSA 1NSBA 4CPOA 4GJTA 1INWA 1W0OA 2HTRA 2BERA 1INGA 3OPZA 1MS1A 1NCDN 1NN2A 4B7NA 4GZQA 4MX0A 2AEQA 1V3BA 2F10A 4HZWA 1N1YA 1L7HA 2SLIA 4QN5A 4YW4A 1SLIA 1EUSA 4WA3A 1V0ZA 1W8NA 3BEQA 5F9TA 4FPOB 2HTYA 2HTWA 1A4GA 4GDJA 1Z4VA 2HU4A 3K36A 3B69A 1N1TA 1S1DA 4XOGA 1IVBA 2W20A 1DIMA 2XCYA 1E8VA 1IVGA 2SIMA 4GB1A 4NN9A 4XJUA 4B7RA 1W0PA 1IVCA 1USXA 1NNAA 4FOQA 1L7FA 4GZPA 4UF7A 3B7EA 1Z4XA 3NN9A 4FPGA 4CPMA 1SO7A 2SILA 4D8SA 1XOGA 2HTQA 1W21A 2ZB6A 3INBA 4HZYA 2QWCA 4MWQA 4XHBA 4MC7A 4B7MA 2VWDA 1MS8A 7NN9A 1Z4YA 4XJ9A 4MWYA 3H72A 3O9KA 4FPEA 2HT7A 2BF6A 3TI3A 4KS3A 4YZ2A 1S0IA 4QN3A 4MWVA 2XZIA 1W1XA 1N1VA 3A71A 1V0EA 1MR5A 4HIZA 1F8DA 3GVJA 4DGRA 3K37A 3SILA 5HUGA 3W09A 4MWRA 2F29A 4YZ1A 4FQ4A 4H52A 2W5OA 3K39A 3SANA 2AH2A 1DILA 4GDIA 4MWJA 1NCBN 1MS4A 4YW5A 4XJ8A 4FPYA 4X4AA 3TIAA 4FOVA 2YA4A 3TI6A 1F8EA 1IVFA 1SNTA 4J9TA 4MZAA 1W20A 4KS2A 4JF7A 2AEPA 2YA5A 4YZ3A 4FOWA 4CPNA 3H6JA 2JKBA 4GZOA 2VVZA 2VK6A 2VW0A 1MZ6A 5HUKA 2A75A 1S18A 3O9JA 2QWEA 4NC5A 4GZTA 3GVKA 3T1EA 3K3AA 2XZKA 4MZEA 4FOYA 2C4AA 4MJUA 4FPCA 2QWAA 2QWFA 5B2CA 1F8CA 4K1JA 4K3YA 3SALA 4XMAA 1WCSA 5HUMA 2BATA 2HT5A 4CPZA 2VSMA 4XIOA 2HT8A 4KS5A 4GZXA 2AGSA 4MWLA 1NNCA 3TI8A 1A4QA 1NMCA 1EUTA 1NSCA 4QN4A 2VW2A 2F24A 4FPHA 2HTVA 4Q6KA 3H73A 3ALWA 4HZZA 2F25A 2YA6A 5M1ZA 3A72A 1NMBN 2F26A 4MWXA 4KS4A 4WEGA 1BJIA 4KS1A 4XJAA 3JU4A 3H71A 4M4VA 4I00A 1MWEA 1MS0A 2ZB5A 3D11A 2QWKA 2F13A 2H2NA 1NCAN 4GZWA 1B9TA 5JYYA 1Z4WA 3NSSA 1MS3A 4X49A 4QN6A 4X6KA 3GVLA 4FZHA 4B7QA 1V0FA 3TICA 4XYXA 1VCJA 4XIKA 1V3DA 4CPYA 1B9SA 1IVEA 1Z50A 4WA4A 4X47A 4XHXA 4XMIA 2F27A 2YDTA 1V3CA 4FPJA 1V3EA 2QWIA 4K1IA 5HUNA 1F8BA 4FVKA 3K38A 2RKCA 2F0ZA 3CL0A 3PJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HTU A;  1V2I A;  1MS9 A;  4QN7 A;  1VCU A;  2F12 A;  4H53 A;  4K1H A;  2QWB A;  2YDP A;  2VSK A;  2CML A;  1WCQ A;  2VW1 A;  4K1K A;  2QWD A;  1NCC N;  3D12 A;  2YA7 A;  2XZJ A;  4HZV A;  1MZ5 A;  4M3M A;  3CKZ A;  4B7J A;  4XJQ A;  1MS5 A;  2W38 A;  4YW2 A;  2BZD A;  4YW1 A;  1INV A;  1N1S A;  2X9M A;  4M4U A;  1EUU A;  5B2D A;  2HU0 A;  4FPL A;  4FPK A;  4WA5 A;  3TI4 A;  4SLI A;  1EUR A;  4WEF A;  4XIL A;  4FJ6 A;  1INX A;  1SLL A;  2W5N A;  3CYE A;  4MWU A;  4XJZ A;  4YW3 A;  2VK7 A;  4XJR A;  2QWJ A;  1S0J A;  1INF A;  5HX0 A;  1NMA N;  4QNP A;  1NSD A;  3TI5 A;  1E8T A;  1B9V A;  4MWW A;  2YA8 A;  4FP3 A;  1USR A;  4BBW A;  2VK5 A;  1L7G A;  3TIB A;  2QWG A;  1W8O A;  1E8U A;  4FP2 A;  1A14 N;  4YZ4 A;  1KIT A;  4XJW A;  6NN9 A;  1INY A;  2QWH A;  4YZ5 A;  3CL2 A;  3ALX A;  4GEZ A;  1NNB A;  1Z4Z A;  4FPF A;  1XOE A;  3SLI A;  2B8H A;  5NN9 A;  4HZX A;  4XE9 A;  2C4L A;  1IVD A;  2F11 A;  4M4N A;  4NCS A;  1INH A;  2FHR A;  4MJV A;  4CPL A;  2F28 A;  4GZS A;  1NSB A;  4CPO A;  4GJT A;  1INW A;  1W0O A;  2HTR A;  2BER A;  1ING A;  3OPZ A;  1MS1 A;  1NCD N;  1NN2 A;  4B7N A;  4GZQ A;  4MX0 A;  2AEQ A;  1V3B A;  2F10 A;  4HZW A;  1N1Y A;  1L7H A;  2SLI A;  4QN5 A;  4YW4 A;  1SLI A;  1EUS A;  4WA3 A;  1V0Z A;  1W8N A;  3BEQ A;  5F9T A;  4FPO B;  2HTY A;  2HTW A;  1A4G A;  4GDJ A;  1Z4V A;  2HU4 A;  3K36 A;  3B69 A;  1N1T A;  4XOG A;  1IVB A;  2W20 A;  1DIM A;  2XCY A;  1E8V A;  1IVG A;  2SIM A;  4GB1 A;  4NN9 A;  4XJU A;  4B7R A;  1W0P A;  1IVC A;  1USX A;  1NNA A;  4FOQ A;  1L7F A;  4GZP A;  4UF7 A;  3B7E A;  1Z4X A;  3NN9 A;  4FPG A;  4CPM A;  1SO7 A;  2SIL A;  4D8S A;  1XOG A;  2HTQ A;  1W21 A;  2ZB6 A;  3INB A;  4HZY A;  2QWC A;  4MWQ A;  4XHB A;  4MC7 A;  4B7M A;  2VWD A;  1MS8 A;  7NN9 A;  1Z4Y A;  4XJ9 A;  4MWY A;  3H72 A;  3O9K A;  4FPE A;  2HT7 A;  2BF6 A;  3TI3 A;  4KS3 A;  4YZ2 A;  1S0I A;  4QN3 A;  4MWV A;  2XZI A;  1W1X A;  1N1V A;  3A71 A;  1V0E A;  1MR5 A;  4HIZ A;  1F8D A;  3GVJ A;  4DGR A;  3K37 A;  3SIL A;  5HUG A;  3W09 A;  4MWR A;  2F29 A;  4YZ1 A;  4FQ4 A;  4H52 A;  2W5O A;  3K39 A;  3SAN A;  2AH2 A;  1DIL A;  4GDI A;  4MWJ A;  1NCB N;  1MS4 A;  4YW5 A;  4XJ8 A;  4FPY A;  4X4A A;  3TIA A;  4FOV A;  2YA4 A;  3TI6 A;  1F8E A;  1IVF A;  1SNT A;  4J9T A;  4MZA A;  1W20 A;  4KS2 A;  4JF7 A;  2AEP A;  2YA5 A;  4YZ3 A;  4FOW A;  4CPN A;  3H6J A;  2JKB A;  4GZO A;  2VVZ A;  2VK6 A;  2VW0 A;  1MZ6 A;  5HUK A;  2A75 A;  3O9J A;  2QWE A;  4NC5 A;  4GZT A;  3GVK A;  3T1E A;  3K3A A;  2XZK A;  4MZE A;  4FOY A;  2C4A A;  4MJU A;  4FPC A;  2QWA A;  2QWF A;  5B2C A;  1F8C A;  4K1J A;  4K3Y A;  3SAL A;  4XMA A;  1WCS A;  5HUM A;  2BAT A;  2HT5 A;  4CPZ A;  2VSM A;  4XIO A;  2HT8 A;  4KS5 A;  4GZX A;  2AGS A;  4MWL A;  1NNC A;  3TI8 A;  1A4Q A;  1NMC A;  1EUT A;  1NSC A;  4QN4 A;  2VW2 A;  2F24 A;  4FPH A;  2HTV A;  4Q6K A;  3H73 A;  3ALW A;  4HZZ A;  2F25 A;  2YA6 A;  5M1Z A;  3A72 A;  1NMB N;  2F26 A;  4MWX A;  4KS4 A;  4WEG A;  1BJI A;  4KS1 A;  4XJA A;  3JU4 A;  3H71 A;  4M4V A;  4I00 A;  1MWE A;  1MS0 A;  2ZB5 A;  3D11 A;  2QWK A;  2F13 A;  1NCA N;  4GZW A;  1B9T A;  5JYY A;  1Z4W A;  3NSS A;  1MS3 A;  4X49 A;  4QN6 A;  4X6K A;  3GVL A;  4FZH A;  4B7Q A;  1V0F A;  3TIC A;  4XYX A;  1VCJ A;  4XIK A;  1V3D A;  4CPY A;  1B9S A;  1IVE A;  1Z50 A;  4WA4 A;  4X47 A;  4XHX A;  4XMI A;  2F27 A;  2YDT A;  1V3C A;  4FPJ A;  1V3E A;  2QWI A;  4K1I A;  5HUN A;  1F8B A;  4FVK A;  3K38 A;  2RKC A;  2F0Z A;  3CL0 A;  3PJQ A; 
#chains in the Genus database with same CATH topology
 1X2J A;  2HTU A;  2IAX A;  1V2I A;  1MS9 A;  4QN7 A;  3E5Z A;  1VCU A;  2F12 A;  4H53 A;  4K1H A;  3P5B L;  2QWB A;  2GVX A;  2IVZ A;  3V1S A;  2YDP A;  3HLI A;  2VSK A;  2CML A;  1WCQ A;  2VW1 A;  4K1K A;  4GNC A;  2QWD A;  1NCC N;  2FPC A;  5EO7 A;  3D12 A;  2YA7 A;  4GN7 A;  1QLG A;  2XZJ A;  4HZV A;  3A9H A;  1MZ5 A;  4M3M A;  3CKZ A;  4B7J A;  4IFN X;  4XJQ A;  1MS5 A;  4CH9 A;  2W38 A;  4YW2 A;  2BZD A;  4YW1 A;  2IAQ A;  1INV A;  1CRZ A;  1N1S A;  4N1B A;  2X9M A;  4M4U A;  4O5T A;  3SOB B;  2IAT A;  5EX7 A;  1EUU A;  5EO8 A;  5B2D A;  2GVV A;  2ZWA A;  2IAP A;  2HU0 A;  1WP5 A;  4FPL A;  4FPK A;  2VAQ A;  4WA5 A;  1N6E A;  1N7D A;  3TI4 A;  1Q7F A;  4SLI A;  1EUR A;  1NPE A;  4WEF A;  4C1Y A;  4XIL A;  5FNR A;  1IJQ A;  2HQS A;  4FJ6 A;  1INX A;  3S94 A;  1SLL A;  2W5N A;  3CYE A;  4MWU A;  4XJZ A;  2H2U A;  4GNA A;  4YW3 A;  2VK7 A;  4AHA A;  5FNU A;  4XJR A;  2QWJ A;  5GTQ A;  1S0J A;  1INF A;  5HX0 A;  4L7D A;  5GX2 A;  3LI4 A;  1NMA N;  4QNP A;  1NSD A;  2IAU A;  1CRU A;  1H6L A;  1E8T A;  3TI5 A;  1B9V A;  4MWW A;  3LI5 A;  2YA8 A;  4FP3 A;  3DR2 A;  4ZY3 A;  3UC1 A;  1USR A;  3Q6P A;  2FLU X;  1ZI0 A;  4BBW A;  1N6F A;  3SRG A;  2VK5 A;  4HHQ A;  4O5S A;  1IUC A;  1L7G A;  3TIB A;  2QWG A;  3AMR A;  1W8O A;  1E8U A;  4FP2 A;  4C1Y B;  1A14 N;  4YZ4 A;  1KIT A;  2FPB A;  4GNB A;  4XJW A;  6NN9 A;  1INY A;  4IMB A;  3WDZ A;  4HW6 A;  2IAW A;  3V64 C;  2XN4 A;  2QWH A;  4YZ5 A;  4GN8 A;  3CL2 A;  3G4H A;  3ALX A;  4GEZ A;  1NNB A;  1Z4Z A;  2FP9 A;  4FPF A;  1XOE A;  1X2R A;  2B8H A;  3SLI A;  5NN9 A;  4HZX A;  4XE9 A;  5FZN A;  2C4L A;  1V04 A;  1IVD A;  2VPJ A;  2GVU A;  2F11 A;  4M4N A;  4NCS A;  2POO A;  4CHB A;  3KYA A;  5D9B A;  1INH A;  2FHR A;  4MJV A;  4CPL A;  2F28 A;  4IFL X;  4GZS A;  1NSB A;  4CPO A;  4GJT A;  1INW A;  1W0O A;  2HTR A;  4ASC A;  2BER A;  1ING A;  1C9U A;  3OPZ A;  1MS1 A;  1NCD N;  1NN2 A;  4B7N A;  4GZQ A;  4A0P A;  4MX0 A;  1ZGK A;  2DSO A;  2AEQ A;  3VNH A;  5GX4 A;  1V3B A;  2F10 A;  3FW0 A;  5FNQ A;  4HZW A;  1N1Y A;  1L7H A;  2SLI A;  4QN5 A;  4YW4 A;  1SLI A;  1EUS A;  4WA3 A;  1V0Z A;  1W8N A;  3BEQ A;  3BYC A;  5F9T A;  4FPO B;  2HTY A;  2HTW A;  3TC9 A;  1A4G A;  4GDJ A;  1Z4V A;  4AGT A;  3Q6K A;  2HU4 A;  3K36 A;  3B69 A;  1N1T A;  1S1D A;  4XOG A;  1IVB A;  2W20 A;  1DIM A;  2XCY A;  1E8V A;  3L6V A;  1IVG A;  2SIM A;  4GB1 A;  4CSD A;  4NN9 A;  4XJU A;  3WN7 A;  1W0P A;  4B7R A;  1IVC A;  1USX A;  1N6D A;  1NNA A;  4FOQ A;  4XMB A;  1L7F A;  4GZP A;  2DYH A;  4UF7 A;  3B7E A;  1Z4X A;  3NN9 A;  4FPG A;  4CPM A;  5F72 C;  1SO7 A;  3HRP A;  4IQK A;  4DG6 A;  2SIL A;  4D8S A;  1XOG A;  2HTQ A;  1W21 A;  2ZB6 A;  2W8B B;  3INB A;  4HZY A;  2ZZK A;  2QWC A;  1E1A A;  4MWQ A;  4XHB A;  2OJH A;  4MC7 A;  4B7M A;  2VWD A;  1MS8 A;  4ZLR A;  7NN9 A;  1Z4Y A;  4XJ9 A;  4MWY A;  3H72 A;  3O9K A;  4FPE A;  2GHS A;  2HT7 A;  2BF6 A;  3TI3 A;  5D9D A;  3SOQ A;  3V65 B;  4D4U A;  5GX3 A;  4KS3 A;  4YZ2 A;  5H47 A;  1S0I A;  4QN3 A;  3II7 A;  4MWV A;  2XZI A;  1W1X A;  1N1V A;  3A71 A;  3I1C A;  3FVZ A;  1V0E A;  4IYG A;  1MR5 A;  4YY8 A;  4HIZ A;  2GVW A;  3IAX A;  1F8D A;  3GVJ A;  4DGR A;  3K37 A;  3SIL A;  5HUG A;  3W09 A;  5CGJ A;  4MWR A;  2F29 A;  4AH4 A;  4YZ1 A;  4FQ4 A;  2ISM A;  4H52 A;  2W5O A;  3K39 A;  1CVM A;  3SAN A;  2AH2 A;  1DIL A;  5FZJ A;  4GDI A;  4MWJ A;  1NCB N;  1MS4 A;  4YW5 A;  4G3N A;  4XJ8 A;  2IAS A;  4FPY A;  4X4A A;  3ZGC A;  3TIA A;  3WW9 A;  4FOV A;  2YA4 A;  3TI6 A;  1F8E A;  1IVF A;  1SNT A;  4J9T A;  4IFJ A;  4MZA A;  1W20 A;  3S8V A;  2V91 A;  4KS2 A;  4JF7 A;  2AEP A;  2QE8 A;  1CQ1 A;  1SUU A;  2YA5 A;  4YZ3 A;  4FOW A;  3VNG A;  4CPN A;  3H6J A;  2JKB A;  4JML A;  3S2K A;  4GZO A;  2VVZ A;  2VK6 A;  2VW0 A;  1MZ6 A;  3ADE A;  5HUK A;  3S8Z A;  2A75 A;  1S18 A;  5GX1 A;  3O9J A;  2QWE A;  4NC5 A;  4GZT A;  3GVK A;  4PWZ A;  2IAV A;  3T1E A;  3K3A A;  2XZK A;  3U0S A;  4MZE A;  4FOY A;  4IN4 A;  3SRE A;  3DAS A;  2P4O A;  1RWL A;  2C4A A;  4MJU A;  4FPC A;  2QWA A;  3O4P A;  2QWF A;  4AGI A;  5B2C A;  1F8C A;  4K1J A;  5GX5 A;  2FP8 A;  4K3Y A;  3SAL A;  2DG1 A;  4XMA A;  1WCS A;  5HUM A;  2BAT A;  2HT5 A;  4CPZ A;  2VSM A;  4XIO A;  2HT8 A;  4KS5 A;  4GZX A;  2AGS A;  4UOU A;  4MWL A;  3Q6T A;  1NNC A;  5D9C A;  3TI8 A;  1A4Q A;  1NMC A;  4HHO A;  4ZGC A;  4D52 B;  1EUT A;  3A9G A;  4L7C A;  1NSC A;  4QN4 A;  2VW2 A;  2F24 A;  4FPH A;  5FNT A;  2HTV A;  4Q6K A;  3LI3 A;  3H73 A;  2DG0 A;  3ALW A;  3WWA A;  4HZZ A;  2F25 A;  2W8B A;  2YA6 A;  5M1Z A;  3A72 A;  1NMB N;  1U6D X;  2F26 A;  4MWX A;  5FNS A;  4KS4 A;  4WEG A;  1BJI A;  4KS1 A;  2Z32 A;  3SOV A;  4XJA A;  3AMS A;  3JU4 A;  3H71 A;  2ZW9 A;  4M4V A;  4I00 A;  3NO0 A;  1MWE A;  1MS0 A;  2ZB5 A;  3D11 A;  2QWK A;  1RWI A;  4L7B A;  1PJX A;  4Q1U A;  2F13 A;  2H2N A;  1NCA N;  4GZW A;  1IUB A;  1B9T A;  5JYY A;  1POO A;  1Z4W A;  3NSS A;  1MS3 A;  4X49 A;  3HLH A;  2G8S A;  2WOZ A;  4QN6 A;  4X6K A;  3GVL A;  3KGG A;  4FZH A;  4B7Q A;  4D52 A;  3G4E A;  1C5K A;  1V0F A;  4R40 A;  3TIC A;  4XYX A;  1VCJ A;  4XIK A;  1K32 A;  1V3D A;  4CPY A;  1B9S A;  1IVE A;  2IAR A;  1Z50 A;  3ZGD A;  4D52 C;  4WA4 A;  4X47 A;  5FWW A;  4XHX A;  4XMI A;  2F27 A;  2YDT A;  1OFZ A;  1QBI A;  4FPJ A;  1V3C A;  4GN9 A;  1V3E A;  2QWI A;  4K1I A;  5HUN A;  1F8B A;  4FVK A;  2IAO A;  3K38 A;  2RKC A;  2F0Z A;  3CL0 A;  3PJQ A; 
#chains in the Genus database with same CATH homology
 2HTU A;  1V2I A;  1MS9 A;  4QN7 A;  1VCU A;  2F12 A;  4H53 A;  4K1H A;  2QWB A;  2YDP A;  2VSK A;  2CML A;  1WCQ A;  2VW1 A;  4K1K A;  2QWD A;  1NCC N;  3D12 A;  2YA7 A;  2XZJ A;  4HZV A;  1MZ5 A;  4M3M A;  3CKZ A;  4B7J A;  4XJQ A;  1MS5 A;  2W38 A;  4YW2 A;  2BZD A;  4YW1 A;  1INV A;  1N1S A;  2X9M A;  4M4U A;  1EUU A;  5B2D A;  2HU0 A;  4FPL A;  4FPK A;  4WA5 A;  3TI4 A;  4SLI A;  1EUR A;  4WEF A;  4XIL A;  4FJ6 A;  1INX A;  1SLL A;  2W5N A;  3CYE A;  4MWU A;  4XJZ A;  2H2U A;  4YW3 A;  2VK7 A;  4XJR A;  2QWJ A;  1S0J A;  1INF A;  5HX0 A;  1NMA N;  4QNP A;  1NSD A;  3TI5 A;  1E8T A;  1B9V A;  4MWW A;  2YA8 A;  4FP3 A;  1USR A;  4BBW A;  2VK5 A;  1L7G A;  3TIB A;  2QWG A;  1W8O A;  1E8U A;  4FP2 A;  1A14 N;  4YZ4 A;  1KIT A;  4XJW A;  6NN9 A;  1INY A;  2QWH A;  4YZ5 A;  3CL2 A;  3ALX A;  4GEZ A;  1NNB A;  1Z4Z A;  4FPF A;  1XOE A;  3SLI A;  2B8H A;  5NN9 A;  4HZX A;  4XE9 A;  2C4L A;  1IVD A;  2F11 A;  4M4N A;  4NCS A;  1INH A;  2FHR A;  4MJV A;  4CPL A;  2F28 A;  4GZS A;  1NSB A;  4CPO A;  4GJT A;  1INW A;  1W0O A;  2HTR A;  2BER A;  1ING A;  3OPZ A;  1MS1 A;  1NCD N;  1NN2 A;  4B7N A;  4GZQ A;  4MX0 A;  2AEQ A;  1V3B A;  2F10 A;  4HZW A;  1N1Y A;  1L7H A;  2SLI A;  4QN5 A;  4YW4 A;  1SLI A;  1EUS A;  4WA3 A;  1V0Z A;  1W8N A;  3BEQ A;  5F9T A;  4FPO B;  2HTY A;  2HTW A;  1A4G A;  4GDJ A;  1Z4V A;  2HU4 A;  3K36 A;  3B69 A;  1N1T A;  1S1D A;  4XOG A;  1IVB A;  2W20 A;  1DIM A;  2XCY A;  1E8V A;  1IVG A;  2SIM A;  4GB1 A;  4NN9 A;  4XJU A;  4B7R A;  1W0P A;  1IVC A;  1USX A;  1NNA A;  4FOQ A;  1L7F A;  4GZP A;  4UF7 A;  3B7E A;  1Z4X A;  3NN9 A;  4FPG A;  4CPM A;  1SO7 A;  2SIL A;  4D8S A;  1XOG A;  2HTQ A;  1W21 A;  2ZB6 A;  3INB A;  4HZY A;  2QWC A;  4MWQ A;  4XHB A;  4MC7 A;  4B7M A;  2VWD A;  1MS8 A;  7NN9 A;  1Z4Y A;  4XJ9 A;  4MWY A;  3H72 A;  3O9K A;  4FPE A;  2HT7 A;  2BF6 A;  3TI3 A;  4KS3 A;  4YZ2 A;  1S0I A;  4QN3 A;  4MWV A;  2XZI A;  1W1X A;  1N1V A;  3A71 A;  1V0E A;  1MR5 A;  4HIZ A;  1F8D A;  3GVJ A;  4DGR A;  3K37 A;  3SIL A;  5HUG A;  3W09 A;  4MWR A;  2F29 A;  4YZ1 A;  4FQ4 A;  4H52 A;  2W5O A;  3K39 A;  3SAN A;  2AH2 A;  1DIL A;  4GDI A;  4MWJ A;  1NCB N;  1MS4 A;  4YW5 A;  4XJ8 A;  4FPY A;  4X4A A;  3TIA A;  4FOV A;  2YA4 A;  3TI6 A;  1F8E A;  1IVF A;  1SNT A;  4J9T A;  4MZA A;  1W20 A;  4KS2 A;  4JF7 A;  2AEP A;  2YA5 A;  4YZ3 A;  4FOW A;  4CPN A;  3H6J A;  2JKB A;  4GZO A;  2VVZ A;  2VK6 A;  2VW0 A;  1MZ6 A;  5HUK A;  2A75 A;  1S18 A;  3O9J A;  2QWE A;  4NC5 A;  4GZT A;  3GVK A;  3T1E A;  3K3A A;  2XZK A;  4MZE A;  4FOY A;  2C4A A;  4MJU A;  4FPC A;  2QWA A;  2QWF A;  5B2C A;  1F8C A;  4K1J A;  4K3Y A;  3SAL A;  4XMA A;  1WCS A;  5HUM A;  2BAT A;  2HT5 A;  4CPZ A;  2VSM A;  4XIO A;  2HT8 A;  4KS5 A;  4GZX A;  2AGS A;  4MWL A;  1NNC A;  3TI8 A;  1A4Q A;  1NMC A;  1EUT A;  1NSC A;  4QN4 A;  2VW2 A;  2F24 A;  4FPH A;  2HTV A;  4Q6K A;  3H73 A;  3ALW A;  4HZZ A;  2F25 A;  2YA6 A;  5M1Z A;  3A72 A;  1NMB N;  2F26 A;  4MWX A;  4KS4 A;  4WEG A;  1BJI A;  4KS1 A;  4XJA A;  3JU4 A;  3H71 A;  4M4V A;  4I00 A;  1MWE A;  1MS0 A;  2ZB5 A;  3D11 A;  2QWK A;  2F13 A;  2H2N A;  1NCA N;  4GZW A;  1B9T A;  5JYY A;  1Z4W A;  3NSS A;  1MS3 A;  4X49 A;  4QN6 A;  4X6K A;  3GVL A;  4FZH A;  4B7Q A;  1V0F A;  3TIC A;  4XYX A;  1VCJ A;  4XIK A;  1V3D A;  4CPY A;  1B9S A;  1IVE A;  1Z50 A;  4WA4 A;  4X47 A;  4XHX A;  4XMI A;  2F27 A;  2YDT A;  1V3C A;  4FPJ A;  1V3E A;  2QWI A;  4K1I A;  5HUN A;  1F8B A;  4FVK A;  3K38 A;  2RKC A;  2F0Z A;  3CL0 A;  3PJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...