2F2AB

Structure of trna-dependent amidotransferase gatcab complexed with gln
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
408
structure length
408
Chain Sequence
b'ETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
publication title Ammonia channel couples glutaminase with transamidase reactions in GatCAB
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 120
structure length 408
sequence length 408
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2f2aB02
2DQNB 2DF4B 2G5HB 2G5IB 2D6FC 3KFUF 1ZQ1C 4WJ3B 3H0LB 3IP4B 3H0MB 3H0RB 3AL0B 2F2AB
chains in the Genus database with same CATH superfamily
2W03A 4NLGA 2FPKA 5AM0A 4B9UA 2XCAA 4QW9A 1HJPA 5KFIA 4K4HA 2JEFA 4FZMA 5KFOA 5J8YC 4ED7A 4J9KA 5J2IA 8ICSA 3H8JA 4QZFA 3AN1A 1ZQNA 4QWCA 3MGVA 2AHOB 4RQ0A 4R64A 2W7OA 1XU4A 2RHFA 2A1JA 4IRKA 5ALMA 3KHLA 3LVVA 4NV0A 5EWFA 2PFPA 4JK1A 2W9AA 3NRWA 5AI4A 1PZNA 5ALIA 3JPQA 2ATLA 1SKSA 3Q8QB 2VIXA 4C8LA 1JROA 1F5SA 4UW9A 3NVWA 4QZBA 1L3UA 5DB8A 4M9LA 2L5YA 3IV6A 5J0PA 4QZCA 4P0QB 3MDCA 2F2AB 5IIOA 5E79U 7ICEA 5CJ7A 4NL9A 5KFQA 3C21A 2HVHA 3GFKB 4UAZA 1ZQGA 4R8UB 5AI6A 4F92B 4I2EA 2E8NA 4C7ZA 2OEHA 4DL6A 4KLSA 5CP2A 4J9OA 3N97B 2ZJ5A 2FDRA 3MR5A 9ICVA 2YB1A 3WKDA 1WCNA 1LVHA 1CRXA 1Q8KA 3PMLA 1ZQCA 5DDYA 4UBBA 3KZIU 3UMCA 1JI7A 3C2LA 1ZQQA 9ICXA 4YMOA 5DBCA 1DGJA 4QZHA 2E8MA 2YY6A 3DDHA 1NJWA 2MUTB 2F44A 2FPLA 2WFAA 5EE0A 2AH5A 5EE1A 3QEAZ 2JZBA 4R63A 9ICTA 4IL6U 3C29A 1KFSA 4DQIA 3MFIA 4PJ0U 2IHNA 4DL5A 4J9PA 4YXMA 3RJEA 2HVIA 1TK0A 1RQNA 3V6KA 3BDPA 2ZUDA 5KT2A 5KFYA 1ZQVA 4PH5A 5AM2A 5KFGA 8ICVA 4J9RA 4YQWA 4IQVA 4FZNA 1ZD2P 2E3TA 4ED1A 3Q8MA 8ICEA 2JV3A 1TKDA 1XWLA 4RQMA 1ZQXA 5AK4A 2Y0SC 5ALHA 1J97A 3F2BA 2QKQA 1L7OA 2WF7A 4QZEA 5KFJA 1U48A 2LM1A 2WAQF 1DXSA 4TUPA 2EH9A 2ZIWB 1NOMA 2DF4B 2ZIUA 3R9KA 3WK5A 3F5EA 3S6JA 4I2CA 3FDSA 2IOFA 1COKA 5EE3A 5DBAA 4ECUA 2BQRA 2DBYA 2WB1C 2A1JB 3T5KA 1NK0A 2K60A 1RQLA 1TVAA 2H3ZA 3FM9A 3MGHA 2RP5A 4PGYA 4B9VA 1L8OA 4IS7A 5AM3A 3TAPA 4UASA 1NK4A 3U26A 4MFCA 4P2HA 3JPRA 1RZTA 1D8BA 2JH1A 3GV8B 2LI6A 4BXOA 3KD3A 3H8WA 4UB8U 3KHGA 3FC4A 2ASDA 4UAUA 3M9OB 2F3NA 3AMZA 3QU9A 4B9SA 5KFWA 7ICKA 3N7SC 4DQQA 4KN4A 1DGSA 1J2NA 1TAQA 4DOAA 1JMSA 4KLEA 5KFEA 1S8OA 4US8A 2RDIA 4PHDA 2JEJA 1T4GA 1S0OA 3T5LA 1N56A 2K8BB 2W8LA 4KLLA 1RDFA 3BS5A 4ECRA 5HP4A 1SIJA 3FYHA 1JXEA 4QIWC 1JRPA 3DEEA 4EBCA 2NRXA 4F5OA 3WK6A 2GOLA 7ICSA 1HUOA 4MF2A 5KFSA 2HHXA 2W11A 7ICLA 4RPZA 1TK8A 4O3PA 4Q44A 4F4XA 2JZBB 5HHHA 3MBYA 4FBTA 5EWEA 4Q45A 9ICKA 2EQYA 4RQ3A 2H3IA 2PFOA 5CRXA 1MC8A 1SL1A 4KLFA 2ZIXA 4CNQA 4HYKA 5J2GA 2FLNA 3RB4A 9ICHA 2GWSA 4RZRA 5J2AA 1BNOA 2HOIA 4EEYA 5J0XA 1NKBA 1A76A 2B21A 3PSFA 3JPSA 3PX6A 1ZRNA 2KN7A 5IILA 5GTHU 1RYRA 1V97A 3KBBA 4RQ1A 1T7PA 3KTQA 4F72A 2HHVA 4QZAA 2AJQA 4UB5A 5KG4A 4M9HA 5ALTA 4CF3A 4DFKA 8ICQA 1TAUA 5KFNA 4NWIA 5KL8B 3OJUA 2XI9A 1ZD5A 2W43A 1URJA 3OHBA 2QLTA 2XGQA 5J2BA 2DQNB 3IDWA 5L1KA 1XSLA 2BHNA 4BUGA 2XVTA 5EOZA 2H5XA 3V7JA 5C5JA 3H40A 2E1EA 3SMVA 4EBEA 4RQNA 4ED8A 9ICJA 3H0RB 1S77D 2CPRA 3PSTA 4RUAA 3B0YA 3M1YA 4A8EA 5ALLA 5KNIA 3HKZC 2DL0A 3SR6A 1MA7A 4P0PB 4P4MA 4ZOHC 1ZQWA 2A1AA 4Y2UA 2GO7A 4KLIA 3WU2U 2W04A 5IIKA 3D2SA 1BPZA 2AGOA 2G06A 4GFJA 2IA6A 5TZVA 1KSPA 7ICGA 3GV7B 3N7RC 4OJPA 4EEKA 3RTVA 5ALJA 1S10A 2E8OA 3ZDCA 4OJOA 3NASA 4RNMA 3LYSA 3J81j 1SXDA 4CRXA 3BQ7A 2BDPA 5J29A 4PZOA 4DLEA 2ZJAA 2KEYA 4OO1J 5DG8A 3GU3A 3HP6A 4UARA 8ICPA 1ZQJA 4KLQA 5AI8A 4Y2JA 2KVSA 2R8IA 1PUZA 2H3VA 3IHQB 5BOLA 2XGPA 3RJHA 2KSOA 4BX9C 3IG5A 4RU9A 4ECXA 4G3IA 4F5PA 1KKXA 1BGXT 2W3SA 5ALXA 2E5SA 5ALVA 2HBKA 1NI3A 5KFLA 3M8SA 5AM1A 4P0QA 3LDAA 2VA3A 5DGAA 1KW4A 1H38A 2ZIXB 3C2KA 4TUQA 5DQHA 9ICSA 3ZDEA 1BPYA 1SL0A 4AYBC 4F8RA 5AKHA 1SWVA 4O3RA 4KLTA 4F3OA 1A6SA 2FMQA 2JH7A 2Y0SF 2E1FA 3H0LB 4BJQA 3PW7A 4NLZA 4GXJA 4ED3A 2W9BA 3SQIA 3H8SA 3TADC 4EZ6A 3F53A 8ICBA 5DB9A 2DUYA 3GIKA 3C1ZA 4RPYA 2XC9A 3IRUA 2C2DA 5KFXA 4NXZA 5ALDA 2FPMA 4ECQA 9ICCA 5AKLA 1S0NA 1T94A 2MUTA 1L3VA 4RQ2A 5KT3A 3NVVA 2HBJA 1ZQAA 5KFDA 4I2HA 4J03A 2AXTU 2VJ4A 5J2DA 2LM4A 3IG8A 3KKAC 4I27A 5AKZA 2HI0A 3SV4A 2BCRA 1C20A 1BPDA 4DL2A 4YG2A 1KFTA 2KJ5A 2HBMA 4RNNA 4ICAA 2MU2A 4OD0A 5CB1A 4Y2QA 5KFHA 1SGGA 1X66A 2G5IB 4PHAA 5DQIA 1ED1A 4IQUA 3CRXA 4P4OA 2DKXA 5J0WA 4M04A 5D46A 2ZIWA 7ICFA 1NKCA 5F9LA 4Y2RA 3BZCA 9ICQA 2UVRA 1ZQZA 4PL1A 1ZQKA 1D9FA 2FE9A 5HNKA 3Q8RB 2W8KA 1ZD3A 3QZ7A 2DGZA 4QIWF 2I6XA 2I9GA 5IIMA 2OM6A 3VC8A 1NJXA 1MQ2A 4NM1A 2ZTEA 3HRDD 2JHDA 4Y2YA 4KTQA 8ICRA 5AKXA 3AM9A 3FAHA 2KSOB 4DL4A 2F1IA 1NK7A 3WK9A 3N4MB 1OUQA 1L6NA 2KKVA 3RH6A 3RRHA 4B9MA 2OYYA 1VJ5A 5AKEA 1SV0C 1Z00A 1LV5A 2IOFK 1ZQYA 4YR2A 2W9MA 5L1MA 2K8CB 1WG8A 5KG6A 4GXKA 4X5VA 1TFRA 1RPLA 5ALFA 8ICLA 3T5JA 2BZFA 1COOA 3T79A 2BQUA 1VDVA 1JN3A 2R18A 3M7DA 2LPEA 2BCVA 2HHWA 4C0ZA 1KBUA 1HIWA 2YN4A 7ICTA 3ISCA 2W9BB 7ICHA 4BDPA 2KZ3A 4KN7A 4IRCA 7ICJA 8ICMA 5ALOA 3RJJA 2NO5A 3QU4A 3BQ0A 2AGPA 1NK9A 1XSNA 3UMGA 8ICUA 4F93B 2ISOA 2F8KA 5CEHA 3ORYA 3ICXA 2FLPA 1ZQOA 4UB6U 5D4BA 4EELA 4AP9A 4RQ4A 4MEYA 1C7YA 5ALSA 1SB3C 3L4PA 5J0RA 3LWMA 4BWMA 5CHGA 5JU5A 4TUSA 1U49A 5IIJA 3UXOA 3PZPA 5B66U 4UAVA 3SI8A 5KFBA 1FEZA 1HUZA 1K5OA 1ZQDA 4ELTA 4O5CA 2P35A 3HKZF 8ICOA 4KX5A 8ICZA 2BCQA 1NZPA 5J0UA 3PSPA 3BQ1A 4ZH4A 1FFUA 2QARA 5KG0A 4DEZA 5DGBA 3PMNA 2NRZA 3RF9A 3TFSA 5AM5A 4F2SA 4O5EA 1IG6A 4TURA 3K1ZA 4I2JA 4PPXA 2LYBA 4R66A 4QWDA 5KG7A 1TV9A 4TQRA 2W7PA 4XQ8A 3RR7A 2KZZA 5ALRA 1KLNA 5DDMA 3C2MA 8ICYA 4DF4A 1NJZA 2AQ4A 2KFZA 3N28A 2WF6A 2Y9TA 3ZI4A 3RJIA 3RBDA 3JPTA 2ASJA 9ICFA 2HHUA 3QUBA 4FS1A 2AQ0A 2CN1A 4FE3A 3AQEA 4YMMA 4KLJA 3SAGA 1ZRMA 2V9WA 3WKBA 3PW4A 1YZ6A 2RLTA 3SV3A 4IR1A 5HR7A 4QWBA 4QZ8A 5J8YA 2KKPA 3V7LA 4DFPA 1ZJMA 8ICHA 4DS5A 2EZYA 4BGDA 3ZDDA 3N7PD 2LYAA 5D49A 3QX7A 3HWTA 4UB2A 5DLFA 5DLGA 1NK6A 1AQ6A 3UQ2A 4F2RA 2OXOA 2JRZA 1JXLA 3MABA 4GXIA 4DWIA 3Q8LA 3HW8A 4RQ5A 2D6FC 2KHQA 4KLOA 4P0PA 9ICIA 4YP3A 2ZUBA 1Z00B 3L5KA 1ZQTA 3E2EA 2FMPA 4AYBF 4GC7A 3SYZA 1KEJA 4PZNA 3ZD9A 3MR3A 3AU2A 5DBBA 3IM1A 2CRXA 3QUCA 5AKJA 5EE9A 1UCVA 4QZGA 3CP8A 5KTQA 3TANA 1JALA 3RH5A 1PVQA 4G9BA 2R8KA 3EPIA 4NY8A 1IM4A 3GDXA 2KIVA 3TFRA 2K4PA 1NK5A 7ICMA 1Z3EB 3RAXA 3AL0B 4QZIA 1BVSA 8ICWA 1S76D 1X42A 1N61A 2YMMA 5KFRA 3JPPA 1L7NA 4O3NA 3WK8A 3PSIA 1N60A 5ALGA 2ALZA 3D2NA 5KG1A 3QU7A 4RT2A 3F2CA 1ZQSA 2Y1IA 5DQGA 3PW5A 4O0IA 1KDHA 1WUDA 5AIAA 1MSWD 4J9QA 4RUCA 3L3FX 5KAIU 2KP7A 4C8NA 4Y2XA 2C2EA 2VA8A 1Z19A 4B6JA 1ZQFA 4R65A 4YFKA 1ZQPA 2QARB 2YTUA 5KT6A 4XUSA 3LVWA 4IQTA 4ECZA 1ZETA 4EENA 1Z1BA 3C1YA 3RH4A 2BPGA 4O9MA 3D6JA 2VJ5A 2F77X 3H4DA 2CXYA 2XY6A 3GIMA 4KITB 4DOBA 4O5KA 1XC9A 5IIIA 9ICOA 5KFAA 1S5LU 1A77A 3GIJA 4KLUA 2H3FA 2ZTDA 9ICBA 2WF8A 1T3NA 2BDUA 1X2IA 1IIPA 2LKYA 4YR0A 4KLMA 4IR9A 4QZ9A 4RNOA 4MEXA 4KMOB 2D3DA 4JWMA 5AK5A 3LWLA 5AKKA 3OJSA 4ECSA 1LKYA 2NRWA 5ALPA 4GIBA 1UT5A 3I76A 4DF8A 4BWJA 1NKEA 5L1JA 2EAPA 4Y2PA 3EYZA 4Z6CA 4I28A 3KZXA 1XSPA 4ECWA 1D8LA 1D8YA 4JUZA 1ZOLA 3RRGA 1MQ3A 1ZQRA 3PO4A 4Q8FA 2WAQC 2G09A 2MA1A 3WKEA 1X9SA 3WKCA 4NLKA 4DOCA 5KFCA 1SKWA 1QSYA 4DO9A 4PGXA 2KNJA 4DL7A 3AU6A 1V85A 3PW0A 1BPXA 1B4FA 4JB3A 3B0XA 2KJ8A 4M9JA 2XY5A 5KFMA 1ECWA 1WWVA 1L7PA 2EDUA 1GO3F 2JMGA 5T14A 5KT7A 9ICEA 1TE2A 3UMBA 3PW2A 3RJFA 1HEKA 4MFFA 1ZQLA 2KK0A 2HHSA 1XS9D 1U45A 2XICA 4IRDA 3SENA 1NJYA 8ICIA 2BCUA 3GZFA 3E0FA 4NL9C 2PI5A 1ZJNA 4ELVA 1U9LA 2BGWA 3F2DA 2PMZC 4QWAA 1IV8A 3RAQA 4PL2A 1RG6A 1ZQMA 4Y2SA 4JV2A 4C8OA 3A0BU 4QW8A 2YMPA 4RQ7A 1K1SA 4M9GA 4EBDA 5J0OA 5TISU 3RB3A 4DLGA 5ALWA 4EZ9A 1Z4NA 5K4LA 7ICPA 4Q8EA 4F4KA 4O3OA 9ICPA 2Q4TA 3GILA 2K8AA 2F8LA 2LYHA 3QZ8A 2JR5A 3CW2C 3F5AA 2WB1F 4ED6A 4I2DA 1XNSA 2ZJ8A 9ICLA 2IHMA 3CYMA 2UVVA 1N5WA 3Q8SB 2AU0A 1D9DA 1EXNA 5KFZA 1IXRA 4O3QA 4I2FA 4J9SA 3QEBZ 5KFPA 5KFKA 2K4HA 1V9PA 1O03A 2GH1A 4DFJA 3THVA 3NGDA 2K4EA 5B5EU 3AUOA 5AM4A 1PVRA 2W3RA 4QZDA 2RRDA 1NZBA 1ZXIA 5ALZA 5CA7A 3WK4A 2NYVA 4PGQA 4YVZA 5F9NA 2QB1A 1KRPA 3G6VA 3QUTA 1LKYB 1Q3VA 4DSFA 5J0YA 4B9NA 4DS4A 5CR0A 3BQ2A 4GC6A 5J2KA 3RB6A 4M47A 2ZTCA 1KTQA 2PFNA 3UM9A 3B9JA 4CF4A 4WJ3B 2V4QA 2Z7JA 4OCZA 4IQWA 5G5GA 1Q46A 4I29A 5AICA 5ALUA 8ICFA 1TAMA 5HR6A 1V38A 4TQSA 4ED2A 3SAHA 2HHTA 5J2CA 3GV5B 3MR6A 1SWWA 4FBUA 2HMXA 4YCXA 2XY7A 5DB6A 5J0SA 5IINA 4MFAA 7ICRA 2KTQA 2IBKA 1UA0A 5J0QA 2KVCA 5AI0A 5KAFU 3KOOA 2BR0A 2FLLA 8ICGA 2I1QA 5C0YA 1OW5A 2KG5A 4RQ6A 3PX4A 3PNCA 4CGZA 2B0CA 1XO0A 2KJ9A 1B0XA 4OJLA 3H7IA 4IC9A 1YT3A 2NRTA 2PFQA 5DG9A 1QQ7A 1VLBA 4XRHA 4DSLA 8ICCA 4DFMA 4KLGA 2PI4A 5J2JA 2WF5A 4PHPA 2B6GA 3PV8A 1BPBA 1QLNA 4C4RA 2FJ6A 3BZKA 1BNPA 7ICIA 4P4PA 3Q8KA 3JPNA 2K89A 2HDOA 3TADA 4C80A 1WWUA 4MF8A 4UB4A 3V72A 3VCBA 4KX3A 4YD1A 3EW9A 2GLEA 2G5HB 4QWEA 4M0AA 2G08A 7ICOA 3MFHA 4KLDA 2BPCA 3ZDBA 1PK3A 2BQ3A 1KFDA 1FO4A 3V6JA 2KICA 3LK9A 2FI1A 9ICMA 3PR4A 3RJGA 3Q8PB 4YD2A 1YZ7A 4M9NA 2JGAA 3KKAA 5KG2A 3GQCA 2EAOA 3BS7A 2JEIA 2C2RA 4ED0A 5KT5A 1ZQBA 4NLBA 5KG3A 5G5HA 3V6HA 4US9A 5DKWA 1T8EA 7ICVA 1FFVA 3TAQA 4C8MA 3MGIA 2KZMA 4Y2VA 5L1LA 7ICUA 4J9LA 1MN8A 4QJFB 2NRVA 4JWNA 2P6UA 3T3FA 2ESEA 3MDAA 4O3SA 4ECTA 3ONNA 2NV3A 3AEVA 2M0NA 2KE7A 3H0MB 8ICAA 4UB1A 2N1RA 1UPHA 4F4WA 1O08A 4DQSA 1U47A 5AK6A 2QB0A 4UB3A 4J9MA 5AI5A 5AKIA 2V4RA 1S0VA 4FS2A 4DQRA 1X6JA 2XCPA 5GTIU 3UXPA 4F5RA 2J6SA 1DK2A 2ODGA 1SL2A 3RR8A 2ISPA 1N48A 4LVSA 1RXWA 2ZXHA 7ICQA 3RJKA 4UBCA 4KMUA 3WKAA 8ICKA 5BOMA 4Q43A 4YMNA 2ES6A 2MRLA 3EWAA 3QU2A 4XA5A 1SZPA 3HT3A 3QNMA 2YMQA 5AI9A 3SZ2A 3NUQA 2PKEA 1L3SA 1N62A 4FZLA 3C5FA 4JV0A 1ZQUA 5KG5A 1N5XA 3K4GA 4LJXA 3HILA 1SV0A 4DSIA 1SV4A 1UT8A 2ZIVA 3PO5A 3HPOA 1S97A 1B22A 2EZXA 4OJ6A 3K75D 4CE6A 2LBOA 1UA1A 1X9WA 2W54A 2PMZF 4EX6A 4Z6DA 3HX0A 1F0MA 3QYPA 4UATA 5ALQA 4QNLA 3TKAA 1S9FA 2HW3A 4ACOA 2OH2A 4KLHA 1L8LA 1X9XA 4F91B 4M2YA 4U6PA 2IOHA 4NLCA 3ISBA 3V7KA 2KOBA 1ZQEA 1AROP 4GLXA 2FMSA 4CDGA 4YN4A 7ICNA 3UXNA 1OXJA 5HHIA 8ICNA 1NK8A 4EYIB 3QU5A 3I28A 4Z6EA 3I1YA 3T5HA 4JMUA 5KFVA 3CNHA 5FP0A 8ICJA 5JUMA 1J2MA 5ALKA 3M8RA 9ICRA 2W9CA 1DRGA 3ZDAA 1S0MA 5AK3A 3BJYA 1Z4OA 3EPGA 4B9TA 3NVZA 3WK7A 4PHEA 3UQ0A 3ETRA 5J2EA 3OSPA 4F4ZA 2Q0ZX 2UVUA 4C7YA 3ALRA 8ICXA 5KFTA 4O3MA 2P6RA 4MHVA 1L5UA 1CI4A 3KHRA 2ZUCA 1ZQ1C 1Q3UA 3IP4B 1QCKA 3G6XA 3MC1A 4NJ8A 3SAFA 5J2HA 1CEZA 5KFUA 3H8MA 4E0DA 3RBEA 5H2FU 2W55A 4F5QA 2VKQA 2YX8A 4JV1A 3M6ZA 2ASLA 3SD7A 2QB0B 4DFDA 1FIQA 4NLNA 1NNLA 3ED5A 5AKGA 1ZQIA 3KFUF 1SXEA 3TACB 3ISDA 2H3QA 3BQTA 1TK5A 3C28A 3ZD8A 3UPQA 3HJEA 5AKYA 2PXIA 1DK3A 3E58A 1N2XA 2KFNA 5ALEA 5HMMA 5J0TA 3M9MB 1KL9A 4YR3A 1PVPA 2ZIUB 1DOQA 1ZYQA 4RQ8A 1SZHA 2XIDA 3TARA 2DPJA 1U4BA 1XO1A 3AQFA 4Y2TA 4I2IA 2JEGA 3OTQA 3SEIA 3A0HU 1QQ6A 3IN5A 3PVXA 3TQ1A 3KHHA 2G0AA 5F3XB 4F71A 2NO4A 3QE9Y 2HHQA 3O0FA 4LZDA 4HAIA 1L3TA 2C22A 5L9XA 4M6WA 1PK1A 2ZIVB 2A19A 3QXGA 2F1HA 4C4SA 2J6UA 4BXOB 3NTUA 2KD1A 4CCHA 2M9NA 3OSNA 2LMRA 2WF9A 5J2FA 4DSEA 1L7MA 4DSKA 2F76X 5L1IA 1JX4A 1RM6C 4U7CA 2DFLA 1QSLA 4Z6FA 4ECYA 2IMWP 4B9LA 1LB2B 5KFFA 1SKRA 2Y1JA 2VANA 1M6YA 5JTIA 5AIBA 2C28A 4FO6A 5DG7A 2BCSA 2A3VA 2ZG6A 3BS5B 4DCCA 4LZGA 3QUQA 2BKEA 2R8JA 3C5GA 2LHTA 2DPIA 2W9CB 2K4IA 1JUDA 3GIIA 1K1QA 2VA2A 3EUB2 5CWRA 2I5HA 2F1JA 9ICAA 4CF5A 2HBLA 4C8KA 9ICGA 2KV2A 4K4GA 4EYHB 4I2BA 3NVYA 2WHEA 5HMLA 4F4YA 2D8CA 2XO7A 9ICWA 1X9MA 1A0PA 1WYGA 2JXJA 1Z1VA 2DWQA 3RB0A 2J6TA 1T3QA 1X6IA 2HCFA 3ETLA 4FFDA 4UAYA 3PR5B 1UQVA 2OHFA 9ICNA 2KMDA 5KL1B 1RYSA 2HOFA 4R8UA 4NM2A 4YXJA 4ELUA 4ECVA 4DQPA 2HOQA 2G07A 2OCEA 3M6KA 3DV9A 3MR2A 2HSZA 2DKZA 1ZQHA 4OJ5A 4K4IA 1QSSA 3H4BA 1F44A 1P7DA 4USAA 3PY8A 1RYUA 4F5NA 5BPCA 5ALNA 2Y9UA 1UHUA 3K1RB 1ZD4A 2MAXA 2OWOA 1BPEA 3EZ5A 4I2GA 1QQ5A 3NRZA 3D2QA 3RFAA 2YMLA 4C4TA 4UQGA 4I2AA 1QTMA 5KT4A 2R8GA 2ZXIA 9ICUA 2EAMA 3JPOA 4DSJA 2WTFA 5AHXA 4F50A 2P66A 2YQEA 1JIHA 1N63A 5ALYA 4EX7A 1WCLA 1Y88A 4RPXA 2UVWA 1RXVA 1KQQA 4M6WB 1PK1B 3OGUA 2YB4A 1QH9A 2MSNA 1X40A 3OPXA 3G6YA 2RQ5A 3NS1A 5JRTA 4DL3A 2KIWA 5EWGA 2AGQA 1B43A 2EANA 3C23A 5DB7A 3OHAA 2KHVA 4UAWA 1KN5A 2BPFA 3PX0A 8ICTA 1CUKA 4RT3A 2R8HA 3TI0A 5A0LA 2RDJA 2O6KA 3M9NB 2E8PA 2EZZA 4J9NA
chains in the Genus database with same CATH topology
1XO0A 3ONNA 2KJ9A 2KKPA 2NV3A 4ICAA 4C0ZA 1HIWA 2M0NA 2W03A 3F5AA 3IN5A 2WB1F 4OJLA 1XNSA 3H0MB 3N7SC 2N1RA 2H3VA 4IC9A 5KL1B 1UPHA 2HOFA 1YT3A 2G0AA 3CYMA 3N7PD 4BX9C 3IG5A 2LYAA 3O0FA 3C29A 1Z19A 4FZMA 2G5IB 3LVWA 4JMUA 5HR7A 2HOQA 2G07A 2ZIVB 2WAQC 2G09A 2MA1A 3M6KA 2E5SA 2HBKA 2K4HA 3MGVA 2W7OA 4NWIA 5KL8B 1ED1A 3ICXA 1DRGA 2XI9A 1Z1BA 2OXOA 4P0QA 2KD1A 2GH1A 2RHFA 3CRXA 1KBUA 2K4EA 1URJA 4OJ5A 3LVVA 4NV0A 2VJ5A 2ZIXB 2D6FC 2KHQA 2ZIWA 1F44A 4P0PA 1A6SA 2F77X 1P7DA 1PVRA 2ZXHA 2K8BB 3NRWA 2DQNB 2RRDA 4FZNA 1NZBA 2F76X 2KNJA 4AYBC 3ALRA 4BUGA 4PL1A 4O3MA 4U7CA 2XVTA 3PZPA 2MRLA 2VIXA 4AYBF 2K89A 2Y0SC 2KJ8A 1ZQ1C 2E1EA 3SMVA 4QIWC 1Q3UA 3DEEA 3IP4B 1Q3VA 3H0RB 3F2BA 1ECWA 3D2QA 2CPRA 3RFAA 2DGZA 2JH7A 3NUQA 3PSTA 2Y0SF 4KX3A 4QIWF 3VCBA 3SAFA 2E1FA 4FZLA 1GO3F 4A8EA 2OM6A 2JMGA 2WAQF 2H3FA 3H0LB 3VC8A 2GOLA 4BJQA 4P0QB 5T14A 2F2AB 2CRXA 3HKZC 1MA7A 2G5HB 2ZIWB 3SQIA 2JHDA 4P0PB 2G08A 4WJ3B 2ZXIA 3HKZF 2Z7JA 2VKQA 4KX5A 3GU3A 2YX8A 1HEKA 2BDUA 2DF4B 1IIPA 3CP8A 3F53A 2A3VA 2ZG6A 3PSPA 2ZIUA 3M6ZA 1PVQA 2LKYA 2W04A 3F5EA 2XICA 1TAMA 2KICA 3D2SA 3RF9A 2ZIVA 5HR6A 2G06A 3SAHA 4GFJA 3GZFA 3E0FA 3AL0B 2H3IA 1OUQA 5CRXA 2KKVA 2YB4A 3K1ZA 1L6NA 2LHTA 4OJ6A 2JGAA 3KFUF 2LYBA 3N7RC 2W7PA 3F2DA 2PMZC 2WB1C 3KZXA 3OPXA 2K4IA 4KMOB 4PL2A 2ZIXA 2LBOA 4OJPA 2OYYA 1T94A 2H3QA 2YB1A 2HMXA 2PMZF 2KIWA 3C28A 1CRXA 2H3ZA 2HBJA 4OJOA 2RP5A 2HOIA 3PSIA 3LYSA 2HBLA 4NLBA 2KHVA 2VJ4A 4QNLA 4ACOA 2K8CB 2KV2A 3D2NA 2OH2A 4CRXA 3IG8A 1PVPA 2ZIUB 2KVCA 3F2CA 1SZHA 2XIDA 3PSFA 1D8BA 2CN1A 4U6PA 1A0PA 2JH1A 1WUDA 4FE3A 3AQEA 4NLCA 4QJFB 5A0LA 2KEYA 3SAGA 3T79A 2R18A 2Q4TA 2KOBA 3AQFA 4OO1J 3L3FX 5C0YA 3M7DA 2KJ5A 2HBMA 2K8AA 4CDGA 2F8LA 4CGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DQN B;  2DF4 B;  2G5H B;  2G5I B;  2D6F C;  3KFU F;  1ZQ1 C;  4WJ3 B;  3H0L B;  3IP4 B;  3H0M B;  3H0R B;  3AL0 B;  2F2A B; 
#chains in the Genus database with same CATH topology
 2W03 A;  4NLG A;  2FPK A;  5AM0 A;  4B9U A;  2XCA A;  4QW9 A;  1HJP A;  5KFI A;  4K4H A;  2JEF A;  4FZM A;  5KFO A;  5J8Y C;  4ED7 A;  4J9K A;  5J2I A;  8ICS A;  3H8J A;  4QZF A;  3AN1 A;  1ZQN A;  4QWC A;  3MGV A;  2AHO B;  4RQ0 A;  4R64 A;  2W7O A;  1XU4 A;  2RHF A;  2A1J A;  4IRK A;  5ALM A;  3KHL A;  3LVV A;  4NV0 A;  5EWF A;  2PFP A;  4JK1 A;  2W9A A;  3NRW A;  5AI4 A;  1PZN A;  5ALI A;  3JPQ A;  2ATL A;  1SKS A;  3Q8Q B;  2VIX A;  4C8L A;  1JRO A;  1F5S A;  4UW9 A;  3NVW A;  4QZB A;  1L3U A;  5DB8 A;  4M9L A;  2L5Y A;  3IV6 A;  5J0P A;  4QZC A;  4P0Q B;  3MDC A;  2F2A B;  5IIO A;  5E79 U;  7ICE A;  5CJ7 A;  4NL9 A;  5KFQ A;  3C21 A;  2HVH A;  3GFK B;  4UAZ A;  1ZQG A;  4R8U B;  5AI6 A;  4F92 B;  4I2E A;  2E8N A;  4C7Z A;  2OEH A;  4DL6 A;  4KLS A;  5CP2 A;  4J9O A;  3N97 B;  2ZJ5 A;  2FDR A;  3MR5 A;  9ICV A;  2YB1 A;  3WKD A;  1WCN A;  1LVH A;  1CRX A;  1Q8K A;  3PML A;  1ZQC A;  5DDY A;  4UBB A;  3KZI U;  3UMC A;  1JI7 A;  3C2L A;  1ZQQ A;  9ICX A;  4YMO A;  5DBC A;  1DGJ A;  4QZH A;  2E8M A;  2YY6 A;  3DDH A;  1NJW A;  2MUT B;  2F44 A;  2FPL A;  2WFA A;  5EE0 A;  2AH5 A;  5EE1 A;  3QEA Z;  2JZB A;  4R63 A;  9ICT A;  4IL6 U;  3C29 A;  1KFS A;  4DQI A;  3MFI A;  4PJ0 U;  2IHN A;  4DL5 A;  4J9P A;  4YXM A;  3RJE A;  2HVI A;  1TK0 A;  1RQN A;  3V6K A;  3BDP A;  2ZUD A;  5KT2 A;  5KFY A;  1ZQV A;  4PH5 A;  5AM2 A;  5KFG A;  8ICV A;  4J9R A;  4YQW A;  4IQV A;  4FZN A;  1ZD2 P;  2E3T A;  4ED1 A;  3Q8M A;  8ICE A;  2JV3 A;  1TKD A;  1XWL A;  4RQM A;  1ZQX A;  5AK4 A;  2Y0S C;  5ALH A;  1J97 A;  3F2B A;  2QKQ A;  1L7O A;  2WF7 A;  4QZE A;  5KFJ A;  1U48 A;  2LM1 A;  2WAQ F;  1DXS A;  4TUP A;  2EH9 A;  2ZIW B;  1NOM A;  2DF4 B;  2ZIU A;  3R9K A;  3WK5 A;  3F5E A;  3S6J A;  4I2C A;  3FDS A;  2IOF A;  1COK A;  5EE3 A;  5DBA A;  4ECU A;  2BQR A;  2DBY A;  2WB1 C;  2A1J B;  3T5K A;  1NK0 A;  2K60 A;  1RQL A;  1TVA A;  2H3Z A;  3FM9 A;  3MGH A;  2RP5 A;  4PGY A;  4B9V A;  1L8O A;  4IS7 A;  5AM3 A;  3TAP A;  4UAS A;  1NK4 A;  3U26 A;  4MFC A;  4P2H A;  3JPR A;  1RZT A;  1D8B A;  2JH1 A;  3GV8 B;  2LI6 A;  4BXO A;  3KD3 A;  3H8W A;  4UB8 U;  3KHG A;  3FC4 A;  2ASD A;  4UAU A;  3M9O B;  2F3N A;  3AMZ A;  3QU9 A;  4B9S A;  5KFW A;  7ICK A;  3N7S C;  4DQQ A;  4KN4 A;  1DGS A;  1J2N A;  1TAQ A;  4DOA A;  1JMS A;  4KLE A;  5KFE A;  1S8O A;  4US8 A;  2RDI A;  4PHD A;  2JEJ A;  1T4G A;  1S0O A;  3T5L A;  1N56 A;  2K8B B;  2W8L A;  4KLL A;  1RDF A;  3BS5 A;  4ECR A;  5HP4 A;  1SIJ A;  3FYH A;  1JXE A;  4QIW C;  1JRP A;  3DEE A;  4EBC A;  2NRX A;  4F5O A;  3WK6 A;  2GOL A;  7ICS A;  1HUO A;  4MF2 A;  5KFS A;  2HHX A;  2W11 A;  7ICL A;  4RPZ A;  1TK8 A;  4O3P A;  4Q44 A;  4F4X A;  2JZB B;  5HHH A;  3MBY A;  4FBT A;  5EWE A;  4Q45 A;  9ICK A;  2EQY A;  4RQ3 A;  2H3I A;  2PFO A;  5CRX A;  1MC8 A;  1SL1 A;  4KLF A;  2ZIX A;  4CNQ A;  4HYK A;  5J2G A;  2FLN A;  3RB4 A;  9ICH A;  2GWS A;  4RZR A;  5J2A A;  1BNO A;  2HOI A;  4EEY A;  5J0X A;  1NKB A;  1A76 A;  2B21 A;  3PSF A;  3JPS A;  3PX6 A;  1ZRN A;  2KN7 A;  5IIL A;  5GTH U;  1RYR A;  1V97 A;  3KBB A;  4RQ1 A;  1T7P A;  3KTQ A;  4F72 A;  2HHV A;  4QZA A;  2AJQ A;  4UB5 A;  5KG4 A;  4M9H A;  5ALT A;  4CF3 A;  4DFK A;  8ICQ A;  1TAU A;  5KFN A;  4NWI A;  5KL8 B;  3OJU A;  2XI9 A;  1ZD5 A;  2W43 A;  1URJ A;  3OHB A;  2QLT A;  2XGQ A;  5J2B A;  2DQN B;  3IDW A;  5L1K A;  1XSL A;  2BHN A;  4BUG A;  2XVT A;  5EOZ A;  2H5X A;  3V7J A;  5C5J A;  3H40 A;  2E1E A;  3SMV A;  4EBE A;  4RQN A;  4ED8 A;  9ICJ A;  3H0R B;  1S77 D;  2CPR A;  3PST A;  4RUA A;  3B0Y A;  3M1Y A;  4A8E A;  5ALL A;  5KNI A;  3HKZ C;  2DL0 A;  3SR6 A;  1MA7 A;  4P0P B;  4P4M A;  4ZOH C;  1ZQW A;  2A1A A;  4Y2U A;  2GO7 A;  4KLI A;  3WU2 U;  2W04 A;  5IIK A;  3D2S A;  1BPZ A;  2AGO A;  2G06 A;  4GFJ A;  2IA6 A;  5TZV A;  1KSP A;  7ICG A;  3GV7 B;  3N7R C;  4OJP A;  4EEK A;  3RTV A;  5ALJ A;  1S10 A;  2E8O A;  3ZDC A;  4OJO A;  3NAS A;  4RNM A;  3LYS A;  3J81 j;  1SXD A;  4CRX A;  3BQ7 A;  2BDP A;  5J29 A;  4PZO A;  4DLE A;  2ZJA A;  2KEY A;  4OO1 J;  5DG8 A;  3GU3 A;  3HP6 A;  4UAR A;  8ICP A;  1ZQJ A;  4KLQ A;  5AI8 A;  4Y2J A;  2KVS A;  2R8I A;  1PUZ A;  2H3V A;  3IHQ B;  5BOL A;  2XGP A;  3RJH A;  2KSO A;  4BX9 C;  3IG5 A;  4RU9 A;  4ECX A;  4G3I A;  4F5P A;  1KKX A;  1BGX T;  2W3S A;  5ALX A;  2E5S A;  5ALV A;  2HBK A;  1NI3 A;  5KFL A;  3M8S A;  5AM1 A;  4P0Q A;  3LDA A;  2VA3 A;  5DGA A;  1KW4 A;  1H38 A;  2ZIX B;  3C2K A;  4TUQ A;  5DQH A;  9ICS A;  3ZDE A;  1BPY A;  1SL0 A;  4AYB C;  4F8R A;  5AKH A;  1SWV A;  4O3R A;  4KLT A;  4F3O A;  1A6S A;  2FMQ A;  2JH7 A;  2Y0S F;  2E1F A;  3H0L B;  4BJQ A;  3PW7 A;  4NLZ A;  4GXJ A;  4ED3 A;  2W9B A;  3SQI A;  3H8S A;  3TAD C;  4EZ6 A;  3F53 A;  8ICB A;  5DB9 A;  2DUY A;  3GIK A;  3C1Z A;  4RPY A;  2XC9 A;  3IRU A;  2C2D A;  5KFX A;  4NXZ A;  5ALD A;  2FPM A;  4ECQ A;  9ICC A;  5AKL A;  1S0N A;  1T94 A;  2MUT A;  1L3V A;  4RQ2 A;  5KT3 A;  3NVV A;  2HBJ A;  1ZQA A;  5KFD A;  4I2H A;  4J03 A;  2AXT U;  2VJ4 A;  5J2D A;  2LM4 A;  3IG8 A;  3KKA C;  4I27 A;  5AKZ A;  2HI0 A;  3SV4 A;  2BCR A;  1C20 A;  1BPD A;  4DL2 A;  4YG2 A;  1KFT A;  2KJ5 A;  2HBM A;  4RNN A;  4ICA A;  2MU2 A;  4OD0 A;  5CB1 A;  4Y2Q A;  5KFH A;  1SGG A;  1X66 A;  2G5I B;  4PHA A;  5DQI A;  1ED1 A;  4IQU A;  3CRX A;  4P4O A;  2DKX A;  5J0W A;  4M04 A;  5D46 A;  2ZIW A;  7ICF A;  1NKC A;  5F9L A;  4Y2R A;  3BZC A;  9ICQ A;  2UVR A;  1ZQZ A;  4PL1 A;  1ZQK A;  1D9F A;  2FE9 A;  5HNK A;  3Q8R B;  2W8K A;  1ZD3 A;  3QZ7 A;  2DGZ A;  4QIW F;  2I6X A;  2I9G A;  5IIM A;  2OM6 A;  3VC8 A;  1NJX A;  1MQ2 A;  4NM1 A;  2ZTE A;  3HRD D;  2JHD A;  4Y2Y A;  4KTQ A;  8ICR A;  5AKX A;  3AM9 A;  3FAH A;  2KSO B;  4DL4 A;  2F1I A;  1NK7 A;  3WK9 A;  3N4M B;  1OUQ A;  1L6N A;  2KKV A;  3RH6 A;  3RRH A;  4B9M A;  2OYY A;  1VJ5 A;  5AKE A;  1SV0 C;  1Z00 A;  1LV5 A;  2IOF K;  1ZQY A;  4YR2 A;  2W9M A;  5L1M A;  2K8C B;  1WG8 A;  5KG6 A;  4GXK A;  4X5V A;  1TFR A;  1RPL A;  5ALF A;  8ICL A;  3T5J A;  2BZF A;  1COO A;  3T79 A;  2BQU A;  1VDV A;  1JN3 A;  2R18 A;  3M7D A;  2LPE A;  2BCV A;  2HHW A;  4C0Z A;  1KBU A;  1HIW A;  2YN4 A;  7ICT A;  3ISC A;  2W9B B;  7ICH A;  4BDP A;  2KZ3 A;  4KN7 A;  4IRC A;  7ICJ A;  8ICM A;  5ALO A;  3RJJ A;  2NO5 A;  3QU4 A;  3BQ0 A;  2AGP A;  1NK9 A;  1XSN A;  3UMG A;  8ICU A;  4F93 B;  2ISO A;  2F8K A;  5CEH A;  3ORY A;  3ICX A;  2FLP A;  1ZQO A;  4UB6 U;  5D4B A;  4EEL A;  4AP9 A;  4RQ4 A;  4MEY A;  1C7Y A;  5ALS A;  1SB3 C;  3L4P A;  5J0R A;  3LWM A;  4BWM A;  5CHG A;  5JU5 A;  4TUS A;  1U49 A;  5IIJ A;  3UXO A;  3PZP A;  5B66 U;  4UAV A;  3SI8 A;  5KFB A;  1FEZ A;  1HUZ A;  1K5O A;  1ZQD A;  4ELT A;  4O5C A;  2P35 A;  3HKZ F;  8ICO A;  4KX5 A;  8ICZ A;  2BCQ A;  1NZP A;  5J0U A;  3PSP A;  3BQ1 A;  4ZH4 A;  1FFU A;  2QAR A;  5KG0 A;  4DEZ A;  5DGB A;  3PMN A;  2NRZ A;  3RF9 A;  3TFS A;  5AM5 A;  4F2S A;  4O5E A;  1IG6 A;  4TUR A;  3K1Z A;  4I2J A;  4PPX A;  2LYB A;  4R66 A;  4QWD A;  5KG7 A;  1TV9 A;  4TQR A;  2W7P A;  4XQ8 A;  3RR7 A;  2KZZ A;  5ALR A;  1KLN A;  5DDM A;  3C2M A;  8ICY A;  4DF4 A;  1NJZ A;  2AQ4 A;  2KFZ A;  3N28 A;  2WF6 A;  2Y9T A;  3ZI4 A;  3RJI A;  3RBD A;  3JPT A;  2ASJ A;  9ICF A;  2HHU A;  3QUB A;  4FS1 A;  2AQ0 A;  2CN1 A;  4FE3 A;  3AQE A;  4YMM A;  4KLJ A;  3SAG A;  1ZRM A;  2V9W A;  3WKB A;  3PW4 A;  1YZ6 A;  2RLT A;  3SV3 A;  4IR1 A;  5HR7 A;  4QWB A;  4QZ8 A;  5J8Y A;  2KKP A;  3V7L A;  4DFP A;  1ZJM A;  8ICH A;  4DS5 A;  2EZY A;  4BGD A;  3ZDD A;  3N7P D;  2LYA A;  5D49 A;  3QX7 A;  3HWT A;  4UB2 A;  5DLF A;  5DLG A;  1NK6 A;  1AQ6 A;  3UQ2 A;  4F2R A;  2OXO A;  2JRZ A;  1JXL A;  3MAB A;  4GXI A;  4DWI A;  3Q8L A;  3HW8 A;  4RQ5 A;  2D6F C;  2KHQ A;  4KLO A;  4P0P A;  9ICI A;  4YP3 A;  2ZUB A;  1Z00 B;  3L5K A;  1ZQT A;  3E2E A;  2FMP A;  4AYB F;  4GC7 A;  3SYZ A;  1KEJ A;  4PZN A;  3ZD9 A;  3MR3 A;  3AU2 A;  5DBB A;  3IM1 A;  2CRX A;  3QUC A;  5AKJ A;  5EE9 A;  1UCV A;  4QZG A;  3CP8 A;  5KTQ A;  3TAN A;  1JAL A;  3RH5 A;  1PVQ A;  4G9B A;  2R8K A;  3EPI A;  4NY8 A;  1IM4 A;  3GDX A;  2KIV A;  3TFR A;  2K4P A;  1NK5 A;  7ICM A;  1Z3E B;  3RAX A;  3AL0 B;  4QZI A;  1BVS A;  8ICW A;  1S76 D;  1X42 A;  1N61 A;  2YMM A;  5KFR A;  3JPP A;  1L7N A;  4O3N A;  3WK8 A;  3PSI A;  1N60 A;  5ALG A;  2ALZ A;  3D2N A;  5KG1 A;  3QU7 A;  4RT2 A;  3F2C A;  1ZQS A;  2Y1I A;  5DQG A;  3PW5 A;  4O0I A;  1KDH A;  1WUD A;  5AIA A;  1MSW D;  4J9Q A;  4RUC A;  3L3F X;  5KAI U;  2KP7 A;  4C8N A;  4Y2X A;  2C2E A;  2VA8 A;  1Z19 A;  4B6J A;  1ZQF A;  4R65 A;  4YFK A;  1ZQP A;  2QAR B;  2YTU A;  5KT6 A;  4XUS A;  3LVW A;  4IQT A;  4ECZ A;  1ZET A;  4EEN A;  1Z1B A;  3C1Y A;  3RH4 A;  2BPG A;  4O9M A;  3D6J A;  2VJ5 A;  2F77 X;  3H4D A;  2CXY A;  2XY6 A;  3GIM A;  4KIT B;  4DOB A;  4O5K A;  1XC9 A;  5III A;  9ICO A;  5KFA A;  1S5L U;  1A77 A;  3GIJ A;  4KLU A;  2H3F A;  2ZTD A;  9ICB A;  2WF8 A;  1T3N A;  2BDU A;  1X2I A;  1IIP A;  2LKY A;  4YR0 A;  4KLM A;  4IR9 A;  4QZ9 A;  4RNO A;  4MEX A;  4KMO B;  2D3D A;  4JWM A;  5AK5 A;  3LWL A;  5AKK A;  3OJS A;  4ECS A;  1LKY A;  2NRW A;  5ALP A;  4GIB A;  1UT5 A;  3I76 A;  4DF8 A;  4BWJ A;  1NKE A;  5L1J A;  2EAP A;  4Y2P A;  3EYZ A;  4Z6C A;  4I28 A;  3KZX A;  1XSP A;  4ECW A;  1D8L A;  1D8Y A;  4JUZ A;  1ZOL A;  3RRG A;  1MQ3 A;  1ZQR A;  3PO4 A;  4Q8F A;  2WAQ C;  2G09 A;  2MA1 A;  3WKE A;  1X9S A;  3WKC A;  4NLK A;  4DOC A;  5KFC A;  1SKW A;  1QSY A;  4DO9 A;  4PGX A;  2KNJ A;  4DL7 A;  3AU6 A;  1V85 A;  3PW0 A;  1BPX A;  1B4F A;  4JB3 A;  3B0X A;  2KJ8 A;  4M9J A;  2XY5 A;  5KFM A;  1ECW A;  1WWV A;  1L7P A;  2EDU A;  1GO3 F;  2JMG A;  5T14 A;  5KT7 A;  9ICE A;  1TE2 A;  3UMB A;  3PW2 A;  3RJF A;  1HEK A;  4MFF A;  1ZQL A;  2KK0 A;  2HHS A;  1XS9 D;  1U45 A;  2XIC A;  4IRD A;  3SEN A;  1NJY A;  8ICI A;  2BCU A;  3GZF A;  3E0F A;  4NL9 C;  2PI5 A;  1ZJN A;  4ELV A;  1U9L A;  2BGW A;  3F2D A;  2PMZ C;  4QWA A;  1IV8 A;  3RAQ A;  4PL2 A;  1RG6 A;  1ZQM A;  4Y2S A;  4JV2 A;  4C8O A;  3A0B U;  4QW8 A;  2YMP A;  4RQ7 A;  1K1S A;  4M9G A;  4EBD A;  5J0O A;  5TIS U;  3RB3 A;  4DLG A;  5ALW A;  4EZ9 A;  1Z4N A;  5K4L A;  7ICP A;  4Q8E A;  4F4K A;  4O3O A;  9ICP A;  2Q4T A;  3GIL A;  2K8A A;  2F8L A;  2LYH A;  3QZ8 A;  2JR5 A;  3CW2 C;  3F5A A;  2WB1 F;  4ED6 A;  4I2D A;  1XNS A;  2ZJ8 A;  9ICL A;  2IHM A;  3CYM A;  2UVV A;  1N5W A;  3Q8S B;  2AU0 A;  1D9D A;  1EXN A;  5KFZ A;  1IXR A;  4O3Q A;  4I2F A;  4J9S A;  3QEB Z;  5KFP A;  5KFK A;  2K4H A;  1V9P A;  1O03 A;  2GH1 A;  4DFJ A;  3THV A;  3NGD A;  2K4E A;  5B5E U;  3AUO A;  5AM4 A;  1PVR A;  2W3R A;  4QZD A;  2RRD A;  1NZB A;  1ZXI A;  5ALZ A;  5CA7 A;  3WK4 A;  2NYV A;  4PGQ A;  4YVZ A;  5F9N A;  2QB1 A;  1KRP A;  3G6V A;  3QUT A;  1LKY B;  1Q3V A;  4DSF A;  5J0Y A;  4B9N A;  4DS4 A;  5CR0 A;  3BQ2 A;  4GC6 A;  5J2K A;  3RB6 A;  4M47 A;  2ZTC A;  1KTQ A;  2PFN A;  3UM9 A;  3B9J A;  4CF4 A;  4WJ3 B;  2V4Q A;  2Z7J A;  4OCZ A;  4IQW A;  5G5G A;  1Q46 A;  4I29 A;  5AIC A;  5ALU A;  8ICF A;  1TAM A;  5HR6 A;  1V38 A;  4TQS A;  4ED2 A;  3SAH A;  2HHT A;  5J2C A;  3GV5 B;  3MR6 A;  1SWW A;  4FBU A;  2HMX A;  4YCX A;  2XY7 A;  5DB6 A;  5J0S A;  5IIN A;  4MFA A;  7ICR A;  2KTQ A;  2IBK A;  1UA0 A;  5J0Q A;  2KVC A;  5AI0 A;  5KAF U;  3KOO A;  2BR0 A;  2FLL A;  8ICG A;  2I1Q A;  5C0Y A;  1OW5 A;  2KG5 A;  4RQ6 A;  3PX4 A;  3PNC A;  4CGZ A;  2B0C A;  1XO0 A;  2KJ9 A;  1B0X A;  4OJL A;  3H7I A;  4IC9 A;  1YT3 A;  2NRT A;  2PFQ A;  5DG9 A;  1QQ7 A;  1VLB A;  4XRH A;  4DSL A;  8ICC A;  4DFM A;  4KLG A;  2PI4 A;  5J2J A;  2WF5 A;  4PHP A;  2B6G A;  3PV8 A;  1BPB A;  1QLN A;  4C4R A;  2FJ6 A;  3BZK A;  1BNP A;  7ICI A;  4P4P A;  3Q8K A;  3JPN A;  2K89 A;  2HDO A;  3TAD A;  4C80 A;  1WWU A;  4MF8 A;  4UB4 A;  3V72 A;  3VCB A;  4KX3 A;  4YD1 A;  3EW9 A;  2GLE A;  2G5H B;  4QWE A;  4M0A A;  2G08 A;  7ICO A;  3MFH A;  4KLD A;  2BPC A;  3ZDB A;  1PK3 A;  2BQ3 A;  1KFD A;  1FO4 A;  3V6J A;  2KIC A;  3LK9 A;  2FI1 A;  9ICM A;  3PR4 A;  3RJG A;  3Q8P B;  4YD2 A;  1YZ7 A;  4M9N A;  2JGA A;  3KKA A;  5KG2 A;  3GQC A;  2EAO A;  3BS7 A;  2JEI A;  2C2R A;  4ED0 A;  5KT5 A;  1ZQB A;  4NLB A;  5KG3 A;  5G5H A;  3V6H A;  4US9 A;  5DKW A;  1T8E A;  7ICV A;  1FFV A;  3TAQ A;  4C8M A;  3MGI A;  2KZM A;  4Y2V A;  5L1L A;  7ICU A;  4J9L A;  1MN8 A;  4QJF B;  2NRV A;  4JWN A;  2P6U A;  3T3F A;  2ESE A;  3MDA A;  4O3S A;  4ECT A;  3ONN A;  2NV3 A;  3AEV A;  2M0N A;  2KE7 A;  3H0M B;  8ICA A;  4UB1 A;  2N1R A;  1UPH A;  4F4W A;  1O08 A;  4DQS A;  1U47 A;  5AK6 A;  2QB0 A;  4UB3 A;  4J9M A;  5AI5 A;  5AKI A;  2V4R A;  1S0V A;  4FS2 A;  4DQR A;  1X6J A;  2XCP A;  5GTI U;  3UXP A;  4F5R A;  2J6S A;  1DK2 A;  2ODG A;  1SL2 A;  3RR8 A;  2ISP A;  1N48 A;  4LVS A;  1RXW A;  2ZXH A;  7ICQ A;  3RJK A;  4UBC A;  4KMU A;  3WKA A;  8ICK A;  5BOM A;  4Q43 A;  4YMN A;  2ES6 A;  2MRL A;  3EWA A;  3QU2 A;  4XA5 A;  1SZP A;  3HT3 A;  3QNM A;  2YMQ A;  5AI9 A;  3SZ2 A;  3NUQ A;  2PKE A;  1L3S A;  1N62 A;  4FZL A;  3C5F A;  4JV0 A;  1ZQU A;  5KG5 A;  1N5X A;  3K4G A;  4LJX A;  3HIL A;  1SV0 A;  4DSI A;  1SV4 A;  1UT8 A;  2ZIV A;  3PO5 A;  3HPO A;  1S97 A;  1B22 A;  2EZX A;  4OJ6 A;  3K75 D;  4CE6 A;  2LBO A;  1UA1 A;  1X9W A;  2W54 A;  2PMZ F;  4EX6 A;  4Z6D A;  3HX0 A;  1F0M A;  3QYP A;  4UAT A;  5ALQ A;  4QNL A;  3TKA A;  1S9F A;  2HW3 A;  4ACO A;  2OH2 A;  4KLH A;  1L8L A;  1X9X A;  4F91 B;  4M2Y A;  4U6P A;  2IOH A;  4NLC A;  3ISB A;  3V7K A;  2KOB A;  1ZQE A;  1ARO P;  4GLX A;  2FMS A;  4CDG A;  4YN4 A;  7ICN A;  3UXN A;  1OXJ A;  5HHI A;  8ICN A;  1NK8 A;  4EYI B;  3QU5 A;  3I28 A;  4Z6E A;  3I1Y A;  3T5H A;  4JMU A;  5KFV A;  3CNH A;  5FP0 A;  8ICJ A;  5JUM A;  1J2M A;  5ALK A;  3M8R A;  9ICR A;  2W9C A;  1DRG A;  3ZDA A;  1S0M A;  5AK3 A;  3BJY A;  1Z4O A;  3EPG A;  4B9T A;  3NVZ A;  3WK7 A;  4PHE A;  3UQ0 A;  3ETR A;  5J2E A;  3OSP A;  4F4Z A;  2Q0Z X;  2UVU A;  4C7Y A;  3ALR A;  8ICX A;  5KFT A;  4O3M A;  2P6R A;  4MHV A;  1L5U A;  1CI4 A;  3KHR A;  2ZUC A;  1ZQ1 C;  1Q3U A;  3IP4 B;  1QCK A;  3G6X A;  3MC1 A;  4NJ8 A;  3SAF A;  5J2H A;  1CEZ A;  5KFU A;  3H8M A;  4E0D A;  3RBE A;  5H2F U;  2W55 A;  4F5Q A;  2VKQ A;  2YX8 A;  4JV1 A;  3M6Z A;  2ASL A;  3SD7 A;  2QB0 B;  4DFD A;  1FIQ A;  4NLN A;  1NNL A;  3ED5 A;  5AKG A;  1ZQI A;  3KFU F;  1SXE A;  3TAC B;  3ISD A;  2H3Q A;  3BQT A;  1TK5 A;  3C28 A;  3ZD8 A;  3UPQ A;  3HJE A;  5AKY A;  2PXI A;  1DK3 A;  3E58 A;  1N2X A;  2KFN A;  5ALE A;  5HMM A;  5J0T A;  3M9M B;  1KL9 A;  4YR3 A;  1PVP A;  2ZIU B;  1DOQ A;  1ZYQ A;  4RQ8 A;  1SZH A;  2XID A;  3TAR A;  2DPJ A;  1U4B A;  1XO1 A;  3AQF A;  4Y2T A;  4I2I A;  2JEG A;  3OTQ A;  3SEI A;  3A0H U;  1QQ6 A;  3IN5 A;  3PVX A;  3TQ1 A;  3KHH A;  2G0A A;  5F3X B;  4F71 A;  2NO4 A;  3QE9 Y;  2HHQ A;  3O0F A;  4LZD A;  4HAI A;  1L3T A;  2C22 A;  5L9X A;  4M6W A;  1PK1 A;  2ZIV B;  2A19 A;  3QXG A;  2F1H A;  4C4S A;  2J6U A;  4BXO B;  3NTU A;  2KD1 A;  4CCH A;  2M9N A;  3OSN A;  2LMR A;  2WF9 A;  5J2F A;  4DSE A;  1L7M A;  4DSK A;  2F76 X;  5L1I A;  1JX4 A;  1RM6 C;  4U7C A;  2DFL A;  1QSL A;  4Z6F A;  4ECY A;  2IMW P;  4B9L A;  1LB2 B;  5KFF A;  1SKR A;  2Y1J A;  2VAN A;  1M6Y A;  5JTI A;  5AIB A;  2C28 A;  4FO6 A;  5DG7 A;  2BCS A;  2A3V A;  2ZG6 A;  3BS5 B;  4DCC A;  4LZG A;  3QUQ A;  2BKE A;  2R8J A;  3C5G A;  2LHT A;  2DPI A;  2W9C B;  2K4I A;  1JUD A;  3GII A;  1K1Q A;  2VA2 A;  3EUB 2;  5CWR A;  2I5H A;  2F1J A;  9ICA A;  4CF5 A;  2HBL A;  4C8K A;  9ICG A;  2KV2 A;  4K4G A;  4EYH B;  4I2B A;  3NVY A;  2WHE A;  5HML A;  4F4Y A;  2D8C A;  2XO7 A;  9ICW A;  1X9M A;  1A0P A;  1WYG A;  2JXJ A;  1Z1V A;  2DWQ A;  3RB0 A;  2J6T A;  1T3Q A;  1X6I A;  2HCF A;  3ETL A;  4FFD A;  4UAY A;  3PR5 B;  1UQV A;  2OHF A;  9ICN A;  2KMD A;  5KL1 B;  1RYS A;  2HOF A;  4R8U A;  4NM2 A;  4YXJ A;  4ELU A;  4ECV A;  4DQP A;  2HOQ A;  2G07 A;  2OCE A;  3M6K A;  3DV9 A;  3MR2 A;  2HSZ A;  2DKZ A;  1ZQH A;  4OJ5 A;  4K4I A;  1QSS A;  3H4B A;  1F44 A;  1P7D A;  4USA A;  3PY8 A;  1RYU A;  4F5N A;  5BPC A;  5ALN A;  2Y9U A;  1UHU A;  3K1R B;  1ZD4 A;  2MAX A;  2OWO A;  1BPE A;  3EZ5 A;  4I2G A;  1QQ5 A;  3NRZ A;  3D2Q A;  3RFA A;  2YML A;  4C4T A;  4UQG A;  4I2A A;  1QTM A;  5KT4 A;  2R8G A;  2ZXI A;  9ICU A;  2EAM A;  3JPO A;  4DSJ A;  2WTF A;  5AHX A;  4F50 A;  2P66 A;  2YQE A;  1JIH A;  1N63 A;  5ALY A;  4EX7 A;  1WCL A;  1Y88 A;  4RPX A;  2UVW A;  1RXV A;  1KQQ A;  4M6W B;  1PK1 B;  3OGU A;  2YB4 A;  1QH9 A;  2MSN A;  1X40 A;  3OPX A;  3G6Y A;  2RQ5 A;  3NS1 A;  5JRT A;  4DL3 A;  2KIW A;  5EWG A;  2AGQ A;  1B43 A;  2EAN A;  3C23 A;  5DB7 A;  3OHA A;  2KHV A;  4UAW A;  1KN5 A;  2BPF A;  3PX0 A;  8ICT A;  1CUK A;  4RT3 A;  2R8H A;  3TI0 A;  5A0L A;  2RDJ A;  2O6K A;  3M9N B;  2E8P A;  2EZZ A;  4J9N A; 
#chains in the Genus database with same CATH homology
 1XO0 A;  3ONN A;  2KJ9 A;  2KKP A;  2NV3 A;  4ICA A;  4C0Z A;  1HIW A;  2M0N A;  2W03 A;  3F5A A;  3IN5 A;  2WB1 F;  4OJL A;  1XNS A;  3H0M B;  3N7S C;  2N1R A;  2H3V A;  4IC9 A;  5KL1 B;  1UPH A;  2HOF A;  1YT3 A;  2G0A A;  3CYM A;  3N7P D;  4BX9 C;  3IG5 A;  2LYA A;  3O0F A;  3C29 A;  1Z19 A;  4FZM A;  2G5I B;  3LVW A;  4JMU A;  5HR7 A;  2HOQ A;  2G07 A;  2ZIV B;  2WAQ C;  2G09 A;  2MA1 A;  3M6K A;  2E5S A;  2HBK A;  2K4H A;  3MGV A;  2W7O A;  4NWI A;  5KL8 B;  1ED1 A;  3ICX A;  1DRG A;  2XI9 A;  1Z1B A;  2OXO A;  4P0Q A;  2KD1 A;  2GH1 A;  2RHF A;  3CRX A;  1KBU A;  2K4E A;  1URJ A;  4OJ5 A;  3LVV A;  4NV0 A;  2VJ5 A;  2ZIX B;  2D6F C;  2KHQ A;  2ZIW A;  1F44 A;  4P0P A;  1A6S A;  2F77 X;  1P7D A;  1PVR A;  2ZXH A;  2K8B B;  3NRW A;  2DQN B;  2RRD A;  4FZN A;  1NZB A;  2F76 X;  2KNJ A;  4AYB C;  3ALR A;  4BUG A;  4PL1 A;  4O3M A;  4U7C A;  2XVT A;  3PZP A;  2MRL A;  2VIX A;  4AYB F;  2K89 A;  2Y0S C;  2KJ8 A;  1ZQ1 C;  2E1E A;  3SMV A;  4QIW C;  1Q3U A;  3DEE A;  3IP4 B;  1Q3V A;  3H0R B;  3F2B A;  1ECW A;  3D2Q A;  2CPR A;  3RFA A;  2DGZ A;  2JH7 A;  3NUQ A;  3PST A;  2Y0S F;  4KX3 A;  4QIW F;  3VCB A;  3SAF A;  2E1F A;  4FZL A;  1GO3 F;  4A8E A;  2OM6 A;  2JMG A;  2WAQ F;  2H3F A;  3H0L B;  3VC8 A;  2GOL A;  4BJQ A;  4P0Q B;  5T14 A;  2F2A B;  2CRX A;  3HKZ C;  1MA7 A;  2G5H B;  2ZIW B;  3SQI A;  2JHD A;  4P0P B;  2G08 A;  4WJ3 B;  2ZXI A;  3HKZ F;  2Z7J A;  2VKQ A;  4KX5 A;  3GU3 A;  2YX8 A;  1HEK A;  2BDU A;  2DF4 B;  1IIP A;  3CP8 A;  3F53 A;  2A3V A;  2ZG6 A;  3PSP A;  2ZIU A;  3M6Z A;  1PVQ A;  2LKY A;  2W04 A;  3F5E A;  2XIC A;  1TAM A;  2KIC A;  3D2S A;  3RF9 A;  2ZIV A;  5HR6 A;  2G06 A;  3SAH A;  4GFJ A;  3GZF A;  3E0F A;  3AL0 B;  2H3I A;  1OUQ A;  5CRX A;  2KKV A;  2YB4 A;  3K1Z A;  1L6N A;  2LHT A;  4OJ6 A;  2JGA A;  3KFU F;  2LYB A;  3N7R C;  2W7P A;  3F2D A;  2PMZ C;  2WB1 C;  3KZX A;  3OPX A;  2K4I A;  4KMO B;  4PL2 A;  2ZIX A;  2LBO A;  4OJP A;  2OYY A;  1T94 A;  2H3Q A;  2YB1 A;  2HMX A;  2PMZ F;  2KIW A;  3C28 A;  1CRX A;  2H3Z A;  2HBJ A;  4OJO A;  2RP5 A;  2HOI A;  3PSI A;  3LYS A;  2HBL A;  4NLB A;  2KHV A;  2VJ4 A;  4QNL A;  4ACO A;  2K8C B;  2KV2 A;  3D2N A;  2OH2 A;  4CRX A;  3IG8 A;  1PVP A;  2ZIU B;  2KVC A;  3F2C A;  1SZH A;  2XID A;  3PSF A;  1D8B A;  2CN1 A;  4U6P A;  1A0P A;  2JH1 A;  1WUD A;  4FE3 A;  3AQE A;  4NLC A;  4QJF B;  5A0L A;  2KEY A;  3SAG A;  3T79 A;  2R18 A;  2Q4T A;  2KOB A;  3AQF A;  4OO1 J;  3L3F X;  5C0Y A;  3M7D A;  2KJ5 A;  2HBM A;  2K8A A;  4CDG A;  2F8L A;  4CGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...