2F2TA

Crystal structure of nucleoside 2-deoxyribosyltransferase from trypanosoma brucei at 1.7 a resolution with 5-aminoisoquinoline bound
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
158
structure length
158
Chain Sequence
b'HHHHHHMRKIYIAGPAVFNPDMGASYYNKVRELLKKENVMPLIPTDNEATEALDIRQKNIQMIKDCDAVIADLSPFRGHEPDCGTAFEVGCAAALNKMVLTFTSDRRNMREKYGSGVDKDNLRVEGFGLPFNLMLYDGVEVFDSFESAFKYFLANFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside 2-deoxyribosyltransferase
publication title Using fragment cocktail crystallography to assist inhibitor design of Trypanosoma brucei nucleoside 2-deoxyribosyltransferase.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 43
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 2.4.2.6: Nucleoside deoxyribosyltransferase.
pdb deposition date 2005-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2f2tA00
2A0KA 3O8NA 4A3SA 4JEMA 3GH1A 3QUAA 3IMKA 4RH3A 4LJKA 1S2DA 2F48A 4HX9A 4MEJA 1WEKA 3PFKA 4OHRA 4FYHA 4KXNA 2IZ6A 2KHZA 4P5EA 3SBXA 2F67A 3UQZA 2F62A 2IZ5A 1S2IA 1MTOA 3BQ9A 2PMBA 2Q4DA 3F5MA 3EHDA 2IZ7A 1F8YA 4PFKA 2Q4OA 3O8LA 3O8OB 3OPYB 1WEHA 6PFKA 4FYKA 5AJUA 4OHBA 4WL0A 4NPAA 4MCJA 2F2TA 1YDHA 5ITSA 4LJRA 3OPYA 3U39A 4JELA 3K2QA 2A33A 1S2LA 1PFKA 2PFKA 4I4IA 1T35A 4KXMA 4LJLA 2HIGA 4I36A 2KLHA 3MAJA 4KXLA 1ZXXA 2F64A 4I7EA 3HNOA 1S3FA 3O8OA 1KZHA 4U1RA 5AJTA 1F8XA 4JENA 1S2GA 4FYIA 4P5DA 1RCUA 2NX2A
chains in the Genus database with same CATH superfamily
2I9KA 2QKYA 3JQAA 2I2WA 2M1ZA 3IVAA 3A1FA 3SQDA 4C6TB 3WLOA 1ZH0A 3WYDA 1NBOA 3UJ6A 2E4UA 1GLGA 3KIPA 4D46A 1CRZA 2R48A 4LJKA 4RDIA 2M6LA 1ATZA 2FV8A 5H7XA 2OO7A 5DTIA 5H1YA 1U0OC 5HBRA 1OBOA 2PAAA 4AJJA 4ZT3A 4ZYZA 3KRTA 3KB1A 3W6OA 1KYXA 1CJUC 3ZW7A 3CO0S 3G82C 3L0ZA 1Q0TA 1ISPA 5HJ2A 2YVKA 4MO9A 2CJWB 4FIZA 5I9LA 3PLRA 2OCPA 3HVJA 4D4MA 4P3PA 4QQRA 1EBUA 4DG8A 1GVNB 2B8NA 4FBMA 3NDBB 4MV8A 3LXXA 2VRCA 4L2IA 4FTWA 1M8KA 1FP2A 4IUBS 4YCJA 1N2CE 3W78A 2Y1WA 4K03A 3C3MA 1XCBA 4XIYA 1RMTA 3C98A 1IG0A 1ACLA 1U8AA 5J2TB 3A2LA 2ZUWA 1K97A 4IOMA 4D98A 4E51A 5JTTA 1LVUA 4ZVSA 4PHGA 1U1CA 3TPZA 2FJPA 1CC1S 1AK9A 1HYBA 4ZQIA 5SYMA 4FD3A 1P1IA 4IJ5A 1U98A 3OETA 1EFUA 1P4AA 4UU7A 4XEUA 2GZDA 2O05A 4OEHA 4DEXA 1FDIA 1VSBA 2YV1A 2EGHA 2VYFA 2YY5A 2ZYDA 4Q18A 1P8AA 2RIPA 4V0KA 5TIIA 5HYVA 3T7TA 1N6LA 1ZP6A 5LQRA 4BNNA 1QIHA 3S68A 3I4CA 3LY9A 2CF6A 4NE7A 1T1SA 2EQBA 1C50A 1W6UA 5AJUA 4E14A 4YDHB 3UCFA 1CNFA 2SKEA 5DJ5A 1E1RA 1I4LD 5IF9A 3WKBA 4EGCB 5IXSA 1DRKA 2H0AA 3UJ8A 2WJIA 3QF7A 4QX6A 1YOVA 1G8KA 2X3FA 4J0KA 5D3MA 3E2MA 3YASA 3IJPA 4KRGA 3AEUB 2I7TA 1UK9A 4MS1B 1QS0B 1U3WA 3RC3A 4DIDA 5FWYA 5ILOA 1RFGE 5H16A 5DNYB 3S81A 1CUVA 3RIMA 1PSDA 2QU7A 3F3SA 2GTPA 2FF7A 2J67A 3NDRA 4MIEA 4FZVA 4QXPA 2QN9A 4XLLA 4IIXA 3NLLA 3OPYI 2GZHA 3PNMA 3OEEA 4JVLA 3W79A 1W25A 1X7ZB 3HC7A 5HK9A 3LRTA 3G2IA 3Q1LA 1U0JA 1QMPA 1EXDA 1ZR2A 4QRIA 2J5RA 3TPCA 2I2CA 2YZ7A 3CH5A 3NC4A 4ZJZA 1B14A 1GQQA 1VJ1A 3OPNA 4K9OA 4QBFA 2HBZA 3V33A 2D7CA 5LOVF 3W9YA 3DUFA 1Q0HA 3IDFA 2ZP1A 1DUIA 5M04A 1GAWA 4EY4A 1N8TA 1OJ7A 3MFQA 1QDLB 3O92A 4XYBA 3RHFA 4A0QA 1DWOA 1OB5A 1RYNA 2X7XA 3TIGA 1FU7A 3WWDA 4BJ1A 4DRYA 3AX6A 2ZJYA 4WTOA 2D5IA 1R8XA 3PCRB 3VNSA 1DRUA 5A5VA 3SN6A 4QEDA 3FPGA 5B1IA 1GR1A 2XMPA 3CUSA 2WMDA 3NG1A 3TXXA 4JI8B 4OKNA 1RMQA 2CLEB 3OZIA 1ST3A 2B3TA 3PUWA 2XECA 3J7TA 3SP1A 5HG0A 2EX4A 3TUJC 3Q3IA 1IIBA 3RVDA 1UMKA 2ZIUB 1HGXA 1N0HA 3L0IB 3UWSA 5KPJA 4CKXA 3FI0A 1K7SN 3JR7A 3NPAA 3H11A 4P82A 1J90A 3NBKA 3Q8MA 5DM60 2HTEA 1M73E 4DCJA 4Z1MD 1AHHA 2IIPA 3LQRA 4B17A 2CVPA 4K40A 1VRCA 2XZOA 5AXCA 1R7RA 4D0SA 4QDXA 3EE6A 5DK6A 2WTXA 4M0FA 1GFIA 3X3HA 1O96A 2GNOA 3CEHA 4WK4B 4N54A 2UU9B 2IP1A 3LBFA 1UXKA 1FMTA 3ZDRA 2RGGA 3M3HA 4Q1EA 2FDXA 1TYZA 2J6IA 3B7GA 4HXGA 1I4EB 2G7MC 5CNMA 3AVXA 4X6XA 3G0BA 3B1KA 1U02A 5KNBA 3CA8A 1XC7A 4K6FA 3GT4A 1PVVA 2RGNC 1KK1A 3F98A 4HMPA 1MVNA 3SBXA 4YJ3B 1D4AA 1QGYA 3C5VA 2RHDA 3DWIA 3KUXA 5FHRA 3N6RA 5IYZF 3PC3A 4CMKA 4WXHA 4X44A 1ZESA 5CT6A 3QVXA 1KTVA 1UINA 3RT1A 3DPUA 1OTXA 5JS8A 2JI4A 3SDZA 1YBVA 3KKMA 2GYYA 3IP5A 4OJTA 2D0PB 3DC2A 4U2EA 4ZGBA 4OXRA 1RQXA 2XZLA 1RWWA 3A6GA 2V65A 2C2GA 2RHWA 3BMCA 4RPIA 3AVYA 4CKBA 1Y8CA 1V5WA 1EDEA 2QTFA 3QY9A 5C9ZA 1EVKA 1JLLB 3QY0A 4AUNA 2IEGA 1H6CA 3F4LA 2H4FA 5BRAA 1BMFA 1WCIB 2H4ZA 3PFBA 2HMVA 1TA0A 2GILA 3TGLA 4C88A 2I78A 1YOBA 1E92A 1GZSA 1EH5A 1IMOA 3SJAA 1RWMA 4R5MA 1T1RA 5BV7A 1G8MA 3K72B 3ZE8A 5CM2Z 1FB5A 4YCSA 2IXBA 3CZAA 2P5UA 2JI6A 5C4IA 2X42A 5P21A 2GAFA 3NIBA 1VHLA 2QN6A 4BBZA 5HNKA 2ZJ4A 2PD3A 4LXYA 5BR8B 3A4MA 1SXJC 1A88A 1OTHA 3ZCPA 3GLIB 3T3PB 2OQVA 3QU4A 3ONNA 1KYYA 1FL9A 2F3UA 3OKCA 4TTRA 3TM4A 1MQ8B 1KE2A 3WNZA 5WRFA 3C2QA 3DVSX 2RC5A 4DCPA 4WN3A 4WACA 1UOPA 4OK6A 1I7PA 3SM3A 2Q4BA 2A33A 2IHKA 3UH1A 3ZKAA 5ADWA 1XDZA 3V2HA 3ZXIA 2ZCUA 4AMUA 1P74A 4YRTA 3ZWAA 1UIRA 3QXHA 3DOCA 5ERXA 1QE5A 3KFXA 2AVNA 4OD0A 4DAEA 3G9XA 5BSEA 1GPJA 4KAXA 7MDHA 5JHHB 4OGLA 1WBBA 4QQNA 2CCKA 3KSDO 2Y1EA 1IONA 5TJ9A 2LPMA 4PWYA 2H17A 4ZZIA 1KWGA 1DG9A 4XOIA 3GZ4A 1RZRD 5H5JA 4EG5A 4BEBA 2PX6A 4OTZA 3KM0A 2B6NA 1EP3B 1OGYA 3SJZA 3ZIAD 2GM3A 3M8KA 5H68A 4DQVA 3CV3A 4FYYA 2ZB3A 1TM7E 1W19A 1AF7A 1BX0A 1F8XA 3KJXA 4AMYA 1OVMA 1HMYA 4JYPA 1JDJA 2X0EA 3ANTA 4CG3A 5C8YA 3GLHA 4HJXA 1MH9A 1S2GA 3S2FA 2O8BA 2AUTA 1MA0A 1M9NA 1GNPA 2IEIA 2WJPA 3M5PA 3N7TA 4JUCA 3H17A 5IN4A 3V55A 1Q1BA 1WM1A 2WSYB 2X6TA 4DKJA 3K09C 4MW4A 4FGZA 2IOQA 3NNNA 1DP4A 3QZUA 3VKFA 1G19A 2N47A 1WB6A 1QQ7A 1ECLA 4B84A 2JZCA 3IQFA 4BEJA 2Q5JA 4HEJA 4I4TB 2Y76A 3GO4A 3RYFA 5KSZA 1LI5A 1VXOA 1QHIA 3ANSA 3N2LA 3SBOA 4W82A 1J8DA 4QGFA 1XL0A 1Y4SA 1BJKA 1OKKD 1MGPA 5IAEA 3UUEA 3SIRA 5EPOA 4L3WA 3TPFA 1LK5A 2O54A 1YFKA 4OSOA 2ZAOA 4G9GA 1ABFA 3VU1A 5C7YA 1DT5A 3QYAA 5K3DA 2AW3A 3ZLUA 4BFZA 2J87A 3WLEA 5CDTA 3R24A 2VBGA 4JASB 1ZJ5A 3Q9LA 1WXGA 4RTSA 1B93A 1B00A 1URPA 2LIVA 4H7PA 4QYMA 3RG8A 2B83A 3BHNA 1Y7TA 3FBWA 2C07A 2QYOA 3LWDA 4JUAA 5AOBA 4DV0B 1K1EA 1SUWA 2WFAA 1EWKA 2A8YA 2J3DA 3GJRA 5IT0A 4KR7A 4LC1A 1VIDA 3CVOA 3ZGNA 5JNRA 3IBYA 5SY6A 3UA4A 5H3CA 4E7PA 1P9WA 2JIRA 4K88A 4KVFA 4DADA 1SZCA 1LS1A 2UVPB 4LOJA 4DDWA 2YXDA 2E5FA 4HAUA 4TMTA 3I9LA 3S6JA 4E5MA 2GJ4A 5LQUA 2BIFA 2WF9A 2WW8A 3GGJA 3NRBA 1Q0SA 4GGMX 4BB5A 2BGKA 1I3CA 4DLUA 4NHEA 4P7KA 3B6EA 4IS2A 1IBLB 2YHIA 5IKPA 1QH8B 3HVUA 2WWTA 1ZC4A 3CC8A 1KAQA 4MCHA 4CFYA 3H86A 3OF2A 3SF8A 2FHPA 1V6CA 4ZVPA 4BQFA 4RGBA 5DHAA 5CB4A 3L5OA 3SLKA 3NVDA 3QKSA 2EIHA 3ZLJA 2I2FA 3FCXA 1TTTA 2FG6C 1R12A 1PJAA 3QX7A 1HZZA 1FJ2A 2HTFA 4L5AA 3INGA 5DK4A 3TWOA 2IXGA 4F45A 4FOSA 3KT0A 1KBZA 1B0AA 1G8YA 1QJCA 1QHGA 2VAMA 3AFGA 3KWJA 4UE2A 1N6IA 2P0EA 1OLSB 2EF0A 2WYIA 5AVOA 1GXSB 3CF4G 4LZLA 1QIMA 1T2VA 4GBED 1Z2EA 4X1IA 1Z4KA 2OVFA 5I6DA 4RTRA 1ZGZA 1QIFA 4N5HX 3KPUA 4KFRA 4N8DA 1RTKA 3PQFA 1I14A 4KNYA 2Q4RA 1JSRA 1U7XA 1Z73A 3IE2A 1JSXA 2OM6A 3QP9A 4TTPA 1CF4A 2GBLA 4F84A 4MV4A 4ARVA 2QV0A 4JD5A 3EUEA 4MGEA 1M5TA 4LE2A 4DBLE 1RP7A 3D1LA 5E6RB 4RD6A 2HMTA 2C04A 3FYCA 1ADBA 1U11A 2UVDA 4KLZA 1M33A 3OZRA 4ESHA 3T94A 3FDXA 1TTHA 4DR6B 5HQ3A 3KYDA 2PZKA 3IUPA 5CT8A 1C30B 4ARAA 2IQ5A 3O1LA 2VWHA 4PBTA 2E87A 4KQGA 3WKEA 1C1XA 3X2EA 4AJ2A 4BYGA 4ICIA 5JS7A 4D80A 1BHSA 2FSSA 1ECBA 1QK5A 2NNWB 2QJOA 1CQWA 4XRRA 1Y5RA 1QIKA 3H9EO 1HDGO 3BE8A 1Y8AA 3HXLA 3KOOA 4AU1A 1GGEA 1NT4A 1GPMA 2RBGA 3W3AA 1S96A 3KWFA 3S5JA 2TYSB 2VIIA 3QWFA 1FW8A 1NVGA 2EERA 2WRZA 4BUZA 1AHPA 2EX0A 2E18A 3VDMA 1Z2AA 3MOIA 1ZVQA 3RVJA 3GJYA 1PN3A 5K99A 5FDFA 2AEJA 1P4HA 3RJZA 4MVWA 1Z6AA 2EKZA 1E9VA 4ITUA 1ORTA 1C7ZA 2HV9A 1NLFA 1O95A 1Z25A 3WHKA 2QA5A 1UK8A 1GAQA 1QOPB 2W6PA 4AJ4A 2Q8PA 2W58A 4JL6A 4FX2A 1PL7A 3N8GA 3PC8A 5MN6A 3KJHA 3Q3EA 3DEHA 3BWXA 1SCQA 3H4TA 4ZIRB 4E88A 2CFRA 3BK1A 1W35A 2K87A 3AKZA 2CV2A 2VHTA 4H9GA 3R40A 5K8UA 2YMPA 2CCGA 1WKCA 3KOYA 4TSFD 2IH4A 4FNOA 4YJ2B 3KDSE 3WGTA 4W99A 4DR1B 3VHXB 1D9XA 1VA4A 2AS0A 3ILYA 2AD5A 4E07A 4WBNF 3DR3A 3HXMA 3RIEA 2OCIA 2XX3A 3TIXB 2H65A 2F90A 4Q00A 1JSZA 3K9HA 4XB2A 2HJHA 2CFCA 4LMBA 1ZMRA 3S5UA 2LUOA 3KHUA 3C8MA 2ZRCA 3REQB 3DE1X 1UFKA 4Z2AA 1US8A 1AGRA 1K08A 3RU2A 3UTDA 1YFJA 4F4UA 1GOTA 1Z08A 4V0OA 4D9KA 4ZOQI 2IYQA 1PR6A 4NPHA 2OHIA 1T5BA 1JILA 4M22A 3R0ZA 2N42A 3HJTA 3UGKA 2QL6A 2EJTA 1R0SA 2WI8A 1EKXA 3IOCA 3L4EA 3PX2A 3NIWA 4HB3A 2VPXA 5FJIA 4UBOA 4AWBA 2GX6A 3O7MA 4MUYA 4L6AA 1T36A 1FFEA 1SXJB 3SLGA 4EPYA 4M60A 5KTRA 1SHKA 1MX3A 2BI7A 3RAGA 2NZ2A 1GPAA 5B1EA 3D2LA 3ZTYA 3TUZC 2GJ8A 1CUEA 3F7NA 1HNWB 3UT0A 1JEQB 1OXBB 4OP1A 2PGAA 4KP7A 5LZ5A 5TMBA 3RYHA 4IRMA 4LV5B 3V3KA 5IJAA 3WNVA 3EZGA 2R1TA 1JEEA 4TUYB 5J5CA 4PSVA 3SF0A 3MLEA 3GUZA 2AUMA 1JTFA 3RTAA 3TEMA 3P4UA 3FCEA 4HPWA 5E1DA 3AHEA 3VZBA 4CKCB 4B7XA 13PKA 3ZHXA 3K5HA 4I8IA 5EWJA 3HJUA 1ZM9A 5K5EA 3LRXA 4PLPA 2EFYA 1YHNA 3DBIA 4TKLA 3TGWA 4EDHA 1A8QA 1I3LA 4P7JA 4CL8A 3ZG6A 4HWGA 3KQVA 4BJ6A 3U4QB 1TZBA 5JSZA 4JKIA 1XRPA 1UK7A 4D9NA 1EPUA 2X1MA 4M88A 3DYIA 2HWYA 3P9CA 4FPXA 4HWOA 1XVTA 1EDZA 3DDUA 1W88B 5F64A 4QOJA 3AEYA 5GONF 5DPMA 5E9AA 2JGIA 3TFQA 1B7GO 2VXOA 3EGXB 3EZLA 1QHSA 2CFOA 2ZBUA 1NAHA 4B43A 4QTTB 1QFZA 2XVAA 1IXKA 2J4DA 3OQOA 1NN0A 1A1SA 2QRVB 2R7MA 3FPKA 3M9XA 5T67A 2Q2VA 3MFYA 4DC0A 4C7BA 5BSKA 2LDBA 1JKJB 2COUA 4HFRA 5U4XA 1UXJA 2AN5A 1JSCA 3CZMA 2EFGA 3E9NA 4FYXA 3UKJA 4EIWA 1X77A 4F38A 4LYDA 3WYBA 821PA 2X5KO 1ZWKA 1E9RA 3BB3A 3CHYA 1CJTC 1DAGA 2WYVA 2Y1FA 3F7MA 4MWOA 3IHLA 1EUZA 3LVRE 4KKVA 1T3HA 3IQIX 2BHSA 4IQ0A 3EY9A 3D4NA 4A0HA 1BMQA 4FYHA 4BX3A 1RXVA 3OC0A 4KXNA 4X54A 2A59A 1BKYA 3EC7A 4YRSA 3CRQA 2X9NA 1XVUA 1NMZA 2YNMC 3ACBA 2OBBA 4QM7A 2PZAA 3GRUA 3ZGZA 1SMKA 4PGGA 1CQZA 4EW2A 5CYGA 3KDAA 5F4BA 2V6FA 3Q3GE 3DEIA 4KUGA 2RKOA 3U4HA 3GOHA 4EVRA 5A2QA 1K8XB 4F6LA 4AS1A 1K66A 1PBNA 1T5HX 3CZ4A 3ENWA 4RD2A 2WAAA 2FLVA 1L5NA 4ZI7A 2C7PA 3RYIB 3QQ5A 4IF6A 2JGMA 2IYOA 1KZ1A 3TSAA 1KI3A 4KI7A 4AP5A 3OIGA 1MJHA 4JFRA 3RGWS 3MGCA 3UKDA 4G5HA 4OX9B 1SK8A 3ABZA 1XMOB 1QG4A 1KAGA 4Y2YA 1SC4A 3GZNB 2FY8A 5ITZA 4FN4A 4IOKA 3ZE1B 3QMPA 2ZTUA 1NW4A 4G0QA 2I29A 4Q21A 5JZOA 3DPIA 3Q12A 1E3DA 2VS1A 1JFVA 3MTQA 2FPLA 3ND8A 4RNCA 1QDUA 1R27A 2ZCJA 1DWUA 4KN5A 2IYPA 4G0WA 4LJAA 3BMQA 4OATA 2AZMA 3U7JA 1EFLA 1R0KA 2HPZA 3HLKA 5CHYA 5K8TA 4X66B 5D01A 1RXSA 4OU4A 3RPEA 4DF3A 3GNLA 1WPGA 3LIIA 3SHWA 3WWZA 1TZMA 5JNVA 4I1OA 3TXYA 3PNOA 2Z56A 2XBMA 2GARA 1Z47A 3DMDA 3ZOKA 4HHEA 2A9QA 3K0CA 1XOIA 3FYUA 1CR4A 2BLLA 3T9BA 3KB6A 4OAPA 2LXNA 2CV0A 1SQFA 1QG6A 2HXSA 3GL9A 3O82A 2C7QA 3OQ1A 3ZD8A 1KKUA 1BFDA 2UUBB 2ES4A 5F7OA 1VJGA 3L6EA 4MSUA 4C4YA 1HG1A 1V7PC 4XTRA 3BA6A 4HNTA 4AZ0B 3MJ4A 1JQLB 3L0CA 3D59A 3E5RA 3PNKA 4JT4A 4LX0A 4BMZA 2ZE8A 1G5RA 1JR3A 1X74A 3ESRA 3MTGA 3BRWD 4G1CA 2HO4A 1BVRA 1LZKA 3GYBA 2A9VA 3UYLA 5EIAA 3NGXA 1GL7A 4Z4IA 3C85A 4LNAA 2VF4X 1B42A 3R1IA 4WNAA 4XSVA 5E4TA 4CV1A 1UK6A 1UWLA 5TQ2B 4YO7A 4RVGA 2G80A 3HO1A 1E2IA 1OH7A 2FKAA 1KJQA 1ORWA 1PFUA 1WWKA 3A9SA 4HGQA 4M6WA 4E12A 4G0XA 1IG3A 2MSLA 1ONOA 2FGJA 4KL8S 1UP6A 2VJCA 1XTVA 5A1JA 2ZM6B 2PO7A 4N41A 1V1MA 2ZIVB 3H9JA 3R3SA 3H7IA 3HGMA 2XCOA 2ZRMA 3GFTA 2IHYA 3N05A 4J90A 4WI1A 4RZ2A 4UBNA 3A3YA 1CFJA 1UFRA 2ZB8A 2QVXX 1NW9B 1HKHA 1O5OA 5D5QA 5EYPA 4BTLA 1W8IA 4FFMA 1TF7A 4L1KA 4OUDA 4Z5XA 3CKLA 3TF5A 5F98A 3VPDA 3AFIA 4G65A 1QWSA 4HYTA 5H02A 2B2NA 2R7AA 2XMBA 4AKTA 1Q0PA 1V8BA 3G9UA 4L4SA 2XWSA 2PL1A 4KPYA 3ADKA 1JRLA 3WV4A 4WD3A 1AQJA 3NC0C 2QN3A 2I6SA 2BTQA 2OM2A 4X7RA 1NUHA 1IB0A 1CDEA 2B69A 2P2GA 1D04A 3MWDB 3OZFA 3JALB 2WPNA 4G56A 5HRUA 1Y80A 3RHSA 3TQFA 5JAHA 4DV4B 1ZHHA 2BE9A 3DPSA 2PH3A 1X1TA 1LS6A 2MHCA 2J48A 4B85A 1R64A 3V7WA 2ZVPX 3OWOA 2MT9A 1HURA 1BH6A 4HMQA 3REOA 5FRDA 1T9CA 2G7ZA 4FQ8A 3TR0A 1B3RA 4IZ6A 3S1SA 3ZXYA 1IN8A 3HJFA 3PD0A 3S27A 2I3AA 2VKQA 3AWIA 3MUFA 4WIAA 5FWXA 4CDRA 4GH5A 1SNYA 3SYNA 3NFYA 2HY7A 1JKXA 1QBGA 1FNMA 3D2BA 3LSYA 2FEXA 2NYRA 4JDUA 4GI7A 2PXHA 3ZY4A 1H2XA 1LTKA 2WNHA 4G41A 2WJAA 3GDGA 2YZ2A 4RKYA 5KTYA 3FNQA 1M8FA 4LMPA 4NDAA 3GLGB 1TUBB 1ZCJA 2QRZA 3ORYA 3AF4A 1ZK0A 1YR8A 3X1XA 4BFWA 2EDAA 5TS2A 3UXHA 1XA3A 1UXOA 2XKKA 5CLIA 3U40A 4F4FA 4X6YA 3A3PA 1JQEA 4CM4B 5JC8A 4I3FA 1FP7A 2W0MA 1G1MA 4ODIA 4PR3A 1S1MA 3SYKA 4QO8A 5F78A 1NF3A 4HLDA 4B7CA 4QYIB 2PMKA 2F1HA 2OLJA 1CF9A 4O59O 4V0MA 3C3XA 1ONPA 2C92A 1DB3A 3IERA 1LRKA 2AMVA 3WKDA 3OLQA 5A04A 3RJ5A 4WN9B 3B1VA 1FA9A 3QGMA 1U4SA 3SC6A 1L9KA 4PC2A 1KIMA 2FE4A 2O3SA 3O4RA 4FYVA 1XTJA 1Y81A 2J0VA 5JCJD 5COAA 2A1UA 1V7CA 2AE2A 4V0QA 4JBIA 1SVMA 1FDOA 5DHTA 5I9IA 1DGQA 3ROQA 4IGEA 3OI7A 2XJ9A 3RK1A 3UB3A 1W48A 3NAGA 4CT0A 2E0IA 3CONA 1H1LB 4JL8A 1GZDA 1F4PA 1AXEA 2GBCA 3K92A 4G1EB 4MWCA 4ND2A 4PSUA 1BNCA 1HORA 1SUSA 1Z4JA 2GDJA 1KVTA 3IJEB 2DQKA 4IICA 3ZNOA 3BWEA 4PCLA 2BZ1A 3NYRA 1USGA 1YCHA 3L8YA 5T8KA 5A03A 4DTCA 2RAFA 1NNSA 3B3GA 3LKBA 5HGXA 1NVKA 2XF2A 2H3EA 4C22A 1VPTA 6GPBA 1OB2A 4I8DA 1GZVA 2B1QA 3NIGB 3NTXA 1CEYA 1ZJ4A 2BGNA 4AY5A 4CG1A 2Y0DA 1PR1A 1FFGA 1X86B 1Z83A 2I34A 5LBUA 1W30A 1T1IA 2IHTA 3KFVA 1K6IA 1TM3E 1U8XX 2IWHA 5IH7A 4DV2B 2ZVJA 4TRNA 2AN3A 5KYWA 2OXIA 1H3NA 4ZQCB 2GK3A 3BWCA 4IH4A 1GAJA 1BJRE 2P75A 5EQFA 3ZD6A 3C8HA 1HEUA 1WXHA 3CNNA 3EYAA 2UXDB 2ID4A 4JL5A 5HHTA 4G97A 2O8EA 1ZOPA 2P6UA 4IXNA 5EHGA 4GRDA 5EY5B 4UTRA 3DM9B 1VYHA 5I9NA 4HV4A 1AQYA 4N4AA 1JEYB 2PUBA 1FDVA 4O4LB 4C4TA 3RVRA 3ZHOA 4LXXA 4LF5B 4K46A 4LECA 4JBHA 4NE9A 5J5VA 4LF6B 4Y2HA 3C97A 1W0KA 4LRWA 4NWIA 2D62A 1EQUA 2WLTA 2FDCA 4D45A 2V45A 3JQRA 3OCWA 4JGIA 1KDVA 3EXEB 2PKEA 1JA0A 4LE1A 1PEKE 1AB6A 1YA4A 5K45A 2WHPA 3FROA 3E7PA 4ZPXA 1YTLA 2NQTA 1G6KA 5EXEA 2NUTA 4CQLA 3T1TA 3DDWA 2Y27A 4I6EA 5ES4B 4AKHA 3SEQA 1D3AA 4BHTA 2AFHB 2WA1A 2R1UA 4FMCB 1QVAA 4GR9A 5CXUA 2R6DA 2N1BA 3JYQA 5LBIA 4BMNA 3LHKA 3EC1A 1ESCA 3EIOA 1E3WA 4C3UA 2XUOA 3O4FA 1XEXB 2A58A 1T2UA 2CL7X 4XD2A 3SS8A 4EHNA 2DG2A 5EERA 1KP9A 3AJDA 2ZRGA 3H4VA 3IUSA 1S7GA 3CO5A 1HLGA 4AG3A 3QK7A 2CXHA 3EWAA 4OI0A 1WTCA 1ZD4A 2IS4A 5KYUA 5TDHA 3TNDA 1CWUA 2ZKIA 3BRQA 4XIGS 3VYUB 2BEKA 3LKDA 4O2BF 5JMPA 5C32A 1I3KA 4TYWA 3DNMA 1M7GA 1IDN1 1KDPA 3BEDA 1IJBA 2QTAA 3AV3A 3BMNA 5FTWA 4MVYA 4ID3A 1P5FA 4F97A 1P4GA 1KEEB 1NI3A 3GQVA 1D0VA 2JK0A 4RM3A 4CVNA 1FTNA 3SKYA 2IBSA 4QLBA 4B82A 4DPKA 8LDHA 3H0CA 1OGIA 4KLNA 1L6IA 2PLAA 2WUFA 3H5AA 5IVHA 1IZYA 1GTG1 3IE1A 3B38A 3QPAA 3C87A 4N03A 1CUZA 3HYTA 3MQ4A 3QXJA 1UBHS 2CWDA 4JB0A 4NC9A 2F8LA 2OESA 4CDNA 2DPXA 1T35A 1WL8A 1YVDA 4XH9B 4HAXA 3ZQ6A 1MDFA 1IUPA 4DCTA 4DIBA 2FP4A 1ZI6A 1Y3BE 4NYIQ 2QY9A 5IFKA 4POAA 3M6FA 3QUTA 1Y89A 3JWGA 4IZIA 4X20B 1HV8A 3QE0A 2Q41A 2ZIEA 4UCFA 3RIHA 3NH6A 4JDPA 4RVHA 4FEEA 4BKUA 4XXHA 5L95A 3GZTB 3Q88A 1O4VA 3KJQA 2JG3A 1R9JA 2Y1LA 1VZ3A 3WL3A 4CMIA 5K9ZA 4P4SB 1XZIA 2PT5A 4MYHA 4IGKA 4FMDB 4EB8A 2TRSB 2XOKD 2XDQB 3EUWA 1VPWA 3FYSA 1YR1A 3WB9A 1B26A 4EYSA 2WMOB 2BRUC 1XEAA 1GZ5A 3IAS6 2VHUA 4NFLA 1VIYA 1T4CB 2R4UA 3JZAA 3EQ7A 4TLLB 3KJEA 4EGFA 4DR2B 3PXDA 1AKUA 3HSYA 1FX0B 3NJ8A 4BOYA 4C4XA 4DA7A 4DEVA 1ACJA 2APJA 1UKEA 4CKWA 2Z2XA 2YRFA 4MIOA 1A4RA 3NDIA 1LBTA 2HA5A 4Q3EA 4NZNA 4RH1A 2FRXA 4GVLA 2A3NA 4YCAA 5CLFA 1L2TA 1ZG3A 5EHXA 3PPVA 1WUIS 3HI4A 2O7SA 2P9BA 3KQQA 4YJGA 2VK2A 2WE7A 5J4LA 1NSYA 2GTIA 2OV1A 3OFND 1AE1A 2C2OA 1H0SA 2DKFA 2OHXA 4B46A 2XYHA 5K09A 1EFAA 4MJ7A 1L5RA 1LQ2A 5F3RA 3WRYA 2F7SA 2MYNA 3X1WA 1VHQA 1D2MA 1ZUHA 2X8LA 3L18A 1J25A 2RKBA 3X1DA 2D74A 5TPWB 3TIIA 1PNOA 1GDHA 1Z6ZA 2P2LA 3P5BA 3L1KA 4J9VA 5BOSB 1ULUA 1LSJA 2FUCA 2OYSA 1MAUA 1WXWA 5BR1A 1DDGA 5A71A 1Z2DA 2OGUA 2B4KA 2CXQA 3L79A 4PPQA 1H2BA 4WZBA 1NVWQ 1ZH2A 3VDXA 4H2DA 5LNK6 1U0NA 4BX0A 4Z2YA 1F2TB 4OHMA 4RNDB 1PSWA 1TVCA 4HAWA 3OE1A 2I67A 4E5PA 3AIMA 3U44A 1IEVA 3FLEA 3KKKA 5I4CA 3ELDA 5ADVA 3K96A 1M6VA 2IEAA 3OX2A 3QVOA 3T1HB 4E09A 1RQPA 5ELMA 4CM5A 4URXR 1V1JA 3EZ7A 4PO1A 2HF7A 4OI4A 3PNVA 4AJKA 1IOZA 3LMKA 4ER0A 4KMMA 3OLVA 1J70A 1QF9A 3FOZA 3FOWA 3WDLA 3O84A 5JARA 4YT4A 1V5EA 2YC4C 5L3QA 4KQFA 4LDQA 4DV7B 1UP7A 4Q9HA 3RVBA 3FOCA 3H6KA 2XB2A 4JMPA 1QPBA 2NU8B 4QG3A 4LGMA 5AVWA 5A7HA 4LXQA 2ZT8A 1J0EA 3X43A 4C6RA 3AF0A 3IULA 3PA8A 4P1ZA 5B2EA 5CYPA 1PFWA 4JYBA 2WM8A 3X1ZA 3W5VA 2OBYA 1JU3A 3D3NA 3MGKA 4KEAA 1BXZA 2D3WA 3NATA 5DXFA 3KE9A 4HBZA 5DNVA 1A2BA 5JYEA 4W9NA 2CNOA 4QU9A 2XUPA 3MJVA 2HHHB 4TWZA 4V24A 3L02A 4R1MA 4LF8B 5E3JA 1DKMA 3N6XA 4RSMA 3N2NA 4FR2A 1L5YA 1GYRA 1QIJA 1ZY2A 1ORHA 4F2DA 3D6FA 4FHCA 4RZIA 2I0FA 2R84A 5KX5A 4A0SA 2OO5C 1EWVA 1ENOA 5FEMA 3DOHA 4RPLA 1MJNA 1A8UA 2PKQO 2R6R1 4ENWA 4ZT5A 4WFJA 4NQRA 1XR3A 1JAXA 5K0EA 1VL0A 3RS4A 3R9WA 1L3BA 1G98A 1NAIA 1TAUA 4PSKA 1B6RA 2OB2A 4R6WA 1NZFA 2P62A 1W4LA 3V1TC 3FBTA 2ONCA 2XBLA 1HXHA 4JLWA 1A9PA 2EWVA 5AW2A 1HLFA 1CUJA 4ZRNA 4MRSA 1FQOA 1JL3A 2AN1A 2BKXA 4B79A 1UBTS 3ETGA 4A36A 1EVJA 2FWAA 3AJ9A 3IURA 6ADHA 4HUQB 1CUFA 1KGDA 1Q44A 1W93A 5E2BA 3SOZA 3VHQA 1Z0KA 2Z83A 2EFCB 2FSHA 3ILVA 4F21A 1S9HA 4XWGA 1Q21A 1AZWA 5B6IA 5IABA 4E2XA 3MJFA 3W8DA 3N59A 3EN0A 1YAHA 3VSDA 4F6RA 4EVQA 1I1OA 3BTOA 1KDZA 2CY0A 4TS1A 2PV7A 3EG9A 3I23A 4I1IA 5E2IA 4ZZ0A 2HHLA 2DPMA 2YMMA 3KZCA 4J43A 3QVJA 2XCLA 4JB3A 5ALQA 4Z7NB 4OGKA 4CLOA 3IE0A 2QMQA 2ZYVX 3O8QA 2EP5A 3H9QA 2PRJA 4E5YA 1HE1C 3V1KA 5HJEA 3WQSB 5AVXA 1YE8A 1Y98A 3MS7A 4LJ9A 1TYEB 5CW1A 3HWSA 4FMPA 2XVYA 3ZWKA 4BAZA 4E4YA 5AUOB 2IL1A 3E5MA 4G1VA 3VO9A 2GI4A 3QSYA 3UEOA 1NHGA 4OA5A 4CNBA 3LOUA 1F4VA 1JZQA 7REQB 3U7IA 1F0PA 2FMIA 3AF2A 1MG5A 1M34A 2E2WA 4JI2B 1ELOA 1JX6A 3MTEA 2ZJFA 4MLCA 3VAYA 1M83A 2AJ8A 5JJKA 3ZKWA 1Y5LA 1M5RA 1UMCB 4XFJA 4TWJA 3INYA 1XCOA 3C3KA 3SMQA 4DSOA 4M54A 5DW0A 1JHYA 2XAUA 3GELA 5BN3A 1NTOA 4G84A 5K3EA 2MU1A 2PRYA 3PUKA 1X8LA 4TZTA 3TRHA 3VDNB 4IMJB 1R1DA 2VK4A 1Z6GA 1CIJA 5CT9A 5I7RA 3D6JA 1C8KA 2J7PD 3MB5A 3VFDA 5ALVA 1RWQA 2PT7A 3GEDA 4HLUA 4IFTA 4K86A 4YV2A 1CUYA 1QYCA 1BGXT 2GCIA 2OWEA 3R41A 1O8BA 1WHTB 1WEHA 2WIKA 4ZO7A 5THQA 2YWRA 3HLYA 5E1OA 1LDMA 1UQUA 4U6NA 4G8BA 5ILGA 1BN6A 3N5CA 1M2JA 3C4QA 1GA6A 3BFKA 2GNAA 2CKMA 2JF0A 4BECA 3OEYA 4ZAXA 2PY6A 1UDBA 3BILA 3D8SA 3IEIA 1IVYA 3PZRA 4UVHA 5KHAA 1XTPA 3DUWA 3OPYA 5KYNA 1PWHA 2COKA 2BFBB 1U2RA 3W5UA 4G4GA 3OY7A 2IXTA 1RYBA 2EBWA 3WGJA 3CVXA 4N3BA 4AZTA 2CMHA 4B3BA 5E7QA 1U31A 4EB6B 3EXIB 4MTLA 4C0JA 4KMOA 1L0BA 1MC4A 3G8DA 4D0GA 4BATA 3PNLA 1XHEA 2OGSA 3UENA 4D56A 3D2AA 4PRKA 2QVCA 3FMPB 3ZOZA 1HLDA 2LD4A 4ZTUB 2CF5A 4YAJA 3TZQA 5C8DA 2HIGA 1CF2O 4QG7A 2QR5A 3MQ2A 1ZN7A 3H4MA 4N8SA 4RBNA 3SOPA 3CJTA 4FFWA 5JAZA 2PUAA 2INGX 2YY6A 1SUIA 3D5QA 5TF4A 4LFBB 2GVNA 3PPWA 3QLUC 4C4RA 1DIOB 4HEHA 3WSTA 3V7NA 4MCIA 1PJBA 3MTDA 1SCDA 1WCYA 5D3ZA 4QOGA 5H82A 4PX2A 1L1FA 1KZHA 1LBSA 2M6RA 2XUDA 1QU2A 3I05A 3D7MA 5HUJA 5IJ0B 5KCZA 1DC6A 4BX2A 2W6QA 6REQB 4RCZA 2VHJA 4WRRA 4J3NA 3TKAA 3CCCA 3KQTA 3DLTA 2AG1A 4HGRA 1BXRB 4QOFA 1FZTA 1UADA 1MC5A 1QH9A 4PZYA 4BB0A 4CCYB 3KSRA 4DWOA 1B6SA 4WLFA 4DDHA 2OAEA 4WNIA 4DIOA 5AW6A 4LTNA 1GU1A 1VKOA 1UXIA 2IUUA 5HUHA 2B4TO 5C7IO 4MVJE 1N9ZA 5A6SB 1IZ8A 1RLJA 2H63A 4AP9A 5LQCA 4R41A 3DYVA 2HSGA 2ZJ1A 2XMDA 2ECQA 3ITEA 2VR1A 3KLBA 4MA0A 4DY4A 1T9HA 1TU4A 4UBKA 1Q15A 4LZZA 1XXLA 4KMRA 4BRSA 4JUBA 4XLTA 2YBEA 3IMCA 4JGGA 4BWYA 3AHCA 4QYTA 1BH2A 2WT8A 2OT3B 4H6VA 1J4AA 1YNSA 4RY0A 1H4QA 2OAP1 2X5JO 3ZBUA 1B41A 3RLIA 4U5QA 2Z30A 1YZHA 5KVQA 2QVZX 4CU2A 2GWRA 2A7QA 3FVTA 4P4LA 1TJ3A 2O0LA 4YJ3F 2RD2A 2H2IA 2BGUA 2HDHA 1XTUA 5FI5A 1ZXLA 3S1AB 1R37A 2HMYB 4IXTA 5KREA 4MS3B 2G67A 3H5RA 4JT2A 1FTYA 1Y5MA 4OG2A 4YP6A 3HZHA 5J4VA 2VATA 2WUWE 3INTA 1XAHA 3LT5A 3K0FB 4MB2A 4V0SA 5KPDA 1JVBA 1IC6A 3ZWBA 2VF2A 2CGEA 1A98A 2QE6A 3C74A 4KG7A 4G9EA 4AZVA 4RKFA 1LLQA 4HYYA 1VCIA 4KQIA 4ZEMA 4WLEA 4CG2A 4FGUA 3IR5A 4AC9A 3DWGA 1F38A 1WV1A 2IOFK 3W9BA 1RXUA 3EXHA 4J8PA 4YWHA 4XVCA 5MFPA 3BB4A 1S02A 1XDBA 2X23A 2ZYHA 1YBFA 3H0KA 2J3QA 3ZBQA 5J1SB 1ZD5A 4HDRB 5AT1A 4N47A 3E1GA 4EZIA 4L5IA 1XP5A 4PF1A 3KD3A 3G2PA 4FYWA 3LDFA 4TYPA 1E6KA 3PVCA 3EPLA 3U1VA 3T1NA 2IK8A 1MJGA 1W0JD 1YQGA 4EYOA 5FBLB 1UKVY 4B32A 4YXFA 3R7SA 4EG1A 1AURA 5LP1A 3KL4A 3K30A 5C52B 4PHFA 2BCEA 3QPDA 2CXOA 1JZTA 3IBCA 5SY9A 4C43A 2CLOB 3AL3A 3D43A 3DXXA 4OXXA 4CU5A 4ML3A 1B74A 2PMWB 3LK6A 4HWPA 4JLJA 3SR0A 3VU8A 2VHXA 4HB2A 4NECA 4XPIB 3K2BA 4DIMA 2SKCA 5AM1A 3T4UA 2OFPA 4R9RA 4LJ8A 5AI8A 4B4UA 1TF2A 1Z0ZA 2YIVX 4KI0A 5T6BA 5JAIA 5CT4A 2A30A 1JKMA 3B53X 2EEPA 3Q5GA 1GUYA 2C31A 5CRIA 3HCDA 3GFFA 3KD2A 3TD6A 1Y48E 4MARA 5AHXA 4TLDA 5D87A 4ZT6A 1GZUA 1FUUA 4HVTA 4F3TA 2QUZA 2XNJA 2Q6OA 5CX1A 5KQLA 2FH5B 4JXXA 1QCDA 1MB2A 1Q1ZA 3HBFA 3U3JA 3VAAA 3OUZA 4Z7OB 3UWPA 2ZPAA 2WJHA 1BW9A 1E3QA 2PDAA 3QNUA 3ZZ0A 4IZHA 5B53A 5HIIA 1N4AA 3KQSA 1KQGA 1MC8A 3EWSA 3NORA 1OXVA 1A5SB 3IKMB 3OJLA 3GGPA 3RC2A 1PDVA 1EJBA 1CQJB 1GWNA 1L8OA 3LRPA 1C9EA 2Z0MA 1OIVA 2CXUA 3LUKA 4RK6A 1Z8FA 5FWDA 4EUNA 4I4TF 3NTRA 2QUHA 1U0RA 4JB2A 1NGSA 2PYIA 4MQFA 1GKUB 2QX8A 1NZDA 5F2NA 1TJ5A 3IMKA 3U3KA 2WUGA 3NWBA 1TAHA 3KPWA 1UMDA 1QP8A 1LPNA 1NYLA 3M70A 3OG9A 4GM4A 3OZWA 2NQ8A 3ET4A 1UKZA 1C80A 3EEYA 2V6BA 5GPBA 2SNIE 4N76A 1JPJA 3S40A 1D4FA 1I7NA 1PG2A 4RTOA 2A5JA 2J3LA 2QG6A 1GSHA 3O8RA 1IBSA 4BFLA 5EPUA 3Q2IA 2OV2A 2Z4TA 8OHMA 2W2OA 1U3UA 4G1FA 4K9RA 4RVOA 3IEVA 3PBKA 1R4MA 2SCUB 2FXIA 3HU1A 4G0MA 4ETNA 2OA0A 4C08A 4F11A 5C8XA 2E4WA 2IKSA 2PYDA 1OTYA 1SBYA 3E1SA 5EKUA 4ZI2A 3O83A 4W5NA 4B81A 2DQZA 2NMVA 3SY8A 4OH7A 2XNKA 3IUBA 3LP5A 3ZS9A 4UMFA 2RH5A 1K98A 4H7IA 3GEGA 1CUDA 3ILSA 4QJIA 4S1WA 4TQAA 1QHXA 1E18A 3ONDA 4UCXA 3WIBA 2G06A 4A9AA 2D06A 4JOSA 3HEBA 1D8TA 1Z5WA 5JFGA 1N78A 1XB2A 1TLLA 3EVFA 2EJWA 5FLKA 4QXOA 2QPOA 1EB8A 2H8KA 1SA0B 2Q45A 3QMWA 4GWKA 4L5BA 5JSFA 3WAGA 3HB7A 2H54A 1QZ3A 3NI2A 5JFOA 3IRVA 1F7UA 2QJWA 4GVXA 1P4JA 4JBYA 5DHQA 1MZPA 4TMXA 1ZYUA 3FSRA 2QTGA 2NP7A 3R23A 3NR2A 3QUCA 3OO0A 2PEYA 3MILA 3VH1A 3HQ4O 3ZGOA 4WY8A 3EDOA 3O2SB 3N8IA 4MRMB 2Q07A 1RJDA 3I9V6 1EUCB 3DHWC 5GADl 3CZRA 2XB9A 2AEMA 1BQEA 1MAHA 1FUIA 3VR5H 3ZDEA 2GMWA 4TT3D 4YCLA 5DULA 3DQZA 3L7LA 1P7CA 2VPIA 4CLDA 2P7HA 3EOZA 3HVKA 1XFAA 4E30A 1YDMA 3VGJA 1C0EA 4M3NA 2M32A 1OFIA 3GHYA 4FFOA 3QG1A 5K0BA 5TB5A 3WADA 4PV7A 1XKTA 3SS9X 5JAQA 1PCXA 2LKDA 2AR0A 4S1PA 4UMVA 2DU8A 5BMVA 3WOHA 1NY6A 4TN5A 4GYYA 3U26A 2KYRA 3FKJA 3ZWPA 1Y6RA 2FCRA 4F04A 5HKOA 4V1CI 2P1DA 3CRMA 3CLRC 1HYQA 3ZHVA 1QP4A 4HYEA 1WW8A 3Q15C 1QANA 2FWRA 3GI1A 2JCBA 2JJ8A 4Q47A 4GKVA 2AZDA 3DDHA 3D5EA 1AO3A 1J5EB 2G5TA 2IHBA 2MR5A 1OROA 1N2EA 3KSMA 4JROA 1Z8NA 5K8VA 4EG0A 1JDPA 3EDCA 1EVIA 3L0PA 1CJVC 3NRCA 2J07A 1R00A 1HBJA 3M5WA 3CR3C 2VJMB 1SU8A 2GJSA 3W6UA 1KFCB 1ETUA 2XNSA 4LY9A 1GZHB 4A8JC 2WTAA 3G7SA 5B3AA 2OPHA 2PXCA 1CEXA 1K7XB 1F0YA 2IWRA 4CMGA 4CIYA 2AJBA 5IUKC 2XLBA 1FW6A 1KMMA 2PGIA 2BJVA 2FSGA 5FA5A 4CQMB 3OUUA 3HSSA 1Z4MA 2CKDA 4QASA 5LQJA 2WM3A 4DC1A 2XTNA 3MRTA 5K7SA 3QHAA 1RLIA 4ZJYA 2WJ6A 4GRIA 4WLVA 1NRIA 5I7HA 2GN1A 1LSOA 4FHGA 2XGGA 3Q41A 4M8NE 3L6RA 1PDWA 4L22A 4OQEA 1NDUA 1FRZA 2WAMA 2J5XA 1OA1A 3B89A 3H2ZA 3OMXA 4M0KA 1C3XA 2HNAA 1Y6FA 1Q83A 4UDOA 5IZ4A 4OLBA 3A4LA 4ZKEA 3KOZA 1BDBA 1Z18A 1QPGA 5HOEA 3K70B 1QO0A 4FBLA 4JI0B 3OQBA 1JVSA 4OLFA 1RBZA 3W4JA 3TJMA 1YJ5A 4QUIA 1CE8B 4M1MA 4X8MA 2X3UA 2VNHA 4X62B 2GCNA 3R7WA 2G9VA 1NUUA 1K7EB 2GBIA 4K9KA 1YS2X 2C2XA 2Q4OA 2BR4A 4KO4S 4H3KB 5A6VA 4YJFB 2NU9B 2ZWIA 4AJHA 1ZRNA 3JQ7A 4IJ6A 4LA4A 2XWJI 1KYZA 2MJLA 2C98A 3M6VA 1CZUA 1LNSA 5A4MS 5BYBA 3LCVB 4OQMA 1SIOA 4QAQA 2V54A 4I9HA 2F2TA 3B13B 4RABA 1CKEA 2EV9A 4D41A 5D86A 5ITSA 3ANNA 4AICA 4PBRA 1CG6A 1GKIA 4WJKB 1MX1A 1E9DA 2YZMA 1YL5A 4XDGA 1NSTA 5K1ZA 1QRSA 2ILTA 2PVCA 3MT9A 4OMDA 4BVLA 4I5GA 3RS8A 2R4TA 4PC6A 4TUYF 4Y9TA 4Y9UA 3ADOA 4TV8A 4FT4A 4NJOA 4RVNA 2AFIB 1E2DA 2BFEB 1SELA 2G9ZA 4TMKA 4A6XA 4RJ2A 2E9SA 5DXJA 3OFJA 3HKBA 3H9BA 3K20A 4OK3A 7MHTA 4HRXA 2DPHA 3RLFA 5F7ZA 5JZMA 3HB1A 4RA6B 4N3NA 3W4IA 3WB0A 4W6ZA 3AGPA 2B78A 1MZVA 1N5KA 3K0AB 4OHUA 5FPKA 5H0IA 1HOTA 4RIHA 3ICWA 1BXGA 4I7EA 2VHZA 2C5SA 3N2GA 2HQ1A 1UFQA 4DIUA 2Z09A 3B1WA 3JQAB 3SICE 1Y9JA 1Z7YA 3LQ2A 2HLNA 3ZV4A 2GEFA 2P68A 3WIOA 3FMOB 2FHSA 5AW5A 4J4TA 3TBHA 3A27A 1JYFA 2WP0A 5F23A 1C4OA 1T2CA 2FPSA 5AICA 1Z29A 1PTJA 4UZEA 2WOOA 2FRDA 3SSAA 1B6GA 1AQNA 3BSSA 3PXUA 4BGIA 4JP5A 4ZFNA 5LUBA 3UBTA 1P4RA 2ZTHA 3F8WA 4H31A 5DP2A 3DWFA 4D8TA 2QMUA 1HYGA 3NETA 3SK0A 5HXAA 4F46A 4HOYA 3PYMA 3QBVA 4XX0A 5JD6A 1F2UA 5TARA 1EIWA 4R1PA 4GLBA 3VJLA 2ZYAA 4BQSA 3FDZB 3T9CA 1QP0A 3IMEA 3U19A 1NFRA 4C5BA 3O4IA 1QVWA 4UFOA 3THYA 2BJWA 1U2ZA 4L2IB 4B4VA 3EVAA 1PFGA 2H31A 1E6MA 2Z08A 5JU6A 1EFVA 5TMDA 3AJRA 4IO0A 5DGXA 3PIIA 1EEHA 1YONA 3GEMA 5DTMA 1IB6A 1T8PA 1PO7A 4GKAA 1VJDA 4KAJA 1U1GA 2FWMX 2DBQA 2WNIA 3AH8A 3KUUA 5DHPA 1DWQA 4J0DA 2FXVA 1KERA 5DCUA 3TRDA 3WL6A 4FDUA 4BNJA 4EA6A 1RJEA 2JANA 5JAMA 2VK1A 3OZGA 4QJ5A 5CW2A 1XN1A 1PJSA 2REBA 1L4KA 4LHVA 2ZI5A 4EQ6A 2N75A 3E5HA 4QA9A 4EL0A 2JDID 4ER3A 3E9MA 3QU9A 3TK1A 4RXUA 2MSCB 2HA0A 2V4ZA 4ZOAA 5K3CA 3VYSB 1C8BA 2G5PA 3U56A 3TYXA 4M1OA 4ENQA 4L9SA 3IL2A 4FGSA 4HI0E 3L1IA 4GZMA 4ZVRA 1VYVA 1BXKA 3F5MA 3T7SA 4MUGA 4XSGA 2B7CA 3IPXA 2RCNA 3OM1A 5D3MB 3H6HA 2GWHA 3WIUA 1DWPA 2J6HA 2R751 3NALA 1PX0A 4FZ3A 4OP3A 4DE5A 1KY2A 4MVJD 5CURA 5FWYB 4CN9A 2ZI4A 4ND4A 4XJXA 1SHZA 1HWYA 2PD6A 3SVTA 1J8VA 1F5NA 1HZZC 1RKUA 2OLEA 3KXLA 4O4JA 3LA6A 4TKZA 1GPLA 1U0LA 4FFPA 1GSAA 5JSHA 1XD8A 3A1TA 2GRUA 4DYHA 1WZIA 1RT9A 5D8DA 4HRAA 5EIWA 2JBAA 2Z8XA 1O08A 2BHRA 2M98A 3SD7A 2Q62A 4P0QB 3S8EA 2JIZD 3BDVA 3OIDA 4R5HA 2JAXA 4PYRA 5E6UA 4IX1A 2XV1A 3RTEA 4OBXA 3SIPA 4ER5A 4ZV7A 1N4DA 4EUKA 3AR6A 3U7FB 4B48A 4F8EA 7GPBA 3ZIAA 4PHCA 4XQGA 1KJIA 3ETLA 3V7UA 1ID1A 5BY2A 3HRIA 1IN4A 4PLHA 1J06A 4R9NA 2QRGA 1E2UA 4DCVA 5FQNA 3VR3A 2C8JA 2E4AA 4A2WA 2C7RA 2WE8A 3NHBA 2G1UA 1CY6A 1HSZA 2O7RA 1VLQA 1N57A 3IAS1 4RSHA 2GKOA 5EC8A 5FA6A 4RJJA 1SAYA 6CHYA 2H7YA 2NW6A 2FWJA 1E1KA 4AS2A 1SOWA 3O1HB 5FCDA 4JXZA 4B3CA 4X7PA 3VPBA 1N7GA 1V3QE 5JD5A 5L4LA 3HBJA 4DR3B 3G6KA 3PNQA 4CIVA 1I8TA 4FSHA 4U3JB 3H11B 2SBTA 1L7AA 1NXSA 1U7UA 3C5HA 4CETA 5AMXA 2UZIR 4B2IA 4WMLA 4MHTA 2PRKA 4M0CA 4UATA 4R3WA 1A7JA 2ZXEA 3PE4A 4GOOD 4CM8A 4DHEA 3TECE 4L7VA 4YPVA 5SZIA 2WZBA 1XWIA 2V7EA 3EJ6A 5ALHA 4Z4GA 1U7PA 1O96B 2FFAA 1WD5A 3M6XA 1CU1A 5HR5A 5CDFA 3FPBA 2Y68A 3QPVA 4B6QA 4DA9A 3SVZA 4QT4A 3EVGA 1UDWA 4MW7A 4YRZA 1O95C 4ZRMA 4DDUA 4LHEA 4CR8A 4XWOA 1RSZA 5DEOA 4A8JB 2D8AA 1SCBA 1U1IA 3LT4A 1V9CA 4RF3A 1HDOA 3IP9A 4L4YA 4JLBA 5LNK1 3PR2B 4JI1B 3UT6A 2BKUA 4RF5A 3HFJA 5TQ0A 3TTXA 3UW3A 1A27A 1MF7A 4TZKA 4J0HA 2I7XA 3C41J 2GD1O 3JQ8A 1FS5A 1GPH1 3L9WA 4P7BA 4UEOA 3ZY6A 5IG2A 3J80A 2JLZA 3E9EA 2I8LA 5LDGA 3TVYA 3QNWA 4GGOA 4Q6WA 3BMCB 4P5EA 4CKBB 1RJWA 1CR2A 3CW2A 1W85A 2PSEA 3FDFA 3IHTA 1CZLA 3LCMA 3QQPA 2AYZA 4HDKB 4UUBA 3JQQA 4IF4A 5JQGA 2C0CA 1OIWA 4WFQA 1DIRA 1M0WA 2WVJA 3HN7A 3SX0A 5DIFA 4I5DA 1JR2A 1IATA 1VJ0A 1R0RE 4H16A 2Q99A 1KEZA 1EFHA 3OA2A 4YCBA 1JDTA 1KY4A 1PNQA 5B7NA 3L43A 4IEEA 2CNDA 3UB2A 4RQBA 3PD7A 2HDOA 2O1EA 4W8HA 4BNVA 2VAVA 5DMHA 4ABTA 4B9EA 4MUBA 3AM1A 2J9GA 5JATA 4ZICA 3PQEA 2AC7A 1O5IA 4EH1A 1GRVA 1Q7RA 2GJAA 3VSCA 2EFHB 3V34A 4B09A 3NAMA 3RC8A 4S1OA 3MTAA 4GLOA 5CU7A 1H8HD 5C1DA 5K01A 4PS0A 4MRPA 4EFDA 3DTNA 2IBTA 2H9YA 4RLFA 3TRKA 2H4XA 2QRLA 2BM1A 3GG9A 2WHRA 4FUTA 1ZMXA 4P81A 3RVKA 3JZFA 5G2OA 4BDTA 3COVA 3CKYA 4KQ6A 4ECAA 2P0YA 1U2GC 4TZ6A 2JD2A 5DISB 5EJ6A 5FA8A 1JBQA 1MP0A 4UU8A 3UF0A 2JC3A 4M9CA 2WIAA 3LW8A 2D5AA 3VVBA 1MUUA 1D09A 2XCUA 3BK2A 2IE0A 4YMUA 3AVPA 1P7PA 3RFUA 1DAKA 1T0JB 1L7RA 3OAAA 4PX5A 5DSTA 1NP7A 4R01A 1Y8ZA 4ZO4A 4E32A 4U2FA 4DXAA 4BNIA 4DQUA 4GPZA 1N5JA 4HZUA 1KRWA 3DFUA 1QAQA 4LF9B 2C4MA 1CETA 1J2UA 5KHOC 3R7AA 1EK1A 1WVMA 5C8YB 3GLHB 5U4QA 3ROEA 4Y9DA 1H2HA 1E2LA 2O8BB 3VR6D 4C04A 2DCMA 2V5AA 4YTEA 2VEOA 4XM0A 5EJ8A 1QF7A 4C2BA 2YW9A 1DE0A 2GBFA 2CBZA 5CNIA 3BERA 3CUYA 1NTRA 3T0IA 1R6XA 1Q1QA 5BR7A 1E9CA 5EVJA 1VTKA 5G0UA 1IUNA 1ULHA 2JEYA 3CZCA 4TS4A 3TKYA 1PYOA 3IPAA 5IBRA 4II2A 4KZKA 2IIBA 3TZEA 1XCLA 1JYEA 3RYFB 1E2HA 3M6WA 1TJNA 3D0KA 1YRQA 3GEEA 1Y7LA 5DXAA 3W9SA 4B3FX 3HK2A 1XL1A 3KKLA 3VV2A 5BN4A 5DSXA 4L3OA 3F6CA 3TD2A 1CD5A 4QLOA 2FI1A 3ONFA 2YFQA 3FYDA 3QUAA 4JLVA 4C20A 3HG7A 2I1LA 2EW8A 3CPHA 4DLAA 3MJDA 3ZE2B 3Q7SA 3LX6A 1XZDA 2PPVA 3A4NA 5DNWA 1G18A 2AKAB 1MVLA 4MZXA 1EXWA 2JFNA 5L45A 1YHZA 1QRAA 2I4IA 2R5WA 4O4LF 2XW6A 3D31A 2OLKA 3N2EA 5KNCD 1YMQA 1VMKA 3G0DA 4E2FA 1AKRA 3N0TA 1X92A 1QORA 3UTCA 4BBJA 2PZGA 3PGKA 1U4NA 4FD2A 2FPOA 2PBLA 4J75A 1XLVA 4A26A 4MJXA 1IHXA 1G21A 1GUFA 1GRQA 1MNAA 2I3DA 3DZJA 2DKNA 4LYHA 4XGNA 3TS1A 4CTKA 5AESA 4CMBA 1CK4A 1GYQA 3CLTC 4QZVA 3Q87B 3IYLW 2F8TA 1P45A 3SYLA 5AM2A 4FMCF 3DMNA 5L6MB 1BMDA 4FLMA 3FTCA 2Y0EA 2C84A 4OYLA 3TL3A 3DKIA 1LK0A 4QSHA 2CZQA 4MXDA 4DSUA 4ZMSA 1P7YA 3D02A 4QXAA 1O6ZA 2YVQA 1GITA 1M10A 1C9MA 1YVEI 2LNDA 2OXFA 2BBTA 2CHUA 3E23A 4HFJA 1Y0BA 3RC9A 1WUJS 3I0MA 4EATA 5IK2A 1PV4A 2IZ7A 4L8WB 4CM7A 2A94A 1JJIA 2HWXA 3F2IA 3FHTA 3NP9A 5FPQA 5AM3A 1OIXA 1SKBA 3LK7A 5JZSA 3SF8B 3GLHE 1OQAA 3TZHA 4B6FA 4C3VA 2QX9A 1M6HA 2AOTA 2JKVA 3K0CC 4MEBA 4G2NA 3SE0A 2QVYX 4Q34A 1EK2A 3C7CB 3EVBA 1EIZA 3FYUC 1ESNA 3RTGA 2OXRA 3BIXA 3QKSB 3GLFB 1R4AA 4I8XA 3RM3A 4MHOA 3W7BA 7ADHA 2JFVA 2GJKA 2H7VA 1T9GS 4OB6A 3AY7A 4ZO6A 1PEAA 3RABA 4EVIA 1LPPA 2OQ2A 3VTFA 2QLFA 1GYPA 1I33A 3VNAA 4JOBA 4JC4A 2ZBGA 1JQKA 2FDRA 4Q9KA 1G0OA 4RMJA 4UE6A 5ARCA 1NE7A 2H57A 3E8XA 4X1IB 5GOTA 3CY6A 3RV4A 2ZBRA 1KR5A 2QAJA 4ILEA 1OSNA 4MW9A 1LGYA 1QO9A 2WJ3A 4UHHA 4ZVUA 3WNBA 4GDFA 3L05A 1Q74A 3ZV3A 3UK7A 4BE7B 3GJQA 3RU3A 2X0DA 1FP1D 1E96A 4CCAA 3VKGA 1ZDMA 2QPTA 4X95A 3ZDDA 3F5QA 3DLCA 3KPVA 4JGBA 5TX7A 4D99A 4RENA 4FMDF 2N9UA 4MK4A 4F85A 3C14C 3U13A 2Y67A 3BXEA 3LYUA 5HQ3B 1HE3A 1Y3CE 3IP7A 3KYDB 4OFXA 3E7FA 4P5PA 2YFYA 4PNPA 2QUBA 2ZJ7A 1Y4UA 2KQUA 5HILA 3FTQA 4J16C 4YVFA 5H3LA 3RRJA 5HM8A 5GJBA 4PN3A 4UARA 4IHAA 4AG6A 1MOQA 3M1IA 4GU5A 3JZIA 3L7DA 3K0EA 4KIFA 1TKRA 2ZE5A 1TC1A 4INZA 4LG1A 3CWQA 3NX4A 3PR1A 2EBHX 1VPLA 5JQWA 2VZEA 1Z26A 4KO2S 4O2AA 2Y1KA 2VZ0A 5JMOA 4E03A 1SVSA 3WGKA 2G1JA 4ND8A 2C3UA 5JI3E 3TLYA 5EWMA 1PEYA 2QMZA 1G2QA 1P1BA 5THXA 4RS3A 3U1BA 1HETA 2VJDA 4HD8A 1E9EA 5CDHA 3E05A 4PAGA 2IVZA 5L9AA 3TUIC 3WJ7A 3DOJA 4IGIA 4BPRA 1XTIA 3C4VA 4NATA 5KOIA 1EE2A 1X3SA 2AEEA 3G2KA 4D44A 1WEKA 1GFSA 2O0HA 1R88A 2H48A 3AF6A 1HSOA 2C5HA 3RREA 5JCOC 2H2WA 5TMEA 5FBKA 3CBQA 5AD1A 2O8VA 3FMIA 1KQNA 3T35A 3D5TA 3ES9A 3FYHA 2X41A 5IVPA 1Q6YA 2KHZA 2NUAA 2RGWA 3FE2A 4TSKA 1M74A 1JLHA 2G5CA 3DE5X 2D59A 1B73A 3TZBA 1KI2A 4KYVA 1AMOA 4UEWA 2FWIA 2OD2A 3LPDA 3SKXA 1IZZA 1S89A 5DYGA 2RHOA 5IW8A 2VCYA 3ZVLA 3MCTA 2R8XA 5LXTA 1SHJA 3HXTA 1W2WB 3TM5A 1GNSA 4V2UA 3PXGA 3MIZA 3Q3HA 3TNYA 2DGDA 1ZH6A 3ZQKA 2HZBA 1EFPA 3L7AA 2I4TA 1XO1A 4FS3A 4NXMB 4AZ3B 3K70D 1KZ9A 2DTEA 3RJTA 4BFCA 4MGZR 4FYKA 4LEIA 5TGZA 5EHNA 5A1TA 1EVZA 1N8NA 1Z17A 5ALPA 1BEUB 4S12A 5BWCA 1PZEA 1Q0LA 1AXGA 1LLCA 1T36B 4YACA 3BAFA 5F5XA 3JVDA 4XZ3A 2VHEA 5FUMA 3FRJA 3JARB 5FP0A 1NMSA 3ZR4B 2I3ZA 3H2IA 4L73A 5AO9A 3V32A 1T8SA 1MJ5A 3RYHB 3SDSA 4E94A 4GZLA 5EJAA 2PEZA 1H3FA 1SU7A 2R1TB 3UMSA 1JFFA 3BRWA 5LQMA 3OPXA 2ZJ3A 4LYAA 5DYWA 4GNRA 2A67A 3PEFA 4D7AA 1H93A 2Q5CA 1G3UA 2CNWD 3M82A 1CNMA 5T8KC 5HEKA 1NBWB 4GMXA 4UVIA 3F4BA 5EWJB 5G0SA 1Z9BA 4ZVVA 1E89A 3CLSC 4JJIA 4NCNA 3DVLA 4N3AA 3QJ5A 3IT3A 4LFAB 2YJGA 3R6TA 5BUSA 1P0QA 4TYQA 1BDJA 5DBHX 1MCZA 5JSZB 3IB3A 4DMFA 1UT8A 3KT6A 3K5IA 5TLSA 3LQYA 2IEZA 4MWBA 1QFMA 5FLEX 1U3DA 2DR3A 5TGTA 2VPYA 4BPBA 3H3FA 2DZDA 3N39C 3D6UA 4KYUA 1FSZA 2X2PA 3G02A 4JEIA 1BKDR 4IXWA 2YZNA 3GUUA 5JZBA 1SU6A 2JAUA 2IS2A 4EYGA 4KR2A 1QK3A 3L7IA 1JT9A 1GZ3A 2CWWA 2DFTA 2V74B 2WPDD 4HYQA 3WGYA 2JAHA 1I2BA 1VI2A 1C1DB 1TQ2A 4MUIA 3KETA 1OBHA 1V96A 3PJRA 3JQAD 2PT9A 2V7UA 2JAOA 4LI3X 1D2CA 1J99A 2BFFA 2EF1A 3OQPA 4G23A 1FNBA 5F5NA 4ZQGA 3ZGLA 4M7PA 2NZJA 4U2DA 1YFLA 3WB1A 1NZJA 1LSSA 1Q1EA 2PSFA 5AR1A 1W75A 1E4VA 1YRAA 2XF8A 3T6KA 3A11A 3PE6A 1KNXA 2QL7A 4KXYA 2AXPA 1DBVO 4HVLA 3NHPA 121PA 1GU0A 1Z0IA 2RJNA 3GR6A 2NXNA 3AW9A 1MV5A 1GHTA 4R8LA 2Q3HA 5CH5A 1LLDA 4FCWA 4E4RA 4QGSA 4Z7JA 3ZWMA 2C4KA 1SFRA 4JP3A 1BRTA 1K63A 4MLZA 4US1R 2ZWVA 2DWQA 3I12A 3KAPA 3U6BA 1GRRA 1X9GA 2FZGA 2ZG6A 2VRCD 3R44A 5FI1B 3TQIA 3H18A 4ZI7B 5AVRA 2OGWA 4FXPA 2B2CA 3ZDYB 1P1FA 1FJHA 1R50A 1DI0A 3MWJA 4ZOLB 5ENZA 3TW8A 4GPIB 5B6PA 2K4MA 1B4DA 3P9IA 1JTVA 1P3DA 3G1UA 4QNRA 3RASA 5FT9A 3T7IA 4RFSA 4B6JA 4MVJF 1RQ7A 2JFQA 1ZXBA 3Q0EA 5JO0A 1HZJA 3O90A 3LQ1A 2CVQA 3L8ZA 5KWVA 5B6JA 2BUBA 5EAIA 5ITZB 5JZ9A 4ZOBA 4EPVA 1SKYB 2ZIWB 5EZQA 1F1JA 4LKRA 4I4NA 1X0VA 4PANA 3OX3A 1Y7PA 2XHZA 4PCVA 3M9LA 2YZKA 4UHDA 3ABIA 3DT8A 3HYRA 1YB6A 3EGOA 2IYXA 4V0NA 3W2GA 5LUAA 4ZEXA 3GRRA 3N7AA 4WVFA 3GARA 1WMDA 1XRQA 1LLUA 3GGGA 3G5MA 4N65A 3RROA 4KQJA 3BMQB 3RSOA 2EBFX 4CDMA 2IJGX 1VE7A 3RC7A 4PIMA 5FKJA 3S8MA 3I9V1 5JCJA 2QN7A 3N8KA 8ADHA 1E1RD 4EO9A 5KOYA 1Q7BA 2KB0A 4DCOA 3K9LA 5KU1A 2G77B 3FN4A 3WYAA 4BJ5A 3QHPA 1H4TA 1XJ5A 1RRPA 3QPCA 5B1SA 3AUTA 4IZOA 4NYMQ 4GFDA 1RWNA 3FYUB 3LFUA 2DMRA 3ZWOA 1KSFX 3HDGA 2CXRA 3KZXA 3QEMA 4FW9A 3AYZB 5CLLA 2D7JA 1W2HA 1F0KA 3OEED 1RPNA 3ACDA 2ZS7A 2BFDA 2EP7A 3OTQA 2F3QA 2ZSUA 1SBIA 2FP3A 4CIXA 3SXUA 2ZSEA 1WZ2A 1XRNA 2H51A 2JIPA 2BP7A 1U99A 2B25A 2JCVA 2KBFA 2QXTA 3MS4A 1LC3A 4G89A 2HC9A 3DV2A 4L75A 4MYDA 2ONYA 4YPOA 3DLHA 2Y66A 4ID9A 3UO8B 1C2TA 4WNAB 2FMXA 1JHOA 2QJRA 4UM7A 3PJGA 2KLHA 3IIEA 3PUIA 4MRAA 4CEIB 2VH1A 3KFLA 1LLFA 4G5GA 4QFMA 4M6WB 1XLTC 4KHPB 3B6JA 3UOGA 3I5YA 2DOKA 3H2SA 3SC2A 4NV0A 3E15A 4MVJP 4HEA6 4R69A 4FX5A 3V42A 2WSMA 1V1MB 4EJMA 1S4QA 2QSJA 2PN1A 3IP6A 2VLBA 3RUCA 2HWKA 4M8IA 4WNYA 1G4UR 4KR3A 4RD4A 3OZCA 3S2ZA 3L41A 4OUDB 4BBPA 3L8CA 4B7AA 4IOJA 4KWIA 1HE8B 3PF8A 1UJ2A 1MJGM 4ZO8A 3CKMA 4PQYA 3WRYC 2IYZA 4D9EA 3TQTA 5J4KA 1AA6A 3UV6A 1NMXA 3FKSA 4Y2UA 2XE7A 2BTQB 2Z2YA 1ZK4A 3KALA 1PZNA 7ABPA 4D5EA 5HQTA 3ISVA 5HM6A 1RHRA 2C3PA 1WB9A 4KLAA 2FPWA 4YONB 1WY5A 4O0LA 3KLPX 2IDZA 5JRZA 2VT6A 3UKOA 3NBQA 3EXG1 2JGJA 2TMGA 4GE0A 3G5LA 4GYWA 1GPWB 1SRRA 4S35A 5A4JA 3HB0A 3KZ1E 4G85A 2K2WA 2HLDA 3WRWA 1CRLA 1N5OX 5AI0A 2ZYSA 2BBWA 3EFEA 2JGFA 4V2IA 4P33A 1GTMA 1WMBA 4L4RA 5JVDA 5KNBD 1L8XA 1MO3A 5EJ7A 3LWNA 3H99A 4GPTA 4JQZA 1VQ1A 4KUHA 5CIYA 4PLTA 2VK8A 2NNLD 3EIEA 4B3MB 3C39A 4I5EA 1C8VB 2VDOB 5FWXB 3JPWA 2IE8A 5CFQA 3IV7A 5JS1A 5AVVA 1J0CA 1ZHOA 2J4FA 2OHOA 3K6SB 5FIUA 5TVKA 2Z6VA 3MWGA 3V1LA 1P1JA 1PJ8A 1L5VA 1R6BX 2M9MA 3RS3A 1LQUA 3GGSA 3AUFA 2C5LA 1JR3E 3I45A 1QDEA 3GNQA 2E4ZA 1HDYA 1L7DA 1D2RA 1NOJA 3KU1A 2YRWA 1G6Q1 1QKKA 2VNSA 1GARA 2FZ4A 2ECKA 2O3UA 3CLUC 4NBUA 4YP5A 5EKXA 5KS2A 2VJYA 1Z4IA 1HR0B 1OT5A 2DM6A 1BMFD 1NOKA 3S55A 1Z2OX 4PFKA 1C9KA 1NUPA 1T8RA 5JJBA 1JG3A 1XPJA 4LS3A 4RA9A 3CGWA 3EUFA 4W9NC 3SPXA 1R0ZA 3LC0A 3CEJA 4MGKR 2R5FA 2YY7A 1M54A 4X64B 5JV5A 2DJIA 1V4NA 2ZSBA 1VL8A 2A1UB 2AG8A 2LCQA 4PGFA 4G4SP 2OCYC 4QULA 5LZ8A 3L7NA 2OBXA 1XD9A 4N6OA 4P8RA 3UVEA 2PA3A 2IUEA 2IY7A 3EISA 3KTAA 3R0IA 3VC2A 4G5SA 4W9MC 1OCEA 3LLCA 2C2WA 5F77A 4CCWA 4K9SA 4YT5A 2P2ZA 1EZZA 3TOSA 4IFEA 3IKTA 1USIA 3HFGA 4NJEA 3T1QA 1K9SA 2XOKA 1SKAA 1V16A 1EX1A 2JVKA 3BB1A 1IBRA 3BQMB 2GS9A 1TT5A 4KR9A 2VSFA 4QKQA 1RRVA 4ZVNA 1WZUA 2ACKA 4Q1CA 4R2LA 4YFYA 4ZMBA 2GUGA 4V38A 5DWDA 2GN2A 5FUWA 5L3ZA 4OB8A 1NNEA 1SVUA 1X1CA 1S01A 2JFGA 3N6VA 1CY7A 4J2OA 4XCVA 3LYAA 5J58A 2VQSA 4KRXA 1UZMA 3AJ8A 1U1EA 1IUOA 3MD9A 1CUHA 1NVVR 1NFQA 4L72A 4PAQA 3RSZA 3VTAA 2CYBA 3P2JA 3U4IA 3WLQA 5DM70 2UUAB 4L95C 3L0DA 1IPFA 4LMAA 1GT6A 1OR8A 1Y7IA 1PIWA 1W5SA 2XD9A 1DX9A 3VZDA 5CYFA 9ABPA 4QFCA 4DCUA 1XK6A 1H8EA 2G70A 4UASA 3N2IA 3SX2A 4QDOA 2CSUA 1CZHA 2LV8A 4ZZ2A 1FLNA 2B8WA 2XYVA 3ZGYA 4Q9AA 2EW1A 4BO7A 2V7PA 2C1EA 5ARBA 3IEMA 4N18A 5KYWB 2HR1A 1QTQA 5L6LB 1IHUA 2CHFA 3EASA 3KYIB 1W44A 3WWYA 3DQQA 1VCOA 4HH4A 4KQCA 1PJ4A 2XGOA 2AK2A 3RS2A 3OY2A 2TSYB 2Z58A 7YASA 5T64A 1N34B 2O8EB 2R7KA 3C7AA 1IDOA 1DKUA 4NYJR 4RH3A 2W4QA 4M9SA 1P7ZA 1R16A 4GM1A 3WMRA 1L7VC 3ADBA 4QPPA 1FVOA 1USUA 4JNCA 4N6NA 2NP6A 4NY1A 3QW4B 4IIHA 4JN6B 2QRJA 2IU4A 5H59A 3AP1A 4V0ME 2FQQA 2Z5FA 3B5IA 4MS4A 1XTRA 4GWLA 3PWKA 2CLCX 4KQMA 3F6SA 4R54A 3UJDA 1XK7A 1J6UA 2O1SA 2NUTB 3PRHA 4CQLB 3JV7A 2W8BA 4HLUC 5FLYA 4MKIA 1GU7A 5KTNA 1GLNA 3TSYA 5BWNA 2ZUTA 4MPTA 1WE2A 5FL7A 1E3WB 2O0MA 1OZHA 3I1YA 3QHQA 1P80A 3WL5A 3WYFA 1DEAA 4HDOB 3WLFA 2C3YA 2ZYTX 3PK0A 2GCEA 3CZ5A 3E9DA 2F43A 1WS6A 2WT4A 2Y0PA 3JZDA 2ORED 2NYVA 4NCHA 4KWEA 1BIFA 4PRLA 1KL7A 4H3VA 3SU8A 1MABA 5DM1A 2XNCA 1XHFA 1ZCAA 1UJ6A 2H2DA 2RDMA 5KYUB 5IULC 3LUAA 3QJYA 3JQBC 4OFBA 3T9AA 4MUAA 2Y3IA 3IQHX 1HH4A 3ZGXA 4EY3A 4BNZA 4MITA 1NRWA 3BMNB 4R2IA 3T8YA 3LXMA 4QBKA 1TAGA 1DADA 2PX3A 3AXSA 3PGXA 4M37A 3RUIA 4A1OA 4HNVA 3RARA 1C29B 2G83A 1CLEA 2W22A 4JX9A 3A1SA 1BFUA 1DDOA 1O58A 1VM6A 2F6RA 2IOYA 3TQQA 3MOSA 4CFSA 2PKXA 3WIDA 3L04A 3PVZA 1JA9A 5B2FA 1KJZA 3M81A 1YD7A 3QELB 2FSPA 3G2LA 4QVKA 1PV2A 1JKIA 4ZEWA 5CG2A 1H2RS 2JFWA 1VPDA 1VLLA 1LTHR 3TOZA 2FP4B 2WYUA 2D0IA 4XQ0A 3IB6A 4CHGA 1I2AA 4XIJA 1Z8DA 2H11A 1P2DA 4YJHA 3RR2A 3V4ZA 3VZSA 4EKDA 1FMFA 4DB4A 3T52A 1GN8A 3IDSA 3VGPA 1YQUA 3AVTA 2IZOA 4D4JA 1C7IA 4B33A 2J5KA 4CMIB 3AQ4A 3LIPA 3W8RA 1OLOA 1W29A 1W6RA 2PSDA 2SKDA 4KWHA 3FGZA 1TPYA 3GU3A 2NYAA 2I7DA 4FC6A 1ZFNA 3G2MA 3WZLA 4RESA 3LGXA 1QU3A 1RYYA 2NVWA 1AIPA 4WY2A 3JASA 4Y6LA 3JTMA 2PGLA 1U0TA 2B92A 3FWNA 1SULA 2VDKB 4H4CA 1XZEA 4IMRA 4IIBA 3TX6A 1WHSA 3UG6A 2A5LA 3FA2A 3U3RA 4PZZA 4CM3A 3DEFA 2D1SA 3D6VA 2FOIA 1KO7A 4CKWB 3WL4A 3VA7A 4CF5A 4H60A 1T0BA 2YOHA 4GOMD 1Q91A 2CDNA 5ALSA 1EFRA 1C3VA 2UZ4A 3BQNB 4YJGB 3PC2A 4RPKA 1AXRA 2NZ8A 4BMYA 4BO5A 1P81A 2WF7A 2YYYA 4OMCA 4QDJA 3UWDA 1DFIA 1ABEA 1DJLA 1N1DA 3EK2A 1D1PA 2ZRDA 1J1IA 4LVNA 5TEWA 5AQEA 3WBJA 4AN1A 4CIAA 1P5ZB 2C1ZA 2C77A 2GGSA 1EHCA 3OLWA 3SFTA 3GH1A 1IXZA 1PYGA 2BI8A 3A1CA 5FWAA 5B3LA 4ZYXA 5TGDA 2FPKA 1N1EA 3T5CA 1IHDA 3DTTA 2JLVA 1CUBA 4DOMA 1QV6A 2YUIA 3SHVA 4HPXB 2P78A 2PU5A 4HBGA 2RAVA 3R3ZA 3A1NA 3L8GA 3NCHA 1QQ5A 1W5AA 3PFKA 4PLYA 4X65B 4L0DA 5FL3A 2PGOA 4XJSA 3HV2A 3DE2X 3LQFA 5CXQA 1NMYA 3G5AA 3T5TA 5BURA 2DWOA 4NZYA 3II6X 2ID7A 4U7TB 2HJGA 2BFWA 3DVAA 2FEMA 2DXIA 3QTTA 1SHTX 4U0JA 3U44B 4ALLA 4CL3A 1YZLA 2ZE6A 2C54A 4S04A 3E03A 3TEFA 4RVFA 4FMBB 1M6VB 3RSCA 3TI7A 5HE8A 4OHCA 1GGJA 3H16A 3EQ8A 2OC4A 4R8VA 4RHUA 3BBPA 3F5DA 1N2HA 3VR1A 3WWOA 2H1WA 4PFSA 2NVUA 1NI4A 1FBTA 3KLNA 5AVSA 3N3BC 4X8LA 1UEIA 2ILVA 4WESA 5KWSA 1TKCA 3QYFA 2BMAA 1FQWA 1EESA 2ASEA 4P2BA 2PS9A 3PRYA 3V6LA 5L3QB 2W6MA 3WGOA 2A5YB 3FDIA 5E38A 4Q7EA 1N2SA 3M7IA 3UJPA 4BNTA 3WGVA 2GLTA 4OQPA 3V8VA 2BM0A 5KZMB 4OY3A 4LHWA 4Q03A 4Z9YA 1MEOA 2RHTA 3VR0A 3EB9A 3FMGA 4I55A 1MC1A 2HKIA 1TUGA 1QNLA 4XDYA 1PS0A 4AMVA 1XJWA 3WZ2A 1UR5A 3H13A 4WADA 3BDAA 1SCIA 3NHRA 3WNDA 4BAGA 3NXKA 4C6SA 2BGIA 3RSFA 4MAAA 4INPA 3SYRA 3U17A 4BIIA 4YT2A 4LY3A 1I0LA 5KU7A 4LSGA 4R98A 4R1TA 3F3KA 2EKQA 2PJDA 2CHGA 1E2QA 2Z2IA 2ZSHA 1B1CA 2F8MA 3FW1A 1MOZA 4ZCPA 2GPYA 1W5EA 1T5OA 4FZ5A 5KX5B 1KO1A 3UAGA 1K68A 3B9QA 3ZZMA 3NUQA 3UAWA 5BNZA 3DCJA 2GNPA 4FU0A 3S2GA 4ASUA 1HDXA 1QYDA 1ZI9A 5CFMA 3L01A 2EL7A 1FFDA 2IU0A 5FUVA 3QXGA 1LK7A 4TRRA 3AUJB 3U5ZB 3OZEA 1F3LA 4K9QA 5IAOA 2CCJA 1XJQA 3OT1A 3F6EX 1YRWA 1IBMB 1W4BA 3ENQA 4Q01A 4YRBA 2QT1A 4HFNA 2JJ1A 2OKGA 4WZBE 4F2WA 4K6GA 1RXYA 3WL8A 3UAYA 1E7QA 3SBEA 2YWXA 1T26A 3DV0B 4IH9A 4P54A 4Z0PA 1HL7A 1BHO1 3OZXA 3JAWA 3DZGA 1GKYA 4U1RA 2Q7OE 1XAJA 4R8SA 1WBJB 3QE2A 1TK2A 2GYUA 4F6RB 1RRCA 1UIMA 2OZKA 4PAMA 1IY0A 3EG9B 1ESMA 1UKAA 1Z5PA 2HBYA 1JSLA 2I8CA 1XNGA 3COZA 3PQ3A 4PYNA 5DOVA 1X13A 3FMVA 1D1TA 3TXAA 4CLOB 4Q9JA 3VVCA 4FGLA 4JBLA 5FFMA 3M49A 2D5LA 3O8QB 1WETA 2A7XA 3P0IA 4PEVA 4D92A 1YS9A 1J21A 3E9ZA 1CNEA 1LY1A 3HDYA 3I42A 1ISRA 3H4IA 1WQ1R 2FEPA 5D84A 1NLUA 2CUKA 3D54D 2P69A 1GQSA 3CM0A 4PZCA 3HY4A 1RPZA 1KS9A 2G63A 1FXUA 3LU1A 2A92A 2BFNA 4U7HA 4U8HA 1U4OA 1M34B 4NEQA 4B3XA 3G2HA 1EXNA 4OHXA 3CUEF 3GCZA 1GNQA 1QJ4A 1VJ5A 3AR8A 3TLAA 3ZKWB 5F9HA 1U8YA 1WIWA 2XDAA 3RFFA 3RYCA 2EFDB 3ERCA 1K89A 5BN3B 4PQRA 2HB6A 1P77A 2AUNA 1BX3A 2E85A 3CE9A 4LRUA 4A1FA 5J47A 5CPBA 1QC5B 3AW8A 4KX5A 3EPHA 1D4OA 1DAFA 5CEEA 1E2KA 2EQ5A 3T7AA 2PBRA 4UAJA 1H9BA 1MMFB 3HKCA 1S8OA 3B3FA 2FPGA 4ITVA 3FPAA 3GFGA 2C2KA 5KC8A 3QI7A 1DFHA 1HEYA 3OJWA 2Z1MA 1GTL1 1TVMA 1CRWG 5HF5A 4AVYA 4B5KA 3TRIA 3PQDA 4BFVA 3ZNQA 3VJKA 1SBNE 3CPSA 1JG2A 1O5TA 2RBKA 1L4FA 1O3YA 2RIRA 3B20A 2G5GX 3LPLA 2WTNA 5BSRA 3ZE6A 1PD1A 4QTXA 1UPTA 3QA3E 4OQQA 4GBGA 1L4HA 3LBYA 2IC5A 3Q7TA 3F49S 3CH4B 1GD1O 3QU7A 1M75A 2PUWA 2VA8A 4OL9A 1GTVA 2PX5A 3BH0A 3BWDD 3OPYB 5JISA 1BZYA 4CEHA 4D6XA 2B99A 2JGKA 3EUAA 1Y1LA 4JI6B 2GZ2A 4BFSA 1H9AA 5L8VA 2AZ4A 4YS6A 2Z57A 4DNPA 4LYGA 3I64A 1MPTA 1XKQA 1D6JA 1O2DA 2X5NA 3GY0A 2V0CA 4K1LA 3COPA 2WTEA 4TM7A 3WDSA 1UCFA 1KY3A 2IP2A 4J6FA 1ECPA 4R2HA 4U7FA 4CODB 3LBHA 2Y9MB 4FDVA 3VM6A 1PT8A 4E6EA 2WB4A 2QD1A 2GBGA 4L16A 2IYEA 5GINE 5AVUA 5DTRA 4R1UA 1PHRA 4YHBA 2Q21A 3CF6R 1OH8A 3A9CA 3OX4A 1HC7A 4HAVA 5IAJA 1IJEA 1AJEA 1W5TA 3VC3A 1U9IA 4KGDA 4YRDA 2O2ZA 2PHZA 4DVGA 5JR3A 3ZJVA 1SQ5A 1IJKA 1PJRA 2V98A 3GFPA 3STXA 5IKXA 3L93A 2W9XA 3ZV5A 4CLRA 3ELWA 1JR3D 3A1DA 1LV8A 1I9GA 5E7MA 1XHLA 3K6JA 1JXOA 4YUVA 1JAZA 1E66A 2DFPA 1CQXA 1NULA 3SI7A 2VPQA 3A9UA 3B6ZA 1DUSA 4IIVA 3HFSA 1I01A 4QEZA 4MUMA 1W9HA 2BTOA 1NDQA 4RMIA 1PI3A 4OSPA 1U6JA 1UAYA 2Q2WA 4ZT4A 3NCTA 1OU0A 1U81A 3VZRA 3ZK7A 3NWPA 4GOXA 4HNUA 5K0LA 4OBBA 1D1QA 5AXBA 1TECE 3OICA 1PZXA 1TM1E 2LCIA 2HJRA 2AJTA 4W1QA 4F7WA 3THXA</