2F2AB

Structure of trna-dependent amidotransferase gatcab complexed with gln
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
408
structure length
408
Chain Sequence
ETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ammonia channel couples glutaminase with transamidase reactions in GatCAB
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
total genus 120
structure length 408
sequence length 408
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2f2aB02
2G5IB 3H0MB 2DF4B 3AL0B 4WJ3B 3H0RB 3KFUF 2DQNB 3IP4B 2G5HB 2F2AB 2D6FC 3H0LB 1ZQ1C
chains in the Genus database with same CATH superfamily
3QU7A 1U4BA 2EAPA 2YQEA 1S8OA 4UATA 2OM6A 4B6JA 2BKEA 4HAIA 2G09A 3SAFA 1ZD4A 3ALRA 3NASA 4PJ0U 1EXNA 5L9XA 1TK5A 1ZQGA 5DBBA 5HNKA 9ICKA 2R8IA 1XSNA 3HP6A 4QZCA 4US8A 2DGZA 5KFRA 4FE3A 4NM1A 4PL2A 5CEHA 4UB2A 4ELVA 4F8RA 2KFZA 2BR0A 3ZDCA 2BCUA 4P0QA 3PW0A 3I28A 3K1RB 3H0RB 4I2FA 5KT6A 5KAIU 2OXOA 2XY6A 2I9GA 4KLHA 1JIHA 1RYRA 2VANA 3SAHA 4CRXA 2RRDA 1X42A 4GFJA 2ZJ8A 1FIQA 2YB1A 1NK5A 1S0NA 3N97B 4J03A 4QZ8A 2ALZA 3NUQA 1PZNA 3H4DA 3QU5A 1X9WA 1P7DA 1NK0A 1MQ2A 2K8BB 8ICAA 5AK6A 2PFNA 2V9WA 8ICIA 1T8EA 4KLQA 4YMMA 2H3VA 3M9OB 4YQWA 2ZTEA 2J6UA 1FEZA 9ICGA 4NL9A 3PV8A 4I2BA 4RUCA 2H5XA 4KLDA 1Q8KA 3SAGA 5TISU 3E2EA 5KL1B 1LV5A 2DWQA 2H3ZA 4F72A 2ZJAA 2EANA 9ICNA 3C23A 4TQSA 3RBEA 2K8CB 3Q8LA 5DLGA 3WKCA 2PI4A 1BNPA 4ZH4A 1T94A 2MSNA 5DGBA 3D2NA 2VJ5A 3JPOA 4I2JA 4ECRA 4I2CA 3TFRA 3L3FX 5KFGA 2E8PA 2WF8A 2HOIA 2IHMA 3TACB 3EPIA 2P35A 8ICHA 2WB1C 5IILA 4G3IA 5J2GA 4JWNA 3DV9A 8ICFA 4FZMA 4DQPA 5AK5A 3H4BA 3AN1A 1SL2A 5BOLA 4IRCA 3T5JA 4P0PA 2EAOA 2IMWP 8ICLA 5CR0A 2V4QA 3PNCA 2W7PA 2A3VA 4K4GA 1S9FA 4DFPA 3QUTA 3H8JA 1VJ5A 1KFDA 3H0LB 5AI4A 4CNQA 2YTUA 3IM1A 5AM0A 5KG4A 1L7NA 2FJ6A 5EE3A 7ICKA 4NL9C 4F50A 2CXYA 2C28A 2Y1IA 1U48A 5AM3A 5AI5A 4A8EA 4R65A 3GIKA 1L7OA 3M9NB 3WK4A 9ICOA 2OHFA 3RJJA 4DL2A 5EOZA 1ZQMA 3RAXA 3AMZA 1NI3A 4DOCA 3GV5B 1CRXA 1KBUA 2NV3A 1SGGA 5KFHA 2ZIVB 4ZOHC 3Q8MA 4P4MA 1L6NA 5J29A 2WAQF 2BCRA 1DK3A 4MEYA 4F5OA 2WF7A 4I2GA 1ZQ1C 1ZQKA 7ICSA 2FPKA 3HJEA 2LPEA 5DB8A 3C2LA 4PGQA 3F53A 4F4WA 2XIDA 5AM2A 2A1JA 2WF9A 2BPFA 4Q45A 2KD1A 3SD7A 3ED5A 5J2DA 2JZBB 3PMNA 1D8YA 3N4MB 3V6HA 3MR3A 2K4IA 2PXIA 3C1ZA 1PK1B 9ICRA 5T14A 2HHTA 3AUOA 4EELA 4DQSA 5J0RA 3BS5B 3C21A 2YMQA 4UB6U 3PX6A 2WF6A 3KHHA 4J9SA 5EWGA 5AM4A 4NLNA 3BZCA 3BDPA 4UAUA 3QX7A 2NRTA 4LZDA 4RU9A 5AHXA 1ZQVA 4BDPA 4ACOA 1L7MA 5A0LA 4TQRA 3PX4A 5AKXA 4O5KA 3Q8QB 5ALZA 3HILA 1TAUA 2EZZA 1L3UA 2QLTA 3RJEA 2KG5A 1VDVA 1ZETA 4QWEA 4DLEA 2YX8A 3V7KA 1NKBA 1QCKA 4UB8U 5K4LA 3RBDA 3OJSA 4QWBA 3SMVA 5L1KA 2Q4TA 2EQYA 4OO1J 3KHRA 4ECTA 1LB2B 1ZQOA 3BJYA 4I28A 3BQ0A 3BQ2A 1NK9A 2W03A 2AGOA 8ICGA 2JXJA 4IQWA 1KFTA 3FC4A 4OD0A 2JEFA 8ICMA 4MEXA 4CF5A 5E79U 4M9NA 4P4PA 2AQ0A 3IG8A 5J0WA 2H3IA 4XQ8A 1X66A 3RJKA 3QUBA 7ICOA 4CDGA 2G5HB 5L1IA 4UAYA 4NM2A 1SWWA 2W9BA 1SV4A 9ICXA 3TANA 2ZXHA 4AYBF 4TUSA 2I5HA 3QEBZ 2UVVA 4MF2A 1QH9A 1FO4A 1SWVA 3MR5A 3Q8KA 4JK1A 3NVVA 1BGXT 4ECQA 4O3PA 3HKZC 5KG5A 4F4YA 4M9HA 1BPZA 5JRTA 4B9LA 1UQVA 8ICWA 4Z6DA 3HX0A 2HI0A 3OSNA 4FZLA 3PX0A 2FLLA 4OJ5A 5EWEA 2W9MA 2CN1A 9ICJA 4F4XA 4KMUA 4M04A 5AI0A 2KJ9A 4RQ5A 3ZDEA 4Z6EA 1S97A 2EAMA 4YXJA 1BNOA 2NRXA 2F8KA 4NLZA 5ALTA 2UVWA 9ICBA 5ALGA 4RPZA 1D9FA 2HHSA 1WUDA 2KIWA 3C5GA 1HUOA 1X40A 7ICRA 2FI1A 3Q8PB 4RNNA 3T5KA 3DEEA 5ALVA 4EEYA 4OJOA 4ECZA 4PGYA 3BQTA 5KNIA 1DRGA 3SR6A 3AU6A 3PW7A 2KKPA 2AQ4A 4KX3A 5HMLA 1RXVA 1JXLA 4IR9A 9ICCA 1ZQEA 5DB6A 1XU4A 2ASLA 1XO1A 4ED2A 4UQGA 4K4IA 2HDOA 8ICKA 1LKYA 4NLGA 4UASA 1XC9A 2JZBA 2K4HA 3QU9A 3RR8A 5J0TA 4O5CA 2KKVA 3GFKB 1BPXA 3V7JA 4IQUA 3U26A 3M6ZA 2Y1JA 1ZD2P 3MDCA 1N60A 3LWLA 3EW9A 5J2HA 4XA5A 3JPQA 4DL7A 3MFHA 1NK7A 2LYBA 4KLTA 3TAQA 9ICPA 2R18A 2BDPA 1X9SA 1ZQUA 3B9JA 4BJQA 4UAZA 5DG8A 5EE1A 3KD3A 5CJ7A 4O3SA 1MQ3A 2HBJA 5J2AA 2MUTA 1B4FA 1A0PA 3A0HU 2KVSA 3NVYA 1NJXA 4PL1A 2JH1A 4HYKA 5ALMA 5KT3A 4DFDA 4EBDA 2CRXA 5B5EU 5KFFA 5L1JA 8ICNA 3ORYA 2XY7A 3J81j 1KFSA 2KICA 1ZQTA 1QLNA 1N5XA 2F8LA 5KFQA 2EDUA 2HBKA 2DKZA 1L8LA 2KMDA 4UBCA 2NRZA 2QKQA 2W3RA 1CUKA 1O03A 1UPHA 4CE6A 2E3TA 2ESEA 4R8UA 5IIMA 4J9OA 4ED6A 4DQIA 4EBEA 2KEYA 3H8SA 4UB5A 4FBTA 7ICPA 5DG9A 1F5SA 3V7LA 4TUPA 2EZXA 5CB1A 1F44A 4LJXA 3L4PA 1BPEA 5FP0A 5DKWA 2JRZA 3QEAZ 3V6KA 1N62A 5L1LA 4XUSA 3PO4A 4NLBA 5KFYA 1PUZA 4QW9A 3OSPA 4PZOA 1BPBA 2DUYA 2XICA 3RB0A 1SB3C 4IC9A 5KG7A 4IR1A 4EX6A 3I76A 4ED8A 4KLLA 4M6WA 3F5EA 3ZD9A 4KLSA 2DL0A 4YFKA 2GO7A 4BWJA 1SV0A 1ZXIA 9ICLA 2NO4A 3V6JA 4M6WB 3B0YA 4UAWA 4C0ZA 1ZQNA 1S10A 1PVQA 5F9LA 4YR3A 3RJFA 2ODGA 4DFJA 3RJGA 3IN5A 5KT2A 4UB4A 3LYSA 4Y2TA 3T79A 1DGJA 3HW8A 4Y2SA 4O5EA 3AL0B 2KFNA 3WK9A 3V72A 4RUAA 1HUZA 4KLFA 8ICQA 1RG6A 3M6KA 2ZIXB 4BX9C 1T3QA 4RQ3A 4EZ6A 3GIMA 2QB1A 3SQIA 1RYSA 4GXIA 2XI9A 2E8OA 4DLGA 3QNMA 4F71A 2K8AA 1V97A 1SXDA 2EZYA 4FFDA 4Y2QA 4C8MA 1NZBA 5CP2A 2JEIA 5KFBA 4OJPA 1L5UA 1SKSA 3MFIA 4YXMA 2XC9A 2YMMA 1KQQA 4DEZA 4CCHA 5AKIA 2ZIUB 3LDAA 3RRGA 1SKRA 1SKWA 4OJ6A 2FPLA 5DBCA 2NRWA 3Q8SB 4NY8A 4YVZA 4R8UB 4DFMA 5CA7A 8ICEA 4DFKA 2LBOA 4KN4A 2MUTB 5KFMA 3HKZF 7ICJA 4EYIB 4YR0A 3QUQA 4QZBA 4MFFA 5C5JA 4ELUA 1ZQCA 8ICBA 2HBMA 1Q46A 2XGQA 4UBBA 8ICRA 4FO6A 2ZXIA 2F2AB 3RB4A 4RQMA 3AM9A 1N63A 4I2EA 3M8SA 3SV3A 2KHVA 1QSLA 2XCPA 4QZAA 1LKYB 3TKAA 4DCCA 1BVSA 4RZRA 2DPJA 2DPIA 2ZIWB 1KRPA 2FMQA 4USAA 4DOBA 2ES6A 5DQHA 3PY8A 3GQCA 4QJFB 5ALIA 4YD2A 2HW3A 2ASDA 1D8LA 1TAQA 4KX5A 4F4ZA 4PPXA 2E5SA 5ALXA 4RQ1A 3NVZA 1SZPA 4JUZA 4ED3A 3H8MA 1NK6A 4YMOA 3N7RC 5J8YA 4UB3A 5ALPA 2F1IA 5AK3A 3IHQB 1NNLA 2DKXA 3BS5A 1X9MA 7ICFA 3NTUA 3WKEA 2HSZA 2K4PA 5DDMA 2KP7A 5KFVA 4AYBC 2XCAA 2P66A 2QARB 2VJ4A 1ZQHA 3C29A 3QZ7A 4F93B 1A6SA 4DL4A 2FPMA 1TV9A 3M9MB 3PVXA 5ALSA 2DF4B 3K1ZA 4P0PB 4QZIA 5ALNA 5D46A 3IDWA 1ZQQA 3AQEA 1UT5A 1WWVA 3E0FA 3C5FA 3UPQA 3KFUF 4IRDA 1YT3A 5IIJA 3RH6A 2W9BB 3RB6A 3RFAA 3MGVA 4TUQA 4IQVA 3HWTA 1BPYA 1ZD5A 2WFAA 1XS9D 4M9JA 3PSPA 3LVVA 3UQ0A 1CEZA 1ZQJA 3PR4A 4NXZA 1X6IA 3ZDBA 5KFSA 3UMBA 1ZYQA 3EZ5A 1JUDA 5AM5A 1D9DA 2F1HA 5L1MA 3WK5A 2OCEA 2KOBA 2YMPA 1COKA 4QZEA 3KHGA 2UVRA 4RNOA 3SEIA 3OHBA 3ISDA 1TE2A 1S0MA 3S6JA 1K1QA 3OPXA 3KTQA 1ZQAA 3UXOA 4DS4A 3TI0A 4M9GA 3AEVA 3T5LA 5DLFA 1ZQBA 2D3DA 2EH9A 1JROA 3BS7A 2ZUDA 5J2CA 2IHNA 2GH1A 1HEKA 3MGHA 1PVPA 2Y9TA 3WKDA 2Z7JA 1T3NA 1XWLA 4CGZA 2O6KA 1Z4OA 2HBLA 3ETLA 4I27A 4CF3A 1J97A 3FM9A 3C1YA 5KFJA 2MU2A 5KFXA 2H3QA 1IM4A 1Z1VA 1N61A 2RHFA 2BCVA 4MF8A 3AU2A 3T5HA 3TFSA 1UHUA 1ZQWA 3BZKA 3RTVA 1SV0C 2BPGA 1S5LU 4UW9A 4IRKA 3N7PD 4UARA 3CP8A 2RQ5A 3F5AA 1S0VA 2BZFA 4LZGA 3C2MA 2IOFA 5ALQA 1XSPA 2HHXA 1TFRA 3RRHA 4BXOA 3IG5A 5J0QA 3CRXA 5AI9A 1YZ7A 2NYVA 3C2KA 3HRDD 1JI7A 1L3TA 3JPTA 2RDJA 1KL9A 2YY6A 2IOFK 1T4GA 1ZQZA 4Y2PA 3KOOA 4KTQA 3FDSA 3TADC 2NRVA 1A76A 3NGDA 2HOQA 5EE0A 4J9KA 4ECWA 4KMOB 3UQ2A 4J9NA 3WK7A 4F5QA 1QQ5A 3ZDAA 4LVSA 3GV8B 4JV2A 4KLMA 2KSOB 1BPDA 2W9CA 4PHAA 4RQNA 3Q8RB 4NLKA 2VA8A 4Y2JA 1ZQDA 4EENA 5AIBA 3SENA 3GIIA 1NK4A 1RQNA 2LM4A 2F3NA 5KFNA 1DK2A 7ICGA 1N5WA 3H7IA 5IIOA 1ZQRA 8ICJA 1WCNA 4KN7A 1ZRMA 2KTQA 5JU5A 3AQFA 2R8KA 2PMZC 1DXSA 2QB0A 5KFLA 5J2IA 3CW2C 1Z1BA 4J9MA 3PSFA 1DOQA 2AXTU 1OUQA 1FFUA 8ICPA 1N48A 4C8OA 2AHOB 2ZIXA 4NV0A 4C7YA 4G9BA 3PW2A 3N7SC 4YN4A 3PMLA 3RR7A 2RDIA 3SI8A 1TAMA 3M1YA 4B9NA 2BDUA 2NO5A 3SV4A 4F3OA 4ED1A 1Q3UA 2DQNB 3LK9A 1Z19A 2KE7A 4KLJA 3JPPA 2Q0ZX 1PK3A 4F5PA 4QZFA 3TARA 5AKEA 3UMCA 1RM6C 4EBCA 5HMMA 2L5YA 1TKDA 2WF5A 5J2EA 5J0UA 2G5IB 2W9AA 2BCQA 1S76D 9ICMA 5BPCA 4Q44A 4BUGA 5AI6A 1JX4A 2XVTA 1COOA 2E8MA 3G6VA 2B21A 2E1EA 4C4TA 2Y9UA 3OGUA 2F76X 4IL6U 4C8LA 4B9VA 9ICTA 4ECVA 9ICQA 1RYUA 4JV0A 3D2QA 3PW4A 2KNJA 4NWIA 3D2SA 4F91B 2FLNA 1KSPA 5KG6A 1SL0A 4KLUA 2LM1A 2BQ3A 4EEKA 2HHUA 4C80A 1X6JA 2RLTA 1AQ6A 2E1FA 4YP3A 4F5NA 1NJZA 5J0PA 9ICUA 1N56A 4DL5A 4O3OA 3G6XA 4U6PA 4F4KA 5J8YC 1IXRA 3QZ8A 4WJ3B 2LHTA 4R63A 5BOMA 4DQQA 1X9XA 2KN7A 1T7PA 4EZ9A 3WK8A 1JN3A 2B0CA 2ZUBA 3RH5A 1KEJA 2J6TA 5KG3A 5GTHU 4QNLA 4R66A 5KFUA 2OH2A 3WKBA 5J2KA 5AKHA 5JTIA 2GOLA 1S77D 2MRLA 4M0AA 3IV6A 3KZIU 4FS1A 8ICYA 4C8NA 3OTQA 5DB7A 2Y0SF 5KFIA 2BHNA 2HHQA 2DFLA 9ICHA 5CHGA 3EUB2 3B0XA 1K1SA 1XSLA 4C7ZA 2C2RA 2JMGA 2GLEA 1LVHA 1JXEA 3MBYA 4J9PA 2AU0A 4O0IA 1RPLA 4P4OA 4I2DA 4RT2A 3OHAA 1S0OA 4I2HA 4RNMA 2JGAA 1L8OA 2M9NA 2ZUCA 3RH4A 4GC6A 4F2SA 2BCSA 1QQ6A 1RDFA 5GTIU 5ALUA 4PHPA 2BQUA 4JMUA 3PO5A 3FYHA 3L5KA 9ICIA 4B9TA 4RPXA 3MGIA 4QZGA 4M2YA 1V9PA 4DF4A 9ICWA 3KBBA 2YB4A 2ZTCA 1U45A 1QSSA 2RP5A 3JPRA 1B43A 3M7DA 2AGQA 5ALWA 4OCZA 2K4EA 2C2DA 5KAFU 1H38A 5KFPA 1NZPA 3RF9A 2CPRA 4X5VA 9ICEA 4RQ4A 4BWMA 7ICLA 5DDYA 3QYPA 4QWDA 5IINA 2ISPA 2A1AA 2YMLA 1WWUA 4Z6FA 9ICVA 3JPSA 4RT3A 4GIBA 2W11A 5AKYA 4R64A 1RZTA 4FBUA 3F2CA 5DG7A 2V4RA 3HT3A 4EX7A 3QXGA 3SZ2A 9ICSA 3PR5B 7ICNA 4KLOA 2ZIUA 4O9MA 1QSYA 4PGXA 1M6YA 2D8CA 3NVWA 1VLBA 2JHDA 5KFWA 1ZQLA 4YCXA 2W8KA 1WCLA 3MC1A 5EWFA 1PK1A 2FLPA 5KG2A 3QU2A 4IQTA 4I29A 2E8NA 5C0YA 4UB1A 4DSJA 3GV7B 4MFCA 8ICTA 3F2BA 3DDHA 5J2BA 2IOHA 3TAPA 4PHDA 2HOFA 2LI6A 5J2FA 2JEGA 1KLNA 3CNHA 2F77X 3MDAA 2KVCA 3JPNA 1ZQFA 4KITB 2W7OA 2JEJA 9ICFA 1JRPA 5IIIA 5AIAA 4M9LA 2B6GA 4Y2UA 1U47A 4YMNA 5ALEA 4I2IA 7ICQA 1ED1A 5KT4A 3PW5A 1ZQSA 5HHHA 2C22A 4P0QB 5TZVA 8ICUA 2LYAA 5CWRA 2W3SA 1NJYA 1IIPA 1SZHA 1V85A 2A1JB 2W9CB 4K4HA 2KZ3A 3I1YA 8ICCA 1Z3EB 2JV3A 1KW4A 5KFOA 4ECSA 4E0DA 4DS5A 2PMZF 3H40A 2C2EA 3O0FA 4O3QA 4QZ9A 1ZD3A 4KLEA 1ZQXA 2W8LA 5AKZA 4DQRA 4NLCA 4XRHA 5DQIA 2KK0A 4J9RA 1U9LA 1NJWA 1DGSA 3PSTA 3THVA 2D6FC 1MN8A 3LVWA 5AICA 1ZJNA 2HVHA 4FS2A 4TURA 1YZ6A 4QIWF 4GXJA 2MAXA 2PFQA 5KFKA 2FDRA 1FFVA 5KG0A 3K75D 8ICXA 5AK4A 4DSKA 4F2RA 4I2AA 4JV1A 1C20A 3T3FA 2KHQA 1ZQPA 3ETRA 3G6YA 1NKEA 2KIVA 1URJA 1QTMA 4B9SA 2M0NA 4C8KA 4C4SA 4DSFA 1J2MA 3K4GA 4YR2A 4QWCA 4ECYA 2BGWA 3GU3A 3OJUA 2IA6A 2BPCA 2ZJ5A 1UA0A 2DBYA 2P6RA 2HMXA 4QW8A 2H3FA 2HHWA 2PKEA 3KKAA 3D6JA 4DL6A 1O08A 2KJ8A 2BQRA 3FAHA 5DB9A 4RQ2A 3HPOA 5ALHA 1HIWA 1WYGA 2P6UA 5AKLA 2PFOA 4U7CA 1SL1A 2ASJA 1OW5A 1JALA 3BQ7A 3BQ1A 5ALDA 2K89A 5KTQA 4FZNA 2HHVA 5KFAA 4IS7A 2N1RA 2ZG6A 4DL3A 2G06A 2FMPA 2KZMA 2LKYA 4GC7A 3UMGA 5KFDA 2KV2A 1UT8A 3VC8A 5DBAA 2WTFA 4J9LA 3PSIA 2WHEA 1A77A 3ISBA 8ICSA 1ZRNA 2WB1F 5D4BA 3GZFA 3N28A 3CYMA 3R9KA 3ISCA 5ALKA 2A19A 4Y2XA 3NS1A 5EE9A 7ICEA 7ICUA 5KT7A 3A0BU 5AM1A 2IBKA 1TVAA 2GWSA 2J6SA 2VIXA 2Y0SC 1QQ7A 4PH5A 5JUMA 4J9QA 1KDHA 1X2IA 3UM9A 2F1JA 1KKXA 4ECUA 2QARA 9ICAA 4Y2YA 5AKKA 5HR6A 5KT5A 2R8JA 2F44A 3GIJA 1ZOLA 4O3RA 2G07A 1SIJA 8ICVA 2AH5A 4EYHB 1TK0A 1JMSA 8ICOA 3QE9Y 1TK8A 3IP4B 3PZPA 2LYHA 5KFCA 4YG2A 3UXPA 1V38A 2ZIVA 2HVIA 3ZD8A 5KFTA 5G5HA 2ZIWA 2W43A 4ED7A 4DSLA 3MABA 5J0YA 1N2XA 1UA1A 2WAQC 4AP9A 4DOAA 2W54A 4PHEA 2VKQA 2OWOA 4QWAA 3M8RA 2PI5A 1ZQIA 2W55A 3TQ1A 5F3XB 5B66U 5DQGA 4Y2RA 4B9UA 2PFPA 3H0MB 5AKJA 4GXKA 1CI4A 5KFZA 3H8WA 2G08A 1ZJMA 2I1QA 1NOMA 5J0XA 2W04A 1J2NA 4YD1A 1ZQYA 5AKGA 4RQ7A 1NKCA 4OJLA 5J0SA 4DO9A 1L7PA 4F92B 1PVRA 1OXJA 3SYZA 4ELTA 5KL8B 5DGAA 4RQ6A 4UAVA 3ZI4A 1Z00B 5F9NA 3RAQA 4DWIA 1RQLA 2G0AA 7ICVA 2JH7A 4P2HA 5D49A 5ALFA 3ICXA 3IRUA 5HP4A 2KZZA 2R8GA 5H2FU 4BGDA 2I6XA 3VCBA 4MHVA 5HR7A 2LMRA 2ISOA 1D8BA 5KG1A 5HHIA 4B9MA 4F5RA 1IG6A 1ECWA 5CRXA 3QUCA 1HJPA 5ALRA 4MFAA 3EPGA 2QB0B 3F2DA 5AI8A 1L3VA 4RQ8A 4M47A 2AGPA 7ICTA 1MSWD 3KZXA 7ICIA 4GLXA 1WG8A 3TADA 1F0MA 4KLIA 4DSIA 5ALYA 4C4RA 1B22A 3EYZA 1K5OA 1IV8A 5KFEA 4RQ0A 1Q3VA 2AJQA 2ZTDA 2VA2A 5J2JA 3EWAA 1Y88A 7ICMA 3NRZA 2VA3A 3ONNA 2OEHA 2YN4A 3NRWA 1RXWA 2ATLA 4RPYA 2MA1A 3GILA 4ED0A 5IIKA 2FMSA 2UVUA 1KN5A 2KSOA 2XO7A 3WKAA 3MR2A 4JWMA 4Y2VA 1MC8A 4QZDA 2XGPA 3RJIA 1KTQA 3KKAC 4ICAA 1B0XA 3QU4A 3UXNA 4ECXA 4DF8A 4QIWC 2FE9A 4CF4A 4O3MA 4PZNA 3KHLA 1U49A 4Q43A 3RB3A 2JR5A 4JB3A 5G5GA 3LWMA 3ZDDA 1XO0A 1MA7A 7ICHA 2KJ5A 4Z6CA 3RJHA 1Z4NA 4DSEA 4NJ8A 1AROP 2K60A 8ICZA 4BXOB 4Q8FA 1C7YA 1XNSA 2HCFA 3GDXA 2OYYA 4Q8EA 2XY5A 4QZHA 4KLGA 5ALJA 1GO3F 3E58A 5J0OA 4US9A 1SXEA 1NK8A 1UCVA 4O3NA 1L3SA 3WU2U 5ALOA 3C28A 1Z00A 3MR6A 5ALLA 3WK6A 2R8HA
chains in the Genus database with same CATH topology
2HBLA 2K4HA 4AYBC 2PMZC 2VJ4A 4OJPA 3KZXA 1HIWA 2RP5A 2ZIWA 3C29A 1T94A 2E1FA 2KKVA 2OM6A 4U7CA 3D2NA 3M7DA 1F44A 1A6SA 2VJ5A 1Z1BA 2G09A 2KD1A 1ED1A 3SAFA 2K4EA 3ALRA 2WAQC 3IG8A 2H3QA 3L3FX 3PSFA 2H3IA 4U6PA 1OUQA 2VKQA 4P0QB 2K89A 2LYAA 2HOIA 4NLBA 3M6ZA 2RHFA 4FZNA 2DF4B 2ZIUB 2ZIXA 4CDGA 1Q3VA 3K1ZA 1IIPA 1SZHA 2G5HB 2WB1C 4NV0A 3RF9A 4P0PB 2CPRA 4OJ6A 2DGZA 2N1RA 2ZG6A 3AQEA 4FE3A 4PL2A 2K4IA 3N7SC 4WJ3B 2ZXHA 2LHTA 4AYBF 2G06A 2PMZF 2XICA 3E0FA 2LYBA 1TAMA 3N7PD 3O0FA 4FZMA 4P0QA 2LKYA 3H0MB 3H0RB 2BDUA 2R18A 3ONNA 3CP8A 4IC9A 2LBOA 5T14A 1YT3A 2KV2A 4NLCA 3NRWA 2OXOA 4P0PA 3HKZC 2G08A 3VC8A 2MA1A 2W7PA 3HKZF 2A3VA 3F5AA 1Q3UA 3RFAA 2DQNB 2W04A 3PSIA 4BJQA 3MGVA 3SAHA 4CRXA 2WB1F 1Z19A 4OJLA 3GZFA 3F5EA 3IG5A 4QNLA 2RRDA 3CYMA 3PSTA 3CRXA 2OH2A 3F2CA 2D6FC 2HBMA 2HBJA 3H0LB 3LVVA 3LVWA 3PSPA 4GFJA 1PVRA 4FZLA 4ICAA 1A0PA 2GOLA 2MRLA 4ACOA 2ZXIA 2F2AB 4OJ5A 4QIWF 5A0LA 2YB1A 2CN1A 4QIWC 4PL1A 5KL8B 2JH1A 2ZIUA 2VIXA 2Y0SF 4C0ZA 4O3MA 2Y0SC 2KJ9A 1PVQA 2CRXA 2KHVA 3NUQA 2G5IB 3IN5A 1P7DA 2JHDA 3KFUF 3LYSA 4A8EA 3T79A 2G0AA 4BUGA 2K8BB 3AL0B 2HOQA 2JMGA 2KICA 2KHQA 2KOBA 1XO0A 2JH7A 2ZIWB 2XVTA 4KMOB 1MA7A 5HR6A 2KJ5A 2YX8A 2F8LA 1WUDA 3ICXA 2H3VA 2KIWA 1URJA 4QJFB 2E1EA 5C0YA 2JGAA 2M0NA 3SMVA 2F76X 2HBKA 2Q4TA 3DEEA 3M6KA 2ZIXB 3F2BA 1XNSA 4OO1J 2OYYA 2G07A 3OPXA 4OJOA 4KX5A 4BX9C 1CRXA 3VCBA 1KBUA 5HR7A 2NV3A 2ZIVB 1D8BA 3SQIA 1GO3F 3GU3A 3SAGA 2E5SA 1ECWA 1DRGA 3IP4B 2W03A 1UPHA 3D2QA 3PZPA 2HOFA 2KKPA 2XI9A 4JMUA 5KL1B 5CRXA 2KNJA 4KX3A 4NWIA 2GH1A 3D2SA 2F77X 1L6NA 2WAQF 1HEKA 2HMXA 2H3ZA 3N7RC 2K8AA 2KVCA 1PVPA 2H3FA 1ZQ1C 2W7OA 3F2DA 2ZIVA 3C28A 2Z7JA 2YB4A 2K8CB 3F53A 2KEYA 1NZBA 3AQFA 2KJ8A 2XIDA 4CGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G5I B;  3H0M B;  2DF4 B;  3AL0 B;  4WJ3 B;  3H0R B;  3KFU F;  2DQN B;  3IP4 B;  2G5H B;  2F2A B;  2D6F C;  3H0L B;  1ZQ1 C; 
#chains in the Genus database with same CATH topology
 3QU7 A;  1U4B A;  2EAP A;  2YQE A;  1S8O A;  4UAT A;  2OM6 A;  4B6J A;  2BKE A;  4HAI A;  2G09 A;  3SAF A;  1ZD4 A;  3ALR A;  3NAS A;  4PJ0 U;  1EXN A;  5L9X A;  1TK5 A;  1ZQG A;  5DBB A;  5HNK A;  9ICK A;  2R8I A;  1XSN A;  3HP6 A;  4QZC A;  4US8 A;  2DGZ A;  5KFR A;  4FE3 A;  4NM1 A;  4PL2 A;  5CEH A;  4UB2 A;  4ELV A;  4F8R A;  2KFZ A;  2BR0 A;  3ZDC A;  2BCU A;  4P0Q A;  3PW0 A;  3I28 A;  3K1R B;  3H0R B;  4I2F A;  5KT6 A;  5KAI U;  2OXO A;  2XY6 A;  2I9G A;  4KLH A;  1JIH A;  1RYR A;  2VAN A;  3SAH A;  4CRX A;  2RRD A;  1X42 A;  4GFJ A;  2ZJ8 A;  1FIQ A;  2YB1 A;  1NK5 A;  1S0N A;  3N97 B;  4J03 A;  4QZ8 A;  2ALZ A;  3NUQ A;  1PZN A;  3H4D A;  3QU5 A;  1X9W A;  1P7D A;  1NK0 A;  1MQ2 A;  2K8B B;  8ICA A;  5AK6 A;  2PFN A;  2V9W A;  8ICI A;  1T8E A;  4KLQ A;  4YMM A;  2H3V A;  3M9O B;  4YQW A;  2ZTE A;  2J6U A;  1FEZ A;  9ICG A;  4NL9 A;  3PV8 A;  4I2B A;  4RUC A;  2H5X A;  4KLD A;  1Q8K A;  3SAG A;  5TIS U;  3E2E A;  5KL1 B;  1LV5 A;  2DWQ A;  2H3Z A;  4F72 A;  2ZJA A;  2EAN A;  9ICN A;  3C23 A;  4TQS A;  3RBE A;  2K8C B;  3Q8L A;  5DLG A;  3WKC A;  2PI4 A;  1BNP A;  4ZH4 A;  1T94 A;  2MSN A;  5DGB A;  3D2N A;  2VJ5 A;  3JPO A;  4I2J A;  4ECR A;  4I2C A;  3TFR A;  3L3F X;  5KFG A;  2E8P A;  2WF8 A;  2HOI A;  2IHM A;  3TAC B;  3EPI A;  2P35 A;  8ICH A;  2WB1 C;  5IIL A;  4G3I A;  5J2G A;  4JWN A;  3DV9 A;  8ICF A;  4FZM A;  4DQP A;  5AK5 A;  3H4B A;  3AN1 A;  1SL2 A;  5BOL A;  4IRC A;  3T5J A;  4P0P A;  2EAO A;  2IMW P;  8ICL A;  5CR0 A;  2V4Q A;  3PNC A;  2W7P A;  2A3V A;  4K4G A;  1S9F A;  4DFP A;  3QUT A;  3H8J A;  1VJ5 A;  1KFD A;  3H0L B;  5AI4 A;  4CNQ A;  2YTU A;  3IM1 A;  5AM0 A;  5KG4 A;  1L7N A;  2FJ6 A;  5EE3 A;  7ICK A;  4NL9 C;  4F50 A;  2CXY A;  2C28 A;  2Y1I A;  1U48 A;  5AM3 A;  5AI5 A;  4A8E A;  4R65 A;  3GIK A;  1L7O A;  3M9N B;  3WK4 A;  9ICO A;  2OHF A;  3RJJ A;  4DL2 A;  5EOZ A;  1ZQM A;  3RAX A;  3AMZ A;  1NI3 A;  4DOC A;  3GV5 B;  1CRX A;  1KBU A;  2NV3 A;  1SGG A;  5KFH A;  2ZIV B;  4ZOH C;  3Q8M A;  4P4M A;  1L6N A;  5J29 A;  2WAQ F;  2BCR A;  1DK3 A;  4MEY A;  4F5O A;  2WF7 A;  4I2G A;  1ZQ1 C;  1ZQK A;  7ICS A;  2FPK A;  3HJE A;  2LPE A;  5DB8 A;  3C2L A;  4PGQ A;  3F53 A;  4F4W A;  2XID A;  5AM2 A;  2A1J A;  2WF9 A;  2BPF A;  4Q45 A;  2KD1 A;  3SD7 A;  3ED5 A;  5J2D A;  2JZB B;  3PMN A;  1D8Y A;  3N4M B;  3V6H A;  3MR3 A;  2K4I A;  2PXI A;  3C1Z A;  1PK1 B;  9ICR A;  5T14 A;  2HHT A;  3AUO A;  4EEL A;  4DQS A;  5J0R A;  3BS5 B;  3C21 A;  2YMQ A;  4UB6 U;  3PX6 A;  2WF6 A;  3KHH A;  4J9S A;  5EWG A;  5AM4 A;  4NLN A;  3BZC A;  3BDP A;  4UAU A;  3QX7 A;  2NRT A;  4LZD A;  4RU9 A;  5AHX A;  1ZQV A;  4BDP A;  4ACO A;  1L7M A;  5A0L A;  4TQR A;  3PX4 A;  5AKX A;  4O5K A;  3Q8Q B;  5ALZ A;  3HIL A;  1TAU A;  2EZZ A;  1L3U A;  2QLT A;  3RJE A;  2KG5 A;  1VDV A;  1ZET A;  4QWE A;  4DLE A;  2YX8 A;  3V7K A;  1NKB A;  1QCK A;  4UB8 U;  5K4L A;  3RBD A;  3OJS A;  4QWB A;  3SMV A;  5L1K A;  2Q4T A;  2EQY A;  4OO1 J;  3KHR A;  4ECT A;  1LB2 B;  1ZQO A;  3BJY A;  4I28 A;  3BQ0 A;  3BQ2 A;  1NK9 A;  2W03 A;  2AGO A;  8ICG A;  2JXJ A;  4IQW A;  1KFT A;  3FC4 A;  4OD0 A;  2JEF A;  8ICM A;  4MEX A;  4CF5 A;  5E79 U;  4M9N A;  4P4P A;  2AQ0 A;  3IG8 A;  5J0W A;  2H3I A;  4XQ8 A;  1X66 A;  3RJK A;  3QUB A;  7ICO A;  4CDG A;  2G5H B;  5L1I A;  4UAY A;  4NM2 A;  1SWW A;  2W9B A;  1SV4 A;  9ICX A;  3TAN A;  2ZXH A;  4AYB F;  4TUS A;  2I5H A;  3QEB Z;  2UVV A;  4MF2 A;  1QH9 A;  1FO4 A;  1SWV A;  3MR5 A;  3Q8K A;  4JK1 A;  3NVV A;  1BGX T;  4ECQ A;  4O3P A;  3HKZ C;  5KG5 A;  4F4Y A;  4M9H A;  1BPZ A;  5JRT A;  4B9L A;  1UQV A;  8ICW A;  4Z6D A;  3HX0 A;  2HI0 A;  3OSN A;  4FZL A;  3PX0 A;  2FLL A;  4OJ5 A;  5EWE A;  2W9M A;  2CN1 A;  9ICJ A;  4F4X A;  4KMU A;  4M04 A;  5AI0 A;  2KJ9 A;  4RQ5 A;  3ZDE A;  4Z6E A;  1S97 A;  2EAM A;  4YXJ A;  1BNO A;  2NRX A;  2F8K A;  4NLZ A;  5ALT A;  2UVW A;  9ICB A;  5ALG A;  4RPZ A;  1D9F A;  2HHS A;  1WUD A;  2KIW A;  3C5G A;  1HUO A;  1X40 A;  7ICR A;  2FI1 A;  3Q8P B;  4RNN A;  3T5K A;  3DEE A;  5ALV A;  4EEY A;  4OJO A;  4ECZ A;  4PGY A;  3BQT A;  5KNI A;  1DRG A;  3SR6 A;  3AU6 A;  3PW7 A;  2KKP A;  2AQ4 A;  4KX3 A;  5HML A;  1RXV A;  1JXL A;  4IR9 A;  9ICC A;  1ZQE A;  5DB6 A;  1XU4 A;  2ASL A;  1XO1 A;  4ED2 A;  4UQG A;  4K4I A;  2HDO A;  8ICK A;  1LKY A;  4NLG A;  4UAS A;  1XC9 A;  2JZB A;  2K4H A;  3QU9 A;  3RR8 A;  5J0T A;  4O5C A;  2KKV A;  3GFK B;  1BPX A;  3V7J A;  4IQU A;  3U26 A;  3M6Z A;  2Y1J A;  1ZD2 P;  3MDC A;  1N60 A;  3LWL A;  3EW9 A;  5J2H A;  4XA5 A;  3JPQ A;  4DL7 A;  3MFH A;  1NK7 A;  2LYB A;  4KLT A;  3TAQ A;  9ICP A;  2R18 A;  2BDP A;  1X9S A;  1ZQU A;  3B9J A;  4BJQ A;  4UAZ A;  5DG8 A;  5EE1 A;  3KD3 A;  5CJ7 A;  4O3S A;  1MQ3 A;  2HBJ A;  5J2A A;  2MUT A;  1B4F A;  1A0P A;  3A0H U;  2KVS A;  3NVY A;  1NJX A;  4PL1 A;  2JH1 A;  4HYK A;  5ALM A;  5KT3 A;  4DFD A;  4EBD A;  2CRX A;  5B5E U;  5KFF A;  5L1J A;  8ICN A;  3ORY A;  2XY7 A;  3J81 j;  1KFS A;  2KIC A;  1ZQT A;  1QLN A;  1N5X A;  2F8L A;  5KFQ A;  2EDU A;  2HBK A;  2DKZ A;  1L8L A;  2KMD A;  4UBC A;  2NRZ A;  2QKQ A;  2W3R A;  1CUK A;  1O03 A;  1UPH A;  4CE6 A;  2E3T A;  2ESE A;  4R8U A;  5IIM A;  4J9O A;  4ED6 A;  4DQI A;  4EBE A;  2KEY A;  3H8S A;  4UB5 A;  4FBT A;  7ICP A;  5DG9 A;  1F5S A;  3V7L A;  4TUP A;  2EZX A;  5CB1 A;  1F44 A;  4LJX A;  3L4P A;  1BPE A;  5FP0 A;  5DKW A;  2JRZ A;  3QEA Z;  3V6K A;  1N62 A;  5L1L A;  4XUS A;  3PO4 A;  4NLB A;  5KFY A;  1PUZ A;  4QW9 A;  3OSP A;  4PZO A;  1BPB A;  2DUY A;  2XIC A;  3RB0 A;  1SB3 C;  4IC9 A;  5KG7 A;  4IR1 A;  4EX6 A;  3I76 A;  4ED8 A;  4KLL A;  4M6W A;  3F5E A;  3ZD9 A;  4KLS A;  2DL0 A;  4YFK A;  2GO7 A;  4BWJ A;  1SV0 A;  1ZXI A;  9ICL A;  2NO4 A;  3V6J A;  4M6W B;  3B0Y A;  4UAW A;  4C0Z A;  1ZQN A;  1S10 A;  1PVQ A;  5F9L A;  4YR3 A;  3RJF A;  2ODG A;  4DFJ A;  3RJG A;  3IN5 A;  5KT2 A;  4UB4 A;  3LYS A;  4Y2T A;  3T79 A;  1DGJ A;  3HW8 A;  4Y2S A;  4O5E A;  3AL0 B;  2KFN A;  3WK9 A;  3V72 A;  4RUA A;  1HUZ A;  4KLF A;  8ICQ A;  1RG6 A;  3M6K A;  2ZIX B;  4BX9 C;  1T3Q A;  4RQ3 A;  4EZ6 A;  3GIM A;  2QB1 A;  3SQI A;  1RYS A;  4GXI A;  2XI9 A;  2E8O A;  4DLG A;  3QNM A;  4F71 A;  2K8A A;  1V97 A;  1SXD A;  2EZY A;  4FFD A;  4Y2Q A;  4C8M A;  1NZB A;  5CP2 A;  2JEI A;  5KFB A;  4OJP A;  1L5U A;  1SKS A;  3MFI A;  4YXM A;  2XC9 A;  2YMM A;  1KQQ A;  4DEZ A;  4CCH A;  5AKI A;  2ZIU B;  3LDA A;  3RRG A;  1SKR A;  1SKW A;  4OJ6 A;  2FPL A;  5DBC A;  2NRW A;  3Q8S B;  4NY8 A;  4YVZ A;  4R8U B;  4DFM A;  5CA7 A;  8ICE A;  4DFK A;  2LBO A;  4KN4 A;  2MUT B;  5KFM A;  3HKZ F;  7ICJ A;  4EYI B;  4YR0 A;  3QUQ A;  4QZB A;  4MFF A;  5C5J A;  4ELU A;  1ZQC A;  8ICB A;  2HBM A;  1Q46 A;  2XGQ A;  4UBB A;  8ICR A;  4FO6 A;  2ZXI A;  2F2A B;  3RB4 A;  4RQM A;  3AM9 A;  1N63 A;  4I2E A;  3M8S A;  3SV3 A;  2KHV A;  1QSL A;  2XCP A;  4QZA A;  1LKY B;  3TKA A;  4DCC A;  1BVS A;  4RZR A;  2DPJ A;  2DPI A;  2ZIW B;  1KRP A;  2FMQ A;  4USA A;  4DOB A;  2ES6 A;  5DQH A;  3PY8 A;  3GQC A;  4QJF B;  5ALI A;  4YD2 A;  2HW3 A;  2ASD A;  1D8L A;  1TAQ A;  4KX5 A;  4F4Z A;  4PPX A;  2E5S A;  5ALX A;  4RQ1 A;  3NVZ A;  1SZP A;  4JUZ A;  4ED3 A;  3H8M A;  1NK6 A;  4YMO A;  3N7R C;  5J8Y A;  4UB3 A;  5ALP A;  2F1I A;  5AK3 A;  3IHQ B;  1NNL A;  2DKX A;  3BS5 A;  1X9M A;  7ICF A;  3NTU A;  3WKE A;  2HSZ A;  2K4P A;  5DDM A;  2KP7 A;  5KFV A;  4AYB C;  2XCA A;  2P66 A;  2QAR B;  2VJ4 A;  1ZQH A;  3C29 A;  3QZ7 A;  4F93 B;  1A6S A;  4DL4 A;  2FPM A;  1TV9 A;  3M9M B;  3PVX A;  5ALS A;  2DF4 B;  3K1Z A;  4P0P B;  4QZI A;  5ALN A;  5D46 A;  3IDW A;  1ZQQ A;  3AQE A;  1UT5 A;  1WWV A;  3E0F A;  3C5F A;  3UPQ A;  3KFU F;  4IRD A;  1YT3 A;  5IIJ A;  3RH6 A;  2W9B B;  3RB6 A;  3RFA A;  3MGV A;  4TUQ A;  4IQV A;  3HWT A;  1BPY A;  1ZD5 A;  2WFA A;  1XS9 D;  4M9J A;  3PSP A;  3LVV A;  3UQ0 A;  1CEZ A;  1ZQJ A;  3PR4 A;  4NXZ A;  1X6I A;  3ZDB A;  5KFS A;  3UMB A;  1ZYQ A;  3EZ5 A;  1JUD A;  5AM5 A;  1D9D A;  2F1H A;  5L1M A;  3WK5 A;  2OCE A;  2KOB A;  2YMP A;  1COK A;  4QZE A;  3KHG A;  2UVR A;  4RNO A;  3SEI A;  3OHB A;  3ISD A;  1TE2 A;  1S0M A;  3S6J A;  1K1Q A;  3OPX A;  3KTQ A;  1ZQA A;  3UXO A;  4DS4 A;  3TI0 A;  4M9G A;  3AEV A;  3T5L A;  5DLF A;  1ZQB A;  2D3D A;  2EH9 A;  1JRO A;  3BS7 A;  2ZUD A;  5J2C A;  2IHN A;  2GH1 A;  1HEK A;  3MGH A;  1PVP A;  2Y9T A;  3WKD A;  2Z7J A;  1T3N A;  1XWL A;  4CGZ A;  2O6K A;  1Z4O A;  2HBL A;  3ETL A;  4I27 A;  4CF3 A;  1J97 A;  3FM9 A;  3C1Y A;  5KFJ A;  2MU2 A;  5KFX A;  2H3Q A;  1IM4 A;  1Z1V A;  1N61 A;  2RHF A;  2BCV A;  4MF8 A;  3AU2 A;  3T5H A;  3TFS A;  1UHU A;  1ZQW A;  3BZK A;  3RTV A;  1SV0 C;  2BPG A;  1S5L U;  4UW9 A;  4IRK A;  3N7P D;  4UAR A;  3CP8 A;  2RQ5 A;  3F5A A;  1S0V A;  2BZF A;  4LZG A;  3C2M A;  2IOF A;  5ALQ A;  1XSP A;  2HHX A;  1TFR A;  3RRH A;  4BXO A;  3IG5 A;  5J0Q A;  3CRX A;  5AI9 A;  1YZ7 A;  2NYV A;  3C2K A;  3HRD D;  1JI7 A;  1L3T A;  3JPT A;  2RDJ A;  1KL9 A;  2YY6 A;  2IOF K;  1T4G A;  1ZQZ A;  4Y2P A;  3KOO A;  4KTQ A;  3FDS A;  3TAD C;  2NRV A;  1A76 A;  3NGD A;  2HOQ A;  5EE0 A;  4J9K A;  4ECW A;  4KMO B;  3UQ2 A;  4J9N A;  3WK7 A;  4F5Q A;  1QQ5 A;  3ZDA A;  4LVS A;  3GV8 B;  4JV2 A;  4KLM A;  2KSO B;  1BPD A;  2W9C A;  4PHA A;  4RQN A;  3Q8R B;  4NLK A;  2VA8 A;  4Y2J A;  1ZQD A;  4EEN A;  5AIB A;  3SEN A;  3GII A;  1NK4 A;  1RQN A;  2LM4 A;  2F3N A;  5KFN A;  1DK2 A;  7ICG A;  1N5W A;  3H7I A;  5IIO A;  1ZQR A;  8ICJ A;  1WCN A;  4KN7 A;  1ZRM A;  2KTQ A;  5JU5 A;  3AQF A;  2R8K A;  2PMZ C;  1DXS A;  2QB0 A;  5KFL A;  5J2I A;  3CW2 C;  1Z1B A;  4J9M A;  3PSF A;  1DOQ A;  2AXT U;  1OUQ A;  1FFU A;  8ICP A;  1N48 A;  4C8O A;  2AHO B;  2ZIX A;  4NV0 A;  4C7Y A;  4G9B A;  3PW2 A;  3N7S C;  4YN4 A;  3PML A;  3RR7 A;  2RDI A;  3SI8 A;  1TAM A;  3M1Y A;  4B9N A;  2BDU A;  2NO5 A;  3SV4 A;  4F3O A;  4ED1 A;  1Q3U A;  2DQN B;  3LK9 A;  1Z19 A;  2KE7 A;  4KLJ A;  3JPP A;  2Q0Z X;  1PK3 A;  4F5P A;  4QZF A;  3TAR A;  5AKE A;  3UMC A;  1RM6 C;  4EBC A;  5HMM A;  2L5Y A;  1TKD A;  2WF5 A;  5J2E A;  5J0U A;  2G5I B;  2W9A A;  2BCQ A;  1S76 D;  9ICM A;  5BPC A;  4Q44 A;  4BUG A;  5AI6 A;  1JX4 A;  2XVT A;  1COO A;  2E8M A;  3G6V A;  2B21 A;  2E1E A;  4C4T A;  2Y9U A;  3OGU A;  2F76 X;  4IL6 U;  4C8L A;  4B9V A;  9ICT A;  4ECV A;  9ICQ A;  1RYU A;  4JV0 A;  3D2Q A;  3PW4 A;  2KNJ A;  4NWI A;  3D2S A;  4F91 B;  2FLN A;  1KSP A;  5KG6 A;  1SL0 A;  4KLU A;  2LM1 A;  2BQ3 A;  4EEK A;  2HHU A;  4C80 A;  1X6J A;  2RLT A;  1AQ6 A;  2E1F A;  4YP3 A;  4F5N A;  1NJZ A;  5J0P A;  9ICU A;  1N56 A;  4DL5 A;  4O3O A;  3G6X A;  4U6P A;  4F4K A;  5J8Y C;  1IXR A;  3QZ8 A;  4WJ3 B;  2LHT A;  4R63 A;  5BOM A;  4DQQ A;  1X9X A;  2KN7 A;  1T7P A;  4EZ9 A;  3WK8 A;  1JN3 A;  2B0C A;  2ZUB A;  3RH5 A;  1KEJ A;  2J6T A;  5KG3 A;  5GTH U;  4QNL A;  4R66 A;  5KFU A;  2OH2 A;  3WKB A;  5J2K A;  5AKH A;  5JTI A;  2GOL A;  1S77 D;  2MRL A;  4M0A A;  3IV6 A;  3KZI U;  4FS1 A;  8ICY A;  4C8N A;  3OTQ A;  5DB7 A;  2Y0S F;  5KFI A;  2BHN A;  2HHQ A;  2DFL A;  9ICH A;  5CHG A;  3EUB 2;  3B0X A;  1K1S A;  1XSL A;  4C7Z A;  2C2R A;  2JMG A;  2GLE A;  1LVH A;  1JXE A;  3MBY A;  4J9P A;  2AU0 A;  4O0I A;  1RPL A;  4P4O A;  4I2D A;  4RT2 A;  3OHA A;  1S0O A;  4I2H A;  4RNM A;  2JGA A;  1L8O A;  2M9N A;  2ZUC A;  3RH4 A;  4GC6 A;  4F2S A;  2BCS A;  1QQ6 A;  1RDF A;  5GTI U;  5ALU A;  4PHP A;  2BQU A;  4JMU A;  3PO5 A;  3FYH A;  3L5K A;  9ICI A;  4B9T A;  4RPX A;  3MGI A;  4QZG A;  4M2Y A;  1V9P A;  4DF4 A;  9ICW A;  3KBB A;  2YB4 A;  2ZTC A;  1U45 A;  1QSS A;  2RP5 A;  3JPR A;  1B43 A;  3M7D A;  2AGQ A;  5ALW A;  4OCZ A;  2K4E A;  2C2D A;  5KAF U;  1H38 A;  5KFP A;  1NZP A;  3RF9 A;  2CPR A;  4X5V A;  9ICE A;  4RQ4 A;  4BWM A;  7ICL A;  5DDY A;  3QYP A;  4QWD A;  5IIN A;  2ISP A;  2A1A A;  2YML A;  1WWU A;  4Z6F A;  9ICV A;  3JPS A;  4RT3 A;  4GIB A;  2W11 A;  5AKY A;  4R64 A;  1RZT A;  4FBU A;  3F2C A;  5DG7 A;  2V4R A;  3HT3 A;  4EX7 A;  3QXG A;  3SZ2 A;  9ICS A;  3PR5 B;  7ICN A;  4KLO A;  2ZIU A;  4O9M A;  1QSY A;  4PGX A;  1M6Y A;  2D8C A;  3NVW A;  1VLB A;  2JHD A;  5KFW A;  1ZQL A;  4YCX A;  2W8K A;  1WCL A;  3MC1 A;  5EWF A;  1PK1 A;  2FLP A;  5KG2 A;  3QU2 A;  4IQT A;  4I29 A;  2E8N A;  5C0Y A;  4UB1 A;  4DSJ A;  3GV7 B;  4MFC A;  8ICT A;  3F2B A;  3DDH A;  5J2B A;  2IOH A;  3TAP A;  4PHD A;  2HOF A;  2LI6 A;  5J2F A;  2JEG A;  1KLN A;  3CNH A;  2F77 X;  3MDA A;  2KVC A;  3JPN A;  1ZQF A;  4KIT B;  2W7O A;  2JEJ A;  9ICF A;  1JRP A;  5III A;  5AIA A;  4M9L A;  2B6G A;  4Y2U A;  1U47 A;  4YMN A;  5ALE A;  4I2I A;  7ICQ A;  1ED1 A;  5KT4 A;  3PW5 A;  1ZQS A;  5HHH A;  2C22 A;  4P0Q B;  5TZV A;  8ICU A;  2LYA A;  5CWR A;  2W3S A;  1NJY A;  1IIP A;  1SZH A;  1V85 A;  2A1J B;  2W9C B;  4K4H A;  2KZ3 A;  3I1Y A;  8ICC A;  1Z3E B;  2JV3 A;  1KW4 A;  5KFO A;  4ECS A;  4E0D A;  4DS5 A;  2PMZ F;  3H40 A;  2C2E A;  3O0F A;  4O3Q A;  4QZ9 A;  1ZD3 A;  4KLE A;  1ZQX A;  2W8L A;  5AKZ A;  4DQR A;  4NLC A;  4XRH A;  5DQI A;  2KK0 A;  4J9R A;  1U9L A;  1NJW A;  1DGS A;  3PST A;  3THV A;  2D6F C;  1MN8 A;  3LVW A;  5AIC A;  1ZJN A;  2HVH A;  4FS2 A;  4TUR A;  1YZ6 A;  4QIW F;  4GXJ A;  2MAX A;  2PFQ A;  5KFK A;  2FDR A;  1FFV A;  5KG0 A;  3K75 D;  8ICX A;  5AK4 A;  4DSK A;  4F2R A;  4I2A A;  4JV1 A;  1C20 A;  3T3F A;  2KHQ A;  1ZQP A;  3ETR A;  3G6Y A;  1NKE A;  2KIV A;  1URJ A;  1QTM A;  4B9S A;  2M0N A;  4C8K A;  4C4S A;  4DSF A;  1J2M A;  3K4G A;  4YR2 A;  4QWC A;  4ECY A;  2BGW A;  3GU3 A;  3OJU A;  2IA6 A;  2BPC A;  2ZJ5 A;  1UA0 A;  2DBY A;  2P6R A;  2HMX A;  4QW8 A;  2H3F A;  2HHW A;  2PKE A;  3KKA A;  3D6J A;  4DL6 A;  1O08 A;  2KJ8 A;  2BQR A;  3FAH A;  5DB9 A;  4RQ2 A;  3HPO A;  5ALH A;  1HIW A;  1WYG A;  2P6U A;  5AKL A;  2PFO A;  4U7C A;  1SL1 A;  2ASJ A;  1OW5 A;  1JAL A;  3BQ7 A;  3BQ1 A;  5ALD A;  2K89 A;  5KTQ A;  4FZN A;  2HHV A;  5KFA A;  4IS7 A;  2N1R A;  2ZG6 A;  4DL3 A;  2G06 A;  2FMP A;  2KZM A;  2LKY A;  4GC7 A;  3UMG A;  5KFD A;  2KV2 A;  1UT8 A;  3VC8 A;  5DBA A;  2WTF A;  4J9L A;  3PSI A;  2WHE A;  1A77 A;  3ISB A;  8ICS A;  1ZRN A;  2WB1 F;  5D4B A;  3GZF A;  3N28 A;  3CYM A;  3R9K A;  3ISC A;  5ALK A;  2A19 A;  4Y2X A;  3NS1 A;  5EE9 A;  7ICE A;  7ICU A;  5KT7 A;  3A0B U;  5AM1 A;  2IBK A;  1TVA A;  2GWS A;  2J6S A;  2VIX A;  2Y0S C;  1QQ7 A;  4PH5 A;  5JUM A;  4J9Q A;  1KDH A;  1X2I A;  3UM9 A;  2F1J A;  1KKX A;  4ECU A;  2QAR A;  9ICA A;  4Y2Y A;  5AKK A;  5HR6 A;  5KT5 A;  2R8J A;  2F44 A;  3GIJ A;  1ZOL A;  4O3R A;  2G07 A;  1SIJ A;  8ICV A;  2AH5 A;  4EYH B;  1TK0 A;  1JMS A;  8ICO A;  3QE9 Y;  1TK8 A;  3IP4 B;  3PZP A;  2LYH A;  5KFC A;  4YG2 A;  3UXP A;  1V38 A;  2ZIV A;  2HVI A;  3ZD8 A;  5KFT A;  5G5H A;  2ZIW A;  2W43 A;  4ED7 A;  4DSL A;  3MAB A;  5J0Y A;  1N2X A;  1UA1 A;  2WAQ C;  4AP9 A;  4DOA A;  2W54 A;  4PHE A;  2VKQ A;  2OWO A;  4QWA A;  3M8R A;  2PI5 A;  1ZQI A;  2W55 A;  3TQ1 A;  5F3X B;  5B66 U;  5DQG A;  4Y2R A;  4B9U A;  2PFP A;  3H0M B;  5AKJ A;  4GXK A;  1CI4 A;  5KFZ A;  3H8W A;  2G08 A;  1ZJM A;  2I1Q A;  1NOM A;  5J0X A;  2W04 A;  1J2N A;  4YD1 A;  1ZQY A;  5AKG A;  4RQ7 A;  1NKC A;  4OJL A;  5J0S A;  4DO9 A;  1L7P A;  4F92 B;  1PVR A;  1OXJ A;  3SYZ A;  4ELT A;  5KL8 B;  5DGA A;  4RQ6 A;  4UAV A;  3ZI4 A;  1Z00 B;  5F9N A;  3RAQ A;  4DWI A;  1RQL A;  2G0A A;  7ICV A;  2JH7 A;  4P2H A;  5D49 A;  5ALF A;  3ICX A;  3IRU A;  5HP4 A;  2KZZ A;  2R8G A;  5H2F U;  4BGD A;  2I6X A;  3VCB A;  4MHV A;  5HR7 A;  2LMR A;  2ISO A;  1D8B A;  5KG1 A;  5HHI A;  4B9M A;  4F5R A;  1IG6 A;  1ECW A;  5CRX A;  3QUC A;  1HJP A;  5ALR A;  4MFA A;  3EPG A;  2QB0 B;  3F2D A;  5AI8 A;  1L3V A;  4RQ8 A;  4M47 A;  2AGP A;  7ICT A;  1MSW D;  3KZX A;  7ICI A;  4GLX A;  1WG8 A;  3TAD A;  1F0M A;  4KLI A;  4DSI A;  5ALY A;  4C4R A;  1B22 A;  3EYZ A;  1K5O A;  1IV8 A;  5KFE A;  4RQ0 A;  1Q3V A;  2AJQ A;  2ZTD A;  2VA2 A;  5J2J A;  3EWA A;  1Y88 A;  7ICM A;  3NRZ A;  2VA3 A;  3ONN A;  2OEH A;  2YN4 A;  3NRW A;  1RXW A;  2ATL A;  4RPY A;  2MA1 A;  3GIL A;  4ED0 A;  5IIK A;  2FMS A;  2UVU A;  1KN5 A;  2KSO A;  2XO7 A;  3WKA A;  3MR2 A;  4JWM A;  4Y2V A;  1MC8 A;  4QZD A;  2XGP A;  3RJI A;  1KTQ A;  3KKA C;  4ICA A;  1B0X A;  3QU4 A;  3UXN A;  4ECX A;  4DF8 A;  4QIW C;  2FE9 A;  4CF4 A;  4O3M A;  4PZN A;  3KHL A;  1U49 A;  4Q43 A;  3RB3 A;  2JR5 A;  4JB3 A;  5G5G A;  3LWM A;  3ZDD A;  1XO0 A;  1MA7 A;  7ICH A;  2KJ5 A;  4Z6C A;  3RJH A;  1Z4N A;  4DSE A;  4NJ8 A;  1ARO P;  2K60 A;  8ICZ A;  4BXO B;  4Q8F A;  1C7Y A;  1XNS A;  2HCF A;  3GDX A;  2OYY A;  4Q8E A;  2XY5 A;  4QZH A;  4KLG A;  5ALJ A;  1GO3 F;  3E58 A;  5J0O A;  4US9 A;  1SXE A;  1NK8 A;  1UCV A;  4O3N A;  1L3S A;  3WU2 U;  5ALO A;  3C28 A;  1Z00 A;  3MR6 A;  5ALL A;  3WK6 A;  2R8H A; 
#chains in the Genus database with same CATH homology
 2HBL A;  2K4H A;  4AYB C;  2PMZ C;  2VJ4 A;  4OJP A;  3KZX A;  1HIW A;  2RP5 A;  2ZIW A;  3C29 A;  1T94 A;  2E1F A;  2KKV A;  2OM6 A;  4U7C A;  3D2N A;  3M7D A;  1F44 A;  1A6S A;  2VJ5 A;  1Z1B A;  2G09 A;  2KD1 A;  1ED1 A;  3SAF A;  2K4E A;  3ALR A;  2WAQ C;  3IG8 A;  2H3Q A;  3L3F X;  3PSF A;  2H3I A;  4U6P A;  1OUQ A;  2VKQ A;  4P0Q B;  2K89 A;  2LYA A;  2HOI A;  4NLB A;  3M6Z A;  2RHF A;  4FZN A;  2DF4 B;  2ZIU B;  2ZIX A;  4CDG A;  1Q3V A;  3K1Z A;  1IIP A;  1SZH A;  2G5H B;  2WB1 C;  4NV0 A;  3RF9 A;  4P0P B;  2CPR A;  4OJ6 A;  2DGZ A;  2N1R A;  2ZG6 A;  3AQE A;  4FE3 A;  4PL2 A;  2K4I A;  3N7S C;  4WJ3 B;  2ZXH A;  2LHT A;  4AYB F;  2G06 A;  2PMZ F;  2XIC A;  3E0F A;  2LYB A;  1TAM A;  3N7P D;  3O0F A;  4FZM A;  4P0Q A;  2LKY A;  3H0M B;  3H0R B;  2BDU A;  2R18 A;  3ONN A;  3CP8 A;  4IC9 A;  2LBO A;  5T14 A;  1YT3 A;  2KV2 A;  4NLC A;  3NRW A;  2OXO A;  4P0P A;  3HKZ C;  2G08 A;  3VC8 A;  2MA1 A;  2W7P A;  3HKZ F;  2A3V A;  3F5A A;  1Q3U A;  3RFA A;  2DQN B;  2W04 A;  3PSI A;  4BJQ A;  3MGV A;  3SAH A;  4CRX A;  2WB1 F;  1Z19 A;  4OJL A;  3GZF A;  3F5E A;  3IG5 A;  4QNL A;  2RRD A;  3CYM A;  3PST A;  3CRX A;  2OH2 A;  3F2C A;  2D6F C;  2HBM A;  2HBJ A;  3H0L B;  3LVV A;  3LVW A;  3PSP A;  4GFJ A;  1PVR A;  4FZL A;  4ICA A;  1A0P A;  2GOL A;  2MRL A;  4ACO A;  2ZXI A;  2F2A B;  4OJ5 A;  4QIW F;  5A0L A;  2YB1 A;  2CN1 A;  4QIW C;  4PL1 A;  5KL8 B;  2JH1 A;  2ZIU A;  2VIX A;  2Y0S F;  4C0Z A;  4O3M A;  2Y0S C;  2KJ9 A;  1PVQ A;  2CRX A;  2KHV A;  3NUQ A;  2G5I B;  3IN5 A;  1P7D A;  2JHD A;  3KFU F;  3LYS A;  4A8E A;  3T79 A;  2G0A A;  4BUG A;  2K8B B;  3AL0 B;  2HOQ A;  2JMG A;  2KIC A;  2KHQ A;  2KOB A;  1XO0 A;  2JH7 A;  2ZIW B;  2XVT A;  4KMO B;  1MA7 A;  5HR6 A;  2KJ5 A;  2YX8 A;  2F8L A;  1WUD A;  3ICX A;  2H3V A;  2KIW A;  1URJ A;  4QJF B;  2E1E A;  5C0Y A;  2JGA A;  2M0N A;  3SMV A;  2F76 X;  2HBK A;  2Q4T A;  3DEE A;  3M6K A;  2ZIX B;  3F2B A;  1XNS A;  4OO1 J;  2OYY A;  2G07 A;  3OPX A;  4OJO A;  4KX5 A;  4BX9 C;  1CRX A;  3VCB A;  1KBU A;  5HR7 A;  2NV3 A;  2ZIV B;  1D8B A;  3SQI A;  1GO3 F;  3GU3 A;  3SAG A;  2E5S A;  1ECW A;  1DRG A;  3IP4 B;  2W03 A;  1UPH A;  3D2Q A;  3PZP A;  2HOF A;  2KKP A;  2XI9 A;  4JMU A;  5KL1 B;  5CRX A;  2KNJ A;  4KX3 A;  4NWI A;  2GH1 A;  3D2S A;  2F77 X;  1L6N A;  2WAQ F;  1HEK A;  2HMX A;  2H3Z A;  3N7R C;  2K8A A;  2KVC A;  1PVP A;  2H3F A;  1ZQ1 C;  2W7O A;  3F2D A;  2ZIV A;  3C28 A;  2Z7J A;  2YB4 A;  2K8C B;  3F53 A;  2KEY A;  1NZB A;  3AQF A;  2KJ8 A;  2XID A;  4CGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...