2F2FA

Crystal structure of cytolethal distending toxin (cdt) from actinobacillus actinomycetemcomitans
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
153
structure length
153
Chain Sequence
PSEPSNFMTLMGQNGALLTVWALAKRNWLWAYPNIYSQDFGNIRNWKIEPGKHREYFRFVNQSLGTCIEAYGNGLIHDTCSLDKLAQEFELLPTDSGAVVIKSVSQGRCVTYNPVSPTYYSTVTLSTCDGATEPLRDQTWYLAPPVLEATAVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytolethal distending toxin A
publication title Variation of loop sequence alters stability of cytolethal distending toxin (CDT): crystal structure of CDT from Actinobacillus actinomycetemcomitans
pubmed doi rcsb
source organism Aggregatibacter actinomycetemcomitans
molecule tags Toxin
total genus 44
structure length 153
sequence length 153
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03498 CDtoxinA Cytolethal distending toxin A/C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2f2fA00
1R8OA 3VWCA 1FV3A 4QBCA 1PC8B 1PZZA 1ABRB 4I96A 4ZFUB 1NUNA 2ZR1B 5BOWA 3I2XA 3N0KA 2MC2A 3HMYA 3OJVA 5FZUA 3RTIB 1V6XA 1ONKB 3NBDA 1L2HA 2E4MA 4DEPA 2XOAA 3O44A 1ILR1 4EEEB 1G82A 3CU1B 4I4OA 4LO1C 1DQOA 7I1BA 3O4OA 5BP5C 3V79C 4I3NA 2FGFA 1S0DA 3N7KA 4L4IA 3O4AA 4I6IA 1IHKA 3RSJA 1PUUB 3BAQA 4ENDA 4GAFA 4LO7C 1TWMA 2D20A 4R6UB 4GOYA 3WMVA 1Z4SA 5DUYA 2ESUA 4EB2B 4OWJA 3BADA 4I4RA 2RQ9A 3NBEA 4YOLA 4CJMA 4I4VA 2F2FC 3WO3A 3AH4A 2FFVA 3D7WB 3AJ6A 4I1EA 3UD9A 3BA5A 1DFCA 4Q9PA 4PC4A 3O3QA 4GP3A 4A7KA 4X37A 1AXMA 4ZA3B 1EPWA 5EC5A 1ISWA 4EFPA 3MALA 5BVPI 2ZQOA 3CQAA 3FJCA 1FMMS 2Z48A 5F8YA 4P0JA 3WA1A 3H6RA 4G9NA 5FZYA 1TFMB 5F8SA 3H6RB 3VT0A 4XKIA 4A7YA 3RTJB 2MLLB 1HKNA 3CA4A 1Q1UA 1YYNA 4J2YA 2HWMA 3V0BA 2HWAA 1FGAA 4I4SA 1BLAA 1XG6A 1Z0HA 2L5XA 3BB2A 4ZFWB 1DZCA 1RZOB 21BIA 4KEIA 2VUAA 2Y9WC 2Y9FA 3I2AA 4QKSA 1AVUA 1BA7A 3VT2A 3V0AA 5BXRA 9ILBA 3RMXA 3Q7YA 3V0AB 3PHZA 1ISZA 3ZC8A 1YF8B 2D23A 3CA6A 4JKXB 1JQZA 1W3AA 1M2TB 2ERMA 1GGPB 2K43A 1BLDA 4TLPA 4OWLA 4I4UA 4II0A 4XFTA 2AXMA 5I1BA 4KC3A 1ISVA 3LTQA 3MPPG 3OJ2A 2GZBA 2D1ZA 2FDBM 3UDAA 2VU9A 1JLYA 3F1RA 3P6IA 2KI6B 1F31A 1QQLA 2ZQNA 3OGFA 1CE7B 4I2SA 1DFQA 4LO0C 1FMZA 2Y9GA 4A7ZA 1HIBA 2P23A 3WINC 1QQKA 3P53A 1SR4C 3AKIA 2YUGA 4X38A 5D61A 4EFRA 1R8NA 4I37A 4P0LA 5FZZA 1AFCA 4JKQA 5DZUA 1XYFA 3BAGA 3WO4A 4FVVA 1V6VA 2WRYA 4ZKTB 2VLCA 1PUMB 4OEEA 2GO2A 1Q03A 5F90A 4I0YA 4HJJA 5GAQA 3ILAA 3A23A 2Q9XA 5D63A 1RY7A 3C9ZA 3O4CA 1IOBA 4F83A 3BX1C 1PWAA 4I4QA 4IQPA 3T8SA 3AKGA 3UJ0A 4I4PA 4D8HA 1WBCA 1JY0A 4JQ0A 8I1BA 3B9UA 3JRRA 1W3FA 4HA2A 4LO3A 3VSZA 3FJAA 1D0HA 3CA3A 4DENA 2NM1A 3JUTA 4Q91A 5BXSA 1IT0A 3PUBA 2P39A 3TC2A 2RG9B 3O5WB 4KBBA 3HSMA 1BFBA 3CRIA 3FJ8A 1E0OA 4KEJA 1XZZA 3HN1A 4JP0A 4EFQA 4OUJA 4IYBA 2D7RA 1W3GA 4H9WA 1UPSA 4ZBVB 3BAVA 4X3AA 3H6QA 4LO1A 3VUOA 2HZ9A 1S0FA 3AJ5A 3W9TA 1AF9A 4Z8SB 3S8JA 1YBIA 5BP5A 4IHZA 4QD2C 2QN4A 1S0GA 2RSTA 3AZVA 3LLPA 3VT1A 4XFUA 1S0CA 2Z49A 3FJEA 1WBAA 4OWKA 1P63A 1EV2A 1YTOA 2X2SA 3AH1A 1TP0A 1JT4A 3O4DA 5BQUA 2K8RA 1ITBA 1G9DA 1TIEA 1SZ6B 3FFZA 2NP0A 5B2HA 1S0BA 4G9MA 4G6MA 1YXWA 3BAHA 5DSSB 3Q7WA 1K5VA 1T9FA 1QXMA 3EF2A 3O4BA 3AKFA 2D24A 3IM5A 1II4A 2VSEA 3FUOA 3A07A 4D0TA 3BA4A 3CA5A 3NBCA 2DS0A 1VCLA 2I1BA 2AAIB 4J23B 4F34A 1V6WA 4IZXA 1IRAX 2BFHA 4J2XA 2D44A 4JAWA 5DVHA 4I4YA 3WO2A 4IZEA 4ZFYB 4QO3A 2E4MC 3FGMA 1TWEA 3ZXGA 3FJDA 2D43A 1S0LA 3ZXDA 3IIRA 3R4UA 1BASA 4AN7B 3SNVA 2MIBA 3WMUA 3F62B 3POKA 4OW4A 5FNXA 1FQ9A 4LO2A 3O49A 5FNWA 3FUQA 4P0KA 3AKHA 1G9AA 3A22A 4P6AA 2VSAA 4J2SA 4USPA 1JT3A 3BRDA 1IILA 1V6UA 3E8LC 2NVHA 3QYDA 5BXPA 4XFSA 3HOMA 3A21A 2D7IA 1Z2VA 4G1RA 1MD6A 4JPZA 1WD3A 3UD8A 2D22A 1M16A 1EVTA 1DLLA 5G00A 3BRFA 3I29B 4I8MA 1Q04A 2K4AB 1I1EA 3K1XA 4GAIA 1DJSB 4Q9GA 3IAGC 1T4QA 2X2TA 3CRHA 3AZWA 5F8WA 3HBWA 41BIA 3BA7A 1FWVA 1BFFA 2BEAA 3FJJA 4KEKA 2BEBA 4LO0A 2KH2A 2IWTB 1ISXA 3WINA 2KI4A 1NZKA 3KMVA 4H04A 4QC4A 1SR4A 4DCKC 5EHAA 3QR5A 3BRGC 4I1BA 2J3PA 1FWUA 3OBRA 1FN0A 4USOA 2HW9A 5BQUC 6I1BA 1XHBA 2NYYA 1AVWB 4GOVA 1G9BA 2NZ9A 4G6JA 4LO8B 5JMCA 1HWPB 3NJ5A 1MC9A 4OEGA 3BAUA 2Q3NB 4I7IA 1IRPA 4EKXB 2DRYA 4OEFA 4L4HA 5E24E 1DZDA 4ZOTA 2R9KB 3BTAA 2NTDA 1JLXA 2DRZA 1OQLB 3FJ9A 3HALA 1HWOB 4ZLBB 1I1BA 4GP0A 1BARA 4QALA 1EYLA 4I4XA 1HWMB 3N7JA 1RG8A 3BAOA 4ZGRB 3OBTA 1N4KA 4LO7B 1KNMA 2UUSA 4IONA 3OGGA 3ZX7A 3FJFA 3PMEA 2FFUA 2F2FA 4IY8A 5HPZA 1TTUA 1HCDA 2KLLA 2KKIA 3H6SE 1J0SA 4WBCA 3AH2A 1DQGA 3RMYA 2VXRA 2AQZA 2DREA 4JRAA 4Z9WB 2IHOA 1HWNB 3CA0A 3VEQA 3FJHA 1A8DA 4D0ZA 4QBVA 3FJBA 1WD4A 2LIEA 4ISQA 2VXTI 3P6JA 3PG0A 4LO2C 3V0BB 4FGFA 3R4SA 1TOOA 5BXTA 3Q7XA 2LIQA 4AN6A 4HR6C 4J2KA 1G9CA 1K5UA 2ET2A 3NBNA 2WBCA 4QD2B 1JTCA 1FV2A 1AVXB 3CAHA 1JT7A 2F8XC 1HCEA 3FJIA 3IM6A 1AVAC 2AFGA 4QKRA 3N7MA 4X39A 31BIA 3IM7A 3VSFA 1BFGA 3CA1A 1S0EA 1IJTA 3FJKA 3UD7A 5JLVA 4ISRA 1DIWA 2Y9XE 2M49A 1ISYA 3UJ4A 3ZC9A 1BFCA 1JT5A 5D62A 5EG6C 4IY9A 3N7LA 1RMLA 3CRGA 2FO1A 1CVSA 3S8KA 4LO3C 3OJMA 2QYIB
chains in the Genus database with same CATH superfamily
1R8OA 3VWCA 1FV3A 4QBCA 1PC8B 1PZZA 1ABRB 4I96A 4ZFUB 1NUNA 2ZR1B 5BOWA 3I2XA 3N0KA 2MC2A 3HMYA 3OJVA 5FZUA 3RTIB 1V6XA 1ONKB 3NBDA 1L2HA 2E4MA 4DEPA 2XOAA 3O44A 1ILR1 4EEEB 1G82A 3CU1B 4I4OA 4LO1C 1DQOA 7I1BA 3O4OA 5BP5C 3V79C 4I3NA 2FGFA 1S0DA 3N7KA 4L4IA 3O4AA 4I6IA 1IHKA 3RSJA 1PUUB 3BAQA 4ENDA 4GAFA 4LO7C 1TWMA 2D20A 4R6UB 4GOYA 3WMVA 1Z4SA 5DUYA 2ESUA 4EB2B 4OWJA 3BADA 4I4RA 2RQ9A 3NBEA 4YOLA 4CJMA 4I4VA 2F2FC 3WO3A 4MZHA 3AH4A 2FFVA 3D7WB 3AJ6A 4I1EA 3UD9A 3BA5A 1DFCA 4Q9PA 4PC4A 3O3QA 4GP3A 4A7KA 4X37A 1AXMA 4ZA3B 1EPWA 5EC5A 1ISWA 4EFPA 3MALA 5BVPI 2ZQOA 3CQAA 3FJCA 1FMMS 2Z48A 5F8YA 4P0JA 3WA1A 3H6RA 4G9NA 5FZYA 1TFMB 5F8SA 3H6RB 3VT0A 4XKIA 4A7YA 3RTJB 2MLLB 1HKNA 3CA4A 1Q1UA 1YYNA 4J2YA 2HWMA 3V0BA 2HWAA 1FGAA 4I4SA 1BLAA 1XG6A 1Z0HA 2L5XA 3BB2A 4ZFWB 1DZCA 1RZOB 21BIA 4KEIA 2VUAA 2Y9WC 2Y9FA 3I2AA 4QKSA 1AVUA 1BA7A 3VT2A 3V0AA 5BXRA 9ILBA 3RMXA 3Q7YA 3V0AB 3PHZA 1ISZA 3ZC8A 1YF8B 2D23A 3CA6A 4JKXB 1JQZA 1W3AA 1M2TB 2ERMA 1GGPB 2K43A 1BLDA 4TLPA 4OWLA 4I4UA 4II0A 4XFTA 2AXMA 5I1BA 4KC3A 1ISVA 3LTQA 3MPPG 3OJ2A 2GZBA 2D1ZA 2FDBM 3UDAA 2VU9A 1JLYA 3F1RA 3P6IA 2KI6B 1F31A 1QQLA 2ZQNA 3OGFA 1CE7B 4I2SA 1DFQA 4LO0C 1FMZA 2Y9GA 4A7ZA 1HIBA 2P23A 3WINC 1QQKA 3P53A 1SR4C 3AKIA 2YUGA 4X38A 5D61A 4EFRA 1R8NA 4I37A 4P0LA 5FZZA 1AFCA 4H75A 4JKQA 5DZUA 1XYFA 3BAGA 3WO4A 4FVVA 1V6VA 2WRYA 4ZKTB 2VLCA 1PUMB 4OEEA 2GO2A 1Q03A 4MZGB 5F90A 4I0YA 4HJJA 5GAQA 3ILAA 3A23A 2Q9XA 5D63A 1RY7A 3C9ZA 3O4CA 1IOBA 4F83A 3BX1C 1PWAA 4I4QA 4IQPA 3T8SA 3AKGA 3UJ0A 4I4PA 4D8HA 1WBCA 1JY0A 4JQ0A 8I1BA 3B9UA 3JRRA 1W3FA 4HA2A 4LO3A 3VSZA 3FJAA 1D0HA 3CA3A 4DENA 2NM1A 3JUTA 4Q91A 5BXSA 1IT0A 3PUBA 2P39A 3TC2A 2RG9B 3O5WB 4KBBA 3HSMA 1BFBA 3CRIA 3FJ8A 1E0OA 4KEJA 1XZZA 3HN1A 4JP0A 4EFQA 4OUJA 4IYBA 2D7RA 1W3GA 4H9WA 1UPSA 4ZBVB 3BAVA 4X3AA 3H6QA 4LO1A 3VUOA 2HZ9A 1S0FA 3AJ5A 3W9TA 1AF9A 4Z8SB 3S8JA 1YBIA 5BP5A 4IHZA 4QD2C 2QN4A 1S0GA 2RSTA 3AZVA 3LLPA 3VT1A 4XFUA 1S0CA 2Z49A 3FJEA 1WBAA 4OWKA 1P63A 1EV2A 1YTOA 2X2SA 3AH1A 1TP0A 1JT4A 3O4DA 5BQUA 2K8RA 1ITBA 1G9DA 1TIEA 1SZ6B 3FFZA 2NP0A 5B2HA 1S0BA 4G9MA 4G6MA 1YXWA 3BAHA 5DSSB 4UY4A 3Q7WA 1K5VA 1T9FA 1QXMA 3EF2A 3O4BA 3AKFA 2D24A 3IM5A 1II4A 2VSEA 3FUOA 3A07A 4D0TA 3BA4A 3CA5A 3NBCA 2DS0A 1VCLA 2I1BA 2AAIB 4J23B 4F34A 1V6WA 4IZXA 1IRAX 2BFHA 4J2XA 2D44A 4JAWA 5DVHA 2NS2A 4I4YA 3WO2A 4IZEA 4ZFYB 4QO3A 2E4MC 3FGMA 1TWEA 3ZXGA 3FJDA 2D43A 1S0LA 3ZXDA 3IIRA 3R4UA 1BASA 4AN7B 3SNVA 2MIBA 3WMUA 3F62B 3POKA 4OW4A 5FNXA 1FQ9A 4LO2A 3O49A 5FNWA 3FUQA 4P0KA 3AKHA 1G9AA 3A22A 4P6AA 2VSAA 4J2SA 4USPA 1JT3A 3BRDA 1IILA 1V6UA 3E8LC 2NVHA 3QYDA 5BXPA 4XFSA 3HOMA 3A21A 2D7IA 1Z2VA 4G1RA 1MD6A 4JPZA 1WD3A 3UD8A 2D22A 1M16A 1EVTA 1DLLA 5G00A 3BRFA 3I29B 4I8MA 1Q04A 2K4AB 1I1EA 3K1XA 4GAIA 1DJSB 4Q9GA 3IAGC 1T4QA 2X2TA 3CRHA 3AZWA 5F8WA 3HBWA 41BIA 3BA7A 1FWVA 1BFFA 2BEAA 3FJJA 4KEKA 2BEBA 4LO0A 2KH2A 2IWTB 1ISXA 3WINA 2KI4A 1NZKA 3KMVA 4H04A 4QC4A 1SR4A 4DCKC 5EHAA 3QR5A 3BRGC 4I1BA 2J3PA 1FWUA 3OBRA 1FN0A 4USOA 2HW9A 5BQUC 6I1BA 1XHBA 2NYYA 1AVWB 4GOVA 1G9BA 2NZ9A 4G6JA 4LO8B 5JMCA 1HWPB 3NJ5A 1MC9A 4OEGA 3BAUA 2Q3NB 4I7IA 1IRPA 4EKXB 2DRYA 4OEFA 4L4HA 5E24E 1DZDA 4ZOTA 2R9KB 3BTAA 2NTDA 1JLXA 2DRZA 1OQLB 3FJ9A 3HALA 1HWOB 4ZLBB 1I1BA 4GP0A 1BARA 4QALA 1EYLA 4I4XA 1HWMB 3N7JA 1RG8A 3BAOA 4ZGRB 3OBTA 1N4KA 4LO7B 1KNMA 2UUSA 4IONA 3OGGA 3ZX7A 3FJFA 3PMEA 2FFUA 2F2FA 4IY8A 5HPZA 1TTUA 1HCDA 2KLLA 2KKIA 3H6SE 1J0SA 4WBCA 3AH2A 1DQGA 3RMYA 2VXRA 2AQZA 2DREA 4JRAA 4Z9WB 2IHOA 1HWNB 3CA0A 3VEQA 3FJHA 1A8DA 4D0ZA 4QBVA 3FJBA 1WD4A 2LIEA 4ISQA 2VXTI 3P6JA 3PG0A 4LO2C 3V0BB 4FGFA 3R4SA 1TOOA 5BXTA 3Q7XA 4MZFB 2LIQA 4AN6A 4HR6C 4J2KA 1G9CA 1K5UA 2ET2A 3NBNA 2WBCA 4QD2B 1JTCA 1FV2A 1AVXB 3CAHA 1JT7A 2F8XC 1HCEA 3FJIA 3IM6A 1AVAC 2AFGA 4QKRA 3N7MA 4X39A 31BIA 3IM7A 3VSFA 1BFGA 3CA1A 1S0EA 1IJTA 3FJKA 3UD7A 5JLVA 4ISRA 1DIWA 2Y9XE 2M49A 1ISYA 3UJ4A 3ZC9A 1BFCA 1JT5A 5D62A 5EG6C 4IY9A 3N7LA 1RMLA 3CRGA 2FO1A 1CVSA 3S8KA 4LO3C 3OJMA 2QYIB
chains in the Genus database with same CATH topology
1R8OA 3VWCA 1FV3A 4QBCA 1PC8B 1PZZA 1ABRB 4I96A 4ZFUB 1NUNA 2ZR1B 5BOWA 3I2XA 3N0KA 2MC2A 3HMYA 3OJVA 5FZUA 3RTIB 1V6XA 1ONKB 3NBDA 1L2HA 2E4MA 4DEPA 2XOAA 3O44A 1ILR1 4EEEB 1G82A 3CU1B 4I4OA 4LO1C 1DQOA 7I1BA 3O4OA 5BP5C 3V79C 4I3NA 2FGFA 1S0DA 3N7KA 4L4IA 3O4AA 4I6IA 1IHKA 3RSJA 1PUUB 3BAQA 4ENDA 4GAFA 4LO7C 1TWMA 2D20A 4R6UB 4GOYA 3WMVA 1Z4SA 5DUYA 2ESUA 4EB2B 4OWJA 3BADA 4I4RA 2RQ9A 3NBEA 4YOLA 4CJMA 4I4VA 2F2FC 3WO3A 4MZHA 3AH4A 2FFVA 3D7WB 3AJ6A 4I1EA 3UD9A 3BA5A 1DFCA 4Q9PA 4PC4A 3O3QA 4GP3A 4A7KA 4X37A 1AXMA 4ZA3B 1EPWA 5EC5A 1ISWA 4EFPA 3MALA 5BVPI 2ZQOA 3CQAA 3FJCA 1FMMS 2Z48A 5F8YA 4P0JA 3WA1A 3H6RA 4G9NA 5FZYA 1TFMB 5F8SA 3H6RB 3VT0A 4XKIA 4A7YA 3RTJB 2MLLB 1HKNA 3CA4A 1Q1UA 1YYNA 4J2YA 2HWMA 3V0BA 2HWAA 1FGAA 4I4SA 1BLAA 1XG6A 1Z0HA 2L5XA 3BB2A 4ZFWB 1DZCA 1RZOB 21BIA 4KEIA 2VUAA 2Y9WC 2Y9FA 3I2AA 4QKSA 1AVUA 1BA7A 3VT2A 3V0AA 5BXRA 9ILBA 3RMXA 3Q7YA 3V0AB 3PHZA 1ISZA 3ZC8A 1YF8B 2D23A 3CA6A 4JKXB 1JQZA 1W3AA 1M2TB 2ERMA 1GGPB 2K43A 1BLDA 4TLPA 4OWLA 4I4UA 4II0A 4XFTA 2AXMA 5I1BA 4KC3A 1ISVA 3LTQA 3MPPG 3OJ2A 2GZBA 2D1ZA 2FDBM 3UDAA 2VU9A 1JLYA 3F1RA 3P6IA 2KI6B 1F31A 1QQLA 2ZQNA 3OGFA 1CE7B 4I2SA 1DFQA 4LO0C 1FMZA 2Y9GA 4A7ZA 1HIBA 2P23A 3WINC 1QQKA 3P53A 1SR4C 3AKIA 2YUGA 4X38A 5D61A 4EFRA 1R8NA 4I37A 4P0LA 5FZZA 1AFCA 4H75A 4JKQA 5DZUA 1XYFA 3BAGA 3WO4A 4FVVA 1V6VA 2WRYA 4ZKTB 2VLCA 1PUMB 4OEEA 2GO2A 1Q03A 4MZGB 5F90A 4I0YA 4HJJA 5GAQA 3ILAA 3A23A 2Q9XA 5D63A 1RY7A 3C9ZA 3O4CA 1IOBA 4F83A 3BX1C 1PWAA 4I4QA 4IQPA 3T8SA 3AKGA 3UJ0A 4I4PA 4D8HA 1WBCA 1JY0A 4JQ0A 8I1BA 3B9UA 3JRRA 1W3FA 4HA2A 4LO3A 3VSZA 3FJAA 1D0HA 3CA3A 4DENA 2NM1A 3JUTA 4Q91A 5BXSA 1IT0A 3PUBA 2P39A 3TC2A 2RG9B 3O5WB 4KBBA 3HSMA 1BFBA 3CRIA 3FJ8A 1E0OA 4KEJA 1XZZA 3HN1A 4JP0A 4EFQA 4OUJA 4IYBA 2D7RA 1W3GA 4H9WA 1UPSA 4ZBVB 3BAVA 4X3AA 3H6QA 4LO1A 3VUOA 2HZ9A 1S0FA 3AJ5A 3W9TA 1AF9A 4Z8SB 3S8JA 1YBIA 5BP5A 4IHZA 4QD2C 2QN4A 1S0GA 2RSTA 3AZVA 3LLPA 3VT1A 4XFUA 1S0CA 2Z49A 3FJEA 1WBAA 4OWKA 1P63A 1EV2A 1YTOA 2X2SA 3AH1A 1TP0A 1JT4A 3O4DA 5BQUA 2K8RA 1ITBA 1G9DA 1TIEA 1SZ6B 3FFZA 2NP0A 5B2HA 1S0BA 4G9MA 4G6MA 1YXWA 3BAHA 5DSSB 4UY4A 3Q7WA 1K5VA 1T9FA 1QXMA 3EF2A 3O4BA 3AKFA 2D24A 3IM5A 1II4A 2VSEA 3FUOA 3A07A 4D0TA 3BA4A 3CA5A 3NBCA 2DS0A 1VCLA 2I1BA 2AAIB 4J23B 4F34A 1V6WA 4IZXA 1IRAX 2BFHA 4J2XA 2D44A 4JAWA 5DVHA 2NS2A 4I4YA 3WO2A 4IZEA 4ZFYB 4QO3A 2E4MC 3FGMA 1TWEA 3ZXGA 3FJDA 2D43A 1S0LA 3ZXDA 3IIRA 3R4UA 1BASA 4AN7B 3SNVA 2MIBA 3WMUA 3F62B 3POKA 4OW4A 5FNXA 1FQ9A 4LO2A 3O49A 5FNWA 3FUQA 4P0KA 3AKHA 1G9AA 3A22A 4P6AA 2VSAA 4J2SA 4USPA 1JT3A 3BRDA 1IILA 1V6UA 3E8LC 2NVHA 3QYDA 5BXPA 4XFSA 3HOMA 3A21A 2D7IA 1Z2VA 4G1RA 1MD6A 4JPZA 1WD3A 3UD8A 2D22A 1M16A 1EVTA 1DLLA 5G00A 3BRFA 3I29B 4I8MA 1Q04A 2K4AB 1I1EA 3K1XA 4GAIA 1DJSB 4Q9GA 3IAGC 1T4QA 2X2TA 3CRHA 3AZWA 5F8WA 3HBWA 41BIA 3BA7A 1FWVA 1BFFA 2BEAA 3FJJA 4KEKA 2BEBA 4LO0A 2KH2A 2IWTB 1ISXA 3WINA 2KI4A 1NZKA 3KMVA 4H04A 4QC4A 1SR4A 4DCKC 5EHAA 3QR5A 3BRGC 4I1BA 2J3PA 1FWUA 3OBRA 1FN0A 4USOA 2HW9A 5BQUC 6I1BA 1XHBA 2NYYA 1AVWB 4GOVA 1G9BA 2NZ9A 4G6JA 4LO8B 5JMCA 1HWPB 3NJ5A 1MC9A 4OEGA 3BAUA 2Q3NB 4I7IA 1IRPA 4EKXB 2DRYA 4OEFA 4L4HA 5E24E 1DZDA 4ZOTA 2R9KB 3BTAA 2NTDA 1JLXA 2DRZA 1OQLB 3FJ9A 3HALA 1HWOB 4ZLBB 1I1BA 4GP0A 1BARA 4QALA 1EYLA 4I4XA 1HWMB 3N7JA 1RG8A 3BAOA 4ZGRB 3OBTA 1N4KA 4LO7B 1KNMA 2UUSA 4IONA 3OGGA 3ZX7A 3FJFA 3PMEA 2FFUA 2F2FA 4IY8A 5HPZA 1TTUA 1HCDA 2KLLA 2KKIA 3H6SE 1J0SA 4WBCA 3AH2A 1DQGA 3RMYA 2VXRA 2AQZA 2DREA 4JRAA 4Z9WB 2IHOA 1HWNB 3CA0A 3VEQA 3FJHA 1A8DA 4D0ZA 4QBVA 3FJBA 1WD4A 2LIEA 4ISQA 2VXTI 3P6JA 3PG0A 4LO2C 3V0BB 4FGFA 3R4SA 1TOOA 5BXTA 3Q7XA 4MZFB 2LIQA 4AN6A 4HR6C 4J2KA 1G9CA 1K5UA 2ET2A 3NBNA 2WBCA 4QD2B 1JTCA 1FV2A 1AVXB 3CAHA 1JT7A 2F8XC 1HCEA 3FJIA 3IM6A 1AVAC 2AFGA 4QKRA 3N7MA 4X39A 31BIA 3IM7A 3VSFA 1BFGA 3CA1A 1S0EA 1IJTA 3FJKA 3UD7A 5JLVA 4ISRA 1DIWA 2Y9XE 2M49A 1ISYA 3UJ4A 3ZC9A 1BFCA 1JT5A 5D62A 5EG6C 4IY9A 3N7LA 1RMLA 3CRGA 2FO1A 1CVSA 3S8KA 4LO3C 3OJMA 2QYIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R8O A;  3VWC A;  1FV3 A;  4QBC A;  1PC8 B;  1PZZ A;  1ABR B;  4I96 A;  4ZFU B;  1NUN A;  2ZR1 B;  5BOW A;  3I2X A;  3N0K A;  2MC2 A;  3HMY A;  3OJV A;  5FZU A;  3RTI B;  1V6X A;  1ONK B;  3NBD A;  1L2H A;  2E4M A;  4DEP A;  2XOA A;  3O44 A;  1ILR 1;  4EEE B;  1G82 A;  3CU1 B;  4I4O A;  4LO1 C;  1DQO A;  7I1B A;  3O4O A;  5BP5 C;  3V79 C;  4I3N A;  2FGF A;  1S0D A;  3N7K A;  4L4I A;  3O4A A;  4I6I A;  1IHK A;  3RSJ A;  1PUU B;  3BAQ A;  4END A;  4GAF A;  4LO7 C;  1TWM A;  2D20 A;  4R6U B;  4GOY A;  3WMV A;  1Z4S A;  5DUY A;  2ESU A;  4EB2 B;  4OWJ A;  3BAD A;  4I4R A;  2RQ9 A;  3NBE A;  4YOL A;  4CJM A;  4I4V A;  2F2F C;  3WO3 A;  3AH4 A;  2FFV A;  3D7W B;  3AJ6 A;  4I1E A;  3UD9 A;  3BA5 A;  1DFC A;  4Q9P A;  4PC4 A;  3O3Q A;  4GP3 A;  4A7K A;  4X37 A;  1AXM A;  4ZA3 B;  1EPW A;  5EC5 A;  1ISW A;  4EFP A;  3MAL A;  5BVP I;  2ZQO A;  3CQA A;  3FJC A;  1FMM S;  2Z48 A;  5F8Y A;  4P0J A;  3WA1 A;  3H6R A;  4G9N A;  5FZY A;  1TFM B;  5F8S A;  3H6R B;  3VT0 A;  4XKI A;  4A7Y A;  3RTJ B;  2MLL B;  1HKN A;  3CA4 A;  1Q1U A;  1YYN A;  4J2Y A;  2HWM A;  3V0B A;  2HWA A;  1FGA A;  4I4S A;  1BLA A;  1XG6 A;  1Z0H A;  2L5X A;  3BB2 A;  4ZFW B;  1DZC A;  1RZO B;  21BI A;  4KEI A;  2VUA A;  2Y9W C;  2Y9F A;  3I2A A;  4QKS A;  1AVU A;  1BA7 A;  3VT2 A;  3V0A A;  5BXR A;  9ILB A;  3RMX A;  3Q7Y A;  3V0A B;  3PHZ A;  1ISZ A;  3ZC8 A;  1YF8 B;  2D23 A;  3CA6 A;  4JKX B;  1JQZ A;  1W3A A;  1M2T B;  2ERM A;  1GGP B;  2K43 A;  1BLD A;  4TLP A;  4OWL A;  4I4U A;  4II0 A;  4XFT A;  2AXM A;  5I1B A;  4KC3 A;  1ISV A;  3LTQ A;  3MPP G;  3OJ2 A;  2GZB A;  2D1Z A;  2FDB M;  3UDA A;  2VU9 A;  1JLY A;  3F1R A;  3P6I A;  2KI6 B;  1F31 A;  1QQL A;  2ZQN A;  3OGF A;  1CE7 B;  4I2S A;  1DFQ A;  4LO0 C;  1FMZ A;  2Y9G A;  4A7Z A;  1HIB A;  2P23 A;  3WIN C;  1QQK A;  3P53 A;  1SR4 C;  3AKI A;  2YUG A;  4X38 A;  5D61 A;  4EFR A;  1R8N A;  4I37 A;  4P0L A;  5FZZ A;  1AFC A;  4JKQ A;  5DZU A;  1XYF A;  3BAG A;  3WO4 A;  4FVV A;  1V6V A;  2WRY A;  4ZKT B;  2VLC A;  1PUM B;  4OEE A;  2GO2 A;  1Q03 A;  5F90 A;  4I0Y A;  4HJJ A;  5GAQ A;  3ILA A;  3A23 A;  2Q9X A;  5D63 A;  1RY7 A;  3C9Z A;  3O4C A;  1IOB A;  4F83 A;  3BX1 C;  1PWA A;  4I4Q A;  4IQP A;  3T8S A;  3AKG A;  3UJ0 A;  4I4P A;  4D8H A;  1WBC A;  1JY0 A;  4JQ0 A;  8I1B A;  3B9U A;  3JRR A;  1W3F A;  4HA2 A;  4LO3 A;  3VSZ A;  3FJA A;  1D0H A;  3CA3 A;  4DEN A;  2NM1 A;  3JUT A;  4Q91 A;  5BXS A;  1IT0 A;  3PUB A;  2P39 A;  3TC2 A;  2RG9 B;  3O5W B;  4KBB A;  3HSM A;  1BFB A;  3CRI A;  3FJ8 A;  1E0O A;  4KEJ A;  1XZZ A;  3HN1 A;  4JP0 A;  4EFQ A;  4OUJ A;  4IYB A;  2D7R A;  1W3G A;  4H9W A;  1UPS A;  4ZBV B;  3BAV A;  4X3A A;  3H6Q A;  4LO1 A;  3VUO A;  2HZ9 A;  1S0F A;  3AJ5 A;  3W9T A;  1AF9 A;  4Z8S B;  3S8J A;  1YBI A;  5BP5 A;  4IHZ A;  4QD2 C;  2QN4 A;  1S0G A;  2RST A;  3AZV A;  3LLP A;  3VT1 A;  4XFU A;  1S0C A;  2Z49 A;  3FJE A;  1WBA A;  4OWK A;  1P63 A;  1EV2 A;  1YTO A;  2X2S A;  3AH1 A;  1TP0 A;  1JT4 A;  3O4D A;  5BQU A;  2K8R A;  1ITB A;  1G9D A;  1TIE A;  1SZ6 B;  3FFZ A;  2NP0 A;  5B2H A;  1S0B A;  4G9M A;  4G6M A;  1YXW A;  3BAH A;  5DSS B;  3Q7W A;  1K5V A;  1T9F A;  1QXM A;  3EF2 A;  3O4B A;  3AKF A;  2D24 A;  3IM5 A;  1II4 A;  2VSE A;  3FUO A;  3A07 A;  4D0T A;  3BA4 A;  3CA5 A;  3NBC A;  2DS0 A;  1VCL A;  2I1B A;  2AAI B;  4J23 B;  4F34 A;  1V6W A;  4IZX A;  1IRA X;  2BFH A;  4J2X A;  2D44 A;  4JAW A;  5DVH A;  4I4Y A;  3WO2 A;  4IZE A;  4ZFY B;  4QO3 A;  2E4M C;  3FGM A;  1TWE A;  3ZXG A;  3FJD A;  2D43 A;  1S0L A;  3ZXD A;  3IIR A;  3R4U A;  1BAS A;  4AN7 B;  3SNV A;  2MIB A;  3WMU A;  3F62 B;  3POK A;  4OW4 A;  5FNX A;  1FQ9 A;  4LO2 A;  3O49 A;  5FNW A;  3FUQ A;  4P0K A;  3AKH A;  1G9A A;  3A22 A;  4P6A A;  2VSA A;  4J2S A;  4USP A;  1JT3 A;  3BRD A;  1IIL A;  1V6U A;  3E8L C;  2NVH A;  3QYD A;  5BXP A;  4XFS A;  3HOM A;  3A21 A;  2D7I A;  1Z2V A;  4G1R A;  1MD6 A;  4JPZ A;  1WD3 A;  3UD8 A;  2D22 A;  1M16 A;  1EVT A;  1DLL A;  5G00 A;  3BRF A;  3I29 B;  4I8M A;  1Q04 A;  2K4A B;  1I1E A;  3K1X A;  4GAI A;  1DJS B;  4Q9G A;  3IAG C;  1T4Q A;  2X2T A;  3CRH A;  3AZW A;  5F8W A;  3HBW A;  41BI A;  3BA7 A;  1FWV A;  1BFF A;  2BEA A;  3FJJ A;  4KEK A;  2BEB A;  4LO0 A;  2KH2 A;  2IWT B;  1ISX A;  3WIN A;  2KI4 A;  1NZK A;  3KMV A;  4H04 A;  4QC4 A;  1SR4 A;  4DCK C;  5EHA A;  3QR5 A;  3BRG C;  4I1B A;  2J3P A;  1FWU A;  3OBR A;  1FN0 A;  4USO A;  2HW9 A;  5BQU C;  6I1B A;  1XHB A;  2NYY A;  1AVW B;  4GOV A;  1G9B A;  2NZ9 A;  4G6J A;  4LO8 B;  5JMC A;  1HWP B;  3NJ5 A;  1MC9 A;  4OEG A;  3BAU A;  2Q3N B;  4I7I A;  1IRP A;  4EKX B;  2DRY A;  4OEF A;  4L4H A;  5E24 E;  1DZD A;  4ZOT A;  2R9K B;  3BTA A;  2NTD A;  1JLX A;  2DRZ A;  1OQL B;  3FJ9 A;  3HAL A;  1HWO B;  4ZLB B;  1I1B A;  4GP0 A;  1BAR A;  4QAL A;  1EYL A;  4I4X A;  1HWM B;  3N7J A;  1RG8 A;  3BAO A;  4ZGR B;  3OBT A;  1N4K A;  4LO7 B;  1KNM A;  2UUS A;  4ION A;  3OGG A;  3ZX7 A;  3FJF A;  3PME A;  2FFU A;  2F2F A;  4IY8 A;  5HPZ A;  1TTU A;  1HCD A;  2KLL A;  2KKI A;  3H6S E;  1J0S A;  4WBC A;  3AH2 A;  1DQG A;  3RMY A;  2VXR A;  2AQZ A;  2DRE A;  4JRA A;  4Z9W B;  2IHO A;  1HWN B;  3CA0 A;  3VEQ A;  3FJH A;  1A8D A;  4D0Z A;  4QBV A;  3FJB A;  1WD4 A;  2LIE A;  4ISQ A;  2VXT I;  3P6J A;  3PG0 A;  4LO2 C;  3V0B B;  4FGF A;  3R4S A;  1TOO A;  5BXT A;  3Q7X A;  2LIQ A;  4AN6 A;  4HR6 C;  4J2K A;  1G9C A;  1K5U A;  2ET2 A;  3NBN A;  2WBC A;  4QD2 B;  1JTC A;  1FV2 A;  1AVX B;  3CAH A;  1JT7 A;  2F8X C;  1HCE A;  3FJI A;  3IM6 A;  1AVA C;  2AFG A;  4QKR A;  3N7M A;  4X39 A;  31BI A;  3IM7 A;  3VSF A;  1BFG A;  3CA1 A;  1S0E A;  1IJT A;  3FJK A;  3UD7 A;  5JLV A;  4ISR A;  1DIW A;  2Y9X E;  2M49 A;  1ISY A;  3UJ4 A;  3ZC9 A;  1BFC A;  1JT5 A;  5D62 A;  5EG6 C;  4IY9 A;  3N7L A;  1RML A;  3CRG A;  2FO1 A;  1CVS A;  3S8K A;  4LO3 C;  3OJM A;  2QYI B; 
#chains in the Genus database with same CATH topology
 1R8O A;  3VWC A;  1FV3 A;  4QBC A;  1PC8 B;  1PZZ A;  1ABR B;  4I96 A;  4ZFU B;  1NUN A;  2ZR1 B;  5BOW A;  3I2X A;  3N0K A;  2MC2 A;  3HMY A;  3OJV A;  5FZU A;  3RTI B;  1V6X A;  1ONK B;  3NBD A;  1L2H A;  2E4M A;  4DEP A;  2XOA A;  3O44 A;  1ILR 1;  4EEE B;  1G82 A;  3CU1 B;  4I4O A;  4LO1 C;  1DQO A;  7I1B A;  3O4O A;  5BP5 C;  3V79 C;  4I3N A;  2FGF A;  1S0D A;  3N7K A;  4L4I A;  3O4A A;  4I6I A;  1IHK A;  3RSJ A;  1PUU B;  3BAQ A;  4END A;  4GAF A;  4LO7 C;  1TWM A;  2D20 A;  4R6U B;  4GOY A;  3WMV A;  1Z4S A;  5DUY A;  2ESU A;  4EB2 B;  4OWJ A;  3BAD A;  4I4R A;  2RQ9 A;  3NBE A;  4YOL A;  4CJM A;  4I4V A;  2F2F C;  3WO3 A;  4MZH A;  3AH4 A;  2FFV A;  3D7W B;  3AJ6 A;  4I1E A;  3UD9 A;  3BA5 A;  1DFC A;  4Q9P A;  4PC4 A;  3O3Q A;  4GP3 A;  4A7K A;  4X37 A;  1AXM A;  4ZA3 B;  1EPW A;  5EC5 A;  1ISW A;  4EFP A;  3MAL A;  5BVP I;  2ZQO A;  3CQA A;  3FJC A;  1FMM S;  2Z48 A;  5F8Y A;  4P0J A;  3WA1 A;  3H6R A;  4G9N A;  5FZY A;  1TFM B;  5F8S A;  3H6R B;  3VT0 A;  4XKI A;  4A7Y A;  3RTJ B;  2MLL B;  1HKN A;  3CA4 A;  1Q1U A;  1YYN A;  4J2Y A;  2HWM A;  3V0B A;  2HWA A;  1FGA A;  4I4S A;  1BLA A;  1XG6 A;  1Z0H A;  2L5X A;  3BB2 A;  4ZFW B;  1DZC A;  1RZO B;  21BI A;  4KEI A;  2VUA A;  2Y9W C;  2Y9F A;  3I2A A;  4QKS A;  1AVU A;  1BA7 A;  3VT2 A;  3V0A A;  5BXR A;  9ILB A;  3RMX A;  3Q7Y A;  3V0A B;  3PHZ A;  1ISZ A;  3ZC8 A;  1YF8 B;  2D23 A;  3CA6 A;  4JKX B;  1JQZ A;  1W3A A;  1M2T B;  2ERM A;  1GGP B;  2K43 A;  1BLD A;  4TLP A;  4OWL A;  4I4U A;  4II0 A;  4XFT A;  2AXM A;  5I1B A;  4KC3 A;  1ISV A;  3LTQ A;  3MPP G;  3OJ2 A;  2GZB A;  2D1Z A;  2FDB M;  3UDA A;  2VU9 A;  1JLY A;  3F1R A;  3P6I A;  2KI6 B;  1F31 A;  1QQL A;  2ZQN A;  3OGF A;  1CE7 B;  4I2S A;  1DFQ A;  4LO0 C;  1FMZ A;  2Y9G A;  4A7Z A;  1HIB A;  2P23 A;  3WIN C;  1QQK A;  3P53 A;  1SR4 C;  3AKI A;  2YUG A;  4X38 A;  5D61 A;  4EFR A;  1R8N A;  4I37 A;  4P0L A;  5FZZ A;  1AFC A;  4H75 A;  4JKQ A;  5DZU A;  1XYF A;  3BAG A;  3WO4 A;  4FVV A;  1V6V A;  2WRY A;  4ZKT B;  2VLC A;  1PUM B;  4OEE A;  2GO2 A;  1Q03 A;  4MZG B;  5F90 A;  4I0Y A;  4HJJ A;  5GAQ A;  3ILA A;  3A23 A;  2Q9X A;  5D63 A;  1RY7 A;  3C9Z A;  3O4C A;  1IOB A;  4F83 A;  3BX1 C;  1PWA A;  4I4Q A;  4IQP A;  3T8S A;  3AKG A;  3UJ0 A;  4I4P A;  4D8H A;  1WBC A;  1JY0 A;  4JQ0 A;  8I1B A;  3B9U A;  3JRR A;  1W3F A;  4HA2 A;  4LO3 A;  3VSZ A;  3FJA A;  1D0H A;  3CA3 A;  4DEN A;  2NM1 A;  3JUT A;  4Q91 A;  5BXS A;  1IT0 A;  3PUB A;  2P39 A;  3TC2 A;  2RG9 B;  3O5W B;  4KBB A;  3HSM A;  1BFB A;  3CRI A;  3FJ8 A;  1E0O A;  4KEJ A;  1XZZ A;  3HN1 A;  4JP0 A;  4EFQ A;  4OUJ A;  4IYB A;  2D7R A;  1W3G A;  4H9W A;  1UPS A;  4ZBV B;  3BAV A;  4X3A A;  3H6Q A;  4LO1 A;  3VUO A;  2HZ9 A;  1S0F A;  3AJ5 A;  3W9T A;  1AF9 A;  4Z8S B;  3S8J A;  1YBI A;  5BP5 A;  4IHZ A;  4QD2 C;  2QN4 A;  1S0G A;  2RST A;  3AZV A;  3LLP A;  3VT1 A;  4XFU A;  1S0C A;  2Z49 A;  3FJE A;  1WBA A;  4OWK A;  1P63 A;  1EV2 A;  1YTO A;  2X2S A;  3AH1 A;  1TP0 A;  1JT4 A;  3O4D A;  5BQU A;  2K8R A;  1ITB A;  1G9D A;  1TIE A;  1SZ6 B;  3FFZ A;  2NP0 A;  5B2H A;  1S0B A;  4G9M A;  4G6M A;  1YXW A;  3BAH A;  5DSS B;  4UY4 A;  3Q7W A;  1K5V A;  1T9F A;  1QXM A;  3EF2 A;  3O4B A;  3AKF A;  2D24 A;  3IM5 A;  1II4 A;  2VSE A;  3FUO A;  3A07 A;  4D0T A;  3BA4 A;  3CA5 A;  3NBC A;  2DS0 A;  1VCL A;  2I1B A;  2AAI B;  4J23 B;  4F34 A;  1V6W A;  4IZX A;  1IRA X;  2BFH A;  4J2X A;  2D44 A;  4JAW A;  5DVH A;  2NS2 A;  4I4Y A;  3WO2 A;  4IZE A;  4ZFY B;  4QO3 A;  2E4M C;  3FGM A;  1TWE A;  3ZXG A;  3FJD A;  2D43 A;  1S0L A;  3ZXD A;  3IIR A;  3R4U A;  1BAS A;  4AN7 B;  3SNV A;  2MIB A;  3WMU A;  3F62 B;  3POK A;  4OW4 A;  5FNX A;  1FQ9 A;  4LO2 A;  3O49 A;  5FNW A;  3FUQ A;  4P0K A;  3AKH A;  1G9A A;  3A22 A;  4P6A A;  2VSA A;  4J2S A;  4USP A;  1JT3 A;  3BRD A;  1IIL A;  1V6U A;  3E8L C;  2NVH A;  3QYD A;  5BXP A;  4XFS A;  3HOM A;  3A21 A;  2D7I A;  1Z2V A;  4G1R A;  1MD6 A;  4JPZ A;  1WD3 A;  3UD8 A;  2D22 A;  1M16 A;  1EVT A;  1DLL A;  5G00 A;  3BRF A;  3I29 B;  4I8M A;  1Q04 A;  2K4A B;  1I1E A;  3K1X A;  4GAI A;  1DJS B;  4Q9G A;  3IAG C;  1T4Q A;  2X2T A;  3CRH A;  3AZW A;  5F8W A;  3HBW A;  41BI A;  3BA7 A;  1FWV A;  1BFF A;  2BEA A;  3FJJ A;  4KEK A;  2BEB A;  4LO0 A;  2KH2 A;  2IWT B;  1ISX A;  3WIN A;  2KI4 A;  1NZK A;  3KMV A;  4H04 A;  4QC4 A;  1SR4 A;  4DCK C;  5EHA A;  3QR5 A;  3BRG C;  4I1B A;  2J3P A;  1FWU A;  3OBR A;  1FN0 A;  4USO A;  2HW9 A;  5BQU C;  6I1B A;  1XHB A;  2NYY A;  1AVW B;  4GOV A;  1G9B A;  2NZ9 A;  4G6J A;  4LO8 B;  5JMC A;  1HWP B;  3NJ5 A;  1MC9 A;  4OEG A;  3BAU A;  2Q3N B;  4I7I A;  1IRP A;  4EKX B;  2DRY A;  4OEF A;  4L4H A;  5E24 E;  1DZD A;  4ZOT A;  2R9K B;  3BTA A;  2NTD A;  1JLX A;  2DRZ A;  1OQL B;  3FJ9 A;  3HAL A;  1HWO B;  4ZLB B;  1I1B A;  4GP0 A;  1BAR A;  4QAL A;  1EYL A;  4I4X A;  1HWM B;  3N7J A;  1RG8 A;  3BAO A;  4ZGR B;  3OBT A;  1N4K A;  4LO7 B;  1KNM A;  2UUS A;  4ION A;  3OGG A;  3ZX7 A;  3FJF A;  3PME A;  2FFU A;  2F2F A;  4IY8 A;  5HPZ A;  1TTU A;  1HCD A;  2KLL A;  2KKI A;  3H6S E;  1J0S A;  4WBC A;  3AH2 A;  1DQG A;  3RMY A;  2VXR A;  2AQZ A;  2DRE A;  4JRA A;  4Z9W B;  2IHO A;  1HWN B;  3CA0 A;  3VEQ A;  3FJH A;  1A8D A;  4D0Z A;  4QBV A;  3FJB A;  1WD4 A;  2LIE A;  4ISQ A;  2VXT I;  3P6J A;  3PG0 A;  4LO2 C;  3V0B B;  4FGF A;  3R4S A;  1TOO A;  5BXT A;  3Q7X A;  4MZF B;  2LIQ A;  4AN6 A;  4HR6 C;  4J2K A;  1G9C A;  1K5U A;  2ET2 A;  3NBN A;  2WBC A;  4QD2 B;  1JTC A;  1FV2 A;  1AVX B;  3CAH A;  1JT7 A;  2F8X C;  1HCE A;  3FJI A;  3IM6 A;  1AVA C;  2AFG A;  4QKR A;  3N7M A;  4X39 A;  31BI A;  3IM7 A;  3VSF A;  1BFG A;  3CA1 A;  1S0E A;  1IJT A;  3FJK A;  3UD7 A;  5JLV A;  4ISR A;  1DIW A;  2Y9X E;  2M49 A;  1ISY A;  3UJ4 A;  3ZC9 A;  1BFC A;  1JT5 A;  5D62 A;  5EG6 C;  4IY9 A;  3N7L A;  1RML A;  3CRG A;  2FO1 A;  1CVS A;  3S8K A;  4LO3 C;  3OJM A;  2QYI B; 
#chains in the Genus database with same CATH homology
 1R8O A;  3VWC A;  1FV3 A;  4QBC A;  1PC8 B;  1PZZ A;  1ABR B;  4I96 A;  4ZFU B;  1NUN A;  2ZR1 B;  5BOW A;  3I2X A;  3N0K A;  2MC2 A;  3HMY A;  3OJV A;  5FZU A;  3RTI B;  1V6X A;  1ONK B;  3NBD A;  1L2H A;  2E4M A;  4DEP A;  2XOA A;  3O44 A;  1ILR 1;  4EEE B;  1G82 A;  3CU1 B;  4I4O A;  4LO1 C;  1DQO A;  7I1B A;  3O4O A;  5BP5 C;  3V79 C;  4I3N A;  2FGF A;  1S0D A;  3N7K A;  4L4I A;  3O4A A;  4I6I A;  1IHK A;  3RSJ A;  1PUU B;  3BAQ A;  4END A;  4GAF A;  4LO7 C;  1TWM A;  2D20 A;  4R6U B;  4GOY A;  3WMV A;  1Z4S A;  5DUY A;  2ESU A;  4EB2 B;  4OWJ A;  3BAD A;  4I4R A;  2RQ9 A;  3NBE A;  4YOL A;  4CJM A;  4I4V A;  2F2F C;  3WO3 A;  4MZH A;  3AH4 A;  2FFV A;  3D7W B;  3AJ6 A;  4I1E A;  3UD9 A;  3BA5 A;  1DFC A;  4Q9P A;  4PC4 A;  3O3Q A;  4GP3 A;  4A7K A;  4X37 A;  1AXM A;  4ZA3 B;  1EPW A;  5EC5 A;  1ISW A;  4EFP A;  3MAL A;  5BVP I;  2ZQO A;  3CQA A;  3FJC A;  1FMM S;  2Z48 A;  5F8Y A;  4P0J A;  3WA1 A;  3H6R A;  4G9N A;  5FZY A;  1TFM B;  5F8S A;  3H6R B;  3VT0 A;  4XKI A;  4A7Y A;  3RTJ B;  2MLL B;  1HKN A;  3CA4 A;  1Q1U A;  1YYN A;  4J2Y A;  2HWM A;  3V0B A;  2HWA A;  1FGA A;  4I4S A;  1BLA A;  1XG6 A;  1Z0H A;  2L5X A;  3BB2 A;  4ZFW B;  1DZC A;  1RZO B;  21BI A;  4KEI A;  2VUA A;  2Y9W C;  2Y9F A;  3I2A A;  4QKS A;  1AVU A;  1BA7 A;  3VT2 A;  3V0A A;  5BXR A;  9ILB A;  3RMX A;  3Q7Y A;  3V0A B;  3PHZ A;  1ISZ A;  3ZC8 A;  1YF8 B;  2D23 A;  3CA6 A;  4JKX B;  1JQZ A;  1W3A A;  1M2T B;  2ERM A;  1GGP B;  2K43 A;  1BLD A;  4TLP A;  4OWL A;  4I4U A;  4II0 A;  4XFT A;  2AXM A;  5I1B A;  4KC3 A;  1ISV A;  3LTQ A;  3MPP G;  3OJ2 A;  2GZB A;  2D1Z A;  2FDB M;  3UDA A;  2VU9 A;  1JLY A;  3F1R A;  3P6I A;  2KI6 B;  1F31 A;  1QQL A;  2ZQN A;  3OGF A;  1CE7 B;  4I2S A;  1DFQ A;  4LO0 C;  1FMZ A;  2Y9G A;  4A7Z A;  1HIB A;  2P23 A;  3WIN C;  1QQK A;  3P53 A;  1SR4 C;  3AKI A;  2YUG A;  4X38 A;  5D61 A;  4EFR A;  1R8N A;  4I37 A;  4P0L A;  5FZZ A;  1AFC A;  4H75 A;  4JKQ A;  5DZU A;  1XYF A;  3BAG A;  3WO4 A;  4FVV A;  1V6V A;  2WRY A;  4ZKT B;  2VLC A;  1PUM B;  4OEE A;  2GO2 A;  1Q03 A;  4MZG B;  5F90 A;  4I0Y A;  4HJJ A;  5GAQ A;  3ILA A;  3A23 A;  2Q9X A;  5D63 A;  1RY7 A;  3C9Z A;  3O4C A;  1IOB A;  4F83 A;  3BX1 C;  1PWA A;  4I4Q A;  4IQP A;  3T8S A;  3AKG A;  3UJ0 A;  4I4P A;  4D8H A;  1WBC A;  1JY0 A;  4JQ0 A;  8I1B A;  3B9U A;  3JRR A;  1W3F A;  4HA2 A;  4LO3 A;  3VSZ A;  3FJA A;  1D0H A;  3CA3 A;  4DEN A;  2NM1 A;  3JUT A;  4Q91 A;  5BXS A;  1IT0 A;  3PUB A;  2P39 A;  3TC2 A;  2RG9 B;  3O5W B;  4KBB A;  3HSM A;  1BFB A;  3CRI A;  3FJ8 A;  1E0O A;  4KEJ A;  1XZZ A;  3HN1 A;  4JP0 A;  4EFQ A;  4OUJ A;  4IYB A;  2D7R A;  1W3G A;  4H9W A;  1UPS A;  4ZBV B;  3BAV A;  4X3A A;  3H6Q A;  4LO1 A;  3VUO A;  2HZ9 A;  1S0F A;  3AJ5 A;  3W9T A;  1AF9 A;  4Z8S B;  3S8J A;  1YBI A;  5BP5 A;  4IHZ A;  4QD2 C;  2QN4 A;  1S0G A;  2RST A;  3AZV A;  3LLP A;  3VT1 A;  4XFU A;  1S0C A;  2Z49 A;  3FJE A;  1WBA A;  4OWK A;  1P63 A;  1EV2 A;  1YTO A;  2X2S A;  3AH1 A;  1TP0 A;  1JT4 A;  3O4D A;  5BQU A;  2K8R A;  1ITB A;  1G9D A;  1TIE A;  1SZ6 B;  3FFZ A;  2NP0 A;  5B2H A;  1S0B A;  4G9M A;  4G6M A;  1YXW A;  3BAH A;  5DSS B;  4UY4 A;  3Q7W A;  1K5V A;  1T9F A;  1QXM A;  3EF2 A;  3O4B A;  3AKF A;  2D24 A;  3IM5 A;  1II4 A;  2VSE A;  3FUO A;  3A07 A;  4D0T A;  3BA4 A;  3CA5 A;  3NBC A;  2DS0 A;  1VCL A;  2I1B A;  2AAI B;  4J23 B;  4F34 A;  1V6W A;  4IZX A;  1IRA X;  2BFH A;  4J2X A;  2D44 A;  4JAW A;  5DVH A;  2NS2 A;  4I4Y A;  3WO2 A;  4IZE A;  4ZFY B;  4QO3 A;  2E4M C;  3FGM A;  1TWE A;  3ZXG A;  3FJD A;  2D43 A;  1S0L A;  3ZXD A;  3IIR A;  3R4U A;  1BAS A;  4AN7 B;  3SNV A;  2MIB A;  3WMU A;  3F62 B;  3POK A;  4OW4 A;  5FNX A;  1FQ9 A;  4LO2 A;  3O49 A;  5FNW A;  3FUQ A;  4P0K A;  3AKH A;  1G9A A;  3A22 A;  4P6A A;  2VSA A;  4J2S A;  4USP A;  1JT3 A;  3BRD A;  1IIL A;  1V6U A;  3E8L C;  2NVH A;  3QYD A;  5BXP A;  4XFS A;  3HOM A;  3A21 A;  2D7I A;  1Z2V A;  4G1R A;  1MD6 A;  4JPZ A;  1WD3 A;  3UD8 A;  2D22 A;  1M16 A;  1EVT A;  1DLL A;  5G00 A;  3BRF A;  3I29 B;  4I8M A;  1Q04 A;  2K4A B;  1I1E A;  3K1X A;  4GAI A;  1DJS B;  4Q9G A;  3IAG C;  1T4Q A;  2X2T A;  3CRH A;  3AZW A;  5F8W A;  3HBW A;  41BI A;  3BA7 A;  1FWV A;  1BFF A;  2BEA A;  3FJJ A;  4KEK A;  2BEB A;  4LO0 A;  2KH2 A;  2IWT B;  1ISX A;  3WIN A;  2KI4 A;  1NZK A;  3KMV A;  4H04 A;  4QC4 A;  1SR4 A;  4DCK C;  5EHA A;  3QR5 A;  3BRG C;  4I1B A;  2J3P A;  1FWU A;  3OBR A;  1FN0 A;  4USO A;  2HW9 A;  5BQU C;  6I1B A;  1XHB A;  2NYY A;  1AVW B;  4GOV A;  1G9B A;  2NZ9 A;  4G6J A;  4LO8 B;  5JMC A;  1HWP B;  3NJ5 A;  1MC9 A;  4OEG A;  3BAU A;  2Q3N B;  4I7I A;  1IRP A;  4EKX B;  2DRY A;  4OEF A;  4L4H A;  5E24 E;  1DZD A;  4ZOT A;  2R9K B;  3BTA A;  2NTD A;  1JLX A;  2DRZ A;  1OQL B;  3FJ9 A;  3HAL A;  1HWO B;  4ZLB B;  1I1B A;  4GP0 A;  1BAR A;  4QAL A;  1EYL A;  4I4X A;  1HWM B;  3N7J A;  1RG8 A;  3BAO A;  4ZGR B;  3OBT A;  1N4K A;  4LO7 B;  1KNM A;  2UUS A;  4ION A;  3OGG A;  3ZX7 A;  3FJF A;  3PME A;  2FFU A;  2F2F A;  4IY8 A;  5HPZ A;  1TTU A;  1HCD A;  2KLL A;  2KKI A;  3H6S E;  1J0S A;  4WBC A;  3AH2 A;  1DQG A;  3RMY A;  2VXR A;  2AQZ A;  2DRE A;  4JRA A;  4Z9W B;  2IHO A;  1HWN B;  3CA0 A;  3VEQ A;  3FJH A;  1A8D A;  4D0Z A;  4QBV A;  3FJB A;  1WD4 A;  2LIE A;  4ISQ A;  2VXT I;  3P6J A;  3PG0 A;  4LO2 C;  3V0B B;  4FGF A;  3R4S A;  1TOO A;  5BXT A;  3Q7X A;  4MZF B;  2LIQ A;  4AN6 A;  4HR6 C;  4J2K A;  1G9C A;  1K5U A;  2ET2 A;  3NBN A;  2WBC A;  4QD2 B;  1JTC A;  1FV2 A;  1AVX B;  3CAH A;  1JT7 A;  2F8X C;  1HCE A;  3FJI A;  3IM6 A;  1AVA C;  2AFG A;  4QKR A;  3N7M A;  4X39 A;  31BI A;  3IM7 A;  3VSF A;  1BFG A;  3CA1 A;  1S0E A;  1IJT A;  3FJK A;  3UD7 A;  5JLV A;  4ISR A;  1DIW A;  2Y9X E;  2M49 A;  1ISY A;  3UJ4 A;  3ZC9 A;  1BFC A;  1JT5 A;  5D62 A;  5EG6 C;  4IY9 A;  3N7L A;  1RML A;  3CRG A;  2FO1 A;  1CVS A;  3S8K A;  4LO3 C;  3OJM A;  2QYI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...