2F2VA

Alpha-spectrin sh3 domain a56g mutant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAGYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title Cooperative propagation of local stability changes from low-stability and high-stability regions in a SH3 domain
pubmed doi rcsb
source organism Gallus gallus
molecule tags Signaling protein
total genus 12
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2005-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2f2vA00
3H0HA 1AWOA 2PZ1A 4RTVA 1K0SA 2RF0A 2DA9A 1E7OA 3GBQA 2FPFA 1AOJA 3QWYA 2EQIA 2RPNA 5I22A 4OMLA 1OEBA 1G83A 1NEGA 2EGAA 2YUOA 5IH2A 3UF4A 4J9CA 1AEYA 3TSWA 3H41A 1GFCA 2AZSA 1N5ZA 3A98A 2VVKA 3M0TA 3VS4A 1LCKA 2OJ2A 3VS1A 3VRZA 4LNPA 5L23A 2CUBA 2NWMA 1ZUKA 1UDLA 1AZGB 2D8HA 2JS0A 1QKXA 1WI7A 1AD5A 2DRMA 2XMFA 1G2BA 2EPDA 2AKLA 2DX1A 2KXDA 2KR3A 3H0FA 1GCQC 3C0CA 2DVJA 3O5ZA 1UGVA 4JJDA 1UTIA 2LJ3A 2F2XA 1X6BA 1CSKA 1K76A 2E5KA 3FJ5A 4JJBA 1A0NB 4JZ3A 2ECZA 4M4ZA 2J7IA 2PNIA 2FG0A 2O88A 1AVZC 1GCQA 2ABLA 2CUDA 4OMQA 2HEQA 4QT7A 1VYVA 1T0HA 1T3SA 1YNZA 4ORZA 5IHNA 3THKA 2CREA 1KIKA 2DL3A 1H3HA 2K2MA 2L3QA 2EGCA 1WLPB 3I5RA 2RNAA 3LH5A 2GQIA 2ESWA 4RTUA 2YT6A 2YDLA 2A28A 5GJVB 1CKBA 1H92A 1UHCA 4HVVA 4LN2A 3PVLA 1CKAA 3VRYA 5IHIA 2F2VA 4J9IA 2DL5A 1JXOA 1NG2A 1SPKA 4Z88A 2DF6A 2EYZA 1WA7A 1ZSGA 1SSHA 1PRMC 2RQUA 5FWBA 1TUDA 2O2OA 1JXMA 1ZUUA 2CSQA 1QCFA 3VS6A 2EGEA 4Z8AA 2FPEA 2RQRA 1TUCA 1UG1A 1I07A 4CC3A 3EHRA 1ARKA 2DL8A 1ABOA 1U5SA 1X43A 2JS2A 2LP5A 1AWJA 1V1CA 2QDLA 1RI9A 1X6GA 1FMKA 1HJDA 3ZL7C 2LJ0A 3EG2A 4DEXA 3TSZA 2M51A 2CT3A 1JU5C 2DILA 2HCKA 2J06A 3EG3A 3H0IA 4RTTA 2KT8A 2A37A 4J9HA 1K9AA 1K1ZA 2KROA 2DYBA 2ED1A 3EGUA 2RQTA 4AFUC 1IO6A 2J6FA 1Z9ZA 1B07A 1MUZA 2JT4A 4F17A 2JMAA 1W70A 1T0JA 1JO8A 1X2KA 2D0NA 2KXCA 1PRLC 1E6GA 4HVWA 2K7AA 1M3BA 1UHFA 1S1NA 4OMMA 1HSQA 1M30A 1YWOA 1NYGA 2G6FX 3TVTA 2J6OA 2IIMA 2JW4A 2SRCA 1SRMA 1RLPC 4GBQA 5EC7A 3UA7A 1JQQA 2O9VA 3QWXX 2EKHA 2EW3A 2DLPA 5I11A 1BB9A 1BBZA 2OAWA 2FRWA 5FW9A 2KT1A 1I1JA 4X1VA 2FEIA 1VYUA 2CH4A 1UJ0A 3VS7A 1K4US 1J3TA 1JEGA 4AFQC 2YUPA 1OPKA 1W6XA 3EHQA 2BZXA 2OI3A 2FPDA 2HBWA 2A36A 1OOTA 1YN8A 3CQTA 2W10A 2MOXA 3RNJA 2ED0A 2JMCA 2RN8A 3M0QA 2A08A 4AG1C 1ABQA 2L0AA 2KRSA 1PKSA 1OPLA 4GLMA 4F16A 2NUZA 2AKKA 1WYXA 4D8DA 3REAB 4CC2A 2O9SA 1GFDA 1NLOC 3EG1A 1HD3A 4J9BA 4ESRA 1T3LA 4R0KA 1TG0A 1WDXA 2AZVA 2KYBA 2DL7A 4OMOA 3M0SA 2VWFA 2M0YA 3VS2A 1E6HA 2HDAA 2ROTA 3NGPA 2MCNA 2LJ1A 2DBKA 4KRTA 4JJCA 4K11A 1PNJA 2DJQA 2MIOA 4FSSA 1W1FA 2DBMA 2EVRA 1RLQC 4LUEA 4RTXA 3U23A 2RMOA 2D1XA 4RTWA 5FWCA 2L2PA 2JXBA 1WFWA 2K79A 4WCIA 1RUWA 1ZX6A 3M0UA 1WIEA 2DNUA 2LNHB 4AFSC 4DEYA 2DL4A 2L3PA 2YSQA 2CT4A 2RQWA 1UJYA 2LQWA 2H8HA 2CDTA 1SHFA 2BZYA 4CC7A 4LUDA 1GL5A 2JTEA 1WXBA 3REBB 1KFZA 3I9QA 3I5SA 2LMJA 1M27C 3VS0A 1UE9A 2GTOA 1X27A 2GGRA 5IXFA 2DMOA 1YCSB 1NLPC 3RBBB 4HCKA 1AWWA 2JM8A 4Z89A 2P4RA 1NYFA 2DM1A 4RTYA 4OMPA 1QWFA 2GTJA 5IHKA 2HSPA 2LQNA 2V1RA 4Y92A 4J9GA 3R6NA 1UECA 5ECAA 2J6KA 4IIOA 4RUGA 2AK5A 2ROLA 1U3OA 1QLYA 1AWXA 2SEMA 2ENMA 1NEBA 1M3CA 1WXTA 3UATA 3I35A 1B3QA 2CH4W 3IQLA 2X3XD 2PTKA 2BTTA 2EBPA 3ULRB 1WX6A 2FO0A 3VS5A 2YUQA 1SHGA 3NHNA 4CC4B 1BK2A 2DRKA 4J9EA 1MV0B 4D8KA 2KE9A 1X69A 1U06A 4EIKA 1H8KA 3PVQA 3JV3A 1WXUA 1MV3A 2KEAA 2L3SA 1GBRA 3VS3A 2B86A 4E6RA 3SEMA 4HVUA 2LX7A 3KFVA 3PE0A 1PWTA 4JZ4A 2C0IA 1NM7A 1EFNA 2EYXA 4RTZA 4ZNXA 1UFFA 1PKTA 1Y57A 2K3BA 2LZ6B 2GBQA 1GBQA 2KYMA 1VA7A 1KJWA 1YP5A 1ZLMA 4HXJA 4J9FA 4LE9A 2F2WA 2LCSA 1M3AA 2JM9A 2KRNA 5IXBA 1PHTA 1VYTA 1AZEA 1GCPA 2KNBB 3UA6A 2KBTA 1OV3A 4AFZC 2C0TA 4A63B 2X3WD 2D8JA 2V1QA 3M0RA 2C0OA 3EG0A 2GNCA 3NMZC 2I0NA 2YUNA 1FYNA 2KRMA 1UUEA 3M0PA 1X2QA 1QKWA 3SHWA 3NPFA 2EYWA 2K6DA 2CSIA 2DE0X 1BU1A 1Z9QA 4IIMA 4F14A 1Y0MA 2W0ZA 1ZBJA 1YWPA 4OMNA 1QWEA 2K9GA 5HCKA 4AG2C 5GJWB 1K0XA 1M8MA 1SEMA 2O31A 2BZ8A 2KGTA 2VKNA 1KSWA 1I0CA 1ZUYA 2FRYA 2RQVA 1XOVA 4J9DA 2EYYA 1GRIA 1SRLA 4JPBW 2J05A
chains in the Genus database with same CATH superfamily
1QCNA 1MMNA 4PJOB 4RTVA 1K0SA 2RI2A 4C92C 1E7OA 3GBQA 3OS5A 5DM7R 2LX9A 4XAXB 2P0KA 3HRUA 5GMKi 3PIPA 1IRXA 2WSFE 4J9CA 4PJOG 3H41A 2AZSA 3V7SA 1RABB 4OMFB 3A98A 4FL6A 3VS4A 2MF2A 2QAZA 2DEQA 4J8OA 5LJ5e 3CMET 1N8RC 4NL3A 2XMFA 1G2BA 3CCJA 2HL3A 4XQ3A 3MEVA 1TUGB 1VQPA 4PNOA 1PSEA 1EZZB 3NFCA 2QDYB 3OS1A 3JCMd 2LJ3A 5GAOp 4C8QD 3SWNA 2QTVA 1VQ8A 3HFNA 2ECZA 2K5IA 2FG0A 4E7ZA 2BE9B 1WHGA 1GCQA 4M78E 4OMQA 1WHHA 3E1SA 3CCLQ 3I56A 1VYVA 4PJMA 1T3SA 4ORZA 1OULA 3RESA 1VQ6T 1VQ9Q 2EGCA 1SG5A 5GJVB 3MP1A 3CCQA 5D6WA 2YWWA 4FYVB 2FVUA 3JCMW 4J9IA 4MMLA 2MPXC 4F7UF 3HP9A 1SPKA 5DLOA 1RACB 2DF6A 1WA7A 3BY7A 1SSHA 3CCRT 1TUDA 1HXDA 1JXMA 2XK0A 2CSQA 1OX9A 4ANJA 2EGEA 1D09B 2R57A 2FPEA 3CCVQ 5KE3A 5IT9E 3OYKA 5J39A 1UGRB 5GAMj 1I07A 4C8QG 2RK2A 2LTOA 1VQMA 1Q7YC 5GANe 5KYXB 2JS2A 4Z02A 4EMKB 1BI2A 2O01E 1HJDA 2CP7A 5GANd 3OYCA 2DD5A 3H0IA 1B34B 3GPLA 2KT8A 2A37A 4J9HA 2KROA 3G4ST 2ED1A 5LJ3h 2QQBA 2IVWA 3VUBA 1MUZA 2JT4A 4F17A 2JUFA 4B9XA 2O4XB 5GAOn 7AT1B 1PRLC 3CC4Q 3RMQA 4C92A 2QTXA 5KCOA 1M9SA 1UHFA 4OMMA 5CCAA 3TVTA 4A53A 3CCMT 4A4KA 4M77C 1ZSZB 1LVKA 3CCUQ 5DY9A 3I55Q 1XJWB 4BB7A 1VUBA 2GCXA 2QQSA 1NPRA 3JB9J 5D7UA 5GAMf 1M2OA 1RLPC 4PK4A 2FL7A 3UA7A 3P8DA 1OZ2A 4E7SA 4BY6B 1V29B 2EJGA 2LT1A 1VQKT 1I1JA 2FEIA 3SD4A 4C5EA 4RCCA 4ZTJA 4FSXA 1JEGA 4FIBA 1KC8R 3UPUA 3H6ZA 3OS0A 2HAXA 4JRIA 5GAN2 3M57A 3CQTA 5A0GA 2MOXA 3RNJA 3G6ET 2Y4XA 2YRCA 2YXYA 1Q7YR 1Q81U 4M7AF 2D6FA 4E7JA 2OX7A 2JZ2A 2X4WA 1PD1A 3VV0A 1TOVA 1VQOT 4II1A 3EGXA 2CZ7B 4HCZA 1N9RA 3CBMA 3LX7A 2K5FA 1BI3A 4FT4A 2AZVA 3OYAA 1QVFS 3OMGA 1FXXA 3A8GB 2HQEA 2HDAA 5C0MA 2HNIA 3JCMV 3NTKA 3CMEQ 1WNLA 2WACA 5HY6A 4RTXA 1XTDA 3BW1A 4X9DA 4KBMB 4EPCA 2K79A 1RUWA 1ZX6A 3M0UA 3CC7A 1YJWT 4KUIA 2DIGA 2HSEB 2RHXA 2LCCA 2RQWA 1UJYA 4DBQA 4LDWA 4B9WA 4F7UB 2LDMA 4PJJA 4AMCA 3JAME 2JTEA 1QVGS 3H8ZA 1K9MU 2QASA 2LMJA 1VQ6Q 4HT9A 4D6WA 3JB9F 5IXFA 2KI7A 3S3MA 2QQ9A 4F7UG 3QKJA 5LJ5f 1ZQ1A 3WVEB 4M7DB 4N0AA 5IHKA 2EWNA 1R0BG 3R6NA 3RMSA 3BFMA 1UECA 4ZGDB 2E64A 5CKEA 4IIOA 2PUOB 4M78C 4M77A 4RKUE 4RG8A 3CPFA 2L89A 1RAEB 4BDYA 1I4K1 1MNEA 4V2SA 4KH1B 3CCRQ 3IQLA 3CXCS 3QXEB 1K9MR 4QKUA 2FO0A 2HQHA 3A8HB 3PMIA 1BCOA 1M1FA 1BK2A 2HL5C 2ZZDA 3MP6A 5GAOr 3VJPA 1MV0B 1YITT 1H8KA 4PLIA 1WXUA 1MV3A 3CCET 1GXIE 2DETA 3L2VA 2VASA 3CC2T 4C5IA 4YTLA 3KFVA 4JZ4A 2XDDA 1NM7A 2RJFA 1RAHB 1OU8A 5CKFA 4JRPA 4J7IA 2EYXA 4ZNXA 3FLGA 5GAMg 3V7RA 1GBQA 1YP5A 4J9FA 4JJNK 3G4SQ 4M78D 5IXBA 2CKKA 1VYTA 1GCPA 2KNBB 2A0FB 3CCLA 3UA6A 2NUTA 5GMKj 4KH0B 4IUUA 2C0TA 2D8JA 5GAN8 2V1QA 3M0RA 2C0OA 4M75A 4AT1B 4OGEA 2YUNA 3HL8A 1C0MA 4JDSA 1UUEA 3SHWA 4LD6A 4GLKA 2K6DA 1W2BS 3RKYA 3CCMQ 5HK0A 3PTAA 3HPWA 1BU1A 2QGGA 1VOMA 5GANf 3EFOA 1D1CA 3OB9A 5M9OA 1U1TA 1YHQT 4J6YA 3DLMA 3H9NA 4MDXA 2BZ8A 3A8LB 4ELZC 4OVAA 2PUKB 3ZEHA 4IUPA 4M7AB 4FYXB 1SRLA 1VQKQ 2RI3A 2EQJA 2CP0A 1BI1A 3H0HA 1RAGB 3OA6A 4XTXA 1X01A 2DAQA 2RB6A 3GLXA 5I21A 3JB9I 2FPFA 1AOJA 4QW2A 4UC4A 1VQ4A 5CKBA 1YIJT 1I81A 5KH6A 5I22A 4FW1A 2EGAA 4M7AG 2YUOA 1M90U 3TSWA 1GFCA 4B6MA 1N5ZA 2VVKA 1LCKA 3G6EQ 4BI4A 4LNPA 4QQ6A 2NWMA 3MO8A 1IXDA 2JS0A 3SWNC 4C92F 3JB9D 1KQSS 1WI7A 1AD5A 4LDVA 2DRMA 2OTJA 1VQOQ 2DX1A 2QG9B 2KR3A 3H0FA 1GCQC 4QVDA 4FW2A 1TXQA 5FRNA 3O5ZA 4JJDA 2E41A 2F2XA 1X6BA 4MZTA 2E5KA 3VKIA 4JJBA 1OI1A 4M4ZA 3DLLA 1M90R 1YI2A 3V8KA 4XU2A 2JTMA 1AVZC 4MDWA 2DEUA 4QT7A 2IG0A 5IHNA 2CREA 1KIKA 5LJ5g 1H3HA 1HYOA 2L3QA 1G3SA 4N4GA 3V8LA 4KULA 3I5RA 3OYHA 1KG1A 2RNAA 2ESWA 5CKHA 3OS2A 1UHCA 1YJWQ 1RAFB 4LD9K 5KYYA 2WSEE 1MHNA 1HK9A 4BUGA 3JB9G 2EYZA 4LDXA 3DB4A 3OSVA 1YJ9T 1DJ7B 1M1GA 2RQUA 2DFUA 4M75E 5FWBA 5A0DA 1SF9A 2K4YA 1QCFA 2VGNA 2NYSA 3VS6A 5FU6B 2X4YA 5A0LA 1BYMA 1R77A 1TUCA 2QA4A 2ZPIB 3EHRA 3CMAT 3TEEA 4M7DE 2DL8A 2CS7A 1VQ7A 5FRMA 2LP5A 2QDLA 1V1CA 2RM4A 5LJ3e 3V7CA 1FMKA 2LJ0A 1D0ZA 1VQ5T 1W4SA 3QYHB 1OZ3A 1Q95G 2DILA 3EG3A 4XU3A 4XTVA 2E3IA 1YJNA 3EGDA 1K9AA 5C6SA 2M0OA 3OYYA 2LRQA 3M9QA 2RQTA 3O8VA 3META 2CP2A 1IO6A 5KYUB 1YITQ 2JMAA 1K73C 1VIFA 3CCEQ 1E6GA 1QVFP 1X75C 4XTZA 2VB6A 4RMOA 3CC2Q 3ZFJA 2K7AA 5GANg 2EKOA 3OBWA 2J6OA 2BE7D 3X24B 4PKCC 5LJ5d 9ATCB 4O6JA 4JUVA 1SRMA 5CAIA 4GBQA 3GP8A 5EC7A 1JQQA 4C92D 3EAEA 2VXEA 2QEXA 4DA4A 1BB9A 4EMKC 4XU1A 1N6AA 2OAWA 3OBYA 5GAOm 1VYUA 1K8AC 2CH4A 1UGSB 2E12A 4IUQA 1K4US 1KQ2A 4M77F 1OYXA 3NTIA 2E5QA 2FZGB 1QVGP 5GAMh 3LGLA 1JJ2S 1M2VA 1YHQQ 1VQPT 4C0DB 3S3OA 4C0GA 2RN8A 4PJOA 3GOXA 3AHUA 1I8FA 4AG1C 4DBFA 2RO0A 1VQLA 2KRSA 4HCBA 4HCCA 2LQ8A 1NJIC 1VQNA 1VQ8T 2NUZA 1D0YA 4C8QB 1I5OB 1KD1C 1AT1B 2AKKA 3QUIA 1N9SA 2ZPBB 4NS5A 1WYXA 1MGQA 3WXMB 2O9SA 1YIJQ 3A1PA 1GFDA 3L2QA 3I56T 4PFPA 2E6ZA 4C92G 1G8XA 3M0SA 4PJLA 2M0YA 3NGPA 2E6NA 2P4TA 2LJ1A 1H3ZA 1IHWA 3L42A 3CCQT 4JJCA 4K11A 3S6WA 3ASKA 1K73R 3E19A 3LW5E 2CP5A 4OB2B 3WVDB 4M75F 3MPUB 2EVRA 4LUEA 4XTYA 3U23A 1KHIA 2RMOA 3BDLA 4BE2A 1N8RR 4RTWA 3LGFA 5FWCA 4E47A 2L2PA 4Q5WA 2YRVA 1PG5B 5KYWB 2MYSA 2DNUA 2LNHB 2GFAA 2NLUA 5CKDA 3RKWA 2DL4A 2L3PA 2CT4A 3CD6A 1R8OB 4A4GA 2BZYA 1VQMT 1GL5A 2ZPFB 3M55A 3KUFA 3REBB 4N0AC 3I9QA 3FJPA 1KC8U 1KQ1A 1Q82C 1K8AR 3QIIA 4BD3A 3OW2A 2GTOA 1X27A 2DMOA 1YCSB 1PD0A 1MMGA 2M02A 5CQYA 3QJ6A 2I2LA 3NTHA 1SKUB 4JLGA 4KGVB 2P4RA 3M54A 4XK8E 1Q7YU 2E1HA 2V1RA 5ECAA 3L2UA 2AK5A 2JOYA 4OF1A 1ZHIA 1YJ9Q 3KXTA 1M3CA 2X4JA 3JCMc 3UATA 2DTIA 2PTKA 2BTTA 3ULRB 2YUQA 3JRZA 4FYWB 1ZA2B 5KYXA 1G3YA 4EMKA 3ZBDA 2KE9A 1U06A 4EIKA 4J7FA 3CMAQ 2EIFA 3JCMh 4M77D 2B86A 4M78F 1B34A 4A4EA 2LX7A 1PWTA 1VQ5Q 4PJOE 1M1KC 4L5GA 3D7SB 4RTZA 1NZ9A 2LZ6B 2X51A 4FM4B 4ME7A 1ZLMA 4HXJA 4M75C 2F2WA 3CPWS 3QG1A 2QGFB 3E9FA 3QYGB 1PHTA 2O4XA 5LJ5j 4M7DC 2KBTA 1OV3A 2L5QA 4AFZC 4A63B 3NMZC 2I0NA 2MK5A 1ZSZA 3MJXA 1QKWA 3CBPA 1IZ6A 2CSIA 3LLRA 4XU0A 3OW2P 3QDRB 3A8OB 3FB9A 3MEWA 3G71A 1RADB 1Q82R 1Y0MA 1YWPA 5LJ3f 2NUPB 1WQ7A 5GJWB 1SEMA 2CP3A 4IUVA 4M75D 3MKDA 4MZMA 3CCSA 4M77G 2HKNA 2FRYA 2QYZA 3X20B 4J9DA 2EYYA 1AWOA 2OTLA 2XICA 2PZ1A 2RF0A 2DA9A 1D0XA 1Q86C 1S72A 3OYEA 3JCMX 2RPNA 4LDYA 3HFOA 1G83A 1AEYA 2QI2A 3M59A 1VQPQ 2K3XA 2C06A 2OJ2A 3VS1A 2XDPA 3CC7T 4ELYC 2CUBA 5L23A 2CGHA 1UDLA 2D8HA 4N4HA 1RL2A 1VQ8Q 4C8QE 5DLQE 3GNFB 1Y96B 1YBYA 3EG9B 2KXDA 1M1KR 3MCAB 3JCMP 3C0CA 5GANj 1PC0A 1C1AA 3I56Q 5GMKl 2QXFA 4CI0C 5GMKh 4A4HA 3FJ5A 1A0NB 3T9NA 1IGQA 2J7IA 2PNIA 3A8MB 3VYGA 5A2QE 2O88A 2DXTA 3HKSA 2LQKA 1T0HA 1YNZA 2ZCFB 5I2SA 3THKA 2DL3A 5FLXE 3JB9H 2MI6A 4RTUA 1CKBA 1H92A 2BKDN 2X35A 4F7UA 5GAOq 2KSSA 1EIFA 2F2VA 4E7KA 4P5NA 3X28B 1OQKA 3M4YA 2CP6A 4L6V5 1VQMQ 1VQ9A 1KK7A 4Z88A 1PRMC 3UWNA 2RD1A 1ZUUA 2VUBA 1Q86R 4M7DA 1N27A 4ZTFA 5D6YA 1UG1A 3PIOA 3FIFA 3M58A 2HD0A 2Y90A 3JCMJ 1TTHB 4F04B 1U5SA 1Y96A 1X43A 1AWJA 2HZYA 3QZ5B 1RI9A 3L2RA 4M78B 1X6GA 4FT2A 3ZL7C 5FU7C 3CCLT 1UB4A 3GIBA 4X9CA 4DEXA 2M51A 2KVQG 2J06A 1JU5C 2HCKA 3JCMb 3CCVA 5CO7A 1Y71A 5CR2A 2CZ6B 2M16A 2HQXA 1LJOA 3EGUA 4M78G 2J6FA 2E3HA 1Z9ZA 4C0FA 1OU9A 1WHKA 1JO8A 4PFZA 1X2KA 2D0NA 2DZ9A 4HVWA 2COYA 1ACMB 3TQ7P 1D3BB 3X25B 2DYIA 2YLCA 1M3BA 1HSQA 1M30A 1YWOA 1NYGA 2G6FX 2MWPA 4BE1A 5KCHA 2XDBA 5LJ3g 2PVGB 1NE8A 2IIMA 2KK4A 3P8HA 5FU6C 2VV5A 3F70A 2PVOB 2SRCA 3CC4A 3C95A 1VQ4T 4IUTA 2O9VA 2FZCB 4EMHA 6AT1B 4OP0A 2KT1A 2XG8D 4BE0A 3FRNA 2CZ0B 3CCUA 3M4GA 2ZAEA 3I55A 5GAN3 1UJ0A 1QVFA 1J3TA 4PJOC 2QQRA 4A54A 2YUPA 4AFQC 2RHYA 3PGGA 3EHQA 2PVDB 2ATCB 2D9TA 2BZXA 2FPDA 4J6WA 3RUXA 2OTJT 3QO3A 1C6VX 1RI0A 4M7AA 2ED0A 3FDRA 4KGXB 2A08A 5GAN5 1ABQA 3PMTA 1JB0E 1PKSA 3DB3A 1OPLA 1AHJB 4F16A 1WJQA 4L59A 4F7UE 3R6OA 3G1JA 1YI2T 2Y4YA 2CYZB 4MMKA 4D8DA 1QQJA 4ZGEB 2JJ9A 1NLOC 2DZCA 4CRIA 2HMAA 4ESRA 4EDUA 1TG0A 2FHDA 1QVGA 3Q1JA 4OMOA 4RG2A 2VWFA 1IREB 2M1HA 1E6HA 2ROTA 3VS2A 3X26B 4E7IA 3AT1B 2DBKA 8ATCB 3SWNB 3CC7Q 2DJQA 1NPPA 3QHSA 3L2ZA 2VYTA 3J7AF 4FSSA 1FX7A 1W1FA 4HA8A 3OQ5A 1O9SA 5LJ3d 3OYLA 1R0CB 2XU8A 2D1XA 2BIVA 3PT9A 2DK3A 2JXBA 4JS5A 4JLIA 1WIEA 4Y91A 1IGUA 1WHJA 4AFSC 1KHCA 2MWOA 3RDVA 3CMEA 2EJ9A 4DEYA 1G3TA 2QA4T 3CXCA 2E10A 5I2MA 3OSSC 4DQ2A 1ZA1B 2V8JA 4CC7A 4OB1B 4DOWA 1WXBA 4C5GA 1X6OA 1VQ7T 2DVEA 4C8QC 2A3LA 3I5SA 4ZN1A 2K2VA 1Y07A 1M27C 4BDZA 3QSUA 3VS0A 1UE9A 2F69A 2YRDA 4A4FA 3OYIA 3OY9A 3RBBB 1AWWA 2AIRB 1YJNT 2DPPB 5HKCA 1NYFA 2IPOB 1QP3A 4RTYA 4OMPA 4LXCA 3PFSA 3M53A 4MZPA 4OB0B 2HSPA 4Y92A 2EJFA 4X34A 2J6KA 1VQ6A 4RUGA 2ROLA 4PJNA 2V8IA 1U3OA 1QLYA 3DKMA 2SEMA 3JCMe 1WXTA 2Z0WA 2FB7A 1BIAA 4TVRA 3ER0A 3I35A 1QCOA 1B3QA 2YHTA 2X3XD 1RAIB 4HKEA 4C5HA 3MEAA 3NHNA 5LL6S 4CC4B 4XTWA 4HT8A 3RKXA 1WHLA 4J9EA 1TS9A 3CCJT 1XQHA 2COZA 1W2BA 2KEAA 4WF2A 1K73U 3VS3A 3SEMA 3CCRA 2DTOA 4M7AE 2C0IA 4E2FB 2QEXT 3HRSA 4C92B 2DJZA 3TCJA 1N8RU 1Y57A 2KYMA 1H641 3TU4K 2DXUA 5KYUA 2EFIA 3CBOA 1M3AA 3SFMA 2JM9A 2KRNA 1ZSZC 3VYHB 1AZEA 2ZPEB 3SB2A 1I5LA 3CXCP 3OYDA 4BY6C 1FYNA 2V8KA 2KRMA 1KC8C 4JRQA 3G4SA 3M0PA 1K8AU 1X2QA 3MP8A 3NPFA 2EYWA 1VQLT 2RJDA 2P84A 1QW1A 1Z9QA 3HTRA 1VQNT 4OGCA 4IIMA 2DO3A 1TU0B 2LC4A 1IB8A 3EH2A 1TH7A 4IKFA 1QWEA 2K9GA 4AG2C 4M7DF 3BE3A 3C12A 4WTOB 1KQSA 1VQ4Q 2PU9B 2O31A 2VKNA 3OYJA 3V8JA 1KSWA 1I0CA 2AT1B 1ZUYA 3M5AA 1XOVA 5IN1A 3EH1A 4FU6A 1B7TA 3CCMA 1GRIA 5CQXA 3LWIA 4E6RA 2J05A 1D1AA 2OAUA 1NJIU 1SSFA 1KD1U 2QQAA 5AT1B 1EX4A 3OYFA 3QWYA 2EQIA 2H3JA 4OMLA 1OEBA 1NEGA 2OTJQ 5IH2A 3UF4A 4JRKA 3EGXB 1W2BP 1VQKA 4E7HA 3M0TA 3LWHA 3GNGA 1MMAA 4C8QA 1Q81C 2FYKA 3VRZA 4R56A 2E65A 1ZUKA 1AZGB 5GMKe 2V26A 1XNIA 1QKXA 1YI2Q 3CD6T 3EFRA 1NJIR 2M9UA 2EPDA 2AKLA 1JRIA 1QMCA 5GAN7 1BKBA 1KD1R 2DVJA 3G6EA 1UGPB 1UGVA 1UTIA 4QVZA 4FCYA 5LJ5h 1WHMA 1WJSA 5LJ3j 1OX8A 1FMWA 3HSBA 3RIRA 1CSKA 1K76A 4JZ3A 5CVIA 2EQUA 4FYYB 1TWBA 4KGZB 2DKGA 2ZPHB 4NOYA 3OYBA 1VQOA 3OYMA 1PCXA 2ABLA 2CUDA 3KBGA 2HEQA 2PQWA 1PSFA 2GFUA 1Q82U 4OB3B 5KYWA 2K2MA 3UDCA 4QQDA 4PLLA 1WLPB 2YLBA 3LH5A 2GQIA 1KQSP 2YT6A 2YDLA 2A28A 1FWZA 1ZBXA 3FEOA 4HVVA 4LN2A 3PVLA 4O5VA 1CKAA 3VRYA 5IHIA 1UEBA 2QA4Q 4BACA 2DL5A 1JXOA 1NG2A 4Y28E 5CIUA 2ZGWA 1K9MC 1VQ7Q 3QJYA 4LDUA 4C0ZA 5IAYA 1ZSGA 5HK3A 2RJEA 2O2OA 4M77B 1RAAB 4Z8AA 1YJWA 2RQRA 2K3YA 4CC3A 1M8VA 1YJNQ 5D6XA 1ARKA 1ABOA 4NL2A 2F5KA 4DBRA 3EFSA 1LNXA 3HRTA 3EG2A 1Q81R 3BDUA 3TSZA 2CT3A 1M1KU 4RTTA 4M7DD 2MAMA 5GANh 4BI3A 8AT1B 1K1ZA 2DYBA 4PL6A 5CK9A 4N4IA 3J80E 2JNGA 5EG2A 4AFUC 2BUDA 2VXFA 2VGMA 1BIBA 2L8DA 4R55A 3G71T 1B07A 2R5AA 3UT1A 3CCJQ 2HBPA 1W70A 2AHJB 1T0JA 3RERA 2KDSA 2KXCA 2RHUA 2NUTB 4KT0E 1PM3A 2DIQA 1S1NA 3J81E 3CCST 2QEXQ 3L1AA 2EYQA 3OMCA 1JJ2A 4C92E 4M75B 1YITA 2OTLT 3INZA 1O75A 3OYNA 4ZGJB 2JW4A 3CCEA 2LCLA 3VU3C 1S72T 3CC2A 2R58A 3QWXX 2XKOC 3EFOB 2EKHA 2EW3A 2DLPA 4M75G 3JCMf 5I11A 2DERA 1BBZA 2FRWA 4PFOA 3OYGA 5FW9A 3E9GA 4X1VA 2HKQB 2QK0A 3CCQQ 4ATOA 4DOVA 4M7AC 3VS7A 1VQLQ 4M7DG 3JSCA 1MMDA 1OPKA 2NUPA 1W6XA 1Q86U 1VQNQ 5J26A 3FC3A 5J3BA 2OI3A 2HBWA 2A36A 1OOTA 1YN8A 4J5YA 3ME9A 2W10A 1P92A 2VC8A 4DBHA 2CZ1B 2JMCA 3M0QA 5GAN6 3QZ9B 1M4ZA 2L0AA 2KAFA 3C94A 4GLMA 3MHXA 1WJRA 4PJOF 4RCBA 2XI9A 3PNWC 1YHQA 3REAB 4CC2A 2RH2A 3EG1A 1HD3A 4M7AD 4J9BA 1T3LA 4R0KA 1M90C 1WDXA 2KYBA 2DL7A 2WSCE 3MEUA 2MCNA 1QP2A 4KUDK 2DXBA 4KRTA 2EQMA 1PNJA 1BI0A 1JJ2P 2MIOA 3EG9A 1YIJA 1U8RA 4QQGA 2DBMA 1RLQC 3CD6Q 2RK1A 2RA2A 1VQ9T 3GF5A 1NBEB 1WFWA 4WCIA 2X9HA 2F1LA 2R5MA 1WGSA 2YSQA 2LQWA 2H8HA 2CDTA 1SHFA 2JTFA 4LUDA 3LYIA 1D1BA 2XD0A 3QDFA 1KFZA 2D0QB 5KYYB 4JS4A 2LVMA 2EAYA 1TSFA 2FZKB 5GAOl 1F1BB 2XHCA 2GGRA 3L2WA 3CCVT 2H3EB 1NLPC 2P0QA 4HCKA 2G3RA 2JM8A 5AYFA 4Z89A 2L3RA 2DM1A 2RHIA 4IURA 1QWFA 2GTJA 2LQNA 2GF7A 4J9GA 1BCMA 2DD4A 3RR6A 2E4HA 2KMTA 2ZPGB 5GAMe 3CPWA 4BI8B 4C8QF 1WQWA 2X4XA 1QVPA 1AWXA 3M56A 2ENMA 1NEBA 1MNDA 4EMGA 5GAMd 4M77E 2CH4W 2LT4A 2DXCA 2EBPA 2F5TX 3VUZA 1YCYA 1WX6A 3VS5A 1SHGA 2DRKA 1WPYA 3EGDB 4M78A 4D8KA 1X69A 2KY9A 3SDZA 3PVQA 3JV3A 2L3SA 1LPLA 1IHVA 4XTUA 1GBRA 1YJ9A 2K57A 3JCMQ 3OW2S 4GY5A 3CC4T 5FU7B 3S3NA 3TREA 2B8AA 3E2UA 4HVUA 3PE0A 1U1SA 1YFNA 3URGA 3P8BB 2LNVA 5GMKm 1EFNA 1LOJA 1UFFA 1PKTA 2K3BA 2XIDA 2GBQA 2DTHA 2RJCA 4J6XA 4LE9A 1KJWA 1VA7A 3CCUT 3C4SA 2LCSA 3I55T 1WZOA 3CMAA 2RHZA 2KQWA 3JCMg 2JN0A 1JBMA 3LH0A 1Y7XA 3G71Q 2P0PA 2EQKA 1D3BA 4PJOD 1VQ5A 4ZN3A 5L8RE 5GAN4 3CEYA 2X3WD 4VUBA 3EG0A 2GNCA 2K5LA 3G7ZA 2COWA 2GQVA 2RI5A 3CCSQ 1UGQB 5KE2A 1G5VA 2DE0X 4QVCA 2OTLQ 5KYNA 4F14A 1M5Q1 2W0ZA 1ZBJA 4E7LA 4J83A 1V76A 4OMNA 5HCKA 1K0XA 1M8MA 1S72Q 3HHTB 3QPHA 2KGTA 3N5BB 2E70A 3CPWP 4C0DC 1FMVA 1G3WA 2A7YA 2MMPA 2RQVA 1M2VB 3A5ZB 1VIEA 5FROA 2JVVA 3QBYA 4JPBW
chains in the Genus database with same CATH topology
3H0HA 1AWOA 2PZ1A 4RTVA 1K0SA 2RF0A 2DA9A 1E7OA 3GBQA 2FPFA 1AOJA 3QWYA 2EQIA 2RPNA 5I22A 4OMLA 1OEBA 1G83A 1NEGA 2EGAA 2YUOA 5IH2A 3UF4A 4J9CA 1AEYA 3TSWA 3H41A 1GFCA 2AZSA 1N5ZA 3A98A 2VVKA 3M0TA 3VS4A 1LCKA 2OJ2A 3VS1A 3VRZA 4LNPA 5L23A 2CUBA 2NWMA 1ZUKA 1UDLA 1AZGB 2D8HA 2JS0A 1QKXA 1WI7A 1AD5A 2DRMA 2XMFA 1G2BA 2EPDA 2AKLA 2DX1A 2KXDA 2KR3A 3H0FA 1GCQC 3C0CA 2DVJA 3O5ZA 1UGVA 4JJDA 1UTIA 2LJ3A 2F2XA 1X6BA 1CSKA 1K76A 2E5KA 3FJ5A 4JJBA 1A0NB 4JZ3A 2ECZA 4M4ZA 2J7IA 2PNIA 2FG0A 2O88A 1AVZC 1GCQA 2ABLA 2CUDA 4OMQA 2HEQA 4QT7A 1VYVA 1T0HA 1T3SA 1YNZA 4ORZA 5IHNA 3THKA 2CREA 1KIKA 2DL3A 1H3HA 2K2MA 2L3QA 2EGCA 1WLPB 3I5RA 2RNAA 3LH5A 2GQIA 2ESWA 4RTUA 2YT6A 2YDLA 2A28A 5GJVB 1CKBA 1H92A 1UHCA 4HVVA 4LN2A 3PVLA 1CKAA 3VRYA 5IHIA 2F2VA 4J9IA 2DL5A 1JXOA 1NG2A 1SPKA 4Z88A 2DF6A 2EYZA 1WA7A 1ZSGA 1SSHA 1PRMC 2RQUA 5FWBA 1TUDA 2O2OA 1JXMA 1ZUUA 2CSQA 1QCFA 3VS6A 2EGEA 4Z8AA 2FPEA 2RQRA 1TUCA 1UG1A 1I07A 4CC3A 3EHRA 1ARKA 2DL8A 1ABOA 1U5SA 1X43A 2JS2A 2LP5A 1AWJA 1V1CA 2QDLA 1RI9A 1X6GA 1FMKA 1HJDA 3ZL7C 2LJ0A 3EG2A 4DEXA 3TSZA 2M51A 2CT3A 1JU5C 2DILA 2HCKA 2J06A 3EG3A 3H0IA 4RTTA 2KT8A 2A37A 4J9HA 1K9AA 1K1ZA 2KROA 2DYBA 2ED1A 3EGUA 2RQTA 4AFUC 1IO6A 2J6FA 1Z9ZA 1B07A 1MUZA 2JT4A 4F17A 2JMAA 1W70A 1T0JA 1JO8A 1X2KA 2D0NA 2KXCA 1PRLC 1E6GA 4HVWA 2K7AA 1M3BA 1UHFA 1S1NA 4OMMA 1HSQA 1M30A 1YWOA 1NYGA 2G6FX 3TVTA 2J6OA 2IIMA 2JW4A 2SRCA 1SRMA 1RLPC 4GBQA 5EC7A 3UA7A 1JQQA 2O9VA 3QWXX 2EKHA 2EW3A 2DLPA 5I11A 1BB9A 1BBZA 2OAWA 2FRWA 5FW9A 2KT1A 1I1JA 4X1VA 2FEIA 1VYUA 2CH4A 1UJ0A 3VS7A 1K4US 1J3TA 1JEGA 4AFQC 2YUPA 1OPKA 1W6XA 3EHQA 2BZXA 2OI3A 2FPDA 2HBWA 2A36A 1OOTA 1YN8A 3CQTA 2W10A 2MOXA 3RNJA 2ED0A 2JMCA 2RN8A 3M0QA 2A08A 4AG1C 1ABQA 2L0AA 2KRSA 1PKSA 1OPLA 4GLMA 4F16A 2NUZA 2AKKA 1WYXA 4D8DA 3REAB 4CC2A 2O9SA 1GFDA 1NLOC 3EG1A 1HD3A 4J9BA 4ESRA 1T3LA 4R0KA 1TG0A 1WDXA 2AZVA 2KYBA 2DL7A 4OMOA 3M0SA 2VWFA 2M0YA 3VS2A 1E6HA 2HDAA 2ROTA 3NGPA 2MCNA 2LJ1A 2DBKA 4KRTA 4JJCA 4K11A 1PNJA 2DJQA 2MIOA 4FSSA 1W1FA 2DBMA 2EVRA 1RLQC 4LUEA 4RTXA 3U23A 2RMOA 2D1XA 4RTWA 5FWCA 2L2PA 2JXBA 1WFWA 2K79A 4WCIA 1RUWA 1ZX6A 3M0UA 1WIEA 2DNUA 2LNHB 4AFSC 4DEYA 2DL4A 2L3PA 2YSQA 2CT4A 2RQWA 1UJYA 2LQWA 2H8HA 2CDTA 1SHFA 2BZYA 4CC7A 4LUDA 1GL5A 2JTEA 1WXBA 3REBB 1KFZA 3I9QA 3I5SA 2LMJA 1M27C 3VS0A 1UE9A 2GTOA 1X27A 2GGRA 5IXFA 2DMOA 1YCSB 1NLPC 3RBBB 4HCKA 1AWWA 2JM8A 4Z89A 2P4RA 1NYFA 2DM1A 4RTYA 4OMPA 1QWFA 2GTJA 5IHKA 2HSPA 2LQNA 2V1RA 4Y92A 4J9GA 3R6NA 1UECA 5ECAA 2J6KA 4IIOA 4RUGA 2AK5A 2ROLA 1U3OA 1QLYA 1AWXA 2SEMA 2ENMA 1NEBA 1M3CA 1WXTA 3UATA 3I35A 1B3QA 2CH4W 3IQLA 2X3XD 2PTKA 2BTTA 2EBPA 3ULRB 1WX6A 2FO0A 3VS5A 2YUQA 1SHGA 3NHNA 4CC4B 1BK2A 2DRKA 4J9EA 1MV0B 4D8KA 2KE9A 1X69A 1U06A 4EIKA 1H8KA 3PVQA 3JV3A 1WXUA 1MV3A 2KEAA 2L3SA 1GBRA 3VS3A 2B86A 4E6RA 3SEMA 4HVUA 2LX7A 3KFVA 3PE0A 1PWTA 4JZ4A 2C0IA 1NM7A 1EFNA 2EYXA 4RTZA 4ZNXA 1UFFA 1PKTA 1Y57A 2K3BA 2LZ6B 2GBQA 1GBQA 2KYMA 1VA7A 1KJWA 1YP5A 1ZLMA 4HXJA 4J9FA 4LE9A 2F2WA 2LCSA 1M3AA 2JM9A 2KRNA 5IXBA 1PHTA 1VYTA 1AZEA 1GCPA 2KNBB 3UA6A 2KBTA 1OV3A 4AFZC 2C0TA 4A63B 2X3WD 2D8JA 2V1QA 3M0RA 2C0OA 3EG0A 2GNCA 3NMZC 2I0NA 2YUNA 1FYNA 2KRMA 1UUEA 3M0PA 1X2QA 1QKWA 3SHWA 3NPFA 2EYWA 2K6DA 2CSIA 2DE0X 1BU1A 1Z9QA 4IIMA 4F14A 1Y0MA 2W0ZA 1ZBJA 1YWPA 4OMNA 1QWEA 2K9GA 5HCKA 4AG2C 5GJWB 1K0XA 1M8MA 1SEMA 2O31A 2BZ8A 2KGTA 2VKNA 1KSWA 1I0CA 1ZUYA 2FRYA 2RQVA 1XOVA 4J9DA 2EYYA 1GRIA 1SRLA 4JPBW 2J05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0H A;  1AWO A;  2PZ1 A;  4RTV A;  1K0S A;  2RF0 A;  2DA9 A;  1E7O A;  3GBQ A;  2FPF A;  1AOJ A;  3QWY A;  2EQI A;  2RPN A;  5I22 A;  4OML A;  1OEB A;  1G83 A;  1NEG A;  2EGA A;  2YUO A;  5IH2 A;  3UF4 A;  4J9C A;  1AEY A;  3TSW A;  3H41 A;  1GFC A;  2AZS A;  1N5Z A;  3A98 A;  2VVK A;  3M0T A;  3VS4 A;  1LCK A;  2OJ2 A;  3VS1 A;  3VRZ A;  4LNP A;  5L23 A;  2CUB A;  2NWM A;  1ZUK A;  1UDL A;  1AZG B;  2D8H A;  2JS0 A;  1QKX A;  1WI7 A;  1AD5 A;  2DRM A;  2XMF A;  1G2B A;  2EPD A;  2AKL A;  2DX1 A;  2KXD A;  2KR3 A;  3H0F A;  1GCQ C;  3C0C A;  2DVJ A;  3O5Z A;  1UGV A;  4JJD A;  1UTI A;  2LJ3 A;  2F2X A;  1X6B A;  1CSK A;  1K76 A;  2E5K A;  3FJ5 A;  4JJB A;  1A0N B;  4JZ3 A;  2ECZ A;  4M4Z A;  2J7I A;  2PNI A;  2FG0 A;  2O88 A;  1AVZ C;  1GCQ A;  2ABL A;  2CUD A;  4OMQ A;  2HEQ A;  4QT7 A;  1VYV A;  1T0H A;  1T3S A;  1YNZ A;  4ORZ A;  5IHN A;  3THK A;  2CRE A;  1KIK A;  2DL3 A;  1H3H A;  2K2M A;  2L3Q A;  2EGC A;  1WLP B;  3I5R A;  2RNA A;  3LH5 A;  2GQI A;  2ESW A;  4RTU A;  2YT6 A;  2YDL A;  2A28 A;  5GJV B;  1CKB A;  1H92 A;  1UHC A;  4HVV A;  4LN2 A;  3PVL A;  1CKA A;  3VRY A;  5IHI A;  2F2V A;  4J9I A;  2DL5 A;  1JXO A;  1NG2 A;  1SPK A;  4Z88 A;  2DF6 A;  2EYZ A;  1WA7 A;  1ZSG A;  1SSH A;  1PRM C;  2RQU A;  5FWB A;  1TUD A;  2O2O A;  1JXM A;  1ZUU A;  2CSQ A;  1QCF A;  3VS6 A;  2EGE A;  4Z8A A;  2FPE A;  2RQR A;  1TUC A;  1UG1 A;  1I07 A;  4CC3 A;  3EHR A;  1ARK A;  2DL8 A;  1ABO A;  1U5S A;  1X43 A;  2JS2 A;  2LP5 A;  1AWJ A;  1V1C A;  2QDL A;  1RI9 A;  1X6G A;  1FMK A;  1HJD A;  3ZL7 C;  2LJ0 A;  3EG2 A;  4DEX A;  3TSZ A;  2M51 A;  2CT3 A;  1JU5 C;  2DIL A;  2HCK A;  2J06 A;  3EG3 A;  3H0I A;  4RTT A;  2KT8 A;  2A37 A;  4J9H A;  1K9A A;  1K1Z A;  2KRO A;  2DYB A;  2ED1 A;  3EGU A;  2RQT A;  4AFU C;  1IO6 A;  2J6F A;  1Z9Z A;  1B07 A;  1MUZ A;  2JT4 A;  4F17 A;  2JMA A;  1W70 A;  1T0J A;  1JO8 A;  1X2K A;  2D0N A;  2KXC A;  1PRL C;  1E6G A;  4HVW A;  2K7A A;  1M3B A;  1UHF A;  1S1N A;  4OMM A;  1HSQ A;  1M30 A;  1YWO A;  1NYG A;  2G6F X;  3TVT A;  2J6O A;  2IIM A;  2JW4 A;  2SRC A;  1SRM A;  1RLP C;  4GBQ A;  5EC7 A;  3UA7 A;  1JQQ A;  2O9V A;  3QWX X;  2EKH A;  2EW3 A;  2DLP A;  5I11 A;  1BB9 A;  1BBZ A;  2OAW A;  2FRW A;  5FW9 A;  2KT1 A;  1I1J A;  4X1V A;  2FEI A;  1VYU A;  2CH4 A;  1UJ0 A;  3VS7 A;  1K4U S;  1J3T A;  1JEG A;  4AFQ C;  2YUP A;  1OPK A;  1W6X A;  3EHQ A;  2BZX A;  2OI3 A;  2FPD A;  2HBW A;  2A36 A;  1OOT A;  1YN8 A;  3CQT A;  2W10 A;  2MOX A;  3RNJ A;  2ED0 A;  2JMC A;  2RN8 A;  3M0Q A;  2A08 A;  4AG1 C;  1ABQ A;  2L0A A;  2KRS A;  1PKS A;  1OPL A;  4GLM A;  4F16 A;  2NUZ A;  2AKK A;  1WYX A;  4D8D A;  3REA B;  4CC2 A;  2O9S A;  1GFD A;  1NLO C;  3EG1 A;  1HD3 A;  4J9B A;  4ESR A;  1T3L A;  4R0K A;  1TG0 A;  1WDX A;  2AZV A;  2KYB A;  2DL7 A;  4OMO A;  3M0S A;  2VWF A;  2M0Y A;  3VS2 A;  1E6H A;  2HDA A;  2ROT A;  3NGP A;  2MCN A;  2LJ1 A;  2DBK A;  4KRT A;  4JJC A;  4K11 A;  1PNJ A;  2DJQ A;  2MIO A;  4FSS A;  1W1F A;  2DBM A;  2EVR A;  1RLQ C;  4LUE A;  4RTX A;  3U23 A;  2RMO A;  2D1X A;  4RTW A;  5FWC A;  2L2P A;  2JXB A;  1WFW A;  2K79 A;  4WCI A;  1RUW A;  1ZX6 A;  3M0U A;  1WIE A;  2DNU A;  2LNH B;  4AFS C;  4DEY A;  2DL4 A;  2L3P A;  2YSQ A;  2CT4 A;  2RQW A;  1UJY A;  2LQW A;  2H8H A;  2CDT A;  1SHF A;  2BZY A;  4CC7 A;  4LUD A;  1GL5 A;  2JTE A;  1WXB A;  3REB B;  1KFZ A;  3I9Q A;  3I5S A;  2LMJ A;  1M27 C;  3VS0 A;  1UE9 A;  2GTO A;  1X27 A;  2GGR A;  5IXF A;  2DMO A;  1YCS B;  1NLP C;  3RBB B;  4HCK A;  1AWW A;  2JM8 A;  4Z89 A;  2P4R A;  1NYF A;  2DM1 A;  4RTY A;  4OMP A;  1QWF A;  2GTJ A;  5IHK A;  2HSP A;  2LQN A;  2V1R A;  4Y92 A;  4J9G A;  3R6N A;  1UEC A;  5ECA A;  2J6K A;  4IIO A;  4RUG A;  2AK5 A;  2ROL A;  1U3O A;  1QLY A;  1AWX A;  2SEM A;  2ENM A;  1NEB A;  1M3C A;  1WXT A;  3UAT A;  3I35 A;  1B3Q A;  2CH4 W;  3IQL A;  2X3X D;  2PTK A;  2BTT A;  2EBP A;  3ULR B;  1WX6 A;  2FO0 A;  3VS5 A;  2YUQ A;  1SHG A;  3NHN A;  4CC4 B;  1BK2 A;  2DRK A;  4J9E A;  1MV0 B;  4D8K A;  2KE9 A;  1X69 A;  1U06 A;  4EIK A;  1H8K A;  3PVQ A;  3JV3 A;  1WXU A;  1MV3 A;  2KEA A;  2L3S A;  1GBR A;  3VS3 A;  2B86 A;  4E6R A;  3SEM A;  4HVU A;  2LX7 A;  3KFV A;  3PE0 A;  1PWT A;  4JZ4 A;  2C0I A;  1NM7 A;  1EFN A;  2EYX A;  4RTZ A;  4ZNX A;  1UFF A;  1PKT A;  1Y57 A;  2K3B A;  2LZ6 B;  2GBQ A;  1GBQ A;  2KYM A;  1VA7 A;  1KJW A;  1YP5 A;  1ZLM A;  4HXJ A;  4J9F A;  4LE9 A;  2F2W A;  2LCS A;  1M3A A;  2JM9 A;  2KRN A;  5IXB A;  1PHT A;  1VYT A;  1AZE A;  1GCP A;  2KNB B;  3UA6 A;  2KBT A;  1OV3 A;  4AFZ C;  2C0T A;  4A63 B;  2X3W D;  2D8J A;  2V1Q A;  3M0R A;  2C0O A;  3EG0 A;  2GNC A;  3NMZ C;  2I0N A;  2YUN A;  1FYN A;  2KRM A;  1UUE A;  3M0P A;  1X2Q A;  1QKW A;  3SHW A;  3NPF A;  2EYW A;  2K6D A;  2CSI A;  2DE0 X;  1BU1 A;  1Z9Q A;  4IIM A;  4F14 A;  1Y0M A;  2W0Z A;  1ZBJ A;  1YWP A;  4OMN A;  1QWE A;  2K9G A;  5HCK A;  4AG2 C;  5GJW B;  1K0X A;  1M8M A;  1SEM A;  2O31 A;  2BZ8 A;  2KGT A;  2VKN A;  1KSW A;  1I0C A;  1ZUY A;  2FRY A;  2RQV A;  1XOV A;  4J9D A;  2EYY A;  1GRI A;  1SRL A;  4JPB W;  2J05 A; 
#chains in the Genus database with same CATH topology
 1QCN A;  1MMN A;  4PJO B;  4RTV A;  1K0S A;  2RI2 A;  4C92 C;  1E7O A;  3GBQ A;  3OS5 A;  5DM7 R;  2LX9 A;  4XAX B;  2P0K A;  3HRU A;  5GMK i;  3PIP A;  1IRX A;  2WSF E;  4J9C A;  4PJO G;  3H41 A;  2AZS A;  3V7S A;  1RAB B;  4OMF B;  3A98 A;  4FL6 A;  3VS4 A;  2MF2 A;  2QAZ A;  2DEQ A;  4J8O A;  5LJ5 e;  3CME T;  1N8R C;  4NL3 A;  2XMF A;  1G2B A;  3CCJ A;  2HL3 A;  4XQ3 A;  3MEV A;  1TUG B;  1VQP A;  4PNO A;  1PSE A;  1EZZ B;  3NFC A;  2QDY B;  3OS1 A;  3JCM d;  2LJ3 A;  5GAO p;  4C8Q D;  3SWN A;  2QTV A;  1VQ8 A;  3HFN A;  2ECZ A;  2K5I A;  2FG0 A;  4E7Z A;  2BE9 B;  1WHG A;  1GCQ A;  4M78 E;  4OMQ A;  1WHH A;  3E1S A;  3CCL Q;  3I56 A;  1VYV A;  4PJM A;  1T3S A;  4ORZ A;  1OUL A;  3RES A;  1VQ6 T;  1VQ9 Q;  2EGC A;  1SG5 A;  5GJV B;  3MP1 A;  3CCQ A;  5D6W A;  2YWW A;  4FYV B;  2FVU A;  3JCM W;  4J9I A;  4MML A;  2MPX C;  4F7U F;  3HP9 A;  1SPK A;  5DLO A;  1RAC B;  2DF6 A;  1WA7 A;  3BY7 A;  1SSH A;  3CCR T;  1TUD A;  1HXD A;  1JXM A;  2XK0 A;  2CSQ A;  1OX9 A;  4ANJ A;  2EGE A;  1D09 B;  2R57 A;  2FPE A;  3CCV Q;  5KE3 A;  5IT9 E;  3OYK A;  5J39 A;  1UGR B;  5GAM j;  1I07 A;  4C8Q G;  2RK2 A;  2LTO A;  1VQM A;  1Q7Y C;  5GAN e;  5KYX B;  2JS2 A;  4Z02 A;  4EMK B;  1BI2 A;  2O01 E;  1HJD A;  2CP7 A;  5GAN d;  3OYC A;  2DD5 A;  3H0I A;  1B34 B;  3GPL A;  2KT8 A;  2A37 A;  4J9H A;  2KRO A;  3G4S T;  2ED1 A;  5LJ3 h;  2QQB A;  2IVW A;  3VUB A;  1MUZ A;  2JT4 A;  4F17 A;  2JUF A;  4B9X A;  2O4X B;  5GAO n;  7AT1 B;  1PRL C;  3CC4 Q;  3RMQ A;  4C92 A;  2QTX A;  5KCO A;  1M9S A;  1UHF A;  4OMM A;  5CCA A;  3TVT A;  4A53 A;  3CCM T;  4A4K A;  4M77 C;  1ZSZ B;  1LVK A;  3CCU Q;  5DY9 A;  3I55 Q;  1XJW B;  4BB7 A;  1VUB A;  2GCX A;  2QQS A;  1NPR A;  3JB9 J;  5D7U A;  5GAM f;  1M2O A;  1RLP C;  4PK4 A;  2FL7 A;  3UA7 A;  3P8D A;  1OZ2 A;  4E7S A;  4BY6 B;  1V29 B;  2EJG A;  2LT1 A;  1VQK T;  1I1J A;  2FEI A;  3SD4 A;  4C5E A;  4RCC A;  4ZTJ A;  4FSX A;  1JEG A;  4FIB A;  1KC8 R;  3UPU A;  3H6Z A;  3OS0 A;  2HAX A;  4JRI A;  5GAN 2;  3M57 A;  3CQT A;  5A0G A;  2MOX A;  3RNJ A;  3G6E T;  2Y4X A;  2YRC A;  2YXY A;  1Q7Y R;  1Q81 U;  4M7A F;  2D6F A;  4E7J A;  2OX7 A;  2JZ2 A;  2X4W A;  1PD1 A;  3VV0 A;  1TOV A;  1VQO T;  4II1 A;  3EGX A;  2CZ7 B;  4HCZ A;  1N9R A;  3CBM A;  3LX7 A;  2K5F A;  1BI3 A;  4FT4 A;  2AZV A;  3OYA A;  1QVF S;  3OMG A;  1FXX A;  3A8G B;  2HQE A;  2HDA A;  5C0M A;  2HNI A;  3JCM V;  3NTK A;  3CME Q;  1WNL A;  2WAC A;  5HY6 A;  4RTX A;  1XTD A;  3BW1 A;  4X9D A;  4KBM B;  4EPC A;  2K79 A;  1RUW A;  1ZX6 A;  3M0U A;  3CC7 A;  1YJW T;  4KUI A;  2DIG A;  2HSE B;  2RHX A;  2LCC A;  2RQW A;  1UJY A;  4DBQ A;  4LDW A;  4B9W A;  4F7U B;  2LDM A;  4PJJ A;  4AMC A;  3JAM E;  2JTE A;  1QVG S;  3H8Z A;  1K9M U;  2QAS A;  2LMJ A;  1VQ6 Q;  4HT9 A;  4D6W A;  3JB9 F;  5IXF A;  2KI7 A;  3S3M A;  2QQ9 A;  4F7U G;  3QKJ A;  5LJ5 f;  1ZQ1 A;  3WVE B;  4M7D B;  4N0A A;  5IHK A;  2EWN A;  1R0B G;  3R6N A;  3RMS A;  3BFM A;  1UEC A;  4ZGD B;  2E64 A;  5CKE A;  4IIO A;  2PUO B;  4M78 C;  4M77 A;  4RKU E;  4RG8 A;  3CPF A;  2L89 A;  1RAE B;  4BDY A;  1I4K 1;  1MNE A;  4V2S A;  4KH1 B;  3CCR Q;  3IQL A;  3CXC S;  3QXE B;  1K9M R;  4QKU A;  2FO0 A;  2HQH A;  3A8H B;  3PMI A;  1BCO A;  1M1F A;  1BK2 A;  2HL5 C;  2ZZD A;  3MP6 A;  5GAO r;  3VJP A;  1MV0 B;  1YIT T;  1H8K A;  4PLI A;  1WXU A;  1MV3 A;  3CCE T;  1GXI E;  2DET A;  3L2V A;  2VAS A;  3CC2 T;  4C5I A;  4YTL A;  3KFV A;  4JZ4 A;  2XDD A;  1NM7 A;  2RJF A;  1RAH B;  1OU8 A;  5CKF A;  4JRP A;  4J7I A;  2EYX A;  4ZNX A;  3FLG A;  5GAM g;  3V7R A;  1GBQ A;  1YP5 A;  4J9F A;  4JJN K;  3G4S Q;  4M78 D;  5IXB A;  2CKK A;  1VYT A;  1GCP A;  2KNB B;  2A0F B;  3CCL A;  3UA6 A;  2NUT A;  5GMK j;  4KH0 B;  4IUU A;  2C0T A;  2D8J A;  5GAN 8;  2V1Q A;  3M0R A;  2C0O A;  4M75 A;  4AT1 B;  4OGE A;  2YUN A;  3HL8 A;  1C0M A;  4JDS A;  1UUE A;  3SHW A;  4LD6 A;  4GLK A;  2K6D A;  1W2B S;  3RKY A;  3CCM Q;  5HK0 A;  3PTA A;  3HPW A;  1BU1 A;  2QGG A;  1VOM A;  5GAN f;  3EFO A;  1D1C A;  3OB9 A;  5M9O A;  1U1T A;  1YHQ T;  4J6Y A;  3DLM A;  3H9N A;  4MDX A;  2BZ8 A;  3A8L B;  4ELZ C;  4OVA A;  2PUK B;  3ZEH A;  4IUP A;  4M7A B;  4FYX B;  1SRL A;  1VQK Q;  2RI3 A;  2EQJ A;  2CP0 A;  1BI1 A;  3H0H A;  1RAG B;  3OA6 A;  4XTX A;  1X01 A;  2DAQ A;  2RB6 A;  3GLX A;  5I21 A;  3JB9 I;  2FPF A;  1AOJ A;  4QW2 A;  4UC4 A;  1VQ4 A;  5CKB A;  1YIJ T;  1I81 A;  5KH6 A;  5I22 A;  4FW1 A;  2EGA A;  4M7A G;  2YUO A;  1M90 U;  3TSW A;  1GFC A;  4B6M A;  1N5Z A;  2VVK A;  1LCK A;  3G6E Q;  4BI4 A;  4LNP A;  4QQ6 A;  2NWM A;  3MO8 A;  1IXD A;  2JS0 A;  3SWN C;  4C92 F;  3JB9 D;  1KQS S;  1WI7 A;  1AD5 A;  4LDV A;  2DRM A;  2OTJ A;  1VQO Q;  2DX1 A;  2QG9 B;  2KR3 A;  3H0F A;  1GCQ C;  4QVD A;  4FW2 A;  1TXQ A;  5FRN A;  3O5Z A;  4JJD A;  2E41 A;  2F2X A;  1X6B A;  4MZT A;  2E5K A;  3VKI A;  4JJB A;  1OI1 A;  4M4Z A;  3DLL A;  1M90 R;  1YI2 A;  3V8K A;  4XU2 A;  2JTM A;  1AVZ C;  4MDW A;  2DEU A;  4QT7 A;  2IG0 A;  5IHN A;  2CRE A;  1KIK A;  5LJ5 g;  1H3H A;  1HYO A;  2L3Q A;  1G3S A;  4N4G A;  3V8L A;  4KUL A;  3I5R A;  3OYH A;  1KG1 A;  2RNA A;  2ESW A;  5CKH A;  3OS2 A;  1UHC A;  1YJW Q;  1RAF B;  4LD9 K;  5KYY A;  2WSE E;  1MHN A;  1HK9 A;  4BUG A;  3JB9 G;  2EYZ A;  4LDX A;  3DB4 A;  3OSV A;  1YJ9 T;  1DJ7 B;  1M1G A;  2RQU A;  2DFU A;  4M75 E;  5FWB A;  5A0D A;  1SF9 A;  2K4Y A;  1QCF A;  2VGN A;  2NYS A;  3VS6 A;  5FU6 B;  2X4Y A;  5A0L A;  1BYM A;  1R77 A;  1TUC A;  2QA4 A;  2ZPI B;  3EHR A;  3CMA T;  3TEE A;  4M7D E;  2DL8 A;  2CS7 A;  1VQ7 A;  5FRM A;  2LP5 A;  2QDL A;  1V1C A;  2RM4 A;  5LJ3 e;  3V7C A;  1FMK A;  2LJ0 A;  1D0Z A;  1VQ5 T;  1W4S A;  3QYH B;  1OZ3 A;  1Q95 G;  2DIL A;  3EG3 A;  4XU3 A;  4XTV A;  2E3I A;  1YJN A;  3EGD A;  1K9A A;  5C6S A;  2M0O A;  3OYY A;  2LRQ A;  3M9Q A;  2RQT A;  3O8V A;  3MET A;  2CP2 A;  1IO6 A;  5KYU B;  1YIT Q;  2JMA A;  1K73 C;  1VIF A;  3CCE Q;  1E6G A;  1QVF P;  1X75 C;  4XTZ A;  2VB6 A;  4RMO A;  3CC2 Q;  3ZFJ A;  2K7A A;  5GAN g;  2EKO A;  3OBW A;  2J6O A;  2BE7 D;  3X24 B;  4PKC C;  5LJ5 d;  9ATC B;  4O6J A;  4JUV A;  1SRM A;  5CAI A;  4GBQ A;  3GP8 A;  5EC7 A;  1JQQ A;  4C92 D;  3EAE A;  2VXE A;  2QEX A;  4DA4 A;  1BB9 A;  4EMK C;  4XU1 A;  1N6A A;  2OAW A;  3OBY A;  5GAO m;  1VYU A;  1K8A C;  2CH4 A;  1UGS B;  2E12 A;  4IUQ A;  1K4U S;  1KQ2 A;  4M77 F;  1OYX A;  3NTI A;  2E5Q A;  2FZG B;  1QVG P;  5GAM h;  3LGL A;  1JJ2 S;  1M2V A;  1YHQ Q;  1VQP T;  4C0D B;  3S3O A;  4C0G A;  2RN8 A;  4PJO A;  3GOX A;  3AHU A;  1I8F A;  4AG1 C;  4DBF A;  2RO0 A;  1VQL A;  2KRS A;  4HCB A;  4HCC A;  2LQ8 A;  1NJI C;  1VQN A;  1VQ8 T;  2NUZ A;  1D0Y A;  4C8Q B;  1I5O B;  1KD1 C;  1AT1 B;  2AKK A;  3QUI A;  1N9S A;  2ZPB B;  4NS5 A;  1WYX A;  1MGQ A;  3WXM B;  2O9S A;  1YIJ Q;  3A1P A;  1GFD A;  3L2Q A;  3I56 T;  4PFP A;  2E6Z A;  4C92 G;  1G8X A;  3M0S A;  4PJL A;  2M0Y A;  3NGP A;  2E6N A;  2P4T A;  2LJ1 A;  1H3Z A;  1IHW A;  3L42 A;  3CCQ T;  4JJC A;  4K11 A;  3S6W A;  3ASK A;  1K73 R;  3E19 A;  3LW5 E;  2CP5 A;  4OB2 B;  3WVD B;  4M75 F;  3MPU B;  2EVR A;  4LUE A;  4XTY A;  3U23 A;  1KHI A;  2RMO A;  3BDL A;  4BE2 A;  1N8R R;  4RTW A;  3LGF A;  5FWC A;  4E47 A;  2L2P A;  4Q5W A;  2YRV A;  1PG5 B;  5KYW B;  2MYS A;  2DNU A;  2LNH B;  2GFA A;  2NLU A;  5CKD A;  3RKW A;  2DL4 A;  2L3P A;  2CT4 A;  3CD6 A;  1R8O B;  4A4G A;  2BZY A;  1VQM T;  1GL5 A;  2ZPF B;  3M55 A;  3KUF A;  3REB B;  4N0A C;  3I9Q A;  3FJP A;  1KC8 U;  1KQ1 A;  1Q82 C;  1K8A R;  3QII A;  4BD3 A;  3OW2 A;  2GTO A;  1X27 A;  2DMO A;  1YCS B;  1PD0 A;  1MMG A;  2M02 A;  5CQY A;  3QJ6 A;  2I2L A;  3NTH A;  1SKU B;  4JLG A;  4KGV B;  2P4R A;  3M54 A;  4XK8 E;  1Q7Y U;  2E1H A;  2V1R A;  5ECA A;  3L2U A;  2AK5 A;  2JOY A;  4OF1 A;  1ZHI A;  1YJ9 Q;  3KXT A;  1M3C A;  2X4J A;  3JCM c;  3UAT A;  2DTI A;  2PTK A;  2BTT A;  3ULR B;  2YUQ A;  3JRZ A;  4FYW B;  1ZA2 B;  5KYX A;  1G3Y A;  4EMK A;  3ZBD A;  2KE9 A;  1U06 A;  4EIK A;  4J7F A;  3CMA Q;  2EIF A;  3JCM h;  4M77 D;  2B86 A;  4M78 F;  1B34 A;  4A4E A;  2LX7 A;  1PWT A;  1VQ5 Q;  4PJO E;  1M1K C;  4L5G A;  3D7S B;  4RTZ A;  1NZ9 A;  2LZ6 B;  2X51 A;  4FM4 B;  4ME7 A;  1ZLM A;  4HXJ A;  4M75 C;  2F2W A;  3CPW S;  3QG1 A;  2QGF B;  3E9F A;  3QYG B;  1PHT A;  2O4X A;  5LJ5 j;  4M7D C;  2KBT A;  1OV3 A;  2L5Q A;  4AFZ C;  4A63 B;  3NMZ C;  2I0N A;  2MK5 A;  1ZSZ A;  3MJX A;  1QKW A;  3CBP A;  1IZ6 A;  2CSI A;  3LLR A;  4XU0 A;  3OW2 P;  3QDR B;  3A8O B;  3FB9 A;  3MEW A;  3G71 A;  1RAD B;  1Q82 R;  1Y0M A;  1YWP A;  5LJ3 f;  2NUP B;  1WQ7 A;  5GJW B;  1SEM A;  2CP3 A;  4IUV A;  4M75 D;  3MKD A;  4MZM A;  3CCS A;  4M77 G;  2HKN A;  2FRY A;  2QYZ A;  3X20 B;  4J9D A;  2EYY A;  1AWO A;  2OTL A;  2XIC A;  2PZ1 A;  2RF0 A;  2DA9 A;  1D0X A;  1Q86 C;  1S72 A;  3OYE A;  3JCM X;  2RPN A;  4LDY A;  3HFO A;  1G83 A;  1AEY A;  2QI2 A;  3M59 A;  1VQP Q;  2K3X A;  2C06 A;  2OJ2 A;  3VS1 A;  2XDP A;  3CC7 T;  4ELY C;  2CUB A;  5L23 A;  2CGH A;  1UDL A;  2D8H A;  4N4H A;  1RL2 A;  1VQ8 Q;  4C8Q E;  5DLQ E;  3GNF B;  1Y96 B;  1YBY A;  3EG9 B;  2KXD A;  1M1K R;  3MCA B;  3JCM P;  3C0C A;  5GAN j;  1PC0 A;  1C1A A;  3I56 Q;  5GMK l;  2QXF A;  4CI0 C;  5GMK h;  4A4H A;  3FJ5 A;  1A0N B;  3T9N A;  1IGQ A;  2J7I A;  2PNI A;  3A8M B;  3VYG A;  5A2Q E;  2O88 A;  2DXT A;  3HKS A;  2LQK A;  1T0H A;  1YNZ A;  2ZCF B;  5I2S A;  3THK A;  2DL3 A;  5FLX E;  3JB9 H;  2MI6 A;  4RTU A;  1CKB A;  1H92 A;  2BKD N;  2X35 A;  4F7U A;  5GAO q;  2KSS A;  1EIF A;  2F2V A;  4E7K A;  4P5N A;  3X28 B;  1OQK A;  3M4Y A;  2CP6 A;  4L6V 5;  1VQM Q;  1VQ9 A;  1KK7 A;  4Z88 A;  1PRM C;  3UWN A;  2RD1 A;  1ZUU A;  2VUB A;  1Q86 R;  4M7D A;  1N27 A;  4ZTF A;  5D6Y A;  1UG1 A;  3PIO A;  3FIF A;  3M58 A;  2HD0 A;  2Y90 A;  3JCM J;  1TTH B;  4F04 B;  1U5S A;  1Y96 A;  1X43 A;  1AWJ A;  2HZY A;  3QZ5 B;  1RI9 A;  3L2R A;  4M78 B;  1X6G A;  4FT2 A;  3ZL7 C;  5FU7 C;  3CCL T;  1UB4 A;  3GIB A;  4X9C A;  4DEX A;  2M51 A;  2KVQ G;  2J06 A;  1JU5 C;  2HCK A;  3JCM b;  3CCV A;  5CO7 A;  1Y71 A;  5CR2 A;  2CZ6 B;  2M16 A;  2HQX A;  1LJO A;  3EGU A;  4M78 G;  2J6F A;  2E3H A;  1Z9Z A;  4C0F A;  1OU9 A;  1WHK A;  1JO8 A;  4PFZ A;  1X2K A;  2D0N A;  2DZ9 A;  4HVW A;  2COY A;  1ACM B;  3TQ7 P;  1D3B B;  3X25 B;  2DYI A;  2YLC A;  1M3B A;  1HSQ A;  1M30 A;  1YWO A;  1NYG A;  2G6F X;  2MWP A;  4BE1 A;  5KCH A;  2XDB A;  5LJ3 g;  2PVG B;  1NE8 A;  2IIM A;  2KK4 A;  3P8H A;  5FU6 C;  2VV5 A;  3F70 A;  2PVO B;  2SRC A;  3CC4 A;  3C95 A;  1VQ4 T;  4IUT A;  2O9V A;  2FZC B;  4EMH A;  6AT1 B;  4OP0 A;  2KT1 A;  2XG8 D;  4BE0 A;  3FRN A;  2CZ0 B;  3CCU A;  3M4G A;  2ZAE A;  3I55 A;  5GAN 3;  1UJ0 A;  1QVF A;  1J3T A;  4PJO C;  2QQR A;  4A54 A;  2YUP A;  4AFQ C;  2RHY A;  3PGG A;  3EHQ A;  2PVD B;  2ATC B;  2D9T A;  2BZX A;  2FPD A;  4J6W A;  3RUX A;  2OTJ T;  3QO3 A;  1C6V X;  1RI0 A;  4M7A A;  2ED0 A;  3FDR A;  4KGX B;  2A08 A;  5GAN 5;  1ABQ A;  3PMT A;  1JB0 E;  1PKS A;  3DB3 A;  1OPL A;  1AHJ B;  4F16 A;  1WJQ A;  4L59 A;  4F7U E;  3R6O A;  3G1J A;  1YI2 T;  2Y4Y A;  2CYZ B;  4MMK A;  4D8D A;  1QQJ A;  4ZGE B;  2JJ9 A;  1NLO C;  2DZC A;  4CRI A;  2HMA A;  4ESR A;  4EDU A;  1TG0 A;  2FHD A;  1QVG A;  3Q1J A;  4OMO A;  4RG2 A;  2VWF A;  1IRE B;  2M1H A;  1E6H A;  2ROT A;  3VS2 A;  3X26 B;  4E7I A;  3AT1 B;  2DBK A;  8ATC B;  3SWN B;  3CC7 Q;  2DJQ A;  1NPP A;  3QHS A;  3L2Z A;  2VYT A;  3J7A F;  4FSS A;  1FX7 A;  1W1F A;  4HA8 A;  3OQ5 A;  1O9S A;  5LJ3 d;  3OYL A;  1R0C B;  2XU8 A;  2D1X A;  2BIV A;  3PT9 A;  2DK3 A;  2JXB A;  4JS5 A;  4JLI A;  1WIE A;  4Y91 A;  1IGU A;  1WHJ A;  4AFS C;  1KHC A;  2MWO A;  3RDV A;  3CME A;  2EJ9 A;  4DEY A;  1G3T A;  2QA4 T;  3CXC A;  2E10 A;  5I2M A;  3OSS C;  4DQ2 A;  1ZA1 B;  2V8J A;  4CC7 A;  4OB1 B;  4DOW A;  1WXB A;  4C5G A;  1X6O A;  1VQ7 T;  2DVE A;  4C8Q C;  2A3L A;  3I5S A;  4ZN1 A;  2K2V A;  1Y07 A;  1M27 C;  4BDZ A;  3QSU A;  3VS0 A;  1UE9 A;  2F69 A;  2YRD A;  4A4F A;  3OYI A;  3OY9 A;  3RBB B;  1AWW A;  2AIR B;  1YJN T;  2DPP B;  5HKC A;  1NYF A;  2IPO B;  1QP3 A;  4RTY A;  4OMP A;  4LXC A;  3PFS A;  3M53 A;  4MZP A;  4OB0 B;  2HSP A;  4Y92 A;  2EJF A;  4X34 A;  2J6K A;  1VQ6 A;  4RUG A;  2ROL A;  4PJN A;  2V8I A;  1U3O A;  1QLY A;  3DKM A;  2SEM A;  3JCM e;  1WXT A;  2Z0W A;  2FB7 A;  1BIA A;  4TVR A;  3ER0 A;  3I35 A;  1QCO A;  1B3Q A;  2YHT A;  2X3X D;  1RAI B;  4HKE A;  4C5H A;  3MEA A;  3NHN A;  5LL6 S;  4CC4 B;  4XTW A;  4HT8 A;  3RKX A;  1WHL A;  4J9E A;  1TS9 A;  3CCJ T;  1XQH A;  2COZ A;  1W2B A;  2KEA A;  4WF2 A;  1K73 U;  3VS3 A;  3SEM A;  3CCR A;  2DTO A;  4M7A E;  2C0I A;  4E2F B;  2QEX T;  3HRS A;  4C92 B;  2DJZ A;  3TCJ A;  1N8R U;  1Y57 A;  2KYM A;  1H64 1;  3TU4 K;  2DXU A;  5KYU A;  2EFI A;  3CBO A;  1M3A A;  3SFM A;  2JM9 A;  2KRN A;  1ZSZ C;  3VYH B;  1AZE A;  2ZPE B;  3SB2 A;  1I5L A;  3CXC P;  3OYD A;  4BY6 C;  1FYN A;  2V8K A;  2KRM A;  1KC8 C;  4JRQ A;  3G4S A;  3M0P A;  1K8A U;  1X2Q A;  3MP8 A;  3NPF A;  2EYW A;  1VQL T;  2RJD A;  2P84 A;  1QW1 A;  1Z9Q A;  3HTR A;  1VQN T;  4OGC A;  4IIM A;  2DO3 A;  1TU0 B;  2LC4 A;  1IB8 A;  3EH2 A;  1TH7 A;  4IKF A;  1QWE A;  2K9G A;  4AG2 C;  4M7D F;  3BE3 A;  3C12 A;  4WTO B;  1KQS A;  1VQ4 Q;  2PU9 B;  2O31 A;  2VKN A;  3OYJ A;  3V8J A;  1KSW A;  1I0C A;  2AT1 B;  1ZUY A;  3M5A A;  1XOV A;  5IN1 A;  3EH1 A;  4FU6 A;  1B7T A;  3CCM A;  1GRI A;  5CQX A;  3LWI A;  4E6R A;  2J05 A;  1D1A A;  2OAU A;  1NJI U;  1SSF A;  1KD1 U;  2QQA A;  5AT1 B;  1EX4 A;  3OYF A;  3QWY A;  2EQI A;  2H3J A;  4OML A;  1OEB A;  1NEG A;  2OTJ Q;  5IH2 A;  3UF4 A;  4JRK A;  3EGX B;  1W2B P;  1VQK A;  4E7H A;  3M0T A;  3LWH A;  3GNG A;  1MMA A;  4C8Q A;  1Q81 C;  2FYK A;  3VRZ A;  4R56 A;  2E65 A;  1ZUK A;  1AZG B;  5GMK e;  2V26 A;  1XNI A;  1QKX A;  1YI2 Q;  3CD6 T;  3EFR A;  1NJI R;  2M9U A;  2EPD A;  2AKL A;  1JRI A;  1QMC A;  5GAN 7;  1BKB A;  1KD1 R;  2DVJ A;  3G6E A;  1UGP B;  1UGV A;  1UTI A;  4QVZ A;  4FCY A;  5LJ5 h;  1WHM A;  1WJS A;  5LJ3 j;  1OX8 A;  1FMW A;  3HSB A;  3RIR A;  1CSK A;  1K76 A;  4JZ3 A;  5CVI A;  2EQU A;  4FYY B;  1TWB A;  4KGZ B;  2DKG A;  2ZPH B;  4NOY A;  3OYB A;  1VQO A;  3OYM A;  1PCX A;  2ABL A;  2CUD A;  3KBG A;  2HEQ A;  2PQW A;  1PSF A;  2GFU A;  1Q82 U;  4OB3 B;  5KYW A;  2K2M A;  3UDC A;  4QQD A;  4PLL A;  1WLP B;  2YLB A;  3LH5 A;  2GQI A;  1KQS P;  2YT6 A;  2YDL A;  2A28 A;  1FWZ A;  1ZBX A;  3FEO A;  4HVV A;  4LN2 A;  3PVL A;  4O5V A;  1CKA A;  3VRY A;  5IHI A;  1UEB A;  2QA4 Q;  4BAC A;  2DL5 A;  1JXO A;  1NG2 A;  4Y28 E;  5CIU A;  2ZGW A;  1K9M C;  1VQ7 Q;  3QJY A;  4LDU A;  4C0Z A;  5IAY A;  1ZSG A;  5HK3 A;  2RJE A;  2O2O A;  4M77 B;  1RAA B;  4Z8A A;  1YJW A;  2RQR A;  2K3Y A;  4CC3 A;  1M8V A;  1YJN Q;  5D6X A;  1ARK A;  1ABO A;  4NL2 A;  2F5K A;  4DBR A;  3EFS A;  1LNX A;  3HRT A;  3EG2 A;  1Q81 R;  3BDU A;  3TSZ A;  2CT3 A;  1M1K U;  4RTT A;  4M7D D;  2MAM A;  5GAN h;  4BI3 A;  8AT1 B;  1K1Z A;  2DYB A;  4PL6 A;  5CK9 A;  4N4I A;  3J80 E;  2JNG A;  5EG2 A;  4AFU C;  2BUD A;  2VXF A;  2VGM A;  1BIB A;  2L8D A;  4R55 A;  3G71 T;  1B07 A;  2R5A A;  3UT1 A;  3CCJ Q;  2HBP A;  1W70 A;  2AHJ B;  1T0J A;  3RER A;  2KDS A;  2KXC A;  2RHU A;  2NUT B;  4KT0 E;  1PM3 A;  2DIQ A;  1S1N A;  3J81 E;  3CCS T;  2QEX Q;  3L1A A;  2EYQ A;  3OMC A;  1JJ2 A;  4C92 E;  4M75 B;  1YIT A;  2OTL T;  3INZ A;  1O75 A;  3OYN A;  4ZGJ B;  2JW4 A;  3CCE A;  2LCL A;  3VU3 C;  1S72 T;  3CC2 A;  2R58 A;  3QWX X;  2XKO C;  3EFO B;  2EKH A;  2EW3 A;  2DLP A;  4M75 G;  3JCM f;  5I11 A;  2DER A;  1BBZ A;  2FRW A;  4PFO A;  3OYG A;  5FW9 A;  3E9G A;  4X1V A;  2HKQ B;  2QK0 A;  3CCQ Q;  4ATO A;  4DOV A;  4M7A C;  3VS7 A;  1VQL Q;  4M7D G;  3JSC A;  1MMD A;  1OPK A;  2NUP A;  1W6X A;  1Q86 U;  1VQN Q;  5J26 A;  3FC3 A;  5J3B A;  2OI3 A;  2HBW A;  2A36 A;  1OOT A;  1YN8 A;  4J5Y A;  3ME9 A;  2W10 A;  1P92 A;  2VC8 A;  4DBH A;  2CZ1 B;  2JMC A;  3M0Q A;  5GAN 6;  3QZ9 B;  1M4Z A;  2L0A A;  2KAF A;  3C94 A;  4GLM A;  3MHX A;  1WJR A;  4PJO F;  4RCB A;  2XI9 A;  3PNW C;  1YHQ A;  3REA B;  4CC2 A;  2RH2 A;  3EG1 A;  1HD3 A;  4M7A D;  4J9B A;  1T3L A;  4R0K A;  1M90 C;  1WDX A;  2KYB A;  2DL7 A;  2WSC E;  3MEU A;  2MCN A;  1QP2 A;  4KUD K;  2DXB A;  4KRT A;  2EQM A;  1PNJ A;  1BI0 A;  1JJ2 P;  2MIO A;  3EG9 A;  1YIJ A;  1U8R A;  4QQG A;  2DBM A;  1RLQ C;  3CD6 Q;  2RK1 A;  2RA2 A;  1VQ9 T;  3GF5 A;  1NBE B;  1WFW A;  4WCI A;  2X9H A;  2F1L A;  2R5M A;  1WGS A;  2YSQ A;  2LQW A;  2H8H A;  2CDT A;  1SHF A;  2JTF A;  4LUD A;  3LYI A;  1D1B A;  2XD0 A;  3QDF A;  1KFZ A;  2D0Q B;  5KYY B;  4JS4 A;  2LVM A;  2EAY A;  1TSF A;  2FZK B;  5GAO l;  1F1B B;  2XHC A;  2GGR A;  3L2W A;  3CCV T;  2H3E B;  1NLP C;  2P0Q A;  4HCK A;  2G3R A;  2JM8 A;  5AYF A;  4Z89 A;  2L3R A;  2DM1 A;  2RHI A;  4IUR A;  1QWF A;  2GTJ A;  2LQN A;  2GF7 A;  4J9G A;  1BCM A;  2DD4 A;  3RR6 A;  2E4H A;  2KMT A;  2ZPG B;  5GAM e;  3CPW A;  4BI8 B;  4C8Q F;  1WQW A;  2X4X A;  1QVP A;  1AWX A;  3M56 A;  2ENM A;  1NEB A;  1MND A;  4EMG A;  5GAM d;  4M77 E;  2CH4 W;  2LT4 A;  2DXC A;  2EBP A;  2F5T X;  3VUZ A;  1YCY A;  1WX6 A;  3VS5 A;  1SHG A;  2DRK A;  1WPY A;  3EGD B;  4M78 A;  4D8K A;  1X69 A;  2KY9 A;  3SDZ A;  3PVQ A;  3JV3 A;  2L3S A;  1LPL A;  1IHV A;  4XTU A;  1GBR A;  1YJ9 A;  2K57 A;  3JCM Q;  3OW2 S;  4GY5 A;  3CC4 T;  5FU7 B;  3S3N A;  3TRE A;  2B8A A;  3E2U A;  4HVU A;  3PE0 A;  1U1S A;  1YFN A;  3URG A;  3P8B B;  2LNV A;  5GMK m;  1EFN A;  1LOJ A;  1UFF A;  1PKT A;  2K3B A;  2XID A;  2GBQ A;  2DTH A;  2RJC A;  4J6X A;  4LE9 A;  1KJW A;  1VA7 A;  3CCU T;  3C4S A;  2LCS A;  3I55 T;  1WZO A;  3CMA A;  2RHZ A;  2KQW A;  3JCM g;  2JN0 A;  1JBM A;  3LH0 A;  1Y7X A;  3G71 Q;  2P0P A;  2EQK A;  1D3B A;  4PJO D;  1VQ5 A;  4ZN3 A;  5L8R E;  5GAN 4;  3CEY A;  2X3W D;  4VUB A;  3EG0 A;  2GNC A;  2K5L A;  3G7Z A;  2COW A;  2GQV A;  2RI5 A;  3CCS Q;  1UGQ B;  5KE2 A;  1G5V A;  2DE0 X;  4QVC A;  2OTL Q;  5KYN A;  4F14 A;  1M5Q 1;  2W0Z A;  1ZBJ A;  4E7L A;  4J83 A;  1V76 A;  4OMN A;  5HCK A;  1K0X A;  1M8M A;  1S72 Q;  3HHT B;  3QPH A;  2KGT A;  3N5B B;  2E70 A;  3CPW P;  4C0D C;  1FMV A;  1G3W A;  2A7Y A;  2MMP A;  2RQV A;  1M2V B;  3A5Z B;  1VIE A;  5FRO A;  2JVV A;  3QBY A;  4JPB W; 
#chains in the Genus database with same CATH homology
 3H0H A;  1AWO A;  2PZ1 A;  4RTV A;  1K0S A;  2RF0 A;  2DA9 A;  1E7O A;  3GBQ A;  2FPF A;  1AOJ A;  3QWY A;  2EQI A;  2RPN A;  5I22 A;  4OML A;  1OEB A;  1G83 A;  1NEG A;  2EGA A;  2YUO A;  5IH2 A;  3UF4 A;  4J9C A;  1AEY A;  3TSW A;  3H41 A;  1GFC A;  2AZS A;  1N5Z A;  3A98 A;  2VVK A;  3M0T A;  3VS4 A;  1LCK A;  2OJ2 A;  3VS1 A;  3VRZ A;  4LNP A;  5L23 A;  2CUB A;  2NWM A;  1ZUK A;  1UDL A;  1AZG B;  2D8H A;  2JS0 A;  1QKX A;  1WI7 A;  1AD5 A;  2DRM A;  2XMF A;  1G2B A;  2EPD A;  2AKL A;  2DX1 A;  2KXD A;  2KR3 A;  3H0F A;  1GCQ C;  3C0C A;  2DVJ A;  3O5Z A;  1UGV A;  4JJD A;  1UTI A;  2LJ3 A;  2F2X A;  1X6B A;  1CSK A;  1K76 A;  2E5K A;  3FJ5 A;  4JJB A;  1A0N B;  4JZ3 A;  2ECZ A;  4M4Z A;  2J7I A;  2PNI A;  2FG0 A;  2O88 A;  1AVZ C;  1GCQ A;  2ABL A;  2CUD A;  4OMQ A;  2HEQ A;  4QT7 A;  1VYV A;  1T0H A;  1T3S A;  1YNZ A;  4ORZ A;  5IHN A;  3THK A;  2CRE A;  1KIK A;  2DL3 A;  1H3H A;  2K2M A;  2L3Q A;  2EGC A;  1WLP B;  3I5R A;  2RNA A;  3LH5 A;  2GQI A;  2ESW A;  4RTU A;  2YT6 A;  2YDL A;  2A28 A;  5GJV B;  1CKB A;  1H92 A;  1UHC A;  4HVV A;  4LN2 A;  3PVL A;  1CKA A;  3VRY A;  5IHI A;  2F2V A;  4J9I A;  2DL5 A;  1JXO A;  1NG2 A;  1SPK A;  4Z88 A;  2DF6 A;  2EYZ A;  1WA7 A;  1ZSG A;  1SSH A;  1PRM C;  2RQU A;  5FWB A;  1TUD A;  2O2O A;  1JXM A;  1ZUU A;  2CSQ A;  1QCF A;  3VS6 A;  2EGE A;  4Z8A A;  2FPE A;  2RQR A;  1TUC A;  1UG1 A;  1I07 A;  4CC3 A;  3EHR A;  1ARK A;  2DL8 A;  1ABO A;  1U5S A;  1X43 A;  2JS2 A;  2LP5 A;  1AWJ A;  1V1C A;  2QDL A;  1RI9 A;  1X6G A;  1FMK A;  1HJD A;  3ZL7 C;  2LJ0 A;  3EG2 A;  4DEX A;  3TSZ A;  2M51 A;  2CT3 A;  1JU5 C;  2DIL A;  2HCK A;  2J06 A;  3EG3 A;  3H0I A;  4RTT A;  2KT8 A;  2A37 A;  4J9H A;  1K9A A;  1K1Z A;  2KRO A;  2DYB A;  2ED1 A;  3EGU A;  2RQT A;  4AFU C;  1IO6 A;  2J6F A;  1Z9Z A;  1B07 A;  1MUZ A;  2JT4 A;  4F17 A;  2JMA A;  1W70 A;  1T0J A;  1JO8 A;  1X2K A;  2D0N A;  2KXC A;  1PRL C;  1E6G A;  4HVW A;  2K7A A;  1M3B A;  1UHF A;  1S1N A;  4OMM A;  1HSQ A;  1M30 A;  1YWO A;  1NYG A;  2G6F X;  3TVT A;  2J6O A;  2IIM A;  2JW4 A;  2SRC A;  1SRM A;  1RLP C;  4GBQ A;  5EC7 A;  3UA7 A;  1JQQ A;  2O9V A;  3QWX X;  2EKH A;  2EW3 A;  2DLP A;  5I11 A;  1BB9 A;  1BBZ A;  2OAW A;  2FRW A;  5FW9 A;  2KT1 A;  1I1J A;  4X1V A;  2FEI A;  1VYU A;  2CH4 A;  1UJ0 A;  3VS7 A;  1K4U S;  1J3T A;  1JEG A;  4AFQ C;  2YUP A;  1OPK A;  1W6X A;  3EHQ A;  2BZX A;  2OI3 A;  2FPD A;  2HBW A;  2A36 A;  1OOT A;  1YN8 A;  3CQT A;  2W10 A;  2MOX A;  3RNJ A;  2ED0 A;  2JMC A;  2RN8 A;  3M0Q A;  2A08 A;  4AG1 C;  1ABQ A;  2L0A A;  2KRS A;  1PKS A;  1OPL A;  4GLM A;  4F16 A;  2NUZ A;  2AKK A;  1WYX A;  4D8D A;  3REA B;  4CC2 A;  2O9S A;  1GFD A;  1NLO C;  3EG1 A;  1HD3 A;  4J9B A;  4ESR A;  1T3L A;  4R0K A;  1TG0 A;  1WDX A;  2AZV A;  2KYB A;  2DL7 A;  4OMO A;  3M0S A;  2VWF A;  2M0Y A;  3VS2 A;  1E6H A;  2HDA A;  2ROT A;  3NGP A;  2MCN A;  2LJ1 A;  2DBK A;  4KRT A;  4JJC A;  4K11 A;  1PNJ A;  2DJQ A;  2MIO A;  4FSS A;  1W1F A;  2DBM A;  2EVR A;  1RLQ C;  4LUE A;  4RTX A;  3U23 A;  2RMO A;  2D1X A;  4RTW A;  5FWC A;  2L2P A;  2JXB A;  1WFW A;  2K79 A;  4WCI A;  1RUW A;  1ZX6 A;  3M0U A;  1WIE A;  2DNU A;  2LNH B;  4AFS C;  4DEY A;  2DL4 A;  2L3P A;  2YSQ A;  2CT4 A;  2RQW A;  1UJY A;  2LQW A;  2H8H A;  2CDT A;  1SHF A;  2BZY A;  4CC7 A;  4LUD A;  1GL5 A;  2JTE A;  1WXB A;  3REB B;  1KFZ A;  3I9Q A;  3I5S A;  2LMJ A;  1M27 C;  3VS0 A;  1UE9 A;  2GTO A;  1X27 A;  2GGR A;  5IXF A;  2DMO A;  1YCS B;  1NLP C;  3RBB B;  4HCK A;  1AWW A;  2JM8 A;  4Z89 A;  2P4R A;  1NYF A;  2DM1 A;  4RTY A;  4OMP A;  1QWF A;  2GTJ A;  5IHK A;  2HSP A;  2LQN A;  2V1R A;  4Y92 A;  4J9G A;  3R6N A;  1UEC A;  5ECA A;  2J6K A;  4IIO A;  4RUG A;  2AK5 A;  2ROL A;  1U3O A;  1QLY A;  1AWX A;  2SEM A;  2ENM A;  1NEB A;  1M3C A;  1WXT A;  3UAT A;  3I35 A;  1B3Q A;  2CH4 W;  3IQL A;  2X3X D;  2PTK A;  2BTT A;  2EBP A;  3ULR B;  1WX6 A;  2FO0 A;  3VS5 A;  2YUQ A;  1SHG A;  3NHN A;  4CC4 B;  1BK2 A;  2DRK A;  4J9E A;  1MV0 B;  4D8K A;  2KE9 A;  1X69 A;  1U06 A;  4EIK A;  1H8K A;  3PVQ A;  3JV3 A;  1WXU A;  1MV3 A;  2KEA A;  2L3S A;  1GBR A;  3VS3 A;  2B86 A;  4E6R A;  3SEM A;  4HVU A;  2LX7 A;  3KFV A;  3PE0 A;  1PWT A;  4JZ4 A;  2C0I A;  1NM7 A;  1EFN A;  2EYX A;  4RTZ A;  4ZNX A;  1UFF A;  1PKT A;  1Y57 A;  2K3B A;  2LZ6 B;  2GBQ A;  1GBQ A;  2KYM A;  1VA7 A;  1KJW A;  1YP5 A;  1ZLM A;  4HXJ A;  4J9F A;  4LE9 A;  2F2W A;  2LCS A;  1M3A A;  2JM9 A;  2KRN A;  5IXB A;  1PHT A;  1VYT A;  1AZE A;  1GCP A;  2KNB B;  3UA6 A;  2KBT A;  1OV3 A;  4AFZ C;  2C0T A;  4A63 B;  2X3W D;  2D8J A;  2V1Q A;  3M0R A;  2C0O A;  3EG0 A;  2GNC A;  3NMZ C;  2I0N A;  2YUN A;  1FYN A;  2KRM A;  1UUE A;  3M0P A;  1X2Q A;  1QKW A;  3SHW A;  3NPF A;  2EYW A;  2K6D A;  2CSI A;  2DE0 X;  1BU1 A;  1Z9Q A;  4IIM A;  4F14 A;  1Y0M A;  2W0Z A;  1ZBJ A;  1YWP A;  4OMN A;  1QWE A;  2K9G A;  5HCK A;  4AG2 C;  5GJW B;  1K0X A;  1M8M A;  1SEM A;  2O31 A;  2BZ8 A;  2KGT A;  2VKN A;  1KSW A;  1I0C A;  1ZUY A;  2FRY A;  2RQV A;  1XOV A;  4J9D A;  2EYY A;  1GRI A;  1SRL A;  4JPB W;  2J05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...