2F2AB

Structure of trna-dependent amidotransferase gatcab complexed with gln
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
408
structure length
408
Chain Sequence
ETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ammonia channel couples glutaminase with transamidase reactions in GatCAB
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
total genus 120
structure length 408
sequence length 408
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2f2aB02
1ZQ1C 2F2AB 3IP4B 2G5IB 2D6FC 3H0MB 2G5HB 3KFUF 2DF4B 3AL0B 2DQNB 3H0LB 4WJ3B 3H0RB
chains in the Genus database with same CATH superfamily
5E79U 1ZETA 2P35A 9ICEA 1S97A 5TISU 4DL7A 3LK9A 1ZXIA 3EPIA 3RH5A 1BPXA 3BDPA 2P66A 2OHFA 4Z6FA 3V72A 1AROP 1WCLA 1ZQCA 7ICJA 8ICLA 4Y2VA 5ALZA 4Z6DA 1UA1A 1TE2A 2JXJA 4OJLA 3PR5B 2VKQA 2OM6A 5L1MA 1WWUA 5JTIA 1DGSA 2RRDA 4RPZA 2F8LA 1ZRNA 5AKKA 3K75D 3GV7B 2FE9A 7ICVA 5DG7A 2JHDA 2IBKA 1L7NA 8ICZA 2FPLA 1FFVA 3BS5B 3RR7A 4M6WB 4ED8A 4OO1J 3JPQA 1ZQTA 5CHGA 2ISOA 4EENA 2R8JA 5AK6A 1JXEA 3ONNA 4CDGA 4Y2PA 1FEZA 3H0MB 3AM9A 1MSWD 2HHUA 2KJ8A 2HOFA 3M9NB 1DK2A 5KFIA 5DGAA 4KLLA 4RQ7A 5KFDA 3PR4A 4QWAA 4AYBF 4R65A 4YN4A 4DQRA 1X6JA 4DL2A 2F1IA 1ZQWA 3QU9A 1TV9A 3GIMA 2BPGA 4ECXA 2FPMA 3OHBA 3L3FX 2XY7A 4DFDA 4F4XA 4QJFB 3M8SA 2W8LA 1BGXT 4DL4A 7ICKA 2KVCA 1ZD3A 5A0LA 3RH4A 2PMZC 2ASDA 2FLLA 4B9TA 2NRVA 3MABA 4I2AA 5KNIA 5AM4A 3RR8A 5HP4A 1B43A 2G5HB 9ICGA 2G5IB 4BX9C 2BDUA 2PMZF 1U45A 5D46A 5AM0A 3D6JA 3QUTA 3ZD9A 4P0QB 8ICKA 2ZIWA 4DL6A 5IIKA 3MDAA 3RB0A 4O3PA 5KFMA 1JX4A 1IXRA 1Q3VA 5ALPA 3J81j 3KKAA 4RUAA 2HHTA 2EAMA 4QWCA 5IIJA 2AGQA 5J2IA 1ZQGA 4GC6A 3N7RC 3RJJA 5J0PA 4F50A 4J9KA 4DFKA 9ICXA 2ZIVB 3WKCA 9ICQA 2RQ5A 2PXIA 5G5HA 5KFYA 2MU2A 4I2CA 1KFTA 1Q8KA 4YD2A 4ED0A 2HDOA 2KNJA 2DBYA 3OGUA 5F9LA 3L5KA 2EAPA 1ZQQA 1WG8A 8ICQA 2P6UA 3ZDDA 2HHXA 1YZ7A 1SXDA 4O5KA 3AL0B 3KHHA 4IL6U 2LPEA 4FE3A 2BPFA 3ETLA 4X5VA 4YXMA 3PX0A 1ZQSA 5ALLA 2VIXA 2KSOA 2E8NA 1Q46A 2ZIUB 4F8RA 1L7PA 2I6XA 1KKXA 4DOBA 3RRHA 4O9MA 4NWIA 4Y2JA 5GTHU 5HNKA 4M9LA 4B9UA 1SL0A 1SIJA 4OJOA 5AKLA 4M9HA 1HJPA 4F93B 3IV6A 1D9DA 4C7ZA 1FO4A 2BQ3A 1NK7A 3MFHA 2EDUA 4P4OA 4QZAA 4UQGA 3BJYA 3BQ7A 3ETRA 2WHEA 1JUDA 3KKAC 5AIBA 2UVWA 1ZQVA 3NTUA 5B5EU 4BDPA 5J2GA 3C1YA 4UAVA 4BXOB 5AICA 3UXPA 4FZMA 4YR3A 4YR0A 5KG3A 2YMQA 2LYBA 1LKYA 4DSIA 2BCQA 3M7DA 4UARA 3LYSA 1ZD4A 1NOMA 2RDIA 3IG5A 8ICSA 5AK5A 2XI9A 4ECYA 4ECWA 4YQWA 8ICFA 5KG0A 2W9MA 1UHUA 4QZBA 1NK4A 3TQ1A 3C21A 2WFAA 4I2GA 3V6JA 4I29A 1TK5A 2E8MA 4USAA 3PMLA 4MHVA 4IRKA 2JR5A 5EE1A 2LM4A 1ZQLA 1RXVA 4LVSA 2JEFA 1X40A 2LYAA 2XGPA 3GQCA 5KFWA 4I2BA 2ZUBA 5KFSA 1XSNA 4DFMA 1UT5A 2KZ3A 5KG1A 5ALTA 2W9CB 4J9RA 3C2KA 3FC4A 7ICLA 5ALQA 2NRWA 3RJEA 1V85A 2NV3A 3UXNA 4RNOA 2LHTA 2KEYA 4FS1A 4QWBA 1NKCA 1N63A 3PNCA 5IILA 1MC8A 2W3RA 3CRXA 2XIDA 3RJHA 1T7PA 3KD3A 4O5EA 5CR0A 5KT2A 2Q0ZX 2B0CA 5ALIA 7ICQA 3WK8A 2Y1IA 3KZXA 2G0AA 2W11A 2W8KA 4R8UB 1MN8A 1X9MA 1DK3A 2ODGA 3WK4A 4LZDA 1UT8A 4RT2A 3RJKA 2MUTB 1Z1VA 1K1SA 4ED1A 1DGJA 3RRGA 4DSJA 1L3SA 3N28A 5ALHA 1T94A 3H0LB 2F77X 4P2HA 4QZDA 1ZQNA 1ZD2P 2V4QA 2JH1A 3PW5A 2BDPA 4YXJA 3A0BU 2OXOA 1CEZA 4EBDA 1SV0A 3UPQA 2Y1JA 2LKYA 2ZXHA 4JK1A 5IIOA 2WB1F 1Z00B 2JEIA 2UVVA 5KFJA 5BOLA 4C8KA 1ZQZA 5KL8B 3C5GA 4ED2A 4JWMA 1SV4A 3QZ7A 4QZIA 4JUZA 5J0OA 8ICVA 3PO5A 1S0MA 3QU7A 5KT4A 4B9VA 2V9WA 4Y2RA 5J29A 1XO1A 4Y2SA 4QZHA 4KLSA 4PHDA 5IIMA 2W9BB 1HEKA 3Q8QB 3AN1A 3HW8A 2DKZA 3TI0A 1TK8A 5L9XA 1BNOA 1QSYA 4UAYA 4OJPA 4IRCA 1D9FA 1HUZA 1NKEA 2HMXA 3AU2A 4C8OA 4EYIB 4UB5A 3R9KA 2ASJA 1SB3C 4ED7A 4QZFA 1ZQAA 3M6ZA 4I2JA 5J2BA 2KSOB 1X9WA 2QARA 2E8OA 2FLNA 4ECSA 2FDRA 5CP2A 5AI4A 2AU0A 1BPDA 7ICFA 5KFQA 2XICA 2IHMA 2AH5A 1Z4NA 3H40A 1D8LA 2KJ5A 3PSPA 2C2RA 3KHRA 3RFAA 4M2YA 4F5PA 3ZD8A 4Z6CA 4Y2TA 2MRLA 3Q8KA 3DDHA 3F5EA 3C5FA 1JMSA 4G3IA 2K8AA 4UB4A 5KFZA 1ZQBA 2C2EA 5ALWA 3FDSA 3QUCA 1A76A 5DBAA 4QW8A 5HHIA 3E58A 1L3TA 3Q8PB 1K5OA 2BGWA 5AM1A 4DL5A 3K1RB 4J03A 1P7DA 5KL1B 5AKHA 2ALZA 4C4SA 3WKAA 1A0PA 2IOHA 2H3FA 5AKXA 4GFJA 2WF5A 9ICSA 3LVVA 2KHVA 2F76X 4ECZA 2LMRA 3VCBA 4WJ3B 8ICRA 3NVVA 5ALUA 5KG7A 1T3QA 1QQ7A 2ZJ5A 4Q8FA 4Y2UA 5EE3A 2F44A 3SENA 3QU5A 3F5AA 2GO7A 3PSIA 4MEYA 4DCCA 1ZQRA 2HW3A 4EBCA 4KMUA 4MF2A 1RYSA 1UQVA 2ESEA 2WF8A 2H3IA 3THVA 2CN1A 2RHFA 3I28A 2QLTA 2W03A 2Y0SC 3NVZA 4PL1A 3LWMA 2GOLA 5AHXA 4DQQA 3IDWA 4BJQA 4KX5A 4U7CA 4GXKA 5ALKA 4GC7A 4YCXA 1ZJNA 2KHQA 2KOBA 5EWFA 2WAQF 3G6YA 5AKZA 3PW4A 1GO3F 4AYBC 2NRTA 1N5WA 1Z19A 4F4YA 4MF8A 3N7SC 4PGYA 4M6WA 4EELA 2IHNA 3T5LA 4CF4A 2B21A 3HT3A 3ED5A 8ICWA 5DB7A 4XA5A 3BQ0A 3NUQA 1BVSA 1U47A 4KLJA 9ICJA 2NRXA 9ICPA 4R64A 4F5OA 5HR7A 7ICOA 4RPYA 4US8A 1SL2A 4RT3A 2C28A 2WF9A 1S0OA 2LYHA 3KBBA 5AI6A 5EOZA 5L1JA 4MFAA 1H38A 3PX6A 2XC9A 2PI5A 2BQUA 1J2MA 4J9OA 2JZBB 3LDAA 1KDHA 1OUQA 3CW2C 4F91B 3H4DA 1QQ5A 4FBTA 4K4GA 3HWTA 1UA0A 5J0UA 4ECQA 3E2EA 2KKPA 3Q8RB 2RP5A 1QQ6A 3V7JA 2QB1A 8ICEA 3HJEA 3V6HA 4JV0A 4DQSA 7ICNA 4PHAA 4B9LA 5ALMA 1QLNA 2JMGA 4M0AA 4NLNA 4US9A 5DBCA 3C28A 4P0QA 1X9XA 2K8CB 4F5NA 2KD1A 4F5QA 2JRZA 4EZ6A 2ES6A 5ALOA 5KFHA 2KFNA 2NO4A 1XSLA 4RQ1A 1B22A 5AK3A 4IQTA 1BPEA 2K4IA 4FS2A 2FMSA 3HX0A 2W7OA 3TFRA 5J0YA 3GILA 3QU2A 2HCFA 2N1RA 1ZQHA 3UMCA 7ICTA 1SL1A 4F72A 2E8PA 3SD7A 4DF4A 3TARA 5J2HA 1J97A 1RYUA 5KFGA 3C1ZA 2FPKA 4KMOB 1SWVA 3GU3A 1UCVA 5KAFU 4O3SA 5KFPA 3Q8SB 1KFSA 4BWJA 3AUOA 3H8WA 7ICSA 1ZQUA 1SXEA 1U4BA 3BZCA 1VLBA 4J9PA 1NJWA 8ICJA 4LZGA 2I9GA 4OCZA 3HPOA 2R18A 1KRPA 4KLOA 5IINA 3EW9A 5ALRA 1KL9A 4J9SA 1JROA 5JUMA 5J2AA 4R66A 3JPOA 4RQNA 9ICBA 2A1JB 1D8YA 4RQMA 3ZDAA 3F2CA 2HBJA 1F44A 5J8YA 1Q3UA 3DV9A 4UAUA 5J2KA 2XO7A 2ZTDA 4DFPA 4ED3A 3EUB2 1SZPA 1PK1A 3HKZF 5KFKA 4TUSA 4BUGA 8ICXA 2KJ9A 2W9CA 5F3XB 4EYHB 2EZZA 9ICAA 5TZVA 3RH6A 2AGPA 1VJ5A 1MQ3A 2BCUA 2G08A 2ZJAA 2BCVA 1NZBA 4FBUA 3GDXA 3TFSA 1O08A 2R8KA 4NLGA 5H2FU 2ZIWB 1NK6A 1U9LA 2XCAA 5KFBA 4QIWF 9ICOA 2DQNB 3H8MA 3H0RB 3ZDBA 3BZKA 4R8UA 2W3SA 1TAQA 1XU4A 3AU6A 4GIBA 1PVQA 4F2RA 9ICIA 1NK5A 1L7MA 1L3UA 1N2XA 4Y2XA 2C22A 5KAIU 2MUTA 4NXZA 3HRDD 4I2DA 4C8MA 3KHGA 2Q4TA 4QWEA 1EXNA 1T8EA 1TAUA 2HVIA 2KZMA 2CRXA 2HHSA 3KOOA 5KFUA 1A77A 2HBMA 4YG2A 3G6VA 8ICMA 3TACB 1Z1BA 2M0NA 4KLIA 4Q43A 4O3RA 2AQ0A 3RJFA 1HUOA 4MEXA 3A0HU 1X66A 1X42A 4F4WA 1ZQFA 2KV2A 7ICGA 3EZ5A 3T5JA 3SAFA 2BKEA 3JPSA 5B66U 7ICEA 1S8OA 3EYZA 1RPLA 8ICTA 5ALGA 2PI4A 5C0YA 1XO0A 5D4BA 5DLGA 2F2AB 3NVYA 3KFUF 3LWLA 5HMLA 1ZD5A 2ISPA 4ACOA 5J0QA 2KTQA 1RZTA 3RBEA 3HP6A 3OTQA 5KT5A 3MBYA 1S9FA 4F5RA 4J9NA 2DWQA 3QXGA 5AI9A 2VA3A 3SV3A 2QARB 4KLQA 5ALYA 2F1JA 2K8BB 4KLEA 3AQFA 4EZ9A 3SAHA 4JB3A 2KG5A 4KLGA 4JWNA 2QKQA 2Y9UA 3WK5A 3TKAA 4KLTA 1ZQJA 2GLEA 2DPJA 2E1EA 1ZRMA 4ECRA 3RB6A 4O3OA 5J0XA 4LJXA 1S77D 4EBEA 2HOQA 3B0YA 3ISBA 3FYHA 4KN7A 5D49A 2PFQA 3ZDCA 3NVWA 3OJSA 3QE9Y 3NRZA 2J6UA 5KFAA 4ZH4A 1X2IA 4IS7A 2R8GA 2GWSA 5L1LA 3SMVA 2EZXA 5DDYA 4DLGA 1JXLA 2P6RA 3M9OB 2C2DA 1QTMA 2VJ4A 5BPCA 3N97B 4HYKA 1KLNA 4RU9A 3TADC 5DG9A 3UMBA 2KVSA 4NL9C 1RQNA 4QNLA 3FM9A 5KFEA 2RLTA 5EE9A 4DL3A 2YB4A 1QSLA 4Z6EA 4KN4A 4RQ0A 2HI0A 4KLDA 5KTQA 3V7LA 3T5KA 2F1HA 1SKWA 2EANA 2W04A 1COOA 3PSFA 3T3FA 1DOQA 1F0MA 5CA7A 2IOFK 2DFLA 2DKXA 2QB0B 8ICPA 4QW9A 8ICIA 5KFCA 2JH7A 1B4FA 1IIPA 4OD0A 4FZLA 2W9AA 1RQLA 2VA2A 1MQ2A 1XWLA 3T5HA 1LB2B 2E3TA 2OEHA 5AK4A 2VANA 4JV1A 1F5SA 1KTQA 5KG6A 4B9NA 2DGZA 1ZYQA 3JPRA 5JRTA 1JALA 2FMPA 4EX7A 8ICOA 4F2SA 3GIKA 2DL0A 4UB6U 3SV4A 4B9MA 4RQ2A 1TAMA 5CEHA 3QU4A 2A1JA 3GV5B 2JGAA 3KZIU 2NRZA 4M9GA 4PHEA 2XY6A 3GIJA 1LKYB 2ZTEA 4I27A 4CF5A 4U6PA 2W43A 3H4BA 4QZCA 4YMOA 1L8OA 3UQ0A 2GH1A 2HBLA 4XUSA 3N4MB 1RG6A 1XS9D 5DKWA 1CI4A 2L5YA 3PX4A 3QX7A 2KZZA 5AKEA 3NASA 5AI5A 4DWIA 3PMNA 2FMQA 1KFDA 5AM2A 2H3VA 3QNMA 2HOIA 1U48A 8ICGA 2DF4B 2YTUA 3Q8MA 3C29A 4RZRA 4DO9A 2VA8A 3QZ8A 3UXOA 5GTIU 2IMWP 1ZQMA 5DGBA 3T79A 2AGOA 5J2CA 2NYVA 3WK7A 1CRXA 4UB2A 4QWDA 2BZFA 1K1QA 4OJ6A 1LV5A 2ZUDA 3QYPA 3DEEA 2PFNA 2A1AA 3RB3A 2LM1A 1ED1A 4BGDA 4CF3A 4TQRA 4ZOHC 5DBBA 1L3VA 5HHHA 1L8LA 4FFDA 4DQPA 3CP8A 1M6YA 1RXWA 5DQHA 5DB9A 4NV0A 4B9SA 3F2BA 9ICHA 2K4PA 1NJZA 1TKDA 2EZYA 3LVWA 4PGXA 1FIQA 4CE6A 5ALVA 1NNLA 1NI3A 5CB1A 4DOCA 4DF8A 1V38A 2LBOA 8ICNA 4C4TA 1KBUA 7ICIA 4PPXA 1BPYA 5AM3A 3MR5A 3RF9A 3ZI4A 4DOAA 2PFOA 4P4PA 2CXYA 2HSZA 1DRGA 2YMLA 3SI8A 3IP4B 2EAOA 3MC1A 4M04A 1Z3EB 3M1YA 1TFRA 3MR3A 4IR9A 2VJ5A 4UBBA 2LI6A 4M9JA 3SAGA 2BPCA 1O03A 5AM5A 1T3NA 7ICHA 5EE0A 2JEGA 1S5LU 2AJQA 2W7PA 5G5GA 2EH9A 5AI8A 3EWAA 4O3QA 2W9BA 2AHOB 4GLXA 4PJ0U 1JI7A 3M9MB 1KEJA 5KFTA 1SWWA 5IIIA 2V4RA 2Z7JA 3M8RA 2BCSA 3ISDA 3H8JA 5KFLA 4PHPA 4Q45A 4CRXA 3MGIA 2NO5A 1NK0A 5DQIA 2XY5A 4XRHA 2ZXIA 3HILA 4O0IA 2D6FC 1Z4OA 4YVZA 3EPGA 5L1KA 8ICHA 1ZQ1C 1C20A 2DUYA 1RDFA 4JMUA 3KTQA 4BXOA 3RB4A 1WCNA 4UATA 3RJIA 3MDCA 3MGHA 2K4HA 5KFRA 3V7KA 5AKYA 4QIWC 1N56A 1KW4A 7ICRA 2G07A 2W55A 5BOMA 8ICBA 3K1ZA 1N60A 4YMNA 4DSFA 4MFCA 3SEIA 4DS4A 3BS5A 2K4EA 1IM4A 5AKIA 4RUCA 4DS5A 1UPHA 5L1IA 1ZQIA 2B6GA 1U49A 1S0VA 3KHLA 4F3OA 1MA7A 1KSPA 1URJA 2JV3A 1S0NA 3PSTA 1C7YA 4Q8EA 9ICLA 2JZBA 8ICUA 4RQ6A 4C8NA 4P4MA 3RTVA 4J9QA 1CUKA 4ECVA 5KFNA 2I5HA 2KK0A 5J2JA 5F9NA 3I76A 1OXJA 3RBDA 1NKBA 3NGDA 3PW0A 7ICMA 2ZIXA 5DG8A 4RNMA 2FLPA 1TK0A 3RJGA 4MFFA 2I1QA 4YD1A 3IRUA 2UVUA 1ZQYA 9ICUA 4FZNA 4NLZA 1Y88A 1YT3A 2OYYA 3CYMA 3AMZA 4F4KA 4ED6A 4YR2A 3WK6A 4TUPA 4OJ5A 4ECUA 2E1FA 4NY8A 3V6KA 1IV8A 3D2NA 4EEKA 9ICCA 2K60A 5J0WA 4J9MA 1JIHA 5JU5A 3OPXA 1XSPA 5DDMA 3QEAZ 3MR2A 4PZNA 3MR6A 4NM2A 1KQQA 7ICPA 1T4GA 4RQ4A 4UB3A 2H3QA 4QZEA 4R63A 3IM1A 4NJ8A 5J0RA 2OCEA 3H7IA 4YFKA 2OWOA 3TAPA 5KFOA 4ELVA 4E0DA 2A3VA 3AQEA 3SR6A 5CRXA 3K4GA 5KFFA 4C8LA 1PZNA 1PUZA 1RYRA 1Z00A 2WB1C 3RAXA 2UVRA 3PO4A 1X9SA 3BQTA 3OJUA 4M9NA 3CNHA 4K4HA 3QUBA 3UQ2A 2PKEA 4XQ8A 4Q44A 3GV8B 5FP0A 2BQRA 4AP9A 3C23A 1BPBA 2ZJ8A 3HKZC 2ATLA 1SKRA 2CPRA 4C7YA 2KN7A 1ZQOA 2DPIA 4UB8U 2YMPA 3WK9A 2WF6A 3GZFA 4GXJA 3E0FA 4DSLA 3B0XA 3UM9A 4A8EA 2R8IA 2ZIVA 1J2NA 3PW2A 9ICTA 9ICVA 1DXSA 9ICMA 4C0ZA 3N7PD 5ALSA 4NM1A 2QB0A 1IG6A 2G09A 1JN3A 2KICA 1NJXA 3OHAA 3JPNA 5AKGA 4EEYA 1KN5A 2HVHA 4NLCA 3ALRA 4IQUA 4I2FA 4CGZA 4I2EA 2KIVA 5J2DA 4KLMA 2W54A 2K89A 3MFIA 1L6NA 3ICXA 4RQ5A 5DB8A 4RNNA 2HHVA 2IOFA 4KLUA 4ECTA 1ZJMA 4JV2A 1YZ6A 3I1YA 2YQEA 5J2FA 4DLEA 1NK8A 3IG8A 5KFVA 3QEBZ 5ALJA 8ICCA 2M9NA 3WU2U 1PVPA 5AI0A 2KIWA 5AKJA 3PY8A 5ALXA 1TVAA 1NZPA 1D8BA 1NJYA 2G06A 5HMMA 1N5XA 3SYZA 4UAZA 1BPZA 1ZQXA 3IHQB 3S6JA 3RAQA 1OW5A 4KLFA 1SKSA 4CNQA 3PW7A 2RDJA 5J2EA 4O5CA 4P0PB 4UBCA 3GIIA 2OH2A 2KE7A 4UB1A 4TQSA 4F4ZA 3L4PA 2YX8A 4GXIA 4UASA 3BS7A 5CJ7A 9ICFA 2A19A 4ELUA 2YN4A 5EWGA 4ELTA 2ZIXB 5ALEA 1SV0C 1AQ6A 5J8YC 1N48A 5T14A 3O0FA 5K4LA 1ZQEA 2IA6A 1WYGA 2Y9TA 1ZQDA 1SGGA 4M47A 5ALDA 3G6XA 3NS1A 2MSNA 2BCRA 2BHNA 1V97A 4Y2QA 4DSEA 5J0TA 4P0PA 3ZDEA 4I2IA 4B6JA 2YMMA 1HIWA 2PFPA 3TADA 1ZOLA 4F92B 1XNSA 3JPPA 2XGQA 4NLBA 1L5UA 3TAQA 5KG4A 4KITB 5EWEA 3F2DA 2FI1A 1PK1B 2JEJA 5DLFA 4RPXA 2WAQC 3FAHA 2H3ZA 3JPTA 8ICAA 4UW9A 3NRWA 3AEVA 1JRPA 4DEZA 2KKVA 2ZG6A 1V9PA 2ZIUA 3H8SA 2Y0SF 2F3NA 3PVXA 3B9JA 1QCKA 2ASLA 5KG5A 1QH9A 4BWMA 4CCHA 1VDVA 3D2QA 1PVRA 1A6SA 5KT7A 3ORYA 5ALNA 1FFUA 1N61A 2HBKA 4RQ3A 1XC9A 3BQ1A 2F8KA 4FO6A 3ISCA 3C2LA 7ICUA 1COKA 9ICRA 2XCPA 1PK3A 2HHQA 5AIAA 3BQ2A 3OSNA 3PZPA 5KT6A 4QZGA 2WF7A 4YMMA 2ZTCA 3IN5A 3C2MA 4I2HA 1X6IA 2KFZA 5DQGA 2R8HA 4PGQA 2WTFA 9ICKA 2HHWA 3MGVA 4I28A 4KLHA 8ICYA 9ICNA 1N62A 2MAXA 4DFJA 2XVTA 4TURA 4QZ8A 3SZ2A 1BNPA 3GFKB 4PL2A 1B0XA 5KG2A 2MA1A 3UMGA 5C5JA 3F53A 2KP7A 3WKDA 4TUQA 2AXTU 2E5SA 4KX3A 3M6KA 1NK9A 5J0SA 2FJ6A 2D3DA 4DQIA 4C4RA 1ZQPA 9ICWA 4G9BA 4IC9A 1L7OA 3U26A 3VC8A 5DB6A 3QUQA 3Q8LA 2YB1A 1S10A 3SQIA 4F71A 3PV8A 3WKEA 3TANA 4DSKA 2AQ4A 4IQVA 1ZQKA 4RQ8A 4KTQA 4C80A 4NLKA 4EX6A 4ICAA 5ALFA 1SZHA 1ECWA 1S76D 2J6SA 2O6KA 2KMDA 4Y2YA 4IQWA 1WUDA 4PZOA 2EQYA 4O3NA 4PH5A 2D8CA 4NL9A 4QZ9A 3D2SA 4J9LA 4IR1A 5KFXA 5CWRA 2ZUCA 1RM6C 1WWVA 2H5XA 4UAWA 3OSPA 5KT3A 5HR6A 4YP3A 2BR0A 2J6TA 3WKBA 4IRDA 4O3MA 2YY6A 1QSSA 1LVHA 4HAIA 4K4IA
chains in the Genus database with same CATH topology
3D2NA 3CP8A 1Z19A 4QIWF 2K4IA 4CGZA 3MGVA 2W7OA 2MRLA 3N7SC 3KZXA 2E1EA 2DQNB 2G0AA 3OPXA 4NV0A 3F2BA 2XVTA 3H0RB 2K4HA 2N1RA 4QIWC 4P0PA 2K89A 2G5HB 3F5EA 1L6NA 2G5IB 3ICXA 4BX9C 2K8AA 2G07A 2DGZA 1HIWA 2BDUA 2HOQA 2PMZF 2H3QA 3LVWA 1PVQA 4PL2A 1T94A 2MA1A 4P0QB 3H0LB 2ZIWA 2F77X 3K1ZA 3NUQA 1XNSA 1TAMA 4NLBA 4OJLA 4KMOB 4FZMA 2JH1A 3GU3A 2VKQA 2OM6A 2K4EA 2LBOA 3IG8A 2A3VA 3AQEA 3F53A 2JGAA 2OXOA 2Q4TA 1Q3VA 2RRDA 3F2DA 2E5SA 5KL1B 1P7DA 2F8LA 4KX3A 1KBUA 1UPHA 2LYBA 2LKYA 2ZXHA 3M6KA 5HR7A 2WB1F 2WB1C 3RF9A 3SMVA 1A0PA 2H3FA 2CRXA 2WAQC 3M7DA 4U6PA 2H3ZA 2JHDA 4GFJA 1PVPA 1DRGA 3LYSA 5KL8B 3LVVA 3N7RC 3IP4B 1MA7A 2KIWA 2HBMA 2KHVA 3IG5A 1URJA 2F76X 5HR6A 4IC9A 2GH1A 2HBLA 2VJ4A 2M0NA 2VJ5A 2XI9A 3NRWA 3VCBA 1Z1BA 4OO1J 4WJ3B 3VC8A 2ZIVB 1D8BA 3PSTA 3SAGA 2R18A 2KKVA 2G06A 2ZG6A 3ONNA 2YB1A 2ZIUA 4CDGA 2Y0SF 3SQIA 2KV2A 1OUQA 3H0MB 3HKZC 1HEKA 2KNJA 2CPRA 4QNLA 3SAFA 2W7PA 3F5AA 4AYBC 3GZFA 2KJ8A 2KKPA 3PSIA 4OJPA 2HOFA 3E0FA 2YB4A 5C0YA 4ICAA 1XO0A 3F2CA 2HBJA 1F44A 2RP5A 2F2AB 4P0PB 1SZHA 2H3VA 2LYAA 2HMXA 3D2QA 1ECWA 1PVRA 4A8EA 2HOIA 2OH2A 2DF4B 3AL0B 3KFUF 1A6SA 1Q3UA 2ZIVA 4ACOA 4FE3A 2H3IA 2YX8A 2CN1A 3C29A 5CRXA 2RHFA 3M6ZA 4AYBF 1WUDA 3HKZF 2HBKA 2Z7JA 4BUGA 2W04A 3PSFA 2VIXA 2W03A 2Y0SC 2ZIXA 2KJ9A 4PL1A 4C0ZA 3N7PD 2GOLA 3T79A 4BJQA 2JMGA 3ALRA 4KX5A 2ZIUB 1CRXA 4U7CA 4CRXA 2G09A 3D2SA 2G08A 2NV3A 3C28A 4P0QA 2K8CB 2KICA 4FZNA 4NWIA 2KD1A 4OJ6A 2ZIXB 1NZBA 3L3FX 2KHQA 2JH7A 2LHTA 2ZXIA 2KEYA 3DEEA 4QJFB 3PZPA 2KOBA 2D6FC 1YT3A 2OYYA 2XICA 5T14A 3O0FA 2WAQF 3CYMA 1ED1A 2K8BB 3IN5A 3AQFA 1IIPA 2KJ5A 2KVCA 1ZQ1C 3PSPA 4FZLA 4OJ5A 4OJOA 5A0LA 3SAHA 3CRXA 2PMZC 1GO3F 2XIDA 2ZIWB 4O3MA 4JMUA 4NLCA 3RFAA 2E1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQ1 C;  2F2A B;  3IP4 B;  2G5I B;  2D6F C;  3H0M B;  2G5H B;  3KFU F;  2DF4 B;  3AL0 B;  2DQN B;  3H0L B;  4WJ3 B;  3H0R B; 
#chains in the Genus database with same CATH topology
 5E79 U;  1ZET A;  2P35 A;  9ICE A;  1S97 A;  5TIS U;  4DL7 A;  3LK9 A;  1ZXI A;  3EPI A;  3RH5 A;  1BPX A;  3BDP A;  2P66 A;  2OHF A;  4Z6F A;  3V72 A;  1ARO P;  1WCL A;  1ZQC A;  7ICJ A;  8ICL A;  4Y2V A;  5ALZ A;  4Z6D A;  1UA1 A;  1TE2 A;  2JXJ A;  4OJL A;  3PR5 B;  2VKQ A;  2OM6 A;  5L1M A;  1WWU A;  5JTI A;  1DGS A;  2RRD A;  4RPZ A;  2F8L A;  1ZRN A;  5AKK A;  3K75 D;  3GV7 B;  2FE9 A;  7ICV A;  5DG7 A;  2JHD A;  2IBK A;  1L7N A;  8ICZ A;  2FPL A;  1FFV A;  3BS5 B;  3RR7 A;  4M6W B;  4ED8 A;  4OO1 J;  3JPQ A;  1ZQT A;  5CHG A;  2ISO A;  4EEN A;  2R8J A;  5AK6 A;  1JXE A;  3ONN A;  4CDG A;  4Y2P A;  1FEZ A;  3H0M B;  3AM9 A;  1MSW D;  2HHU A;  2KJ8 A;  2HOF A;  3M9N B;  1DK2 A;  5KFI A;  5DGA A;  4KLL A;  4RQ7 A;  5KFD A;  3PR4 A;  4QWA A;  4AYB F;  4R65 A;  4YN4 A;  4DQR A;  1X6J A;  4DL2 A;  2F1I A;  1ZQW A;  3QU9 A;  1TV9 A;  3GIM A;  2BPG A;  4ECX A;  2FPM A;  3OHB A;  3L3F X;  2XY7 A;  4DFD A;  4F4X A;  4QJF B;  3M8S A;  2W8L A;  1BGX T;  4DL4 A;  7ICK A;  2KVC A;  1ZD3 A;  5A0L A;  3RH4 A;  2PMZ C;  2ASD A;  2FLL A;  4B9T A;  2NRV A;  3MAB A;  4I2A A;  5KNI A;  5AM4 A;  3RR8 A;  5HP4 A;  1B43 A;  2G5H B;  9ICG A;  2G5I B;  4BX9 C;  2BDU A;  2PMZ F;  1U45 A;  5D46 A;  5AM0 A;  3D6J A;  3QUT A;  3ZD9 A;  4P0Q B;  8ICK A;  2ZIW A;  4DL6 A;  5IIK A;  3MDA A;  3RB0 A;  4O3P A;  5KFM A;  1JX4 A;  1IXR A;  1Q3V A;  5ALP A;  3J81 j;  3KKA A;  4RUA A;  2HHT A;  2EAM A;  4QWC A;  5IIJ A;  2AGQ A;  5J2I A;  1ZQG A;  4GC6 A;  3N7R C;  3RJJ A;  5J0P A;  4F50 A;  4J9K A;  4DFK A;  9ICX A;  2ZIV B;  3WKC A;  9ICQ A;  2RQ5 A;  2PXI A;  5G5H A;  5KFY A;  2MU2 A;  4I2C A;  1KFT A;  1Q8K A;  4YD2 A;  4ED0 A;  2HDO A;  2KNJ A;  2DBY A;  3OGU A;  5F9L A;  3L5K A;  2EAP A;  1ZQQ A;  1WG8 A;  8ICQ A;  2P6U A;  3ZDD A;  2HHX A;  1YZ7 A;  1SXD A;  4O5K A;  3AL0 B;  3KHH A;  4IL6 U;  2LPE A;  4FE3 A;  2BPF A;  3ETL A;  4X5V A;  4YXM A;  3PX0 A;  1ZQS A;  5ALL A;  2VIX A;  2KSO A;  2E8N A;  1Q46 A;  2ZIU B;  4F8R A;  1L7P A;  2I6X A;  1KKX A;  4DOB A;  3RRH A;  4O9M A;  4NWI A;  4Y2J A;  5GTH U;  5HNK A;  4M9L A;  4B9U A;  1SL0 A;  1SIJ A;  4OJO A;  5AKL A;  4M9H A;  1HJP A;  4F93 B;  3IV6 A;  1D9D A;  4C7Z A;  1FO4 A;  2BQ3 A;  1NK7 A;  3MFH A;  2EDU A;  4P4O A;  4QZA A;  4UQG A;  3BJY A;  3BQ7 A;  3ETR A;  2WHE A;  1JUD A;  3KKA C;  5AIB A;  2UVW A;  1ZQV A;  3NTU A;  5B5E U;  4BDP A;  5J2G A;  3C1Y A;  4UAV A;  4BXO B;  5AIC A;  3UXP A;  4FZM A;  4YR3 A;  4YR0 A;  5KG3 A;  2YMQ A;  2LYB A;  1LKY A;  4DSI A;  2BCQ A;  3M7D A;  4UAR A;  3LYS A;  1ZD4 A;  1NOM A;  2RDI A;  3IG5 A;  8ICS A;  5AK5 A;  2XI9 A;  4ECY A;  4ECW A;  4YQW A;  8ICF A;  5KG0 A;  2W9M A;  1UHU A;  4QZB A;  1NK4 A;  3TQ1 A;  3C21 A;  2WFA A;  4I2G A;  3V6J A;  4I29 A;  1TK5 A;  2E8M A;  4USA A;  3PML A;  4MHV A;  4IRK A;  2JR5 A;  5EE1 A;  2LM4 A;  1ZQL A;  1RXV A;  4LVS A;  2JEF A;  1X40 A;  2LYA A;  2XGP A;  3GQC A;  5KFW A;  4I2B A;  2ZUB A;  5KFS A;  1XSN A;  4DFM A;  1UT5 A;  2KZ3 A;  5KG1 A;  5ALT A;  2W9C B;  4J9R A;  3C2K A;  3FC4 A;  7ICL A;  5ALQ A;  2NRW A;  3RJE A;  1V85 A;  2NV3 A;  3UXN A;  4RNO A;  2LHT A;  2KEY A;  4FS1 A;  4QWB A;  1NKC A;  1N63 A;  3PNC A;  5IIL A;  1MC8 A;  2W3R A;  3CRX A;  2XID A;  3RJH A;  1T7P A;  3KD3 A;  4O5E A;  5CR0 A;  5KT2 A;  2Q0Z X;  2B0C A;  5ALI A;  7ICQ A;  3WK8 A;  2Y1I A;  3KZX A;  2G0A A;  2W11 A;  2W8K A;  4R8U B;  1MN8 A;  1X9M A;  1DK3 A;  2ODG A;  3WK4 A;  4LZD A;  1UT8 A;  4RT2 A;  3RJK A;  2MUT B;  1Z1V A;  1K1S A;  4ED1 A;  1DGJ A;  3RRG A;  4DSJ A;  1L3S A;  3N28 A;  5ALH A;  1T94 A;  3H0L B;  2F77 X;  4P2H A;  4QZD A;  1ZQN A;  1ZD2 P;  2V4Q A;  2JH1 A;  3PW5 A;  2BDP A;  4YXJ A;  3A0B U;  2OXO A;  1CEZ A;  4EBD A;  1SV0 A;  3UPQ A;  2Y1J A;  2LKY A;  2ZXH A;  4JK1 A;  5IIO A;  2WB1 F;  1Z00 B;  2JEI A;  2UVV A;  5KFJ A;  5BOL A;  4C8K A;  1ZQZ A;  5KL8 B;  3C5G A;  4ED2 A;  4JWM A;  1SV4 A;  3QZ7 A;  4QZI A;  4JUZ A;  5J0O A;  8ICV A;  3PO5 A;  1S0M A;  3QU7 A;  5KT4 A;  4B9V A;  2V9W A;  4Y2R A;  5J29 A;  1XO1 A;  4Y2S A;  4QZH A;  4KLS A;  4PHD A;  5IIM A;  2W9B B;  1HEK A;  3Q8Q B;  3AN1 A;  3HW8 A;  2DKZ A;  3TI0 A;  1TK8 A;  5L9X A;  1BNO A;  1QSY A;  4UAY A;  4OJP A;  4IRC A;  1D9F A;  1HUZ A;  1NKE A;  2HMX A;  3AU2 A;  4C8O A;  4EYI B;  4UB5 A;  3R9K A;  2ASJ A;  1SB3 C;  4ED7 A;  4QZF A;  1ZQA A;  3M6Z A;  4I2J A;  5J2B A;  2KSO B;  1X9W A;  2QAR A;  2E8O A;  2FLN A;  4ECS A;  2FDR A;  5CP2 A;  5AI4 A;  2AU0 A;  1BPD A;  7ICF A;  5KFQ A;  2XIC A;  2IHM A;  2AH5 A;  1Z4N A;  3H40 A;  1D8L A;  2KJ5 A;  3PSP A;  2C2R A;  3KHR A;  3RFA A;  4M2Y A;  4F5P A;  3ZD8 A;  4Z6C A;  4Y2T A;  2MRL A;  3Q8K A;  3DDH A;  3F5E A;  3C5F A;  1JMS A;  4G3I A;  2K8A A;  4UB4 A;  5KFZ A;  1ZQB A;  2C2E A;  5ALW A;  3FDS A;  3QUC A;  1A76 A;  5DBA A;  4QW8 A;  5HHI A;  3E58 A;  1L3T A;  3Q8P B;  1K5O A;  2BGW A;  5AM1 A;  4DL5 A;  3K1R B;  4J03 A;  1P7D A;  5KL1 B;  5AKH A;  2ALZ A;  4C4S A;  3WKA A;  1A0P A;  2IOH A;  2H3F A;  5AKX A;  4GFJ A;  2WF5 A;  9ICS A;  3LVV A;  2KHV A;  2F76 X;  4ECZ A;  2LMR A;  3VCB A;  4WJ3 B;  8ICR A;  3NVV A;  5ALU A;  5KG7 A;  1T3Q A;  1QQ7 A;  2ZJ5 A;  4Q8F A;  4Y2U A;  5EE3 A;  2F44 A;  3SEN A;  3QU5 A;  3F5A A;  2GO7 A;  3PSI A;  4MEY A;  4DCC A;  1ZQR A;  2HW3 A;  4EBC A;  4KMU A;  4MF2 A;  1RYS A;  1UQV A;  2ESE A;  2WF8 A;  2H3I A;  3THV A;  2CN1 A;  2RHF A;  3I28 A;  2QLT A;  2W03 A;  2Y0S C;  3NVZ A;  4PL1 A;  3LWM A;  2GOL A;  5AHX A;  4DQQ A;  3IDW A;  4BJQ A;  4KX5 A;  4U7C A;  4GXK A;  5ALK A;  4GC7 A;  4YCX A;  1ZJN A;  2KHQ A;  2KOB A;  5EWF A;  2WAQ F;  3G6Y A;  5AKZ A;  3PW4 A;  1GO3 F;  4AYB C;  2NRT A;  1N5W A;  1Z19 A;  4F4Y A;  4MF8 A;  3N7S C;  4PGY A;  4M6W A;  4EEL A;  2IHN A;  3T5L A;  4CF4 A;  2B21 A;  3HT3 A;  3ED5 A;  8ICW A;  5DB7 A;  4XA5 A;  3BQ0 A;  3NUQ A;  1BVS A;  1U47 A;  4KLJ A;  9ICJ A;  2NRX A;  9ICP A;  4R64 A;  4F5O A;  5HR7 A;  7ICO A;  4RPY A;  4US8 A;  1SL2 A;  4RT3 A;  2C28 A;  2WF9 A;  1S0O A;  2LYH A;  3KBB A;  5AI6 A;  5EOZ A;  5L1J A;  4MFA A;  1H38 A;  3PX6 A;  2XC9 A;  2PI5 A;  2BQU A;  1J2M A;  4J9O A;  2JZB B;  3LDA A;  1KDH A;  1OUQ A;  3CW2 C;  4F91 B;  3H4D A;  1QQ5 A;  4FBT A;  4K4G A;  3HWT A;  1UA0 A;  5J0U A;  4ECQ A;  3E2E A;  2KKP A;  3Q8R B;  2RP5 A;  1QQ6 A;  3V7J A;  2QB1 A;  8ICE A;  3HJE A;  3V6H A;  4JV0 A;  4DQS A;  7ICN A;  4PHA A;  4B9L A;  5ALM A;  1QLN A;  2JMG A;  4M0A A;  4NLN A;  4US9 A;  5DBC A;  3C28 A;  4P0Q A;  1X9X A;  2K8C B;  4F5N A;  2KD1 A;  4F5Q A;  2JRZ A;  4EZ6 A;  2ES6 A;  5ALO A;  5KFH A;  2KFN A;  2NO4 A;  1XSL A;  4RQ1 A;  1B22 A;  5AK3 A;  4IQT A;  1BPE A;  2K4I A;  4FS2 A;  2FMS A;  3HX0 A;  2W7O A;  3TFR A;  5J0Y A;  3GIL A;  3QU2 A;  2HCF A;  2N1R A;  1ZQH A;  3UMC A;  7ICT A;  1SL1 A;  4F72 A;  2E8P A;  3SD7 A;  4DF4 A;  3TAR A;  5J2H A;  1J97 A;  1RYU A;  5KFG A;  3C1Z A;  2FPK A;  4KMO B;  1SWV A;  3GU3 A;  1UCV A;  5KAF U;  4O3S A;  5KFP A;  3Q8S B;  1KFS A;  4BWJ A;  3AUO A;  3H8W A;  7ICS A;  1ZQU A;  1SXE A;  1U4B A;  3BZC A;  1VLB A;  4J9P A;  1NJW A;  8ICJ A;  4LZG A;  2I9G A;  4OCZ A;  3HPO A;  2R18 A;  1KRP A;  4KLO A;  5IIN A;  3EW9 A;  5ALR A;  1KL9 A;  4J9S A;  1JRO A;  5JUM A;  5J2A A;  4R66 A;  3JPO A;  4RQN A;  9ICB A;  2A1J B;  1D8Y A;  4RQM A;  3ZDA A;  3F2C A;  2HBJ A;  1F44 A;  5J8Y A;  1Q3U A;  3DV9 A;  4UAU A;  5J2K A;  2XO7 A;  2ZTD A;  4DFP A;  4ED3 A;  3EUB 2;  1SZP A;  1PK1 A;  3HKZ F;  5KFK A;  4TUS A;  4BUG A;  8ICX A;  2KJ9 A;  2W9C A;  5F3X B;  4EYH B;  2EZZ A;  9ICA A;  5TZV A;  3RH6 A;  2AGP A;  1VJ5 A;  1MQ3 A;  2BCU A;  2G08 A;  2ZJA A;  2BCV A;  1NZB A;  4FBU A;  3GDX A;  3TFS A;  1O08 A;  2R8K A;  4NLG A;  5H2F U;  2ZIW B;  1NK6 A;  1U9L A;  2XCA A;  5KFB A;  4QIW F;  9ICO A;  2DQN B;  3H8M A;  3H0R B;  3ZDB A;  3BZK A;  4R8U A;  2W3S A;  1TAQ A;  1XU4 A;  3AU6 A;  4GIB A;  1PVQ A;  4F2R A;  9ICI A;  1NK5 A;  1L7M A;  1L3U A;  1N2X A;  4Y2X A;  2C22 A;  5KAI U;  2MUT A;  4NXZ A;  3HRD D;  4I2D A;  4C8M A;  3KHG A;  2Q4T A;  4QWE A;  1EXN A;  1T8E A;  1TAU A;  2HVI A;  2KZM A;  2CRX A;  2HHS A;  3KOO A;  5KFU A;  1A77 A;  2HBM A;  4YG2 A;  3G6V A;  8ICM A;  3TAC B;  1Z1B A;  2M0N A;  4KLI A;  4Q43 A;  4O3R A;  2AQ0 A;  3RJF A;  1HUO A;  4MEX A;  3A0H U;  1X66 A;  1X42 A;  4F4W A;  1ZQF A;  2KV2 A;  7ICG A;  3EZ5 A;  3T5J A;  3SAF A;  2BKE A;  3JPS A;  5B66 U;  7ICE A;  1S8O A;  3EYZ A;  1RPL A;  8ICT A;  5ALG A;  2PI4 A;  5C0Y A;  1XO0 A;  5D4B A;  5DLG A;  2F2A B;  3NVY A;  3KFU F;  3LWL A;  5HML A;  1ZD5 A;  2ISP A;  4ACO A;  5J0Q A;  2KTQ A;  1RZT A;  3RBE A;  3HP6 A;  3OTQ A;  5KT5 A;  3MBY A;  1S9F A;  4F5R A;  4J9N A;  2DWQ A;  3QXG A;  5AI9 A;  2VA3 A;  3SV3 A;  2QAR B;  4KLQ A;  5ALY A;  2F1J A;  2K8B B;  4KLE A;  3AQF A;  4EZ9 A;  3SAH A;  4JB3 A;  2KG5 A;  4KLG A;  4JWN A;  2QKQ A;  2Y9U A;  3WK5 A;  3TKA A;  4KLT A;  1ZQJ A;  2GLE A;  2DPJ A;  2E1E A;  1ZRM A;  4ECR A;  3RB6 A;  4O3O A;  5J0X A;  4LJX A;  1S77 D;  4EBE A;  2HOQ A;  3B0Y A;  3ISB A;  3FYH A;  4KN7 A;  5D49 A;  2PFQ A;  3ZDC A;  3NVW A;  3OJS A;  3QE9 Y;  3NRZ A;  2J6U A;  5KFA A;  4ZH4 A;  1X2I A;  4IS7 A;  2R8G A;  2GWS A;  5L1L A;  3SMV A;  2EZX A;  5DDY A;  4DLG A;  1JXL A;  2P6R A;  3M9O B;  2C2D A;  1QTM A;  2VJ4 A;  5BPC A;  3N97 B;  4HYK A;  1KLN A;  4RU9 A;  3TAD C;  5DG9 A;  3UMB A;  2KVS A;  4NL9 C;  1RQN A;  4QNL A;  3FM9 A;  5KFE A;  2RLT A;  5EE9 A;  4DL3 A;  2YB4 A;  1QSL A;  4Z6E A;  4KN4 A;  4RQ0 A;  2HI0 A;  4KLD A;  5KTQ A;  3V7L A;  3T5K A;  2F1H A;  1SKW A;  2EAN A;  2W04 A;  1COO A;  3PSF A;  3T3F A;  1DOQ A;  1F0M A;  5CA7 A;  2IOF K;  2DFL A;  2DKX A;  2QB0 B;  8ICP A;  4QW9 A;  8ICI A;  5KFC A;  2JH7 A;  1B4F A;  1IIP A;  4OD0 A;  4FZL A;  2W9A A;  1RQL A;  2VA2 A;  1MQ2 A;  1XWL A;  3T5H A;  1LB2 B;  2E3T A;  2OEH A;  5AK4 A;  2VAN A;  4JV1 A;  1F5S A;  1KTQ A;  5KG6 A;  4B9N A;  2DGZ A;  1ZYQ A;  3JPR A;  5JRT A;  1JAL A;  2FMP A;  4EX7 A;  8ICO A;  4F2S A;  3GIK A;  2DL0 A;  4UB6 U;  3SV4 A;  4B9M A;  4RQ2 A;  1TAM A;  5CEH A;  3QU4 A;  2A1J A;  3GV5 B;  2JGA A;  3KZI U;  2NRZ A;  4M9G A;  4PHE A;  2XY6 A;  3GIJ A;  1LKY B;  2ZTE A;  4I27 A;  4CF5 A;  4U6P A;  2W43 A;  3H4B A;  4QZC A;  4YMO A;  1L8O A;  3UQ0 A;  2GH1 A;  2HBL A;  4XUS A;  3N4M B;  1RG6 A;  1XS9 D;  5DKW A;  1CI4 A;  2L5Y A;  3PX4 A;  3QX7 A;  2KZZ A;  5AKE A;  3NAS A;  5AI5 A;  4DWI A;  3PMN A;  2FMQ A;  1KFD A;  5AM2 A;  2H3V A;  3QNM A;  2HOI A;  1U48 A;  8ICG A;  2DF4 B;  2YTU A;  3Q8M A;  3C29 A;  4RZR A;  4DO9 A;  2VA8 A;  3QZ8 A;  3UXO A;  5GTI U;  2IMW P;  1ZQM A;  5DGB A;  3T79 A;  2AGO A;  5J2C A;  2NYV A;  3WK7 A;  1CRX A;  4UB2 A;  4QWD A;  2BZF A;  1K1Q A;  4OJ6 A;  1LV5 A;  2ZUD A;  3QYP A;  3DEE A;  2PFN A;  2A1A A;  3RB3 A;  2LM1 A;  1ED1 A;  4BGD A;  4CF3 A;  4TQR A;  4ZOH C;  5DBB A;  1L3V A;  5HHH A;  1L8L A;  4FFD A;  4DQP A;  3CP8 A;  1M6Y A;  1RXW A;  5DQH A;  5DB9 A;  4NV0 A;  4B9S A;  3F2B A;  9ICH A;  2K4P A;  1NJZ A;  1TKD A;  2EZY A;  3LVW A;  4PGX A;  1FIQ A;  4CE6 A;  5ALV A;  1NNL A;  1NI3 A;  5CB1 A;  4DOC A;  4DF8 A;  1V38 A;  2LBO A;  8ICN A;  4C4T A;  1KBU A;  7ICI A;  4PPX A;  1BPY A;  5AM3 A;  3MR5 A;  3RF9 A;  3ZI4 A;  4DOA A;  2PFO A;  4P4P A;  2CXY A;  2HSZ A;  1DRG A;  2YML A;  3SI8 A;  3IP4 B;  2EAO A;  3MC1 A;  4M04 A;  1Z3E B;  3M1Y A;  1TFR A;  3MR3 A;  4IR9 A;  2VJ5 A;  4UBB A;  2LI6 A;  4M9J A;  3SAG A;  2BPC A;  1O03 A;  5AM5 A;  1T3N A;  7ICH A;  5EE0 A;  2JEG A;  1S5L U;  2AJQ A;  2W7P A;  5G5G A;  2EH9 A;  5AI8 A;  3EWA A;  4O3Q A;  2W9B A;  2AHO B;  4GLX A;  4PJ0 U;  1JI7 A;  3M9M B;  1KEJ A;  5KFT A;  1SWW A;  5III A;  2V4R A;  2Z7J A;  3M8R A;  2BCS A;  3ISD A;  3H8J A;  5KFL A;  4PHP A;  4Q45 A;  4CRX A;  3MGI A;  2NO5 A;  1NK0 A;  5DQI A;  2XY5 A;  4XRH A;  2ZXI A;  3HIL A;  4O0I A;  2D6F C;  1Z4O A;  4YVZ A;  3EPG A;  5L1K A;  8ICH A;  1ZQ1 C;  1C20 A;  2DUY A;  1RDF A;  4JMU A;  3KTQ A;  4BXO A;  3RB4 A;  1WCN A;  4UAT A;  3RJI A;  3MDC A;  3MGH A;  2K4H A;  5KFR A;  3V7K A;  5AKY A;  4QIW C;  1N56 A;  1KW4 A;  7ICR A;  2G07 A;  2W55 A;  5BOM A;  8ICB A;  3K1Z A;  1N60 A;  4YMN A;  4DSF A;  4MFC A;  3SEI A;  4DS4 A;  3BS5 A;  2K4E A;  1IM4 A;  5AKI A;  4RUC A;  4DS5 A;  1UPH A;  5L1I A;  1ZQI A;  2B6G A;  1U49 A;  1S0V A;  3KHL A;  4F3O A;  1MA7 A;  1KSP A;  1URJ A;  2JV3 A;  1S0N A;  3PST A;  1C7Y A;  4Q8E A;  9ICL A;  2JZB A;  8ICU A;  4RQ6 A;  4C8N A;  4P4M A;  3RTV A;  4J9Q A;  1CUK A;  4ECV A;  5KFN A;  2I5H A;  2KK0 A;  5J2J A;  5F9N A;  3I76 A;  1OXJ A;  3RBD A;  1NKB A;  3NGD A;  3PW0 A;  7ICM A;  2ZIX A;  5DG8 A;  4RNM A;  2FLP A;  1TK0 A;  3RJG A;  4MFF A;  2I1Q A;  4YD1 A;  3IRU A;  2UVU A;  1ZQY A;  9ICU A;  4FZN A;  4NLZ A;  1Y88 A;  1YT3 A;  2OYY A;  3CYM A;  3AMZ A;  4F4K A;  4ED6 A;  4YR2 A;  3WK6 A;  4TUP A;  4OJ5 A;  4ECU A;  2E1F A;  4NY8 A;  3V6K A;  1IV8 A;  3D2N A;  4EEK A;  9ICC A;  2K60 A;  5J0W A;  4J9M A;  1JIH A;  5JU5 A;  3OPX A;  1XSP A;  5DDM A;  3QEA Z;  3MR2 A;  4PZN A;  3MR6 A;  4NM2 A;  1KQQ A;  7ICP A;  1T4G A;  4RQ4 A;  4UB3 A;  2H3Q A;  4QZE A;  4R63 A;  3IM1 A;  4NJ8 A;  5J0R A;  2OCE A;  3H7I A;  4YFK A;  2OWO A;  3TAP A;  5KFO A;  4ELV A;  4E0D A;  2A3V A;  3AQE A;  3SR6 A;  5CRX A;  3K4G A;  5KFF A;  4C8L A;  1PZN A;  1PUZ A;  1RYR A;  1Z00 A;  2WB1 C;  3RAX A;  2UVR A;  3PO4 A;  1X9S A;  3BQT A;  3OJU A;  4M9N A;  3CNH A;  4K4H A;  3QUB A;  3UQ2 A;  2PKE A;  4XQ8 A;  4Q44 A;  3GV8 B;  5FP0 A;  2BQR A;  4AP9 A;  3C23 A;  1BPB A;  2ZJ8 A;  3HKZ C;  2ATL A;  1SKR A;  2CPR A;  4C7Y A;  2KN7 A;  1ZQO A;  2DPI A;  4UB8 U;  2YMP A;  3WK9 A;  2WF6 A;  3GZF A;  4GXJ A;  3E0F A;  4DSL A;  3B0X A;  3UM9 A;  4A8E A;  2R8I A;  2ZIV A;  1J2N A;  3PW2 A;  9ICT A;  9ICV A;  1DXS A;  9ICM A;  4C0Z A;  3N7P D;  5ALS A;  4NM1 A;  2QB0 A;  1IG6 A;  2G09 A;  1JN3 A;  2KIC A;  1NJX A;  3OHA A;  3JPN A;  5AKG A;  4EEY A;  1KN5 A;  2HVH A;  4NLC A;  3ALR A;  4IQU A;  4I2F A;  4CGZ A;  4I2E A;  2KIV A;  5J2D A;  4KLM A;  2W54 A;  2K89 A;  3MFI A;  1L6N A;  3ICX A;  4RQ5 A;  5DB8 A;  4RNN A;  2HHV A;  2IOF A;  4KLU A;  4ECT A;  1ZJM A;  4JV2 A;  1YZ6 A;  3I1Y A;  2YQE A;  5J2F A;  4DLE A;  1NK8 A;  3IG8 A;  5KFV A;  3QEB Z;  5ALJ A;  8ICC A;  2M9N A;  3WU2 U;  1PVP A;  5AI0 A;  2KIW A;  5AKJ A;  3PY8 A;  5ALX A;  1TVA A;  1NZP A;  1D8B A;  1NJY A;  2G06 A;  5HMM A;  1N5X A;  3SYZ A;  4UAZ A;  1BPZ A;  1ZQX A;  3IHQ B;  3S6J A;  3RAQ A;  1OW5 A;  4KLF A;  1SKS A;  4CNQ A;  3PW7 A;  2RDJ A;  5J2E A;  4O5C A;  4P0P B;  4UBC A;  3GII A;  2OH2 A;  2KE7 A;  4UB1 A;  4TQS A;  4F4Z A;  3L4P A;  2YX8 A;  4GXI A;  4UAS A;  3BS7 A;  5CJ7 A;  9ICF A;  2A19 A;  4ELU A;  2YN4 A;  5EWG A;  4ELT A;  2ZIX B;  5ALE A;  1SV0 C;  1AQ6 A;  5J8Y C;  1N48 A;  5T14 A;  3O0F A;  5K4L A;  1ZQE A;  2IA6 A;  1WYG A;  2Y9T A;  1ZQD A;  1SGG A;  4M47 A;  5ALD A;  3G6X A;  3NS1 A;  2MSN A;  2BCR A;  2BHN A;  1V97 A;  4Y2Q A;  4DSE A;  5J0T A;  4P0P A;  3ZDE A;  4I2I A;  4B6J A;  2YMM A;  1HIW A;  2PFP A;  3TAD A;  1ZOL A;  4F92 B;  1XNS A;  3JPP A;  2XGQ A;  4NLB A;  1L5U A;  3TAQ A;  5KG4 A;  4KIT B;  5EWE A;  3F2D A;  2FI1 A;  1PK1 B;  2JEJ A;  5DLF A;  4RPX A;  2WAQ C;  3FAH A;  2H3Z A;  3JPT A;  8ICA A;  4UW9 A;  3NRW A;  3AEV A;  1JRP A;  4DEZ A;  2KKV A;  2ZG6 A;  1V9P A;  2ZIU A;  3H8S A;  2Y0S F;  2F3N A;  3PVX A;  3B9J A;  1QCK A;  2ASL A;  5KG5 A;  1QH9 A;  4BWM A;  4CCH A;  1VDV A;  3D2Q A;  1PVR A;  1A6S A;  5KT7 A;  3ORY A;  5ALN A;  1FFU A;  1N61 A;  2HBK A;  4RQ3 A;  1XC9 A;  3BQ1 A;  2F8K A;  4FO6 A;  3ISC A;  3C2L A;  7ICU A;  1COK A;  9ICR A;  2XCP A;  1PK3 A;  2HHQ A;  5AIA A;  3BQ2 A;  3OSN A;  3PZP A;  5KT6 A;  4QZG A;  2WF7 A;  4YMM A;  2ZTC A;  3IN5 A;  3C2M A;  4I2H A;  1X6I A;  2KFZ A;  5DQG A;  2R8H A;  4PGQ A;  2WTF A;  9ICK A;  2HHW A;  3MGV A;  4I28 A;  4KLH A;  8ICY A;  9ICN A;  1N62 A;  2MAX A;  4DFJ A;  2XVT A;  4TUR A;  4QZ8 A;  3SZ2 A;  1BNP A;  3GFK B;  4PL2 A;  1B0X A;  5KG2 A;  2MA1 A;  3UMG A;  5C5J A;  3F53 A;  2KP7 A;  3WKD A;  4TUQ A;  2AXT U;  2E5S A;  4KX3 A;  3M6K A;  1NK9 A;  5J0S A;  2FJ6 A;  2D3D A;  4DQI A;  4C4R A;  1ZQP A;  9ICW A;  4G9B A;  4IC9 A;  1L7O A;  3U26 A;  3VC8 A;  5DB6 A;  3QUQ A;  3Q8L A;  2YB1 A;  1S10 A;  3SQI A;  4F71 A;  3PV8 A;  3WKE A;  3TAN A;  4DSK A;  2AQ4 A;  4IQV A;  1ZQK A;  4RQ8 A;  4KTQ A;  4C80 A;  4NLK A;  4EX6 A;  4ICA A;  5ALF A;  1SZH A;  1ECW A;  1S76 D;  2J6S A;  2O6K A;  2KMD A;  4Y2Y A;  4IQW A;  1WUD A;  4PZO A;  2EQY A;  4O3N A;  4PH5 A;  2D8C A;  4NL9 A;  4QZ9 A;  3D2S A;  4J9L A;  4IR1 A;  5KFX A;  5CWR A;  2ZUC A;  1RM6 C;  1WWV A;  2H5X A;  4UAW A;  3OSP A;  5KT3 A;  5HR6 A;  4YP3 A;  2BR0 A;  2J6T A;  3WKB A;  4IRD A;  4O3M A;  2YY6 A;  1QSS A;  1LVH A;  4HAI A;  4K4I A; 
#chains in the Genus database with same CATH homology
 3D2N A;  3CP8 A;  1Z19 A;  4QIW F;  2K4I A;  4CGZ A;  3MGV A;  2W7O A;  2MRL A;  3N7S C;  3KZX A;  2E1E A;  2DQN B;  2G0A A;  3OPX A;  4NV0 A;  3F2B A;  2XVT A;  3H0R B;  2K4H A;  2N1R A;  4QIW C;  4P0P A;  2K89 A;  2G5H B;  3F5E A;  1L6N A;  2G5I B;  3ICX A;  4BX9 C;  2K8A A;  2G07 A;  2DGZ A;  1HIW A;  2BDU A;  2HOQ A;  2PMZ F;  2H3Q A;  3LVW A;  1PVQ A;  4PL2 A;  1T94 A;  2MA1 A;  4P0Q B;  3H0L B;  2ZIW A;  2F77 X;  3K1Z A;  3NUQ A;  1XNS A;  1TAM A;  4NLB A;  4OJL A;  4KMO B;  4FZM A;  2JH1 A;  3GU3 A;  2VKQ A;  2OM6 A;  2K4E A;  2LBO A;  3IG8 A;  2A3V A;  3AQE A;  3F53 A;  2JGA A;  2OXO A;  2Q4T A;  1Q3V A;  2RRD A;  3F2D A;  2E5S A;  5KL1 B;  1P7D A;  2F8L A;  4KX3 A;  1KBU A;  1UPH A;  2LYB A;  2LKY A;  2ZXH A;  3M6K A;  5HR7 A;  2WB1 F;  2WB1 C;  3RF9 A;  3SMV A;  1A0P A;  2H3F A;  2CRX A;  2WAQ C;  3M7D A;  4U6P A;  2H3Z A;  2JHD A;  4GFJ A;  1PVP A;  1DRG A;  3LYS A;  5KL8 B;  3LVV A;  3N7R C;  3IP4 B;  1MA7 A;  2KIW A;  2HBM A;  2KHV A;  3IG5 A;  1URJ A;  2F76 X;  5HR6 A;  4IC9 A;  2GH1 A;  2HBL A;  2VJ4 A;  2M0N A;  2VJ5 A;  2XI9 A;  3NRW A;  3VCB A;  1Z1B A;  4OO1 J;  4WJ3 B;  3VC8 A;  2ZIV B;  1D8B A;  3PST A;  3SAG A;  2R18 A;  2KKV A;  2G06 A;  2ZG6 A;  3ONN A;  2YB1 A;  2ZIU A;  4CDG A;  2Y0S F;  3SQI A;  2KV2 A;  1OUQ A;  3H0M B;  3HKZ C;  1HEK A;  2KNJ A;  2CPR A;  4QNL A;  3SAF A;  2W7P A;  3F5A A;  4AYB C;  3GZF A;  2KJ8 A;  2KKP A;  3PSI A;  4OJP A;  2HOF A;  3E0F A;  2YB4 A;  5C0Y A;  4ICA A;  1XO0 A;  3F2C A;  2HBJ A;  1F44 A;  2RP5 A;  2F2A B;  4P0P B;  1SZH A;  2H3V A;  2LYA A;  2HMX A;  3D2Q A;  1ECW A;  1PVR A;  4A8E A;  2HOI A;  2OH2 A;  2DF4 B;  3AL0 B;  3KFU F;  1A6S A;  1Q3U A;  2ZIV A;  4ACO A;  4FE3 A;  2H3I A;  2YX8 A;  2CN1 A;  3C29 A;  5CRX A;  2RHF A;  3M6Z A;  4AYB F;  1WUD A;  3HKZ F;  2HBK A;  2Z7J A;  4BUG A;  2W04 A;  3PSF A;  2VIX A;  2W03 A;  2Y0S C;  2ZIX A;  2KJ9 A;  4PL1 A;  4C0Z A;  3N7P D;  2GOL A;  3T79 A;  4BJQ A;  2JMG A;  3ALR A;  4KX5 A;  2ZIU B;  1CRX A;  4U7C A;  4CRX A;  2G09 A;  3D2S A;  2G08 A;  2NV3 A;  3C28 A;  4P0Q A;  2K8C B;  2KIC A;  4FZN A;  4NWI A;  2KD1 A;  4OJ6 A;  2ZIX B;  1NZB A;  3L3F X;  2KHQ A;  2JH7 A;  2LHT A;  2ZXI A;  2KEY A;  3DEE A;  4QJF B;  3PZP A;  2KOB A;  2D6F C;  1YT3 A;  2OYY A;  2XIC A;  5T14 A;  3O0F A;  2WAQ F;  3CYM A;  1ED1 A;  2K8B B;  3IN5 A;  3AQF A;  1IIP A;  2KJ5 A;  2KVC A;  1ZQ1 C;  3PSP A;  4FZL A;  4OJ5 A;  4OJO A;  5A0L A;  3SAH A;  3CRX A;  2PMZ C;  1GO3 F;  2XID A;  2ZIW B;  4O3M A;  4JMU A;  4NLC A;  3RFA A;  2E1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...