2F38A

Crystal structure of prostaglandin f synathase containing bimatoprost
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
319
structure length
319
Chain Sequence
QQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Prostaglandin F2alpha formation from prostaglandin H2 by prostaglandin F synthase (PGFS): crystal structure of PGFS containing bimatoprost.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C3
total genus 115
structure length 319
sequence length 319
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2005-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2f38A00
3LQGA 1ADSA 3O0KA 4LAUA 2PDMA 3CMFA 2DUZA 1PWMA 4XK2A 3UGRA 2HDJA 3UG8A 1HW6A 3R6IA 3DOPA 3LN3A 3UZYA 1X96A 3R43A 5AZ0A 2ACSA 2PDQA 2PDPA 1PZ1A 3V35A 1A80A 2NVDA 3GHUA 3WG6A 3H4GA 4QR6A 2PEVA 4WDTA 4GQGA 1RALA 4GCAA 3V0TA 1Q13A 4NKCA 4DZ5A 2PZNA 4JTDA 4LBRA 4Q3MA 1R38A 2NVCA 4JQ4A 4YS1A 2C91A 4QBXA 3M0IA 2PDWA 4HMNA 3LBOA 4XAPA 4LAZA 3RX4A 2BGSA 4LB3A 4GACA 2J8TA 4ICCX 3GHRA 1YE4A 3H7UA 1VP5A 4XZNX 3ONBA 4JTAA 1X98A 4QXIA 2PDBA 4XVEA 5JH2A 3QKZA 2PDYA 1GVEA 2IKJA 3WBWA 3LUTA 4H8NA 3BUVA 2IKGA 3CV7A 3GHTA 2PDCA 3GHSA 3CV6A 4GABA 5AZ1A 3WBYA 4YVXA 2I17A 4DBWA 4JQ1A 1M9HA 1EKOA 3G5EA 3T42A 1T40A 3ONCA 5LIYX 1X97A 1XGDA 4WDXA 5HNTA 5C7HA 2PDIA 2INEA 5DANA 2FZDA 2FVLA 1MI3A 2ACQA 3UZZA 4GQ0A 1AZ1A 1PZ0A 1ZGDA 4MHBA 4FA3A 4QX4A 4PRRA 1RY8A 1YE6A 1XJBA 4JTRA 2PDKA 2IQ0A 3M64A 2FZBA 5HA7A 3KRBA 4WDUA 3UFYA 2IKHA 3R58A 5JH1A 2PDLA 1YNPA 4XZMX 2HVNA 1EF3A 3V0SA 3RX2A 3Q67A 2PD9A 3BV7A 1Z9AA 2IS7A 3H7RA 4ZFCA 2I16A 2A79A 3S3GA 3O3RA 2PDJA 3COTA 2IPFA 4WDWA 4IGSA 4WGHA 5LIUX 1XF0A 3Q65A 1S2CA 4YVVA 5M2FX 3N6QA 1Z3NA 1EL3A 5LIXX 1AH4A 3G1RA 1UR3M 1AFSA 2WZTA 3D3FA 4HBKA 3WCZA 3MB9A 1AH3A 3UP8A 1FRBA 2HVOA 3R94A 2HE5A 3UZXA 4R9OA 2FGBA 2PDHA 4RPQA 3UYIA 4IJCA 3BCJA 3C3UA 4EXBA 1QRQA 2HV5A 4XZIA 4AUBA 4PMJA 1IHIA 4JTCA 3VXGA 2WZMA 1J96A 3LENA 1LQAA 2FZ8A 4WEVX 4FZIA 1PYFA 1EXBA 2ALRA 3GUGA 3CAVA 3V36A 1JEZA 3R8HA 1MRQA 3UWEA 2F2KA 4JIRA 5HNUA 1S1RA 3BURA 3M4HA 4JQ3A 4XO7A 2PD5A 5KETA 2R24A 2CLPA 3LEPA 2ACRA 3R7MA 4WRHA 1US0A 3LZ3A 2IPGA 3LQLA 3MC5A 2R9RA 3EB4A 1PWLA 1OG6A 4JIHA 2BGQA 1C9WA 3RX3A 3LD5A 2P5NA 1RY0A 4GIEA 3ERPA 4H7CA 3F7JA 3FX4A 3CASA 4GA8A 4IJRA 1ZSXA 4XVDA 1S2AA 4JQAA 1SM9A 1YNQA 2FZ9A 1QWKA 3LZ5A 1HQTA 1IEIA 3LNMA 3EB3A 2PDXA 2F38A 1ZQ5A 4PR4A 1MZRA 3CAQA 3R8GA 2DUXA 1Z8AA 4PUWA 3B3DA 5LIKX 1Q5MA 2INZA 4EXAA 1LWIA 5LIWX 4FALA 2AGTA 4Q7BA 4G5DA 1ZUAX 1Z89A 4LBSA 4XZHA 2PDGA 4YVPA 1T41A 3U2CA 2PDUA 2PF8A 2ISFA 4ASTA 2VDGA 2QXWA 1AH0A 4LB4A 3WBXA 2DV0A 3V0UA 1VBJA 3DN5A 4OTKA 1AZ2A 2IPWA 4DBUA 4YU1A 4JTQA 3UZWA 3N2TA 2HE8A 4F40A 2IQDA 2HEJA 3P2VA 2BP1A 4XZLX 4I5XA 3NTYA 4L1WA 2PDNA 4PRTA 4FAMA 4JIIX 4PUUA 1K8CA 3EAUA 2PDFA 4XO6A 4L1XA 2IKIA 1S1PA 2IPJA 4DBSA 4JQ2A 2ACUA 3FJNA 2PFHA
chains in the Genus database with same CATH superfamily
2D20A 1ADSA 1HJUA 3TCEA 3TTSA 3CMFA 3W1NA 1E6PA 2SFPA 3BTNA 3VCNA 4K8GA 2H9AB 3KLLA 2C6QA 1KBBA 4LUSA 2DW7A 3LLFA 1RHCA 1E70M 1Z32X 3U5UA 4QJ4B 1PEZA 3WUBA 2ZZ4A 1ELSA 3HQNA 1TMHA 1KCXA 1DQWA 2ACSA 3SQLA 1M6JA 3V35A 4IXXA 1EC8A 1LWJA 2QVNA 4MFEA 4TR9A 4QCEA 5DY2A 3T6CA 4E2DA 1LP6A 5A6JA 2GSEA 4DZ5A 4IGNA 4PGLA 2FTPA 3PB2A 1Z42A 4GY7A 2WMIB 4LCQA 4JTDA 1Q3NA 3SRFA 4R88A 3WLNA 4ZO9A 1GGOA 3GDRA 4N9EA 5HK4A 4RNHA 4QM1A 4LOCA 4QE4A 5LNVA 4UR7A 7A3HA 4WSHA 4ZEPA 1V8EA 4GACA 2IXVA 1M68A 1S5TA 3W84A 2BV9A 1EJVC 2PUZA 2P0IA 3UEQA 4GXPA 3CZGA 5HWMA 3GG0A 2NQ9A 2NV2A 4AZ7A 2C1IA 4HB7A 5BOFA 2WB5A 1QMLA 1BWKA 1K8YA 1B3VA 4PB5A 1LRNA 3VCCA 5D03A 1W6TA 3BUVA 4GVFA 3RCYA 4B3LA 1DWFM 3MVIA 2W9MA 2YLAA 4HYWA 4MWAE 2JKAA 2WSRA 1OFQA 1LJYA 4JX5A 4HNVA 3W6LA 4QEHA 4ZB2A 5BZAA 3STGA 3MBFA 1S5VA 4DI9A 3B04A 3EDFA 5F2IA 4B91A 4B4HA 4NX0A 2P50A 4I7UA 4MWAD 2VFEA 3WSUA 1VJIA 2JK2A 4E8DA 1Y7VA 1R9ZA 4RUBA 4H6RA 1ITXA 1T8QA 1OINA 3BLLA 1KNWA 1GZ1A 2WMIA 2X1SA 4FR1A 2NWRA 4JXCA 2Y0FA 1QW7A 1V0LA 1ME9A 1JYXA 4MJ4A 1W2PA 1EDGA 2R14A 4E0CA 2ON3A 1Q6QA 4PRRA 2D2OA 1REQA 1LBMA 1U1JA 4S3BA 1X7FA 2PDKA 4DVOA 2BGNE 3N3MA 2NSXA 4OT7A 2J7EA 2O7QA 3V0SA 2WHKA 2Q8XA 4LUSB 3BV7A 1W5PA 1LUCB 3K46A 4P7RA 2IS7A 5MF5A 3H7RA 3SCVA 3VNYA 1PAMA 1GT8A 5FEPA 2V2DA 1HXJA 4DJEA 4PMRA 5DMNA 1C8QA 3CUGA 3WLIA 4REQB 2QPUA 5EMUA 5EA9A 1KWKA 4LU0A 3FYOA 4GVGA 4GHRA 4FOUA 1ZZMA 4G6CA 4UXDA 2YCLB 2V5BA 1K02A 4TTGA 3M0XA 2VFGA 5I7GA 5D2YA 1F6KA 4A35A 2PP0A 4HSHA 3CEPA 1UWTA 3QN3A 4WLCA 1XLGA 2JKPA 3LCFA 5HAOA 4ZTXA 1H1NA 3PUGA 1EPXA 5G4WA 2RHGA 3PSWA 1JD9A 3VINA 3AWOA 1E15A 1E1EA 5C8BB 1IHIA 3BAJA 4MWAB 2UY2A 4ROQA 2QCCA 4CQAA 2PLJA 4DJED 3SJNA 3WMBA 3AIUA 3LXAA 4NZ5A 3WO8A 5LGZA 1B4KA 3ATZA 5CBBA 1ICSA 5DEZA 4HA3A 4WSKA 2V2HA 1JPHA 3PSVA 1XIGA 2ZTJA 3DG6A 1SO4A 1X6UA 2BOEX 2W63A 5ABGA 4JOMA 1TVNA 2GVYA 1ZALA 3TWBA 4DLFA 3LEPA 3G0UA 1RVGA 2ACRA 2NV1A 3IAPA 4B90A 2DSZA 3B8WA 1CX9A 5I23A 4IGHA 3LRKA 1SO6A 3WLMA 4IPIA 2GVJA 3KE0A 1WKDA 1Z44A 1RQBA 2TPSA 4AD4A 1UQYA 5LKYA 2OYKA 3ICJA 4QSFA 3AYRA 4R5EA 3W7LA 3LSCA 1ZP3A 2OT0A 5EMMA 2Z27A 3FX4A 4M56A 1JYVA 3HO8A 1HNYA 1LT7A 2VYOA 1VPYA 3VIOA 3K4AA 3WDJA 3SB0A 3PWAA 4R3UA 1VS1A 3D3AA 4JQAA 1SSGA 3B8UA 4JTEA 3OW1A 3ABSA 1IZCA 3DFHA 4EXQA 3WH8A 4H3DA 1EJWC 3HG4A 1Q7ZA 2TRSA 1L0PA 1JG9A 4MAVA 3MI3A 2E9LA 3CWOX 3DYPA 1A5LC 4P7LA 1QAPA 2E0PA 1NSJA 4NJHA 4WXZA 2Z2UA 3UXAA 2WHJA 4GXMA 1H7NA 4JTHA 1RV8A 2I7GA 2PRMA 2ZDRA 3AHXA 1XUZA 1R30A 3BG3A 1T7LA 5M03A 3NUKA 1O60A 3HJEA 3EOUA 3MSGA 1W3NA 2IPWA 1NJJA 1DYSA 3TSMA 1U5VA 3KVMA 4X2RA 3UJSA 3S5YA 5F1UA 4XZ9A 3O0FA 1GWJA 2AL1A 1W1PA 1ISYA 2Q3RA 3EDKA 4JDYA 1ZFJA 5A6TC 1R3WA 2UV8G 3VO0A 3G1DA 3EAUA 1K9DA 4TVCA 3LCGA 3LPPA 4PTVA 3W7NA 1S5NA 4CVUA 4AX7A 4DBSA 4AAJA 4Q8TA 5MKGA 4H7ZA 3VPLA 3QXBA 1QI2A 1IWBA 2Z00A 1OABA 2DZPA 1WXZA 4GUHA 3LHVA 3CPRA 3HZ3A 3G1SA 4CU6A 2VZSA 3CQJA 1W3KA 4UTHA 4IHCA 3QV8A 1HW6A 1NWRA 1UIOA 3R6IA 5PTDA 3L0NA 2VR2A 3EBVA 3WNKA 1OFOA 3HQ1A 1R2TA 3EGJA 2HBXA 2QDDA 1MQRA 3GHUA 5FF3A 2W6RA 5BCAA 2PEVA 4LNYA 2JGYA 3VD9A 2XVNA 3VZZA 4NF7A 1THFD 4IPPA 2X8RA 1ZB5A 1U30A 2GL5A 2JE8A 2QJMA 3KWXA 5LXXA 2Z4GA 3AC0A 3B4UA 4HKPA 4UMAA 5FIPA 1J10A 1MDLA 5GVJA 3VNMA 2ZXAA 4UFMA 3UJEA 3NXLA 1G4TA 4B2DD 4ATWA 2VI0A 3KTCA 5C7VA 3ZXWA 3SY8A 5D8ZA 3SAZA 3E1F1 4F0MA 1X1OA 3LSBA 2FIQA 2HPIA 3NQ6A 2EPOA 1EO5A 5JH2A 1LM1A 1W31A 4BR1A 1FH8A 1I2QA 2ZX8A 3QMSA 2IKJA 3VFCA 1O5KA 8CGTA 3BG9A 3LUTA 3FAWA 4FR6A 3W76A 4ATLA 4XBJA 1I9CB 1M3UA 1XV8A 4NG3A 4U5KA 4AFYA 3WMCA 2G3JA 3GU1A 3BL3A 5AZ1A 4GX9A 3B0YA 3AIBA 4DBWA 1B9BA 3JR2A 3TE9A 4K36A 3P61A 3GM8A 1IV8A 4AD2A 2Y4SA 2ZZ1A 2Y8UA 1R3YA 4MJMA 5LSMA 1GYNA 4XIMA 4CUCA 2RFGA 4M0XA 2C71A 4Q4RA 2IW0A 3SDOA 1BRLA 1ZTVA 3VNZA 5DBTA 2X05A 4N7QA 4M29A 3HV9A 4ML4A 5I77A 2XIMA 3NVDA 1PPIA 4UBPC 4FNQA 5FL0A 5AC6A 2JQXA 1JZ5A 3WDPP 4XQ6A 4EF9A 1HF6A 1Y5WA 2BY0A 1TPUA 4GQQA 4IX2A 1A5BA 3WQ4A 2GGEA 4O1CA 1MSSA 2Y63A 3KBMA 1TJ1A 3IPWA 4W8BA 3H55A 3DENA 3EPMA 3NGJA 4E4PA 4KERA 1IE7C 1DBTA 3ZJ6A 2A79A 3NM1A 4LYRA 1BKSA 3M16A 3DAQA 1G01A 2IPFA 2H9AA 2X7WA 3FVMA 4EPKA 1I75A 1F6YA 2H3DA 3M41A 2BOFX 3NG3A 3Q65A 3WLTA 4RXGA 3VIJA 1FFQA 3OTRA 4KRTA 4XBSA 4C6EA 4PTDA 3C56A 3GXTA 1AFSA 3G24A 3HV8A 4IZGA 1UPPA 1RZMA 4BI7A 1BG4A 1ADOA 3FIGA 4Y8EA 3K1DA 1JAEA 2ZRWA 1LBLA 1VRDA 4GYPC 1FH7A 1UZDA 2HV5A 7CGTA 3E0VA 5EU9A 3EXRA 2CBIA 1GVRA 1TRIA 6REQA 2AMXA 2WXDM 3GSMA 4C90A 1FUYA 1XKYA 1JGMA 1WOAA 4NI8A 2XN0A 3NOEA 1WXYA 1OC5A 2DUAA 1YBQB 1GK8A 2OQYA 1B90A 3IJ8A 3L0GA 1D3CA 2XH2A 1FKWA 5C2GA 2C19A 1PVNA 8XIAA 4LNCA 1TPFA 4AVFA 1VHNA 4ADTA 4Q4OA 2JIEA 3ARYA 2EKCA 2XVPA 3M4HA 5HWNA 4FNUA 3GR4A 5AVNA 3UCDA 2OX4A 4NJKA 2ZZ3A 2VEKA 2NV9A 4EK7A 3LQLA 5LYRA 4FXSA 4JBRA 3BJTA 3QQ1A 1VBHA 4ZBCA 1WZAA 3JZEA 1HZYA 1KFCA 1WDQA 3MW7A 3WQFA 3C0LA 3VC6A 3EX4A 3TXVA 2ABAA 4Q7IA 5A6KA 2VEFA 3OG2A 2YYTA 3QV9A 2VUNA 3CASA 3KVKA 3VDHA 4LH8A 1UUMA 3RGTA 5JBDA 3OLGA 4JYFA 3NA8A 4KWUA 3SR7A 4ZA0A 4PMUA 1UJPA 3OZOA 3EYPA 5REQB 3W24A 4XKYB 2HXTA 5CAKA 3W73A 4UTKA 2D69A 4O8AA 4CN6A 4ICNA 4K7YA 3RF9A 2BFGA 3F1QA 1F2JA 1DP0A 1HKJA 1A5MC 2Y1HA 4IG2A 2WC4A 4O19A 2DVUA 1I1XA 4V15A 5C9WA 1H5VA 5EYWA 4TOQA 2A3LA 2XZ9A 2OQLA 1OFRA 1RK6A 2OPJA 4M19A 3W27A 1KCLA 4IFRA 2QXWA 1XIFA 3D47A 1OWQA 5DRCA 4NT0A 1LROA 2B7OA 4AD0A 3ANVA 3V0UA 1QPNA 3TKFA 2J47A 4Q22A 4AMAA 3O63A 2W66A 1SZNA 4ZQPA 5JVLA 4JFUA 3N6HA 5HINA 1XLFA 4XUGA 4DWSB 3W7QA 3WJSA 4HNLA 3SCTA 4ERGA 4C6PA 3E0WA 2XIQA 3KBWA 3G2GA 3PTMA 2E28A 2OEJA 3S83A 3WL1A 1XYLA 3N2MA 4PUDA 4PFMA 4S3GA 1K8CA 1YYAA 1KXVA 1OB0A 4Y6GA 3W74A 4TX6A 2KX9A 4AEFA 2Z7KA 1XIHA 5B80A 3R79A 1K6WA 5MHBA 3W72A 2PFHA 1LLOA 1J12A 3E6EA 1CDGA 1KFKA 1RA5A 2A7NA 1K4GA 2FTYA 2E67A 1AW5A 5D32A 4AY1A 1H7OA 4TU1A 1BSLA 1ZU8A 4MZ8A 1E0TA 4XSLA 4RZ5A 1LWHA 4Z1BA 3WG6A 3HU7A 3YPIA 3P8JA 4TX9A 1VLWA 3S0CA 1EA0A 3OBAA 1W9BM 1GQJA 4HCLA 4I90A 1UR8A 3LRMA 2CWNA 3AZRA 2GQAA 1OQFA 2E6YA 4ZXLA 1UUOA 1LORA 3ALGA 4OVXA 1PIGA 2VRJA 1X6LA 1SW0A 1TCMA 1QOPA 1W9UA 3ABXA 4L6HA 4TVUA 2DT1A 1AK5A 4ZOBA 2DVXA 2D0HA 5J5DA 2O9TA 4D6HA 3ARUA 3PUOA 2EQDA 3B9OA 4CCZA 5TNVA 4F0KA 3S8HA 1W9DM 1ZJHA 5GPRA 4CD6A 3BAKA 3C2FA 1PCWA 3M5VA 1H62A 4WHBA 4J28A 3LERA 2PB1A 3CK5A 1VZWA 1N55A 4NAFB 3IANA 1TUFA 3W7HA 2VEMA 4AZCA 1AMYA 2IKGA 3VIPA 3AHTA 1K6AA 4YHGA 4GGHA 4PTWA 1CLVA 1SZGA 2OGJA 2QDEA 4LVGA 3PG9A 3OGSA 1MXGA 4GABA 2WJDA 2GLKA 3ZVHB 1P1XA 3TJ4A 1ECQA 5ABHA 1NP0A 1NOUA 4FXFA 4AX6A 1XD1A 4HPNA 5GNXA 1WAWA 1Q8AA 1X97A 1V7YA 2E1DA 3GTHA 3UG4A 3CT2A 3BJSA 4KPLA 2FVLA 4US5D 4I6KA 4L6DA 3VX1A 2YCIX 1TJPA 4N9CA 2CZFA 2R1PA 2WC3A 3SIMA 1LF1A 1GVFA 3GDKA 3PJWA 1KFWA 2A5HA 1A4MA 1SO3A 2OB3A 1RCQA 4P8UA 4CLMA 4URIA 2YXXA 5HMSA 1W54A 5C2CA 3L4TA 4XZWA 2G96A 3VCRA 3UFYA 1L9WA 3R58A 3TN4A 1YNPA 2BXZA 1FP8A 4XZMX 3ITVA 4DYKA 3OODA 3SJ3A 3TFXA 5AY7A 3F4CA 1OX5A 3ZLHA 5BRBA 3Q94A 2GDVA 3S4TA 2V67A 3RJYA 1AA1B 2NT1A 2CERA 3O3RA 1N82A 4IGSA 3EOLA 2G8ZA 1JF5A 3C2OA 1WBJA 3WK3A 3VGBA 1QASA 4Z1CA 4LRTA 1V4YA 4Q4SA 1LT8A 2GQ8A 2WAGA 4L4MA 4GYPA 5LIXX 2FH8A 4CD7A 3W88A 5GJNA 4WIWA 3WBEA 5I3DA 1C9DA 3HGOA 3WCZA 4P7QA 1E6NA 2ZDSA 1KGWA 4MB1A 1R8LA 2F6XA 5IFPA 2ZC8A 1ZL1A 4PUNA 4HJWA 1QRQA 1EGMA 3CAWA 4HMCA 1DJXA 4XZIA 3AIVA 1QI5A 4AXNA 4IL0A 2WHLA 4C6MA 5XIAA 5CCZA 1LL7A 3N29A 4C5YA 3LLXA 3WNPA 3IJIA 4IFKB 5HMEA 1OGGA 3GDLA 3GQYA 3IAQA 3OBEA 1M1BA 1M7PA 3B8DA 4FI4A 4NSBA 3V36A 3IIVA 4MYXA 1Q6GA 1O94A 1NH6A 1DIDA 3L2LA 4A22A 5XINA 4FNTA 4BF9A 5I03A 3VD5A 3ZLFA 4XAZA 1EQPA 1KC7A 4H1ZA 4S3FA 1KFJA 4XIAA 3ZO9A 4KS0A 4P61A 5BU6A 1P0DA 1Q4WA 4AF0B 4XTIA 1ISWA 2VVSA 4HD5A 1F3XA 3ATYA 1PKLA 1QATA 1F73A 3J7HA 4AZIA 2QCNA 3ERPA 4JS3A 2KAUC 3HGSA 4NU7A 2W61A 3MMUA 4UUIA 1S2AA 1MVYA 2E5BA 1SM9A 2QUMA 2WVUA 3DX5A 3N11A 5F2GA 3AYSA 1XIEA 1YPIA 1WQ5A 3QHOA 1LLZA 2ZOXA 4C6FA 2XWDA 3M9YA 2GJPA 4S39A 2WMGA 3CMGA 3TEVA 1R2SA 3TOYA 2QMKA 3QHNA 2BB0A 3M43A 3T2QA 4EPDC 3TSBA 2CCRA 1CLKA 3CQKA 2VZOA 4XZHA 4MJZA 5IDZA 3LI0A 4K7VA 3H54A 1ZBWA 4NJJA 3BSHA 1R9XA 2PDUA 1NFBA 2DJXA 2VEIA 1FWIC 4KH2A 3BLIA 3E5BA 1BGAA 2PP3A 1JCMP 1EJRC 4FLQA 4PSRA 5GNZA 5AECA 4U10A 1Q6LA 3A4XA 3N2TA 5BXRA 2QUTA 5CGMA 2R1NA 3EB2A 1FWHC 3PC0A 5K4ZA 4AVOA 5KEZA 2BVYA 5AHIA 3MHUA 3FHAA 3FKKA 1V02A 5D37A 3GYCA 1SR9A 3QW4B 3W71A 2JALA 3SCQA 4QDWA 2CU0A 1GKQA 4JNZA 1B30A 3VFLA 4KKXA 5K9DA 3SO7A 4AHPA 1Q2SA 5FEZA 4L1XA 3WK2A 1S1PA 4L1GA 4ENLA 3BVJA 4W9TA 4ACZA 3FJNA 2NQZA 4X3ZA 4U28A 3IGHX 2QCLA 1EOKA 3PFRA 4X63A 4C6CA 2EGZA 2FMNA 3KBJA 1XP3A 4LS0A 5ABFA 3V75A 3WBAA 3CIWA 3N19B 3DOPA 1ZLPA 1K03A 3ARWA 1ADDA 1TREA 5KTLA 2C1HA 3EWUA 1DV7A 1AODA 4S3CA 5LZLA 2DP3A 3H53A 3O6DA 4GQGA 2DT3A 4NYYA 1E1FA 2FJUB 1WBHA 3ZJ7A 3W6MA 1XRTA 1MRAA 4ZQCA 4G8TA 1CXKA 3IV8A 4E2BA 1YX1A 2CHOA 1TWWA 4IIEA 3O6YX 1XC4A 1XDJA 3GC5A 4EWJA 4YS1A 3WLQA 3W9ZA 4MF4A 3M0IA 2PDWA 4H9MA 1YDYA 5CEWA 2VEPA 2A3BA 2EPNA 3WMSA 3BH4A 5CBJA 2XU2A 3TYEA 4RDYA 1YE4A 2J66A 3TCSA 5KZDA 3W01A 2RKXA 4XZNX 1A5CA 4JTAA 4KCTA 2ZICA 4Q4PA 1UR2A 4UCGA 3QOMA 4UOQA 3LTYA 2CITA 4D8ZA 1UWRA 1FWGC 4XAYA 3FJLA 3POHA 2DSVA 1JPDX 5IBXA 4HCDA 4NZJA 3FN9A 1FCBA 3CTTA 1FWAC 1W2VA 1UR1A 1Q7MA 1F9CA 3CL6A 5I09A 1Y5XA 5C55A 2YXOA 4U5IA 3HMCA 1UQZA 4Y9NA 3G5EA 4O18A 4KEUA 2J4GA 1VFTA 2GSJA 3B0UX 3OB8A 2YKKA 2QHAA 1C8VA 2E9MA 3VUSA 2BOGX 2A85A 4CNSA 2QAFA 3S47A 1XYZA 3G6MA 4H6KA 1ZGDA 4C1LA 3TW9A 5AYBA 2Q8ZA 1GQLA 3N12A 1QBAA 4A3QA 1S3HA 2B7PA 1SMDA 2NX3A 1ZENA 1JDDA 3NZPA 1WDRA 2XUCA 1Y0EA 2FFIA 2DY3A 1PX4A 4N4QA 3NQBA 4QEEA 2QCGA 3HTWA 1BG9A 4DYJA 3QPEA 4HZ7A 1SZEA 3S3GA 1AUSL 2YIHA 3H2EA 3HURA 3W26A 1C92A 4C6LA 3S1XA 1F4HA 1W1B1 4DWSA 3MPGA 3GZAA 1MW0A 2V38A 1PJ9A 3TSDA 1M04A 3OZMA 3H22A 4M6PA 4GO8A 3DKLA 4AB4A 1FXQA 4D71A 4CU7A 3AU6A 1M7XA 4F9JA 4QS5A 2CLOA 4PYSA 1XWYA 3C2EA 2V5CA 4D6FA 5CSUA 1FDJA 1DJYA 1W37A 3K30A 4GBDA 4PTXA 2JBMA 1H1ZA 3ZSSA 3IUIA 4CCEA 1DJWA 3N2BA 5D2TA 1UWAA 1YKWA 1K4HA 2YFNA 1F05A 3TAOA 1E6ZA 1OBAA 4E2VA 2IUZA 3GBEA 1V08A 2AKMA 5FJJA 5LHEA 1ZRQA 2AQWA 4AIOA 1QW9A 5JUVA 4R85A 1KFLA 4HN8A 4AD5A 1ISZA 2L5HA 4Z42C 1JCNA 1TZ7A 1GOXA 2V63A 3QFWA 4HZ6A 1PYFA 3CAVA 2ZXDA 3RR4A 4AVNA 5IRPA 3EPOA 2YCKX 4IISA 5J8LA 3BURA 2BDQA 2YR1A 1J2WA 1JUBA 3PBVA 2CESA 2CZVA 5AVHA 2C7FA 4IP7A 3TWAA 3E0IA 4PB4A 1HJVA 1EH9A 2OYLA 3UZJA 3H2OA 4HYVA 5C54A 2OSXA 4MFDA 4O1EA 3T4CA 4PCFA 3M44A 1W56A 2P5NA 1HKKA 5T9CE 3B8SA 4C5ZA 3GE7A 2H90A 5A2AA 2CLMA 4IJRA 3EKLA 3GDTA 3NFUA 3ME3A 2GGIA 4MAZA 1G4PA 5DRIA 2FZ9A 3WUGA 4CVWA 2AAAA 3D0CA 3KCOA 3AMKA 4PCTA 3VOJA 4E4UA 3PBYA 2DZVA 2BLEA 3N4AA 4MKNA 5LHFA 1JFHA 1VQTA 1W3HA 4O57A 3GIYA 1X1ZA 4H4IA 1UR0A 1J0ZA 2QW5A 4GNJA 3S1GA 1QVBA 4MNMA 5K2ZA 3ZIZA 1SO5A 3L5AA 3B3DA 3CUHA 5LIKX 1LCOA 5BXSA 5IFTA 5LIWX 3O8AA 2AGTA 3EA2A 1ZUAX 3W1PA 4X61A 4F2UA 3V7PA 4YVPA 1CI1A 2V3FA 3AIWA 3TA6A 1U1UA 3U2OA 1VCVA 4W5ZA 1L6GA 4ASTA 1TO3A 4B5XA 2DV0A 3DN5A 4QCFA 3M5YA 2XSAA 1V77A 1H7WA 2REQA 2PTWA 2E09A 3AU2A 2RJGA 2ZUTA 1GOQA 3S1WA 4HPHA 3GXNA 3WQDA 1MFVA 4UFKA 4Q8OA 5EMLA 1RJPA 3IS4A 3BOFA 4L6OA 4GYKA 4XZLX 3NTYA 4HHLA 1OFEA 1YXCA 3UYCA 5A2BA 4PRTA 3TVAA 4WVXA 3NVTA 5JBEA 2V69A 4Q6XA 4O8RA 9RUBA 3VOCA 1FDZA 3A5VA 5I3HA 5J5RA 4HSOA 3OP2A 3ITTA 2Q01A 2PDMA 3OU8A 1BF6A 5I3JA 1FX6A 3HPFA 4AMCA 1RK5A 3QZAA 5E9AA 4BHYA 3UGRA 4H9TA 2HDJA 5CJMA 4HNUA 2OFJA 2OX1A 3B8TA 3TYBA 1F74A 1TTPA 3B9AA 2HMCA 4ERAA 4S38A 3LX9A 2O4MA 1L8PA 1S39A 3R2GA 1EA9C 2G50A 4OUEA 3FS2A 1GHRA 1OM0A 1CB2A 2PZNA 4O28A 4CNNA 3VIIA 3VNIA 3WF2A 3VNDA 3PB0A 4QISA 1P7TA 1QNQA 4TUFA 3UERA 2BMBA 3PBMA 4XAFA 2JGQA 4OECA 4AWUA 3K4DA 1OFDA 1L2QA 2X0HA 3BLDA 3SUWA 4FO4A 4GI4A 1RAKA 3ZQ9A 2P1FA 3WQEA 3GHRA 3W1AA 1KGUA 3GNDA 2GZXA 3VE7A 2YA1A 3GNPA 4WY0A 4DN1A 4LQ1A 5DX7A 3UPWA 1PO9A 2WKJA 3MSDA 4RDVA 4F66A 4XVEA 5CPNA 2AMGA 1GVEA 4M8UA 5RUBA 3G1FA 4GFIA 3VC5A 3Q4DA 1SFTA 1V3HA 4JTLA 1E0UA 3KOYA 3TYUA 1OYBA 4C6IA 2ZUVA 1DQXA 4GQRA 3SN4A 1NELA 3QY8A 3WENA 1E5NA 1PHQA 1ZHAA 4DPPA 4UCFA 1J0YA 4S2CA 4EX4A 2HSAA 1C29A 1FHLA 2XIBA 2ZX6A 3CLMA 4JYEA 2X1TA 3G8RA 4PMNA 5CC7A 2GVLA 1UP3A 2BWGA 2Y7GA 2Y8VA 5A8MA 3M0VA 1Q7QA 4H41A 3CH0A 3DHFA 3APTA 4LX4A 4B9ZA 2XVLA 3N9SA 4DO4A 4GINA 4BKNA 1G5AA 3AWNA 3URBA 2YL5A 4QX4A 1TTIA 4ROPA 1C8YA 4CQ8A 1QPQA 3TLLA 3GXDA 3KDNA 1US2A 4KW2A 1XIMA 3M0LA 1YDOA 2E8ZA 3KRBA 1R86A 3WDHA 3ARQA 2QYGA 4JY8A 1VBRA 2HZGA 2F9RA 4PH6A 1VAHA 2ZIDA 1FCVA 1JAKA 3WJXA 4G9PA 3N4EA 4MDPA 3TTQA 1MMFA 1TWDA 1VB9A 4PBEA 3W82A 3AROA 1HJXA 3BQ6A 1A5SA 3I7SA 1NDYA 1E3ZA 7REQA 5HJXA 1ITCA 6TAAA 1LOQA 1SSDA 3IVUA 3W25A 5M5DA 5CLWA 2GGHA 2V68A 2WJFA 2F7FA 2XFFA 2D24A 3ITGA 4MM1A 3E96A 5EFDA 4KIRA 4GJ1A 4J3TA 2WZIA 4I8DA 4QG9A 3LB0A 4J3XA 4MOZA 4IJCA 1W9VA 1D7KA 2IMRA 4N9BA 4EXBA 4YHEA 4AWTA 4GK8A 1XCXA 4C6DA 5IXEA 3P14A 1XYFA 2HBVA 4PMJA 2VX4A 3WH5A 4DF1A 4R53A 4ATDA 3G8EA 1KLYA 3E3HA 5MKGB 4F0RA 3LENA 4V27A 3W7RA 1AD4A 4GVHA 1TQXA 3LPFA 4LJ3A 4FZIA 3TFCA 2VP8A 3DERA 1G0CA 4Y9MA 1KM4A 3DXIA 3QJAA 5CZJA 1JEZA 3WFLA 1DJHA 4KRUA 2X30A 5HNUA 5AYXA 2PBOA 4UQEA 4BWLC 2PS2A 2FLIA 4LY4A 3ITLA 1JYWA 5ABFB 3QKEA 4Z2LA 8XIMA 4JX4A 1SU5A 3NYZA 3T78A 5I3GA 2PWDA 2YBUA 1IGSA 4Z1AA 1OG6A 1SFJA 2PU1A 1BVNP 1HJSA 4ORIA 3UWUA 4GI6A 2WO5A 1TV4A 1TCDA 3UT0A 2ZRVA 2FJKA 4UWMA 2VGFA 3HG5A 1PCKA 4NVTA 1ECEA 4JTJA 3UQNA 3CV2A 2QJNA 1EP2A 3GD6A 1UH4A 5A6BA 3C8NA 2F38A 4QE1A 5BWAA 1XKJA 2FGZA 2O9PA 4C7FA 2E9BA 4C91A 4S3KA 3MTWA 4OBTA 1BVWA 1BD0A 2HCVA 1K77A 2WSYA 2W4XA 2DH3A 3TP4A 1R3TA 4G5DA 2UBPC 1GJUA 1Z89A 3A12A 1MNSA 4C1NA 3QR0A 3EWWA 5E70A 5U7SA 2ISFA 5I79A 5TD4A 3CTLA 1WUFA 3DKJA 3WBXA 1Z41A 4TIMA 3QSRA 2VELA 2PMQA 4DBUA 2Q09A 1A0EA 1E9LA 3BC9A 3RR1A 5BU9A 3O9NA 3EXSA 2B4GA 4A4AA 3TV8A 3P2VA 7TIMA 4TTUA 1SVDA 3LLDA 1UD3A 3TQPA 4Z2IA 3ABRA 2ZUSA 2NLIA 3RILA 3WQGA 4IJBA 4E6MA 3E12A 2CNCA 4GJIA 4MDOA 5F4XA 2YZ5A 1O4UA 3LMYA 3PZIA 4H6QA 1A5KC 1XUUA 1YTEA 3FCPA 3R13A 3WQVA 4JHZA 4GZEA 4WSJA 3CPUA 3LY0A 1GVQA 1TVPA 1NQ6A 3WLOA 1CCWB 3MUCA 2P3ZA 5H8UA 2GJNA 6XIAA 4X22A 3P80A 3STPA 1F3TA 1X96A 4GE8A 2PCEA 3R43A 1TA3B 3AHVA 1CGTA 3L67A 4YTUA 5TIMA 3N2CA 2NVDA 4ZSUA 3UXDA 2EHHA 3T0AA 1J9YA 3G18A 2EXOA 1SYTA 4N9DA 3M1ZA 4JIQA 3TC7A 5K4XA 7XIMA 4IQLA 1FXPA 4Z08A 4MJ2A 2VFIA 1WDSA 2GVGA 1PTDA 3ZWTA 2CKSA 2OJPA 1PDYA 1W17A 8TIMA 3D6NA 2YL9A 3KBSA 3R11A 2ZFAA 1GEHA 4WKFA 4PUMA 3GXPA 4PMDA 3VGFA 2OO6A 1E1CB 1UWSA 1PTAA 3CUFA 2PDBA 5DCEA 4GBUA 4GY0A 1RLCL 2ZKMX 2DZAA 3F4DA 4HMDA 1LG1A 4H8NA 3H21A 1DXIA 3QPYA 2QCHA 1F4AA 5AHEA 4FXRA 1KBKA 1EO7A 1VRXA 1TA3A 1GQIA 4J27A 4JQ1A 4MADA 5DY3A 1QHOA 2G3MA 3TZNA 3NIYA 3N15A 2NQJA 4YCPA 3N04A 1EEPA 1XGDA 1CEOA 5HNTA 1WDDA 4RPPA 5C7HA 1V5XA 3W1TA 5AKQA 4Q8UA 3AMGA 3STEA 5HMFA 3L66A 1KQZA 2INFA 4C6JA 1XX1A 3RRAA 3BAWA 5KZMA 1RY8A 3S9IA 3W2NA 1MQQA 1YXDA 3WF4A 1YLVA 2W79A 2E40A 4WUIA 4EANA 5DLCA 4IMCA 5B7YA 2RDUA 4N02A 3O6AA 3QTGA 2OCZA 2OG9A 1QFEA 3ID7A 4QE5A 3P5ZA 3I7QA 1K9FA 2WMHA 4MNKA 3NQFA 4ZFCA 3RLVA 3MMDA 1PZ2A 3ZT7A 3NQCA 4JL1A 4DM2A 4KFPA 2XM1A 4H01A 4XX6A 5G2HA 5LIUX 5FSEC 4TV5A 3QYQA 3H2NA 2JF6A 4K3ZA 1OHLA 1AH4A 3G1RA 2A6NA 5AC7A 4WK9A 3QEZA 4RV8A 3O05A 4QHRA 2PCQA 3TA9A 3PVFA 2HE5A 3AFBA 1P6CA 4R9OA 2PDHA 4BFAA 3OIHA 2D22A 3AIEA 1XDLA 3MDUA 4IMDA 1WOBA 4FF7A 3OBKA 2XGZA 1R85A 5K9CA 4DUXA 1SW3A 5A8QA 1XYCA 3RG6A 1H4PA 1N8IA 2W92A 4Q8PA 5CG0A 4OE7A 3UXKA 1AVAA 3PM6A 4M7TA 1EF2A 3AS3A 5HPOA 4BWLA 1TG7A 5H8PA 3EX3A 2V81A 4QDPA 3CUIA 4NL1A 1S1RA 4H6EA 1G94A 3CHVA 4NRRA 4AZCB 2WVVB 4ILSA 1H60A 3U4AA 1BPLB 4X2PA 4C6KA 3GKFA 3B0XA 4PMVA 4WRHA 4DNMA 3BQ5A 3PZQA 2CZEA 3UJ2A 2R9RA 2OMAA 1UMLA 2YZRA 3U0HA 4CEXC 1QI0A 3HA1A 4M1RA 2FZNA 4UFLA 3U3HA 2PAJA 1IWPA 2CLLA 4GNVA 1H09A 3HGRA 2H3BA 3KXQA 1FWRA 3W1LA 3A24A 1BTMA 2JIWA 5AOUA 4C7GA 2E77A 4IIGA 1NWUA 2V3EA 2QKFA 5TAOA 4XVDA 1M5WA 1FWNA 4JKKA 4MKVA 4X60A 5FJRA 3M46A 3P0XA 1POKA 1DIKA 3L2MA 3KAOA 3VOFA 1BAGA 1QWKA 1VC4A 1VEOA 3C3NA 4UOJA 3LCLA 1XBZA 1JZ4A 4DPQA 4GZIA 1E51A 3DC0A 4PR4A 4DAFA 1HP4A 5BMXA 2YW4A 1V6YA 4K1WA 3CZKA 3XIMA 1PB0A 3W23A 2B7QA 2EPLX 5A3HA 3WLLA 3U9IA 4LXFA 2NWSA 5FF2A 3IACA 3RM4A 4XB3A 1DJZA 4DO7A 1O5QA 4W5UA 5A6AA 1JXKA 1TX2A 5A6BD 1HIZA 4ZCWA 2PF8A 1A47A 5F2LA 1UW9A 4O1DA 4C1KA 5FF4A 1OK6A 4LB4A 2OWWA 1HL9A 5LNWA 1CGVA 2WMJA 5IDIA 2XH0A 2ZA1A 1CZ1A 1OY0A 4L61A 5LGXA 2YLLA 3ARSA 2D0FA 1UPMB 1Q45A 3HB9A 1NM9A 3KHDA 3GW3A 3L21A 3WQPA 4F40A 1CW2A 1BWVA 2GK1B 1CGUA 4CD4A 4RZ6A 4L1WA 4WD0A 1LL6A 5CPQA 3WFAA 1UKSA 4G7EB 3BW3A 2PURA 2AQOA 3F4VA 3C6CA 2PDFA 3LA4A 4DJDD 1XRSA 1W5OA 3EMQA 1XW8A 3CL8A 3IWPA 1IF2A 1K9EA 1OC7A 4I7WA 4DJFA 2VZTA 3LQGA 1CNVA 2WK2A 3SQSA 4H9YA 3CZEA 2EF9A 2X0SA 5IHSA 5AYIA 1YEYA 1EP1A 1F8MA 5FEWA 4PCPA 1KBIA 3AMDA 1KM0A 4Y90A 1TFVA 2GGGA 1N8WA 3TYDA 2QDHA 3GTIA 3WUFA 3M5ZA 4LVDA 5I3KA 1W3IA 3THQA 3M47A 3S42A 4GOAA 4XD3A 2PDPA 1PZ1A 4F4RA 2VD9A 3W2JA 3HFYA 1MEIA 4QR6A 2VM8A 5G1YA 3SM0A 3TK7A 1RALA 3PPFA 3QGAC 4HA0A 2FTWA 5REQA 3M0YA 3WLPA 3H2MA 2BY1A 2X1UA 4K39A 4FK9A 4Y96A 1D3HA 4PULA 1OZQA 1YBQA 3SCNA 4J2PA 3EZ4A 1Q85A 1QHPA 3BXWA 4XAPA 1VJZA 3RX4A 3SRHA 4H2HA 2WC7A 8RUCA 2Q3OA 2XFRA 4AZBA 3G1AA 3HOJA 3K5XA 5FEXA 3RPMA 1RD6A 1V6XA 2J8GA 3ONBA 3GAYA 1ALDA 3VMOA 1A0CA 4BJHA 2HXUA 5BW6A 1CGWA 4EVZA 3R4IA 5DT5A 3WX7A 4AZGA 2FKPA 1GYLA 1JQVA 4QFUA 1G1YA 2G3NA 3PJUA 4ZO6A 2GWGA 3U5YA 4M6QA 5E0KA 1TQJA 4E3VA 3A4JA 3S2JA 2V30A 4TXEA 4AEOA 3QVQA 1GQNA 1UH2A 2WVTA 5HATA 3CIXA 5CPOA 3E9AA 4WOZA 3TN3A 5D2XA 1BQCA 4A3HA 3OYZA 1SR0A 6REQB 1JZ3A 4JTTA 1JR1A 5TF0A 4UZSA 3BO9A 1YE6A 3BDKA 4GIAA 3W38A 3WQ8A 3BG5A 1E6SM 2DH2A 5HULA 2QT3A 4LVFA 2G3FA 3GY1A 3H2FA 4LC6A 1LZOA 1VIZA 4HTBA 2VCCA 3HM7A 1XHGA 5E6ZA 3ZR6A 1GW1A 3PS7A 4DYEA 1DJQA 4JN6A 3NEHA 1Z9AA 3CO4A 1K3UA 4B5UA 1ITQA 2FDMA 2QQ6A 3K13A 1X7IA 3N25A 3ZVHA 2PDJA 3SCUA 4NHVA 2IXUA 4DI8A 3UVIA 2ISVA 2W5FA 5CC5A 5FSDC 2XWEA 1BYCA 4H8VA 2OWXA 3AYVA 4HN4A 4O4WA 4ZMGA 3NPUA 3R8RA 2AQVA 2O9RA 2EBNA 2PRHA 3MWAA 3E02A 3KRUA 7TAAA 4LRSA 1O5XA 2BZNA 2WV8A 5F7UA 1JZ7A 3V16A 1IYXA 2WNZA 2CBVA 3GX9A 1TUXA 1TWSA 4W7VA 4WY0F 2XJ7A 3GS6A 3HPSA 3LOTA 3QH2A 1JCTA 4NJIA 1EIBA 1YHTA 1UZHA 3PPHA 3L4ZA 4FX7A 4WKHA 3MJMA 5GJPA 1ZBKA 1TWZA 2ZE0A 1Y8BA 3VDAA 4AEEA 2DZXA 3KLKA 3B40A 4YNGA 1XXXA 4WF7A 4QSHA 3L9CA 1FWFC 1KFBA 3KL0A 4P8VA 1EUNA 3SQMA 1J2BA 4AY7A 1DTUA 1QI3A 2A6LA 4ECLA 4CNTA 1P48A 4NNAA 1C90A 2CLPA 2YA2A 2DU2A 3R89A 5DXYA 3EA1A 1OGBA 1RCXB 1VFUA 5C6MA 3WELA 1K8ZA 2OGYA 4HK7A 1YQ2A 1PS9A 1T5AA 5HANA 5A94A 3MO7A 5A95A 3GVQA 4NNCA 4DZAA 4RV3A 4A3RA 1JRCA 1XLCA 1BKHA 1HN1A 4R34A 2WQDA 1XCWA 2Y62A 2YB1A 3GLCA 1XCFA 2FQIA 3F2BA 1YNQA 3PZGA 5JBFA 4IQDA 3UWQA 2TODA 2VCBA 5AHMA 2X42A 5IOBA 1NDWA 1TTJA 2OLAA 3CAQA 3WH7A 1GYMA 1UROA 3T2PA 4GIYA 2DPEA 4DWSD 2WKLA 4IUOA 4R7WA 5G5IA 4IPLA 4F79A 2MNRA 3NWRA 3L4WA 3NNTA 3WQ5A 5HJLA 2X09A 2OWCA 1MQPA 4DUOA 1YADA 4PFHA 4HA1A 3NQEA 4B5VA 1NFGA 1N7KA 2QAPA 1F7BA 1IR2A 4Z2HA 3PZUA 3TJLA 2OELA 2PGEA 2PRLA 5G4EA 3AQUA 1XLMA 2XFWA 2XG9A 3LI1A 3KVLA 1NIUA 1XYAA 4KCWA 1OC6A 1T99A 4RW3A 4DJFD 2DZSA 2I1OA 1PL9A 3CBWA 2H8XA 4AC7C 3GG7A 4YYFA 2F84A 1K1DA 3GO2A 2GSHA 4S3JA 2CC0A 1KXTA 3LHUA 1OX6A 1NTHA 4MLJA 1AJ0A 3TTOA 3W7DA 2QJIA 2YCJA 3UXLA 2TAAA 4JQ2A 3QFEA 3G1HA 3H12A 4RE3A 1FH9A 4FOKA 2VC5A 1HL8A 1S5WA 4BEQA 3DHUA 4XK2A 1YPFA 5HNNA 5DELA 2V2CA 3LCHA 3UG8A 4JNYA 5EFFA 1DJGA 2DVTA 3H4WA 3UZYA 5G1MA 4UTUA 2FHCA 2YPIA 3QZEA 4DXKA 3I4KA 4EWND 1OCQA 1B3ZA 3CHFA 3QMRA 3QC0A 4QLJA 1K70A 4WQ6A 3SRKA 3IRSA 4NQ1A 4LS2A 4E8CA 3WZ0E 1V3KA 4LC8A 1EDTA 4LBRA 2QF7A 4Q3MA 3WD0A 1R38A 3UY8A 1FP9A 1SUXA 4IMGA 5HUOA 1IXQA 4B4FA 2ANUA 3UW6A 1S3TC 1UR4A 1VBGA 3KBNA 1XC6A 2GUUA 2QPXA 1EC7A 2G41A 4M51A 3H7UA 4A3UA 2OEMA 3ABOA 4O53A 3O15A 3LCXA 2PLKA 3IEBA 4IP5A 1PX8A 3MUAA 4MYAA 1Q65A 4H9VA 2Z24A 4DZHA 1W3TA 3AZSA 2P53A 4D1JA 3ZZ1A 5D9OA 4OOZA 2EPMX 4MB3A 3BAXA 4IPNB 4BK9A 5C9UA 1LDCA 3A9BA 3FNDA 2CZDA 3BK0A 3IJQA 2EG7A 4PN2A 2HK0A 1TV2A 4LAOA 3VMPA 4O4VA 1TWIA 4JYDA 3NSMA 5LIYX 1FKXA 2E5DA 2PODA 4MSSA 4WDXA 1WO2A 2YX0A 1KCKA 1Q66A 3S1VA 4BQ4A 2WWDA 2YBTA 3OVGA 1ICQA 4KIEA 5AC5A 2ACQA 2PTDA 4IIBA 2GWNA 4NILA 1HP5A 4JEJA 1IZJA 1T96A 1FDYA 2OTDA 3P8IA 3W7JA 3BZGA 3L0KA 3AJ7A 3VD3A 4FIRA 5HQMA 3ES8A 3ZMRA 4IG2B 1CB7B 3H2AA 3ECQA 3M64A 4UQAA 4IICA 1KTCA 3VVGA 1XPYA 1V0KA 1YDNA 3L5MA 4ML9A 4PTNA 1UBPC 5A2CA 4XG1A 1CECA 4M5PA 4MIMA 1P0NA 1RVKA 5HPCA 4V1XA 1DQUA 4O1AA 1IR1A 4GYFA 5G4HC 1E43A 3EMZA 4Y8FA 3P60A 4XKYA 1NEYA 1W32A 4A05A 4M3PA 2EJAA 3U8GA 1CENA 4Q8VA 4YLWA 1EHNA 3NEVA 3LTPA 1UBSA 4IUGA 4GI9A 1M53A 1ZCCA 4H00A 1EJUC 4O11A 1J0JA 4EACA 4F48A 1DORA 4GPNA 4D6DA 2HVOA 1WAUA 1OG0A 2AGKA 4JD4A 4ZQRA 2FGBA 4ICMA 4IXHA 3L68A 4HNOA 1US3A 4YL2A 1KV8A 1UC4A 1RPKA 1RLDA 5EKYA 3MV01 3DFOA 4AXKA 2RUSA 2VD8A 1MW2A 4H8HA 4AUBA 5I6SA 3W7KA 4HGXA 3K1GA 2CW6A 2ISSA 4IF2A 4P7NA 1DVJA 4ORMA 2Y88A 3WF1A 4XAGA 1WYIA 3MT1A 3QW3A 4Y9PA 1UD6A 2XVKA 3BLKA 3I3BA 4CNOA 5C5YA 4U3CA 4HPJA 1B57A 1PYMA 2F2KA 4TMCA 4JIRA 3E2SA 1NOWA 3MDWA 5KETA 1OFAA 1IEXA 4JAWA 3H24A 2ZQ0A 3BSGA 3DI1A 3S2NA 3EDEA 3FEMA 4PMXA 2GJLA 1GJWA 3NPVA 1NF0A 1VKFA 3RK8A 1SQ7A 3WY1A 1PWLA 4Q6JA 2XTKA 4OOUA 1ZAHA 4CCDA 4I5UA 2R8WA 3AS0A 2POZA 2X16A 3E0FA 3PBUA 1VCFA 1EX5A 4X0VA 1FWSA 4EKJA 4F9DA 5FJTA 3CB8A 2FDSA 1MO0A 3S6DA 2ZVRA 2FPYA 1TZZA 2PTXA 2DSUA 3U7BA 1V51A 4BF7A 3GW0A 3B9DA 3LGEA 1MZRA 4Q4QA 4HZ8A 1GTEA 2VXNA 4MY9A 1GOIA 2DUXA 5CC3A 1RBLA 1KLZA 3RLUA 4JTIA 2X41A 3VIKA 4MPQA 3NM3A 4HYRA 1Q5MA 3WF3A 2INZA 3GG8A 3TIMA 4JTKA 2WPGA 1A5NC 5BMWA 5ENLA 3RN6A 1Z48A 2YDAA 3SURA 3DBPA 4ZOAA 1CGYA 1UHVA 3GXMA 5IM51 2VNCA 4J4KA 3PR2A 3VILA 5A6SA 1VBJA 3CPGA 3A5FA 3KWSA 4B16A 2TSYA 4QAWA 4O14A 4NZCA 4UFJA 3KDOA 3ZYZA 4C6NA 2GK1A 4GVIA 3UGVA 1RJRA 1U33A 5A8NA 2WYSA 4JX6A 4F3HA 1XDMA 3EWXA 3VKBA 3GVRA 1EB3A 1FY6A 5AC4A 1JCJA 4S23A 2LLEA 4JIIX 4Q8MA 2OOFA 3W1XA 1ME8A 2WPBA 3L4XA 4A2SA 1AG1O 1ZBVA 3KBVA 2FVKA 3HPZA 3FY1A 1J0KA 3DFQA 2J24A 3OYXA 2EG6A 3LM3A 2CPUA 1CPUA 2DUZA 4DQWA 3U6WA 1WKFA 3CMJA 5HXMA 1FVPA 3WEMA 1QNRA 4MTVA 1J5SA 1JIBA 3WJZA 2D3LA 1TPC1 4CD5A 5CGQA 3VAVA 4IPJA 4GYJA 1R6WA 1JF6A 4XD5A 1QJWA 2J75A 3KVJA 4A2RA 4QNWA 1RP8A 1TKKA 5A8GA 2O7SA 4DXXA 2QF8A 1BGGA 3U4FA 4JKMA 1Y65A 1R9YA 3FAXA 2VEGA 4IIDA 2QUNA 4H9XA 4AD3A 2Y5JA 3DCPA 4IOTA 4OJYA 3EDJA 3S5NA 4D2JA 4U31A 4KFOA 4HQVA 4HMNA 4UQCA 1ZP4A 4LAZA 3CYJA 4OUIA 4LB3A 3A3WA 1Q6FA 2Y70A 1W5QA 4ICCX 1WNOA 2PWFA 4IH3A 3VIHA 2AAMA 4W89A 1E0WA 3TH6A 1UWUA 1X98A 3HBLA 4NJGA 2J7HA 3PNZA 1DJIA 3GUWA 3HPXA 1GZGA 4HVXA 3KL5A 2ASHA 2UY5A 4RW5A 3SY5A 3WNLA 3L4VA 4D8AA 3WBWA 2GQ3A 4A8LA 1NQKA 4ZQNA 3T0CA 1Q8JA 3P6LA 2MANA 4JTGA 3GHSA 3CV6A 3TYZA 2YYUA 4R7OA 1DJNA 3WBYA 2I17A 4WKAA 3LPOA 5CQ1A 1YRRA 3DUGA 1PZ3A 4HIBA 2PA6A 3BCFA 2P8BA 1KKOA 3N13A 4WXYA 1TMQA 3VKKA 3KX6A 2J25A 4GNKB 1MI3A 1KW1A 3WDIA 6PTDA 5HMDA 5BNKA 4GQ0A 2J7FA 2VGGA 2JFEX 1HO4A 1IT7A 1XJBA 3T09A 4LYPA 4H8UA 1JGIA 2IQ0A 5CSRA 3KS5A 5E0CA 4R27A 1D2KA 3NQMA 2XH4A 2QS8A 1SZFA 2E6DA 5ECUA 1CYGA 2HVNA 5CC6A 5E0FA 1EF3A 3RX2A 2TMDA 4Z0SA 1V3MA 4GKTA 2PBGA 1BFNA 4N6EA 2J62A 3UNTA 5D38A 3FK4A 9XIAA 1V0MA 4BEUA 1DEDA 1QO2A 2ZUUA 2NXHA 1HKIA 3T44A 5DN1A 3WLJA 1XF0A 4FX6M 1G4EA 1DIOA 2C0AA 1OCJA 3A4WA 3GDBA 4RR4A 3E38A 4AU0A 1XYMA 2Z7GA 3MANA 4LWWA 5JIPA 3JU2A 3SUTA 3T40A 1PIIA 2YCLA 3KFTA 3UP8A 4E4FA 1GKRA 1S38A 4AYSA 3PTQA 1R46A 4YTQA 2BHYA 3MUY1 3GKAA 3C61A 3MKCA 4DF0A 3C3UA 3FYYA 2CXGA 1I0BA 4L4OA 3MCNA 3V1HA 4WCJA 3W1MA 2P0OA 2D0GA 3II1A 3CQHA 3UVAA 1OJXA 3A64A 1HGYA 2XZ7A 4IGMA 3RLHA 1XLHA 3AMLA 1HT6A 3VXGA 3EOSA 4LYKA 2ODOA 5FF0A 1E4LA 1FQ0A 1R47A 4QLKA 3W1UA 3O06A 5H91A 4UNKA 1HKWA 1V6UA 5KINA 2VC9A 5DMYA 1V3JA 4J3VA 1MFUA 1R3QA 5SWUA 3NQAA 4CGTA 2VKZG 1VPQA 3EWZA 3LGDA 2NQ5A 4DJDC 9XIMA 1T6MA 4XO7A 3W2KA 1UZ4A 8A3HA 1JI1A 1TJ2A 2EG8A 4KWSA 1YTDA 1R3VA 1AQFA 2GOUA 4HHHA 5CPSA 5E09A 3DGBA 3SBFA 1M7OA 1P0BA 3GTNA 3ARVA 3M7SA 1JDEA 3CL7A 4UTWC 4H19A 2WJZA 3IJ7A 4M82A 3S1UA 1YW1A 3KTXA 2PPGA 2J6XA 1SGJA 1UB3A 1WCGA 2ZX7A 4JFVA 4ZOCA 1EFZA 4GA8A 1ZSXA 1BHGA 3KOZA 1R3RA 2DORA 1J11A 3WQCA 3TQVA 4DRSA 1B9ZA 5FCZA 1DL3A 2OLHA 2PGWA 3PF3A 1VIWA 4LEFA 1E4MM 3MWCA 3LMZA 1F3WA 3RU8X 4LVBA 4DNHA 2J9YA 3IK4A 2EEXA 3IGUA 4AQLA 1XH0A 1EGVA 3E74A 3A6OA 4AW7A 3GDMA 4LALA 1GHSA 3VDCA 2A0NA 2OT1A 2BHZA 1JPMA 3UETA 1HO1A 4O1BA 2ZWYA 3GRIA 2B7NA 3BLOA 5T26A 3UU0A 4QNEA 3EMCA 2Z1WA 4GD0A 4IL2A 3IJ6A 5LNSA 3CUJA 1R3SA 1F07A 3U2ZA 1T41A 3O1NA 3EA3A 1DTNA 1OFPA 3LHTA 2QV5A 1G9HA 3OVRA 4MUZA 1GEQA 1W1VA 3PP7A 3ZWSA 5BXTA 5CSSA 1CGXA 1MW3A 4AD1A 4KT2A 2QJGA 1Y5VA 1S2VA 4RX0A 3POCA 4J35A 1I4NA 2A21A 3ZS4A 2OO0A 1UWIA 2J7DA 1ONXA 4QJ3B 4PL1A 2Z29A 1H0GA 2E6AA 3RMJA 4UOZA 3BOLA 5C0QA 4LFYA 3W1QA 1ML1A 3DI0A 3OJGA 1GVSA 4FLRA 1XFBA 3CH9A 2G37A 1B3WA 4QP0A 1RBAA 3W1RA 2R1MA 2HS8A 2WCAA 1I2PA 1KXHA 4L4PA 3UR8A 5CBIA 3MP5A 1V6WA 3RIKA 3O0KA 5A6MA 3WD2A 3H23A 3LBMA 3SI9A 3L4UA 2Y5SA 4A8RA 3O6CA 2X1RA 1H11A 2FVMA 1IT0A 1VFHA 1FWCC 3JS3A 5BRPA 1V93A 2DT2A 3S5SA 2NXIA 2VOTA 3NZ1A 2NXGA 3DG3A 3F03K 2R6OA 4AC1X 3MMWA 3ANUA 5FAGA 3IV3A 3M7WA 3DYOA 1Q6CA 3VZYA 4YTSA 3BLPX 1GZJA 1UD2A 3N17A 2ZZ7A 3WLRA 4GH3A 5EMJA 3KOWA 2X40A 4CN4A 3G1VA 1TV7A 3GR7A 4XD6A 4C65A 1PBGA 4QIUA 1O95A 4LSBA 3GC4A 2Y89A 1PV8A 3W37A 1VCGA 3KHJA 1RH9A 4BI6A 1UC5A 1WUEA 1Q2RA 5F2MA 4J7RA 5EY5A 4G7EA 4ZO7A 2J8TA 1O7AA 4L80A 1I2OA 2Y7DA 4FP1A 3GC2A 2ADAA 2CETA 1L2UA 5E1QA 3NGFA 2E8YA 3N9RA 5D9NA 3QKZA 4O15A 3RXZA 4FHAA 1DPMA 3IIXA 1J93A 5FJPA 2O4QA 3VGHA 4RLIA 5LA0A 3CV7A 3FA5A 3RMEA 3MS8A 2YB4A 1TRDA 1Q63A 3F5LA 1WKEA 3K2GA 4TQTA 1PTGA 5M3WA 1EKOA 3ARRA 3TNBA 4LEQA 3UY7A 3U57A 5I07A 1FA2A 3AIQA 3N2OA 1AQMA 4CN1A 4DY1A 4IFOA 3C2RA 2YW3A 2DZBA 1BVZA 1UCWA 1UP2A 1QCWA 1FWJC 3I65A 4IP4A 2G4JA 5EBAA 4CCCA 1U22A 4RE4A 4GY1A 5C70A 2XGBA 1B4EA 4XZBA 5FA5A 3HMJG 5E93A 4KCVA 1A0DA 1QK0A 2VMFA 2Y24A 3QF0A 5T8GA 4HK5A 4RCXA 2GOKA 1U2YA 3DESA 1XISA 4R9XA 3W7GA 4HNNA 4PZVA 4PBFA 3ZT6A 4QQUA 3OZYA 1GOWA 3TR2A 1RXOB 1IIGA 2I57A 1F8IA 1JDAA 3OIXA 3IK2A 1DXFA 3N73A 5JH1A 1BXBA 1P1MA 4IT1A 3VGEA 4AG0A 2OZTA 4KMQA 1M01A 5EMYA 1XLAA 1JPKA 2WNQA 1K8XA 4GC3A 4V1YA 3QY7A 4RL3A 3COTA 3VNLA 4L7ZA 3UWZA 3M0JA 4XKMA 3VA8A 1D3GA 1H61A 3UG3A 4NZ4A 1LQ0A 2HTMA 3C8FA 4FPSA 5M2FX 1FHUA 2BY3A 3DHDA 3NO1A 3LBCA 4Z2GA 1P7TB 3M6DA 4BA0A 4DLMA 1H51A 3UPBA 2I5QA 4O13A 3USZA 3W75A 4DX3A 4JKLA 1I0DA 2Z6IA 4G2DA 3AXMA 3NQGA 3MHGA 3N3TA 4N6FA 2GJXB 2UY4A 3TQ0A 3BCJA 4F0SA 4D1IA 3WK0A 2WM0A 1B1YA 3RFAA 5D8WA 4WGXA 5DQPA 4W7WA 1XRFA 1C93A 2A2IA 4JNMA 2QCDA 2CBJA 3UXIA 4GZ7A 2ALRA 4HOZA 3CUXA 2ZVIA 5I0DA 4RDZA 5I06A 4UMCA 2VC7A 3UWEA 2A3EA 4JQ3A 4MG4A 4Q8QA 1ENUA 4PBGA 4S1FA 4B5SA 4DF2A 3S5OA 3PUDA 3AS2A 1OFBA 4ZQOA 1NOFA 1UYQA 1AL7A 3CM4A 4GUGA 3L23A 3FXGA 1OCBA 3CAKA 1KV5A 3PN8A 2H6RA 1R0MA 2RH9A 3FFSA 5DFAA 2Z6JA 3QOKA 1HJWA 3KL3A 3SCSA 3M07A 2BTMA 1RPXA 1PXGA 1TYGA 1E1CA 2VQTA 4PMQA 1VR6A 3LZ5A 4YIWA 1HQTA 2WQPA 5BWFA 4AHQA 3PWIA 2NQHA 4XV0A 3SEPA 3W7MA 3PFMA 2Z1SA 3RM8A 2QUVA 1TELA 4O50A 4UIOA 5HDRA 1EWEA 2HNHA 4EXAA 3EX6A 1GG1A 1H3GA 4CQCA 3KOFA 3OHIA 2C3ZA 3B05A 2VZUA 3PWGA 3B8VA 2Y7FA 3RPTA 1KBJA 4L4LA 5F4SA 4POCA 3CB3A 1KTBA 5HQEA 1I45A 1Q4NX 3WQ6A 2PE4A 3C0SA 3CZ8A 1H49A 5L6UA 3GFZA 3JZUA 1V0NA 1V3LA 3TN5A 2HE8A 4UC5A 2ZZ5A 2AOSA 2QJHA 4PMZA 1G6CA 4O54A 4Q8NA 3UCCA 3W7OA 1I1WA 2PWEA 2XHYA 4US5A 2OVLA 3G0SA 2ATMA 3AS1A 1HX0A 4YMZA 2YFOA 2A3CA 5FACA 4JY9A 4DJFC 4I6VA 4PSPA 3GFYA 1I2RA 3LV5A 1EQCA 3BPWA 4GGBA 1V03A 2C14A 4I9AA 3W00A 3GH4A 1E6XM 2IPJA 1LLWA 3CC1A 3UD6A 2C16A 1XR2A 4QLLA 1PE1A 3IJDA 3RNDA 1S46A 2R91A 4PEKA 5CJNA 1CXHA 1XS2A 3UA4A 4B5WA 3B9EA 2XDFA 3VABA 1FFRA 3DIPA 1KR0A 1VD6A 4FLOA 2W27A 2XPKA 3LS9A 1LRQA 1IIHA 1EXPA 2F6UA 2WCSA 4JTFA 2JEPA 5CXPA 2B81A 4WJ8A 1XFCA 3WMLA 4L65A 4IX0A 2FB2A 2DQWA 4LUIA 4WDTA 3XINA 1J0HA 2WCGA 4AYGA 5H1WA 5XIMA 5LA1A 1ITUA 1G7VA 1W8GA 3MYPA 3UG5A 2PSNA 2HQAA 3W2LA 4HHPA 4DIAA 3AAMA 6ALDA 2RJHA 1N2VA 4PB3A 1ONRA 2V5JA 5EB8A 2QMJA 3G1YA 2ZBTA 1KR1A 4DO5A 4KGLA 3I6EA 2O55A 1TE6A 1JRBA 2KZHA 4LPCA 5FJOA 3CHDA 2W0UA 3WDQA 4FEZA 1P4CA 2P3EA 2BG5A 2QV4A 4LVAA 1TPDA 1ESWA 1NWTA 2PDCA 1YMYA 1BTCA 1FBAA 4K6AA 4OWGA 2CLKA 3GFXA 4O12A 1M65A 3VNKA 1UWQA 1K7XA 2FGLA 4RNFA 1GORA 1VFFA 3LK6A 4J3ZA 5FESA 2PDIA 1VEMA 5IHRA 1EJXC 2FZDA 3WN6A 1XQKA 4BQ3A 1JULA 3ORWA 2BODX 1ODZA 3MQTA 2HK1A 1AZ1A 1CTNA 2BHUA 2CHNA 3ITXA 4CKQA 2VGIA 3ZR4A 4NZ1A 3OG3A 1WPCA 3HPAA 1A5UA 1UIPA 5HR7A 4ZL1A 4Z2KA 3P62A 3ABZA 1FWBC 1XLDA 4JZ5A 3U2EA 1H41A 3TW6A 4FX8A 1G4SA 4D6CA 2WBGA 3CU2A 3LGGA 3A22A 1XBXA 2VOMA 3LCWA 3QMTA 4DWDA 5C9ZA 3REQA 1ODUA 2HRWA 3EWCA 1AQ0A 4AZ5A 2PD9A 3NQ2A 3C2VA 1EPVA 3KTSA 3RYSA 1KBLA 2QCFA 1NWSA 1JD7A 4ACYA 3RHGA 2VCAA 4I7VA 4GLEA 1QOXA 3PHAA 1S2CA 4YVVA 1W1A1 2I5IA 3BWWA 4NRSA 3QGKC 1F6PA 2VZVA 3N6QA 1BQGA 1V6TA 1J01A 1QK2A 2WWCA 5AC8A 1MEHA 3CGTA 3SZ8A 2DIEA 3BW4A 3GNNA 1J18A 1CBGA 3E2RA 1TPEA 4RJEA 4MPKA 3AALA 1RD5A 4GC4A 4RPQA 1YPXA 3EEZA 2GJXA 4GRSA 3VGGA 4B3KA 1V6VA 4HNCA 1W0MA 2QZRA 1UKOA 4BS0A 4EOUA 2WSKA 1LYXA 1MZHA 2W62A 3BGGA 3CZLA 1RQHA 4N0RA 1KM2A 3SCWA 1ISVA 3OGRA 3EOOA 1EXBA 3EOEA 4HPXA 3GUGA 1KRBC 4GUFA 2I56A 3TYAA 2PWVA 5A8PA 2ZXQA 4GG9A 4LS1A 4J5NA 2R24A 1RA0A 3ZM8A 2PC8A 2YDQA 3V5CA 2Z1XA 1U1HA 1EEXA 2X7VA 2I9EA 4J2MA 3LZ3A 4TV6A 4JIPA 1C8XA 1BXNA 1FWEC 1QWGA 3T81A 1H7XA 5CG7A 1OF8A 2I9UA 2E1WA 1C9WA 4PMYA 1IXOA 1ZS2A 3RX3A 2FHBA 3IGSA 2P8CA 3LD5A 3G0XA 1GW9A 3VDGA 1XPGA 1XH1A 5DCBA 2JEQA 4FNRA 1HGWA 1W3JA 1P0KA 3CEUA 3ARXA 3R25A 5CPTA 2ZUWA 1ISXA 4HU0A 1A49A 3V18A 2E7FA 4D9PA 5HR6A 2XIOA 1PKNA 1ZQ5A 2DIKA 3IIPA 3MUZ1 3T8QA 1ZPTA 3E2QA 2HNEA 3W83A 2BY2A 3R8GA 2VR5A 2MUCA 1MDRA 2CEQA 3OQEA 1LL4A 1VHCA 2QEZA 1VLIA 1CWYA 5L9FA 4YXGA 5G2IA 4UTLA 1I2NA 2DT0A 1HVXA 3KRZA 3CYVA 1NAL1 3U2CA 3P81A 2IQTA 2YL8A 1J4EA 3T7VA 3QQWA 4US6A 1K7EA 4PL2A 2Y8KA 3IVTA 3CQIA 1Z69A 4QROA 2OR2A 2C0HA 5EPDA 4ERIA 3AI0A 3W0KA 4U2YA 2VX5A 5F1VA 2YDSA 3GNXA 2QGYA 3F2DA 5HNRA 4PUUA 3G3MA 5FI8A 2W67A 5DXXA 3G77A 3DBNA 2PI6A 1HVQA 4WY0B 5U4NA 1GOMA 4HU8A 1O1HA 3B97A 1OT1A 2ACUA 1R7OA 4B5NA 4N2YA 3OQ8A 4OQVA 4LAUA 3QQ0A 2V8ZA 2A4AA 4FSAA 3MA8A 1WDWA 4J40A 3T8LA 1LG2A 4LV9A 2W91A 3SGGA 3F4NA 1XBVA 1UOZA 5JXQA 2V3GA 2YBVA 2WANA 1ZJAA 3T2OA 4JFSA 3MBDA 3QBUA 2WW5A 2REQB 2OYMA 4EIVA 2VENA 3W85A 4JGDA 1X1NA 4NX5A 1N8FA 3T55A 5I5RA 2VRQA 2VX6A 2H8ZA 1M41A 3U7VA 2A7RA 1B54A 2GQ9A 3V0TA 4H83A 3GIPA 4ZR8A 3UR2A 3ALFA 1U5JA 1QNVA 5CPLA 3QGVA 1YTKA 3AISA 1MYRA 3KUMA 4U4MA 2HS6A 2YSWA 4AF0A 3WYZA 1TVLA 5G2WA 3VK5A 3LBOA 2A3HA 4I9JA 2ATSA 3V4BA 4ALDA 2NUWA 4ZB0A 1SFSA 3LM7A 4O0ZA 4IIFA 4F2BA 2PC4A 1BYAA 3I68A 3NZGA 1NY1A 2NX1A 3AXKA 3NL3A 1TJ0A 3M0KA 5D9MA 3H2CA 2X1IA 4JL2A 4W4QA 3T0DA 3DFYA 1P6WA 5A6LA 1OD8A 1TIWA 6A3HA 1BYDA 3S6TA 4E2OA 3N1AA 1XIIA 3VKCA 4YVXA 5AHFA 3RM9A 3ITOA 3STFA 1OIFA 4S3AA 3VIFA 2FFCA 3ONCA 1E4NA 3BANA 1TPVA 2NLYA 2ZA3A 4KGJA 2WVVA 3MCMA 3BARA 3TW7A 1MWOA 1BF2A 2AL2B 1OYCA 5ECVA 2D2HA 2CYGA 3W7CA 4MHBA 2NVAA 2VUYA 3PJXA 4AIBA 4JTRA 1QTWA 1PDZA 1LOSA 3G22A 4ZQMA 1KA9F 1PUDA 5LA2A 3MVTA 3QM3A 1XLBA 3LV6A 5AYZA 1OF6A 1U5HA 2ONEA 4MB5A 3ZT5A 3B0VC 1A50A 4K37A 3UF9A 4JFTA 4GCXA 3C2YA 3MYOA 5BXPA 3L12A 3VIMA 1V3IA 1HL2A 1E9IA 3N18A 4HU3A 3L4YA 1XYBA 2G4FA 1C7SA 5CAHA 4RE0A 1TJRA 1GNXA 3KOXA 3GVGA 5DF0A 5T91A 3BV4A 3RU6A 4FF5A 4E3TA 1EOMA 2OSWA 4A8NA 5CKSA 3W7EA 1XGZA 4AISA 4M6VA 4HBKA 3ITCA 3UZXA 1V02E 3NURA 1XLLA 4J3UA 1XBYA 4H2CA 1QPOA 4L9YA 4O17A 4ZODA 3BSMA 1A5AA 1L6SA 2Z1KA 1GG0A 2A1YA 1IZKA 3AHYA 1XICA 3PAJA 5FJIA 3TONA 1HG3A 1Q6RA 1OVDA 3TNOA 2VWTA 3CNYA 1ZNNA 1EZ2A 3PZTA 4QG8A 2J7BA 4X9YA 4NZ3A 2ESCA 4JPGA 3R8HA 3NO3A 2ZRYA 3I4EA 2EKGA 1ICPA 4NXKA 5H6HA 1HKMA 5CGTA 5D9PA 3T07A 1DWJM 1P0EA 3MP3A 3M0HA 3ES7A 2RGMA 2WKGA 4ZVJA 2ZRXA 2O92A 1F3EA 1XINA 1Q6DA 1KFEA 2I5GA 4F8XA 4QJ1A 3EB4A 3P3BA 2OZ8A 3CHCA 1KB3A 3FLUA 4AIUA 2BGQA 2UZ9A 3WF0A 4KWVA 1CXEA 4UNLA 4PEEA 3T0BA 1J0IA 1M7JA 3RUBL 3MI6A 3S9ZA 3HFTA 1P43A 3I3DA 3RLGA 2VC6A 4FNPA 5A1AA 3ZFHA 2B31A 1AMKA 1SJBA 1L6YA 2QCEA 1ZJIA 3AXXA 1VFOA 3W7IA 4B92A 4IFKA 1EBGA 2BXYA 2Z2AA 4CQDA 3QZ6A 1AW2A 2FPTA 4OV9A 4X0NA 4DUWA 4OU1A 5K9XA 3H8AA 3PJTA 3N2XA 2ZE3A 3P5YA 2PWGA 4WX2A 1GJPA 1C7TA 5G1TA 3UWWA 3QR3A 4FALA 2CKRA 4IWWA 4Q7BA 3L7RA 4LBSA 4JHOA 1QNOA 3KW3A 6CGTA 4YN5A 3QTPA 1GQKA 2OLSA 3AXIA 1BWLA 2WOQA 4Q32A 3PZOA 1QPKA 2VDGA 1AH0A 4I8YA 3IRDA 3QHMA 2X2GA 4OTKA 1W91A 3B4YA 4CNPA 4YTRA 1VFMA 1HUVA 3GVVA 1E9ZB 1JCXA 1FHDA 4JTQA 2WHMA 1OEPA 3S2LA 1MW1A 2FZMA 1UKQA 2VR4A 2BP1A 2G0WA 2OOGA 4LV4A 2G5WA 1EIXA 1VGAA 1WDPA 5EBUA 2DFAA 5D02A 3RJXA 4BZYA 3PG8A 4U33A 4PRWA 1A5OC 1ZY9A 2Y7EA 4J3SA 4AIEA 1POJA 3SY1A 2Z1VA 2V3DA 3GB6A 4EE9A 3TROA 1BLIA 3MCOA 1IWAA 3RAOA 3KCJA 2HROA 2RGLA 3G3DA 1WV2A 4QDMA 2BNJA 1E55A 3W22A 3VOGA 2FMOA 2WBKA 4D72A 3VIGA 2VFHA 3WD3A 1GOOA 2A7PA 1B2YA 3AZTA 3GTFA 1I60A 4W88A 4HHMA 3AJXA 4G1NA 3HG3A 1R5YA 4LCRA 1KO0A 2GJRA 3APGA 4KBXA 1T0OA 1TB3A 1TPH1 3OVQA 4KWWA 3T1GA 3FYPA 3NQ8A 1LRTA 1UZ1A 1W1TA 3M5XA 3O7UA 2CHRA 1JL8A 2DJLA 3TOPA 4UMBA 2RDTA 2Y5EA 3AXHA 4PUKA 4XUYA 3R12A 4GQBA 4JQ4A 3SRDA 3SSZA 1KKRA 4D6JA 1X6NA 4QBXA 1DHPA 4EAYA 4P8WA 4YWIA 3FGCA 4UTMA 4AY8A 1GVOA 2YGYA 5DMLA 3ABQA 1O12A 2QGHA 4ONVA 3EWYA 3VU2A 4NUWA 2TYSA 4A21A 3NQDA 3H26A 1H50A 1LUCA 2NX9A 3VD7A 2PDYA 1G67A 3TJXA 1VJSA 3TJIA 4UNIA 5FAJA 4C6OA 5I3IA 2R1KA 2XINA 1B3XA 3QV6A 2CLIA 3JW7A 1H1YA 3WH9A 4X9SA 1KM3A 4L5ZA 3OO2A 2Q02A 5FKYA 1E9YB 3HF3A 4FB7A 2NQLA 4CD8A 3NZQA 3WNOA 2UY3A 4D6GA 4GI8A 4IMEA 3WNMA 1B3OA 5D04C 4Y2WA 7ENLA 3VGDA 1YIXA 5K7JA 2DSKA 4GUJA 4LUJA 1XG4A 3IIZA 4RZ4A 3CUZA 1MEWA 2WZHA 2DGAA 3SCOA 1H7PA 4QTGA 2WNNA 1GOKA 4FA3A 4LUYA 3XISA 2CLHA 1KM6A 2RDWA 3AUJA 3FOKA 5LNUA 1H7RA 5HA7A 4YPJA 4S2BA 3D46A 5D09A 4XTDA 4PC8A 4QQ3A 3DYMA 4FOJA 4LAKA 3PZNA 1IEVA 5KSWA 3GU2A 5D33A 1ONEA 1IEWA 4QGCA 4E38A 3W07A 4HJFA 3ARPA 4U3AA 3M0MA 4ZXOA 3MSYA 4NAEB 4TMBA 1X8CA 3TC3A 3OA5A 4WDWA 1ONWA 3KZPA 1VYRA 1TR1A 3AYTA 4PE8A 3TLQA 1V79A 1XL9A 2Q71A 3P84A 4LGXA 1Z3NA 1EL3A 3QLLA 3C0JA 4A8IA 5CPMA 1EWDA 4DJEC 1BRLB 3MB9A 1AH3A 3W2MA 4XBKA 3W28A 4F0HA 2G97A 4NXSA 3GU9A 1XGEA 1S5MA 3W6YA 1E4IA 4ZGYA 1TIMA 2BX7A 3NL5A 3PBWA 3DGRA 1GONA 1W8SA 3C0QA 2GGJA 5M1TA 2W3ZA 2VGBA 5HJYA 5CZKA 1XH2A 3GVWA 4HSNA 4AZHA 4MB4A 4WJXA 4KRZA 2YJQA 1W5NA 3MP4A 4DJDA 1GPFA 5A8OA 3I7RA 1J96A 1XIDA 3T9PA 3TMQA 2QULA 5H2ZA 1EYWA 2P10A 4H9ZA 1LQAA 3WLSA 4M6UA 2O9OA 3PAOA 4WEVX 3NYDA 2P76A 2XVGA 2DDXA 4BQ2A 1WZMA 1XLEA 4C1NB 3OPSA 2Y61A 3FSTA 1UD8A 4UTWA 2XN1A 3TN6A 1ZBCA 3HQOA 2PD5A 4Y7EA 4HK6A 3WKZA 4DHGA 4KCUA 3B06A 1V7AA 4MNJA 2ISDA 4INFA 3N34A 4H7VA 4JIEA 4LF2A 9CGTA 4LUTB 1TR9A 4K1GA 2G3IA 3BMXA 2EAWA 1OD0A 2OKOA 4IIHA 3L5LA 2E68A 4W85A 3AHZA 4LANA 3TX9A 4JIHA 5D4YA 1VEPA 2WMFA 3CO8A 2FHFA 4S3DA 3GNRA 2BVWA 4GIEA 4W7UA 4DEFA 3L65A 2E6FA 4QG6A 2D2JA 3DFTA 4MVAA 3A3HA 4Q8WA 1PKMA 3LXBA 3QC3A 3W29A 3GTXA 4J1OA 2PTYA 1FOBA 4IMFA 1SFLA 1IEIA 2HWGA 3LNMA 3CJPA 3UBPC 2PDXA 1VENA 2XYLA 7PTDA 3NQ7A 3ELFA 2V0TA 4WZHA 7ODCA 3SCPA 4PUWA 4JDBA 7REQB 4KESA 1DE5A 4UTIA 4DELA 1PSCA 4WR3A 1IQ8A 4CQ9A 1JUEA 4CNUA 5HUPA 1EZWA 5BYWA 3SSJA 3E49A 5AHNA 1QBBA 3Q37A 1UG6A 3DU0A 3AMCA 4BI5A 3DECA 4DBDA 4CU8A 4U2ZA 2G95A 4F0LA 3PTDA 2ZXBA 2VFDA 3IVSA 4NASA 2J7CA 1MUMA 4K8EA 4YU1A 3W7PA 4B2DA 4K38A 5D2WA 4ZTYA 4Z17A 2FPVA 1FCUA 1B3YA 2EPHA 3FXYA 3UZWA 3H4XA 1WKYA 2EJ1A 2ZX9A 1L8NA 1X8FA 3MV11 3FHQA 3EX1A 3ZVIA 3NL6A 1GVYA 1QT1A 2HJPA 3EPNA 3N9KA 4IQJA 5ABEA 4L9XA 4BQ5A 5JIWA 4FAMA 4JR5A 3WL0A 4UFIA 4KEZA 4OHQA 4S3EA 2AKZA 2XSXA 2IKIA 4A29A 4ZOEA 5AHLA 3USBA 5DMMA 2YL6A 3IGXA 3QSTA 4DAIA 3ANYA 3INPA 4MY1A 4HA4A 3OLEA 3W86A 3WQWA 3ZOAA 3FJ4A 1GUVA 3DDMA 2VFFA 4UZUA 3KP1A 2GYIA 3LYEA 2QPSA 1JDFA 1SMAA 1E72M 3PPGA 3WFZA 2XSBA 4WJEA 4C6BA 1SPQA 3LHYA 4NIRA 3C86A 4MUPA 1ZJBA 2C18A 1QO5A 3WK1A 3H4GA 3VYLA 2X0YA 3KEHA 1E71M 1R7AA 3T08A 3A4AA 3LRLA 5BOEA 4UB9A 3GXIA 4ZFMA 2WZEA 4OZOA 2BS9A 5AB3A 3FW6A 1TTQA 2DEPA 2OODA 1VH7A 1VPXA 3F5KA 3QYSA 1KGXA 3NZRA 3H70A 3SADA 1W3LA 1SZRA 4GXWA 1WE5A 1E40A 2QR6A 2C91A 5JMUA 3TMLA 3PZVA 4N4PA 2XIIA 5CH9A 4GJJA 2DZWA 3BLEA 5FJUA 3TC6A 2PF0A 2NSOA 1RSCA 3NDOA 4G7FA 2J9XA 3JVAA 3JUGA 3K8KA 2Z25A 4GMEA 2ALDA 3DFPA 4AHOA 4UQDA 5D2VA 4G1KA 4UQBA 5HOSA 1SJCA 4NP7A 4Y9AA 1NFPA 3V3WA 1LBFA 2V5DA 5TQLA 3N4FA 2QUUA 1DHKA 1GTHA 1QR7A 1F61A 1M9HA 3MU7A 3HN3A 4IM4A 2JKEA 1MXSA 3NR0A 3NSNA 2INEA 4I9TA 1TV8A 4PCNA 5DCDA 3WQOA 4BCEA 3ZSTA 4HMEA 1EC9A 3MUIA 3UZZA 4B5TA 4Q4MA 2DW6A 1GVIA 5HWJA 4W84A 1G7UA 1XIJA 1DWIM 2V6AA 4W8LA 3CIVA 1NU5A 3LNPA 4PA8A 1UASA 1RR2A 3NPWA 1L6FA 1KRCC 3SW6A 2V5KA 3SFKA 2WM1A 4MLRA 4ES4A 3UPMA 1KM1A 3SGZA 2ABBA 1VF8A 1T8XA 1OT2A 2EO7A 1VYSX 4FS9A 3Q67A 1DKWA 3C4UA 2XFYA 2Z28A 3EEGA 4UTTA 1BXCA 3GNOA 2POTA 3V5OA 4XD4A 4HNTA 2ZUNA 3NQVA 3AO0A 1JQXA 3WDRA 1S2WA 2OZ0A 4WGHA 1D7FA 3MO4A 3T4WA 1I8JA 1E5JA 2V5LA 1O1ZA 1M03A 3DHPA 3FV9A 1PX3A 1H0IA 2Z0IA 2NW0A 4IMAA 2BSLA 4FMVA 2F61A 1UR3M 2WZTA 3P82A 3I3EA 3S6OA 3P93A 1VBUA 1FRBA 4RKAA 1RP9A 3PZMA 2QIIA 1OZMA 1C3FA 3FEQA 2Z26A 1QXLA 2DZUA 1KXQA 3OLDA 1NVMA 3E5PA 4RK8A 5D30A 5I3FA 5GJMA 2D1ZA 4FIQA 4W93A 4LYQA 3EKZA 3DFSA 3R0KA 4A6GA 1CXIA 3NXFA 4NAEA 3TAKA 3MSRA 3KCLA 4M7SA 3MUXA 3O07A 3M0ZA 4RZBA 3OLIA 1DOSA 1W9XA 2BXVA 4LBUA 2YA0A 1UMYA 3D5HA 3W53A 1XLKA 5J04A 5HQLA 3R5EA 3UR5A 4H04A 4D6EA 2ZCGA 3WIJA 3VZXA 3MC5A 4M24A 3WUEA 1EHAA 3TQKA 1UD5A 5C2XA 3F2CA 2Y85A 1TMLA 4REQA 2C79A 1A3HA 4E5TA 4PCSA 1MNZA 2XIJA 3SFWA 2PU0A 2DZTA 3EKGA 1UKPA 1VFLA 5JQ9A 1YXYA 1W9PA 2VT0A 3QRHA 1KWGA 1LQ2A 3SGUA 1HJQA 1CIUA 5FL1A 3W4RA 4DUVA 4EP8C 3BZJA 1O6IA 1JI2A 3BLFA 4TX8A 3CS2A 2Y2WA 4NI3A 3IJLA 3QR1A 1QDSA 3WD1A 1B31A 1AL8A 5ABTA 2GFTA 5E6YA 1REQB 4C6QA 5C9RA 4JCLA 3TR9A 2V82A 3E0LA 1NP2A 3S5ZA 1OX4A 2D23A 2CFFA 4LUTA 4GFSA 4D6IA 1XQLA 2ZZ6A 2HPMA 1W1IE 3MJYA 1AZ2A 1UUQA 1JZ6A 3FVDA 3QLDA 3S46A 2OZ3A 4ZE4A 4DO6A 4NYUA 3PNUA 4JN8A 3WJWA 3THCA 4PODA 2IQDA 2J78A 1WP6A 3M6YA 3B0PA 4I5XA 2QLYA 1UR9A 2A3AA 6ENLA 3ENLA 3EWBX 3TTEA 4B3ZA 4HP5A 1XM3A 3UESA 4J3WA 1E73M 2WMKA 4XO6A 1O68A 3MHFA 4HCHA 1IT8A 3CXOA 3VDBA 4ADUA 1JZ8A 3OVPA 3DFNA 1B5TA 1X38A 4JHMA 3VI2A 1QW8A 3OGVA 1KRAC 3UJRA 5CJ5A 1E0VA 1PWMA 1DE6A 5C71A 1GPWA 1Q6OA 3HIJA 1TZ9A 1UA7A 4OBSA 2J13A 3OHMB 3FA4A