2F2AB

Structure of trna-dependent amidotransferase gatcab complexed with gln
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
408
structure length
408
Chain Sequence
ETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
publication title Ammonia channel couples glutaminase with transamidase reactions in GatCAB
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 120
structure length 408
sequence length 408
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2f2aB02
3AL0B 2DQNB 3H0LB 3KFUF 3H0MB 4WJ3B 2DF4B 3IP4B 2F2AB 2G5IB 2G5HB 3H0RB 2D6FC 1ZQ1C
chains in the Genus database with same CATH superfamily
4KLDA 3N7SC 8ICMA 5AIBA 1PK3A 2EANA 3RB0A 5C5JA 3MR3A 1O08A 1QCKA 4I29A 2QB0B 3FC4A 9ICQA 4QZHA 5KFJA 5EE9A 4I2EA 1WG8A 4ECSA 2W8KA 2BKEA 3RBEA 2IMWP 2AGPA 4MF2A 1ZETA 1NJZA 3PZPA 1BPBA 5DG9A 4ELUA 3QYPA 4YFKA 4QZ9A 4O3MA 5DBAA 3SV4A 9ICWA 4C8LA 8ICKA 1TAUA 1L7OA 2V4QA 8ICJA 3KHGA 1ED1A 3C23A 4JV0A 3RJFA 3F5AA 4DQPA 4JUZA 3NVZA 3A0BU 1B4FA 1ZQYA 2HBMA 2Y1IA 1JRPA 4GC6A 2QB0A 5AKZA 9ICNA 4EEKA 5J8YC 1SKWA 4TUQA 4ED8A 4IC9A 1XSPA 5KFBA 2WF5A 2KV2A 5KFPA 4KX3A 2W55A 3AU6A 4RQNA 2A1JB 4P0PB 3PW7A 2P6UA 4TQSA 2RQ5A 2JR5A 2B0CA 2YB4A 4CF4A 1PUZA 3PSIA 5J0RA 1ZJNA 3UMCA 5AKGA 5KFIA 2JEGA 2C2RA 1ZRMA 7ICOA 5AI8A 2V9WA 4IRCA 1SV4A 5AM0A 2ZXHA 2W9MA 3PO4A 8ICEA 4IR9A 3C29A 4DOCA 4MFAA 2WF9A 2ES6A 4J9KA 1L3VA 4C80A 3M8RA 4US9A 7ICJA 3KKAA 2HOIA 3SMVA 2HVIA 2A1JA 2JMGA 5ALUA 4P0PA 5AM5A 1RQNA 2FPKA 4ICAA 1RDFA 2QKQA 3SENA 1ZQRA 3PY8A 5ALNA 3TFSA 1DK3A 8ICYA 4F8RA 4P4MA 1S76D 3TKAA 2L5YA 1IIPA 2K8AA 4F5PA 5KFZA 1X42A 2DKZA 2AQ0A 3J81j 3ZI4A 4BWMA 1MSWD 2ZIUB 3EWAA 3RAXA 1X9MA 2OYYA 1S0MA 4I2JA 3QE9Y 3HPOA 3QZ8A 9ICLA 2QLTA 5J0XA 3GIJA 2BCUA 5K4LA 5ALHA 4ED0A 2JH1A 1SZPA 4QZ8A 1SKSA 3AQEA 4Q44A 3AUOA 2KN7A 1T3QA 4UB6U 1KSPA 4ACOA 2P66A 5DQHA 1NI3A 2D6FC 9ICPA 4NLBA 3Q8MA 1WCNA 4YR0A 1RG6A 2FMSA 3C2LA 2LHTA 1DRGA 1ZQFA 1BNOA 4NLCA 3A0HU 2HHXA 4OO1J 2E3TA 4BDPA 1NNLA 2ZIUA 2DPJA 4G9BA 1JI7A 5BOMA 4QIWF 5KFEA 2EDUA 4J9LA 8ICOA 2W7OA 4QZFA 2ZJAA 4DF4A 2CN1A 4UB2A 4FZMA 2IA6A 5HMLA 1QQ7A 5KG1A 5J2CA 1XC9A 3MC1A 5AK5A 4DSIA 5KFOA 4O3RA 3GILA 2I6XA 4O9MA 1L3UA 5CR0A 1RXVA 4I2GA 1NK5A 2W11A 3BQ2A 4B9TA 1X9WA 2FE9A 2HW3A 5ALIA 3MR6A 1JN3A 2DUYA 4KLHA 3EW9A 3NVWA 2KHQA 2KFZA 1SL2A 1FFVA 9ICRA 2ZJ5A 4EBEA 3B0XA 4ECWA 2KMDA 3RB3A 3LVVA 5KFUA 1BVSA 3M8SA 1NK8A 1J2NA 5G5HA 1H38A 2DF4B 4NL9C 5IIOA 5F9LA 2W03A 5J2HA 2GH1A 4OJ5A 1LVHA 5D4BA 2KKVA 4K4HA 9ICBA 3RB4A 3Q8RB 1XO1A 4UB4A 4GIBA 1U4BA 2ZTDA 3AU2A 4KLSA 1K5OA 7ICMA 1UA0A 3ISDA 3PO5A 4B9NA 2IOFK 4EYHB 4Y2RA 4J9OA 1HIWA 4F92B 1ZQSA 3NGDA 2MRLA 1ZQDA 4KMOB 2XY5A 3THVA 7ICNA 2XICA 1GO3F 3D2QA 2UVRA 5C0YA 7ICTA 4IQUA 3QNMA 4EYIB 2FLPA 3KD3A 3ISCA 4QZGA 4UB3A 2OCEA 1SV0C 2W04A 3N4MB 4DQRA 1SB3C 5KFFA 3PV8A 7ICRA 2KZ3A 1ZQNA 1MQ3A 4CCHA 3N28A 5ALYA 1BPEA 5ALFA 4LZDA 2J6TA 1X40A 3CP8A 2VIXA 3TAPA 3C1YA 4B9MA 4YMNA 4B9VA 2E8NA 4C8KA 2JH7A 4JV2A 2GLEA 2PFPA 4DFKA 2ZIVB 4PH5A 1QH9A 3EZ5A 5KG2A 1S8OA 1Y88A 3QU7A 4JV1A 9ICKA 4DFJA 5ALLA 1SL1A 2F76X 3RRGA 7ICQA 1QQ6A 5T14A 3SZ2A 5HMMA 3SAFA 3JPRA 3MBYA 4FS2A 2E8OA 5L1MA 3T5KA 4FO6A 3LK9A 4F2SA 3LWMA 1FIQA 4NLGA 1ZQXA 4BX9C 4RQ7A 3NTUA 4Q8EA 2RRDA 3H0LB 1NKCA 3T3FA 3NUQA 2E5SA 3T79A 1U49A 2HMXA 3UXOA 2ZIVA 3C1ZA 2ZIXB 4QWAA 1B43A 4I27A 5DGBA 2FMPA 4B9UA 3GV7B 3GV8B 5KFYA 2VKQA 5D49A 3RJGA 4JB3A 3BQ0A 1J2MA 5EE3A 5J0UA 3IP4B 5AIAA 2EAOA 4RPYA 7ICSA 1QSYA 3M9MB 2FLNA 3JPQA 2BPFA 3BJYA 4DL2A 5ALMA 1NZBA 4DSJA 2FLLA 3VCBA 3KKAC 1AROP 2W7PA 4UBCA 5H2FU 5ALRA 1D8YA 4YR2A 2J6UA 2ZIXA 3BDPA 2HHVA 2DGZA 4DCCA 2E1EA 1TK0A 5J29A 2JEIA 5ALGA 3RH5A 3UXPA 3PX0A 3MGVA 2BCQA 4O3OA 3B9JA 4UAVA 1Z19A 1D8BA 2K4PA 3HRDD 3SAGA 3KHRA 2IOFA 3AL0B 3RH4A 2LYHA 4F4WA 1ZQJA 8ICHA 3RR8A 1JXEA 1L6NA 3AMZA 1D9DA 2PFOA 2PI4A 3H0RB 3V7KA 2YX8A 4M9LA 2CXYA 5JUMA 4EX6A 4I2DA 3PW4A 4F2RA 4KLMA 4F4XA 4R66A 5CHGA 5IINA 5KG7A 3F2BA 1KDHA 2PMZC 2A19A 1ZQVA 2WB1C 4F4YA 1VJ5A 4PHAA 3I1YA 1KEJA 4C0ZA 2V4RA 3K75D 4Y2YA 3RRHA 1T94A 5DG7A 2BQ3A 4K4IA 4IS7A 4JMUA 2JRZA 4NXZA 2LM4A 5AI5A 1JALA 8ICQA 1ZQKA 4PPXA 1ZQIA 3RJKA 1RZTA 1N5WA 2IOHA 3OHAA 3QXGA 5L1IA 2FDRA 4ECQA 1NK4A 3LVWA 2I9GA 5AKXA 2C2DA 1B0XA 3QX7A 4NV0A 4M0AA 4M47A 3PNCA 1UT5A 1UHUA 4DFPA 3M6KA 3WK8A 2BPGA 9ICVA 3OSPA 4DFDA 3RJJA 3H4DA 5BOLA 2YMMA 3QZ7A 4P0QB 3PW0A 2VA2A 5ALXA 4TUSA 1X2IA 3EYZA 2R8IA 2G0AA 3TQ1A 4F4KA 4PGYA 3KBBA 1S10A 4DL6A 3QEAZ 5J2BA 5KNIA 5J2FA 9ICAA 1JMSA 1S0OA 4QWCA 2LPEA 4DWIA 3OJSA 4RQ6A 1LKYB 2XI9A 1DGSA 4Q8FA 5KFHA 4PHDA 2DL0A 3SAHA 2MUTB 3C5GA 1S0NA 2D8CA 4KLOA 2VJ5A 2NRVA 4O5EA 3F2DA 1X9XA 4PZOA 4U6PA 2DQNB 4DSKA 3RJIA 4Y2PA 1RXWA 3KTQA 1BNPA 4P0QA 3ZD9A 3Q8SB 2W3RA 3UQ0A 2ATLA 1XSNA 1Q3VA 3GQCA 3UXNA 2FPLA 4TQRA 3O0FA 3GIMA 4JWMA 1SZHA 4NLNA 2HSZA 2HCFA 3D2NA 2G08A 2EQYA 4DQSA 9ICTA 1U47A 1ZQZA 3OPXA 4UBBA 3TFRA 4DOBA 1LKYA 2Y9TA 5KFRA 8ICXA 3EPIA 4RNOA 1CUKA 1P7DA 1KFTA 1ZQAA 5ALVA 1DGJA 4UAZA 2MUTA 5IIJA 2R8GA 3V6HA 1Q3UA 4DFMA 1L7MA 3I76A 2HHTA 4NWIA 1T8EA 4DL4A 2OEHA 1X66A 3HP6A 2K4EA 3AN1A 4I2BA 7ICUA 3M6ZA 3CW2C 2BQUA 4Y2TA 3WKEA 1T4GA 1TV9A 1KLNA 1Z4OA 2KOBA 2DKXA 2XGQA 5DLFA 2NRWA 1Z00B 4DQQA 9ICEA 4HYKA 5KAFU 1TE2A 2UVUA 5EWFA 1NK6A 2MU2A 1A76A 2K4HA 4GXKA 4HAIA 2HVHA 4MF8A 2ALZA 3UM9A 5J0OA 3QUCA 3M1YA 3ONNA 3JPTA 3Q8PB 4DL7A 2C22A 4F72A 5AK6A 4EZ6A 4QJFB 4M6WB 3QU9A 4ECUA 2B6GA 4GXJA 3PSFA 5TISU 2MAXA 2AXTU 2XIDA 1L7NA 1MA7A 3WKDA 3FYHA 2K8BB 2LBOA 4Y2JA 4BGDA 3V6JA 4PZNA 1ZQLA 5HHHA 4TURA 3GFKB 4F71A 1Z00A 1O03A 5J2DA 2JXJA 5AKIA 4FZLA 1HUOA 4I2HA 2KVCA 3PVXA 2LMRA 3OTQA 3IG5A 4JK1A 2OM6A 2AH5A 3SV3A 1EXNA 5F3XB 3C21A 4M6WA 5EE1A 5J2JA 4DLGA 2LYBA 1DK2A 2K89A 7ICKA 3C5FA 4ED1A 2KJ9A 2XGPA 9ICUA 3QUTA 2KKPA 4Y2QA 4M9JA 4DSLA 1TFRA 5DDYA 3RB6A 1RPLA 1X9SA 1SL0A 4DLEA 1D8LA 8ICNA 4UARA 3IRUA 5DB9A 2B21A 4YMOA 3ORYA 3HX0A 3QU5A 2W9BB 4USAA 2ZTCA 3WKBA 3HILA 3RFAA 5DDMA 3V72A 5HHIA 5DB6A 3RTVA 4RQ1A 3NASA 8ICUA 1MQ2A 1N63A 4IR1A 1JROA 5KFCA 3BS5B 3PR4A 4KX5A 2KFNA 4KITB 5J0WA 3QUQA 1F44A 2WF7A 1F0MA 2HI0A 3NRWA 4RQ2A 3IN5A 1K1SA 2G5HB 2KSOB 1TVAA 3B0YA 4R63A 2PFQA 4KN7A 3H4BA 5DB8A 2NRXA 4OJ6A 5KFNA 5ALOA 3JPPA 2K8CB 1T7PA 2W9BA 1D9FA 4A8EA 5ALTA 3PMNA 4UAWA 7ICLA 2ISOA 2VJ4A 2YN4A 4UQGA 8ICCA 4QZIA 1ZQEA 3RJHA 3BS5A 2KJ5A 2G07A 4F5QA 1CI4A 5KL1B 4UAYA 5EOZA 4R64A 2IBKA 1IG6A 2F2AB 5ALSA 4TUPA 1JIHA 1Q8KA 4YP3A 1TKDA 1V85A 2OWOA 2VA8A 3TANA 4XA5A 3V6KA 2VANA 8ICIA 4RZRA 3C28A 1X6IA 4C8NA 4AYBC 2KSOA 1IM4A 4RQ5A 4ED3A 1ZQWA 2RHFA 4C8MA 3CYMA 1L8LA 5J2EA 1MN8A 4IQTA 4O5CA 2P6RA 2KE7A 3PMLA 3Q8KA 5KT5A 3VC8A 1KL9A 1NOMA 1OXJA 4YXMA 4NM1A 1BGXT 1KRPA 4C7YA 1YT3A 2M0NA 4IRKA 4IRDA 3IG8A 1QTMA 2HBKA 2ESEA 5AM3A 3JPSA 9ICSA 5KAIU 3L4PA 4ECRA 3IM1A 4BXOB 4F91B 2YMPA 1DXSA 3N7PD 5GTIU 5DQIA 2ZUBA 2R8HA 3BQ7A 5IILA 2YTUA 3H40A 3BZKA 4K4GA 1V38A 1KN5A 4I2IA 1ZRNA 1TK8A 5KTQA 2Y0SC 8ICTA 2E8MA 2EZZA 4RQ3A 4I2FA 4PGXA 1L7PA 4KLGA 1SWWA 2F8KA 1FFUA 4Y2XA 4X5VA 2YMQA 5ALKA 3GV5B 3HKZC 5TZVA 5J2AA 3ZDCA 4B9SA 4RPZA 2KIVA 1T3NA 3AEVA 5AI4A 2JGAA 3WK5A 3RAQA 1ZQPA 2VA3A 3MGIA 4Z6EA 2ZJ8A 1N60A 1HJPA 4KMUA 4QZCA 1QLNA 2ZIWB 5KFDA 3F2CA 4ED2A 3H8SA 4IQWA 2C28A 1ZQOA 1N2XA 2MA1A 4F5RA 2R8KA 4KLLA 3SD7A 3TARA 2JZBB 3WK4A 3M7DA 1SXDA 3H0MB 4CNQA 2KZZA 1ZD3A 1TK5A 3RJEA 1FEZA 1URJA 2I5HA 2OH2A 1XSLA 3WK7A 5JU5A 4RUAA 2PMZF 4GLXA 2WB1F 3EUB2 2WAQC 5J0QA 1SWVA 2D3DA 5KFSA 5AI9A 8ICBA 4C8OA 2ZIWA 1ZD5A 4IL6U 5JRTA 2GO7A 1L3SA 4AP9A 5KFKA 1Q46A 3QU2A 2HHQA 2JZBA 3Q8QB 5ALJA 5KT2A 3MFHA 5KG4A 4RPXA 1RYRA 1XWLA 8ICWA 4Q45A 3TAQA 4F5OA 2PI5A 9ICOA 4EENA 5DG8A 3DEEA 4YMMA 3LDAA 9ICXA 4OJOA 4FBTA 5IIKA 2UVWA 4I28A 1OW5A 1TAQA 2KNJA 2W54A 1N62A 2DPIA 4NLZA 2EAPA 5BPCA 4O3PA 3IHQB 4Z6DA 3TADA 7ICHA 2ASJA 1WCLA 1KFDA 1ZD2P 2H3ZA 3H8MA 5ALWA 2RDIA 1M6YA 2YQEA 8ICSA 2LYAA 3F53A 2EH9A 2A3VA 9ICMA 4KN4A 2LI6A 2YY6A 3PSTA 2ZTEA 1SGGA 3BS7A 4NY8A 2KP7A 1ZJMA 2KZMA 5KFTA 1JUDA 1KKXA 1COOA 1WYGA 2BR0A 5A0LA 4KLIA 2GWSA 3QU4A 5CP2A 1UCVA 4F4ZA 1ZQCA 3JPOA 1FO4A 3NS1A 2KVSA 1U9LA 2CPRA 9ICIA 3AQFA 2NRZA 5DKWA 4M9GA 2EAMA 4WJ3B 5B66U 4P4PA 3UPQA 3DDHA 5HNKA 2IHMA 5AI6A 5KFVA 4O5KA 7ICEA 2FMQA 4J9RA 3L3FX 3KZXA 4NM2A 4ZOHC 1NJYA 4M04A 2ZUDA 5ALZA 2KIWA 4UW9A 4KLUA 4DS5A 2Y1JA 5AM4A 3UQ2A 2F3NA 2ODGA 3ZD8A 4EX7A 1Z1BA 3ZDAA 3BQTA 5AKJA 3JPNA 1BPDA 5KG3A 3PW5A 2ZXIA 5KFGA 2ZG6A 4RQ4A 4Z6CA 2F44A 1NJXA 4R8UB 4YG2A 3MGHA 1S0VA 2H3QA 4RQMA 2HDOA 4M9HA 1MC8A 3KFUF 2GOLA 5AKHA 3AM9A 4NLKA 1VDVA 1ZXIA 4Z6FA 4EBCA 4QWBA 5KT6A 2C2EA 2HHUA 2KJ8A 2BCVA 2BDUA 3OHBA 2Q0ZX 2OHFA 2HBLA 2O6KA 7ICFA 3TACB 2A1AA 2XVTA 2Z7JA 3MDAA 2W9CB 2HOQA 4ECYA 2YMLA 4YCXA 7ICVA 3N7RC 1S97A 5ALPA 1BPYA 5J0YA 2XCPA 1CEZA 1RM6C 3WKCA 2G09A 1V9PA 4QZEA 2BHNA 2H3FA 2KEYA 5F9NA 3GDXA 4R8UA 1ZQQA 4XUSA 2UVVA 4J9SA 2WFAA 3KOOA 3UMGA 4EEYA 2ASLA 4C4RA 4C4SA 4OCZA 4BJQA 5J2IA 1NZPA 1S5LU 2K60A 4UAUA 5AHXA 1IXRA 1NKEA 2W9CA 5DB7A 2NV3A 4Y2SA 3H8WA 2AQ4A 4DO9A 2H3VA 2F1JA 5HR7A 2NRTA 4QWEA 2F8LA 4QW8A 5DLGA 1L5UA 2ISPA 8ICLA 3MR5A 4UATA 5AM2A 4DF8A 3N97B 1ECWA 1XU4A 2IHNA 1OUQA 1JXLA 5KFAA 5DGAA 4F50A 5L1KA 8ICAA 3OGUA 4YXJA 2W43A 3D6JA 3EPGA 4O3QA 1N56A 5CB1A 2DWQA 1XO0A 5EE0A 2WTFA 7ICPA 5ALDA 4XQ8A 1LB2B 1PVQA 4YD2A 4YD1A 2ZUCA 2BDPA 4KLQA 3SYZA 1N5XA 3ICXA 2PKEA 5E79U 4CF5A 5EWGA 1UQVA 5CA7A 4NJ8A 1AQ6A 4RUCA 4O0IA 3ZDEA 4E0DA 3HWTA 5KFWA 3WK6A 4ECVA 3RR7A 4OJLA 8ICVA 5KT4A 3PX4A 4FFDA 4ECTA 2KHVA 3QEBZ 4ED6A 5J0TA 4DOAA 4RT2A 2F1IA 4GC7A 8ICPA 4CRXA 4FS1A 1ZQUA 3SQIA 1ZYQA 5DQGA 2WF8A 4BWJA 2XCAA 1ZQBA 2BCSA 2DBYA 3KZIU 1Z1VA 4Y2UA 4MEYA 4YVZA 4ELTA 5J2GA 3PW2A 2KICA 5HP4A 3LYSA 5GTHU 4F93B 1RYUA 4O3SA 1IV8A 4JWNA 2JEJA 1A6SA 2F77X 3LWLA 2AU0A 5JTIA 3NVVA 4PJ0U 1V97A 3MFIA 4US8A 8ICRA 5AICA 2P35A 4MHVA 4IQVA 3GIKA 4J03A 3RBDA 3T5HA 5KFXA 1S77D 4B6JA 2RDJA 2BGWA 3PSPA 4AYBF 5J0PA 4P2HA 4OD0A 3WKAA 1KFSA 4DSFA 2NO4A 3SR6A 3ETRA 4B9LA 7ICGA 4ECZA 5AKLA 3TADC 1L8OA 2R8JA 2QB1A 2WHEA 1SIJA 1ZQGA 5L1JA 5AKYA 9ICCA 2DFLA 4I2AA 3OJUA 3E58A 4GXIA 2Q4TA 2E8PA 5J0SA 2WF6A 3FDSA 1Z3EB 2AGQA 4QIWC 9ICGA 1UA1A 4RT3A 3ALRA 4BUGA 4M2YA 3GIIA 5KFLA 5DBCA 4QZDA 5AK4A 5KFMA 1PVPA 4FE3A 3BQ1A 5KG0A 5AK3A 4J9QA 4O3NA 3E0FA 4Q43A 2R18A 3QUBA 5KT7A 1KBUA 5CRXA 4OJPA 2Y0SF 4UB5A 3M9NB 2LM1A 4PL2A 5AM1A 5J8YA 3PR5B 3TI0A 4MEXA 1YZ6A 1ZQTA 9ICHA 4DEZA 5CJ7A 2NYVA 3HKZF 3RH6A 4EZ9A 3L5KA 2H3IA 2FI1A 2F1HA 2KG5A 5G5GA 1QSSA 3SI8A 3FAHA 3GZFA 4XRHA 2M9NA 4RQ8A 2W3SA 5EWEA 2NO5A 4MFFA 1COKA 3E2EA 1A77A 2QARB 5IIIA 4DSEA 1QSLA 3ED5A 3H7IA 3MABA 2FJ6A 2HBJA 4CE6A 2RLTA 9ICJA 4MFCA 4YR3A 5DBBA 3KHLA 4DQIA 2XY6A 1JX4A 3ETLA 1F5SA 1QQ5A 1NJWA 3UMBA 5AI0A 1PVRA 2BQRA 5J2KA 2MSNA 3K4GA 3I28A 1XNSA 4KTQA 1Z4NA 2WAQF 2J6SA 4GFJA 4CF3A 1TAMA 3KHHA 1WUDA 1CRXA 4ELVA 1KW4A 1YZ7A 1L3TA 5KG5A 3SEIA 4QW9A 2CRXA 4M9NA 4I2CA 1ZQHA 2QARA 4KLFA 4BXOA 4RNMA 1A0PA 5KL8B 2JV3A 2EZXA 4PGQA 1RYSA 4UB8U 4EBDA 4KLEA 4KLJA 3T5LA 4YQWA 3MR2A 1NK7A 4PHEA 3HJEA 4PL1A 3S6JA 1N61A 2PFNA 3V7LA 1HEKA 2JHDA 4DL5A 3T5JA 3Q8LA 4R65A 1U48A 1NK0A 3NVYA 2G5IB 1ZOLA 3G6XA 3D2SA 1C20A 5CWRA 4QNLA 1S9FA 5FP0A 8ICFA 4J9MA 4U7CA 4QWDA 3BZCA 2BPCA 4QZAA 4CGZA 2K4IA 4ECXA 2AHOB 5ALQA 1ZQ1C 8ICZA 5ALEA 4F3OA 3FM9A 8ICGA 2XC9A 3RF9A 4QZBA 1WWVA 1RQLA 3R9KA 2I1QA 2HOFA 4Y2VA 4LZGA 4P4OA 3C2MA 5IIMA 4RU9A 5AKKA 2KTQA 9ICFA 1WWUA 4KLTA 2HHSA 1BPZA 3ISBA 3K1RB 2Y9UA 2W8LA 1BPXA 3G6VA 3HT3A 4RNNA 3C2KA 3WK9A 4ED7A 1UPHA 1ZQMA 2BCRA 1SKRA 4LVSA 2H5XA 3K1ZA 3ZDDA 4C4TA 5CEHA 1NKBA 3G6YA 3WU2U 4G3IA 2YB1A 2KK0A 5D46A 2PXIA 7ICIA 4FBUA 2KD1A 1KTQA 2JEFA 1PK1B 4F5NA 2FPMA 3ZDBA 4NL9A 1N48A 3HW8A 5KFQA 3NRZA 5KT3A 5L9XA 3M9OB 1U45A 3CNHA 5AKEA 1X6JA 2XO7A 2W9AA 5L1LA 4J9NA 1SXEA 4PHPA 3CRXA 5B5EU 4DS4A 4RQ0A 4J9PA 2RP5A 3OSNA 2E1FA 2HHWA 4CDGA 1KQQA 1J97A 2AJQA 1VLBA 1XS9D 4YN4A 3V7JA 1PZNA 4ZH4A 2N1RA 5KG6A 4UASA 1LV5A 3DV9A 1DOQA 2G06A 3F5EA 2ASDA 4LJXA 3MDCA 1K1QA 1UT8A 1C7YA 1NK9A 1PK1A 1B22A 2BZFA 3IV6A 3PX6A 2LKYA 3IDWA 3U26A 2EZYA 3H8JA 4UB1A 2AGOA 4C7ZA 2OXOA 5HR6A 4DL3A 3GU3A 1SV0A 4EELA 4FZNA 1HUZA 2XY7A 1ZD4A
chains in the Genus database with same CATH topology
2GOLA 3C29A 3N7SC 2VJ4A 2W04A 3D2NA 1XO0A 4JMUA 2G08A 1PVRA 2KVCA 1PVQA 2H3ZA 3OPXA 2JGAA 1XNSA 2KJ8A 2KJ5A 2G07A 3ICXA 3IG5A 5KL1B 2HOIA 2OM6A 2BDUA 2LYAA 3SMVA 1P7DA 2WAQF 3F53A 1NZBA 2HBLA 4GFJA 3VCBA 2Q4TA 2A3VA 2F2AB 1UPHA 1TAMA 2JMGA 1WUDA 2ZIWB 4FZLA 2W7PA 3PSTA 1CRXA 4P0PA 3F2CA 3CP8A 3K1ZA 3LVWA 2XVTA 2VIXA 2Z7JA 2LYBA 1Q3UA 4ICAA 2MA1A 2ZIXA 2HOQA 3C28A 2K89A 4NWIA 4AYBC 2KHQA 3PZPA 3M7DA 4NV0A 4QIWC 2CRXA 3N7RC 2YB1A 3H0MB 2KJ9A 2JH7A 2K4EA 2DGZA 2RHFA 4OJLA 3M6ZA 5A0LA 2E1EA 3CYMA 3ALRA 2KD1A 1A0PA 3LVVA 5KL8B 4BUGA 3M6KA 2ZIVB 2KKPA 1PVPA 4FE3A 4O3MA 3MGVA 1IIPA 2G09A 2K8AA 1Z19A 3VC8A 2H3FA 2KEYA 1D8BA 1URJA 3E0FA 2R18A 2KOBA 2DF4B 2KHVA 2ZIUB 4P0QB 3SAGA 2OH2A 1YT3A 2M0NA 1KBUA 3AL0B 2F76X 4PL1A 4CRXA 5CRXA 4OJPA 2OYYA 1ED1A 2Y0SF 2PMZF 3F5AA 2W03A 5T14A 2WB1F 3IG8A 2JHDA 1HEKA 2G0AA 4PL2A 3SAFA 2WAQC 3SQIA 2CPRA 3AQFA 2GH1A 4OJ5A 3RFAA 2KKVA 2HBMA 2HBKA 3CRXA 2G5IB 1L6NA 2JH1A 3D2SA 4BJQA 2KICA 2RP5A 4QNLA 4WJ3B 2K4HA 3LYSA 2E1FA 3AQEA 2ZIWA 4CDGA 4KX5A 4IC9A 3HKZF 2XI9A 4U7CA 2KV2A 3ONNA 4KX3A 4ACOA 3L3FX 3KZXA 2NV3A 3N7PD 3H0RB 4BX9C 2YX8A 2H3IA 2N1RA 1F44A 2D6FC 1A6SA 4NLBA 2F77X 4QJFB 2H3VA 3SAHA 2RRDA 3H0LB 4CGZA 5HR7A 2KIWA 3NRWA 3NUQA 4P0PB 1HIWA 2F8LA 2E5SA 3T79A 2LHTA 2G06A 2VJ5A 3F5EA 2HMXA 3GZFA 1DRGA 3IN5A 2K4IA 3PSFA 2ZIVA 2ZIXB 2MRLA 3F2DA 4NLCA 4KMOB 2G5HB 4U6PA 4OO1J 1ZQ1C 3DEEA 1Z1BA 2Y0SC 3F2BA 2XIDA 2DQNB 2YB4A 2PMZC 4OJOA 1ECWA 2WB1C 2XICA 1MA7A 2VKQA 1OUQA 3RF9A 2ZXIA 3PSIA 1GO3F 2K8BB 2ZIUA 2LKYA 4P0QA 3D2QA 2LBOA 4C0ZA 2ZG6A 3PSPA 2KNJA 4OJ6A 4AYBF 2HBJA 5C0YA 2OXOA 4QIWF 2K8CB 1Q3VA 5HR6A 2HOFA 3GU3A 2ZXHA 1T94A 2W7OA 3O0FA 4FZNA 4A8EA 3IP4B 2CN1A 2H3QA 1SZHA 4FZMA 3HKZC 3KFUF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AL0 B;  2DQN B;  3H0L B;  3KFU F;  3H0M B;  4WJ3 B;  2DF4 B;  3IP4 B;  2F2A B;  2G5I B;  2G5H B;  3H0R B;  2D6F C;  1ZQ1 C; 
#chains in the Genus database with same CATH topology
 4KLD A;  3N7S C;  8ICM A;  5AIB A;  1PK3 A;  2EAN A;  3RB0 A;  5C5J A;  3MR3 A;  1O08 A;  1QCK A;  4I29 A;  2QB0 B;  3FC4 A;  9ICQ A;  4QZH A;  5KFJ A;  5EE9 A;  4I2E A;  1WG8 A;  4ECS A;  2W8K A;  2BKE A;  3RBE A;  2IMW P;  2AGP A;  4MF2 A;  1ZET A;  1NJZ A;  3PZP A;  1BPB A;  5DG9 A;  4ELU A;  3QYP A;  4YFK A;  4QZ9 A;  4O3M A;  5DBA A;  3SV4 A;  9ICW A;  4C8L A;  8ICK A;  1TAU A;  1L7O A;  2V4Q A;  8ICJ A;  3KHG A;  1ED1 A;  3C23 A;  4JV0 A;  3RJF A;  3F5A A;  4DQP A;  4JUZ A;  3NVZ A;  3A0B U;  1B4F A;  1ZQY A;  2HBM A;  2Y1I A;  1JRP A;  4GC6 A;  2QB0 A;  5AKZ A;  9ICN A;  4EEK A;  5J8Y C;  1SKW A;  4TUQ A;  4ED8 A;  4IC9 A;  1XSP A;  5KFB A;  2WF5 A;  2KV2 A;  5KFP A;  4KX3 A;  2W55 A;  3AU6 A;  4RQN A;  2A1J B;  4P0P B;  3PW7 A;  2P6U A;  4TQS A;  2RQ5 A;  2JR5 A;  2B0C A;  2YB4 A;  4CF4 A;  1PUZ A;  3PSI A;  5J0R A;  1ZJN A;  3UMC A;  5AKG A;  5KFI A;  2JEG A;  2C2R A;  1ZRM A;  7ICO A;  5AI8 A;  2V9W A;  4IRC A;  1SV4 A;  5AM0 A;  2ZXH A;  2W9M A;  3PO4 A;  8ICE A;  4IR9 A;  3C29 A;  4DOC A;  4MFA A;  2WF9 A;  2ES6 A;  4J9K A;  1L3V A;  4C80 A;  3M8R A;  4US9 A;  7ICJ A;  3KKA A;  2HOI A;  3SMV A;  2HVI A;  2A1J A;  2JMG A;  5ALU A;  4P0P A;  5AM5 A;  1RQN A;  2FPK A;  4ICA A;  1RDF A;  2QKQ A;  3SEN A;  1ZQR A;  3PY8 A;  5ALN A;  3TFS A;  1DK3 A;  8ICY A;  4F8R A;  4P4M A;  1S76 D;  3TKA A;  2L5Y A;  1IIP A;  2K8A A;  4F5P A;  5KFZ A;  1X42 A;  2DKZ A;  2AQ0 A;  3J81 j;  3ZI4 A;  4BWM A;  1MSW D;  2ZIU B;  3EWA A;  3RAX A;  1X9M A;  2OYY A;  1S0M A;  4I2J A;  3QE9 Y;  3HPO A;  3QZ8 A;  9ICL A;  2QLT A;  5J0X A;  3GIJ A;  2BCU A;  5K4L A;  5ALH A;  4ED0 A;  2JH1 A;  1SZP A;  4QZ8 A;  1SKS A;  3AQE A;  4Q44 A;  3AUO A;  2KN7 A;  1T3Q A;  4UB6 U;  1KSP A;  4ACO A;  2P66 A;  5DQH A;  1NI3 A;  2D6F C;  9ICP A;  4NLB A;  3Q8M A;  1WCN A;  4YR0 A;  1RG6 A;  2FMS A;  3C2L A;  2LHT A;  1DRG A;  1ZQF A;  1BNO A;  4NLC A;  3A0H U;  2HHX A;  4OO1 J;  2E3T A;  4BDP A;  1NNL A;  2ZIU A;  2DPJ A;  4G9B A;  1JI7 A;  5BOM A;  4QIW F;  5KFE A;  2EDU A;  4J9L A;  8ICO A;  2W7O A;  4QZF A;  2ZJA A;  4DF4 A;  2CN1 A;  4UB2 A;  4FZM A;  2IA6 A;  5HML A;  1QQ7 A;  5KG1 A;  5J2C A;  1XC9 A;  3MC1 A;  5AK5 A;  4DSI A;  5KFO A;  4O3R A;  3GIL A;  2I6X A;  4O9M A;  1L3U A;  5CR0 A;  1RXV A;  4I2G A;  1NK5 A;  2W11 A;  3BQ2 A;  4B9T A;  1X9W A;  2FE9 A;  2HW3 A;  5ALI A;  3MR6 A;  1JN3 A;  2DUY A;  4KLH A;  3EW9 A;  3NVW A;  2KHQ A;  2KFZ A;  1SL2 A;  1FFV A;  9ICR A;  2ZJ5 A;  4EBE A;  3B0X A;  4ECW A;  2KMD A;  3RB3 A;  3LVV A;  5KFU A;  1BVS A;  3M8S A;  1NK8 A;  1J2N A;  5G5H A;  1H38 A;  2DF4 B;  4NL9 C;  5IIO A;  5F9L A;  2W03 A;  5J2H A;  2GH1 A;  4OJ5 A;  1LVH A;  5D4B A;  2KKV A;  4K4H A;  9ICB A;  3RB4 A;  3Q8R B;  1XO1 A;  4UB4 A;  4GIB A;  1U4B A;  2ZTD A;  3AU2 A;  4KLS A;  1K5O A;  7ICM A;  1UA0 A;  3ISD A;  3PO5 A;  4B9N A;  2IOF K;  4EYH B;  4Y2R A;  4J9O A;  1HIW A;  4F92 B;  1ZQS A;  3NGD A;  2MRL A;  1ZQD A;  4KMO B;  2XY5 A;  3THV A;  7ICN A;  2XIC A;  1GO3 F;  3D2Q A;  2UVR A;  5C0Y A;  7ICT A;  4IQU A;  3QNM A;  4EYI B;  2FLP A;  3KD3 A;  3ISC A;  4QZG A;  4UB3 A;  2OCE A;  1SV0 C;  2W04 A;  3N4M B;  4DQR A;  1SB3 C;  5KFF A;  3PV8 A;  7ICR A;  2KZ3 A;  1ZQN A;  1MQ3 A;  4CCH A;  3N28 A;  5ALY A;  1BPE A;  5ALF A;  4LZD A;  2J6T A;  1X40 A;  3CP8 A;  2VIX A;  3TAP A;  3C1Y A;  4B9M A;  4YMN A;  4B9V A;  2E8N A;  4C8K A;  2JH7 A;  4JV2 A;  2GLE A;  2PFP A;  4DFK A;  2ZIV B;  4PH5 A;  1QH9 A;  3EZ5 A;  5KG2 A;  1S8O A;  1Y88 A;  3QU7 A;  4JV1 A;  9ICK A;  4DFJ A;  5ALL A;  1SL1 A;  2F76 X;  3RRG A;  7ICQ A;  1QQ6 A;  5T14 A;  3SZ2 A;  5HMM A;  3SAF A;  3JPR A;  3MBY A;  4FS2 A;  2E8O A;  5L1M A;  3T5K A;  4FO6 A;  3LK9 A;  4F2S A;  3LWM A;  1FIQ A;  4NLG A;  1ZQX A;  4BX9 C;  4RQ7 A;  3NTU A;  4Q8E A;  2RRD A;  3H0L B;  1NKC A;  3T3F A;  3NUQ A;  2E5S A;  3T79 A;  1U49 A;  2HMX A;  3UXO A;  2ZIV A;  3C1Z A;  2ZIX B;  4QWA A;  1B43 A;  4I27 A;  5DGB A;  2FMP A;  4B9U A;  3GV7 B;  3GV8 B;  5KFY A;  2VKQ A;  5D49 A;  3RJG A;  4JB3 A;  3BQ0 A;  1J2M A;  5EE3 A;  5J0U A;  3IP4 B;  5AIA A;  2EAO A;  4RPY A;  7ICS A;  1QSY A;  3M9M B;  2FLN A;  3JPQ A;  2BPF A;  3BJY A;  4DL2 A;  5ALM A;  1NZB A;  4DSJ A;  2FLL A;  3VCB A;  3KKA C;  1ARO P;  2W7P A;  4UBC A;  5H2F U;  5ALR A;  1D8Y A;  4YR2 A;  2J6U A;  2ZIX A;  3BDP A;  2HHV A;  2DGZ A;  4DCC A;  2E1E A;  1TK0 A;  5J29 A;  2JEI A;  5ALG A;  3RH5 A;  3UXP A;  3PX0 A;  3MGV A;  2BCQ A;  4O3O A;  3B9J A;  4UAV A;  1Z19 A;  1D8B A;  2K4P A;  3HRD D;  3SAG A;  3KHR A;  2IOF A;  3AL0 B;  3RH4 A;  2LYH A;  4F4W A;  1ZQJ A;  8ICH A;  3RR8 A;  1JXE A;  1L6N A;  3AMZ A;  1D9D A;  2PFO A;  2PI4 A;  3H0R B;  3V7K A;  2YX8 A;  4M9L A;  2CXY A;  5JUM A;  4EX6 A;  4I2D A;  3PW4 A;  4F2R A;  4KLM A;  4F4X A;  4R66 A;  5CHG A;  5IIN A;  5KG7 A;  3F2B A;  1KDH A;  2PMZ C;  2A19 A;  1ZQV A;  2WB1 C;  4F4Y A;  1VJ5 A;  4PHA A;  3I1Y A;  1KEJ A;  4C0Z A;  2V4R A;  3K75 D;  4Y2Y A;  3RRH A;  1T94 A;  5DG7 A;  2BQ3 A;  4K4I A;  4IS7 A;  4JMU A;  2JRZ A;  4NXZ A;  2LM4 A;  5AI5 A;  1JAL A;  8ICQ A;  1ZQK A;  4PPX A;  1ZQI A;  3RJK A;  1RZT A;  1N5W A;  2IOH A;  3OHA A;  3QXG A;  5L1I A;  2FDR A;  4ECQ A;  1NK4 A;  3LVW A;  2I9G A;  5AKX A;  2C2D A;  1B0X A;  3QX7 A;  4NV0 A;  4M0A A;  4M47 A;  3PNC A;  1UT5 A;  1UHU A;  4DFP A;  3M6K A;  3WK8 A;  2BPG A;  9ICV A;  3OSP A;  4DFD A;  3RJJ A;  3H4D A;  5BOL A;  2YMM A;  3QZ7 A;  4P0Q B;  3PW0 A;  2VA2 A;  5ALX A;  4TUS A;  1X2I A;  3EYZ A;  2R8I A;  2G0A A;  3TQ1 A;  4F4K A;  4PGY A;  3KBB A;  1S10 A;  4DL6 A;  3QEA Z;  5J2B A;  5KNI A;  5J2F A;  9ICA A;  1JMS A;  1S0O A;  4QWC A;  2LPE A;  4DWI A;  3OJS A;  4RQ6 A;  1LKY B;  2XI9 A;  1DGS A;  4Q8F A;  5KFH A;  4PHD A;  2DL0 A;  3SAH A;  2MUT B;  3C5G A;  1S0N A;  2D8C A;  4KLO A;  2VJ5 A;  2NRV A;  4O5E A;  3F2D A;  1X9X A;  4PZO A;  4U6P A;  2DQN B;  4DSK A;  3RJI A;  4Y2P A;  1RXW A;  3KTQ A;  1BNP A;  4P0Q A;  3ZD9 A;  3Q8S B;  2W3R A;  3UQ0 A;  2ATL A;  1XSN A;  1Q3V A;  3GQC A;  3UXN A;  2FPL A;  4TQR A;  3O0F A;  3GIM A;  4JWM A;  1SZH A;  4NLN A;  2HSZ A;  2HCF A;  3D2N A;  2G08 A;  2EQY A;  4DQS A;  9ICT A;  1U47 A;  1ZQZ A;  3OPX A;  4UBB A;  3TFR A;  4DOB A;  1LKY A;  2Y9T A;  5KFR A;  8ICX A;  3EPI A;  4RNO A;  1CUK A;  1P7D A;  1KFT A;  1ZQA A;  5ALV A;  1DGJ A;  4UAZ A;  2MUT A;  5IIJ A;  2R8G A;  3V6H A;  1Q3U A;  4DFM A;  1L7M A;  3I76 A;  2HHT A;  4NWI A;  1T8E A;  4DL4 A;  2OEH A;  1X66 A;  3HP6 A;  2K4E A;  3AN1 A;  4I2B A;  7ICU A;  3M6Z A;  3CW2 C;  2BQU A;  4Y2T A;  3WKE A;  1T4G A;  1TV9 A;  1KLN A;  1Z4O A;  2KOB A;  2DKX A;  2XGQ A;  5DLF A;  2NRW A;  1Z00 B;  4DQQ A;  9ICE A;  4HYK A;  5KAF U;  1TE2 A;  2UVU A;  5EWF A;  1NK6 A;  2MU2 A;  1A76 A;  2K4H A;  4GXK A;  4HAI A;  2HVH A;  4MF8 A;  2ALZ A;  3UM9 A;  5J0O A;  3QUC A;  3M1Y A;  3ONN A;  3JPT A;  3Q8P B;  4DL7 A;  2C22 A;  4F72 A;  5AK6 A;  4EZ6 A;  4QJF B;  4M6W B;  3QU9 A;  4ECU A;  2B6G A;  4GXJ A;  3PSF A;  5TIS U;  2MAX A;  2AXT U;  2XID A;  1L7N A;  1MA7 A;  3WKD A;  3FYH A;  2K8B B;  2LBO A;  4Y2J A;  4BGD A;  3V6J A;  4PZN A;  1ZQL A;  5HHH A;  4TUR A;  3GFK B;  4F71 A;  1Z00 A;  1O03 A;  5J2D A;  2JXJ A;  5AKI A;  4FZL A;  1HUO A;  4I2H A;  2KVC A;  3PVX A;  2LMR A;  3OTQ A;  3IG5 A;  4JK1 A;  2OM6 A;  2AH5 A;  3SV3 A;  1EXN A;  5F3X B;  3C21 A;  4M6W A;  5EE1 A;  5J2J A;  4DLG A;  2LYB A;  1DK2 A;  2K89 A;  7ICK A;  3C5F A;  4ED1 A;  2KJ9 A;  2XGP A;  9ICU A;  3QUT A;  2KKP A;  4Y2Q A;  4M9J A;  4DSL A;  1TFR A;  5DDY A;  3RB6 A;  1RPL A;  1X9S A;  1SL0 A;  4DLE A;  1D8L A;  8ICN A;  4UAR A;  3IRU A;  5DB9 A;  2B21 A;  4YMO A;  3ORY A;  3HX0 A;  3QU5 A;  2W9B B;  4USA A;  2ZTC A;  3WKB A;  3HIL A;  3RFA A;  5DDM A;  3V72 A;  5HHI A;  5DB6 A;  3RTV A;  4RQ1 A;  3NAS A;  8ICU A;  1MQ2 A;  1N63 A;  4IR1 A;  1JRO A;  5KFC A;  3BS5 B;  3PR4 A;  4KX5 A;  2KFN A;  4KIT B;  5J0W A;  3QUQ A;  1F44 A;  2WF7 A;  1F0M A;  2HI0 A;  3NRW A;  4RQ2 A;  3IN5 A;  1K1S A;  2G5H B;  2KSO B;  1TVA A;  3B0Y A;  4R63 A;  2PFQ A;  4KN7 A;  3H4B A;  5DB8 A;  2NRX A;  4OJ6 A;  5KFN A;  5ALO A;  3JPP A;  2K8C B;  1T7P A;  2W9B A;  1D9F A;  4A8E A;  5ALT A;  3PMN A;  4UAW A;  7ICL A;  2ISO A;  2VJ4 A;  2YN4 A;  4UQG A;  8ICC A;  4QZI A;  1ZQE A;  3RJH A;  3BS5 A;  2KJ5 A;  2G07 A;  4F5Q A;  1CI4 A;  5KL1 B;  4UAY A;  5EOZ A;  4R64 A;  2IBK A;  1IG6 A;  2F2A B;  5ALS A;  4TUP A;  1JIH A;  1Q8K A;  4YP3 A;  1TKD A;  1V85 A;  2OWO A;  2VA8 A;  3TAN A;  4XA5 A;  3V6K A;  2VAN A;  8ICI A;  4RZR A;  3C28 A;  1X6I A;  4C8N A;  4AYB C;  2KSO A;  1IM4 A;  4RQ5 A;  4ED3 A;  1ZQW A;  2RHF A;  4C8M A;  3CYM A;  1L8L A;  5J2E A;  1MN8 A;  4IQT A;  4O5C A;  2P6R A;  2KE7 A;  3PML A;  3Q8K A;  5KT5 A;  3VC8 A;  1KL9 A;  1NOM A;  1OXJ A;  4YXM A;  4NM1 A;  1BGX T;  1KRP A;  4C7Y A;  1YT3 A;  2M0N A;  4IRK A;  4IRD A;  3IG8 A;  1QTM A;  2HBK A;  2ESE A;  5AM3 A;  3JPS A;  9ICS A;  5KAI U;  3L4P A;  4ECR A;  3IM1 A;  4BXO B;  4F91 B;  2YMP A;  1DXS A;  3N7P D;  5GTI U;  5DQI A;  2ZUB A;  2R8H A;  3BQ7 A;  5IIL A;  2YTU A;  3H40 A;  3BZK A;  4K4G A;  1V38 A;  1KN5 A;  4I2I A;  1ZRN A;  1TK8 A;  5KTQ A;  2Y0S C;  8ICT A;  2E8M A;  2EZZ A;  4RQ3 A;  4I2F A;  4PGX A;  1L7P A;  4KLG A;  1SWW A;  2F8K A;  1FFU A;  4Y2X A;  4X5V A;  2YMQ A;  5ALK A;  3GV5 B;  3HKZ C;  5TZV A;  5J2A A;  3ZDC A;  4B9S A;  4RPZ A;  2KIV A;  1T3N A;  3AEV A;  5AI4 A;  2JGA A;  3WK5 A;  3RAQ A;  1ZQP A;  2VA3 A;  3MGI A;  4Z6E A;  2ZJ8 A;  1N60 A;  1HJP A;  4KMU A;  4QZC A;  1QLN A;  2ZIW B;  5KFD A;  3F2C A;  4ED2 A;  3H8S A;  4IQW A;  2C28 A;  1ZQO A;  1N2X A;  2MA1 A;  4F5R A;  2R8K A;  4KLL A;  3SD7 A;  3TAR A;  2JZB B;  3WK4 A;  3M7D A;  1SXD A;  3H0M B;  4CNQ A;  2KZZ A;  1ZD3 A;  1TK5 A;  3RJE A;  1FEZ A;  1URJ A;  2I5H A;  2OH2 A;  1XSL A;  3WK7 A;  5JU5 A;  4RUA A;  2PMZ F;  4GLX A;  2WB1 F;  3EUB 2;  2WAQ C;  5J0Q A;  1SWV A;  2D3D A;  5KFS A;  5AI9 A;  8ICB A;  4C8O A;  2ZIW A;  1ZD5 A;  4IL6 U;  5JRT A;  2GO7 A;  1L3S A;  4AP9 A;  5KFK A;  1Q46 A;  3QU2 A;  2HHQ A;  2JZB A;  3Q8Q B;  5ALJ A;  5KT2 A;  3MFH A;  5KG4 A;  4RPX A;  1RYR A;  1XWL A;  8ICW A;  4Q45 A;  3TAQ A;  4F5O A;  2PI5 A;  9ICO A;  4EEN A;  5DG8 A;  3DEE A;  4YMM A;  3LDA A;  9ICX A;  4OJO A;  4FBT A;  5IIK A;  2UVW A;  4I28 A;  1OW5 A;  1TAQ A;  2KNJ A;  2W54 A;  1N62 A;  2DPI A;  4NLZ A;  2EAP A;  5BPC A;  4O3P A;  3IHQ B;  4Z6D A;  3TAD A;  7ICH A;  2ASJ A;  1WCL A;  1KFD A;  1ZD2 P;  2H3Z A;  3H8M A;  5ALW A;  2RDI A;  1M6Y A;  2YQE A;  8ICS A;  2LYA A;  3F53 A;  2EH9 A;  2A3V A;  9ICM A;  4KN4 A;  2LI6 A;  2YY6 A;  3PST A;  2ZTE A;  1SGG A;  3BS7 A;  4NY8 A;  2KP7 A;  1ZJM A;  2KZM A;  5KFT A;  1JUD A;  1KKX A;  1COO A;  1WYG A;  2BR0 A;  5A0L A;  4KLI A;  2GWS A;  3QU4 A;  5CP2 A;  1UCV A;  4F4Z A;  1ZQC A;  3JPO A;  1FO4 A;  3NS1 A;  2KVS A;  1U9L A;  2CPR A;  9ICI A;  3AQF A;  2NRZ A;  5DKW A;  4M9G A;  2EAM A;  4WJ3 B;  5B66 U;  4P4P A;  3UPQ A;  3DDH A;  5HNK A;  2IHM A;  5AI6 A;  5KFV A;  4O5K A;  7ICE A;  2FMQ A;  4J9R A;  3L3F X;  3KZX A;  4NM2 A;  4ZOH C;  1NJY A;  4M04 A;  2ZUD A;  5ALZ A;  2KIW A;  4UW9 A;  4KLU A;  4DS5 A;  2Y1J A;  5AM4 A;  3UQ2 A;  2F3N A;  2ODG A;  3ZD8 A;  4EX7 A;  1Z1B A;  3ZDA A;  3BQT A;  5AKJ A;  3JPN A;  1BPD A;  5KG3 A;  3PW5 A;  2ZXI A;  5KFG A;  2ZG6 A;  4RQ4 A;  4Z6C A;  2F44 A;  1NJX A;  4R8U B;  4YG2 A;  3MGH A;  1S0V A;  2H3Q A;  4RQM A;  2HDO A;  4M9H A;  1MC8 A;  3KFU F;  2GOL A;  5AKH A;  3AM9 A;  4NLK A;  1VDV A;  1ZXI A;  4Z6F A;  4EBC A;  4QWB A;  5KT6 A;  2C2E A;  2HHU A;  2KJ8 A;  2BCV A;  2BDU A;  3OHB A;  2Q0Z X;  2OHF A;  2HBL A;  2O6K A;  7ICF A;  3TAC B;  2A1A A;  2XVT A;  2Z7J A;  3MDA A;  2W9C B;  2HOQ A;  4ECY A;  2YML A;  4YCX A;  7ICV A;  3N7R C;  1S97 A;  5ALP A;  1BPY A;  5J0Y A;  2XCP A;  1CEZ A;  1RM6 C;  3WKC A;  2G09 A;  1V9P A;  4QZE A;  2BHN A;  2H3F A;  2KEY A;  5F9N A;  3GDX A;  4R8U A;  1ZQQ A;  4XUS A;  2UVV A;  4J9S A;  2WFA A;  3KOO A;  3UMG A;  4EEY A;  2ASL A;  4C4R A;  4C4S A;  4OCZ A;  4BJQ A;  5J2I A;  1NZP A;  1S5L U;  2K60 A;  4UAU A;  5AHX A;  1IXR A;  1NKE A;  2W9C A;  5DB7 A;  2NV3 A;  4Y2S A;  3H8W A;  2AQ4 A;  4DO9 A;  2H3V A;  2F1J A;  5HR7 A;  2NRT A;  4QWE A;  2F8L A;  4QW8 A;  5DLG A;  1L5U A;  2ISP A;  8ICL A;  3MR5 A;  4UAT A;  5AM2 A;  4DF8 A;  3N97 B;  1ECW A;  1XU4 A;  2IHN A;  1OUQ A;  1JXL A;  5KFA A;  5DGA A;  4F50 A;  5L1K A;  8ICA A;  3OGU A;  4YXJ A;  2W43 A;  3D6J A;  3EPG A;  4O3Q A;  1N56 A;  5CB1 A;  2DWQ A;  1XO0 A;  5EE0 A;  2WTF A;  7ICP A;  5ALD A;  4XQ8 A;  1LB2 B;  1PVQ A;  4YD2 A;  4YD1 A;  2ZUC A;  2BDP A;  4KLQ A;  3SYZ A;  1N5X A;  3ICX A;  2PKE A;  5E79 U;  4CF5 A;  5EWG A;  1UQV A;  5CA7 A;  4NJ8 A;  1AQ6 A;  4RUC A;  4O0I A;  3ZDE A;  4E0D A;  3HWT A;  5KFW A;  3WK6 A;  4ECV A;  3RR7 A;  4OJL A;  8ICV A;  5KT4 A;  3PX4 A;  4FFD A;  4ECT A;  2KHV A;  3QEB Z;  4ED6 A;  5J0T A;  4DOA A;  4RT2 A;  2F1I A;  4GC7 A;  8ICP A;  4CRX A;  4FS1 A;  1ZQU A;  3SQI A;  1ZYQ A;  5DQG A;  2WF8 A;  4BWJ A;  2XCA A;  1ZQB A;  2BCS A;  2DBY A;  3KZI U;  1Z1V A;  4Y2U A;  4MEY A;  4YVZ A;  4ELT A;  5J2G A;  3PW2 A;  2KIC A;  5HP4 A;  3LYS A;  5GTH U;  4F93 B;  1RYU A;  4O3S A;  1IV8 A;  4JWN A;  2JEJ A;  1A6S A;  2F77 X;  3LWL A;  2AU0 A;  5JTI A;  3NVV A;  4PJ0 U;  1V97 A;  3MFI A;  4US8 A;  8ICR A;  5AIC A;  2P35 A;  4MHV A;  4IQV A;  3GIK A;  4J03 A;  3RBD A;  3T5H A;  5KFX A;  1S77 D;  4B6J A;  2RDJ A;  2BGW A;  3PSP A;  4AYB F;  5J0P A;  4P2H A;  4OD0 A;  3WKA A;  1KFS A;  4DSF A;  2NO4 A;  3SR6 A;  3ETR A;  4B9L A;  7ICG A;  4ECZ A;  5AKL A;  3TAD C;  1L8O A;  2R8J A;  2QB1 A;  2WHE A;  1SIJ A;  1ZQG A;  5L1J A;  5AKY A;  9ICC A;  2DFL A;  4I2A A;  3OJU A;  3E58 A;  4GXI A;  2Q4T A;  2E8P A;  5J0S A;  2WF6 A;  3FDS A;  1Z3E B;  2AGQ A;  4QIW C;  9ICG A;  1UA1 A;  4RT3 A;  3ALR A;  4BUG A;  4M2Y A;  3GII A;  5KFL A;  5DBC A;  4QZD A;  5AK4 A;  5KFM A;  1PVP A;  4FE3 A;  3BQ1 A;  5KG0 A;  5AK3 A;  4J9Q A;  4O3N A;  3E0F A;  4Q43 A;  2R18 A;  3QUB A;  5KT7 A;  1KBU A;  5CRX A;  4OJP A;  2Y0S F;  4UB5 A;  3M9N B;  2LM1 A;  4PL2 A;  5AM1 A;  5J8Y A;  3PR5 B;  3TI0 A;  4MEX A;  1YZ6 A;  1ZQT A;  9ICH A;  4DEZ A;  5CJ7 A;  2NYV A;  3HKZ F;  3RH6 A;  4EZ9 A;  3L5K A;  2H3I A;  2FI1 A;  2F1H A;  2KG5 A;  5G5G A;  1QSS A;  3SI8 A;  3FAH A;  3GZF A;  4XRH A;  2M9N A;  4RQ8 A;  2W3S A;  5EWE A;  2NO5 A;  4MFF A;  1COK A;  3E2E A;  1A77 A;  2QAR B;  5III A;  4DSE A;  1QSL A;  3ED5 A;  3H7I A;  3MAB A;  2FJ6 A;  2HBJ A;  4CE6 A;  2RLT A;  9ICJ A;  4MFC A;  4YR3 A;  5DBB A;  3KHL A;  4DQI A;  2XY6 A;  1JX4 A;  3ETL A;  1F5S A;  1QQ5 A;  1NJW A;  3UMB A;  5AI0 A;  1PVR A;  2BQR A;  5J2K A;  2MSN A;  3K4G A;  3I28 A;  1XNS A;  4KTQ A;  1Z4N A;  2WAQ F;  2J6S A;  4GFJ A;  4CF3 A;  1TAM A;  3KHH A;  1WUD A;  1CRX A;  4ELV A;  1KW4 A;  1YZ7 A;  1L3T A;  5KG5 A;  3SEI A;  4QW9 A;  2CRX A;  4M9N A;  4I2C A;  1ZQH A;  2QAR A;  4KLF A;  4BXO A;  4RNM A;  1A0P A;  5KL8 B;  2JV3 A;  2EZX A;  4PGQ A;  1RYS A;  4UB8 U;  4EBD A;  4KLE A;  4KLJ A;  3T5L A;  4YQW A;  3MR2 A;  1NK7 A;  4PHE A;  3HJE A;  4PL1 A;  3S6J A;  1N61 A;  2PFN A;  3V7L A;  1HEK A;  2JHD A;  4DL5 A;  3T5J A;  3Q8L A;  4R65 A;  1U48 A;  1NK0 A;  3NVY A;  2G5I B;  1ZOL A;  3G6X A;  3D2S A;  1C20 A;  5CWR A;  4QNL A;  1S9F A;  5FP0 A;  8ICF A;  4J9M A;  4U7C A;  4QWD A;  3BZC A;  2BPC A;  4QZA A;  4CGZ A;  2K4I A;  4ECX A;  2AHO B;  5ALQ A;  1ZQ1 C;  8ICZ A;  5ALE A;  4F3O A;  3FM9 A;  8ICG A;  2XC9 A;  3RF9 A;  4QZB A;  1WWV A;  1RQL A;  3R9K A;  2I1Q A;  2HOF A;  4Y2V A;  4LZG A;  4P4O A;  3C2M A;  5IIM A;  4RU9 A;  5AKK A;  2KTQ A;  9ICF A;  1WWU A;  4KLT A;  2HHS A;  1BPZ A;  3ISB A;  3K1R B;  2Y9U A;  2W8L A;  1BPX A;  3G6V A;  3HT3 A;  4RNN A;  3C2K A;  3WK9 A;  4ED7 A;  1UPH A;  1ZQM A;  2BCR A;  1SKR A;  4LVS A;  2H5X A;  3K1Z A;  3ZDD A;  4C4T A;  5CEH A;  1NKB A;  3G6Y A;  3WU2 U;  4G3I A;  2YB1 A;  2KK0 A;  5D46 A;  2PXI A;  7ICI A;  4FBU A;  2KD1 A;  1KTQ A;  2JEF A;  1PK1 B;  4F5N A;  2FPM A;  3ZDB A;  4NL9 A;  1N48 A;  3HW8 A;  5KFQ A;  3NRZ A;  5KT3 A;  5L9X A;  3M9O B;  1U45 A;  3CNH A;  5AKE A;  1X6J A;  2XO7 A;  2W9A A;  5L1L A;  4J9N A;  1SXE A;  4PHP A;  3CRX A;  5B5E U;  4DS4 A;  4RQ0 A;  4J9P A;  2RP5 A;  3OSN A;  2E1F A;  2HHW A;  4CDG A;  1KQQ A;  1J97 A;  2AJQ A;  1VLB A;  1XS9 D;  4YN4 A;  3V7J A;  1PZN A;  4ZH4 A;  2N1R A;  5KG6 A;  4UAS A;  1LV5 A;  3DV9 A;  1DOQ A;  2G06 A;  3F5E A;  2ASD A;  4LJX A;  3MDC A;  1K1Q A;  1UT8 A;  1C7Y A;  1NK9 A;  1PK1 A;  1B22 A;  2BZF A;  3IV6 A;  3PX6 A;  2LKY A;  3IDW A;  3U26 A;  2EZY A;  3H8J A;  4UB1 A;  2AGO A;  4C7Z A;  2OXO A;  5HR6 A;  4DL3 A;  3GU3 A;  1SV0 A;  4EEL A;  4FZN A;  1HUZ A;  2XY7 A;  1ZD4 A; 
#chains in the Genus database with same CATH homology
 2GOL A;  3C29 A;  3N7S C;  2VJ4 A;  2W04 A;  3D2N A;  1XO0 A;  4JMU A;  2G08 A;  1PVR A;  2KVC A;  1PVQ A;  2H3Z A;  3OPX A;  2JGA A;  1XNS A;  2KJ8 A;  2KJ5 A;  2G07 A;  3ICX A;  3IG5 A;  5KL1 B;  2HOI A;  2OM6 A;  2BDU A;  2LYA A;  3SMV A;  1P7D A;  2WAQ F;  3F53 A;  1NZB A;  2HBL A;  4GFJ A;  3VCB A;  2Q4T A;  2A3V A;  2F2A B;  1UPH A;  1TAM A;  2JMG A;  1WUD A;  2ZIW B;  4FZL A;  2W7P A;  3PST A;  1CRX A;  4P0P A;  3F2C A;  3CP8 A;  3K1Z A;  3LVW A;  2XVT A;  2VIX A;  2Z7J A;  2LYB A;  1Q3U A;  4ICA A;  2MA1 A;  2ZIX A;  2HOQ A;  3C28 A;  2K89 A;  4NWI A;  4AYB C;  2KHQ A;  3PZP A;  3M7D A;  4NV0 A;  4QIW C;  2CRX A;  3N7R C;  2YB1 A;  3H0M B;  2KJ9 A;  2JH7 A;  2K4E A;  2DGZ A;  2RHF A;  4OJL A;  3M6Z A;  5A0L A;  2E1E A;  3CYM A;  3ALR A;  2KD1 A;  1A0P A;  3LVV A;  5KL8 B;  4BUG A;  3M6K A;  2ZIV B;  2KKP A;  1PVP A;  4FE3 A;  4O3M A;  3MGV A;  1IIP A;  2G09 A;  2K8A A;  1Z19 A;  3VC8 A;  2H3F A;  2KEY A;  1D8B A;  1URJ A;  3E0F A;  2R18 A;  2KOB A;  2DF4 B;  2KHV A;  2ZIU B;  4P0Q B;  3SAG A;  2OH2 A;  1YT3 A;  2M0N A;  1KBU A;  3AL0 B;  2F76 X;  4PL1 A;  4CRX A;  5CRX A;  4OJP A;  2OYY A;  1ED1 A;  2Y0S F;  2PMZ F;  3F5A A;  2W03 A;  5T14 A;  2WB1 F;  3IG8 A;  2JHD A;  1HEK A;  2G0A A;  4PL2 A;  3SAF A;  2WAQ C;  3SQI A;  2CPR A;  3AQF A;  2GH1 A;  4OJ5 A;  3RFA A;  2KKV A;  2HBM A;  2HBK A;  3CRX A;  2G5I B;  1L6N A;  2JH1 A;  3D2S A;  4BJQ A;  2KIC A;  2RP5 A;  4QNL A;  4WJ3 B;  2K4H A;  3LYS A;  2E1F A;  3AQE A;  2ZIW A;  4CDG A;  4KX5 A;  4IC9 A;  3HKZ F;  2XI9 A;  4U7C A;  2KV2 A;  3ONN A;  4KX3 A;  4ACO A;  3L3F X;  3KZX A;  2NV3 A;  3N7P D;  3H0R B;  4BX9 C;  2YX8 A;  2H3I A;  2N1R A;  1F44 A;  2D6F C;  1A6S A;  4NLB A;  2F77 X;  4QJF B;  2H3V A;  3SAH A;  2RRD A;  3H0L B;  4CGZ A;  5HR7 A;  2KIW A;  3NRW A;  3NUQ A;  4P0P B;  1HIW A;  2F8L A;  2E5S A;  3T79 A;  2LHT A;  2G06 A;  2VJ5 A;  3F5E A;  2HMX A;  3GZF A;  1DRG A;  3IN5 A;  2K4I A;  3PSF A;  2ZIV A;  2ZIX B;  2MRL A;  3F2D A;  4NLC A;  4KMO B;  2G5H B;  4U6P A;  4OO1 J;  1ZQ1 C;  3DEE A;  1Z1B A;  2Y0S C;  3F2B A;  2XID A;  2DQN B;  2YB4 A;  2PMZ C;  4OJO A;  1ECW A;  2WB1 C;  2XIC A;  1MA7 A;  2VKQ A;  1OUQ A;  3RF9 A;  2ZXI A;  3PSI A;  1GO3 F;  2K8B B;  2ZIU A;  2LKY A;  4P0Q A;  3D2Q A;  2LBO A;  4C0Z A;  2ZG6 A;  3PSP A;  2KNJ A;  4OJ6 A;  4AYB F;  2HBJ A;  5C0Y A;  2OXO A;  4QIW F;  2K8C B;  1Q3V A;  5HR6 A;  2HOF A;  3GU3 A;  2ZXH A;  1T94 A;  2W7O A;  3O0F A;  4FZN A;  4A8E A;  3IP4 B;  2CN1 A;  2H3Q A;  1SZH A;  4FZM A;  3HKZ C;  3KFU F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...