2F38A

Crystal structure of prostaglandin f synathase containing bimatoprost
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
319
structure length
319
Chain Sequence
b'QQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Prostaglandin F2alpha formation from prostaglandin H2 by prostaglandin F synthase (PGFS): crystal structure of PGFS containing bimatoprost.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 115
structure length 319
sequence length 319
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2005-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2f38A00
3EAUA 4ICCX 4PRRA 1PYFA 1UR3M 2FZ8A 2PEVA 4GA8A 1MRQA 4IGSA 1T40A 4R9OA 1R38A 1Q5MA 4XZMX 4XO6A 2ACRA 2PDFA 4PR4A 3P2VA 4GCAA 4LBSA 1HQTA 4QBXA 4FALA 4LAZA 4DBWA 1YE6A 4WDUA 2NVCA 2HDJA 3LENA 3T42A 2R24A 2HVOA 1AFSA 1MZRA 3WBYA 4JTCA 2C91A 2PZNA 4JTAA 1Q13A 5JH2A 4PUWA 2PDUA 4GACA 1ZQ5A 3GHTA 1EKOA 2FZBA 3UGRA 1JEZA 4WDWA 4FZIA 3V35A 2HE8A 4YVPA 3N6QA 3CASA 4JQ3A 2ACQA 4ZFCA 2IPJA 4DBSA 5LIYX 2PDIA 2IPGA 3V36A 5KETA 4EXAA 2BGSA 2IKGA 3FX4A 3ONCA 3M4HA 1YE4A 3WG6A 4WGHA 5JH1A 4EXBA 3RX2A 5M2FX 1EF3A 4Q3MA 5HNTA 2PDQA 3CMFA 1Z3NA 3CV7A 3UG8A 1LQAA 2PDCA 2IKIA 3BCJA 3CV6A 3UYIA 1X98A 4JQAA 4YU1A 3UZZA 3G1RA 3LEPA 2QXWA 3R6IA 3GUGA 3LUTA 1GVEA 2PDJA 2IKHA 4PMJA 4PUUA 1RY8A 3Q67A 2DUZA 2FVLA 2ACSA 3O0KA 3UP8A 3KRBA 3GHUA 4YVVA 3EB4A 3VXGA 4LAUA 2INEA 4IJCA 5LIKX 4XVDA 3R94A 3UZYA 4F40A 1S1PA 4JIHA 2J8TA 3LN3A 2WZTA 4HBKA 2F38A 3V0SA 1J96A 1HW6A 2INZA 2IPWA 2PD9A 4XZNX 3M64A 4XK2A 4LB3A 2DUXA 2PDKA 1C9WA 4WDTA 3G5EA 3LBOA 5C7HA 3EB3A 4YVXA 2PDXA 3LQGA 2FGBA 3C3UA 1PZ0A 3RX4A 4IJRA 2I17A 3MB9A 2A79A 2FZ9A 1EL3A 2NVDA 2IQ0A 3H4GA 3MC5A 2IKJA 3LNMA 5LIXX 4AUBA 3R58A 4JQ1A 5DANA 4LB4A 4L1XA 3DOPA 3DN5A 3NTYA 4PRTA 4FAMA 1X97A 2PD5A 2IQDA 2PDGA 4G5DA 1AZ2A 5LIUX 3UWEA 3R8HA 2F2KA 3B3DA 3CAQA 2HEJA 4WDXA 1EXBA 4JIIX 1XF0A 4XO7A 1PWLA 1S2AA 4H7CA 5LIWX 4Q7BA 2ALRA 3LD5A 4JQ4A 4H8NA 1ZSXA 4LBRA 4XZLX 3RX3A 3R7MA 1Z9AA 5HA7A 1T41A 2HV5A 2BP1A 3WBWA 3WBXA 3WCZA 1VBJA 1XJBA 2ACUA 1S1RA 5HNUA 2IPFA 4NKCA 4GQGA 1A80A 2PDHA 1QRQA 2PDLA 2HVNA 4MHBA 1ZGDA 4XAPA 4DZ5A 2PDNA 3UZWA 3COTA 3O3RA 1K8CA 2P5NA 4JTRA 4JTQA 4WRHA 4RPQA 1AH3A 4GIEA 3U2CA 3V0TA 4OTKA 3M0IA 1IHIA 3GHSA 3S3GA 2ISFA 3LQLA 1RALA 1SM9A 1AH4A 4I5XA 3R43A 4HMNA 1Z8AA 3Q65A 2AGTA 1PWMA 1IEIA 2R9RA 4QX4A 3BUVA 3UFYA 3H7RA 1LWIA 1M9HA 1FRBA 4GABA 3QKZA 1MI3A 2VDGA 1AZ1A 4JQ2A 3ERPA 2CLPA 3D3FA 4XZIA 3F7JA 5AZ0A 1YNPA 5AZ1A 1ZUAX 2PF8A 4QR6A 2PDPA 1S2CA 1XGDA 1QWKA 2PDMA 3UZXA 1Z89A 2I16A 2PDYA 3R8GA 3ONBA 2PDWA 3CAVA 4ASTA 3BURA 1X96A 2WZMA 4YS1A 3BV7A 2DV0A 4XZHA 1OG6A 4L1WA 1AH0A 3GHRA 2PDBA 3H7UA 1ADSA 3FJNA 2FZDA 3N2TA 4XVEA 4DBUA 4WEVX 4GQ0A 2IS7A 1YNQA 1US0A 2HE5A 2PFHA 1RY0A 3LZ3A 2BGQA 4JIRA 3LZ5A 4QXIA 1VP5A 4JTDA 1PZ1A 4FA3A 3V0UA
chains in the Genus database with same CATH superfamily
2QV4A 3F5KA 4GYPA 3KL0A 1PYFA 1IWAA 2BV9A 4O15A 3U5YA 1TKKA 1E51A 1FBAA 3GTIA 2J7BA 2P0OA 1WE5A 5GNXA 4Q22A 1R38A 2MNRA 4HNCA 4DUXA 3OHMB 1PBGA 4XZMX 1I60A 4ALDA 3DKLA 3MHGA 3VD4A 1FXQA 3NL3A 5CJ5A 3MV11 1HO4A 7REQA 4JNZA 4ZR8A 3FLUA 4PFHA 4RXGA 1JUKA 4HOZA 3MO7A 2BB0A 1QWGA 5F1UA 1IQ8A 3GO2A 1A5OC 1W1B1 2XGIA 1MW2A 3P82A 3FJ4A 1VPQA 3G24A 3BAJA 4WDUA 2RUSA 3BLEA 3EEZA 4H01A 2QYGA 1TMQA 3SQSA 2J79A 3DG3A 2G0WA 2OX1A 1TO3A 2FTWA 1H7NA 1KKRA 1WDQA 3PTKA 1MRAA 2ZWYA 3NQMA 4ZEPA 3DC8A 3VNMA 4XB3A 2VR5A 3GVQA 3BLIA 4K8HA 2VGBA 1P6BA 7TAAA 5ENLA 2P1FA 2FGZA 5HWJA 2PMQA 5BU9A 4DZIA 3WELA 1R87A 1EEXA 3I6TA 3LXAA 4B9YA 4JZ5A 1A5MC 3P62A 3PBVA 3D5HA 3MVTA 3QJAA 4PN2A 3RPTA 1WDPA 3P84A 1KCKA 3E0VA 4NRRA 1UZDA 1X98A 3MJMA 2DSWA 3G8EA 4GPNA 4Y7EA 4KRTA 4X22A 4PMQA 3VMPA 1BSLA 4S3KA 3EXTA 1QDSA 3GXFA 1J0ZA 4WIWA 4CU8A 3W07A 3TXVA 3UCQA 1XX1A 2PTYA 4EKJA 1NWRA 2D0GA 4G6CA 1RD5A 4DXKA 1L9WA 4OE7A 1OX6A 1Q63A 1YW1A 1TR1A 1XSIA 3WK1A 4CN1A 1K4HA 1L8NA 4CQCA 1SMAA 3CWNA 3S2JA 1LOQA 3TK7A 2F7FA 1IIGA 4C5YA 3EX1A 1FH9A 3W71A 1YLVA 3LRLA 1M03A 2EAWA 4YPJA 3W7GA 4XZNX 3I65A 4KW2A 4RPPA 1OFAA 3GU9A 4GQQA 4H8UA 3IGXA 5DXXA 1NOUA 3TJ4A 1VEMA 3OLEA 3USBA 3LYEA 3AMDA 2PRHA 3AFBA 4C6FA 4AVOA 2BTMA 1ZENA 1GPFA 3G22A 3KBSA 3DDMA 4B15A 4B5XA 1OWQA 2H9AB 1EO7A 1EP2A 1ODUA 5FCZA 1DWIM 1GVSA 2BHZA 3WQDA 2ZADA 4KETA 1TJ0A 2VQTA 4QISA 5I3JA 3VNJA 3IAQA 3W53A 2W4XA 2NX9A 3VGGA 4US5A 1XUZA 4HPGA 3A4XA 5LNWA 5CSUA 3NTYA 2X1SA 1F07A 4GJJA 2PDGA 4O0KA 5A8OA 4G5DA 3WDIA 1XGZA 4WDXA 3WY1A 2QJIA 1M53A 3DBPA 3W25A 2GJRA 1Z41A 2ZVIA 3B9OA 3LHYA 3MUAA 4RZ4A 1JPKA 3QHOA 5BMXA 1GVRA 3FVDA 2VRQA 1VC4A 2A7PA 4HYWA 2QS8A 5FJUA 4AZ5A 1E0XA 1IXQA 4EWJA 3W1AA 2WSKA 3PSWA 4I90A 1XDMA 2JBMA 5DFAA 2CIPA 3CO4A 5I3DA 4YYCA 3W24A 3W72A 1KRCC 3MYOA 3JUGA 2D3NA 1S1RA 4KBXA 1EP1A 2WC3A 1D9EA 1TPEA 3QR3A 3RF9A 3NZGA 4J2PA 2J47A 3QPZA 1XIGA 3NQAA 1J12A 1H62A 2HVNA 2WVVA 3E74A 3BQ5A 1XLBA 2PDNA 1J2WA 3Q2DA 1B4EA 4U4MA 1ZU8A 4QDPA 1W3HA 2AL2B 4N6FA 5CC5A 1FHLA 3QV6A 1Q8JA 3OYZA 5DCEA 2XN2A 3TR2A 4EF8A 2J27A 2J9ZA 5E93A 3FSTA 3KS6A 4HMNA 1E9YB 1J01A 2ZRUA 3Q65A 4ZVJA 5XINA 3TONA 3UXAA 7REQB 3S8HA 3B9EA 3SUUA 3N13A 3UWQA 3F2BA 1XRTA 3OVQA 1O94A 1UUMA 4GVIA 1M9HA 1OFBA 1WXYA 4JY9A 3BO9A 4H1ZA 4IP4A 4D1IA 2WZEA 4JICA 1U83A 2C13A 3RJYA 1OFQA 1IV8A 1L6SA 1GTHA 3S47A 2RGLA 4I9TA 4OU1A 3RRXA 1XGDA 1VHNA 4QE5A 3NGJA 3NO5A 1AD4A 2XVNA 3CL7A 3KE0A 3U57A 1GZGA 1B5TA 1E40A 3QY8A 3VDGA 4ZXLA 3WQPA 5AHEA 4NZCA 2NX3A 1OIFA 5JU6A 4ACYA 3LHUA 3MT1A 2RDTA 1R46A 3Q94A 1EJ7L 4IUOA 4RE2A 4WGXA 4ZO6A 4PE8A 2D20A 5HXMA 5DF0A 2ZVRA 2QUMA 3QV8A 3RHGA 3TUUA 4MWAA 2HXTA 2C16A 3GB6A 3M0LA 5J5RA 3CLWA 4AX7A 2Z4GA 5I7GA 1TREA 1TVPA 3KDOA 4P7RA 5IM51 3N25A 5G2HA 3B9AA 2D0HA 3II1A 1JD7A 5A8GA 1AMYA 3LERA 1KWKA 3QSTA 4UQDA 4GOAA 1Y5WA 1CGYA 3TW6A 7ENLA 1QNVA 1O1HA 2J7HA 4PULA 3WSUA 3LENA 3GDMA 3T7VA 2E8YA 1TX0A 3N17A 2Y62A 3UWYA 3VDCA 1RR2A 3VX1A 1Q6QA 1T8QA 3ZVHB 4BWLA 4KGLA 4MYXA 1XLGA 1WP6A 1KM2A 1JEZA 4G7EA 3TTOA 3ATYA 4UZSA 1JUBA 1NDWA 4NZ3A 4ZFCA 2IPJA 2EPMX 2REQA 1VJZA 1RBAA 4PSPA 4UQEA 3QY7A 5HMFA 3EYPA 2UZ9A 1AW2A 2Q71A 2ZXQA 5BNKA 3A4WA 3E0LA 3TH6A 4C1NA 3NVTA 4FNSA 1FWGC 3E3HA 2NQ5A 4GNVA 1GKPA 3MUCA 1VR6A 4AHPA 6TAAA 2B7NA 2HXUA 2VC5A 1KBBA 4A8RA 4R7OA 3KVLA 1RXOB 2GPTA 3FHQA 4W8LA 4O54A 3CV6A 1R7AA 3BG3A 3KFTA 2OMAA 4GRSA 4MB5A 4NP7A 2J13A 1I75A 1AK5A 1OX5A 3ME3A 4CD5A 1RQEA 4RUBA 1JCMP 2IKHA 2R1MA 1XRVA 1XLAA 2BMBA 3ABXA 4J5NA 3T09A 3APGA 3M1ZA 1FWTA 2I5IA 1KO0A 2BX7A 3DUGA 4O10A 3L66A 4UZUA 1ME8A 4BQ2A 1PXGA 2G3IA 3O6DA 3PJUA 4UNLA 1O7AA 1E1EA 1BKSA 2OOGA 4A2SA 1CXFA 4NZ5A 3UZ5A 4YNGA 2X0HA 4QJ5B 3H54A 2VXNA 5D2XA 1QNRA 2WVVB 2VMFA 3KWXA 1B3XA 3W83A 1HW6A 2INZA 2W91A 4EP8C 4DJFD 6XIAA 3D0CA 3WNLA 1Z6KA 1AG1O 3SRFA 3AU2A 2WSQA 3FY1A 4WDTA 5I07A 1DJYA 1Q6DA 4F0HA 3GTNA 2DH3A 3NURA 4DLFA 4UMBA 1UOZA 1PKMA 1AVAA 4JFSA 2Z24A 4JHMA 1TV2A 1P0KA 4J3TA 3CL6A 3CPUA 2IMRA 2ZRVA 5F7UA 1W54A 1V0KA 4NZ4A 3QR1A 1DIDA 1HKKA 3SFKA 1BHGA 1NDZA 2Z2BA 3OVPA 4FOJA 3ES8A 1FVPA 1QBBA 4HQVA 4HPHA 2PWEA 1B3OA 1EIBA 1T8XA 5MKGA 1FUYA 5BWAA 4R88A 4LYPA 5LIUX 5HPCA 1M7JA 3PPFA 4LY8A 4GH3A 2F2KA 3CUJA 2CLKA 3CAQA 3W6MA 3QEZA 4LFYA 2XSXA 4PH6A 1YTDA 1TV4A 1J4EA 1FOBA 3IUIA 3BANA 4HPJA 2NV1A 3F4VA 4FSAA 4WR3A 4F8XA 3N2CA 1ZJAA 2E6FA 3AWNA 3NYZA 2H6RA 3KBWA 4UQ9A 3WKZA 2EKGA 4NI3A 1TJPA 3CQ0A 1ZY9A 4EPKA 3NPVA 1K70A 3LG3A 3E2SA 4N9EA 1S2UA 1V8EA 1LDCA 3E9AA 2X30A 2PS2A 2NT1A 2I57A 2C1IA 3PWAA 3WF3A 3DZ1A 3EWBX 2C71A 3H6OA 2ZZ7A 2GUUA 2XH7A 1UJQA 3H21A 4ZO8A 5FEPA 1EJTC 1P6WA 3FGCA 4MG4A 1FCBA 5D8ZA 2ZUTA 1V08A 5KMYA 2GVEA 1EOMA 3WD2A 3BAKA 1RHCA 2QR6A 1JAKA 1IEIA 3BMXA 2X2GA 3HO8A 2QULA 4XUGA 3STGA 4TXEA 1UPMB 5D2YA 1UMLA 2XJ7A 2VZTA 1R2RA 2PUZA 1LWIA 2OEJA 5K9DA 2E9BA 2YBTA 3V75A 5LNVA 1EF2A 5M03A 3BVJA 1J6PA 1KTNA 3IVTA 1BGGA 3QKEA 4KRUA 3SGZA 1DOSA 3M0MA 2QW5A 5CG7A 3NXFA 3G1SA 4WHBA 1S2CA 3RYSA 3KL5A 3PG8A 4HSHA 1DJIA 3RG6A 1VBGA 4C6NA 3LI1A 3ARUA 3C0SA 2Y2WA 2X1IA 4JY8A 4PB4A 4QG8A 5CCZA 2REQB 5GQBA 5I79A 3BCDA 3CAVA 1X96A 3SY8A 1X1ZA 3E0WA 1ONXA 2AAMA 1NDYA 2YDRA 2OLHA 4IOTA 5G2WA 3NOEA 3VGDA 1LBFA 4PMYA 4QQ3A 1HVXA 4NL1A 1ODZA 4M7TA 1U22A 3SRHA 3LLDA 4AIUA 3HIJA 4QSHA 1KRBC 2E6AA 4XBKA 2FH6A 4U10A 4WJ8A 4OFCA 3A24A 3WFLA 1K7FA 1POJA 3G1FA 3ZJ7A 2GQ9A 4DBEA 1K03A 3WH8A 4W88A 4ORMA 4C6DA 1VEPA 2JGQA 4RZBA 1PKYA 1C90A 1TRIA 4JTGA 4KFPA 5EB8A 2VT0A 5CC3A 2G4JA 2QHAA 4UCGA 3AXHA 3GZ3A 5C9XA 3DG6A 5FL0A 3GFZA 2VRKA 1LQ2A 3DERA 1OF6A 3DH7A 1P0EA 1FWJC 4ZQRA 3VNZA 1JXKA 4MJ2A 3AC0A 2GGIA 4QBXA 4LUTB 4ZL1A 3HGRA 2QDGA 2ZRWA 3VGEA 3FIGA 1TWDA 1JYNA 2ISSA 4W7WA 2JF7A 3BOXA 1XICA 4YCOA 1T6MA 3TQ0A 1ZBVA 5IRPA 4HT3A 3A3XA 2CFFA 2D2OA 2X42A 1ZCOA 3CTTA 4JIPA 1ZQ5A 2FZMA 3U0HA 3GUWA 1UCWA 2VC9A 5TNVA 2IW0A 4NSBA 4DYEA 4DWSA 3HQOA 3EDDA 1M41A 5AB3A 2QCMA 4HA1A 4BS0A 4RR4A 3MMDA 1QMLA 5CC6A 4YTQA 1P0NA 3CT7A 1LP6A 1JULA 1IT8A 2XH0A 3VE9A 3EXSA 4IHCA 2P10A 4CEUC 2E6DA 3M7WA 5BW6A 3QGKC 1CXEA 2BOFX 4EXBA 4Q3MA 2HCVA 3B8VA 3ZT6A 3SY1A 3CMFA 4DB7A 4HOXA 1CIUA 4JFWA 1DWJM 1FHVA 2B7QA 5CAHA 2PDCA 1L2QA 1TMLA 2NQLA 4A8IA 3W22A 4G9PA 5LHEA 1RVKA 1W17A 5T26A 1JZ4A 3D6NA 1I0BA 4PTDA 2QUNA 3MVIA 3GC5A 1E1CB 3HQ1A 2XTKA 3UW6A 3PPHA 4QEEA 1US2A 2EF9A 5BCAA 4S3EA 3WMSA 1XLIA 4PMJA 5CEWA 3W88A 2I5QA 1V51A 3T44A 4GJ1A 1FKXA 3T40A 3SIMA 1NOFA 4LC8A 1JGMA 4MIMA 4KWOA 2FMOA 4L9XA 2HNHA 1L6GA 3VKKA 5IDIA 4H7VA 3KWSA 3UR5A 2QNEA 1S46A 2B4GA 5LA2A 4LF1A 1BF2A 3S1GA 1VHCA 1GOXA 4V15A 5AC8A 4HBKA 4A22A 4NX0A 1TV8A 2IPWA 5BOEA 3CZGA 5D02A 3LCXA 3S46A 4AZIA 2WW5A 3GVRA 1UJPA 1W1YA 3QF0A 4GI4A 4IQLA 1GJWA 1RA5A 4GX8A 2V68A 3L9CA 1DWGM 3WJXA 4J3ZA 4GZIA 3RLUA 4NHVA 4KERA 6CGTA 2XVPA 4AFYA 4ATWA 2E40A 4LEFA 5LIXX 4V27A 5I3GA 1WCGA 3PBYA 4TV6A 4PFMA 1ADOA 1TPDA 4L1XA 4IFRA 4M6UA 4RNIA 3VCCA 4LY4A 3W85A 2QQ6A 1KR1A 3MCMA 1HL2A 3L4YA 4IIBA 4ZFMA 4NU7A 3PFRA 1WKDA 5CGMA 3FDGA 1KM1A 4X2RA 3GW0A 2CERA 4O8RA 2CLIA 5BRPA 3N4EA 1YPIA 2BOGX 4JQ4A 2BHUA 1XIJA 3NNTA 3GU1A 4JCMA 4DJDC 2XU2A 3OGRA 4C6IA 1V03A 3L21A 2BBFA 1H5VA 2OQHA 4ZENA 4PMDA 2IPFA 2RDWA 3R12A 3VABA 1Q6RA 3PTMA 2G50A 4AYSA 3PG9A 1R3YA 2ZUWA 3WLRA 4DZ5A 4EXQA 4E2OA 4EK7A 1TUFA 3OQ8A 1X6LA 3C2VA 5I3FA 1Q2RA 1IXOA 3U9IA 2Z2UA 1QI2A 3CUZA 1TPVA 4EPBC 1ITCA 3P5ZA 4PTNA 1DJXA 1OFRA 5HBFA 1FWCC 4JCLA 3ZR5A 4ZE4A 2C1HA 1VYPX 3SECA 3E49A 3S6OA 3C0QA 1L6WA 2NWSA 3LHTA 4DF2A 3M44A 1WZMA 1FRBA 3W81A 3FOKA 4QEHA 2J62A 4LS2A 1PTAA 2VM8A 4XZIA 3F7JA 3VE7A 3S2LA 8XIMA 2QJNA 1PHQA 3OIXA 1SPQA 4PTXA 1UD3A 4W86A 3TQKA 3W73A 3LRMA 3A9BA 3MUIA 4Q33A 4FS9A 2G97A 3WO8A 4RW3A 5FJTA 3K5XA 3R89A 4DWSB 4XD3A 5G2IA 2YA1A 4JEQA 1X38A 1EC7A 3THDA 3BOFA 2Y6ZA 3CQHA 3T4CA 4FIRA 2CBVA 1V7AA 3W84A 3IVSA 2ZX8A 3WJYA 1PTGA 1VCVA 3WN6A 1TR9A 5FJRA 3U48A 1S3TC 4IG2A 3GRIA 5EMUA 4IGMA 2Z1VA 5CC7A 1FWDC 3VD7A 2WMKA 4C6BA 4WSHA 5JIWA 2Z26A 1ZPTA 3FVMA 4H6KA 5J5DA 1U5VA 2OEKA 2VD8A 2YXXA 3BAYA 4EPEC 3I7RA 4W5UA 3AUOA 3PS7A 1KV8A 4JAWA 3W82A 2AGKA 1HZYA 1O5QA 3VPLA 3M46A 3W1QA 2ZA2A 2D2GA 4CCEA 4DXXA 5SWUA 3KBMA 3DU0A 3VNYA 1FCQA 2XINA 2EGZA 3NL6A 3P2VA 2XIQA 2BZNA 3CUGA 3T55A 1S5NA 1CCWB 4A29A 1E1FA 1W2PA 2NVCA 5EMLA 4Y8FA 1TX2A 1NQ6A 3W6YA 1O12A 2WSYA 3BSHA 2CHOA 3ANYA 2X16A 4QLLA 1C8XA 1KM4A 2R8WA 3H53A 5IHRA 4F0LA 2PC4A 5KZDA 1V4YA 5D2VA 3S6TA 3JZUA 3M0HA 2E28A 3DFTA 4ZQMA 4YHEA 4YVPA 4FK9A 3RNDA 1C7SA 2C79A 4JN7A 2ZWZA 4ZB0A 4NG3A 4C60A 1E6SM 4HYRA 4WZHA 3QHNA 4L9ZA 2YCEA 2VURA 3CHCA 5CKSA 3SCRA 3MCNA 3AS3A 3GR7A 4GCXA 4U3AA 1UBSA 4C91A 1W9XA 5C55A 1E71M 3CPRA 3SB0A 4PUEA 2EPHA 3PANA 4XAZA 2P53A 5A1AA 3MMUA 1LUCA 2YXGA 3ARZA 4AIBA 1XC4A 4ECLA 2ZIDA 2YDAA 3AYRA 3G18A 4AD2A 5KZMA 4AIOA 1ZAJA 4PTWA 3BWWA 4LNYA 1H7WA 4U28A 4Y6GA 2DZTA 3TCSA 3BPWA 4AD4A 4IQJA 3YPIA 3KRZA 3UVAA 2QV5A 3MCOA 1NFPA 1OC7A 1E15A 2V2HA 4HVXA 4XD6A 1W91A 2QDHA 3NJ3A 1O5XA 3AUJA 4QE4A 4GO8A 4ZXOA 4GFIA 1B3ZA 4F40A 5F4WA 4DF1A 1VF8A 2PP3A 4AD5A 3VOCA 3W7DA 1C8YA 2CBIA 4UFLA 1ZALA 3PUGA 3N6JA 1DIEA 4TX9A 4MY9A 3M64A 1HKIA 5FAGA 3NQEA 4UFJA 3QVQA 4E5TA 4EVZA 2WJFA 1A0CA 4A6GA 1A5AA 3M6DA 4GZJA 4PUMA 2QLYA 4I5UA 2V9DA 5D09A 3EB3A 4HPXA 1V6XA 3VIFA 1K7EA 3ITXA 1JGIA 3O63A 1YDYA 1DJHA 2D69A 1VKFA 1PZ0A 2L5HA 3BQ6A 1WZKA 2CCRA 4AVFA 4GUJA 1F8IA 3H2OA 1CDGA 4EACA 1EL3A 2VFFA 3GR4A 4LF2A 3L23A 4GYJA 5KSWA 3KOFA 3TNOA 4DXVA 3EMCA 2O9PA 3NIYA 1B3YA 1JNEA 3DKJA 1X97A 4O16A 3IIZA 3IRDA 1I1XA 4S39A 1LG1A 2FPYA 2R1PA 1US3A 5LGZA 4Q6JA 2EJ1A 3TU9A 1LLWA 2OKOA 3VC5A 4DO7A 4RDWA 3H24A 1PWLA 1JUEA 5DMYA 4DELA 5JQ9A 3H22A 3IUDA 4PMOA 5LIWX 1F73A 3JW7A 4HB7A 3VGHA 3S9YA 3MI2A 1JRCA 3FCPA 4H2HA 4XZLX 3OVRA 1C7TA 1MW3A 4OECA 4P8WA 4D1JA 3LK6A 1PDZA 3BLOA 3WBWA 2B81A 1FP9A 1KCZA 5B7ZA 4GE8A 1MDLA 1MUWA 4KFOA 3NO3A 1OEPA 4JTSA 4W7UA 4FI4A 4OVXA 4AXNA 1YYAA 4PCFA 2OQLA 5DMLA 2TRSA 4REQA 2GDQA 3QTPA 1KRAC 2D1ZA 1Q6EA 3V5FA 5AOUA 3J7HA 3TSDA 1W8GA 3FFSA 4ZB2A 1CB7B 5F1VA 3MZ2A 4JN8A 2P5NA 5C6MA 2H90A 2QGHA 4W89A 3RU6A 4GIEA 4NI8A 4ES4A 5J04A 1J0JA 2Z29A 2XGZA 1MEHA 1LL4A 1KRMA 3RLVA 3U3HA 1LM1A 3UVIA 5EU9A 4PL2A 5EMJA 3M5XA 4NASA 5A6JA 3P3BA 2J6VA 3E6EA 5A2AA 2EG6A 3ITYA 4FNUA 2FJUB 4GY0A 3R1ZA 1EO5A 2ZZ6A 1Z8AA 5FF3A 3AS2A 3ABOA 4MOZA 2D2JA 4AX6A 4B5VA 1CB2A 2BNJA 3WLHA 3ITCA 2WVSA 4IMFA 3QOMA 3O7UA 3TC6A 3D3FA 1JAEA 3Q58A 1A3HA 1SMDA 1U1HA 1OIMA 2HBVA 4FF5A 3L4XA 1TB3A 3C5QA 1TYGA 2OGJA 3S42A 1SZFA 2W67A 3E02A 3OO2A 5EA9A 3SBFA 1KM3A 3GDTA 4ZQOA 1DJQA 1P1XA 3C52A 1J0HA 3AJXA 3EDFA 4GHRA 1SSGA 2PDWA 2EJAA 5FKYA 3EEGA 3L2IA 3GDKA 2X1TA 2WCGA 3WQCA 3C2YA 4BEUA 3AICA 3VCRA 4M51A 4Q4QA 1U1JA 2R1LA 1SZGA 3KOZA 1DHPA 2OJPA 3IRSA 3L4VA 5B80A 3BAIA 3NQ7A 1ME7A 2WYSA 1LUCB 1IWBA 2WMHA 4GY1A 4M6QA 1GJUA 3U4FA 2NXHA 4UR7A 4BJHA 2XN0A 2BGNE 2YPIA 2KX9A 3U4AA 4FPSA 1LL7A 3IWPA 1JCTA 2PAJA 2PEVA 4PUDA 2JQXA 4MMWA 3GXIA 3MP5A 3QLLA 1AD1A 1OFDA 1YNYA 1XLHA 1GW1A 2V6AA 1K6AA 3UCDA 1JNDA 4GI9A 4S1FA 1CEOA 1EZWA 3TXZA 2PDFA 4DUOA 4K38A 4LBSA 2YDQA 2DZXA 3HPFA 5FJJA 1A50A 2E09A 1H7PA 4QTGA 1XC6A 3GIPA 3EOSA 3PVFA 4YTUA 3ZM8A 2QMJA 3I68A 5GJPA 4PMXA 4JN6A 3T6CA 4N9DA 3UWUA 3QN3A 5D9PA 3UBPC 1EKOA 4S3GA 1XLEA 3HMJG 1K9DA 5HMEA 1OG0A 1XV8A 2BY1A 1WO2A 2JEPA 3MDUA 4DPPA 5K7JA 5T8GA 2BGSA 3RCMA 1J10A 1DXFA 3M0JA 1P7TA 3LTYA 1LRNA 3C8NA 2XIOA 4GQBA 1EXPA 4FX6M 5HQMA 4DRSA 3SADA 2CLOA 1G4EA 5AYYA 4MJ4A 3RX2A 1AQHA 4LUYA 1SO5A 3WUEA 3BMVA 1EA0A 1MNSA 3RUBL 3WFAA 4W9TA 3EA1A 4S3CA 5I03A 4IMEA 1UKPA 3UYIA 3K8KA 4AZGA 4HHLA 1H50A 3VDAA 1PE1A 3KDNA 1HTIA 3P60A 1Y8BA 1JQXA 1XKYA 1MXDA 3LUTA 2J88A 3N29A 3AIRA 2PP0A 4PCTA 1K02A 4R9XA 4DI8A 1RY8A 4ONVA 3E2QA 4WX2A 4QDWA 2WOQA 4A3HA 1VFSA 3KW3A 5MHBA 3PF3A 5HNNA 1DWFM 4ERGA 5JBEA 4JFUA 1YXCA 4FLRA 3G77A 3QRHA 3CJPA 3HOJA 2CZEA 4B9ZA 3ZS4A 1E4MM 5A6LA 1O6IA 2YLLA 4BY3A 4FNPA 3WD3A 2YR1A 5HOSA 2Y5SA 2P0IA 4CD6A 2BOEX 2WMGA 4O1BA 4R33A 4A3YA 4JXCA 3LX9A 1UKQA 4FO4A 4N0RA 5A95A 4M80A 1FWFC 4JTLA 4IJRA 1GEHA 4NZFA 3OA5A 4RDVA 4Z2HA 5KTLA 3ZO9A 1K8YA 5CJMA 2GQ8A 3SW6A 4O13A 2XVKA 4Z1DA 2WAGA 4IP5A 4WQ6A 3RM4A 4HKPA 4PRTA 4MUPA 1KGWA 1XYZA 1SR9A 2C19A 1BVWA 3CZKA 3LLXA 3S5YA 3WQGA 2HPIA 1RZMA 4UFKA 1XIHA 4Z2IA 3C2OA 4U5KA 5HDRA 1BG9A 5H8UA 4BEQA 4XO7A 4US5D 4KFNA 2WMIA 1TA3A 2Z25A 3TE9A 5D9OA 4H7CA 5I00A 4A4AA 1RD6A 3EMQA 3CZEA 3UF9A 5EMKA 3WH9A 4H8NA 4B16A 4DHGA 3REQB 4DNMA 3SCNA 3WLSA 1XD1A 3BZJA 5C71A 1XYFA 2TSYA 3INPA 4UFIA 2KZHA 4DO4A 4W84A 3KRUA 3IIPA 4IMCA 5CAKA 1XHGA 1P43A 1W3LA 3OLIA 3UXLA 1OYCA 5HNUA 1T0OA 2YL6A 3IIXA 3MP3A 2GVYA 1QHOA 1E6QM 4YWIA 2PDLA 5E9XA 2YCJA 3FEMA 4MLRA 4MHBA 4FNTA 3P5YA 4KEVA 4TUFA 3C6CA 2OEMA 3NZRA 4JTRA 3WNKA 2C0AA 3V0TA 2Y61A 3LM3A 4Y2WA 1FHUA 2XYLA 2TMDA 3G1XA 4LS1A 4EAYA 3LQLA 4QS6A 2W92A 4OBRA 4UTUA 3PP7A 1IR2A 3AIBA 4N4PA 3R43A 1C93A 4NAFA 1YTEA 1F7BA 1RJQA 2R9RA 4BF5A 1IWPA 2HRWA 1ONEA 3K13A 2Y85A 1Q6FA 2A5HA 4JTTA 3GNRA 4H9VA 3GH7A 3M43A 4JS3A 1TTPA 2PB1A 2YZRA 3OEXA 1PB0A 2P88A 4MPKA 4B3KA 3L65A 3VDBA 4C90A 4CVUA 3PNZA 4DJEC 3IK4A 3U7VA 5ABGA 2BASA 4DX3A 2DSUA 1KA9F 2I16A 3HU7A 4ZBCA 3MDWA 6ALDA 3R2GA 1M3UA 1VS1A 1XCWA 3UNTA 1E0TA 4FLOA 1XDJA 3BURA 3T4WA 5D33A 3VC6A 4IXHA 4HP5A 3MU7A 2B31A 2VEIA 1P7TB 4QHRA 3EPMA 1EPXA 1QPNA 3F1QA 1OF8A 4WEVX 2DSVA 4RE4A 3T08A 1G4TA 2R91A 2Y1HA 4Z1YA 2XH4A 4F0KA 1RY0A 4M24A 3TW7A 4WY0A 5FJIA 4BI6A 3CQKA 3DXIA 5DBTA 1PZ1A 1D7KA 1MVYA 2GGEA 4PRRA 3MTWA 4A3QA 4UCFA 1G4SA 3EWYA 2FPVA 5C8BB 3HPZA 4AZBA 1GPWA 3AYTA 1QI4A 1A5BA 1DTUA 2VGFA 3IIVA 3W7HA 4O52A 5K4ZA 4HU0A 4L5ZA 1AW5A 4IGSA 1T40A 4KKXA 4IGNA 1Q5MA 5GVJA 3I3BA 4MKVA 3WL1A 3BMWA 2Q02A 4MWAD 4BR1A 4NT0A 3ZXWA 5HJLA 1SO3A 2ZUMA 1VCGA 1S5TA 2EO7A 4AZCA 1T99A 3NSMA 2A3HA 3PULA 3SRKA 2PTXA 1CNVA 1W3IA 3PPGA 4UUIA 3AHXA 3OLGA 4F9JA 5CGTA 5BRBA 3I6RA 3WL0A 2G8ZA 3HFYA 2O56A 3BLFA 3P7YA 1VYRA 4O19A 1EJWC 3EWUA 4WDWA 2QEZA 1XG3A 2A3BA 3LB0A 3ZWSA 3V35A 4AD0A 3D3AA 4YYFA 3CHVA 1XRSA 2Z7KA 4XIAA 4UFMA 3IGHX 2XSBA 4IF2A 4UQBA 2WHJA 1YXYA 1WZAA 1GKQA 1KBKA 1Q85A 5I78A 3FYYA 2C18A 4GIYA 1R2SA 3PAOA 1LWHA 4N4QA 5CPNA 2OELA 3WG6A 5A94A 5D9NA 4P7QA 1KXVA 4L1GA 3SCPA 2R1KA 5HQLA 1G6CA 7CGTA 1U33A 3LLFA 2ZX9A 4H8HA 5M2FX 2OWXA 3CUHA 2C14A 1UYQA 3CV7A 3F03K 5C0QA 1IGSA 3W7NA 2FHCA 1UR4A 3VKDA 1QAPA 2OZ8A 3L4WA 3WLLA 3PZOA 1K1DA 4YU1A 4C5ZA 3LEPA 3W28A 4O18A 2YLAA 2YCIX 2DVXA 3OU8A 1EOKA 2WMIB 5A8QA 8TIMA 3W29A 5T9BG 3GS6A 1W5PA 1KQZA 2DH2A 4PMUA 4JTIA 1ITXA 2W9MA 2YA2A 1ISYA 3DEQA 3UETA 3EB4A 2GDUA 1N8IA 2JE8A 1E4NA 1YPXA 2YFOA 3E5BA 1UWAA 1S1PA 1H0IA 5CPLA 1YTKA 2Q09A 3W00A 1E5JA 3PZQA 1JCNA 1VH7A 3RO8A 7PTDA 3WQOA 2BY2A 2QCFA 3M7SA 5I5RA 4LB3A 3ZJ8A 1OZQA 1OX4B 2DUXA 5D4YA 2DSKA 3CB8A 4Z17A 1CBGA 1VD6A 4I8YA 4C6EA 1IE7C 2BY0A 1MEIA 3LQGA 2GJNA 3NM3A 3SI9A 3G1HA 5BXPA 2FMNA 3C2FA 3CV1A 3SDOA 3UNDA 4NAFB 3ZJ6A 2O4MA 5DN1A 3BGAA 1J79A 4JQ1A 4EANA 4QQUA 1TTQA 1PS9A 3URNA 1NELA 2EPNA 3LV5A 1ESWA 2G96A 3VO0A 4LV9A 1UIPA 4NNCA 2UY4A 3AISA 1WDDA 3T9PA 2GGHA 2ZRZA 4X60A 5GJNA 3WQ4A 2NUWA 2YFNA 3R8HA 4PMVA 1V6UA 3GG8A 2ZA1A 1XYAA 4M6VA 2WSRA 1UP3A 3MY9A 1W3KA 2OYLA 2CEQA 1BGAA 3GDBA 4D9PA 1DJNA 3MI3A 4WXZA 4LT9A 1G0CA 2BP1A 2YYTA 4Q8VA 3BK0A 4FP1A 1W9BM 3QGVA 4GK8A 1XQLA 5ECVA 4GQGA 3AQUA 3PY2A 1ICPA 3LTPA 4WY0B 4JNYA 2DZSA 1WA3A 1BYDA 4EPDC 2X8RA 3WEOA 4ENLA 4AY7A 1OK4A 5AECA 5EL1A 4YMZA 4KEMA 3KP0A 3LU2A 3C61A 2ZYFA 2F6UA 4OTKA 2Y7GA 2PRMA 5E0FA 3VVGA 5XIMA 4NYUA 4UMCA 4JDBA 1TV7A 4PTMA 2C8NA 4Q8OA 2BY3A 3SEPA 3MP4A 1JPDX 3N6HA 2Y24A 2PF0A 4OZOA 1CECA 1TE6A 4GISA 2AGTA 2VTFA 1VAHA 4JKLA 1LT7A 2H3DA 1V3JA 4YLWA 1KCXA 3KTSA 1W1VA 4IL2A 4ZQNA 3LRKA 4H6RA 1OM0A 2V3EA 2XFRA 4ZOCA 1G9HA 3H7VA 4O50A 2PF8A 5J8LA 4H2CA 2A7RA 2J8GA 5TAOA 3S1VA 4U3CA 1B9BA 3DFOA 4U2ZA 3TQPA 3S2MA 1SFJA 5IFPA 4KIEA 4AWEA 3ONBA 3DX5A 1UR1A 1Q7QA 3KHDA 1EIXA 1I2RA 1SW3A 3QTGA 4H41A 2QCEA 3FHAA 3V3WA 2WZMA 4C65A 1XLFA 3O05A 2XM1A 4FR6A 4B91A 4L1WA 4JYFA 2NUYA 3GIYA 4Y8EA 4C7GA 3ITGA 4DBUA 3MWCA 4R7WA 3HV8A 4CKQA 1BTMA 3FN9A 3UXDA 2WMJA 1YNQA 1EZ2A 1H0GA 3DYMA 1SFSA 1V6WA 2PFHA 3A3HA 2WM1A 3DECA 3IARA 1RCXB 1BKHA 3QXBA 4FA3A 1DJZA 1TZZA 3CL8A 2VGIA 5C70A 4RW5A 3B8IA 4Z2JA 4YL2A 5C9UA 1OCBA 2PWHA 6A3HA 4PRWA 3TLQA 3NQGA 4L80A 4RL3A 3KVJA 1AQ0A 5H2ZA 4C6PA 1V6TA 3B9DA 3GNOA 2QCHA 2FTYA 4XKMA 1F4HA 4L7ZA 1MQQA 1HJXA 3FW6A 1TJ2A 1DXIA 2G37A 4DBWA 2D24A 1YE6A 1BWKA 4PMZA 2YCLB 1R0MA 1TMHA 3ANUA 4MKNA 2VFIA 3I7QA 4UR9A 2YX0A 2YB1A 3DESA 3OJGA 5AYZA 6REQB 4IWWA 1H11A 3U6WA 4ZOAA 2HMCA 5IBXA 3TSMA 3KLLA 4QIUA 3F4DA 3H8AA 5FOOA 1JIBA 2VEMA 2J74A 2VR2A 4FXJA 2H8ZA 2WPBA 1SSDA 2Y70A 5AYBA 2WKLA 5HMDA 5FI8A 2FVKA 4KF1A 5FF4A 4UOJA 4UTTA 6TIMA 1V0MA 3WUBA 1R3SA 2RJGA 1PVNA 3FX4A 4P2VA 9XIAA 4FXFA 5CBIA 1VLWA 4I9AA 3GH4A 1MDRA 4DWSD 3A64A 4C7FA 2YOCA 3TP4A 2HNEA 5HNTA 3AIUA 1AJZA 1EFZA 3LPFA 3SCVA 2Q3RA 2DT1A 4AMCA 3BW3A 3UG8A 5A6KA 1J6OA 5LA0A 1G67A 2CKRA 3WQ6A 4LU0A 4GG9A 4POCA 4GINA 4J27A 2WB5A 2VEGA 2X40A 2R6OA 4B5TA 1GVEA 3C56A 3K30A 3TJXA 4DI9A 4PUUA 2QGYA 3K1DA 4NJIA 1KNWA 2V5BA 3OBEA 4ZB5A 3KZSA 1R8LA 5EGRA 2GOUA 3AIEA 2CLEA 4A3RA 5FJOA 2INEA 3KZPA 3TC7A 4S3JA 3H70A 4DEFA 1AL7A 1HJVA 3SGGA 5CPSA 3JR2A 1UA3A 1DV7A 1IF2A 3LHWA 2CITA 2AAAA 1JL8A 3RR1A 2CZDA 3W1PA 3ARSA 1BAGA 4GC3A 1KQYA 3L7RA 1C92A 3UJ2A 2GJXB 3G5EA 3LBOA 4Q4PA 2VDIA 5KINA 2X1RA 1BYBA 4JGDA 2VFGA 4HTBA 4CD8A 1NF7A 3S5NA 3CIVA 2WWDA 1QHPA 2OZ0A 1XLLA 3EBVA 3BL3A 4Z1BA 3KTXA 5AKQA 1WDRA 2A79A 2D73A 2X2YA 5C9WA 2IKJA 3GFXA 1X1OA 2AMXA 3W7LA 3WMBA 4AEFA 2Z6JA 1YX1A 1CYGA 1UWIA 3R10A 4JHOA 4BKNA 4LB4A 4FXSA 3CWOX 3VZYA 1VBUA 2HS6A 3GBDA 3IJDA 5AYIA 1WXZA 2HS8A 4MB4A 3IV8A 1A53A 1JDCA 1R3RA 3AXMA 4JX5A 4LXFA 4IISA 3WEMA 4GNKB 4JIIX 5A2BA 4GLEA 1CLVA 1GJPA 3FJLA 3WQ5A 3B97A 3LD5A 3PB0A 1QBAA 2G5WA 4UTMA 3CC1A 5HANA 4E8DA 4UC5A 2IXVA 2ZZ2A 4FOUA 3EPOA 3KCOA 4FXRA 2GWGA 2Y7DA 3VI2A 1ZAIA 2GUBA 3IEBA 3ELFA 3T1GA 3PTDA 3SO7A 4OBTA 1IYXA 2YL9A 5FJPA 4HMDA 5BXRA 2AL2A 1XH2A 4MF4A 1OY0A 3WX7A 2J77A 4XAPA 3PZ9A 1EUAA 4AEEA 2PTWA 5KZEA 1V02E 2OO6A 3W7IA 4A35A 1XRFA 3I7SA 2VX7A 4F0SA 5HULA 2RDXA 3M0IA 4HZ8A 3BG5A 3W2KA 1CGTA 2JK2A 3BW2A 3TA9A 4WJXA 1CXHA 1R9ZA 1IEWA 2OSWA 1ISVA 4EAMA 2VZVA 4LC6A 4RNFA 2EBNA 4KGJA 4J3VA 1PIIA 5HUPA 4K68A 3TMQA 4P61A 4JIEA 2FTPA 1TCMA 3T0AA 3WH5A 2WXDM 2OT0A 4INFA 2G3JA 1MI3A 2NLYA 1LOLA 2CLPA 2Y63A 5D04C 3BLKA 3D46A 3GC2A 4OGZA 4HN8A 3BJSA 2E5CA 3C86A 1X39A 4QR6A 4E4UA 1PL9A 4LCSA 2F9RA 2I7GA 4IIHA 5IBXC 1RP8A 3UJFA 2XWDA 5EMMA 3WH7A 3K1GA 3SUVA 1JQVA 5PTDA 3SRDA 4FX8A 3AJ7A 1SVDA 4MKSA 2OVLA 2QCLA 2RHGA 1BQCA 7A3HA 3AO0A 4Q4MA 2QJJA 2ADAA 2ZQ0A 1BVZA 3CZ8A 4UTTC 4NXKA 2E5DA 4WUIA 3AIVA 1RBLA 4GI6A 3OPSA 3IIOA 1G1YA 3N14A 3NQVA 1TJRA 2HE5A 4FEZA 5HR6A 1V6VA 2MUCA 2BGQA 2Z1XA 3Q45A 3VIJA 1WOAA 5DXYA 3G6MA 3WDHA 2X7WA 1OINA 1W9UA 4P8VA 5CSRA 4G1NA 4ICCX 3W1XA 3ABSA 4PUNA 2DW7A 2O9RA 2UY3A 1MQRA 3DAQA 4AHQA 1WDSA 3WQEA 1PO9A 1M65A 3HF3A 3V16A 3MYPA 4IMDA 1H5YA 1JD9A 3HQNA 1NH6A 4RXFA 4HZ7A 4L4PA 4U33A 3HURA 2O7SA 1BFNA 1KXTA 1OZMA 3WJWA 2QJMA 2DZBA 1HQTA 3AHVA 1YDNA 1QI3A 3EOUA 3C2RA 4J4KA 5DBUA 3T42A 3QH2A 4Z42C 3ZVHA 2HVOA 1AFSA 4F4RA 3TAOA 3WBYA 2D3LA 5ABEA 4JTCA 3EB2A 4I9MA 3UG5A 1XYLA 1GW9A 5JH2A 4AZ7A 2F6KA 1HG3A 4UTIA 3PZNA 3GXDA 3UGRA 1JF6A 5F2MA 3H4WA 2QPXA 5LIYX 1D2KA 1XD0A 2CLLA 1PKNA 3IJLA 5K4XA 4E2VA 2NQHA 3ZJKA 3GYEA 5IFTA 3V1PA 3M4HA 1W1PA 2JIWA 2NWRA 2XIIA 1MWOA 3WDQA 4IX2A 2VENA 3ABQA 3W86A 4Q8PA 1JDAA 1CW2A 1I2NA 4EWND 3W3OA 1RCOB 3IJ6A 5TF0A 4EF9A 2IKIA 4XZ9A 3BSMA 3GG1A 3QPEA 5JBFA 1C29A 2ABBA 2NQ9A 4PCPA 3B0XA 1QK2A 1TRDA 3IJQA 2TYSA 2RGMA 4DNHA 1FP8A 3MSDA 3W9ZA 2A85A 3ZLGA 3PUOA 3GVVA 1O5RA 2ODOA 3RJXA 1Z7AA 4LUJA 1G4PA 3WEZA 4F79A 1UZ4A 2DJLA 1GQNA 4CQDA 2FZNA 1M1BA 4V1YA 3HMCA 1P6CA 2OPJA 1V0NA 3PZMA 1JFHA 1I2PA 2FDSA 4PA8A 3OZMA 3LSBA 4DJFC 4MZ1A 4XKYA 3W1UA 1H1YA 1WKFA 1J96A 4KESA 2GUYA 1NARA 2YCKX 3BE7A 1NAL1 1OB0A 3W7RA 3T0DA 3TWBA 1Z48A 1UP2A 1CTNA 3GDLA 2PDXA 1AUSL 3BXWA 1TUXA 3TN4A 4NX5A 4PUKA 3SY5A 2VZOA 1QPQA 3TTYA 4YTTA 3OG3A 3TIMA 3JRKA 5L6UA 3AZSA 4DM1A 3TFCA 4N42A 4R34A 1KBIA 4K1WA 2DT0A 5ABHA 4CCDA 2QUUA 2X09A 4V1XA 3KRSA 1M01A 5A69A 1IT0A 1N8FA 3R0DA 5AN7A 3RIKA 3LI0A 3VOIA 3WDJA 4JBRA 4DZHA 2Y7FA 2VZSA 3DENA 2ZKMX 1V3LA 3FKKA 3SUSA 3S5SA 3V5OA 1DBTA 3CUXA 3V5CA 4WVXA 5F2LA 3M9YA 1OJXA 5CPTA 2CETA 3QHMA 1FWWA 1FXPA 3K8LA 4ROPA 3G0SA 3MSYA 1TG7A 3UESA 3WBXA 2XWEA 3IUHA 4AWTA 1HKVA 3CXOA 3SIZA 4PB5A 3T2PA 2J7DA 3K2GA 1QK0A 1W3NA 2W61A 1JZ8A 1KW1A 2PBOA 4DAFA 1J18A 3H2AA 2PU1A 4KQNA 4A05A 3F4WA 5H91A 3TN5A 3VU2A 4LSBA 2PDHA 1CXIA 3KHJA 5DRCA 1LZOA 1R7OA 4JKMA 1RPXA 1ML1A 3L0NA 2VGGA 3G3MA 4Q8WA 5JVLA 3WFZA 2BSLA 3O15A 1UKTA 5BOOA 3COTA 1XCFA 1FDZA 1LTDA 3H2NA 2VKZG 3L5AA 4LYKA 5I02A 1F76A 3ARYA 4P7NA 4G2DA 1ZJHA 1SJAA 2ZC8A 1TIWA 3MKCA 4BQ5A 4H6EA 4D71A 2GSJA 4CNUA 3W38A 1LBMA 4WCJA 5AHIA 1EP3A 3B05A 4IPIA 1I9CB 1B3VA 3HTWA 3TTSA 1RALA 1SM9A 1V7YA 1AH4A 4LCQA 1W8SA 3BCFA 4FLSA 2PGFA 3KOXA 1CENA 4HJFA 3R4IA 3CMGA 1WAWA 4WXYA 3CNYA 3ITTA 3LPGA 2DU2A 4RDYA 1E4IA 3UY8A 3A5VA 1EDGA 2OO0A 3QYQA 4O0ZA 3BW4A 4RE0A 3MBDA 2HTMA 3PZTA 4W8BA 4GXMA 3UCCA 2DVTA 5G1YA 1B1YA 4B5SA 2DZAA 2Z00A 4H19A 1HJQA 2DT2A 3CBWA 3PR2A 4HMCA 3PUEA 2VUYA 1NSJA 1FWNA 3DCPA 3APYA 4MAZA 3N9KA 3G8RA 5A5WA 1XL9A 3CU2A 3UR8A 4MB3A 4XZBA 4DZAA 3UR2A 1KWGA 1AH0A 4P5UA 2FFCA 3JVAA 3EZ4A 4JX6A 3SN1A 4K7YA 3WJZA 3O1NA 1T7LA 1QPOA 4M0XA 3BARA 4OUIA 1GHRA 1EH9A 3DI0A 4EE9A 5ABFB 4U2YA 2VNCA 1P48A 3AHYA 3WLPA 2FVMA 2WBKA 2C1GA 1K3UA 2DIEA 1FDJA 1OFEA 1PX3A 2CPUA 2VOTA 3EAUA 1CT5A 2PWGA 4O17A 3IACA 1NP0A 3NM1A 4UOZA 3BG9A 4ICMA 4RV8A 1MUCA 1UMYA 4GJIA 4DUVA 3OIHA 3GC4A 1Q7MA 2ZOXA 3IJIA 4DYKA 2E6YA 2YDSA 5DO8A 4LUTA 1UB3A 4TMBA 1XLKA 1SFLA 3MI6A 2PE4A 4M6PA 2Q6ZA 3UXKA 2F8QA 3PBMA 3VNIA 3MUY1 1GVFA 4IIFA 4MNJA 3CEPA 1H3GA 5AHNA 3SR7A 4D6IA 3NZQA 4LH8A 4AZ6A 1WXJA 1VBRA 3HGJA 1UPPA 3NDZA 1B54A 3B0YA 1EC8A 1F2JA 2VFHA 4XKYB 2OZTA 3LCHA 4GACA 1RV8A 3UJEA 2BLEA 1IEQA 2VFEA 2WQDA 2GYIA 3WF1A 4O28A 4JX4A 3PFMA 4LNCA 3V18A 2YKKA 1TWWA 2Y5EA 1Z42A 3VX0A 1FTXA 1KV5A 2W62A 3H26A 1QU4A 2WC7A 1OC6A 1IR1A 4GUGA 1ALDA 1TWSA 5DX7A 5JIPA 3BGGA 3PK7A 2WNNA 3F4NA 2HWGA 3F4CA 2ZUSA 1UQZA 1XIFA 1WX0A 4O14A 1VBHA 3M0YA 1E3ZA 1EB3A 1UIOA 3TVAA 4RDZA 2YZ5A 1BYCA 1EQCA 4L64A 5JXQA 4UTJA 1E1CA 1ZP3A 1LF1A 2GJLA 4JD4A 3TJIA 4JQAA 1A5UA 2DZPA 3LSCA 2ZZ5A 1OD8A 2BDQA 4YN5A 3TA6A 4XBJA 3FKRA 2JKEA 1FWSA 4QP0A 2TODA 1F6PA 1UOKA 4OHQA 4ACZA 2ZUUA 1EHAA 2C15A 2PDJA 2NQJA 2E4TA 5REQA 5TD4A 3S1XA 4M3PA 2CLHA 1X8CA 1VCFA 2OG9A 3G1AA 5HINA 1W1TA 3NA8A 4WF7A 4AHOA 3GFYA 2DPEA 1FDYA 4CQAA 4MVAA 2QCCA 3GXPA 1GVYA 2YL5A 3PB2A 4NF7A 3RPMA 1TJ1A 1NQKA 2YIHA 1V79A 1GCYA 2XFWA 3H2FA 3ZSSA 2WZTA 3GNXA 5C9RA 1PKLA 4J28A 4V2XA 4WD0A 3FYOA 3OQEA 1QJWA 2PD9A 1OVDA 5ABTA 1B2YA 1UROA 4CD7A 2Q8ZA 1RPKA 2PDKA 4NXSA 3DIPA 4M19A 2AQVA 1Q6CA 2BVDA 3VFLA 5LNRA 1KC7A 5HMSA 2PCEA 1ZFJA 1X1NA 2XVGA 3N4AA 1UD6A 3EOEA 3QV7A 3DHDA 1IIHA 3LBMA 3VZZA 4W5ZA 1T96A 2YYUA 3VD5A 2ASHA 3LOTA 1GONA 1TTIA 2BXVA 5H8PA 2IQDA 3AHZA 1D8CA 1WPCA 3UWEA 3A4JA 2QJHA 1XG4A 1SR0A 1YKWA 1YXDA 4Q7NA 3UJSA 4GMEA 4DO6A 1BF6A 4S38A 2O0TA 2Z28A 4DJDA 5G4WA 2ZX7A 3W7KA 5FD0A 4I3GA 3GY1A 4XTIA 4JEJA 1OC5A 1VQTA 5IXEA 1VFLA 4L4MA 5D8WA 4HZ6A 2WC4A 3GWQA 5HAOA 1BRLB 2VCCA 3ES7A 1KFBA 1BWVA 1VYSX 1G7UA 3AXIA 3WENA 3WCZA 3BC9A 1VBJA 2INFA 1QW9A 2Q8XA 3CS2A 1UR8A 1XJBA 5CQ1A 4M5PA 1A4MA 4GIRA 4NUWA 1AL8A 1KXHA 3SUTA 1SZEA 3VIMA 1H2JA 1W3TA 3B40A 3NPWA 2BODX 1X8FA 1X6NA 1I45A 4HPNA 2BVYA 3TDFA 2A0NA 3O3RA 3A9IA 2R94A 3GIQA 4GUFA 4OJYA 1EWDA 5G4HC 3OLDA 4WKAA 1QXLA 1ZJIA 5HJYA 4I6VA 3W87A 4CN6A 4E4FA 2F61A 3E0FA 4FOKA 4LVDA 1XXXA 4JFVA 3PZGA 7ODCA 5D30A 5TIMA 3H7RA 3NZ1A 1E43A 3STPA 1AZ1A 1NEYA 3LPPA 3QY6A 4O1AA 1XPGA 5CPOA 4EIVA 3SQMA 1QO2A 3H12A 1M7OA 2F84A 4E8GA 2PDPA 3HV9A 2QCGA 4AZHA 4L56A 3MSRA 2VRJA 2VX4A 4XSMA 2NLIA 2MANA 1ZCCA 3ABRA 3H23A 1Q3NA 3OOQA 2TPSA 1JR1A 1KXQA 5DMNA 1WDWA 2DV0A 5AYXA 3U5UA 3MUZ1 1QOQA 1LOSA 3ALGA 3H7UA 3QFEA 1OABA 3OG2A 2WK2A 1SJBA 4RE3A 1XLMA 4JPGA 2WKJA 4GQ0A 3GSMA 3RPDA 2WNZA 3MMTA 3TZFA 4AH7A 4BK9A 3N4FA 4DAIA 4GUHA 2W66A 2VCAA 1TCDA 4R5EA 2V5CA 1E0UA 4LUSA 4QXIA 4D8LA 2FZ8A 3P61A 3WNNA 3OZOA 5CSYA 5E5CA 1ITUA 4Z2GA 1B57A 3UPBA 4ACZB 1YBQB 1M6JA 5DRIA 1DORA 3FXYA 4DBDA 3T0CA 5REQB 1J5SA 4CCCA 1P0DA 3R8RA 3EOOA 2R1NA 3EKGA 4WKFA 4OBSA 1QCWA 3DI1A 1VIWA 1PAMA 2GGGA 2YBUA 4CD4A 4HSNA 4RZ5A 4XAGA 5GJMA 2WBGA 1KGUA 1E4LA 3P14A 1ZNNA 1REQB 4NJKA 5H1WA 5EY5A 2WM0A 4Y9AA 4KCUA 2RAGA 2UY2A 1MZRA 3PSVA 2ZE0A 5EMYA 3QQWA 1UZHA 4HCLA 3RAOA 3L67A 3NWRA 2HK0A 2E7FA 2I14A 3L5MA 1F74A 4MGGA 1OD0A 2Y89A 3ICJA 1C3FA 3N3MA 3W2LA 3A4AA 3CIXA 2AMGA 4XG1A 1VZWA 2ESCA 4YXGA 1K9FA 3NQ6A 3RM8A 3ARVA 2JF6A 1UH2A 1ZAHA 3NQDA 1I1WA 3ZLHA 3W7PA 1KB3A 3EWWA 1F8MA 1PDYA 4ZTXA 1HFBA 1E55A 4BZYA 2DQXA 4LTSA 5FEZA 1R5YA 2AKZA 1FWHC 1UWUA 3DG7A 4P7LA 3RILA 3LCWA 1NVMA 4UXDA 1JYXA 5C5YA 3OB8A 3TNBA 2D0FA 3EPNA 3LGDA 3K4AA 3B4YA 3I3DA 3IGSA 2Q8LA 1FH7A 1LWJA 1VGAA 4BFAA 2Y7EA 1UD2A 2XZ9A 1ZB5A 3XINA 3GUGA 1K7XA 5CLTA 2V5DA 4B3LA 1G5AA 3LY0A 4D2JA 1JI1A 4L6DA 1Q7ZA 4M81A 5FEWA 1TFVA 4KCVA 1HJWA 4CN4A 2J75A 2FGLA 4NAEA 1E6PA 1UR9A 3POHA 4JTJA 1IZCA 5H6HA 1JFXA 1BXNA 3CAKA 1R85A 3G2GA 3CLMA 4XBSA 4TTGA 4FMVA 1CLXA 1TPH1 3A13A 3AMLA 3P8JA 2V3DA 3VKBA 3UZYA 2ZCGA 4K37A 4JIHA 1EEPA 5A8MA 1HIZA 2AL1A 3W2MA 1CGVA 4KS0A 5C2GA 2P8BA 4JTFA 1F6YA 1CPUA 1YDVA 3NVDA 1E0VA 3E5PA 4NRSA 2OYMA 1XIDA 2W0UA 4HNNA 3S9IA 4MADA 2FYMA 2FGBA 1F3EA 2WPGA 5DELA 5CZTA 3H2CA 2A2IA 3WLKX 1ZJBA 4QG9A 3ALFA 2NT0A 3O6CA 2BVWA 2FZ9A 3I10A 2V3GA 2NVDA 1GOWA 4MB1A 3FXGA 3LCLA 3B8SA 4E0CA 3NEVA 1QT1A 1E6XM 5DANA 3P0WA 5FAJA 1S2TA 1K9EA 4D72A 3GDRA 3P0XA 3ZMRA 1DKWA 2PD5A 3W7CA 4JOMA 3GAKA 2ISVA 2ZX5A 3VKCA 3SCWA 1AZ2A 2FLIA 2YGYA 1Y0EA 3N15A 3VIPA 2HEJA 3GXMA 3GG0A 1SQ7A 4B2DA 4XX6A 1NFBA 1SW7A 3NL5A 1G69A 1VRDA 1VPYA 2HROA 2DW6A 5BXSA 3OA3A 1F5ZA 2Z1SA 3E12A 4XD4A 5BMWA 3CGTA 2HV5A 2O55A 2ZTJA 2JIEA 3NPXA 4NYYA 4TR9A 2VOMA 1HKJA 2VVSA 2VI0A 1AJ2A 1LORA 1P4CA 2VO5A 4QAIA 1B3WA 5DLCA 4TQTA 4IL0A 4PYSA 1A80A 3EWXA 1QOPA 1KFWA 2PCQA 4QJ1A 6PTDA 3WLMA 2VZUA 1OGBA 4LUSB 4ZSTA 3M6YA 3MANA 3T8LA 1AW1A 1U2YA 2PRLA 3KEHA 3G0XA 4IFOA 4MZYA 1N55A 3JS3A 1W1ZA 1E9IA 1J0IA 1RK5A 2QCDB 3CMJA 4MNLA 1DWHM 5RUBA 4LVGA 2ZUVA 1DL3A 4KWUA 1XI3A 2GQAA 4O1DA 4LPCA 1O1ZA 4UQAA 3BUVA 3KBVA 1UUQA 3IJ8A 3P74A 1JDDA 4GIAA 5ECUA 4XZWA 3WUFA 4GKTA 3E1F1 2GLKA 3CYVA 1W5MA 4QAWA 3VGBA 2NX1A 1FKWA 1NP2A 4GFSA 1KD0A 5AZ0A 2OFJA 4PBEA 4N02A 5CPMA 4HOWA 3NZPA 4FIQA 5A6TC 1GUVA 3ABZA 2YJQA 4X61A 1BD0A 4IGHA 3W7MA 3UZXA 3AIWA 2J78A 4KEUA 4E3VA 3DFPA 2CU0A 1E3XA 3VIHA 3RXZA 2JKAA 5AHLA 4XV0A 5IOBA 1TPB1 3S1UA 3EGJA 4Q4RA 4Q32A 3N3TA 2ZZ3A 1QOXA 3BDKA 2G95A 1MYRA 4OWGA 1Q45A 2Y4SA 2NQZA 1IZJA 1BYAA 4HHMA 2FZDA 3W1NA 5MF5A 1W32A 1TSIA 4Y90A 2QIWA 1H61A 4M56A 3BSGA 3CHDA 8XIAA 3E38A 4IH3A 3AXKA 3LZ5A 4KWVA 1Y65A 4M1RA 1QTWA 5EKYA 3KVKA 4OOZA 1DQUA 1JZ5A 1CX9A 2FQIA 2I1OA 1XLCA 3KOWA 4MJMA 1QUMA 1LROA 1WUFA 3CYJA 4GA8A 1PSCA 4IQEA 2XG9A 3UJRA 4IPJA 3WMCA 2J7EA 4GYPC 4A3UA 3TN6A 4FX7A 9RUBA 3R5EA 4H3DA 4CNOA 4NAEB 4XO6A 2WVUA 1CXKA 4CQ9A 4FNRA 4J2MA 2QAFA 4G7FA 1P5BA 1B9ZA 3B06A 1WZLA 2I56A 5KITA 3EMZA 2DZWA 2DP3A 1XINA 4GQRA 1ZS2A 4UMAA 4HA0A 5D03A 3CZJA 3UT0A 2JFEX 1JZ2A 1RUSA 1GHSA 1C9DA 3UPWA 5EPDA 3OYXA 3WD1A 1IT7A 1K8ZA 2ABAA 5LGXA 3VKJA 3G1VA 3TEVA 1K9TA 1OYAA 2E1DA 3HBLA 1NFGA 3KBJA 4PUJA 1UHVA 2D2HA 3CQIA 1HL9A 4AMAA 2VHLA 3FNDA 2A3LA 4DBSA 2A6NA 1UWQA 1WUEA 3RCNA 1FFRA 1HKMA 1UR2A 2W27A 1XKJA 1H4PA 4S3FA 1SFTA 5FEXA 4I7WA 3MMWA 1D3GA 1ELSA 1PEZA 3LS9A 4B5UA 1LJYA 3OW1A 4HJWA 1LRQA 4F2UA 1XH1A 3W26A 3QC3A 4KMQA 3QBUA 3BJTA 2G4FA 4E2DA 3KL3A 3VOHA 2Z1KA 2V38A 2PDQA 5F2IA 1P0BA 1NOWA 3OP2A 3TFXA 3UWVA 1UWTA 3T81A 1LQAA 2ZRYA 3GG7A 3VDHA 4D6CA 4GD0A 3IS4A 1GQIA 4W7VA 3AOFA 1GORA 5G5IA 1MO0A 4A8LA 1UH4A 2WWCA 3RK8A 2XN1A 1MZHA 3AMKA 3BLDA 1R9YA 1VB9A 3ITVA 1TPFA 2PLKA 4ZGYA 2ZFAA 3PM6A 2XM2A 2GVLA 1NU5A 2PGRA 4CLMA 4KCTA 4XISA 3KLKA 3Q67A 4O4WA 1FQ0A 2DUZA 4MYAA 3ZFHA 2O4QA 3NPUA 1KFEA 3QPYA 2J66A 3UP8A 1OK6A 3P93A 1Z69A 4DF0A 3VCNA 3G1DA 3VD9A 4F0RA 4AEOA 4Z08A 1HL8A 1J0YA 5FIPA 4O1EA 1V3HA 3LCGA 3R25A 3W2NA 5DY3A 1W31A 1EJRC 3KXQA 2WCAA 2NSXA 3AYSA 3NOYA 3SJ3A 1UD4A 1VFMA 5CBJA 3FYPA 3W7QA 1TVLA 3GTFA 3CWHA 4LS0A 2B0MA 5C7HA 2FDMA 5B7YA 1A3XA 1GZ1A 4Y9PA 3OBKA 1HUVA 4GYKA 2GGJA 1RQHA 3FA5A 2XFYA 3IAPA 4D6JA 5HJXA 1CGWA 3DBNA 4QSFA 1DEDA 3LHVA 3VUSA 4K8EA 2H8XA 2QCNA 3LMZA 4ZO7A 4HHPA 2YA0A 1GG1A 3SM0A 4FAMA 2V63A 1IZKA 4Q7IA 2WHMA 4GZEA 4PCNA 3WQWA 3M0ZA 1H63A 4G8TA 1N2VA 3CAWA 3REQA 5CBBA 3SCSA 2WJZA 3HG2A 3RMJA 3BOLA 2PURA 1UC4A 1XR2A 3QGAC 3GBEA 3PHAA 4Q7BA 2EG7A 4MFDA 2R14A 4DN1A 4AD1A 3KP1A 5E9AA 5HA7A 1W9DM 3WYZA 3QV9A 3L0GA 4LWWA 1XGEA 3MQTA 2E1WA 1QR7A 1N82A 3W1TA 2PP1A 4J40A 1TWIA 2BVTA 4D6GA 4TVDA 5FA5A 5D38A 1QO5A 2O7QA 3ZIZA 2A4AA 3C2EA 2ZDRA 5FACA 5BU6A 4ROQA 1EWEA 5FF0A 1A0EA 1GKRA 3ZR6A 2DORA 1ZLPA 4PMRA 3KUMA 3WLJA 4UTFA 4JYDA 4MM1A 4LANA 3IV3A 1PCWA 1N8WA 2Y88A 3LXBA 3SJNA 2GVJA 3GHSA 2CESA 1TIMA 1S2VA 3M16A 5DMMA 1I8JA 1DQXA 5CJNA 2BHYA 2OR2A 4P7OA 2W63A 1M7PA 2WZIA 4QCFA 1M68A 1BWLA 5M3WA 3VNDA 3FSUA 2OXNA 1TE1A 3TMLA 2VL4A 1DVJA 4Z0SA 3M0KA 1OSEA 5AFDA 4PBFA 3UFYA 1JVNA 4E38A 4DJEA 1E6NA 2CBUA 5HUOA 3ZR4A 2EKCA 1ECEA 4WLCA 4GGHA 4D6DA 4JHZA 2VDGA 6ENLA 3LGGA 2QF7A 3UU0A 4BI5A 4LW7A 2VQUA 3SCOA 3TAKA 5AZ1A 5LA1A 3LV6A 3VFCA 3GM8A 5E0KA 1W5QA 2XDFA 3GAYA 1KGXA 4W87A 1YMYA 4LAKA 4NJHA 1R2TA 3NR0A 3EKZA 2ISDA 2PBGA 2HK1A 3AALA 3W7EA 5LSMA 1OG6A 1KFKA 4UIOA 4TV5A 4TO8A 1EJUC 1W37A 1UASA 4RKAA 3B0VC 3DHUA 3P6LA 2WHKA 4IX0A 4JIRA 1F4AA 2XIMA 3IVUA 2VC7A 3S0CA 3PWGA 4JTDA 1D3HA 2IUZA 4GI8A 3V0UA 1GEQA 3WQFA 3WH6A 1B30A 5M5DA 2ZTKA 2DEPA 1XIEA 3EA2A 4HZMA 4AU0A 4KRZA 3HGSA 1J9YA 3ZZ1A 1HNYA 2R82A 4G1KA 3ITOA 2W3ZA 3HA1A 3KX6A 4MWAB 3WMLA 1MRQA 1J5TA 1L8PA 3CTLA 2V8ZA 4QE1A 3MKKA 4MWAC 1NF0A 1ZHAA 5A2CA 4Q4SA 1M5WA 3UERA 3OTRA 4Z2KA 1V02A 3UEQA 1WB0A 3QW4B 3TKFA 3V1HA 1NIUA 4RJEA 4H9YA 3S2NA 1EBGA 3TTEA 4I8DA 4LALA 2ALDA 4AD3A 1EDQA 2G3NA 3E2RA 1BVNP 1PV8A 2YW3A 3V7PA 3NXLA 2C91A 2IQTA 1RP9A 3QZEA 2I9UA 2E9MA 5BRQA 3SUWA 2PDUA 1N7KA 4WJEA 2QF8A 3S6DA 5BOFA 4GH1A 2BG5A 1EA9C 1GQKA 4JYEA 3JZEA 2E9LA 4H9UA 4UNKA 1BXCA 3STCA 3VIKA 1QPKA 1PTDA 2PDIA 3RMEA 3LPOA 2IPGA 2PLJA 1JCXA 4G7EB 4BWLC 4J7RA 3PAJA 4EXAA 2HBXA 1KM6A 3ITLA 3N9RA 4DO5A 4KEZA 2OX4A 2ZE3A 2VEPA 1XBZA 4O57A 4YIWA 1S39A 2NXIA 1ONWA 4C1NB 1F05A 2VJXA 3TYDA 2E3ZA 1XQKA 3ZWTA 1A5CA 3W02A 4AC7C 2P3ZA 3GXNA 5A6BA 2DZVA 2G3MA 3UZZA 4DWDA 3O06A 1EPVA 4L4OA 3ARWA 3E0IA 1XIBA 3JU2A 4IMAA 2GSEA 2ATSA 5HWNA 2OZ3A 1TQJA 1UWRA 3RN6A 3IJ7A 2GJPA 5JMUA 4YVVA 4DIAA 1L0PA 3B04A 1YDOA 4O4VA 8CGTA 1V3MA 4LAUA 1OGSA 3ENLA 3WZ0E 3M47A 1PIGA 1PZ2A 3TWAA 5D05A 1BTCA 2WVTA 3THUA 1M04A 1AQMA 3VD3A 3WQVA 3T2OA 3R13A 1OX4A 1E9ZB 2Y8KA 3VMOA 4E3TA 4M29A 3FAWA 3PBUA 4D6EA 3RO6A 3U2EA 4TVCA 1VFTA 5BYWA 2DIKA 3PZIA 2JALA 4M7SA 4ZQPA 2WLZA 5A6AA 2X7VA 3SFWA 3TYBA 4MFEA 3TYCA 2AOSA 1KTCA 1U5HA 3HZ3A 4MY8A 2WJEA 1DP0A 1JZ3A 4ICNA 2OSYA 4UTLA 4P8UA 2CXEA 2W79A 3MC5A 4B90A 3NG3A 4IFKA 4Z2LA 1V0LA 3UQNA 3TTQA 3TYAA 1OCQA 2PZ0A 3UZJA 2WCSA 4PL1A 1MNZA 4QRNA 3THQA 1LYXA 3DOPA 1K8XA 4PB3A 1U1UA 3ARQA 3CH0A 2BXZA 2XH2A 3POCA 4MY1A 2Y5JA 4YTSA 2G3FA 1NY1A 3GH5A 4HU3A 4NJGA 2FH8A 1V77A 5MKGB 2WKGA 1JDFA 1KBJA 5I3KA 4M82A 1MFVA 3VM7A 3RX3A 3R7MA 1Z9AA 3SCUA 3MZNA 3O9NA 5K2ZA 4J1OA 1HKWA 1OHLA 4NY2A 1DE5A 1DJWA 4O1CA 4NIRA 4LVBA 4GC4A 3UWWA 4QS5A 1V3KA 2ZDSA 3UWZA 1QRQA 1KTBA 2GSHA 2VP8A 4D8AA 5I3IA 1GT8A 3NSXA 3CZLA 1PJ9A 3AHTA 4H7ZA 3AAMA 1A47A 1EHNA 4CEXC 2RDUA 4RPQA 1AH3A 2QPUA 4JL1A 3W1RA 2E8ZA 4UOQA 5E0CA 4CUCA 3CM4A 4R7JA 3FA4A 3URAA 1ZBKA 5FESA 1GWJA 4CQBA 2BS9A 1GOIA 3F5JA 2P3EA 1RSCA 2QDDA 5LNSA 1ITQA 1NM9A 3DFNA 3IJ9A 3VKAA 3FDKA 5I24A 3HPAA 2PSNA 4D6FA 3FGCB 1X7IA 3WNMA 1DHKA 4Y9NA 3CH9A 1UR0A 3A3WA 2VWTA 1GVOA 5CGQA 2GK1A 3NQFA 5AVHA 1XIIA 3RITA 2OU4A 2EQDA 1O5KA 2QUTA 4K2SA 3O16A 4JDYA 1UC5A 4NVTA 3NSNA 5AVNA 5C2CA 3RGTA 1H41A 4N9CA 1JXJA 5HK4A 3T07A 3W76A 4AYGA 2QDEA 2WANA 2IXUA 3I4KA 2XUCA 3LXCA 3S9ZA 2PWVA 4C6JA 4IP7A 1OFPA 3ZOAA 4QJ4B 4AC1X 4QITA 2Q3OA 3P67A 5L9FA 4AW7A 4K8GA 5E1QA 2IS7A 3BV4A 4LEQA 3F2DA 3K4WA 5AC6A 4ERAA 3KBNA 4JTKA 4W4QA 3GR8A 2A7NA 3GD6A 4NZJA 2P8CA 3AIQA 1GZJA 2J25A 4Q8MA 3IANA 4ZOEA 1S2WA 1F3XA 4QG6A 4LRTA 4Y9OA 3CHFA 3B8WA 3H55A 1U30A 3GU2A 3QW3A 1T5AA 5HWMA 4E2BA 1KM0A 4FHAA 2YW4A 3GQYA 1A3WA 4PMNA 7TIMA 2CZ5A 4LOCA 1UUOA 3WLNA 2YCLA 3NO1A 4HSOA 4L9YA 4WSKA 3W74A 3APTA 1RJPA 2VX5A 1R3TA 4FALA 2CWXA 1HP5A 6REQA 4HNTA 4PBGA 5CLWA 5F2GA 4U5IA 1YRRA 2OLAA 3B4UA 1HN1A 2VDHA 2QIIA 4PUWA 1AODA 1JI2A 4B5NA 2VC6A 1LG2A 2OOFA 3CASA 5HPOA 4ZSUA 3GNNA 4M1BA 3AYVA 4MDOA 1G7VA 1LBLA 3CQJA 3VIGA 4KCWA 1L6YA 5KETA 1PIFA 3QFWA 5HQEA 2VD9A 3M5VA 3SQLA 4DWSC 1E0WA 4R3UA 2FHFA 1IEXA 4EOUA 1MMFA 3G1YA 3MSGA 5D32A 2OODA 2WNQA 4TMCA 4S2CA 3ZT7A 3NCOA 4IFKB 3SSJA 5FSDC 1HVQA 1H09A 4FNQA 1PZ3A 4HCDA 3K8MA 4A21A 3W4RA 4CQ8A 1THFD 2ONEA 1JYWA 2A1YA 1ONRA 1VEOA 2J9XA 3HPXA 4YWSA 3LCIA 2QMKA 1O60A 1YPFA 5I3HA 2Y0FA 3K4DA 3KOYA 2NV9A 4LCRA 4QLJA 1HJSA 1D8WA 2EG8A 2E0PA 1GVIA 2HQAA 3WLIA 4AWSA 4IPLA 1O66A 3LGEA 1ECQA 1J2BA 3SAZA 2CLFA 3O0KA 3KRBA 3WLOA 1EYEA 1LRTA 4UR8A 2ZXBA 1Q4WA 2QPSA 2CWNA 2J7GA 1A4LA 5I2UA 3MS8A 3VM5A 3IK2A 4WOZA 4IJCA 4RZ6A 5E6YA 4CCZA 1PHWA 1G01A 1XUUA 4F48A 1I2OA 2PLMA 3S4TA 3A47A 3RM9A 2GJXA 1I6NA 3LN3A 1BG4A 4L61A 2BWGA 2D23A 3AS0A 3ZYZA 3U7BA 1JG9A 1FWIC 2PGEA 2VYOA 1XFCA 1GQLA 4PODA 5G1TA 2OT1A 1XYMA 1NWUA 1ZBCA 2EPOA 1XYBA 2RKXA 2FFIA 1SO6A 2PC8A 4RCXA 4UQCA 3A12A 1ME9A 4L65A 4BI7A 2I17A 1XCXA 5D37A 4DM2A 4IQDA 5AY7A 2IQ0A 3H4GA 5BWFA 4PGLA 2Z6IA 1ZL1A 1JF5A 1FY6A 3LNMA 4F9DA 3HPSA 3P80A 3DFHA 4AUBA 2YXOA 3R58A 1W6TA 4AVNA 4DYJA 4K6AA 1A5SA 1OT1A 3UG4A 3D47A 2D22A 4KWSA 3DYPA 1RLCL 2C6QA 2E68A 3SZ8A 3AS1A 3NQ2A 1OYBA 1SZNA 2GK1B 4US6A 4HN4A 4GBUA 3O8AA 5BROA 3B3DA 2J8FA 1H49A 4PC8A 1RVGA 1K6WA 3CEUA 4E4PA 4AQLA 3LA4A 2ON3A 3EX2A 3O6AA 2XSAA 1S2AA 4H4IA 4E6MA 4XQ6A 2V5KA 4I9JA 2E67A 3PPCA 2ZA3A 3VZXA 2V82A 2DGAA 1MW1A 1Y7VA 3STFA 1CGXA 1DTNA 3WUGA 3O6YX 1KM5A 4IIEA 3T78A 4BF9A 4BA0A 4MWAE 3N1AA 4DJDD 3TX9A 2VUNA 5C9ZA 2ACUA 4I6KA 3GVWA 1GGOA 1UZ1A 2WJDA 4R27A 3VNKA 4FR1A 4IIGA 1AA1B 3KM8A 1UWSA 2YL8A 4TX6A 1ZGDA 3OZPA 3TR9A 4JTQA 4B4HA 1PUDA 1EGVA 5H8MA 3U2CA 3AZRA 4NNBA 2ZXAA 4PZVA 2VELA 4CNPA 1KR0A 3R79A 2FJKA 3R11A 4LAMA 1QW8A 5U4NA 3VA8A 3QQ0A 4I5XA 1C8VA 2WSPA 3PUDA 3CHEA 2NXGA 3ECQA 1PWMA 4AY1A 5GPRA 3T0TA 5FL1A 4HNOA 5CZJA 2GFTA 1Q8AA 2F2HA 3QLDA 2C0HA 1UP0A 2CBJA 3NYDA 1EGZA 1GOMA 3UA4A 2X1UA 1EJXC 4ZTYA 1A5NC 1RLDA 1F3TA 1ZUAX 3WLQA 1FA2A 2V81A 4XTDA 1QWKA 5LZLA 3OGVA 3RCYA 3PJWA 4PTVA 3ZLFA 4HGXA 3R8GA 4JFTA 4RX0A 4LJ3A 5A6SA 1EX5A 3DGBA 4ASTA 4G56A 2QUVA 3L5LA 2B7PA 4C6OA 4DUWA 3HG5A 4Z0JA 3ISIX 3GHRA 1LT8A 2PDBA 1DJGA 1LLZA 1BEUA 4PSRA 3FJNA 1XSKA 3FK4A 3ORWA 3S1WA 4J9JA 4MJZA 2OYKA 5FSEC 2OLSA 1BSIA 5I6SA 1I2QA 3CK5A 3ARTA 4H83A 2BXYA 3KCJA 2J7FA 1H51A 5E70A 4IG2B 3TC3A 4A8NA 1FFQA 3HG4A 4H9XA 5I23A 1DIOA 2GVGA 1FHDA 2J7CA 4MZ8A 4MDPA 2ZBTA 1IGWA 3EX3A 1VFHA 3NUKA 4X0VA 1QNSA 4YJ5A 1XFBA 1F9CA 1Y5XA 4UB9A 1D7FA 3G0UA 4S23A 3LDVA 3ZQ9A 1MXGA 1VJSA 5LHFA 2YB4A 3F5LA 3MA8A 1AJ0A 4XSLA 2V2DA 4N2YA 2ZRXA 3ATZA 1VFUA 4C1KA 1ZP4A 2ACRA 4H9ZA 1EYWA 3AZTA 4UBPC 4PR4A 4GCAA 1KFCA 1VFOA 1WYIA 2OTDA 4LAZA 1XBYA 1RCQA 2CLMA 3TQVA 1FWAC 3GTXA 1A5KC 4S3AA 3LHZA 5IDZA 4AWUA 8RUCA 5KZ6A 5BXTA 3CB3A 2UWFA 2UY5A 1JCJA 4O11A 3GHTA 4H04A 3KVMA 4FZIA 4HMEA 1K77A 3BLLA 2V2CA 3PN8A 2WNWA 1W3JA 1WAUA 3RLHA 3EKLA 1R30A 3WD0A 2O9TA 3V36A 5FF2A 3TSBA 2IKGA 1PCKA 1XP3A 3VGFA 4HU8A 2KAUC 4HIBA 4Z1AA 3ONCA 2TAAA 1ICQA 1YE4A 3MBFA 3U2ZA 5G4EA 4WGHA 2DT3A 2A3CA 1HO1A 1U5JA 1JDEA 3GE7A 4HA3A 4I5RA 3MW7A 4LRSA 1Z3NA 3UR7A 3EXRA 3BCJA 1MSSA 5K9XA 4C1LA 1C91A 2NV2A 1BPLB 2GOKA 4HNLA 2VVNA 3G1RA 3UY7A 3R6IA 3A6OA 2PWFA 2XHYA 3HJEA 2HZGA 3L12A 4D6HA 2Y8UA 5CSSA 3R0KA 2ZX6A 4AXKA 1KBLA 3HB9A 4ML4A 2FVLA 4PEEA 3A22A 2DVUA 2UV8G 1QFEA 3ARXA 1L2UA 1B4KA 1Q66A 1UH3A 1E5NA 4FLQA 1RA0A 3WF2A 2RJHA 3AMGA 1X7FA 3VAVA 4DJFA 2PA6A 1NWSA 1TQXA 5LIKX 5CZKA 1M7XA 3R94A 1A0DA 3WBAA 2FB2A 2CNCA 1SW0A 3U8GA 5K9CA 2F38A 2PU0A 1ISXA 4AY8A 1PX8A 3N2MA 2Z2AA 1JJKA 2RFGA 4QNWA 5JBDA 4CGTA 1W56A 4WK9A 4Y9MA 3VUPA 3QR0A 3WQ8A 4JL2A 2ISWA 3AMCA 4C7DA 1FWEC 3HN3A 1V6YA 1TZ9A 3WD4A 1ISWA 2QKFA 1R3QA 3WF0A 3W37A 5AC5A 1MQPA 3THCA 1S5MA 4DPQA 3C3UA 5D9MA 2X05A 2UBPC 3N12A 1OCNA 1F3WA 2NUXA 1NWTA 3F2CA 1A49A 4DLMA 1NJJA 5TBOA 4KPLA 1K4GA 4Z1CA 4KIRA 4HD5A 3VIOA 2QAPA 2V3FA 3W01A 2JKPA 3UG3A 3WF4A 4ZOBA 1RBOB 3WDRA 3UPMA 3NFUA 1GOQA 1LLOA 1KLZA 1LL6A 2OSXA 4NJJA 4D8ZA 2Z1WA 1EJVC 3L68A 1EXBA 4QDMA 1XF0A 2OKTA 4Q8QA 2CZVA 3KS5A 3HFTA 1VFFA 5M1TA 1RH9A 4XD5A 3ARPA 5CG0A 3HG3A 2I9EA 3B8DA 3A23A 4HA4A 3U2OA 4HNUA 1QHZA 1E73M 4JNMA 4X9SA 3B0PA 1T41A 5GNYA 4ADUA 4QLKA 4TTUA 4CU7A 3WK3A 3UYCA 3W27A 1W2VA 4LVFA 4B2DD 4W85A 1MXSA 1QNPA 1GYMA 1O95A 3DHPA 3M07A 4TU1A 4Y96A 4X9YA 1H60A 3W2UA 2CHNA 3PBGA 3SN4A 3UZWA 1NTHA 1DXEA 1Q65A 4C6QA 4REQB 1UD8A 1J11A 4GYFA 3AI0A 4WKHA 4S3BA 2W5FA 2CC0A 4H9TA 1GVQA 1WV2A 1TWZA 3W70A 2V5JA 4HYVA 2ISFA 3SN0A 4QNEA 4CU6A 4UTWA 1G94A 1S3HA 4PEKA 4HTYA 1CWYA 2OB3A 5DEZA 2YBVA 4ERIA 4GWEA 1WKYA 2WHLA 3HQPA 3TW9A 2FB3A 1POKA 4HNVA 5A3HA 2HJPA 5F4XA 2ZICA 1F6KA 3B0UX 1HX0A 1R3WA 3ERPA 4IM4A 4S2BA 5AHFA 2SFPA 1YNPA 8A3HA 1Q6OA 2HPMA 4CNNA 3EX6A 1Z89A 1CZ1A 3BICA 3Q4DA 1HT6A 3WDPP 2ANUA 1FH8A 1PYMA 3QMSA 4YS1A 1I0DA 3TJLA 3BV7A 4XZHA 1PX4A 5HR7A 2BFGA 2X0SA 1UD5A 4YCPA 4XVEA 5ABFA 4PCSA 5F4SA 3OGSA 3NQCA 1H1NA 2QVNA 1GQJA 1GYLA 5K3VA 3L2MA 1US0A 1HXJA 4V28A 3G3DA 3N19B 3T0BA 3K46A 3MV01 4HU4A 5I06A 3A5FA 3TROA 1IXPA 1DQWA 6XIMA 4B92A 3W1LA 2V5LA 5D2WA 5DY2A 3RU8X 4Q8TA 5EBUA 2DFAA 3VIIA 3TYEA 2VEKA 3C0JA 4H8VA 1Q6GA 1XH0A 3XISA 5LYRA 4W8AA 4R9OA 2PTDA 3Q37A 2P76A 5LKYA 1JPHA 3FJ6A 3ZSTA 5A8PA 2ZUNA 1W9PA 4R85A 1OT2A 2A3AA 4LV4A 1UG6A 4HK5A 4IJBA 4O12A 4V33A 1DIKA 2GL5A 4IMGA 4M8UA 3RRAA 2HDJA 1UA7A 2R24A 9XIMA 2J4GA 3EWDA