2F2VA

Alpha-spectrin sh3 domain a56g mutant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
b'MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAGYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title Cooperative propagation of local stability changes from low-stability and high-stability regions in a SH3 domain
pubmed doi rcsb
source organism Gallus gallus
molecule tags Signaling protein
total genus 12
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2005-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2f2vA00
2JM8A 1I1JA 2YDLA 2EKHA 1PRLC 1TUCA 2LJ1A 2NWMA 3THKA 4JJCA 1ZLMA 4RTVA 2YUQA 4RTUA 4Z88A 1RLPC 3UA6A 1CKAA 1BB9A 1G2BA 2VWFA 2FEIA 2IIMA 1M27C 4CC2A 1NM7A 1ARKA 4J9DA 2GQIA 1JU5C 2ABLA 3C0CA 5IXFA 2FO0A 3VS1A 4CC7A 1AWJA 1X2QA 2X3XD 2JS2A 3O5ZA 5IHIA 4A63B 5FWCA 1K0XA 1T0HA 2BTTA 1B3QA 1UJ0A 1GRIA 2DRKA 1K76A 1QCFA 3M0SA 4R0KA 4HXJA 2HSPA 4ESRA 1X69A 1H92A 3H0HA 3EG2A 2RPNA 2BZXA 5I11A 2DL3A 4Z89A 2DBKA 3CQTA 2AKKA 1WDXA 2A36A 2EVRA 1CKBA 2GTOA 2P4RA 2K2MA 2DILA 2JTEA 3RNJA 1RI9A 5IHKA 2W0ZA 1AWOA 2JMAA 3REBB 2JS0A 1MV3A 2AKLA 2VKNA 1K0SA 1RLQC 2B86A 1E6HA 4HCKA 1GFCA 4E6RA 1BK2A 4FSSA 2W10A 1X6BA 1Z9ZA 4F14A 1J3TA 1AWXA 2EPDA 2QDLA 4LN2A 1PNJA 1I07A 1AZEA 2CSQA 4AG2C 4ZNXA 1JQQA 2DL8A 2JXBA 4X1VA 3VS0A 1I0CA 1NG2A 2KT8A 3UATA 2KEAA 1IO6A 2DL7A 2JM9A 1SHGA 2CREA 2FRYA 5FWBA 1U5SA 4JJBA 3I5SA 1FYNA 2LP5A 2EYZA 2DE0X 2LJ0A 4AFZC 2LX7A 3QWXX 4LUEA 4RTZA 4HVVA 2J6OA 2ROLA 2GTJA 1SSHA 1SEMA 1WFWA 2NUZA 3KFVA 2PZ1A 2EYYA 2L0AA 2ED1A 3NHNA 1JXOA 2CUBA 2KRMA 1KSWA 4J9GA 4OMLA 1Y57A 2LQNA 2DL5A 3PVQA 4IIOA 1PKSA 2MCNA 2DX1A 4J9HA 2O9SA 3QWYA 1H3HA 3LH5A 1WXTA 4AFSC 4J9CA 2DA9A 4QT7A 2LCSA 2K7AA 1SHFA 1UHFA 1AOJA 1M3CA 2YUPA 3PVLA 2OJ2A 3NMZC 1GBQA 1U06A 1W1FA 1NYFA 4M4ZA 2CT3A 4DEXA 2ECZA 3R6NA 4CC4B 2KNBB 1AD5A 4AG1C 4AFQC 2FPFA 3TVTA 2MOXA 3I35A 2L2PA 3EHQA 4RTWA 3U23A 2C0TA 2FPEA 3I5RA 4JZ4A 1E7OA 1X27A 1AVZC 3M0UA 2J6FA 1M3BA 4HVUA 2KXCA 2XMFA 1PHTA 1QKXA 1WA7A 1A0NB 3SEMA 1UE9A 1UECA 2KYMA 2M51A 1OEBA 3VS3A 2KYBA 1TG0A 3ZL7C 1GCQC 3EG3A 2RN8A 2D1XA 1HSQA 1JEGA 5IH2A 1UFFA 2ENMA 1BU1A 1QLYA 1OV3A 2KT1A 1KIKA 1SPKA 2KGTA 1SRLA 1YWOA 2RQRA 5GJWB 4J9IA 2RNAA 2OI3A 2GNCA 2EGCA 2DYBA 3PE0A 2FPDA 1JO8A 1HJDA 2M0YA 4DEYA 2K3BA 2YUOA 2HCKA 4F16A 2AZSA 3GBQA 2H8HA 3VS6A 4GLMA 2LQWA 2LMJA 1WXUA 1T3SA 3SHWA 4RTTA 3UA7A 1WXBA 1VA7A 4D8DA 3EGUA 3TSZA 1PKTA 1UTIA 1X2KA 2LZ6B 1K4US 2EQIA 1WX6A 2V1RA 3M0RA 4J9BA 1BBZA 1VYTA 3VRZA 1V1CA 1X43A 1ABOA 4JJDA 4LNPA 5ECAA 5L23A 2CH4A 1UDLA 3NGPA 2EYXA 2KBTA 1B07A 4OMPA 2YSQA 4JPBW 3TSWA 1M3AA 1CSKA 3REAB 1EFNA 2EGEA 4RTXA 1MV0B 3RBBB 1YCSB 4JZ3A 3M0QA 2A37A 2O31A 2L3SA 1SRMA 2KR3A 1W6XA 1Y0MA 3H0FA 2LJ3A 1OPLA 2G6FX 1ZSGA 2O9VA 1T0JA 2LNHB 1XOVA 2PNIA 2AZVA 1GL5A 4EIKA 1OOTA 1KFZA 3H41A 1U3OA 2L3QA 2I0NA 1M8MA 4Z8AA 4GBQA 4HVWA 4K11A 1PWTA 2YUNA 1W70A 1ZUUA 1RUWA 2DRMA 1E6GA 1NLOC 2ESWA 4WCIA 1Z9QA 3VS2A 2KRSA 2A08A 2J6KA 5IXBA 1NEGA 1UUEA 1ZUYA 2K6DA 2K9GA 2DL4A 2JW4A 3M0PA 2RQUA 1NEBA 4ORZA 2GBQA 2KE9A 2EGAA 2CDTA 1K9AA 2BZ8A 1GBRA 1QWFA 3VRYA 2DMOA 5EC7A 2MIOA 2YT6A 2AK5A 2GGRA 2SRCA 2FRWA 2DJQA 2O2OA 4KRTA 2J05A 4J9FA 2DBMA 1PRMC 3JV3A 1QWEA 1AWWA 2D8HA 2F2WA 2EBPA 1YN8A 2DF6A 2KRNA 2F2VA 4J9EA 1UG1A 1VYUA 4LUDA 1OPKA 1UHCA 4RTYA 3M0TA 1UGVA 1N5ZA 2RF0A 1AZGB 2HBWA 2RQTA 2VVKA 1GCPA 5I22A 2OAWA 1K1ZA 1H8KA 2CUDA 4D8KA 5HCKA 3EG0A 3NPFA 1ZX6A 2C0IA 1QKWA 1WI7A 1T3LA 2KROA 2L3PA 2J7IA 1WLPB 3A98A 1YWPA 3H0IA 4CC3A 2BZYA 2J06A 3I9QA 2JMCA 2KXDA 1AEYA 4Y92A 2DNUA 2DLPA 2C0OA 2A28A 2K79A 5IHNA 2DVJA 1NYGA 1X6GA 2FG0A 2D8JA 2X3WD 3VS4A 4OMMA 3UF4A 1JXMA 2HEQA 4F17A 1KJWA 2SEMA 1NLPC 2E5KA 2CSIA 2RQWA 2JT4A 1M30A 4AFUC 4OMQA 1S1NA 1ZUKA 1HD3A 3EG1A 4IIMA 2CH4W 1TUDA 3IQLA 3FJ5A 1YP5A 2F2XA 4OMOA 2D0NA 2O88A 4LE9A 1GCQA 1WYXA 1ABQA 4OMNA 1YNZA 2RMOA 1LCKA 1GFDA 1FMKA 2EYWA 2ED0A 2V1QA 1G83A 2ROTA 3VS5A 2RQVA 1VYVA 2CT4A 2EW3A 1UJYA 2PTKA 5FW9A 2HDAA 3ULRB 1MUZA 1WIEA 3EHRA 4RUGA 1ZBJA 3VS7A 5GJVB 2DM1A
chains in the Genus database with same CATH superfamily
2JM8A 4RG2A 5KYYA 3CBPA 4J5YA 2YDLA 1M5Q1 4WF2A 3CD6T 1TUCA 2DVEA 4JJCA 1ZLMA 2YUQA 4JRQA 1D1BA 4BDZA 1CKAA 2IIMA 1VQMA 2HZYA 4CC2A 4ANJA 4J83A 1OU8A 2ZPHB 2QXFA 5IXFA 2VASA 4HT9A 1VQ6T 4LDXA 2EQKA 1AWJA 3O5ZA 4ZGJB 1VQOQ 3MEUA 2XG8D 1K0XA 2P4TA 3V7CA 5IT9E 1GRIA 1K76A 1QCFA 4HXJA 4B9WA 3OYJA 2ZPIB 1H92A 1VIEA 1KHCA 3HRTA 3S6WA 3EG2A 4QVZA 4Z89A 3SFMA 2LCCA 2RH2A 4M75D 1WDXA 4QW2A 1VIFA 2EVRA 4XTUA 4C92F 1CKBA 3OMGA 1JJ2P 4C8QF 2GTOA 1TXQA 2K2MA 2DKGA 3QSUA 3OW2S 4M78E 2CP6A 5IHKA 2YWWA 2DZ9A 1AWOA 5J3BA 4M75B 4FW1A 1VQMQ 2DYIA 3JCMb 2VKNA 1R77A 2B8AA 5CKDA 2DAQA 1M1FA 2A3LA 1E6HA 1WHLA 3MJXA 4J6WA 1BK2A 4AT1B 3RDVA 2W10A 1Z9ZA 4DA4A 1QVGS 4B6MA 1D0ZA 2XDDA 3OSVA 2EPDA 3E9GA 3PTAA 2QK0A 1KQSP 1PNJA 1G8XA 4AG2C 1N8RR 2JXBA 3VS0A 3OMCA 1I0CA 1P92A 4KGVB 4QQGA 3UATA 2KVQG 2V8KA 4J6XA 4JJBA 3I5SA 1FYNA 2LP5A 1ZSZA 2R57A 2LJ0A 2LX7A 3QWXX 5A2QE 1QVFA 4LUEA 2ROLA 1SEMA 2NUZA 2L0AA 3VV0A 1VQKA 5GANe 1JXOA 1HK9A 4QVCA 4PJOA 3OYMA 4OMLA 3JCMP 5I2SA 3CCJT 3PVQA 2MCNA 3CCLA 3Q1JA 4XU1A 2L89A 2O9SA 1M1GA 3LH5A 4JRIA 1WXTA 4FYXB 2VUBA 3I56A 2X4XA 1UHFA 5GANd 1M3CA 2DXBA 2QTXA 1C6VX 3NMZC 1GBQA 4PLIA 3DLLA 1YHQT 4M4ZA 3F70A 3SB2A 2ECZA 3G6EA 5D6YA 3G7ZA 2VGMA 4ELZC 1UB4A 4CC4B 1NJIU 1VQKQ 4FYVB 4AFQC 2FPFA 2EJFA 5GAOq 2MOXA 2L2PA 1VOMA 3EHQA 2FPEA 4PJOE 1YBYA 3CCLQ 1YIJT 3I5RA 3CXCP 4JZ4A 3A8HB 1AVZC 4XTXA 1Q81R 3TREA 3I56Q 3G4ST 2LC4A 1M90R 3QKJA 4KGXB 1TG0A 3EG3A 2RN8A 2OTLT 2QA4A 1QW1A 5IH2A 4F7UF 1D3BB 1Q86R 1ZA1B 3GF5A 2WSCE 1YWOA 2XD0A 2RQRA 1JJ2S 1XJWB 5EG2A 4E7KA 1NJIC 2RNAA 3G6EQ 2OI3A 3PE0A 2FPDA 5HK0A 1HJDA 4WTOB 4E7IA 1I5OB 1FWZA 3GBQA 1RI0A 1WHKA 6AT1B 2HQHA 3VS6A 3S3OA 5A0GA 1D3BA 2X35A 2H3EB 1N6AA 3CCUA 4BY6C 2E6NA 2EQUA 3SHWA 3VUBA 3OYKA 2L8DA 5LJ5e 1KQSS 1UGPB 4M78C 2ZZDA 1X2KA 3CMET 4XTVA 7AT1B 3M0RA 3E9FA 3VRZA 4JJDA 4LNPA 3C12A 5ECAA 5L23A 2QA4Q 3CCSA 3ER0A 3AHUA 1B07A 4M7DB 4OMPA 2YSQA 4EPCA 3EFSA 1M3AA 1CSKA 4L5GA 5LJ5j 2YRDA 3CCVT 2VGNA 3FB9A 1RAFB 2FL7A 5LJ5d 2RO0A 4JZ3A 3JCMJ 4A4HA 2KR3A 1H641 1Y0MA 3RIRA 4N4HA 4IUUA 4MMKA 1VQLT 1ZSGA 2O9VA 2Y4XA 1T0JA 1GL5A 4PLLA 3J7AF 2F5KA 5CKFA 3NTIA 3CCUQ 2I0NA 4Z8AA 4FCYA 2PUOB 2YUNA 1VQNT 2ESWA 3VS2A 5IXBA 4WCIA 1Z9QA 4Z02A 2A08A 2J6KA 2XDBA 1MNEA 2K6DA 2XI9A 3CMAA 2DL4A 2MI6A 4A54A 3CCSQ 4RCCA 4ORZA 2LT4A 2GBQA 2RD1A 3M54A 2EAYA 1RAEB 2R5MA 3QO3A 5GMKl 2DTIA 3FEOA 2P0KA 2HQXA 2GF7A 2E41A 2YT6A 3E1SA 2GGRA 2DJQA 2HKNA 1AWWA 2EBPA 3I55A 3A8GB 3L2ZA 1KG1A 4MMLA 4J9EA 1YJWT 3CXCS 2NLUA 1ZSZC 1UHCA 2LCLA 2QI2A 1N5ZA 5LJ3f 3CMAQ 3D7SB 3CC7T 1M9SA 3EFOB 4M77D 3GLXA 4DQ2A 1VQ9A 1EZZB 5HCKA 5GANg 3M4YA 3EG0A 4PJOC 1R0CB 2EFIA 1WI7A 2ZPGB 2KROA 2X4WA 2DZCA 3G71A 2EIFA 3QUIA 3H0IA 2PVGB 1KD1R 2J06A 2X4JA 4OGEA 3DB4A 3I9QA 2KXDA 3EFOA 3VKIA 4Y92A 2RJEA 2RA2A 4QKUA 2DLPA 3I55Q 2ZAEA 2A28A 2K79A 4KH0B 1G3YA 3OYBA 4PNOA 2QQ9A 3JCMe 2KMTA 2D8JA 2X3WD 4M77A 4OMMA 4X9DA 1JXMA 2HEQA 3MKDA 5I21A 1KJWA 1VQOT 2E5KA 2XHCA 2ZCFB 2JT4A 1VQ9Q 1RABB 3UT1A 5KCHA 4OMQA 2RI5A 4PJOG 3G71Q 2D0NA 3JCMd 2O88A 1QMCA 1GCQA 2XK0A 5KYUB 4MDXA 3NTKA 2RMOA 1QVPA 3BW1A 3ME9A 3QG1A 1LCKA 2NUTB 2KQWA 1WGSA 2RI2A 5GAOn 1VQMT 5GAN6 2RQVA 2MYSA 1VYVA 3S3MA 2CZ0B 2O01E 2PTKA 2DERA 4LD6A 4E7ZA 1MUZA 4M77E 1ZBJA 3VS7A 2ATCB 3CPWA 2FB7A 2MPXC 3VU3C 4A4KA 3EGDB 3WVEB 2LJ1A 2NWMA 5DLQE 2K3YA 4Z88A 1RLPC 1OX8A 2K5LA 2FEIA 1M27C 1D0YA 3VJPA 2DK3A 5LJ5g 2GQIA 3C0CA 2H3JA 4Q5WA 1Y96A 1BIAA 5FWCA 1T0HA 2XIDA 1B3QA 4P5NA 4JRPA 3UWNA 3M0SA 2RM4A 1X69A 4KH1B 4C5EA 3JSCA 1N8RU 4ZGEB 3H0HA 3M4GA 1NZ9A 2KY9A 2RPNA 2BZXA 5AYFA 4BI3A 2DBKA 1H3ZA 1C0MA 5KE3A 2HL3A 4BE0A 4V2SA 1RAHB 1YJWA 2DILA 2JTEA 2WACA 2W0ZA 1M2VA 1QVGP 2QGFB 5CKEA 2AKLA 2CP3A 2CP7A 1FMWA 2F69A 5GAOl 1GFCA 3HFNA 4MZPA 4F04B 1XQHA 4M7AB 2RJCA 4HCCA 1AWXA 4FW2A 1N8RC 3CPFA 3HKSA 1I07A 1AZEA 3H8ZA 1YCYA 4DBHA 4XU0A 4HT8A 1VQKT 1JQQA 1W2BA 2DL8A 1TSFA 3CCEA 3BDLA 2D0QB 3HP9A 2KEAA 3CCLT 4JRKA 3LWHA 3A8LB 1G3SA 4AFZC 1YJWQ 2G3RA 4HVVA 3I56T 3KFVA 4ZTFA 5HK3A 2ZPBB 3HFOA 4EDUA 1EIFA 2M16A 2V26A 3PGGA 2CUBA 1KSWA 4J9GA 2JJ9A 2M0OA 3BY7A 5GAN2 4IIOA 2DL5A 4L6V5 1PKSA 2V8IA 5GAN8 3G6ET 2CKKA 3GNFB 3OY9A 1H3HA 3M9QA 5CO7A 1IGUA 1Q81U 2O4XA 1G3WA 1YI2A 3PT9A 3LGLA 3CCEQ 3M5AA 3BE3A 4LDVA 2FZGB 1M90U 3HSBA 4M78A 3QDFA 5FU6C 3OYYA 2E3IA 1O75A 4GY5A 1Q86U 1U06A 3LW5E 2LX9A 4XTWA 4XTZA 1IRXA 4IUQA 2XKOC 1Q7YR 3R6NA 1GXIE 2DTOA 4XU3A 2AHJB 4DBFA 2QA4T 5GAMe 2COZA 1AD5A 2WSEE 4M77C 3JCMg 2CP2A 3I35A 4RTWA 3U23A 4N4IA 2C0TA 1Q81C 2HQEA 1UGSB 3CBMA 1X27A 2JN0A 1OI1A 4R55A 4OB3B 1VQ8A 1M3BA 4OF1A 5GAN4 1M90C 1Q82U 4KGZB 3E19A 1YI2Q 2KYMA 1DJ7B 3QDRB 5GAMj 1M8VA 3J81E 1OEBA 3VS3A 2KYBA 1Q86C 5GAMd 1GCQC 3L2WA 2P0PA 3CCUT 2E6ZA 4J8OA 1JEGA 3C4SA 1QLYA 2KT1A 3OYAA 4C92B 3HRSA 4J9IA 4ZN1A 4C8QB 2GNCA 2DYBA 1D09B 2KK4A 3E2UA 4LDYA 2YUOA 1UGQB 3CCST 2HCKA 1W4SA 2L3RA 3MEAA 1QVFP 4M77G 2E10A 1YFNA 5KYXB 5KYWB 1WXUA 1Q82C 1T3SA 4RTTA 3UA7A 4M75A 1VA7A 4PFZA 1VQ8Q 2E1HA 2BE9B 2MAMA 2X4YA 2LZ6B 2OX7A 3EG9B 1X75C 3HL8A 4LDUA 5FU7B 1ABOA 1PC0A 4PJOF 1PD0A 2PUKB 2HKQB 4MZTA 1LVKA 2DD5A 4JPBW 3TSWA 1Q95G 5GANf 4DOVA 3MCAB 2MWPA 4RTXA 1K8AR 1C1AA 1VQ5A 3CMAT 1YCSB 3HPWA 2O31A 1SRMA 2RK2A 1K73R 2Y90A 1W6XA 2LJ3A 2G6FX 2E70A 2LNHB 2PNIA 3H41A 3HTRA 2L3QA 1NBEB 3JB9H 4C0ZA 4K11A 1N9SA 4TVRA 1W70A 2DRMA 1E6GA 4M75E 4PK4A 1NEGA 2RHUA 1KHIA 3KXTA 2YXYA 2K9GA 2JW4A 3I55T 1JBMA 2RQUA 3RR6A 3KUFA 4ZTJA 2KE9A 4HKEA 4LD9K 1K9AA 4C0DB 1QWFA 5KYNA 4PJMA 1VQ5Q 4OB0B 2CZ7B 1V76A 5GAOp 2DMOA 1VQ9T 2AK5A 2J05A 3JV3A 3QYGB 4IKFA 3QXEB 1OZ2A 3TQ7P 3G71T 3GIBA 3M59A 4II1A 2XICA 2RHYA 5C0MA 4LUDA 1WQ7A 1OPKA 2PVOB 3PIOA 2LQ8A 2M9UA 1AZGB 1VQ7T 3V8LA 3EH2A 1GCPA 3PMIA 4UC4A 1K1ZA 1VUBA 3OQ5A 1WHHA 1EX4A 4D8KA 3OBYA 4RMOA 2CS7A 4FL6A 4ZN3A 1ZX6A 1QKWA 4F7UB 1T3LA 1BI1A 3A98A 3X25B 3OYLA 1YWPA 4JS4A 4NOYA 2BZYA 4CRIA 4BE1A 3OA6A 2PVDB 1O9SA 2DNUA 2BE7D 5AT1B 4O6JA 4LDWA 3X20B 1QVFS 4M7DD 2C0OA 3A8MB 1NYGA 2OTJA 3VYHB 3M53A 2EYQA 1Y71A 2BUDA 4EMHA 3CEYA 4MDWA 2ZGWA 1ZQ1A 2JVVA 1S72A 3GP8A 1TS9A 5GAMg 1QCNA 3V8KA 1ZUKA 2CH4W 8ATCB 3OYHA 4ATOA 4CI0C 2F2XA 2K3XA 3QIIA 4BDYA 3V7SA 1Y7XA 2OAUA 5GANh 4M7DA 3MPUB 4OMNA 2QASA 5CQYA 3QHSA 1YNZA 3CCRA 2LT1A 4M78G 3X24B 1GFDA 1FMKA 2EYWA 2MWOA 3JB9D 1G83A 2OTJQ 4F7UE 3SWNB 2QQBA 1UJYA 2LTOA 2HBPA 5FW9A 3ZFJA 8AT1B 3UDCA 4BI8B 2HDAA 5HKCA 3ULRB 5A0DA 4RUGA 5GJVB 2DM1A 2AT1B 1B34B 1S72Q 5DLOA 3OYFA 5KH6A 4XTYA 1PRLC 3RESA 2FVUA 3THKA 4JUVA 4RTVA 3V7RA 3GPLA 1YJ9A 5CQXA 3L1AA 4RTUA 3UA6A 4M75C 2QEXA 1G2BA 2VWFA 4FIBA 1NM7A 1ARKA 4IUTA 3MP1A 4E47A 2FO0A 3VS1A 4CC7A 2X3XD 5IHIA 2JS2A 3X28B 4M7DE 4QQDA 4A63B 3CCRQ 2BTTA 4XK8E 4E7SA 1UJ0A 4R0KA 2HSPA 2MF2A 1IGQA 1YITA 2JZ2A 5CCAA 4A4FA 3CQTA 3P8HA 1U1TA 2JUFA 3V8JA 2JOYA 2P4RA 4EMKB 1B7TA 3LLRA 3L42A 3CCET 1YJ9Q 3MEWA 2DD4A 3CC2A 4E7LA 2KSSA 2QEXQ 2JMAA 3REBB 2JS0A 4M75G 1VQ7A 2MK5A 4M77F 2B86A 3G1JA 3M55A 3JCMf 3PMTA 5KE2A 3L2QA 4FT4A 1X01A 1BKBA 4BB7A 4N0AA 1RADB 5LJ5h 2DPPB 2NUPB 1NE8A 4X9CA 5LJ3j 3SDZA 1YITQ 4X1VA 3M58A 1SF9A 2L5QA 3EGXB 2JM9A 1SHGA 5CR2A 3MHXA 1D1CA 2DE0X 3HHTB 1YI2T 2BKDN 4PKCC 1OZ3A 3CC2Q 1Q7YU 3A8OB 3CPWP 2EYYA 1XNIA 3NHNA 1VQ7Q 1MNDA 3C95A 2KRMA 5M9OA 5GAOr 4J9HA 1PSEA 5GMKe 3QWYA 4FSXA 3LGFA 2QG9B 5KYUA 3MP8A 2HNIA 2LCSA 2RI3A 1SHFA 1AOJA 4L59A 2YUPA 2NUTA 3PVLA 4J7FA 3AT1B 3FDRA 1VQ8T 1Q7YC 1RAGB 1NYFA 1U1SA 5GMKj 1D1AA 2CT3A 4O5VA 4A4EA 1MMGA 3JCMW 2K57A 5DM7R 3DB3A 1G5VA 3EGDA 4AG1C 1K9MR 4E7HA 1SG5A 3TVTA 2A7YA 2E5QA 3QPHA 4KULA 2J6FA 4HVUA 2XMFA 1PHTA 2C06A 1UECA 4HCBA 2E65A 2M51A 4AMCA 4EMGA 1YJNA 4M7AD 4M7DC 1KIKA 1OV3A 1W2BP 1SRLA 2DTHA 2XU8A 3OB9A 5D6WA 1IZ6A 5CK9A 1K8AU 1M1KR 2EGCA 1WJRA 1JO8A 3TEEA 2M0YA 1K73U 2K3BA 4F16A 2CZ1B 2AZSA 1VQPA 2LQWA 2LMJA 3CBOA 1ZBXA 4Y91A 1VQ5T 1WJSA 3L2RA 4D8DA 3EGUA 3TSZA 1X6OA 3JCMh 1K4US 3OW2A 1M2OA 2EQIA 4M7AA 1WX6A 4J9BA 1BBZA 1VYTA 1X43A 3WXMB 1IXDA 1YJNQ 2CH4A 1UDLA 3NGPA 2EYXA 2KBTA 1K8AC 3MEVA 1KC8R 4M7DG 3CCMA 2QQAA 4C5HA 2X51A 4PFPA 2M02A 1K73C 2RHXA 3QJ6A 3RBBB 3META 4YTLA 3M0QA 1BYMA 2F1LA 2A37A 2L3SA 3CPWS 1MHNA 1OPLA 4PL6A 1VQPQ 2YHTA 1KFZA 4M78F 1OYXA 2I2LA 3QBYA 1M8MA 4GBQA 4BY6B 3L2VA 4A53A 1PWTA 2P84A 5KYYB 1ZUUA 1NLOC 2K2VA 3VUZA 3BDUA 1ZUYA 2HSEB 3M57A 3OS5A 4Y28E 3M0PA 1SKUB 5IN1A 4M7AE 2IPOB 5LJ3g 2EGAA 2CDTA 4KT0E 1VQ4A 3CC4A 4ZGDB 1GBRA 3CCMQ 4XQ3A 5I2MA 3JB9G 4EMKC 4JJNK 1WHMA 4N0AC 4OB1B 5EC7A 2COYA 3OYDA 2SRCA 5GMKi 1PRMC 3FC3A 1QWEA 2D8HA 2F2WA 1QP2A 2HMAA 1YN8A 2DFUA 4C92D 2F2VA 2JTFA 4N4GA 4C8QD 4C0FA 3L2UA 4OMFB 2EKOA 1TOVA 2DEQA 1IREB 2EQMA 1OULA 1UGVA 2RF0A 2FYKA 2HBWA 2RB6A 2GQVA 1FX7A 1MGQA 5I22A 5CAIA 1H8KA 4A4GA 2CUDA 3RERA 1VQ4Q 3NPFA 3QZ9B 3JCMV 2DIQA 2OTJT 3CC4Q 2C0IA 3EFRA 1W2BS 1RL2A 4QQ6A 2K5FA 4M75F 3RUXA 2J7IA 2K5IA 3INZA 4CC3A 1S72T 1AEYA 4C92A 3GNGA 4C8QA 4LXCA 3EH1A 4KUDK 3OBWA 3QJYA 2DVJA 1PD1A 1X6GA 2E64A 1JJ2A 4PJOD 1ZSZB 3VS4A 5KYXA 5KYWA 2SEMA 3CCRT 3JCMc 2CSIA 2RQWA 4AFUC 2X9HA 3SD4A 1XTDA 3EG9A 4PJOB 1TU0B 4RCBA 1TUDA 3FJ5A 1YP5A 1OX9A 3JAME 1WYXA 1KQSA 1AT1B 5FRNA 1TH7A 5FRMA 1ABQA 1QQJA 1JRIA 2CP5A 3C94A 4NL2A 4NL3A 3FLGA 2RHZA 4C92E 1BCMA 4OP0A 5GAN7 1YJ9T 2E12A 4C8QE 2QEXT 2V8JA 2VV5A 5GMKm 2ED0A 1NPPA 3HRUA 1HYOA 2EW3A 1WIEA 4FU6A 1R0BG 4JLIA 5GANj 2HAXA 1I1JA 3H9NA 4OVAA 5LL6S 2EKHA 3A1PA 1YITT 1KK7A 1KD1U 1I8FA 3CCQA 1BB9A 2CGHA 1U8RA 3O8VA 5GAMh 4J9DA 2F5TX 4IUPA 1JU5C 2ABLA 4BACA 1X2QA 5FROA 4M7AC 5D6XA 3QZ5B 1PM3A 3CC2T 2DRKA 5GAN5 1RAAB 4ESRA 9ATCB 1NPRA 1FMVA 1SSFA 2VYTA 3CD6A 5I11A 2IVWA 2HL5C 2DL3A 2RJDA 1LOJA 2AKKA 4HCZA 1TWBA 2A36A 2GFAA 1KD1C 1QCOA 3RKWA 1VQ6A 1ZHIA 3JCMQ 3P8DA 3RNJA 3FRNA 3CCQQ 1RI9A 4IURA 3CXCA 3NFCA 5LJ5f 1MV3A 3X26B 3H6ZA 2CZ6B 1UEBA 1K0SA 1WHGA 1RLQC 2RK1A 3FIFA 4HCKA 5DY9A 1IHWA 4F7UA 4E6RA 4FSSA 2COWA 1X6BA 2YRVA 4M7AG 3LX7A 4F14A 1J3TA 1TTHB 2QDLA 4LN2A 2DETA 1WJQA 1MMNA 2CSQA 4ZNXA 3DLMA 3CD6Q 2VB6A 1NG2A 4B9XA 2KT8A 3LWIA 2VC8A 1Q82R 1IO6A 2FHDA 2DL7A 2CREA 2FRYA 5FWBA 1HXDA 1WNLA 1U5SA 2VXEA 4M7DF 2DXUA 2EJGA 5GAN3 2EYZA 1VQ6Q 1V29B 1ZA2B 2KDSA 4RKUE 3LYIA 4RTZA 2J6OA 1SSHA 2GTJA 1WFWA 1BI3A 1TUGB 2PZ1A 1I4K1 3RKYA 1IHVA 1D0XA 2ED1A 5J26A 4C5GA 1OU9A 4FYWB 1BI2A 1WQWA 3PNWC 1K9MU 1Y57A 4ME7A 4DBQA 2LQNA 2DX1A 2WSFE 3JCMX 3BFMA 4FM4B 4BUGA 3URGA 2JTMA 4MZMA 4AFSC 4JS5A 3VYGA 2QQRA 4DOWA 4J9CA 2DA9A 4QT7A 2K7AA 1PCXA 2XDPA 5C6SA 4ELYC 1G3TA 4DBRA 1IB8A 1KQ1A 2OJ2A 4C5IA 3MP6A 1W1FA 3SWNA 3OYCA 4C92C 3JB9F 3CCJA 4C8QC 4PJNA 4DEXA 1JB0E 1M1KU 1K9MC 2M1HA 1B34A 1WZOA 2KNBB 1YJNT 3J80E 1E7OA 3ASKA 3M0UA 2LNVA 3RKXA 2KXCA 1A0NB 1WA7A 1QKXA 3SEMA 1UE9A 1Y07A 1YHQA 4BE2A 3RMSA 4PFOA 1VQPT 1PSFA 5FU7C 2QTVA 5GAOm 3ZL7C 1WHJA 2D1XA 1HSQA 1UFFA 5FU6B 2ENMA 1BU1A 1KC8U 1SPKA 2KGTA 2QAZA 3R6OA 1M1KC 1OQKA 4RG8A 5LJ3e 4BI4A 4C92G 2Z0WA 3CCJQ 5GJWB 4C8QG 1YIJA 3KBGA 3WVDB 4DEYA 1NJIR 2H8HA 4EMKA 3G4SA 2PQWA 4M77B 3UPUA 2KAFA 4GLMA 4OGCA 1AHJB 5CVIA 3CCMT 2OTLA 2YLBA 1MMAA 3ZEHA 1WXBA 1MMDA 5LJ3d 1PKTA 4R56A 1YHQQ 1UTIA 1PG5B 3MO8A 2BIVA 2V1RA 4NS5A 2P0QA 3PIPA 2QDYB 1KC8C 2LDMA 2VXFA 1V1CA 2NUPA 5HY6A 4C0DC 3REAB 1EFNA 2AIRB 2EGEA 2RHIA 1YIJQ 1MV0B 3EGXA 4OB2B 4FYYB 5CKHA 3QYHB 2KI7A 4KBMB 2QQSA 2D6FA 2GFUA 3H0FA 2JNGA 3RMQA 3CMEA 1LJOA 1VQ4T 3G4SQ 1R8OB 3CC4T 1XOVA 2AZVA 4EIKA 1OOTA 4J7IA 1U3OA 2DEUA 2E3HA 2OTLQ 4X34A 3N5BB 1RACB 5IAYA 4HVWA 4IUVA 4BD3A 3JB9J 1RUWA 2KRSA 1BI0A 1UUEA 2D9TA 2E4HA 3CCVA 3OYEA 1F1BB 2QGGA 2QYZA 2K4YA 1NEBA 1I5LA 4C0GA 4E7JA 2EWNA 1VQLA 1RAIB 3T9NA 3OYNA 2HD0A 2BZ8A 2ZPEB 3VRYA 1Y96B 3OS0A 1VQNA 1QP3A 3OS1A 2MIOA 2R58A 1KQ2A 3TU4K 2FRWA 2O2OA 3CMEQ 4KRTA 4J9FA 2DBMA 3PFSA 5KCOA 1LNXA 1N9RA 2DF6A 3A5ZB 2KRNA 2ZPFB 3OYGA 3TCJA 1UG1A 1VYUA 4J6YA 3OS2A 4RTYA 2IG0A 3M0TA 3CCVQ 3JRZA 2LQKA 2RQTA 2VVKA 1M2VB 2OAWA 1ACMB 3S3NA 2DIGA 1VQLQ 3M56A 1LPLA 2NYSA 5L8RE 4F7UG 3OW2P 2GCXA 2L3PA 1M4ZA 1WPYA 1WLPB 3LH0A 5LJ3h 2R5AA 1VQNQ 2FZKB 2YLCA 3ZBDA 2JMCA 5D7UA 4M7AF 2EQJA 5A0LA 4JLGA 3CC7A 2EJ9A 3GOXA 4QVDA 5IHNA 1BCOA 2A0FB 2FG0A 3SWNC 5CKBA 4KUIA 2PU9B 1UGRB 2LVMA 3UF4A 2MMPA 4F17A 2DJZA 1NLPC 2LRQA 1QVGA 2Y4YA 3DKMA 1M30A 1BIBA 2RJFA 1S1NA 4HA8A 2DXTA 1HD3A 3EG1A 4IIMA 5J39A 3IQLA 1N27A 4D6WA 2CP0A 4XU2A 4OMOA 2YRCA 4LE9A 4M78D 3OYIA 3OSSC 1I81A 3FJPA 2O4XB 3JB9I 2DO3A 4JDSA 1VQOA 3P8BB 4PJJA 4VUBA 4FT2A 3CC7Q 2CYZB 3CCQT 3EAEA 3NTHA 4XAXB 4M78B 4PJLA 5GMKh 4GLKA 2V1QA 2ROTA 3VS5A 4E2FB 2CT4A 2FZCB 2DXCA 5CIUA 1FXXA 3EHRA 5GAMf 5FLXE
chains in the Genus database with same CATH topology
2JM8A 1I1JA 2YDLA 2EKHA 1PRLC 1TUCA 2LJ1A 2NWMA 3THKA 4JJCA 1ZLMA 4RTVA 2YUQA 4RTUA 4Z88A 1RLPC 3UA6A 1CKAA 1BB9A 1G2BA 2VWFA 2FEIA 2IIMA 1M27C 4CC2A 1NM7A 1ARKA 4J9DA 2GQIA 1JU5C 2ABLA 3C0CA 5IXFA 2FO0A 3VS1A 4CC7A 1AWJA 1X2QA 2X3XD 2JS2A 3O5ZA 5IHIA 4A63B 5FWCA 1K0XA 1T0HA 2BTTA 1B3QA 1UJ0A 1GRIA 2DRKA 1K76A 1QCFA 3M0SA 4R0KA 4HXJA 2HSPA 4ESRA 1X69A 1H92A 3H0HA 3EG2A 2RPNA 2BZXA 5I11A 2DL3A 4Z89A 2DBKA 3CQTA 2AKKA 1WDXA 2A36A 2EVRA 1CKBA 2GTOA 2P4RA 2K2MA 2DILA 2JTEA 3RNJA 1RI9A 5IHKA 2W0ZA 1AWOA 2JMAA 3REBB 2JS0A 1MV3A 2AKLA 2VKNA 1K0SA 1RLQC 2B86A 1E6HA 4HCKA 1GFCA 4E6RA 1BK2A 4FSSA 2W10A 1X6BA 1Z9ZA 4F14A 1J3TA 1AWXA 2EPDA 2QDLA 4LN2A 1PNJA 1I07A 1AZEA 2CSQA 4AG2C 4ZNXA 1JQQA 2DL8A 2JXBA 4X1VA 3VS0A 1I0CA 1NG2A 2KT8A 3UATA 2KEAA 1IO6A 2DL7A 2JM9A 1SHGA 2CREA 2FRYA 5FWBA 1U5SA 4JJBA 3I5SA 1FYNA 2LP5A 2EYZA 2DE0X 2LJ0A 4AFZC 2LX7A 3QWXX 4LUEA 4RTZA 4HVVA 2J6OA 2ROLA 2GTJA 1SSHA 1SEMA 1WFWA 2NUZA 3KFVA 2PZ1A 2EYYA 2L0AA 2ED1A 3NHNA 1JXOA 2CUBA 2KRMA 1KSWA 4J9GA 4OMLA 1Y57A 2LQNA 2DL5A 3PVQA 4IIOA 1PKSA 2MCNA 2DX1A 4J9HA 2O9SA 3QWYA 1H3HA 3LH5A 1WXTA 4AFSC 4J9CA 2DA9A 4QT7A 2LCSA 2K7AA 1SHFA 1UHFA 1AOJA 1M3CA 2YUPA 3PVLA 2OJ2A 3NMZC 1GBQA 1U06A 1W1FA 1NYFA 4M4ZA 2CT3A 4DEXA 2ECZA 3R6NA 4CC4B 2KNBB 1AD5A 4AG1C 4AFQC 2FPFA 3TVTA 2MOXA 3I35A 2L2PA 3EHQA 4RTWA 3U23A 2C0TA 2FPEA 3I5RA 4JZ4A 1E7OA 1X27A 1AVZC 3M0UA 2J6FA 1M3BA 4HVUA 2KXCA 2XMFA 1PHTA 1QKXA 1WA7A 1A0NB 3SEMA 1UE9A 1UECA 2KYMA 2M51A 1OEBA 3VS3A 2KYBA 1TG0A 3ZL7C 1GCQC 3EG3A 2RN8A 2D1XA 1HSQA 1JEGA 5IH2A 1UFFA 2ENMA 1BU1A 1QLYA 1OV3A 2KT1A 1KIKA 1SPKA 2KGTA 1SRLA 1YWOA 2RQRA 5GJWB 4J9IA 2RNAA 2OI3A 2GNCA 2EGCA 2DYBA 3PE0A 2FPDA 1JO8A 1HJDA 2M0YA 4DEYA 2K3BA 2YUOA 2HCKA 4F16A 2AZSA 3GBQA 2H8HA 3VS6A 4GLMA 2LQWA 2LMJA 1WXUA 1T3SA 3SHWA 4RTTA 3UA7A 1WXBA 1VA7A 4D8DA 3EGUA 3TSZA 1PKTA 1UTIA 1X2KA 2LZ6B 1K4US 2EQIA 1WX6A 2V1RA 3M0RA 4J9BA 1BBZA 1VYTA 3VRZA 1V1CA 1X43A 1ABOA 4JJDA 4LNPA 5ECAA 5L23A 2CH4A 1UDLA 3NGPA 2EYXA 2KBTA 1B07A 4OMPA 2YSQA 4JPBW 3TSWA 1M3AA 1CSKA 3REAB 1EFNA 2EGEA 4RTXA 1MV0B 3RBBB 1YCSB 4JZ3A 3M0QA 2A37A 2O31A 2L3SA 1SRMA 2KR3A 1W6XA 1Y0MA 3H0FA 2LJ3A 1OPLA 2G6FX 1ZSGA 2O9VA 1T0JA 2LNHB 1XOVA 2PNIA 2AZVA 1GL5A 4EIKA 1OOTA 1KFZA 3H41A 1U3OA 2L3QA 2I0NA 1M8MA 4Z8AA 4GBQA 4HVWA 4K11A 1PWTA 2YUNA 1W70A 1ZUUA 1RUWA 2DRMA 1E6GA 1NLOC 2ESWA 4WCIA 1Z9QA 3VS2A 2KRSA 2A08A 2J6KA 5IXBA 1NEGA 1UUEA 1ZUYA 2K6DA 2K9GA 2DL4A 2JW4A 3M0PA 2RQUA 1NEBA 4ORZA 2GBQA 2KE9A 2EGAA 2CDTA 1K9AA 2BZ8A 1GBRA 1QWFA 3VRYA 2DMOA 5EC7A 2MIOA 2YT6A 2AK5A 2GGRA 2SRCA 2FRWA 2DJQA 2O2OA 4KRTA 2J05A 4J9FA 2DBMA 1PRMC 3JV3A 1QWEA 1AWWA 2D8HA 2F2WA 2EBPA 1YN8A 2DF6A 2KRNA 2F2VA 4J9EA 1UG1A 1VYUA 4LUDA 1OPKA 1UHCA 4RTYA 3M0TA 1UGVA 1N5ZA 2RF0A 1AZGB 2HBWA 2RQTA 2VVKA 1GCPA 5I22A 2OAWA 1K1ZA 1H8KA 2CUDA 4D8KA 5HCKA 3EG0A 3NPFA 1ZX6A 2C0IA 1QKWA 1WI7A 1T3LA 2KROA 2L3PA 2J7IA 1WLPB 3A98A 1YWPA 3H0IA 4CC3A 2BZYA 2J06A 3I9QA 2JMCA 2KXDA 1AEYA 4Y92A 2DNUA 2DLPA 2C0OA 2A28A 2K79A 5IHNA 2DVJA 1NYGA 1X6GA 2FG0A 2D8JA 2X3WD 3VS4A 4OMMA 3UF4A 1JXMA 2HEQA 4F17A 1KJWA 2SEMA 1NLPC 2E5KA 2CSIA 2RQWA 2JT4A 1M30A 4AFUC 4OMQA 1S1NA 1ZUKA 1HD3A 3EG1A 4IIMA 2CH4W 1TUDA 3IQLA 3FJ5A 1YP5A 2F2XA 4OMOA 2D0NA 2O88A 4LE9A 1GCQA 1WYXA 1ABQA 4OMNA 1YNZA 2RMOA 1LCKA 1GFDA 1FMKA 2EYWA 2ED0A 2V1QA 1G83A 2ROTA 3VS5A 2RQVA 1VYVA 2CT4A 2EW3A 1UJYA 2PTKA 5FW9A 2HDAA 3ULRB 1MUZA 1WIEA 3EHRA 4RUGA 1ZBJA 3VS7A 5GJVB 2DM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JM8 A;  1I1J A;  2YDL A;  2EKH A;  1PRL C;  1TUC A;  2LJ1 A;  2NWM A;  3THK A;  4JJC A;  1ZLM A;  4RTV A;  2YUQ A;  4RTU A;  4Z88 A;  1RLP C;  3UA6 A;  1CKA A;  1BB9 A;  1G2B A;  2VWF A;  2FEI A;  2IIM A;  1M27 C;  4CC2 A;  1NM7 A;  1ARK A;  4J9D A;  2GQI A;  1JU5 C;  2ABL A;  3C0C A;  5IXF A;  2FO0 A;  3VS1 A;  4CC7 A;  1AWJ A;  1X2Q A;  2X3X D;  2JS2 A;  3O5Z A;  5IHI A;  4A63 B;  5FWC A;  1K0X A;  1T0H A;  2BTT A;  1B3Q A;  1UJ0 A;  1GRI A;  2DRK A;  1K76 A;  1QCF A;  3M0S A;  4R0K A;  4HXJ A;  2HSP A;  4ESR A;  1X69 A;  1H92 A;  3H0H A;  3EG2 A;  2RPN A;  2BZX A;  5I11 A;  2DL3 A;  4Z89 A;  2DBK A;  3CQT A;  2AKK A;  1WDX A;  2A36 A;  2EVR A;  1CKB A;  2GTO A;  2P4R A;  2K2M A;  2DIL A;  2JTE A;  3RNJ A;  1RI9 A;  5IHK A;  2W0Z A;  1AWO A;  2JMA A;  3REB B;  2JS0 A;  1MV3 A;  2AKL A;  2VKN A;  1K0S A;  1RLQ C;  2B86 A;  1E6H A;  4HCK A;  1GFC A;  4E6R A;  1BK2 A;  4FSS A;  2W10 A;  1X6B A;  1Z9Z A;  4F14 A;  1J3T A;  1AWX A;  2EPD A;  2QDL A;  4LN2 A;  1PNJ A;  1I07 A;  1AZE A;  2CSQ A;  4AG2 C;  4ZNX A;  1JQQ A;  2DL8 A;  2JXB A;  4X1V A;  3VS0 A;  1I0C A;  1NG2 A;  2KT8 A;  3UAT A;  2KEA A;  1IO6 A;  2DL7 A;  2JM9 A;  1SHG A;  2CRE A;  2FRY A;  5FWB A;  1U5S A;  4JJB A;  3I5S A;  1FYN A;  2LP5 A;  2EYZ A;  2DE0 X;  2LJ0 A;  4AFZ C;  2LX7 A;  3QWX X;  4LUE A;  4RTZ A;  4HVV A;  2J6O A;  2ROL A;  2GTJ A;  1SSH A;  1SEM A;  1WFW A;  2NUZ A;  3KFV A;  2PZ1 A;  2EYY A;  2L0A A;  2ED1 A;  3NHN A;  1JXO A;  2CUB A;  2KRM A;  1KSW A;  4J9G A;  4OML A;  1Y57 A;  2LQN A;  2DL5 A;  3PVQ A;  4IIO A;  1PKS A;  2MCN A;  2DX1 A;  4J9H A;  2O9S A;  3QWY A;  1H3H A;  3LH5 A;  1WXT A;  4AFS C;  4J9C A;  2DA9 A;  4QT7 A;  2LCS A;  2K7A A;  1SHF A;  1UHF A;  1AOJ A;  1M3C A;  2YUP A;  3PVL A;  2OJ2 A;  3NMZ C;  1GBQ A;  1U06 A;  1W1F A;  1NYF A;  4M4Z A;  2CT3 A;  4DEX A;  2ECZ A;  3R6N A;  4CC4 B;  2KNB B;  1AD5 A;  4AG1 C;  4AFQ C;  2FPF A;  3TVT A;  2MOX A;  3I35 A;  2L2P A;  3EHQ A;  4RTW A;  3U23 A;  2C0T A;  2FPE A;  3I5R A;  4JZ4 A;  1E7O A;  1X27 A;  1AVZ C;  3M0U A;  2J6F A;  1M3B A;  4HVU A;  2KXC A;  2XMF A;  1PHT A;  1QKX A;  1WA7 A;  1A0N B;  3SEM A;  1UE9 A;  1UEC A;  2KYM A;  2M51 A;  1OEB A;  3VS3 A;  2KYB A;  1TG0 A;  3ZL7 C;  1GCQ C;  3EG3 A;  2RN8 A;  2D1X A;  1HSQ A;  1JEG A;  5IH2 A;  1UFF A;  2ENM A;  1BU1 A;  1QLY A;  1OV3 A;  2KT1 A;  1KIK A;  1SPK A;  2KGT A;  1SRL A;  1YWO A;  2RQR A;  5GJW B;  4J9I A;  2RNA A;  2OI3 A;  2GNC A;  2EGC A;  2DYB A;  3PE0 A;  2FPD A;  1JO8 A;  1HJD A;  2M0Y A;  4DEY A;  2K3B A;  2YUO A;  2HCK A;  4F16 A;  2AZS A;  3GBQ A;  2H8H A;  3VS6 A;  4GLM A;  2LQW A;  2LMJ A;  1WXU A;  1T3S A;  3SHW A;  4RTT A;  3UA7 A;  1WXB A;  1VA7 A;  4D8D A;  3EGU A;  3TSZ A;  1PKT A;  1UTI A;  1X2K A;  2LZ6 B;  1K4U S;  2EQI A;  1WX6 A;  2V1R A;  3M0R A;  4J9B A;  1BBZ A;  1VYT A;  3VRZ A;  1V1C A;  1X43 A;  1ABO A;  4JJD A;  4LNP A;  5ECA A;  5L23 A;  2CH4 A;  1UDL A;  3NGP A;  2EYX A;  2KBT A;  1B07 A;  4OMP A;  2YSQ A;  4JPB W;  3TSW A;  1M3A A;  1CSK A;  3REA B;  1EFN A;  2EGE A;  4RTX A;  1MV0 B;  3RBB B;  1YCS B;  4JZ3 A;  3M0Q A;  2A37 A;  2O31 A;  2L3S A;  1SRM A;  2KR3 A;  1W6X A;  1Y0M A;  3H0F A;  2LJ3 A;  1OPL A;  2G6F X;  1ZSG A;  2O9V A;  1T0J A;  2LNH B;  1XOV A;  2PNI A;  2AZV A;  1GL5 A;  4EIK A;  1OOT A;  1KFZ A;  3H41 A;  1U3O A;  2L3Q A;  2I0N A;  1M8M A;  4Z8A A;  4GBQ A;  4HVW A;  4K11 A;  1PWT A;  2YUN A;  1W70 A;  1ZUU A;  1RUW A;  2DRM A;  1E6G A;  1NLO C;  2ESW A;  4WCI A;  1Z9Q A;  3VS2 A;  2KRS A;  2A08 A;  2J6K A;  5IXB A;  1NEG A;  1UUE A;  1ZUY A;  2K6D A;  2K9G A;  2DL4 A;  2JW4 A;  3M0P A;  2RQU A;  1NEB A;  4ORZ A;  2GBQ A;  2KE9 A;  2EGA A;  2CDT A;  1K9A A;  2BZ8 A;  1GBR A;  1QWF A;  3VRY A;  2DMO A;  5EC7 A;  2MIO A;  2YT6 A;  2AK5 A;  2GGR A;  2SRC A;  2FRW A;  2DJQ A;  2O2O A;  4KRT A;  2J05 A;  4J9F A;  2DBM A;  1PRM C;  3JV3 A;  1QWE A;  1AWW A;  2D8H A;  2F2W A;  2EBP A;  1YN8 A;  2DF6 A;  2KRN A;  2F2V A;  4J9E A;  1UG1 A;  1VYU A;  4LUD A;  1OPK A;  1UHC A;  4RTY A;  3M0T A;  1UGV A;  1N5Z A;  2RF0 A;  1AZG B;  2HBW A;  2RQT A;  2VVK A;  1GCP A;  5I22 A;  2OAW A;  1K1Z A;  1H8K A;  2CUD A;  4D8K A;  5HCK A;  3EG0 A;  3NPF A;  1ZX6 A;  2C0I A;  1QKW A;  1WI7 A;  1T3L A;  2KRO A;  2L3P A;  2J7I A;  1WLP B;  3A98 A;  1YWP A;  3H0I A;  4CC3 A;  2BZY A;  2J06 A;  3I9Q A;  2JMC A;  2KXD A;  1AEY A;  4Y92 A;  2DNU A;  2DLP A;  2C0O A;  2A28 A;  2K79 A;  5IHN A;  2DVJ A;  1NYG A;  1X6G A;  2FG0 A;  2D8J A;  2X3W D;  3VS4 A;  4OMM A;  3UF4 A;  1JXM A;  2HEQ A;  4F17 A;  1KJW A;  2SEM A;  1NLP C;  2E5K A;  2CSI A;  2RQW A;  2JT4 A;  1M30 A;  4AFU C;  4OMQ A;  1S1N A;  1ZUK A;  1HD3 A;  3EG1 A;  4IIM A;  2CH4 W;  1TUD A;  3IQL A;  3FJ5 A;  1YP5 A;  2F2X A;  4OMO A;  2D0N A;  2O88 A;  4LE9 A;  1GCQ A;  1WYX A;  1ABQ A;  4OMN A;  1YNZ A;  2RMO A;  1LCK A;  1GFD A;  1FMK A;  2EYW A;  2ED0 A;  2V1Q A;  1G83 A;  2ROT A;  3VS5 A;  2RQV A;  1VYV A;  2CT4 A;  2EW3 A;  1UJY A;  2PTK A;  5FW9 A;  2HDA A;  3ULR B;  1MUZ A;  1WIE A;  3EHR A;  4RUG A;  1ZBJ A;  3VS7 A;  5GJV B;  2DM1 A; 
#chains in the Genus database with same CATH topology
 2JM8 A;  4RG2 A;  5KYY A;  3CBP A;  4J5Y A;  2YDL A;  1M5Q 1;  4WF2 A;  3CD6 T;  1TUC A;  2DVE A;  4JJC A;  1ZLM A;  2YUQ A;  4JRQ A;  1D1B A;  4BDZ A;  1CKA A;  2IIM A;  1VQM A;  2HZY A;  4CC2 A;  4ANJ A;  4J83 A;  1OU8 A;  2ZPH B;  2QXF A;  5IXF A;  2VAS A;  4HT9 A;  1VQ6 T;  4LDX A;  2EQK A;  1AWJ A;  3O5Z A;  4ZGJ B;  1VQO Q;  3MEU A;  2XG8 D;  1K0X A;  2P4T A;  3V7C A;  5IT9 E;  1GRI A;  1K76 A;  1QCF A;  4HXJ A;  4B9W A;  3OYJ A;  2ZPI B;  1H92 A;  1VIE A;  1KHC A;  3HRT A;  3S6W A;  3EG2 A;  4QVZ A;  4Z89 A;  3SFM A;  2LCC A;  2RH2 A;  4M75 D;  1WDX A;  4QW2 A;  1VIF A;  2EVR A;  4XTU A;  4C92 F;  1CKB A;  3OMG A;  1JJ2 P;  4C8Q F;  2GTO A;  1TXQ A;  2K2M A;  2DKG A;  3QSU A;  3OW2 S;  4M78 E;  2CP6 A;  5IHK A;  2YWW A;  2DZ9 A;  1AWO A;  5J3B A;  4M75 B;  4FW1 A;  1VQM Q;  2DYI A;  3JCM b;  2VKN A;  1R77 A;  2B8A A;  5CKD A;  2DAQ A;  1M1F A;  2A3L A;  1E6H A;  1WHL A;  3MJX A;  4J6W A;  1BK2 A;  4AT1 B;  3RDV A;  2W10 A;  1Z9Z A;  4DA4 A;  1QVG S;  4B6M A;  1D0Z A;  2XDD A;  3OSV A;  2EPD A;  3E9G A;  3PTA A;  2QK0 A;  1KQS P;  1PNJ A;  1G8X A;  4AG2 C;  1N8R R;  2JXB A;  3VS0 A;  3OMC A;  1I0C A;  1P92 A;  4KGV B;  4QQG A;  3UAT A;  2KVQ G;  2V8K A;  4J6X A;  4JJB A;  3I5S A;  1FYN A;  2LP5 A;  1ZSZ A;  2R57 A;  2LJ0 A;  2LX7 A;  3QWX X;  5A2Q E;  1QVF A;  4LUE A;  2ROL A;  1SEM A;  2NUZ A;  2L0A A;  3VV0 A;  1VQK A;  5GAN e;  1JXO A;  1HK9 A;  4QVC A;  4PJO A;  3OYM A;  4OML A;  3JCM P;  5I2S A;  3CCJ T;  3PVQ A;  2MCN A;  3CCL A;  3Q1J A;  4XU1 A;  2L89 A;  2O9S A;  1M1G A;  3LH5 A;  4JRI A;  1WXT A;  4FYX B;  2VUB A;  3I56 A;  2X4X A;  1UHF A;  5GAN d;  1M3C A;  2DXB A;  2QTX A;  1C6V X;  3NMZ C;  1GBQ A;  4PLI A;  3DLL A;  1YHQ T;  4M4Z A;  3F70 A;  3SB2 A;  2ECZ A;  3G6E A;  5D6Y A;  3G7Z A;  2VGM A;  4ELZ C;  1UB4 A;  4CC4 B;  1NJI U;  1VQK Q;  4FYV B;  4AFQ C;  2FPF A;  2EJF A;  5GAO q;  2MOX A;  2L2P A;  1VOM A;  3EHQ A;  2FPE A;  4PJO E;  1YBY A;  3CCL Q;  1YIJ T;  3I5R A;  3CXC P;  4JZ4 A;  3A8H B;  1AVZ C;  4XTX A;  1Q81 R;  3TRE A;  3I56 Q;  3G4S T;  2LC4 A;  1M90 R;  3QKJ A;  4KGX B;  1TG0 A;  3EG3 A;  2RN8 A;  2OTL T;  2QA4 A;  1QW1 A;  5IH2 A;  4F7U F;  1D3B B;  1Q86 R;  1ZA1 B;  3GF5 A;  2WSC E;  1YWO A;  2XD0 A;  2RQR A;  1JJ2 S;  1XJW B;  5EG2 A;  4E7K A;  1NJI C;  2RNA A;  3G6E Q;  2OI3 A;  3PE0 A;  2FPD A;  5HK0 A;  1HJD A;  4WTO B;  4E7I A;  1I5O B;  1FWZ A;  3GBQ A;  1RI0 A;  1WHK A;  6AT1 B;  2HQH A;  3VS6 A;  3S3O A;  5A0G A;  1D3B A;  2X35 A;  2H3E B;  1N6A A;  3CCU A;  4BY6 C;  2E6N A;  2EQU A;  3SHW A;  3VUB A;  3OYK A;  2L8D A;  5LJ5 e;  1KQS S;  1UGP B;  4M78 C;  2ZZD A;  1X2K A;  3CME T;  4XTV A;  7AT1 B;  3M0R A;  3E9F A;  3VRZ A;  4JJD A;  4LNP A;  3C12 A;  5ECA A;  5L23 A;  2QA4 Q;  3CCS A;  3ER0 A;  3AHU A;  1B07 A;  4M7D B;  4OMP A;  2YSQ A;  4EPC A;  3EFS A;  1M3A A;  1CSK A;  4L5G A;  5LJ5 j;  2YRD A;  3CCV T;  2VGN A;  3FB9 A;  1RAF B;  2FL7 A;  5LJ5 d;  2RO0 A;  4JZ3 A;  3JCM J;  4A4H A;  2KR3 A;  1H64 1;  1Y0M A;  3RIR A;  4N4H A;  4IUU A;  4MMK A;  1VQL T;  1ZSG A;  2O9V A;  2Y4X A;  1T0J A;  1GL5 A;  4PLL A;  3J7A F;  2F5K A;  5CKF A;  3NTI A;  3CCU Q;  2I0N A;  4Z8A A;  4FCY A;  2PUO B;  2YUN A;  1VQN T;  2ESW A;  3VS2 A;  5IXB A;  4WCI A;  1Z9Q A;  4Z02 A;  2A08 A;  2J6K A;  2XDB A;  1MNE A;  2K6D A;  2XI9 A;  3CMA A;  2DL4 A;  2MI6 A;  4A54 A;  3CCS Q;  4RCC A;  4ORZ A;  2LT4 A;  2GBQ A;  2RD1 A;  3M54 A;  2EAY A;  1RAE B;  2R5M A;  3QO3 A;  5GMK l;  2DTI A;  3FEO A;  2P0K A;  2HQX A;  2GF7 A;  2E41 A;  2YT6 A;  3E1S A;  2GGR A;  2DJQ A;  2HKN A;  1AWW A;  2EBP A;  3I55 A;  3A8G B;  3L2Z A;  1KG1 A;  4MML A;  4J9E A;  1YJW T;  3CXC S;  2NLU A;  1ZSZ C;  1UHC A;  2LCL A;  2QI2 A;  1N5Z A;  5LJ3 f;  3CMA Q;  3D7S B;  3CC7 T;  1M9S A;  3EFO B;  4M77 D;  3GLX A;  4DQ2 A;  1VQ9 A;  1EZZ B;  5HCK A;  5GAN g;  3M4Y A;  3EG0 A;  4PJO C;  1R0C B;  2EFI A;  1WI7 A;  2ZPG B;  2KRO A;  2X4W A;  2DZC A;  3G71 A;  2EIF A;  3QUI A;  3H0I A;  2PVG B;  1KD1 R;  2J06 A;  2X4J A;  4OGE A;  3DB4 A;  3I9Q A;  2KXD A;  3EFO A;  3VKI A;  4Y92 A;  2RJE A;  2RA2 A;  4QKU A;  2DLP A;  3I55 Q;  2ZAE A;  2A28 A;  2K79 A;  4KH0 B;  1G3Y A;  3OYB A;  4PNO A;  2QQ9 A;  3JCM e;  2KMT A;  2D8J A;  2X3W D;  4M77 A;  4OMM A;  4X9D A;  1JXM A;  2HEQ A;  3MKD A;  5I21 A;  1KJW A;  1VQO T;  2E5K A;  2XHC A;  2ZCF B;  2JT4 A;  1VQ9 Q;  1RAB B;  3UT1 A;  5KCH A;  4OMQ A;  2RI5 A;  4PJO G;  3G71 Q;  2D0N A;  3JCM d;  2O88 A;  1QMC A;  1GCQ A;  2XK0 A;  5KYU B;  4MDX A;  3NTK A;  2RMO A;  1QVP A;  3BW1 A;  3ME9 A;  3QG1 A;  1LCK A;  2NUT B;  2KQW A;  1WGS A;  2RI2 A;  5GAO n;  1VQM T;  5GAN 6;  2RQV A;  2MYS A;  1VYV A;  3S3M A;  2CZ0 B;  2O01 E;  2PTK A;  2DER A;  4LD6 A;  4E7Z A;  1MUZ A;  4M77 E;  1ZBJ A;  3VS7 A;  2ATC B;  3CPW A;  2FB7 A;  2MPX C;  3VU3 C;  4A4K A;  3EGD B;  3WVE B;  2LJ1 A;  2NWM A;  5DLQ E;  2K3Y A;  4Z88 A;  1RLP C;  1OX8 A;  2K5L A;  2FEI A;  1M27 C;  1D0Y A;  3VJP A;  2DK3 A;  5LJ5 g;  2GQI A;  3C0C A;  2H3J A;  4Q5W A;  1Y96 A;  1BIA A;  5FWC A;  1T0H A;  2XID A;  1B3Q A;  4P5N A;  4JRP A;  3UWN A;  3M0S A;  2RM4 A;  1X69 A;  4KH1 B;  4C5E A;  3JSC A;  1N8R U;  4ZGE B;  3H0H A;  3M4G A;  1NZ9 A;  2KY9 A;  2RPN A;  2BZX A;  5AYF A;  4BI3 A;  2DBK A;  1H3Z A;  1C0M A;  5KE3 A;  2HL3 A;  4BE0 A;  4V2S A;  1RAH B;  1YJW A;  2DIL A;  2JTE A;  2WAC A;  2W0Z A;  1M2V A;  1QVG P;  2QGF B;  5CKE A;  2AKL A;  2CP3 A;  2CP7 A;  1FMW A;  2F69 A;  5GAO l;  1GFC A;  3HFN A;  4MZP A;  4F04 B;  1XQH A;  4M7A B;  2RJC A;  4HCC A;  1AWX A;  4FW2 A;  1N8R C;  3CPF A;  3HKS A;  1I07 A;  1AZE A;  3H8Z A;  1YCY A;  4DBH A;  4XU0 A;  4HT8 A;  1VQK T;  1JQQ A;  1W2B A;  2DL8 A;  1TSF A;  3CCE A;  3BDL A;  2D0Q B;  3HP9 A;  2KEA A;  3CCL T;  4JRK A;  3LWH A;  3A8L B;  1G3S A;  4AFZ C;  1YJW Q;  2G3R A;  4HVV A;  3I56 T;  3KFV A;  4ZTF A;  5HK3 A;  2ZPB B;  3HFO A;  4EDU A;  1EIF A;  2M16 A;  2V26 A;  3PGG A;  2CUB A;  1KSW A;  4J9G A;  2JJ9 A;  2M0O A;  3BY7 A;  5GAN 2;  4IIO A;  2DL5 A;  4L6V 5;  1PKS A;  2V8I A;  5GAN 8;  3G6E T;  2CKK A;  3GNF B;  3OY9 A;  1H3H A;  3M9Q A;  5CO7 A;  1IGU A;  1Q81 U;  2O4X A;  1G3W A;  1YI2 A;  3PT9 A;  3LGL A;  3CCE Q;  3M5A A;  3BE3 A;  4LDV A;  2FZG B;  1M90 U;  3HSB A;  4M78 A;  3QDF A;  5FU6 C;  3OYY A;  2E3I A;  1O75 A;  4GY5 A;  1Q86 U;  1U06 A;  3LW5 E;  2LX9 A;  4XTW A;  4XTZ A;  1IRX A;  4IUQ A;  2XKO C;  1Q7Y R;  3R6N A;  1GXI E;  2DTO A;  4XU3 A;  2AHJ B;  4DBF A;  2QA4 T;  5GAM e;  2COZ A;  1AD5 A;  2WSE E;  4M77 C;  3JCM g;  2CP2 A;  3I35 A;  4RTW A;  3U23 A;  4N4I A;  2C0T A;  1Q81 C;  2HQE A;  1UGS B;  3CBM A;  1X27 A;  2JN0 A;  1OI1 A;  4R55 A;  4OB3 B;  1VQ8 A;  1M3B A;  4OF1 A;  5GAN 4;  1M90 C;  1Q82 U;  4KGZ B;  3E19 A;  1YI2 Q;  2KYM A;  1DJ7 B;  3QDR B;  5GAM j;  1M8V A;  3J81 E;  1OEB A;  3VS3 A;  2KYB A;  1Q86 C;  5GAM d;  1GCQ C;  3L2W A;  2P0P A;  3CCU T;  2E6Z A;  4J8O A;  1JEG A;  3C4S A;  1QLY A;  2KT1 A;  3OYA A;  4C92 B;  3HRS A;  4J9I A;  4ZN1 A;  4C8Q B;  2GNC A;  2DYB A;  1D09 B;  2KK4 A;  3E2U A;  4LDY A;  2YUO A;  1UGQ B;  3CCS T;  2HCK A;  1W4S A;  2L3R A;  3MEA A;  1QVF P;  4M77 G;  2E10 A;  1YFN A;  5KYX B;  5KYW B;  1WXU A;  1Q82 C;  1T3S A;  4RTT A;  3UA7 A;  4M75 A;  1VA7 A;  4PFZ A;  1VQ8 Q;  2E1H A;  2BE9 B;  2MAM A;  2X4Y A;  2LZ6 B;  2OX7 A;  3EG9 B;  1X75 C;  3HL8 A;  4LDU A;  5FU7 B;  1ABO A;  1PC0 A;  4PJO F;  1PD0 A;  2PUK B;  2HKQ B;  4MZT A;  1LVK A;  2DD5 A;  4JPB W;  3TSW A;  1Q95 G;  5GAN f;  4DOV A;  3MCA B;  2MWP A;  4RTX A;  1K8A R;  1C1A A;  1VQ5 A;  3CMA T;  1YCS B;  3HPW A;  2O31 A;  1SRM A;  2RK2 A;  1K73 R;  2Y90 A;  1W6X A;  2LJ3 A;  2G6F X;  2E70 A;  2LNH B;  2PNI A;  3H41 A;  3HTR A;  2L3Q A;  1NBE B;  3JB9 H;  4C0Z A;  4K11 A;  1N9S A;  4TVR A;  1W70 A;  2DRM A;  1E6G A;  4M75 E;  4PK4 A;  1NEG A;  2RHU A;  1KHI A;  3KXT A;  2YXY A;  2K9G A;  2JW4 A;  3I55 T;  1JBM A;  2RQU A;  3RR6 A;  3KUF A;  4ZTJ A;  2KE9 A;  4HKE A;  4LD9 K;  1K9A A;  4C0D B;  1QWF A;  5KYN A;  4PJM A;  1VQ5 Q;  4OB0 B;  2CZ7 B;  1V76 A;  5GAO p;  2DMO A;  1VQ9 T;  2AK5 A;  2J05 A;  3JV3 A;  3QYG B;  4IKF A;  3QXE B;  1OZ2 A;  3TQ7 P;  3G71 T;  3GIB A;  3M59 A;  4II1 A;  2XIC A;  2RHY A;  5C0M A;  4LUD A;  1WQ7 A;  1OPK A;  2PVO B;  3PIO A;  2LQ8 A;  2M9U A;  1AZG B;  1VQ7 T;  3V8L A;  3EH2 A;  1GCP A;  3PMI A;  4UC4 A;  1K1Z A;  1VUB A;  3OQ5 A;  1WHH A;  1EX4 A;  4D8K A;  3OBY A;  4RMO A;  2CS7 A;  4FL6 A;  4ZN3 A;  1ZX6 A;  1QKW A;  4F7U B;  1T3L A;  1BI1 A;  3A98 A;  3X25 B;  3OYL A;  1YWP A;  4JS4 A;  4NOY A;  2BZY A;  4CRI A;  4BE1 A;  3OA6 A;  2PVD B;  1O9S A;  2DNU A;  2BE7 D;  5AT1 B;  4O6J A;  4LDW A;  3X20 B;  1QVF S;  4M7D D;  2C0O A;  3A8M B;  1NYG A;  2OTJ A;  3VYH B;  3M53 A;  2EYQ A;  1Y71 A;  2BUD A;  4EMH A;  3CEY A;  4MDW A;  2ZGW A;  1ZQ1 A;  2JVV A;  1S72 A;  3GP8 A;  1TS9 A;  5GAM g;  1QCN A;  3V8K A;  1ZUK A;  2CH4 W;  8ATC B;  3OYH A;  4ATO A;  4CI0 C;  2F2X A;  2K3X A;  3QII A;  4BDY A;  3V7S A;  1Y7X A;  2OAU A;  5GAN h;  4M7D A;  3MPU B;  4OMN A;  2QAS A;  5CQY A;  3QHS A;  1YNZ A;  3CCR A;  2LT1 A;  4M78 G;  3X24 B;  1GFD A;  1FMK A;  2EYW A;  2MWO A;  3JB9 D;  1G83 A;  2OTJ Q;  4F7U E;  3SWN B;  2QQB A;  1UJY A;  2LTO A;  2HBP A;  5FW9 A;  3ZFJ A;  8AT1 B;  3UDC A;  4BI8 B;  2HDA A;  5HKC A;  3ULR B;  5A0D A;  4RUG A;  5GJV B;  2DM1 A;  2AT1 B;  1B34 B;  1S72 Q;  5DLO A;  3OYF A;  5KH6 A;  4XTY A;  1PRL C;  3RES A;  2FVU A;  3THK A;  4JUV A;  4RTV A;  3V7R A;  3GPL A;  1YJ9 A;  5CQX A;  3L1A A;  4RTU A;  3UA6 A;  4M75 C;  2QEX A;  1G2B A;  2VWF A;  4FIB A;  1NM7 A;  1ARK A;  4IUT A;  3MP1 A;  4E47 A;  2FO0 A;  3VS1 A;  4CC7 A;  2X3X D;  5IHI A;  2JS2 A;  3X28 B;  4M7D E;  4QQD A;  4A63 B;  3CCR Q;  2BTT A;  4XK8 E;  4E7S A;  1UJ0 A;  4R0K A;  2HSP A;  2MF2 A;  1IGQ A;  1YIT A;  2JZ2 A;  5CCA A;  4A4F A;  3CQT A;  3P8H A;  1U1T A;  2JUF A;  3V8J A;  2JOY A;  2P4R A;  4EMK B;  1B7T A;  3LLR A;  3L42 A;  3CCE T;  1YJ9 Q;  3MEW A;  2DD4 A;  3CC2 A;  4E7L A;  2KSS A;  2QEX Q;  2JMA A;  3REB B;  2JS0 A;  4M75 G;  1VQ7 A;  2MK5 A;  4M77 F;  2B86 A;  3G1J A;  3M55 A;  3JCM f;  3PMT A;  5KE2 A;  3L2Q A;  4FT4 A;  1X01 A;  1BKB A;  4BB7 A;  4N0A A;  1RAD B;  5LJ5 h;  2DPP B;  2NUP B;  1NE8 A;  4X9C A;  5LJ3 j;  3SDZ A;  1YIT Q;  4X1V A;  3M58 A;  1SF9 A;  2L5Q A;  3EGX B;  2JM9 A;  1SHG A;  5CR2 A;  3MHX A;  1D1C A;  2DE0 X;  3HHT B;  1YI2 T;  2BKD N;  4PKC C;  1OZ3 A;  3CC2 Q;  1Q7Y U;  3A8O B;  3CPW P;  2EYY A;  1XNI A;  3NHN A;  1VQ7 Q;  1MND A;  3C95 A;  2KRM A;  5M9O A;  5GAO r;  4J9H A;  1PSE A;  5GMK e;  3QWY A;  4FSX A;  3LGF A;  2QG9 B;  5KYU A;  3MP8 A;  2HNI A;  2LCS A;  2RI3 A;  1SHF A;  1AOJ A;  4L59 A;  2YUP A;  2NUT A;  3PVL A;  4J7F A;  3AT1 B;  3FDR A;  1VQ8 T;  1Q7Y C;  1RAG B;  1NYF A;  1U1S A;  5GMK j;  1D1A A;  2CT3 A;  4O5V A;  4A4E A;  1MMG A;  3JCM W;  2K57 A;  5DM7 R;  3DB3 A;  1G5V A;  3EGD A;  4AG1 C;  1K9M R;  4E7H A;  1SG5 A;  3TVT A;  2A7Y A;  2E5Q A;  3QPH A;  4KUL A;  2J6F A;  4HVU A;  2XMF A;  1PHT A;  2C06 A;  1UEC A;  4HCB A;  2E65 A;  2M51 A;  4AMC A;  4EMG A;  1YJN A;  4M7A D;  4M7D C;  1KIK A;  1OV3 A;  1W2B P;  1SRL A;  2DTH A;  2XU8 A;  3OB9 A;  5D6W A;  1IZ6 A;  5CK9 A;  1K8A U;  1M1K R;  2EGC A;  1WJR A;  1JO8 A;  3TEE A;  2M0Y A;  1K73 U;  2K3B A;  4F16 A;  2CZ1 B;  2AZS A;  1VQP A;  2LQW A;  2LMJ A;  3CBO A;  1ZBX A;  4Y91 A;  1VQ5 T;  1WJS A;  3L2R A;  4D8D A;  3EGU A;  3TSZ A;  1X6O A;  3JCM h;  1K4U S;  3OW2 A;  1M2O A;  2EQI A;  4M7A A;  1WX6 A;  4J9B A;  1BBZ A;  1VYT A;  1X43 A;  3WXM B;  1IXD A;  1YJN Q;  2CH4 A;  1UDL A;  3NGP A;  2EYX A;  2KBT A;  1K8A C;  3MEV A;  1KC8 R;  4M7D G;  3CCM A;  2QQA A;  4C5H A;  2X51 A;  4PFP A;  2M02 A;  1K73 C;  2RHX A;  3QJ6 A;  3RBB B;  3MET A;  4YTL A;  3M0Q A;  1BYM A;  2F1L A;  2A37 A;  2L3S A;  3CPW S;  1MHN A;  1OPL A;  4PL6 A;  1VQP Q;  2YHT A;  1KFZ A;  4M78 F;  1OYX A;  2I2L A;  3QBY A;  1M8M A;  4GBQ A;  4BY6 B;  3L2V A;  4A53 A;  1PWT A;  2P84 A;  5KYY B;  1ZUU A;  1NLO C;  2K2V A;  3VUZ A;  3BDU A;  1ZUY A;  2HSE B;  3M57 A;  3OS5 A;  4Y28 E;  3M0P A;  1SKU B;  5IN1 A;  4M7A E;  2IPO B;  5LJ3 g;  2EGA A;  2CDT A;  4KT0 E;  1VQ4 A;  3CC4 A;  4ZGD B;  1GBR A;  3CCM Q;  4XQ3 A;  5I2M A;  3JB9 G;  4EMK C;  4JJN K;  1WHM A;  4N0A C;  4OB1 B;  5EC7 A;  2COY A;  3OYD A;  2SRC A;  5GMK i;  1PRM C;  3FC3 A;  1QWE A;  2D8H A;  2F2W A;  1QP2 A;  2HMA A;  1YN8 A;  2DFU A;  4C92 D;  2F2V A;  2JTF A;  4N4G A;  4C8Q D;  4C0F A;  3L2U A;  4OMF B;  2EKO A;  1TOV A;  2DEQ A;  1IRE B;  2EQM A;  1OUL A;  1UGV A;  2RF0 A;  2FYK A;  2HBW A;  2RB6 A;  2GQV A;  1FX7 A;  1MGQ A;  5I22 A;  5CAI A;  1H8K A;  4A4G A;  2CUD A;  3RER A;  1VQ4 Q;  3NPF A;  3QZ9 B;  3JCM V;  2DIQ A;  2OTJ T;  3CC4 Q;  2C0I A;  3EFR A;  1W2B S;  1RL2 A;  4QQ6 A;  2K5F A;  4M75 F;  3RUX A;  2J7I A;  2K5I A;  3INZ A;  4CC3 A;  1S72 T;  1AEY A;  4C92 A;  3GNG A;  4C8Q A;  4LXC A;  3EH1 A;  4KUD K;  3OBW A;  3QJY A;  2DVJ A;  1PD1 A;  1X6G A;  2E64 A;  1JJ2 A;  4PJO D;  1ZSZ B;  3VS4 A;  5KYX A;  5KYW A;  2SEM A;  3CCR T;  3JCM c;  2CSI A;  2RQW A;  4AFU C;  2X9H A;  3SD4 A;  1XTD A;  3EG9 A;  4PJO B;  1TU0 B;  4RCB A;  1TUD A;  3FJ5 A;  1YP5 A;  1OX9 A;  3JAM E;  1WYX A;  1KQS A;  1AT1 B;  5FRN A;  1TH7 A;  5FRM A;  1ABQ A;  1QQJ A;  1JRI A;  2CP5 A;  3C94 A;  4NL2 A;  4NL3 A;  3FLG A;  2RHZ A;  4C92 E;  1BCM A;  4OP0 A;  5GAN 7;  1YJ9 T;  2E12 A;  4C8Q E;  2QEX T;  2V8J A;  2VV5 A;  5GMK m;  2ED0 A;  1NPP A;  3HRU A;  1HYO A;  2EW3 A;  1WIE A;  4FU6 A;  1R0B G;  4JLI A;  5GAN j;  2HAX A;  1I1J A;  3H9N A;  4OVA A;  5LL6 S;  2EKH A;  3A1P A;  1YIT T;  1KK7 A;  1KD1 U;  1I8F A;  3CCQ A;  1BB9 A;  2CGH A;  1U8R A;  3O8V A;  5GAM h;  4J9D A;  2F5T X;  4IUP A;  1JU5 C;  2ABL A;  4BAC A;  1X2Q A;  5FRO A;  4M7A C;  5D6X A;  3QZ5 B;  1PM3 A;  3CC2 T;  2DRK A;  5GAN 5;  1RAA B;  4ESR A;  9ATC B;  1NPR A;  1FMV A;  1SSF A;  2VYT A;  3CD6 A;  5I11 A;  2IVW A;  2HL5 C;  2DL3 A;  2RJD A;  1LOJ A;  2AKK A;  4HCZ A;  1TWB A;  2A36 A;  2GFA A;  1KD1 C;  1QCO A;  3RKW A;  1VQ6 A;  1ZHI A;  3JCM Q;  3P8D A;  3RNJ A;  3FRN A;  3CCQ Q;  1RI9 A;  4IUR A;  3CXC A;  3NFC A;  5LJ5 f;  1MV3 A;  3X26 B;  3H6Z A;  2CZ6 B;  1UEB A;  1K0S A;  1WHG A;  1RLQ C;  2RK1 A;  3FIF A;  4HCK A;  5DY9 A;  1IHW A;  4F7U A;  4E6R A;  4FSS A;  2COW A;  1X6B A;  2YRV A;  4M7A G;  3LX7 A;  4F14 A;  1J3T A;  1TTH B;  2QDL A;  4LN2 A;  2DET A;  1WJQ A;  1MMN A;  2CSQ A;  4ZNX A;  3DLM A;  3CD6 Q;  2VB6 A;  1NG2 A;  4B9X A;  2KT8 A;  3LWI A;  2VC8 A;  1Q82 R;  1IO6 A;  2FHD A;  2DL7 A;  2CRE A;  2FRY A;  5FWB A;  1HXD A;  1WNL A;  1U5S A;  2VXE A;  4M7D F;  2DXU A;  2EJG A;  5GAN 3;  2EYZ A;  1VQ6 Q;  1V29 B;  1ZA2 B;  2KDS A;  4RKU E;  3LYI A;  4RTZ A;  2J6O A;  1SSH A;  2GTJ A;  1WFW A;  1BI3 A;  1TUG B;  2PZ1 A;  1I4K 1;  3RKY A;  1IHV A;  1D0X A;  2ED1 A;  5J26 A;  4C5G A;  1OU9 A;  4FYW B;  1BI2 A;  1WQW A;  3PNW C;  1K9M U;  1Y57 A;  4ME7 A;  4DBQ A;  2LQN A;  2DX1 A;  2WSF E;  3JCM X;  3BFM A;  4FM4 B;  4BUG A;  3URG A;  2JTM A;  4MZM A;  4AFS C;  4JS5 A;  3VYG A;  2QQR A;  4DOW A;  4J9C A;  2DA9 A;  4QT7 A;  2K7A A;  1PCX A;  2XDP A;  5C6S A;  4ELY C;  1G3T A;  4DBR A;  1IB8 A;  1KQ1 A;  2OJ2 A;  4C5I A;  3MP6 A;  1W1F A;  3SWN A;  3OYC A;  4C92 C;  3JB9 F;  3CCJ A;  4C8Q C;  4PJN A;  4DEX A;  1JB0 E;  1M1K U;  1K9M C;  2M1H A;  1B34 A;  1WZO A;  2KNB B;  1YJN T;  3J80 E;  1E7O A;  3ASK A;  3M0U A;  2LNV A;  3RKX A;  2KXC A;  1A0N B;  1WA7 A;  1QKX A;  3SEM A;  1UE9 A;  1Y07 A;  1YHQ A;  4BE2 A;  3RMS A;  4PFO A;  1VQP T;  1PSF A;  5FU7 C;  2QTV A;  5GAO m;  3ZL7 C;  1WHJ A;  2D1X A;  1HSQ A;  1UFF A;  5FU6 B;  2ENM A;  1BU1 A;  1KC8 U;  1SPK A;  2KGT A;  2QAZ A;  3R6O A;  1M1K C;  1OQK A;  4RG8 A;  5LJ3 e;  4BI4 A;  4C92 G;  2Z0W A;  3CCJ Q;  5GJW B;  4C8Q G;  1YIJ A;  3KBG A;  3WVD B;  4DEY A;  1NJI R;  2H8H A;  4EMK A;  3G4S A;  2PQW A;  4M77 B;  3UPU A;  2KAF A;  4GLM A;  4OGC A;  1AHJ B;  5CVI A;  3CCM T;  2OTL A;  2YLB A;  1MMA A;  3ZEH A;  1WXB A;  1MMD A;  5LJ3 d;  1PKT A;  4R56 A;  1YHQ Q;  1UTI A;  1PG5 B;  3MO8 A;  2BIV A;  2V1R A;  4NS5 A;  2P0Q A;  3PIP A;  2QDY B;  1KC8 C;  2LDM A;  2VXF A;  1V1C A;  2NUP A;  5HY6 A;  4C0D C;  3REA B;  1EFN A;  2AIR B;  2EGE A;  2RHI A;  1YIJ Q;  1MV0 B;  3EGX A;  4OB2 B;  4FYY B;  5CKH A;  3QYH B;  2KI7 A;  4KBM B;  2QQS A;  2D6F A;  2GFU A;  3H0F A;  2JNG A;  3RMQ A;  3CME A;  1LJO A;  1VQ4 T;  3G4S Q;  1R8O B;  3CC4 T;  1XOV A;  2AZV A;  4EIK A;  1OOT A;  4J7I A;  1U3O A;  2DEU A;  2E3H A;  2OTL Q;  4X34 A;  3N5B B;  1RAC B;  5IAY A;  4HVW A;  4IUV A;  4BD3 A;  3JB9 J;  1RUW A;  2KRS A;  1BI0 A;  1UUE A;  2D9T A;  2E4H A;  3CCV A;  3OYE A;  1F1B B;  2QGG A;  2QYZ A;  2K4Y A;  1NEB A;  1I5L A;  4C0G A;  4E7J A;  2EWN A;  1VQL A;  1RAI B;  3T9N A;  3OYN A;  2HD0 A;  2BZ8 A;  2ZPE B;  3VRY A;  1Y96 B;  3OS0 A;  1VQN A;  1QP3 A;  3OS1 A;  2MIO A;  2R58 A;  1KQ2 A;  3TU4 K;  2FRW A;  2O2O A;  3CME Q;  4KRT A;  4J9F A;  2DBM A;  3PFS A;  5KCO A;  1LNX A;  1N9R A;  2DF6 A;  3A5Z B;  2KRN A;  2ZPF B;  3OYG A;  3TCJ A;  1UG1 A;  1VYU A;  4J6Y A;  3OS2 A;  4RTY A;  2IG0 A;  3M0T A;  3CCV Q;  3JRZ A;  2LQK A;  2RQT A;  2VVK A;  1M2V B;  2OAW A;  1ACM B;  3S3N A;  2DIG A;  1VQL Q;  3M56 A;  1LPL A;  2NYS A;  5L8R E;  4F7U G;  3OW2 P;  2GCX A;  2L3P A;  1M4Z A;  1WPY A;  1WLP B;  3LH0 A;  5LJ3 h;  2R5A A;  1VQN Q;  2FZK B;  2YLC A;  3ZBD A;  2JMC A;  5D7U A;  4M7A F;  2EQJ A;  5A0L A;  4JLG A;  3CC7 A;  2EJ9 A;  3GOX A;  4QVD A;  5IHN A;  1BCO A;  2A0F B;  2FG0 A;  3SWN C;  5CKB A;  4KUI A;  2PU9 B;  1UGR B;  2LVM A;  3UF4 A;  2MMP A;  4F17 A;  2DJZ A;  1NLP C;  2LRQ A;  1QVG A;  2Y4Y A;  3DKM A;  1M30 A;  1BIB A;  2RJF A;  1S1N A;  4HA8 A;  2DXT A;  1HD3 A;  3EG1 A;  4IIM A;  5J39 A;  3IQL A;  1N27 A;  4D6W A;  2CP0 A;  4XU2 A;  4OMO A;  2YRC A;  4LE9 A;  4M78 D;  3OYI A;  3OSS C;  1I81 A;  3FJP A;  2O4X B;  3JB9 I;  2DO3 A;  4JDS A;  1VQO A;  3P8B B;  4PJJ A;  4VUB A;  4FT2 A;  3CC7 Q;  2CYZ B;  3CCQ T;  3EAE A;  3NTH A;  4XAX B;  4M78 B;  4PJL A;  5GMK h;  4GLK A;  2V1Q A;  2ROT A;  3VS5 A;  4E2F B;  2CT4 A;  2FZC B;  2DXC A;  5CIU A;  1FXX A;  3EHR A;  5GAM f;  5FLX E; 
#chains in the Genus database with same CATH homology
 2JM8 A;  1I1J A;  2YDL A;  2EKH A;  1PRL C;  1TUC A;  2LJ1 A;  2NWM A;  3THK A;  4JJC A;  1ZLM A;  4RTV A;  2YUQ A;  4RTU A;  4Z88 A;  1RLP C;  3UA6 A;  1CKA A;  1BB9 A;  1G2B A;  2VWF A;  2FEI A;  2IIM A;  1M27 C;  4CC2 A;  1NM7 A;  1ARK A;  4J9D A;  2GQI A;  1JU5 C;  2ABL A;  3C0C A;  5IXF A;  2FO0 A;  3VS1 A;  4CC7 A;  1AWJ A;  1X2Q A;  2X3X D;  2JS2 A;  3O5Z A;  5IHI A;  4A63 B;  5FWC A;  1K0X A;  1T0H A;  2BTT A;  1B3Q A;  1UJ0 A;  1GRI A;  2DRK A;  1K76 A;  1QCF A;  3M0S A;  4R0K A;  4HXJ A;  2HSP A;  4ESR A;  1X69 A;  1H92 A;  3H0H A;  3EG2 A;  2RPN A;  2BZX A;  5I11 A;  2DL3 A;  4Z89 A;  2DBK A;  3CQT A;  2AKK A;  1WDX A;  2A36 A;  2EVR A;  1CKB A;  2GTO A;  2P4R A;  2K2M A;  2DIL A;  2JTE A;  3RNJ A;  1RI9 A;  5IHK A;  2W0Z A;  1AWO A;  2JMA A;  3REB B;  2JS0 A;  1MV3 A;  2AKL A;  2VKN A;  1K0S A;  1RLQ C;  2B86 A;  1E6H A;  4HCK A;  1GFC A;  4E6R A;  1BK2 A;  4FSS A;  2W10 A;  1X6B A;  1Z9Z A;  4F14 A;  1J3T A;  1AWX A;  2EPD A;  2QDL A;  4LN2 A;  1PNJ A;  1I07 A;  1AZE A;  2CSQ A;  4AG2 C;  4ZNX A;  1JQQ A;  2DL8 A;  2JXB A;  4X1V A;  3VS0 A;  1I0C A;  1NG2 A;  2KT8 A;  3UAT A;  2KEA A;  1IO6 A;  2DL7 A;  2JM9 A;  1SHG A;  2CRE A;  2FRY A;  5FWB A;  1U5S A;  4JJB A;  3I5S A;  1FYN A;  2LP5 A;  2EYZ A;  2DE0 X;  2LJ0 A;  4AFZ C;  2LX7 A;  3QWX X;  4LUE A;  4RTZ A;  4HVV A;  2J6O A;  2ROL A;  2GTJ A;  1SSH A;  1SEM A;  1WFW A;  2NUZ A;  3KFV A;  2PZ1 A;  2EYY A;  2L0A A;  2ED1 A;  3NHN A;  1JXO A;  2CUB A;  2KRM A;  1KSW A;  4J9G A;  4OML A;  1Y57 A;  2LQN A;  2DL5 A;  3PVQ A;  4IIO A;  1PKS A;  2MCN A;  2DX1 A;  4J9H A;  2O9S A;  3QWY A;  1H3H A;  3LH5 A;  1WXT A;  4AFS C;  4J9C A;  2DA9 A;  4QT7 A;  2LCS A;  2K7A A;  1SHF A;  1UHF A;  1AOJ A;  1M3C A;  2YUP A;  3PVL A;  2OJ2 A;  3NMZ C;  1GBQ A;  1U06 A;  1W1F A;  1NYF A;  4M4Z A;  2CT3 A;  4DEX A;  2ECZ A;  3R6N A;  4CC4 B;  2KNB B;  1AD5 A;  4AG1 C;  4AFQ C;  2FPF A;  3TVT A;  2MOX A;  3I35 A;  2L2P A;  3EHQ A;  4RTW A;  3U23 A;  2C0T A;  2FPE A;  3I5R A;  4JZ4 A;  1E7O A;  1X27 A;  1AVZ C;  3M0U A;  2J6F A;  1M3B A;  4HVU A;  2KXC A;  2XMF A;  1PHT A;  1QKX A;  1WA7 A;  1A0N B;  3SEM A;  1UE9 A;  1UEC A;  2KYM A;  2M51 A;  1OEB A;  3VS3 A;  2KYB A;  1TG0 A;  3ZL7 C;  1GCQ C;  3EG3 A;  2RN8 A;  2D1X A;  1HSQ A;  1JEG A;  5IH2 A;  1UFF A;  2ENM A;  1BU1 A;  1QLY A;  1OV3 A;  2KT1 A;  1KIK A;  1SPK A;  2KGT A;  1SRL A;  1YWO A;  2RQR A;  5GJW B;  4J9I A;  2RNA A;  2OI3 A;  2GNC A;  2EGC A;  2DYB A;  3PE0 A;  2FPD A;  1JO8 A;  1HJD A;  2M0Y A;  4DEY A;  2K3B A;  2YUO A;  2HCK A;  4F16 A;  2AZS A;  3GBQ A;  2H8H A;  3VS6 A;  4GLM A;  2LQW A;  2LMJ A;  1WXU A;  1T3S A;  3SHW A;  4RTT A;  3UA7 A;  1WXB A;  1VA7 A;  4D8D A;  3EGU A;  3TSZ A;  1PKT A;  1UTI A;  1X2K A;  2LZ6 B;  1K4U S;  2EQI A;  1WX6 A;  2V1R A;  3M0R A;  4J9B A;  1BBZ A;  1VYT A;  3VRZ A;  1V1C A;  1X43 A;  1ABO A;  4JJD A;  4LNP A;  5ECA A;  5L23 A;  2CH4 A;  1UDL A;  3NGP A;  2EYX A;  2KBT A;  1B07 A;  4OMP A;  2YSQ A;  4JPB W;  3TSW A;  1M3A A;  1CSK A;  3REA B;  1EFN A;  2EGE A;  4RTX A;  1MV0 B;  3RBB B;  1YCS B;  4JZ3 A;  3M0Q A;  2A37 A;  2O31 A;  2L3S A;  1SRM A;  2KR3 A;  1W6X A;  1Y0M A;  3H0F A;  2LJ3 A;  1OPL A;  2G6F X;  1ZSG A;  2O9V A;  1T0J A;  2LNH B;  1XOV A;  2PNI A;  2AZV A;  1GL5 A;  4EIK A;  1OOT A;  1KFZ A;  3H41 A;  1U3O A;  2L3Q A;  2I0N A;  1M8M A;  4Z8A A;  4GBQ A;  4HVW A;  4K11 A;  1PWT A;  2YUN A;  1W70 A;  1ZUU A;  1RUW A;  2DRM A;  1E6G A;  1NLO C;  2ESW A;  4WCI A;  1Z9Q A;  3VS2 A;  2KRS A;  2A08 A;  2J6K A;  5IXB A;  1NEG A;  1UUE A;  1ZUY A;  2K6D A;  2K9G A;  2DL4 A;  2JW4 A;  3M0P A;  2RQU A;  1NEB A;  4ORZ A;  2GBQ A;  2KE9 A;  2EGA A;  2CDT A;  1K9A A;  2BZ8 A;  1GBR A;  1QWF A;  3VRY A;  2DMO A;  5EC7 A;  2MIO A;  2YT6 A;  2AK5 A;  2GGR A;  2SRC A;  2FRW A;  2DJQ A;  2O2O A;  4KRT A;  2J05 A;  4J9F A;  2DBM A;  1PRM C;  3JV3 A;  1QWE A;  1AWW A;  2D8H A;  2F2W A;  2EBP A;  1YN8 A;  2DF6 A;  2KRN A;  2F2V A;  4J9E A;  1UG1 A;  1VYU A;  4LUD A;  1OPK A;  1UHC A;  4RTY A;  3M0T A;  1UGV A;  1N5Z A;  2RF0 A;  1AZG B;  2HBW A;  2RQT A;  2VVK A;  1GCP A;  5I22 A;  2OAW A;  1K1Z A;  1H8K A;  2CUD A;  4D8K A;  5HCK A;  3EG0 A;  3NPF A;  1ZX6 A;  2C0I A;  1QKW A;  1WI7 A;  1T3L A;  2KRO A;  2L3P A;  2J7I A;  1WLP B;  3A98 A;  1YWP A;  3H0I A;  4CC3 A;  2BZY A;  2J06 A;  3I9Q A;  2JMC A;  2KXD A;  1AEY A;  4Y92 A;  2DNU A;  2DLP A;  2C0O A;  2A28 A;  2K79 A;  5IHN A;  2DVJ A;  1NYG A;  1X6G A;  2FG0 A;  2D8J A;  2X3W D;  3VS4 A;  4OMM A;  3UF4 A;  1JXM A;  2HEQ A;  4F17 A;  1KJW A;  2SEM A;  1NLP C;  2E5K A;  2CSI A;  2RQW A;  2JT4 A;  1M30 A;  4AFU C;  4OMQ A;  1S1N A;  1ZUK A;  1HD3 A;  3EG1 A;  4IIM A;  2CH4 W;  1TUD A;  3IQL A;  3FJ5 A;  1YP5 A;  2F2X A;  4OMO A;  2D0N A;  2O88 A;  4LE9 A;  1GCQ A;  1WYX A;  1ABQ A;  4OMN A;  1YNZ A;  2RMO A;  1LCK A;  1GFD A;  1FMK A;  2EYW A;  2ED0 A;  2V1Q A;  1G83 A;  2ROT A;  3VS5 A;  2RQV A;  1VYV A;  2CT4 A;  2EW3 A;  1UJY A;  2PTK A;  5FW9 A;  2HDA A;  3ULR B;  1MUZ A;  1WIE A;  3EHR A;  4RUG A;  1ZBJ A;  3VS7 A;  5GJV B;  2DM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...