2F2AB

Structure of trna-dependent amidotransferase gatcab complexed with gln
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
408
structure length
408
Chain Sequence
ETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ammonia channel couples glutaminase with transamidase reactions in GatCAB
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
total genus 120
structure length 408
sequence length 408
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2f2aB02
2DF4B 3IP4B 2F2AB 3H0RB 2DQNB 3KFUF 4WJ3B 2G5IB 3AL0B 2G5HB 3H0LB 2D6FC 1ZQ1C 3H0MB
chains in the Genus database with same CATH superfamily
5KT3A 4P2HA 2ZTDA 3MGIA 5B66U 1D8LA 5AI0A 3MR5A 4NLBA 4NXZA 4YN4A 3H0RB 1X40A 4F72A 5KNIA 2BZFA 1ED1A 2VJ5A 4DQSA 2K8BB 3CRXA 3OJUA 2JXJA 4DQPA 5EE9A 2K4HA 5KFOA 4IQVA 3M1YA 7ICVA 4Z6DA 2E5SA 3AU6A 5DB8A 3C5GA 2W04A 3SV3A 1XU4A 2KEYA 4XQ8A 1K1SA 5AKXA 3RJHA 4KLEA 1V97A 2YN4A 3H8WA 4RQ7A 2IHMA 2EAOA 5AKHA 8ICXA 4ED7A 1J2NA 4C7YA 3ISDA 4CNQA 5L1KA 2E3TA 2P6UA 8ICIA 2ASLA 1QQ7A 2F77X 3TFSA 2BDUA 1NK0A 2P66A 3IG8A 2YX8A 2G06A 3LVWA 7ICLA 2YMPA 2DKZA 2MU2A 2FDRA 2NRVA 5J0WA 3OHAA 1ZJMA 1ZQMA 4XRHA 4Q45A 5TZVA 1XSLA 2E1EA 1DK3A 4ED3A 1KLNA 2YY6A 3F2DA 1KDHA 1FO4A 1KN5A 2GOLA 2HOIA 1SKSA 4F2RA 2G08A 2P35A 5T14A 4BWJA 7ICTA 5DBAA 3AU2A 5D49A 4PGYA 2E8OA 1Z19A 3ICXA 3OSPA 3KTQA 4Y2TA 4YR2A 4EX7A 1NK7A 1LV5A 1PK1B 4A8EA 1Z3EB 4ED0A 3HP6A 4UASA 3G6VA 4C0ZA 4F92B 4YXJA 1KFDA 1KRPA 3B0XA 1ZQPA 8ICKA 2LPEA 5AM4A 4B9NA 3GILA 4RQ1A 4Q8EA 1PVRA 4P4OA 4I2BA 5J8YA 4Y2XA 4DOCA 1S0MA 3BQTA 1SZPA 5ALHA 1BGXT 5F3XB 5J2KA 3CNHA 4J9MA 1HUZA 3PSTA 2HI0A 1ZETA 4PGXA 5DLFA 4FBUA 1L3UA 4GIBA 3C2KA 4X5VA 2KFZA 4O3NA 1ZYQA 1KTQA 1TK0A 2Y0SC 3H7IA 2IBKA 3WKDA 3MR3A 5AKLA 2IA6A 1N61A 4J03A 1NK8A 3SEIA 4DSEA 3N7SC 4M6WA 3PSPA 4IL6U 4LZDA 4MFCA 2XY7A 2H3QA 8ICAA 2KZMA 4GLXA 2EZZA 3TI0A 4JK1A 5AICA 1RPLA 3RF9A 2PKEA 2PMZC 1CI4A 4DSJA 4P0PB 5C5JA 2K4IA 3T5KA 1L5UA 3F5AA 3Q8MA 1YZ6A 2E1FA 2JH1A 1F5SA 2NV3A 2GO7A 1XC9A 2XO7A 1Q3VA 5IILA 2PFNA 7ICOA 2HOQA 1T8EA 1M6YA 3HPOA 5HMMA 5ALWA 4Y2RA 5ALDA 5J0XA 1JX4A 5DQGA 1ZOLA 3PW2A 5ALUA 2WB1C 1ZQHA 4RQ8A 2C2RA 1KFTA 4TQRA 4MF8A 2KVSA 2ESEA 4DL4A 2YMQA 2HSZA 4FFDA 4J9KA 1UHUA 1B4FA 2NRZA 5ALSA 5KT4A 2P6RA 4QWCA 8ICZA 1H38A 4M6WB 5KL8B 4UB1A 2XCAA 2AXTU 2LMRA 4PPXA 1D9FA 1QCKA 5ALMA 1U9LA 2XICA 2XGQA 5KG7A 1LKYA 9ICJA 4FS2A 3D2SA 2EH9A 4O3OA 2KIWA 2KSOA 1C20A 4UB2A 5KFTA 5HR6A 3PX4A 3C29A 5AKKA 1S97A 1CRXA 4IC9A 3HJEA 4KLSA 7ICEA 2KTQA 5AM2A 3MDAA 2VA2A 4RQ3A 9ICQA 2DFLA 1RQLA 3WK4A 1SWVA 1XO0A 1L3TA 4UB5A 3N4MB 3T3FA 3FAHA 4Y2QA 5DDMA 3PR5B 3HKZC 5KFAA 3KHLA 8ICVA 4CE6A 3H40A 9ICRA 3NGDA 8ICRA 2VKQA 5ALZA 5AK4A 4BUGA 1NI3A 3M6ZA 1V38A 4CGZA 5AI5A 4JB3A 5DKWA 4JWMA 9ICVA 1JALA 4I27A 1NK9A 3MGVA 2H3VA 3NRWA 5J0YA 2W54A 8ICWA 8ICPA 3TADA 9ICIA 4R65A 7ICNA 3IM1A 4NM1A 4O3QA 1SKWA 2LI6A 2KZZA 5KFRA 1KKXA 1S5LU 1L3SA 4QZBA 1SWWA 5J0SA 3ISCA 3RAQA 2MAXA 4QNLA 4ECXA 4LVSA 2WAQC 4NM2A 1X42A 1L7OA 4YD1A 4P0QB 3N7PD 5L1JA 4F4XA 1RZTA 2WF9A 2AHOB 3LDAA 5BOLA 2NO5A 2ZIUA 1B22A 3CW2C 3K1ZA 4QWAA 3KOOA 2F44A 5KFWA 3MABA 2HW3A 4KTQA 4DWIA 3M6KA 4ED1A 5ALJA 3RR7A 5AI9A 3OSNA 5IIJA 2NRWA 3ZI4A 3PSIA 3BJYA 1RDFA 5KFQA 2R18A 2OHFA 2KV2A 1T3QA 3C21A 2FMQA 4ECTA 3BZCA 4Y2JA 5AI4A 3RRGA 3I76A 2XIDA 4UBCA 5CB1A 3SAFA 7ICKA 1TAUA 5CA7A 1FFVA 2F3NA 1WWUA 5HHIA 4OD0A 4B9VA 4US9A 1LB2B 1ECWA 4PZNA 5AKEA 2KICA 1S0OA 2DQNB 2K4EA 1FIQA 8ICSA 3UMGA 4TUPA 4UBBA 1ZQKA 2RP5A 3ETLA 4YFKA 1JROA 2PFPA 1TAQA 7ICQA 3GDXA 4DS5A 3LWMA 1S9FA 3ED5A 1JXEA 5ALXA 4DSLA 1NNLA 1JUDA 3LYSA 4QZCA 4DS4A 4BX9C 5GTIU 3NUQA 1RM6C 5KFEA 3F5EA 3CYMA 4UQGA 4NL9A 4I2GA 4ACOA 3SYZA 1K1QA 4ECZA 4JUZA 3THVA 9ICPA 4FE3A 1A77A 3TADC 3PZPA 7ICRA 1JXLA 2UVVA 4Y2PA 3NVWA 4P0PA 3TKAA 3ONNA 2K89A 1WG8A 5KFSA 1U48A 5AI6A 2KJ9A 4F91B 3SAHA 3ZDDA 1PZNA 1V9PA 1N2XA 4DO9A 4RZRA 4DOAA 4DFKA 4QZFA 4OJ6A 4UB6U 5KL1B 3QZ7A 4FBTA 2V4RA 2I6XA 3F2BA 3GIJA 4KMUA 5KG6A 4C80A 2BCSA 3V7KA 2DPIA 2WFAA 9ICUA 2ES6A 5KFPA 1X9SA 3K75D 1UA1A 5D46A 4I2EA 4Y2YA 3GV8B 2Y0SF 3PO4A 3EWAA 4O0IA 2KOBA 2CRXA 2UVWA 1XNSA 4OJOA 2QKQA 2ATLA 1ZQIA 2ZTEA 5DBCA 4I28A 4R8UB 2I9GA 3K4GA 3T5JA 2LHTA 4U6PA 4G9BA 3RB3A 5KFMA 5J2GA 2H3ZA 4DF4A 4PJ0U 1PVPA 2EZXA 2KZ3A 3QU2A 5JU5A 2RDIA 1ZXIA 1JI7A 3ALRA 4I2JA 3UXNA 5F9LA 5L1IA 4F5QA 3NRZA 4QZDA 5L9XA 2N1RA 1UQVA 2BHNA 1RYSA 8ICBA 1U49A 3JPOA 2M9NA 1C7YA 1SZHA 5KG3A 3H8MA 4DFPA 1IM4A 1KW4A 2QB0A 3JPNA 2R8KA 4KN4A 4M04A 2DGZA 4NL9C 4UATA 2JR5A 1KQQA 3MDCA 4RQMA 5CRXA 2BGWA 4NLKA 1T4GA 2JH7A 1P7DA 9ICOA 3QXGA 2Q0ZX 3TAPA 4NLNA 1NKCA 5CWRA 4IQUA 4DQRA 5DB6A 3PMLA 3M7DA 4Z6FA 3C1ZA 4G3IA 5DGBA 2HHSA 2FE9A 3PX0A 1ZQRA 2FPLA 8ICUA 1Y88A 5ALFA 2CPRA 2VIXA 2FLPA 4DFDA 4OJ5A 2WTFA 2KE7A 2W03A 4UB4A 4R64A 3MR6A 3B9JA 5KAFU 7ICMA 2I1QA 3WK8A 3SI8A 1N48A 5IIOA 3Q8PB 3GIIA 5J0UA 2ZXHA 3C2MA 4O3PA 3AL0B 8ICJA 4ELUA 4RQNA 1BPBA 2G09A 4M9NA 3H0LB 2LBOA 2R8HA 3SENA 1NK4A 4ECVA 4Y2VA 3H4BA 4B9SA 4DLGA 3TANA 5J0OA 5J2AA 4BWMA 3RB0A 1MA7A 3T5LA 3SZ2A 1ZQCA 2B0CA 4DSFA 2ISOA 4UAWA 2JEIA 4M9GA 1PUZA 2QB0B 1N62A 2KIVA 1IXRA 4IQWA 2YB4A 1RQNA 5JTIA 1TFRA 4KLHA 3KHGA 2HBLA 5KFIA 5DGAA 1ZD5A 4UAZA 4CDGA 5KT5A 1ZQGA 4YD2A 3NASA 3PW5A 4PH5A 1XWLA 2F76X 5ALPA 3WKBA 4RPZA 4I2CA 3C28A 3RAXA 5HP4A 8ICLA 2D8CA 4C4SA 4WJ3B 2UVUA 2O6KA 3BDPA 5AIAA 2HOFA 1ZQAA 4F71A 2KJ8A 2ZIWA 3R9KA 1N60A 2KVCA 4RU9A 4KLLA 2IMWP 2DBYA 1RG6A 5IINA 5CR0A 3BS5B 4I2AA 1SL1A 5E79U 5BPCA 2JGAA 1XSPA 1F44A 1NJZA 8ICEA 1COOA 4UB8U 3MFIA 1OUQA 2W43A 4JV0A 4C8LA 4M9HA 5D4BA 2VA8A 3AQEA 4CF3A 2FMPA 1ZQXA 2HHVA 7ICPA 4F8RA 2W7PA 2HDOA 5KFJA 4Q44A 2A3VA 3FDSA 4E0DA 1ZQVA 9ICSA 2ZIWB 2YQEA 4I2DA 3PSFA 5BOMA 4C8OA 1T3NA 1V85A 4F50A 2FPMA 1YZ7A 1Q8KA 2HHUA 1PK1A 4F5RA 2G5IB 1MQ3A 1ZRMA 4LJXA 1X6JA 4O3RA 1WWVA 3RBDA 5EE1A 2XVTA 4NJ8A 1Z1VA 8ICCA 4DF8A 3ZD8A 2OEHA 5ALNA 2XY6A 5DDYA 2OCEA 4PHPA 4QZHA 1QLNA 5ALVA 4RT3A 5KFXA 4FO6A 5EOZA 3E2EA 1L7NA 3N28A 5KFKA 2H5XA 5A0LA 5JRTA 4QWBA 4R63A 2H3FA 9ICKA 3PX6A 4U7CA 3KZIU 4GXJA 3MR2A 5J0QA 2JEGA 4JV2A 4I2HA 2DKXA 4XA5A 4QW9A 1PVQA 3N7RC 4EZ6A 4F3OA 5DQIA 4RPYA 3ZD9A 2IOFA 2HCFA 3GV7B 2BCQA 4Y2UA 4NWIA 2GLEA 1CEZA 2W8KA 4NLZA 2EANA 3FC4A 5J2DA 3WK7A 2C2DA 2MRLA 1X6IA 3KZXA 1J97A 2OM6A 1TK8A 2F1HA 2ZJAA 3RTVA 1JN3A 1NJWA 5ALIA 2PFQA 1NJYA 1YT3A 2JZBB 4Z6CA 9ICWA 4IRDA 2KK0A 4FZMA 4Q8FA 5KG1A 3UQ2A 2FLLA 4K4HA 2KD1A 1RXVA 2DL0A 1HEKA 4JWNA 9ICMA 4O5CA 1ZQWA 5G5GA 1UT8A 4KLTA 2HVIA 4DSKA 4ELTA 3RB6A 2FJ6A 3B0YA 5AK6A 3PW0A 2W55A 7ICIA 4AYBF 3G6XA 3HKZF 3D6JA 3MFHA 2EDUA 3AQFA 4TUQA 2C2EA 1QSSA 2HMXA 1TAMA 1JMSA 3QU7A 5ALEA 4YXMA 4ECWA 1ZQQA 4GC7A 5IIKA 4EYHB 3HRDD 3NS1A 4OJPA 2KSOB 5J0RA 3UM9A 4RNNA 1T94A 2RRDA 1BPEA 1BPZA 3K1RB 1BPYA 1JIHA 2F1IA 2GWSA 3H0MB 4CRXA 5IIMA 1LKYB 1TK5A 4KLFA 5AKYA 5EE0A 4DEZA 2KJ5A 4O3MA 4MHVA 2EZYA 3T79A 2NRTA 4DL3A 4HAIA 3OGUA 3TACB 5KG2A 4EELA 3JPRA 1QH9A 4BJQA 1SV0A 3PY8A 1S0NA 4O3SA 1HUOA 2W7OA 3VCBA 3ZDAA 4BDPA 3HILA 3RJGA 4J9QA 2ASDA 3L3FX 3GFKB 3NTUA 2Z7JA 5J2BA 3L4PA 2RLTA 2EAMA 4YP3A 4P0QA 1ZQSA 5HMLA 4KLIA 2LYHA 4QIWF 3AM9A 2CXYA 4TURA 4QZGA 2FPKA 2ZIVA 2AGOA 4BXOB 1UA0A 5J0PA 1U47A 3RRHA 2QB1A 2R8IA 4F4KA 3RR8A 2K60A 2JRZA 2YMMA 2ZTCA 2KG5A 2ASJA 4MEYA 1DGSA 2EQYA 3IV6A 2E8PA 3F2CA 1QTMA 3QUBA 2DPJA 1KFSA 3ZDCA 1CUKA 9ICTA 1MSWD 1COKA 2H3IA 2RDJA 3SV4A 3S6JA 3Q8QB 3WK9A 5L1MA 5KG0A 5KFVA 9ICEA 1X9WA 3JPSA 4GFJA 2A1JA 4DQIA 2AJQA 2ZUDA 5CEHA 5CJ7A 2ZIXB 3UXPA 4YVZA 2BCUA 1N5WA 3GQCA 3A0HU 4EEYA 2XC9A 4KLOA 1SB3C 1IG6A 2DUYA 4XUSA 5DB7A 5AIBA 5DBBA 2DWQA 4RQ6A 1WUDA 2A19A 3QUCA 5KFUA 4EX6A 3IG5A 1TE2A 1U4BA 2HHQA 4RQ5A 1WYGA 4USAA 1ZQJA 4RQ2A 2W9CB 3QUQA 3C2LA 1L7MA 2VANA 3EPIA 3AN1A 5IIIA 3WK6A 2XGPA 4KITB 8ICMA 4MFAA 8ICHA 2Y1JA 4UAYA 1ZD4A 1HIWA 2JEFA 4C8NA 5DG9A 3L5KA 5KT6A 3D2QA 3ZDBA 1KSPA 2ZIXA 3H4DA 4IR1A 4B6JA 2BCRA 5AKGA 1BPXA 5L1LA 3AMZA 2JEJA 3NVYA 1DOQA 5ALKA 9ICXA 3GIKA 1RYRA 2HVHA 3V7JA 1MN8A 1ZQFA 1OW5A 1SGGA 4J9SA 4ED2A 4YG2A 4AP9A 1S77D 2IHNA 2DF4B 4P4MA 1Q3UA 4GXKA 3MGHA 2V4QA 3DDHA 4YR0A 7ICHA 5J2JA 1NOMA 2KP7A 5ALRA 4RT2A 4QZAA 2MSNA 2JHDA 2E8NA 2ZUBA 2C28A 2G0AA 3KD3A 4RUCA 2AGQA 9ICHA 1X2IA 9ICCA 3SAGA 1N56A 3BQ0A 2WF5A 1X66A 2KMDA 1D8YA 4Z6EA 1Z00A 4I2FA 1JRPA 4OO1J 1S8OA 1S76D 1L3VA 9ICFA 3A0BU 1WCLA 2BPCA 5EE3A 4AYBC 4PL1A 2FI1A 1UT5A 2W3RA 2W3SA 3Q8LA 2LM4A 2W8LA 4ZOHC 5KFFA 2R8GA 1ZQUA 8ICQA 3UXOA 2G5HB 3LWLA 2MUTA 2F8KA 4LZGA 4YMNA 4DSIA 7ICSA 4RQ0A 4KLQA 4QZEA 1DXSA 9ICBA 4EBDA 3LVVA 1ZQ1C 2XY5A 2OWOA 3M9NB 3E58A 5GTHU 1ZQOA 1UCVA 3WU2U 4UARA 3PO5A 5ALYA 1NZBA 4BXOA 3QU4A 2YTUA 1AROP 2B21A 1DGJA 3PVXA 4RUAA 3KBBA 2UVRA 1KEJA 5JUMA 1OXJA 1SV4A 4PL2A 5AM5A 5AKJA 1J2MA 2YMLA 4ICAA 5KAIU 2HHTA 1RYUA 1NJXA 4B9MA 2IOHA 4Q43A 1ZQEA 4RQ4A 4PHAA 4KMOB 1NKBA 2A1AA 2HBJA 3M9MB 2NO4A 4R8UA 2VA3A 4P4PA 4ZH4A 3RJIA 3QEBZ 1IIPA 5CP2A 4B9LA 2BDPA 2W9MA 4UB3A 3FYHA 4QZ9A 4NY8A 4F2SA 8ICTA 4FZLA 3V7LA 2L5YA 1SV0C 2ZG6A 3UMBA 4I29A 3WKCA 1O08A 2EAPA 2ZJ8A 5AHXA 3ETRA 2WF8A 2Q4TA 9ICLA 3TQ1A 4F93B 2NRXA 4NV0A 2PI5A 4J9RA 4JMUA 4GXIA 2PI4A 8ICFA 4ECQA 2BKEA 1NKEA 1RXWA 4PHEA 2M0NA 4J9OA 2NYVA 4YMOA 5J29A 1QQ6A 3Q8SB 2K8AA 5KFCA 3BQ1A 3KFUF 2OXOA 4C7ZA 3N97B 3SMVA 2OYYA 4F5OA 2LYBA 3SR6A 2KHVA 2LM1A 1ZJNA 3QNMA 2WB1F 4KX3A 3HWTA 5KFNA 4F4WA 5KFHA 3C23A 4FZNA 1N5XA 4MEXA 8ICOA 4TQSA 3H8SA 3O0FA 5ALTA 4IS7A 3UQ0A 3RJJA 3KKAC 3PNCA 3E0FA 3EW9A 1BNPA 1VDVA 4J9PA 4CCHA 4F5PA 4ED8A 1ZD2P 1O03A 5KT2A 4O5KA 2KHQA 1F0MA 2PFOA 2OH2A 3QEAZ 4DL7A 2ALZA 3EYZA 7ICJA 1L6NA 2Y1IA 1Q46A 4ECYA 1VLBA 3CP8A 4M47A 4EZ9A 1FFUA 5EWEA 2QARB 3G6YA 1SIJA 4DL5A 3QZ8A 5DG8A 1B0XA 2E8MA 3EZ5A 2W9BB 4KLJA 1UPHA 1IV8A 2HBMA 4Y2SA 5H2FU 1SL0A 1MC8A 3RJEA 2AQ4A 2BQUA 1A76A 2AU0A 3LK9A 5TISU 2CN1A 1ZQBA 4JV1A 3V6JA 9ICGA 4ECUA 2HBKA 4KN7A 1XS9D 2J6TA 4B9TA 5CHGA 4MF2A 1FEZA 2AQ0A 2QLTA 5KFYA 7ICFA 4YCXA 2XCPA 2ZJ5A 2B6GA 1BNOA 1URJA 4F5NA 1BVSA 3AUOA 8ICYA 4C4TA 5ALOA 4BGDA 2A1JB 3ISBA 1DRGA 1ZD3A 4QZIA 1N63A 1PK3A 4EYIB 1SXEA 4KLMA 1A6SA 5KFBA 5J2EA 1ZRNA 4K4IA 3I1YA 2BR0A 9ICNA 4C4RA 5EWGA 4O9MA 2ZIVB 2I5HA 4QW8A 3WKAA 4K4GA 5KFDA 3BS7A 5KFGA 2G07A 2V9WA 3QE9Y 2KN7A 4QZ8A 2Y9UA 2BQRA 5F9NA 5HNKA 3DEEA 2PMZF 3QX7A 3I28A 3QU9A 4F4ZA 2BCVA 3PV8A 4KLUA 4M9JA 1L8OA 1ZQNA 2AH5A 4DCCA 4DL6A 3PW7A 4M2YA 3RBEA 2HHWA 4ECSA 3FM9A 4OCZA 3IN5A 2PXIA 4MFFA 2W11A 5J2IA 2JMGA 4GC6A 4PZOA 3JPTA 3RH6A 4NLGA 5AM1A 2W9BA 4QWEA 1LVHA 2BPFA 3EPGA 2W9CA 1ZQTA 4KLDA 4PHDA 3UPQA 2WHEA 4EBCA 2XI9A 3M8SA 3C5FA 4F4YA 4DFJA 5G5HA 2WF6A 1ZQZA 1QSYA 4ELVA 2W9AA 3OTQA 3RH5A 3QU5A 3J81j 2RHFA 2ODGA 3ZDEA 4ED6A 5ALQA 3BZKA 4DL2A 3PR4A 3AEVA 3JPPA 5J2CA 1HJPA 4QIWC 4DQQA 5KTQA 1XO1A 3BQ7A 3RH4A 4US8A 3F53A 4I2IA 4YQWA 1TVAA 5J0TA 1KL9A 5HR7A 1NZPA 3DV9A 3IP4B 1NK5A 3H8JA 4PGQA 4O5EA 1U45A 2D3DA 2RQ5A 3QUTA 3GV5B 4C8KA 1ZQYA 4IQTA 3RB4A 3U26A 3TFRA 4DFMA 5AK5A 5KG4A 3ORYA 5K4LA 4UW9A 1D8BA 2ZIUB 2ISPA 3D2NA 4FS1A 2BQ3A 2D6FC 3BQ2A 5ALGA 4IRCA 5HHHA 3IRUA 1SXDA 2VJ4A 4J9NA 3Q8RB 2GH1A 5AKZA 2FLNA 4EENA 3EUB2 3C1YA 1GO3F 2KNJA 3RJKA 1QSLA 2MA1A 1L7PA 4HYKA 4EEKA 3HW8A 1AQ6A 4J9LA 3GIMA 8ICGA 4RNOA 1SKRA 2R8JA 2FMSA 2MUTB 3V6HA 3HT3A 3QYPA 5FP0A 4YR3A 3KHHA 2AGPA 2BPGA 2KKVA 3GU3A 3UMCA 1SL2A 1BPDA 2KFNA 2J6SA 2WF7A 2J6UA 3RFAA 3PW4A 3BS5A 1NK6A 1DK2A 1X9MA 5AK3A 1ZQLA 3OHBA 1Z4OA 5DLGA 3PMNA 4UAUA 4TUSA 2K4PA 2K8CB 3KKAA 3KHRA 1TKDA 5DB9A 2IOFK 3M8RA 5J2FA 1TV9A 3JPQA 5EWFA 4OJLA 2ZUCA 1KBUA 1B43A 3T5HA 4C8MA 3TAQA 1X9XA 5AM0A 7ICUA 2JZBA 3IDWA 3VC8A 2Y9TA 2LYAA 5KG5A 5KFLA 4RPXA 7ICGA 4CF4A 4QWDA 4DOBA 1L8LA 3OPXA 4RNMA 4YMMA 3HX0A 3GZFA 2YB1A 3NVVA 5KT7A 1T7PA 2F1JA 1K5OA 2HHXA 2KKPA 3V6KA 5J2HA 5AM3A 5B5EU 2F8LA 3NVZA 2QARA 5AI8A 8ICNA 3MC1A 5C0YA 2ZXIA 3V72A 2F2AB 1S0VA 4B9UA 3WK5A 1Z4NA 5DG7A 4UAVA 4ECRA 4EBEA 2C22A 4KLGA 1VJ5A 9ICAA 5KFZA 3OJSA 4R66A 4IRKA 3SD7A 3RJFA 2JV3A 1Z1BA 5ALLA 4M0AA 4IR9A 1XSNA 3M9OB 4QJFB 3Q8KA 2WAQF 1QQ5A 1Z00B 1WCNA 3WKEA 3SQIA 2LKYA 5DQHA 4DLEA 1MQ2A 4NLCA 1S10A 1D9DA 3TARA 1EXNA 4CF5A 1ZQDA 5J8YC 1A0PA 5AKIA 3MBYA 4M9LA 3IHQB 4KX5A
chains in the Genus database with same CATH topology
4P0QA 4C0ZA 2K8AA 3KFUF 3D2QA 3RFAA 2OXOA 2G09A 3ALRA 2RHFA 3H0LB 2W7PA 1NZBA 2ZIXA 3LYSA 4QIWF 3SMVA 2LBOA 4BX9C 2OYYA 2LYBA 2A3VA 1YT3A 3NUQA 1URJA 2KHVA 2K8CB 3F5EA 4FZMA 2WB1F 4NLBA 4KX3A 3CYMA 3H0RB 5KL8B 2N1RA 3AQEA 2ZIWB 1PVRA 4ACOA 2KD1A 4FZNA 4PL2A 1MA7A 3PSFA 1HEKA 2ZIVA 4QIWC 1DRGA 4QNLA 4OJLA 2D6FC 3O0FA 1KBUA 4ICAA 4FE3A 2WAQC 2XICA 1ED1A 3PZPA 3N7PD 2VJ5A 2DF4B 3F53A 4P0QB 1SZHA 2K8BB 3VC8A 1Q3UA 4KMOB 3CRXA 1A6SA 2HBJA 2LYAA 3PSTA 5HR7A 2K4HA 4P0PA 2ZIUA 3IP4B 4AYBF 2E5SA 3K1ZA 3D2SA 2G5IB 3OPXA 3HKZF 2YB4A 3ONNA 2K89A 3GZFA 2W04A 3F2CA 2KIWA 2KEYA 3E0FA 2YB1A 1IIPA 2DGZA 2HBLA 2KJ9A 5HR6A 3AQFA 3SAHA 2JHDA 2ZIVB 3M6KA 2Y0SC 3C29A 2HMXA 1TAMA 2KKPA 4CDGA 1CRXA 2XVTA 2G07A 4IC9A 2H3IA 5CRXA 4OJ6A 2G0AA 5KL1B 3PSIA 3N7SC 2F76X 1D8BA 4OJPA 2F8LA 2R18A 2ZIUB 2JH7A 2KHQA 3D2NA 2KV2A 3DEEA 3PSPA 4FZLA 2F77X 2PMZF 4GFJA 3SAGA 2BDUA 3C28A 1P7DA 5A0LA 2ZXIA 2OH2A 2F2AB 3IG8A 2YX8A 2ZG6A 5C0YA 1T94A 2H3QA 2RRDA 2G06A 4WJ3B 2H3FA 2VJ4A 2ZIXB 3LVWA 1XO0A 4U7CA 3H0MB 2XIDA 1L6NA 4OO1J 4CRXA 2GH1A 3CP8A 2HOFA 3M7DA 3SAFA 3HKZC 2E1EA 2Y0SF 3RF9A 2KJ8A 1GO3F 2PMZC 4P0PB 2KNJA 2ZIWA 4AYBC 4PL1A 2K4IA 1WUDA 2KJ5A 3IN5A 4O3MA 3F2DA 2KOBA 2KVCA 2CRXA 2MA1A 1XNSA 3F5AA 4OJOA 2E1FA 2CPRA 2JMGA 2Q4TA 2JH1A 2VIXA 3IG5A 3T79A 1Z1BA 4OJ5A 1PVQA 2GOLA 3N7RC 2HOIA 2NV3A 2VKQA 4QJFB 2G08A 2W03A 2WAQF 4BUGA 1ECWA 2G5HB 4NV0A 1Q3VA 3M6ZA 1UPHA 4CGZA 4BJQA 2KICA 2HBMA 5T14A 2DQNB 2K4EA 3F2BA 2JGAA 2W7OA 2LKYA 3SQIA 4NWIA 4JMUA 1F44A 4NLCA 2LHTA 3VCBA 2HOQA 4U6PA 1Z19A 1OUQA 2RP5A 3ICXA 2XI9A 2CN1A 3MGVA 2H3VA 3LVVA 1ZQ1C 2ZXHA 3NRWA 4A8EA 3L3FX 2HBKA 2H3ZA 2M0NA 1A0PA 2Z7JA 1PVPA 2KKVA 2MRLA 3GU3A 3KZXA 3AL0B 4KX5A 2WB1C 2OM6A 1HIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DF4 B;  3IP4 B;  2F2A B;  3H0R B;  2DQN B;  3KFU F;  4WJ3 B;  2G5I B;  3AL0 B;  2G5H B;  3H0L B;  2D6F C;  1ZQ1 C;  3H0M B; 
#chains in the Genus database with same CATH topology
 5KT3 A;  4P2H A;  2ZTD A;  3MGI A;  5B66 U;  1D8L A;  5AI0 A;  3MR5 A;  4NLB A;  4NXZ A;  4YN4 A;  3H0R B;  1X40 A;  4F72 A;  5KNI A;  2BZF A;  1ED1 A;  2VJ5 A;  4DQS A;  2K8B B;  3CRX A;  3OJU A;  2JXJ A;  4DQP A;  5EE9 A;  2K4H A;  5KFO A;  4IQV A;  3M1Y A;  7ICV A;  4Z6D A;  2E5S A;  3AU6 A;  5DB8 A;  3C5G A;  2W04 A;  3SV3 A;  1XU4 A;  2KEY A;  4XQ8 A;  1K1S A;  5AKX A;  3RJH A;  4KLE A;  1V97 A;  2YN4 A;  3H8W A;  4RQ7 A;  2IHM A;  2EAO A;  5AKH A;  8ICX A;  4ED7 A;  1J2N A;  4C7Y A;  3ISD A;  4CNQ A;  5L1K A;  2E3T A;  2P6U A;  8ICI A;  2ASL A;  1QQ7 A;  2F77 X;  3TFS A;  2BDU A;  1NK0 A;  2P66 A;  3IG8 A;  2YX8 A;  2G06 A;  3LVW A;  7ICL A;  2YMP A;  2DKZ A;  2MU2 A;  2FDR A;  2NRV A;  5J0W A;  3OHA A;  1ZJM A;  1ZQM A;  4XRH A;  4Q45 A;  5TZV A;  1XSL A;  2E1E A;  1DK3 A;  4ED3 A;  1KLN A;  2YY6 A;  3F2D A;  1KDH A;  1FO4 A;  1KN5 A;  2GOL A;  2HOI A;  1SKS A;  4F2R A;  2G08 A;  2P35 A;  5T14 A;  4BWJ A;  7ICT A;  5DBA A;  3AU2 A;  5D49 A;  4PGY A;  2E8O A;  1Z19 A;  3ICX A;  3OSP A;  3KTQ A;  4Y2T A;  4YR2 A;  4EX7 A;  1NK7 A;  1LV5 A;  1PK1 B;  4A8E A;  1Z3E B;  4ED0 A;  3HP6 A;  4UAS A;  3G6V A;  4C0Z A;  4F92 B;  4YXJ A;  1KFD A;  1KRP A;  3B0X A;  1ZQP A;  8ICK A;  2LPE A;  5AM4 A;  4B9N A;  3GIL A;  4RQ1 A;  4Q8E A;  1PVR A;  4P4O A;  4I2B A;  5J8Y A;  4Y2X A;  4DOC A;  1S0M A;  3BQT A;  1SZP A;  5ALH A;  1BGX T;  5F3X B;  5J2K A;  3CNH A;  4J9M A;  1HUZ A;  3PST A;  2HI0 A;  1ZET A;  4PGX A;  5DLF A;  4FBU A;  1L3U A;  4GIB A;  3C2K A;  4X5V A;  2KFZ A;  4O3N A;  1ZYQ A;  1KTQ A;  1TK0 A;  2Y0S C;  3H7I A;  2IBK A;  3WKD A;  3MR3 A;  5AKL A;  2IA6 A;  1N61 A;  4J03 A;  1NK8 A;  3SEI A;  4DSE A;  3N7S C;  4M6W A;  3PSP A;  4IL6 U;  4LZD A;  4MFC A;  2XY7 A;  2H3Q A;  8ICA A;  2KZM A;  4GLX A;  2EZZ A;  3TI0 A;  4JK1 A;  5AIC A;  1RPL A;  3RF9 A;  2PKE A;  2PMZ C;  1CI4 A;  4DSJ A;  4P0P B;  5C5J A;  2K4I A;  3T5K A;  1L5U A;  3F5A A;  3Q8M A;  1YZ6 A;  2E1F A;  2JH1 A;  1F5S A;  2NV3 A;  2GO7 A;  1XC9 A;  2XO7 A;  1Q3V A;  5IIL A;  2PFN A;  7ICO A;  2HOQ A;  1T8E A;  1M6Y A;  3HPO A;  5HMM A;  5ALW A;  4Y2R A;  5ALD A;  5J0X A;  1JX4 A;  5DQG A;  1ZOL A;  3PW2 A;  5ALU A;  2WB1 C;  1ZQH A;  4RQ8 A;  2C2R A;  1KFT A;  4TQR A;  4MF8 A;  2KVS A;  2ESE A;  4DL4 A;  2YMQ A;  2HSZ A;  4FFD A;  4J9K A;  1UHU A;  1B4F A;  2NRZ A;  5ALS A;  5KT4 A;  2P6R A;  4QWC A;  8ICZ A;  1H38 A;  4M6W B;  5KL8 B;  4UB1 A;  2XCA A;  2AXT U;  2LMR A;  4PPX A;  1D9F A;  1QCK A;  5ALM A;  1U9L A;  2XIC A;  2XGQ A;  5KG7 A;  1LKY A;  9ICJ A;  4FS2 A;  3D2S A;  2EH9 A;  4O3O A;  2KIW A;  2KSO A;  1C20 A;  4UB2 A;  5KFT A;  5HR6 A;  3PX4 A;  3C29 A;  5AKK A;  1S97 A;  1CRX A;  4IC9 A;  3HJE A;  4KLS A;  7ICE A;  2KTQ A;  5AM2 A;  3MDA A;  2VA2 A;  4RQ3 A;  9ICQ A;  2DFL A;  1RQL A;  3WK4 A;  1SWV A;  1XO0 A;  1L3T A;  4UB5 A;  3N4M B;  3T3F A;  3FAH A;  4Y2Q A;  5DDM A;  3PR5 B;  3HKZ C;  5KFA A;  3KHL A;  8ICV A;  4CE6 A;  3H40 A;  9ICR A;  3NGD A;  8ICR A;  2VKQ A;  5ALZ A;  5AK4 A;  4BUG A;  1NI3 A;  3M6Z A;  1V38 A;  4CGZ A;  5AI5 A;  4JB3 A;  5DKW A;  4JWM A;  9ICV A;  1JAL A;  4I27 A;  1NK9 A;  3MGV A;  2H3V A;  3NRW A;  5J0Y A;  2W54 A;  8ICW A;  8ICP A;  3TAD A;  9ICI A;  4R65 A;  7ICN A;  3IM1 A;  4NM1 A;  4O3Q A;  1SKW A;  2LI6 A;  2KZZ A;  5KFR A;  1KKX A;  1S5L U;  1L3S A;  4QZB A;  1SWW A;  5J0S A;  3ISC A;  3RAQ A;  2MAX A;  4QNL A;  4ECX A;  4LVS A;  2WAQ C;  4NM2 A;  1X42 A;  1L7O A;  4YD1 A;  4P0Q B;  3N7P D;  5L1J A;  4F4X A;  1RZT A;  2WF9 A;  2AHO B;  3LDA A;  5BOL A;  2NO5 A;  2ZIU A;  1B22 A;  3CW2 C;  3K1Z A;  4QWA A;  3KOO A;  2F44 A;  5KFW A;  3MAB A;  2HW3 A;  4KTQ A;  4DWI A;  3M6K A;  4ED1 A;  5ALJ A;  3RR7 A;  5AI9 A;  3OSN A;  5IIJ A;  2NRW A;  3ZI4 A;  3PSI A;  3BJY A;  1RDF A;  5KFQ A;  2R18 A;  2OHF A;  2KV2 A;  1T3Q A;  3C21 A;  2FMQ A;  4ECT A;  3BZC A;  4Y2J A;  5AI4 A;  3RRG A;  3I76 A;  2XID A;  4UBC A;  5CB1 A;  3SAF A;  7ICK A;  1TAU A;  5CA7 A;  1FFV A;  2F3N A;  1WWU A;  5HHI A;  4OD0 A;  4B9V A;  4US9 A;  1LB2 B;  1ECW A;  4PZN A;  5AKE A;  2KIC A;  1S0O A;  2DQN B;  2K4E A;  1FIQ A;  8ICS A;  3UMG A;  4TUP A;  4UBB A;  1ZQK A;  2RP5 A;  3ETL A;  4YFK A;  1JRO A;  2PFP A;  1TAQ A;  7ICQ A;  3GDX A;  4DS5 A;  3LWM A;  1S9F A;  3ED5 A;  1JXE A;  5ALX A;  4DSL A;  1NNL A;  1JUD A;  3LYS A;  4QZC A;  4DS4 A;  4BX9 C;  5GTI U;  3NUQ A;  1RM6 C;  5KFE A;  3F5E A;  3CYM A;  4UQG A;  4NL9 A;  4I2G A;  4ACO A;  3SYZ A;  1K1Q A;  4ECZ A;  4JUZ A;  3THV A;  9ICP A;  4FE3 A;  1A77 A;  3TAD C;  3PZP A;  7ICR A;  1JXL A;  2UVV A;  4Y2P A;  3NVW A;  4P0P A;  3TKA A;  3ONN A;  2K89 A;  1WG8 A;  5KFS A;  1U48 A;  5AI6 A;  2KJ9 A;  4F91 B;  3SAH A;  3ZDD A;  1PZN A;  1V9P A;  1N2X A;  4DO9 A;  4RZR A;  4DOA A;  4DFK A;  4QZF A;  4OJ6 A;  4UB6 U;  5KL1 B;  3QZ7 A;  4FBT A;  2V4R A;  2I6X A;  3F2B A;  3GIJ A;  4KMU A;  5KG6 A;  4C80 A;  2BCS A;  3V7K A;  2DPI A;  2WFA A;  9ICU A;  2ES6 A;  5KFP A;  1X9S A;  3K75 D;  1UA1 A;  5D46 A;  4I2E A;  4Y2Y A;  3GV8 B;  2Y0S F;  3PO4 A;  3EWA A;  4O0I A;  2KOB A;  2CRX A;  2UVW A;  1XNS A;  4OJO A;  2QKQ A;  2ATL A;  1ZQI A;  2ZTE A;  5DBC A;  4I28 A;  4R8U B;  2I9G A;  3K4G A;  3T5J A;  2LHT A;  4U6P A;  4G9B A;  3RB3 A;  5KFM A;  5J2G A;  2H3Z A;  4DF4 A;  4PJ0 U;  1PVP A;  2EZX A;  2KZ3 A;  3QU2 A;  5JU5 A;  2RDI A;  1ZXI A;  1JI7 A;  3ALR A;  4I2J A;  3UXN A;  5F9L A;  5L1I A;  4F5Q A;  3NRZ A;  4QZD A;  5L9X A;  2N1R A;  1UQV A;  2BHN A;  1RYS A;  8ICB A;  1U49 A;  3JPO A;  2M9N A;  1C7Y A;  1SZH A;  5KG3 A;  3H8M A;  4DFP A;  1IM4 A;  1KW4 A;  2QB0 A;  3JPN A;  2R8K A;  4KN4 A;  4M04 A;  2DGZ A;  4NL9 C;  4UAT A;  2JR5 A;  1KQQ A;  3MDC A;  4RQM A;  5CRX A;  2BGW A;  4NLK A;  1T4G A;  2JH7 A;  1P7D A;  9ICO A;  3QXG A;  2Q0Z X;  3TAP A;  4NLN A;  1NKC A;  5CWR A;  4IQU A;  4DQR A;  5DB6 A;  3PML A;  3M7D A;  4Z6F A;  3C1Z A;  4G3I A;  5DGB A;  2HHS A;  2FE9 A;  3PX0 A;  1ZQR A;  2FPL A;  8ICU A;  1Y88 A;  5ALF A;  2CPR A;  2VIX A;  2FLP A;  4DFD A;  4OJ5 A;  2WTF A;  2KE7 A;  2W03 A;  4UB4 A;  4R64 A;  3MR6 A;  3B9J A;  5KAF U;  7ICM A;  2I1Q A;  3WK8 A;  3SI8 A;  1N48 A;  5IIO A;  3Q8P B;  3GII A;  5J0U A;  2ZXH A;  3C2M A;  4O3P A;  3AL0 B;  8ICJ A;  4ELU A;  4RQN A;  1BPB A;  2G09 A;  4M9N A;  3H0L B;  2LBO A;  2R8H A;  3SEN A;  1NK4 A;  4ECV A;  4Y2V A;  3H4B A;  4B9S A;  4DLG A;  3TAN A;  5J0O A;  5J2A A;  4BWM A;  3RB0 A;  1MA7 A;  3T5L A;  3SZ2 A;  1ZQC A;  2B0C A;  4DSF A;  2ISO A;  4UAW A;  2JEI A;  4M9G A;  1PUZ A;  2QB0 B;  1N62 A;  2KIV A;  1IXR A;  4IQW A;  2YB4 A;  1RQN A;  5JTI A;  1TFR A;  4KLH A;  3KHG A;  2HBL A;  5KFI A;  5DGA A;  1ZD5 A;  4UAZ A;  4CDG A;  5KT5 A;  1ZQG A;  4YD2 A;  3NAS A;  3PW5 A;  4PH5 A;  1XWL A;  2F76 X;  5ALP A;  3WKB A;  4RPZ A;  4I2C A;  3C28 A;  3RAX A;  5HP4 A;  8ICL A;  2D8C A;  4C4S A;  4WJ3 B;  2UVU A;  2O6K A;  3BDP A;  5AIA A;  2HOF A;  1ZQA A;  4F71 A;  2KJ8 A;  2ZIW A;  3R9K A;  1N60 A;  2KVC A;  4RU9 A;  4KLL A;  2IMW P;  2DBY A;  1RG6 A;  5IIN A;  5CR0 A;  3BS5 B;  4I2A A;  1SL1 A;  5E79 U;  5BPC A;  2JGA A;  1XSP A;  1F44 A;  1NJZ A;  8ICE A;  1COO A;  4UB8 U;  3MFI A;  1OUQ A;  2W43 A;  4JV0 A;  4C8L A;  4M9H A;  5D4B A;  2VA8 A;  3AQE A;  4CF3 A;  2FMP A;  1ZQX A;  2HHV A;  7ICP A;  4F8R A;  2W7P A;  2HDO A;  5KFJ A;  4Q44 A;  2A3V A;  3FDS A;  4E0D A;  1ZQV A;  9ICS A;  2ZIW B;  2YQE A;  4I2D A;  3PSF A;  5BOM A;  4C8O A;  1T3N A;  1V85 A;  4F50 A;  2FPM A;  1YZ7 A;  1Q8K A;  2HHU A;  1PK1 A;  4F5R A;  2G5I B;  1MQ3 A;  1ZRM A;  4LJX A;  1X6J A;  4O3R A;  1WWV A;  3RBD A;  5EE1 A;  2XVT A;  4NJ8 A;  1Z1V A;  8ICC A;  4DF8 A;  3ZD8 A;  2OEH A;  5ALN A;  2XY6 A;  5DDY A;  2OCE A;  4PHP A;  4QZH A;  1QLN A;  5ALV A;  4RT3 A;  5KFX A;  4FO6 A;  5EOZ A;  3E2E A;  1L7N A;  3N28 A;  5KFK A;  2H5X A;  5A0L A;  5JRT A;  4QWB A;  4R63 A;  2H3F A;  9ICK A;  3PX6 A;  4U7C A;  3KZI U;  4GXJ A;  3MR2 A;  5J0Q A;  2JEG A;  4JV2 A;  4I2H A;  2DKX A;  4XA5 A;  4QW9 A;  1PVQ A;  3N7R C;  4EZ6 A;  4F3O A;  5DQI A;  4RPY A;  3ZD9 A;  2IOF A;  2HCF A;  3GV7 B;  2BCQ A;  4Y2U A;  4NWI A;  2GLE A;  1CEZ A;  2W8K A;  4NLZ A;  2EAN A;  3FC4 A;  5J2D A;  3WK7 A;  2C2D A;  2MRL A;  1X6I A;  3KZX A;  1J97 A;  2OM6 A;  1TK8 A;  2F1H A;  2ZJA A;  3RTV A;  1JN3 A;  1NJW A;  5ALI A;  2PFQ A;  1NJY A;  1YT3 A;  2JZB B;  4Z6C A;  9ICW A;  4IRD A;  2KK0 A;  4FZM A;  4Q8F A;  5KG1 A;  3UQ2 A;  2FLL A;  4K4H A;  2KD1 A;  1RXV A;  2DL0 A;  1HEK A;  4JWN A;  9ICM A;  4O5C A;  1ZQW A;  5G5G A;  1UT8 A;  4KLT A;  2HVI A;  4DSK A;  4ELT A;  3RB6 A;  2FJ6 A;  3B0Y A;  5AK6 A;  3PW0 A;  2W55 A;  7ICI A;  4AYB F;  3G6X A;  3HKZ F;  3D6J A;  3MFH A;  2EDU A;  3AQF A;  4TUQ A;  2C2E A;  1QSS A;  2HMX A;  1TAM A;  1JMS A;  3QU7 A;  5ALE A;  4YXM A;  4ECW A;  1ZQQ A;  4GC7 A;  5IIK A;  4EYH B;  3HRD D;  3NS1 A;  4OJP A;  2KSO B;  5J0R A;  3UM9 A;  4RNN A;  1T94 A;  2RRD A;  1BPE A;  1BPZ A;  3K1R B;  1BPY A;  1JIH A;  2F1I A;  2GWS A;  3H0M B;  4CRX A;  5IIM A;  1LKY B;  1TK5 A;  4KLF A;  5AKY A;  5EE0 A;  4DEZ A;  2KJ5 A;  4O3M A;  4MHV A;  2EZY A;  3T79 A;  2NRT A;  4DL3 A;  4HAI A;  3OGU A;  3TAC B;  5KG2 A;  4EEL A;  3JPR A;  1QH9 A;  4BJQ A;  1SV0 A;  3PY8 A;  1S0N A;  4O3S A;  1HUO A;  2W7O A;  3VCB A;  3ZDA A;  4BDP A;  3HIL A;  3RJG A;  4J9Q A;  2ASD A;  3L3F X;  3GFK B;  3NTU A;  2Z7J A;  5J2B A;  3L4P A;  2RLT A;  2EAM A;  4YP3 A;  4P0Q A;  1ZQS A;  5HML A;  4KLI A;  2LYH A;  4QIW F;  3AM9 A;  2CXY A;  4TUR A;  4QZG A;  2FPK A;  2ZIV A;  2AGO A;  4BXO B;  1UA0 A;  5J0P A;  1U47 A;  3RRH A;  2QB1 A;  2R8I A;  4F4K A;  3RR8 A;  2K60 A;  2JRZ A;  2YMM A;  2ZTC A;  2KG5 A;  2ASJ A;  4MEY A;  1DGS A;  2EQY A;  3IV6 A;  2E8P A;  3F2C A;  1QTM A;  3QUB A;  2DPJ A;  1KFS A;  3ZDC A;  1CUK A;  9ICT A;  1MSW D;  1COK A;  2H3I A;  2RDJ A;  3SV4 A;  3S6J A;  3Q8Q B;  3WK9 A;  5L1M A;  5KG0 A;  5KFV A;  9ICE A;  1X9W A;  3JPS A;  4GFJ A;  2A1J A;  4DQI A;  2AJQ A;  2ZUD A;  5CEH A;  5CJ7 A;  2ZIX B;  3UXP A;  4YVZ A;  2BCU A;  1N5W A;  3GQC A;  3A0H U;  4EEY A;  2XC9 A;  4KLO A;  1SB3 C;  1IG6 A;  2DUY A;  4XUS A;  5DB7 A;  5AIB A;  5DBB A;  2DWQ A;  4RQ6 A;  1WUD A;  2A19 A;  3QUC A;  5KFU A;  4EX6 A;  3IG5 A;  1TE2 A;  1U4B A;  2HHQ A;  4RQ5 A;  1WYG A;  4USA A;  1ZQJ A;  4RQ2 A;  2W9C B;  3QUQ A;  3C2L A;  1L7M A;  2VAN A;  3EPI A;  3AN1 A;  5III A;  3WK6 A;  2XGP A;  4KIT B;  8ICM A;  4MFA A;  8ICH A;  2Y1J A;  4UAY A;  1ZD4 A;  1HIW A;  2JEF A;  4C8N A;  5DG9 A;  3L5K A;  5KT6 A;  3D2Q A;  3ZDB A;  1KSP A;  2ZIX A;  3H4D A;  4IR1 A;  4B6J A;  2BCR A;  5AKG A;  1BPX A;  5L1L A;  3AMZ A;  2JEJ A;  3NVY A;  1DOQ A;  5ALK A;  9ICX A;  3GIK A;  1RYR A;  2HVH A;  3V7J A;  1MN8 A;  1ZQF A;  1OW5 A;  1SGG A;  4J9S A;  4ED2 A;  4YG2 A;  4AP9 A;  1S77 D;  2IHN A;  2DF4 B;  4P4M A;  1Q3U A;  4GXK A;  3MGH A;  2V4Q A;  3DDH A;  4YR0 A;  7ICH A;  5J2J A;  1NOM A;  2KP7 A;  5ALR A;  4RT2 A;  4QZA A;  2MSN A;  2JHD A;  2E8N A;  2ZUB A;  2C28 A;  2G0A A;  3KD3 A;  4RUC A;  2AGQ A;  9ICH A;  1X2I A;  9ICC A;  3SAG A;  1N56 A;  3BQ0 A;  2WF5 A;  1X66 A;  2KMD A;  1D8Y A;  4Z6E A;  1Z00 A;  4I2F A;  1JRP A;  4OO1 J;  1S8O A;  1S76 D;  1L3V A;  9ICF A;  3A0B U;  1WCL A;  2BPC A;  5EE3 A;  4AYB C;  4PL1 A;  2FI1 A;  1UT5 A;  2W3R A;  2W3S A;  3Q8L A;  2LM4 A;  2W8L A;  4ZOH C;  5KFF A;  2R8G A;  1ZQU A;  8ICQ A;  3UXO A;  2G5H B;  3LWL A;  2MUT A;  2F8K A;  4LZG A;  4YMN A;  4DSI A;  7ICS A;  4RQ0 A;  4KLQ A;  4QZE A;  1DXS A;  9ICB A;  4EBD A;  3LVV A;  1ZQ1 C;  2XY5 A;  2OWO A;  3M9N B;  3E58 A;  5GTH U;  1ZQO A;  1UCV A;  3WU2 U;  4UAR A;  3PO5 A;  5ALY A;  1NZB A;  4BXO A;  3QU4 A;  2YTU A;  1ARO P;  2B21 A;  1DGJ A;  3PVX A;  4RUA A;  3KBB A;  2UVR A;  1KEJ A;  5JUM A;  1OXJ A;  1SV4 A;  4PL2 A;  5AM5 A;  5AKJ A;  1J2M A;  2YML A;  4ICA A;  5KAI U;  2HHT A;  1RYU A;  1NJX A;  4B9M A;  2IOH A;  4Q43 A;  1ZQE A;  4RQ4 A;  4PHA A;  4KMO B;  1NKB A;  2A1A A;  2HBJ A;  3M9M B;  2NO4 A;  4R8U A;  2VA3 A;  4P4P A;  4ZH4 A;  3RJI A;  3QEB Z;  1IIP A;  5CP2 A;  4B9L A;  2BDP A;  2W9M A;  4UB3 A;  3FYH A;  4QZ9 A;  4NY8 A;  4F2S A;  8ICT A;  4FZL A;  3V7L A;  2L5Y A;  1SV0 C;  2ZG6 A;  3UMB A;  4I29 A;  3WKC A;  1O08 A;  2EAP A;  2ZJ8 A;  5AHX A;  3ETR A;  2WF8 A;  2Q4T A;  9ICL A;  3TQ1 A;  4F93 B;  2NRX A;  4NV0 A;  2PI5 A;  4J9R A;  4JMU A;  4GXI A;  2PI4 A;  8ICF A;  4ECQ A;  2BKE A;  1NKE A;  1RXW A;  4PHE A;  2M0N A;  4J9O A;  2NYV A;  4YMO A;  5J29 A;  1QQ6 A;  3Q8S B;  2K8A A;  5KFC A;  3BQ1 A;  3KFU F;  2OXO A;  4C7Z A;  3N97 B;  3SMV A;  2OYY A;  4F5O A;  2LYB A;  3SR6 A;  2KHV A;  2LM1 A;  1ZJN A;  3QNM A;  2WB1 F;  4KX3 A;  3HWT A;  5KFN A;  4F4W A;  5KFH A;  3C23 A;  4FZN A;  1N5X A;  4MEX A;  8ICO A;  4TQS A;  3H8S A;  3O0F A;  5ALT A;  4IS7 A;  3UQ0 A;  3RJJ A;  3KKA C;  3PNC A;  3E0F A;  3EW9 A;  1BNP A;  1VDV A;  4J9P A;  4CCH A;  4F5P A;  4ED8 A;  1ZD2 P;  1O03 A;  5KT2 A;  4O5K A;  2KHQ A;  1F0M A;  2PFO A;  2OH2 A;  3QEA Z;  4DL7 A;  2ALZ A;  3EYZ A;  7ICJ A;  1L6N A;  2Y1I A;  1Q46 A;  4ECY A;  1VLB A;  3CP8 A;  4M47 A;  4EZ9 A;  1FFU A;  5EWE A;  2QAR B;  3G6Y A;  1SIJ A;  4DL5 A;  3QZ8 A;  5DG8 A;  1B0X A;  2E8M A;  3EZ5 A;  2W9B B;  4KLJ A;  1UPH A;  1IV8 A;  2HBM A;  4Y2S A;  5H2F U;  1SL0 A;  1MC8 A;  3RJE A;  2AQ4 A;  2BQU A;  1A76 A;  2AU0 A;  3LK9 A;  5TIS U;  2CN1 A;  1ZQB A;  4JV1 A;  3V6J A;  9ICG A;  4ECU A;  2HBK A;  4KN7 A;  1XS9 D;  2J6T A;  4B9T A;  5CHG A;  4MF2 A;  1FEZ A;  2AQ0 A;  2QLT A;  5KFY A;  7ICF A;  4YCX A;  2XCP A;  2ZJ5 A;  2B6G A;  1BNO A;  1URJ A;  4F5N A;  1BVS A;  3AUO A;  8ICY A;  4C4T A;  5ALO A;  4BGD A;  2A1J B;  3ISB A;  1DRG A;  1ZD3 A;  4QZI A;  1N63 A;  1PK3 A;  4EYI B;  1SXE A;  4KLM A;  1A6S A;  5KFB A;  5J2E A;  1ZRN A;  4K4I A;  3I1Y A;  2BR0 A;  9ICN A;  4C4R A;  5EWG A;  4O9M A;  2ZIV B;  2I5H A;  4QW8 A;  3WKA A;  4K4G A;  5KFD A;  3BS7 A;  5KFG A;  2G07 A;  2V9W A;  3QE9 Y;  2KN7 A;  4QZ8 A;  2Y9U A;  2BQR A;  5F9N A;  5HNK A;  3DEE A;  2PMZ F;  3QX7 A;  3I28 A;  3QU9 A;  4F4Z A;  2BCV A;  3PV8 A;  4KLU A;  4M9J A;  1L8O A;  1ZQN A;  2AH5 A;  4DCC A;  4DL6 A;  3PW7 A;  4M2Y A;  3RBE A;  2HHW A;  4ECS A;  3FM9 A;  4OCZ A;  3IN5 A;  2PXI A;  4MFF A;  2W11 A;  5J2I A;  2JMG A;  4GC6 A;  4PZO A;  3JPT A;  3RH6 A;  4NLG A;  5AM1 A;  2W9B A;  4QWE A;  1LVH A;  2BPF A;  3EPG A;  2W9C A;  1ZQT A;  4KLD A;  4PHD A;  3UPQ A;  2WHE A;  4EBC A;  2XI9 A;  3M8S A;  3C5F A;  4F4Y A;  4DFJ A;  5G5H A;  2WF6 A;  1ZQZ A;  1QSY A;  4ELV A;  2W9A A;  3OTQ A;  3RH5 A;  3QU5 A;  3J81 j;  2RHF A;  2ODG A;  3ZDE A;  4ED6 A;  5ALQ A;  3BZK A;  4DL2 A;  3PR4 A;  3AEV A;  3JPP A;  5J2C A;  1HJP A;  4QIW C;  4DQQ A;  5KTQ A;  1XO1 A;  3BQ7 A;  3RH4 A;  4US8 A;  3F53 A;  4I2I A;  4YQW A;  1TVA A;  5J0T A;  1KL9 A;  5HR7 A;  1NZP A;  3DV9 A;  3IP4 B;  1NK5 A;  3H8J A;  4PGQ A;  4O5E A;  1U45 A;  2D3D A;  2RQ5 A;  3QUT A;  3GV5 B;  4C8K A;  1ZQY A;  4IQT A;  3RB4 A;  3U26 A;  3TFR A;  4DFM A;  5AK5 A;  5KG4 A;  3ORY A;  5K4L A;  4UW9 A;  1D8B A;  2ZIU B;  2ISP A;  3D2N A;  4FS1 A;  2BQ3 A;  2D6F C;  3BQ2 A;  5ALG A;  4IRC A;  5HHH A;  3IRU A;  1SXD A;  2VJ4 A;  4J9N A;  3Q8R B;  2GH1 A;  5AKZ A;  2FLN A;  4EEN A;  3EUB 2;  3C1Y A;  1GO3 F;  2KNJ A;  3RJK A;  1QSL A;  2MA1 A;  1L7P A;  4HYK A;  4EEK A;  3HW8 A;  1AQ6 A;  4J9L A;  3GIM A;  8ICG A;  4RNO A;  1SKR A;  2R8J A;  2FMS A;  2MUT B;  3V6H A;  3HT3 A;  3QYP A;  5FP0 A;  4YR3 A;  3KHH A;  2AGP A;  2BPG A;  2KKV A;  3GU3 A;  3UMC A;  1SL2 A;  1BPD A;  2KFN A;  2J6S A;  2WF7 A;  2J6U A;  3RFA A;  3PW4 A;  3BS5 A;  1NK6 A;  1DK2 A;  1X9M A;  5AK3 A;  1ZQL A;  3OHB A;  1Z4O A;  5DLG A;  3PMN A;  4UAU A;  4TUS A;  2K4P A;  2K8C B;  3KKA A;  3KHR A;  1TKD A;  5DB9 A;  2IOF K;  3M8R A;  5J2F A;  1TV9 A;  3JPQ A;  5EWF A;  4OJL A;  2ZUC A;  1KBU A;  1B43 A;  3T5H A;  4C8M A;  3TAQ A;  1X9X A;  5AM0 A;  7ICU A;  2JZB A;  3IDW A;  3VC8 A;  2Y9T A;  2LYA A;  5KG5 A;  5KFL A;  4RPX A;  7ICG A;  4CF4 A;  4QWD A;  4DOB A;  1L8L A;  3OPX A;  4RNM A;  4YMM A;  3HX0 A;  3GZF A;  2YB1 A;  3NVV A;  5KT7 A;  1T7P A;  2F1J A;  1K5O A;  2HHX A;  2KKP A;  3V6K A;  5J2H A;  5AM3 A;  5B5E U;  2F8L A;  3NVZ A;  2QAR A;  5AI8 A;  8ICN A;  3MC1 A;  5C0Y A;  2ZXI A;  3V72 A;  2F2A B;  1S0V A;  4B9U A;  3WK5 A;  1Z4N A;  5DG7 A;  4UAV A;  4ECR A;  4EBE A;  2C22 A;  4KLG A;  1VJ5 A;  9ICA A;  5KFZ A;  3OJS A;  4R66 A;  4IRK A;  3SD7 A;  3RJF A;  2JV3 A;  1Z1B A;  5ALL A;  4M0A A;  4IR9 A;  1XSN A;  3M9O B;  4QJF B;  3Q8K A;  2WAQ F;  1QQ5 A;  1Z00 B;  1WCN A;  3WKE A;  3SQI A;  2LKY A;  5DQH A;  4DLE A;  1MQ2 A;  4NLC A;  1S10 A;  1D9D A;  3TAR A;  1EXN A;  4CF5 A;  1ZQD A;  5J8Y C;  1A0P A;  5AKI A;  3MBY A;  4M9L A;  3IHQ B;  4KX5 A; 
#chains in the Genus database with same CATH homology
 4P0Q A;  4C0Z A;  2K8A A;  3KFU F;  3D2Q A;  3RFA A;  2OXO A;  2G09 A;  3ALR A;  2RHF A;  3H0L B;  2W7P A;  1NZB A;  2ZIX A;  3LYS A;  4QIW F;  3SMV A;  2LBO A;  4BX9 C;  2OYY A;  2LYB A;  2A3V A;  1YT3 A;  3NUQ A;  1URJ A;  2KHV A;  2K8C B;  3F5E A;  4FZM A;  2WB1 F;  4NLB A;  4KX3 A;  3CYM A;  3H0R B;  5KL8 B;  2N1R A;  3AQE A;  2ZIW B;  1PVR A;  4ACO A;  2KD1 A;  4FZN A;  4PL2 A;  1MA7 A;  3PSF A;  1HEK A;  2ZIV A;  4QIW C;  1DRG A;  4QNL A;  4OJL A;  2D6F C;  3O0F A;  1KBU A;  4ICA A;  4FE3 A;  2WAQ C;  2XIC A;  1ED1 A;  3PZP A;  3N7P D;  2VJ5 A;  2DF4 B;  3F53 A;  4P0Q B;  1SZH A;  2K8B B;  3VC8 A;  1Q3U A;  4KMO B;  3CRX A;  1A6S A;  2HBJ A;  2LYA A;  3PST A;  5HR7 A;  2K4H A;  4P0P A;  2ZIU A;  3IP4 B;  4AYB F;  2E5S A;  3K1Z A;  3D2S A;  2G5I B;  3OPX A;  3HKZ F;  2YB4 A;  3ONN A;  2K89 A;  3GZF A;  2W04 A;  3F2C A;  2KIW A;  2KEY A;  3E0F A;  2YB1 A;  1IIP A;  2DGZ A;  2HBL A;  2KJ9 A;  5HR6 A;  3AQF A;  3SAH A;  2JHD A;  2ZIV B;  3M6K A;  2Y0S C;  3C29 A;  2HMX A;  1TAM A;  2KKP A;  4CDG A;  1CRX A;  2XVT A;  2G07 A;  4IC9 A;  2H3I A;  5CRX A;  4OJ6 A;  2G0A A;  5KL1 B;  3PSI A;  3N7S C;  2F76 X;  1D8B A;  4OJP A;  2F8L A;  2R18 A;  2ZIU B;  2JH7 A;  2KHQ A;  3D2N A;  2KV2 A;  3DEE A;  3PSP A;  4FZL A;  2F77 X;  2PMZ F;  4GFJ A;  3SAG A;  2BDU A;  3C28 A;  1P7D A;  5A0L A;  2ZXI A;  2OH2 A;  2F2A B;  3IG8 A;  2YX8 A;  2ZG6 A;  5C0Y A;  1T94 A;  2H3Q A;  2RRD A;  2G06 A;  4WJ3 B;  2H3F A;  2VJ4 A;  2ZIX B;  3LVW A;  1XO0 A;  4U7C A;  3H0M B;  2XID A;  1L6N A;  4OO1 J;  4CRX A;  2GH1 A;  3CP8 A;  2HOF A;  3M7D A;  3SAF A;  3HKZ C;  2E1E A;  2Y0S F;  3RF9 A;  2KJ8 A;  1GO3 F;  2PMZ C;  4P0P B;  2KNJ A;  2ZIW A;  4AYB C;  4PL1 A;  2K4I A;  1WUD A;  2KJ5 A;  3IN5 A;  4O3M A;  3F2D A;  2KOB A;  2KVC A;  2CRX A;  2MA1 A;  1XNS A;  3F5A A;  4OJO A;  2E1F A;  2CPR A;  2JMG A;  2Q4T A;  2JH1 A;  2VIX A;  3IG5 A;  3T79 A;  1Z1B A;  4OJ5 A;  1PVQ A;  2GOL A;  3N7R C;  2HOI A;  2NV3 A;  2VKQ A;  4QJF B;  2G08 A;  2W03 A;  2WAQ F;  4BUG A;  1ECW A;  2G5H B;  4NV0 A;  1Q3V A;  3M6Z A;  1UPH A;  4CGZ A;  4BJQ A;  2KIC A;  2HBM A;  5T14 A;  2DQN B;  2K4E A;  3F2B A;  2JGA A;  2W7O A;  2LKY A;  3SQI A;  4NWI A;  4JMU A;  1F44 A;  4NLC A;  2LHT A;  3VCB A;  2HOQ A;  4U6P A;  1Z19 A;  1OUQ A;  2RP5 A;  3ICX A;  2XI9 A;  2CN1 A;  3MGV A;  2H3V A;  3LVV A;  1ZQ1 C;  2ZXH A;  3NRW A;  4A8E A;  3L3F X;  2HBK A;  2H3Z A;  2M0N A;  1A0P A;  2Z7J A;  1PVP A;  2KKV A;  2MRL A;  3GU3 A;  3KZX A;  3AL0 B;  4KX5 A;  2WB1 C;  2OM6 A;  1HIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...