2F38A

Crystal structure of prostaglandin f synathase containing bimatoprost
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
319
structure length
319
Chain Sequence
QQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Prostaglandin F2alpha formation from prostaglandin H2 by prostaglandin F synthase (PGFS): crystal structure of PGFS containing bimatoprost.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 115
structure length 319
sequence length 319
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2005-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2f38A00
2HE5A 1VBJA 1S2AA 1VP5A 4WDXA 3WBYA 4XO7A 2PD5A 2ACQA 3B3DA 2R9RA 3BUVA 1EKOA 4NKCA 5M2FX 2R24A 1S2CA 4JTAA 4WDWA 3MC5A 2DV0A 3R6IA 2IKIA 2PF8A 2HEJA 3LD5A 4JIHA 4LAZA 1Z9AA 4HBKA 4YU1A 3O3RA 2FZBA 4YVVA 4H8NA 4QX4A 3KRBA 2IQ0A 3UGRA 4LAUA 3M64A 1QWKA 4JQ4A 3S3GA 4XZLX 4QBXA 1MRQA 4WGHA 4H7CA 1HQTA 4PMJA 5LIWX 3H4GA 1QRQA 2PD9A 3UZXA 1XJBA 4GACA 2ACSA 4EXAA 4JIRA 4JTQA 2PEVA 4PR4A 2PDKA 3CASA 1PWLA 3H7UA 2FVLA 4FAMA 4YS1A 2NVCA 1T40A 2F2KA 2PDLA 3CV7A 1S1PA 4OTKA 3UYIA 3M4HA 3BCJA 2FZ8A 4JQAA 5LIKX 4FA3A 2AGTA 1YE4A 2PDIA 4WDUA 3GHSA 3O0KA 1YE6A 1PWMA 2IKJA 5KETA 1T41A 2I17A 2IPJA 3D3FA 3N6QA 2CLPA 1UR3M 4IJRA 1ZQ5A 1LWIA 1RY8A 3ONCA 2IPWA 3BURA 3QKZA 4PRTA 3V0UA 1FRBA 1A80A 4DBSA 4Q7BA 2DUXA 4LBRA 2F38A 3R7MA 3RX3A 1Z89A 5AZ0A 3UZWA 1EL3A 3LZ3A 1AFSA 4ZFCA 2BGQA 4LB4A 2IKHA 3CAQA 3UZYA 4GIEA 1Z8AA 4Q3MA 2FZDA 1EXBA 4XZIA 2PDYA 3LN3A 3Q65A 2BP1A 4ASTA 2IS7A 2PDCA 3LBOA 4RPQA 1LQAA 2FZ9A 4JTRA 1J96A 4JQ3A 2IKGA 3H7RA 4WEVX 3UWEA 3CAVA 1AH0A 1HW6A 1YNPA 4PRRA 4XVEA 2C91A 2WZMA 4LB3A 1Q5MA 1ADSA 3ONBA 3F7JA 1X97A 1K8CA 3G1RA 2ALRA 3R8HA 3R94A 1X96A 5LIUX 4YVXA 3DN5A 3EB4A 3UP8A 5LIXX 3T42A 2PDNA 2PZNA 5AZ1A 1MI3A 2PFHA 5JH2A 3LQLA 4FZIA 2WZTA 3WCZA 1ZSXA 3MB9A 3FJNA 1PZ1A 3RX2A 3V0TA 1XGDA 3GHUA 1IEIA 1GVEA 1AH4A 2PDBA 2PDJA 3G5EA 4QXIA 3UFYA 1JEZA 2NVDA 1AH3A 2QXWA 2PDQA 3EAUA 2ACUA 4GA8A 3V35A 3ERPA 2FGBA 3DOPA 3Q67A 2IQDA 4ICCX 4PUWA 3LZ5A 3V0SA 3COTA 4IJCA 2INEA 5HA7A 3R58A 2J8TA 2PDXA 4XAPA 1AZ2A 4JTCA 4DZ5A 4WDTA 1M9HA 4QR6A 4PUUA 2I16A 4XK2A 2IPGA 4EXBA 2HV5A 3U2CA 3GUGA 3RX4A 3V36A 3LEPA 4LBSA 1OG6A 4R9OA 3LNMA 1YNQA 2VDGA 5HNTA 4L1XA 2BGSA 2INZA 1AZ1A 3LENA 4DBWA 2PDUA 4XO6A 1MZRA 3NTYA 4XVDA 3GHTA 3BV7A 4GQ0A 2HE8A 2HVNA 1R38A 2IPFA 3WBXA 4GABA 1US0A 3P2VA 1S1RA 4HMNA 2ACRA 2A79A 3GHRA 3EB3A 1X98A 4WRHA 1PYFA 4FALA 2PDGA 4IGSA 4JIIX 4F40A 2ISFA 1PZ0A 4XZMX 3WG6A 2PDPA 3WBWA 3N2TA 4L1WA 4G5DA 4AUBA 1IHIA 1ZUAX 3CV6A 4MHBA 3LUTA 4GQGA 5HNUA 3LQGA 3R8GA 2PDFA 2PDHA 3R43A 3UG8A 3FX4A 2HDJA 1RALA 4GCAA 3C3UA 4JQ1A 5LIYX 3M0IA 1XF0A 1SM9A 4JQ2A 3UZZA 5JH1A 1Z3NA 3CMFA 2PDMA 2P5NA 4YVPA 5C7HA 1RY0A 2DUZA 5DANA 4XZNX 4JTDA 2HVOA 3VXGA 4I5XA 4DBUA 1EF3A 4XZHA 2PDWA 1Q13A 1ZGDA 1C9WA
chains in the Genus database with same CATH superfamily
2Y24A 2C6QA 3L4ZA 3MQTA 3UJRA 2GZXA 1IQ8A 1PTDA 5EBAA 3W7DA 1VBUA 3QPEA 5EU9A 3DXIA 2BHUA 1DWAM 1H60A 1GTEA 3NZQA 3PVFA 3CHVA 4EACA 4AZCA 1FVPA 3KRUA 1LUCA 4WK9A 2XVPA 2DSZA 5M2FX 2QJGA 2EHHA 2Z4GA 3LXCA 4AD1A 1NVMA 3GBDA 3KOZA 3S9ZA 3GZ3A 1F07A 1I0BA 1EZ2A 3NDYA 1UKSA 3BO9A 3D5HA 5C9RA 3ALGA 1W9PA 1FH7A 4JEQA 1G4EA 4US5D 5MF5A 1GJWA 4YCPA 4H9UA 2FKPA 3SY8A 4GVFA 2E1DA 3QOKA 4FF5A 3TYEA 1A5CA 4F2TA 2VX5A 4W7VA 2YIHA 3IJDA 1HO4A 4DF1A 3MVIA 2CLHA 3PPCA 4J40A 4ZOBA 7PTDA 5K4XA 2XDFA 3W83A 1NDYA 1T40A 4MY8A 3ICJA 2HMCA 3WQDA 5GJPA 5D2VA 3UJ2A 1JJKA 2VYOA 2YLAA 3ATYA 1LL6A 4C6BA 2ZZ2A 4JL1A 1ITXA 1UG6A 1KFEA 1AMYA 3EWYA 1SJAA 2VM8A 2WHLA 2WQDA 5ENLA 5C55A 4QHRA 3QV7A 3WLQA 3ITYA 2PDIA 2AQWA 4C1LA 3ZR4A 1H7OA 1LL7A 3MY9A 2DZXA 4IQEA 2ZZ6A 1GOIA 1YXDA 3R5EA 3W81A 4LJ3A 1D8WA 3CUGA 5HANA 2DZTA 4I5UA 3GXNA 2FH6A 3H2FA 5CPQA 4FHAA 3PANA 1FRBA 4FXJA 3QV9A 1UZ4A 5DT5A 3N2BA 1WV2A 1GG0A 3KM8A 4J7RA 2Y88A 4EVZA 3LM3A 1O12A 4RDZA 1UH2A 3I6RA 3UZYA 1NQKA 1VQTA 2PUZA 4LVDA 1WDDA 3P62A 3SRKA 3M0YA 4EAMA 3G6LA 2CXEA 2ZBTA 1BVZA 4NX5A 1ZBVA 5F2IA 1XLAA 4MJ2A 3CAVA 1WZMA 2A3EA 3UR7A 3T05A 2OMAA 3R13A 3FLUA 4DI9A 3E2QA 1JZ4A 3AIRA 3G1FA 2XN2A 3OZOA 1Q5MA 3QTPA 1RPKA 4HPNA 2WO5A 3PTMA 3RR1A 4DXKA 2YCEA 1K7XA 3WLIA 4MG4A 4I7UA 4JTKA 1N8IA 4QCEA 1UWUA 2D69A 3CPUA 3GDRA 3EPNA 3QN3A 5I77A 3EB4A 1CPUA 4WJ8A 3AXKA 2BY0A 2G4JA 2VRJA 4UFLA 3TROA 1GGOA 1JGIA 3LRKA 2FVKA 5A6AA 4H04A 4M19A 4GIAA 2OOGA 4ZR8A 4HNVA 4DZAA 3AMGA 3APTA 3NQ6A 2HS6A 3CMJA 5KINA 2P53A 1MDRA 4OGZA 2X05A 1OADA 1V4YA 3E02A 1P0BA 3L21A 4QE5A 4JN6A 1G0CA 2VUNA 3SJ3A 1BYCA 2G50A 3KBJA 4W7UA 4KETA 3TKFA 3KBWA 2FTWA 3WNNA 3N1AA 4XAPA 3GC5A 1OFQA 2WNQA 3NVDA 3T4WA 5ECVA 1VKFA 3IUIA 4K8EA 4K7VA 2QMJA 4PUUA 1ITQA 4AISA 3URAA 3AHZA 4UFMA 1FCQA 2HV5A 4KEUA 1KB3A 2XH2A 1EHNA 1GKRA 4AZHA 2ZX5A 1MSSA 3UJFA 3T81A 4E3TA 2HK0A 4XO6A 1HKIA 3BV7A 1Q6LA 3NYDA 4PFHA 3EXTA 5ABFB 3HPXA 3NQVA 2ACRA 3K4AA 3LGGA 3WDQA 1PX3A 1GYMA 2E68A 1YLVA 2VWSA 2AL2B 2VC6A 1CXLA 3DKLA 1KKRA 2B0MA 4YWIA 5HOSA 1EDTA 1K03A 1Q4WA 4XZMX 4Y9NA 6A3HA 4GC4A 2DZSA 4L1WA 1VCGA 1OSEA 1W9VA 4G9PA 2GVEA 1XIIA 4Z2HA 3ORWA 2Y8UA 4RZ6A 3S0CA 1MW0A 3FCPA 3ARTA 2G3FA 3SQSA 5HNUA 4GGBA 1O60A 4C6MA 1NM9A 4ZB2A 1BG4A 3UG8A 2WBKA 2YLLA 1RALA 2NUWA 2H90A 4LVFA 2QVNA 3C3UA 1NF0A 5AVHA 3T2QA 3PBUA 4WKFA 1MUMA 2Z25A 1N8FA 3UZZA 4UNLA 3BL3A 3WBAA 1UQZA 4HA3A 1ZBWA 2FQIA 2VD8A 3CQHA 2G3MA 1IWAA 3P61A 1H09A 3WFAA 3EOLA 4MJZA 3AIUA 5C5YA 1ZGDA 1VPXA 3S9IA 3HN3A 2Y7GA 1LF1A 4K39A 4J3UA 3WLPA 3C8NA 3VNJA 2BHYA 3ZS4A 3PPHA 1KFJA 1H5VA 2WHMA 4U2ZA 1FH8A 2NXGA 2GLKA 1UD8A 4RE0A 2TRSA 4RK8A 4XAZA 4P5UA 3RHGA 2C15A 2G8ZA 5HK4A 4HK6A 3FN9A 1ISYA 5CCZA 3L0GA 1P6WA 3AUJA 3WK3A 1A5NC 1LG1A 1H63A 2V0TA 1BRLA 3H4WA 2D2GA 1ADOA 2A3AA 4O1AA 1K1DA 4J3TA 2OWXA 1KGXA 1R9ZA 4KCTA 2Y7FA 1PX4A 3HJZA 4IX2A 4X0VA 5A6TC 5I02A 4JN8A 1ZHAA 3GIPA 1UBSA 3E2VA 1VFOA 3GUWA 1YEYA 4XIMA 1W2VA 3R89A 1HQTA 5U4NA 3FVMA 2WWDA 5L9FA 3W7QA 3TV8A 4D6JA 5I0DA 2VEMA 3CUHA 1EJSC 1GVIA 1U2YA 4PMDA 3PAOA 2WZEA 4V33A 2QUVA 2VVNA 3ECQA 1FWFC 1PTAA 3NL6A 3BC9A 4MIMA 4YPJA 4JNMA 3KOWA 4X3ZA 1ICPA 4IHCA 3OYXA 1QTWA 4U10A 3TR2A 2Z2BA 2XH4A 1W3IA 2VQUA 4DY1A 2F84A 2VD9A 3M4HA 5LIKX 1IE7C 1X6UA 2AGTA 4NF7A 4LCQA 1KXVA 5E70A 1PIFA 2ZZ7A 1UPMB 5F1VA 3WK1A 4O1BA 2QCCA 1QVBA 2IXUA 4MWAB 3VGHA 4XKMA 4ILSA 3W7IA 5K9DA 1B3WA 1UR3M 2EAWA 3PNUA 3CMGA 2XGZA 1F9CA 4F8XA 1EIBA 4PRTA 3V0UA 1LOQA 1L8NA 2CFFA 2OYMA 2CESA 4QDPA 3U9IA 2EPKX 5HINA 4DJDC 1G67A 3VNZA 5AZ0A 4UFKA 3VNYA 1DP0A 3REQB 2WV8A 3VMOA 3H8AA 3ARRA 3S42A 2BZNA 4DF2A 3NZRA 5EMJA 5CGMA 1UWRA 2D2JA 3W73A 3CUXA 1SZRA 1LQAA 1OJXA 1Z6KA 3FEMA 2XWEA 5GJMA 2IKGA 1TPB1 3RITA 1W9BM 1AH0A 1R9XA 3VZZA 2GWNA 2EBNA 1K9TA 2PB1A 3E0IA 3XIMA 1JUBA 4ZL1A 5F4WA 1GWJA 5AYZA 1EA9C 3UXLA 1XI3A 3I10A 4GD0A 1H0IA 3WLMA 1QW8A 1KQZA 2PWDA 1KWGA 1F8MA 3NFUA 3RPTA 4HHLA 1KM5A 5AHFA 1PHQA 4QS6A 1Y5XA 3P93A 1TG7A 3IUDA 1EOMA 1J8VA 3USBA 3IGUA 3T42A 3GNOA 3W25A 2ZZ3A 2C8NA 3E38A 1T6MA 4H1ZA 4ERGA 5HWJA 1R0MA 2YSWA 4KWVA 3TQVA 2ZX6A 2A1YA 3RX2A 1E1CA 4GISA 4M80A 3OP2A 1AH4A 1K3UA 3OVPA 1JFXA 4I3GA 4C6JA 2ZA2A 4FK9A 3SCQA 1AH3A 1J93A 3PK7A 3MPGA 3LHWA 1LORA 3VILA 3DFPA 1XIDA 3Q37A 1IT7A 1WPCA 4HSOA 3RFAA 1U22A 2V5BA 4PBFA 3RRXA 3AZSA 2REQA 3S6TA 3EYPA 4MNKA 1GOXA 1E4NA 1GNXA 2WSKA 2GGEA 3OQ8A 5D2XA 1SU5A 1E6SM 1XLJA 1RLDA 3CH9A 3CZLA 4GNJA 4ZXLA 2Z1SA 2VCCA 4H9TA 1CW2A 2E9LA 1KCXA 3WQPA 5LHFA 4G56A 3BAXA 3GXPA 2VCAA 4QE4A 3KWXA 1TX0A 4JOMA 5D04C 3U2CA 4AZ5A 4BQ4A 5JIPA 3IVUA 4YNGA 2I5GA 4YN5A 4PB5A 5EMMA 3DECA 2FTPA 2AKZA 5AHEA 1M53A 3NTYA 3OIHA 3EDEA 3VX1A 5BWFA 1VGAA 5FACA 3S1XA 4GABA 1US0A 4U2YA 2P0IA 3FYYA 1UA3A 1U5VA 5XIAA 3GHRA 4PTDA 5EFFA 4UTKA 3NL3A 3KL5A 2Q8ZA 2JFEX 4PUJA 4H8HA 1TYGA 4RR4A 2CZ5A 1J0KA 3MMTA 4LWWA 4ROPA 2E8ZA 1Q7MA 5C70A 3AJ7A 3OGRA 2DT2A 2XIBA 3PZIA 2Y61A 1NY1A 5D37A 1F3EA 4FNUA 3I7RA 4LNYA 3IS4A 4MHBA 3LOTA 1NH6A 3O7UA 4Z17A 5E93A 1B54A 2E6AA 2B7NA 1P7TA 1P6BA 3M47A 1XYMA 4GXWA 4C7DA 1UR2A 1HP5A 3CEUA 4H3DA 4MB5A 2AAAA 1UKQA 4NZ5A 3M0IA 4GHRA 4R34A 4JYDA 2V68A 1JUEA 4O1CA 5AYIA 1R5YA 2RDWA 3NIYA 1F6KA 3VU2A 1SPQA 1XYZA 3CV2A 4KBXA 4U28A 3TWBA 1EDGA 2R1LA 1N8WA 1MXSA 2Q3RA 2WKJA 4XD4A 2O92A 3WH7A 1HN1A 1U5JA 4M6UA 1AA1B 5CZSA 1ZU8A 3K8MA 1CB2A 2VOTA 4AEFA 3UG4A 2QF8A 4LF2A 3ZT7A 1RJQA 4H8VA 5LXXA 2QV4A 1Q66A 3I65A 1H51A 5HMEA 5JXQA 2PLJA 4LS2A 4Z0SA 4JHZA 3WN6A 1ZBCA 4BF5A 2YDAA 2I57A 1OZQA 3FFSA 3BAKA 5AHMA 5CSUA 4PC8A 2E9BA 4J3WA 4ZQOA 1DOSA 1S38A 1BRLB 2QUNA 4ZB5A 2PCQA 2WMJA 2Z1VA 4QBXA 2C0AA 1FWWA 2Q3OA 3BZJA 1JYWA 5AHNA 3LTSA 2VRKA 1AUSL 1O1HA 1EHAA 2X0SA 2HWGA 1GYNA 2QLYA 1KCZA 1QCWA 1FBAA 1RJRA 2H3DA 5JBFA 3OU8A 2QV5A 5F2MA 4FOUA 4XD5A 1AD4A 3WNKA 1FOBA 1W9UA 2WMIA 3W38A 1PKLA 3N4AA 3K2GA 1OCBA 4DF0A 1NWUA 5JQ9A 4JTEA 2NXIA 1YE4A 1V6TA 4GZIA 4QS5A 4P7NA 4QGCA 3MCMA 3L23A 4JFWA 3C4UA 3KBNA 3GDLA 3H7VA 3AS1A 3C0SA 1DL3A 4D1JA 3IJ8A 1ALDA 3LCFA 1XUZA 3TYCA 3YPIA 3IRSA 5EPDA 3B4UA 3FNDA 5IFPA 1HL2A 2ZUVA 4REQA 4BWLC 3RX3A 1ICQA 3LPOA 3QSRA 4S1FA 1N2VA 3HO8A 3UNDA 2DUAA 2BGQA 4ATWA 5IDZA 2IKHA 3H12A 2DT1A 5HJYA 3MA8A 2OSYA 1KCLA 1ZTVA 4CQBA 1VAHA 1DJNA 3UBPC 1OFOA 2NT0A 1JQXA 2XZ7A 3EOEA 1JCMP 1RK5A 4V28A 1W1TA 1UD5A 2OELA 5DFAA 2NQZA 3V75A 1D3CA 3GH7A 2BG5A 3SCTA 2E9MA 1U33A 3NSXA 4FP1A 3QY7A 3C2VA 4X9YA 1H7XA 1ZAHA 5FEPA 5C2XA 4G1NA 3W1MA 5FOOA 1MEWA 3BVJA 3KAOA 3VGEA 3O8AA 1UP2A 4JICA 2OPJA 1MW1A 1FCUA 2EF9A 5D9MA 4BHYA 3VD5A 3UG3A 3WDHA 1EQCA 2CBIA 3H70A 1UD4A 4YVXA 4N7QA 4LYQA 3OG2A 1TUXA 3VUPA 2XN0A 4C6CA 5AZ1A 1XRTA 1JRCA 4D6HA 2CBUA 1F76A 1O94A 4AWTA 1XCXA 4Q4PA 1EO7A 1QPQA 1NQ6A 3STFA 1KFKA 3TAKA 1HJWA 1XGDA 5DCBA 3NO5A 5K9XA 4CQ9A 1GVRA 1W5PA 2FJKA 5A6KA 4D9PA 3TW6A 2YL9A 3VFCA 2VFDA 2GGIA 1EZWA 4ZQPA 4LTSA 3WJXA 4CD4A 1PDZA 1NFGA 4O0KA 1WBJA 1FFQA 3WLHA 1O5QA 1V3KA 1X8FA 3Q67A 1ISZA 1RPXA 1VJSA 3O1NA 3S2MA 4IFOA 3S1WA 3URBA 4P8UA 3R58A 2JALA 5XINA 2WCGA 3TSMA 3N34A 4UQAA 4UMCA 1VRXA 4MKNA 2W67A 2REQB 1ZFJA 1CEOA 1GG1A 2YA1A 1WDQA 2HS8A 1E51A 4ZEPA 4CQ8A 3N2MA 2PLMA 4DO6A 4KRZA 4A21A 3TDFA 1B3VA 1HX0A 4S3CA 4GY0A 5G2WA 2AAMA 3AFBA 3E0WA 3GFXA 3S1GA 5CAKA 2DORA 2V3FA 3VIOA 2GJRA 4BCEA 1LWHA 1WKEA 1FCVA 3TMLA 2OKOA 4P7RA 4BI6A 4RE3A 5LNUA 1VIWA 1FWTA 3TTOA 4DI8A 1QT1A 4WRHA 4QNEA 1PYFA 2VCBA 3PY2A 4LPCA 2QUTA 4C6NA 4MGGA 1TWDA 1JCNA 3W00A 2W66A 2OO6A 4TMBA 4W89A 2WVVA 3WBWA 1TCMA 4MPQA 1MNSA 1S5VA 3VDHA 1KFWA 3Q45A 4Q22A 2AQOA 1WDSA 5FAJA 3VGDA 1TPC1 4A3HA 5I3KA 2I1OA 5LGXA 3LUTA 1UOZA 2E25A 1GKPA 3AZTA 1ME7A 3LMZA 3Q2DA 1BWLA 5G2IA 1ESWA 1ISXA 4QLJA 1FP9A 2I14A 4NZJA 2MUCA 1EJVC 4LC8A 1BPLB 4H7ZA 2HDJA 5A8NA 1YNYA 4UBPC 3TC3A 1C9DA 4L56A 1S3TC 4BF9A 2ZUTA 4NG3A 1FWEC 3IJ7A 4EWND 1Z3NA 1L6WA 2VX4A 3LB0A 2DT0A 3DCPA 4M56A 3DKJA 2NLIA 4JIEA 4ORMA 4C5ZA 2G97A 3H2MA 5CQ1A 3GFZA 2XVLA 2NSOA 3VIKA 2RHGA 3W4RA 3SRDA 4M6PA 3AJXA 1ZY9A 3MZ2A 4HPXA 1ZS2A 3ARVA 4HZ7A 5K2ZA 4ML4A 3D47A 4UTFA 1AW5A 1W31A 4LVGA 5CPMA 3QW4B 2PGFA 3HB9A 2TPSA 3BUVA 4AAJA 1TWZA 1HKKA 1VRDA 2WM1A 1GEQA 3QZAA 6TIMA 3AQUA 1RQBA 1RD5A 4CQDA 2NQJA 4XTIA 3W22A 3OQEA 1XCWA 1WE5A 3A3HA 4JDYA 4M6VA 4LUTA 2GQAA 3UETA 1MNZA 1GONA 4F0SA 4GIRA 1S2VA 2ABBA 4MB1A 1J9YA 2IQ0A 3SUWA 3UGRA 3CWHA 3ABSA 4PMXA 4EOUA 4JQ4A 5EMUA 1RSCA 5DX7A 4H83A 1ECQA 2VMFA 1OG0A 3QR1A 1XD1A 2CKSA 1CGYA 2EG6A 1OVDA 4HU4A 4NSBA 5HUOA 2XVGA 1IZKA 5C2CA 1DQUA 4KH2A 2X42A 2J7EA 4GCXA 3PF3A 3TCEA 4CEUC 2VFGA 1XCFA 3WQ4A 1RCOB 1W3HA 4FR1A 1W3KA 1HO1A 2Y8VA 1UP3A 1W0MA 4MF4A 1PS9A 3CV7A 3BCFA 4EXQA 3VK5A 5E5CA 3WQFA 3W37A 3NWRA 3BXWA 4JKLA 1JG9A 4Q8QA 1OD0A 1CXIA 4MKSA 4P61A 3AXIA 5CSRA 3QC0A 2D0HA 2NUXA 3KHDA 4OOZA 4W4QA 3M5VA 1TJ1A 4CN6A 1QNSA 3PB2A 2H9AB 3DG7A 3ARSA 4HOXA 3HGJA 1I75A 5H2ZA 3LLFA 1PWMA 5KETA 3EEGA 1O95A 3BQ6A 2WMIB 3B8DA 3B03A 3PZOA 1E0UA 3PUDA 2PSNA 4KCVA 5JBEA 1A80A 1TREA 2BFGA 2Z1XA 7A3HA 1RJPA 3JUGA 1UH4A 5DF0A 3MVTA 1TCDA 1VENA 1XYAA 3GU2A 1GK8A 1V51A 4I9MA 2BX7A 3GW0A 1A4MA 2GGHA 3IGHX 1F7BA 1BKSA 1KRBC 3BLOA 3DH7A 4D6FA 2ZXQA 2PDCA 4REQB 5FJTA 4AVFA 3VDGA 1NFPA 3AYVA 1IIHA 4LX4A 1SGJA 1E56A 3F5KA 4J3SA 4KWWA 4XBKA 3B8SA 4G6CA 4Z2LA 1WOAA 3M41A 3A21A 3M6YA 4H6RA 3B9AA 2OB3A 3MCOA 3RJXA 2VEIA 2GJNA 2ZCGA 4ML9A 3N3MA 4NVTA 3UWQA 1VPQA 8TIMA 2JEQA 4Y9MA 3PWAA 3A4XA 4KGJA 5SWUA 2JIEA 2FZNA 4JFVA 3E0FA 1XWYA 1RLCL 3G1RA 4U31A 2IW0A 6XIMA 1K70A 4MY1A 1EJUC 1PBGA 5LIUX 1YDOA 2E77A 1XYFA 4C6PA 3QMTA 1Q3NA 2HROA 5D33A 2NX1A 3GXIA 5A8GA 2VC9A 2XHYA 1Y65A 2ZRZA 1IZJA 4Q8OA 3RDKA 4WHBA 2E09A 1JULA 3CZKA 4FEZA 4AVNA 5FJRA 2CYGA 1H7PA 4B5XA 3N17A 3C2RA 4CCDA 2CLEA 3QFEA 4O1FA 4J1OA 5C9WA 3C52A 4DWDA 1P5BA 1RCQA 4Y9OA 3DUGA 3PZQA 1HUVA 1F61A 2OXNA 4IJCA 4FR6A 1KV8A 3H6OA 2VQTA 4E2BA 5I3GA 2QCGA 1HJSA 2V2DA 2QF7A 1I1XA 1E6QM 2HK1A 4JFUA 1GOOA 1C7SA 3OEXA 1XLIA 3HFYA 2XJ7A 3WD4A 1J6OA 4XK2A 4YTQA 4IG2A 4HYRA 1M7OA 4IJBA 3A13A 1ZALA 2GK1B 2Q09A 1SW3A 2OX4A 3AAMA 3I4KA 1TJ2A 1TRDA 1MZRA 5GVJA 3AISA 4GUHA 1XYLA 4GQ0A 4IMFA 1R7OA 4MVAA 1F4AA 3UWVA 3MSDA 3EB2A 4PUNA 3P8IA 4S3EA 3N2OA 1OCNA 1Y7VA 4AMAA 3FYOA 5AKQA 1CGXA 2YKKA 4JIIX 3T7VA 3CZGA 2C14A 2E67A 4TVCA 4M1BA 2Y6ZA 4MADA 2ZKMX 3P3BA 1QOXA 3LV5A 3QQ0A 4NT0A 4O19A 3EDKA 4Y8FA 3G1AA 2Z24A 2ATMA 4HP5A 3FVDA 3CV6A 1JDAA 1W1VA 1E6XM 4MLRA 3R0UA 2ZUNA 1JYNA 2WVVB 3VZYA 2C71A 3TYAA 3RCMA 1XLLA 2OWWA 1H62A 3M44A 4F0HA 2I9UA 4GI8A 3KLKA 3POHA 2ZUWA 3QKEA 3TA6A 1Q6OA 1SM9A 2YB1A 2YFOA 5BXSA 1XLCA 3SFWA 2D0FA 3CUZA 3P67A 3VXGA 1OYCA 1N7KA 3UGVA 1HKJA 4X61A 3QHOA 3UESA 4LYRA 2BS9A 5CZTA 5CC5A 1FTXA 3LERA 1TV3A 1KTNA 3A12A 2O9TA 2V38A 2OFJA 4ZODA 2NX9A 4WDXA 1M65A 3UPMA 4M51A 1RHCA 3MMUA 1CWYA 4A8RA 3GH5A 3FXGA 3SQLA 4QQ3A 4JX6A 3ARPA 3N9SA 3SRHA 3DEQA 4UZUA 1MQRA 4OIFA 2R9RA 4L7ZA 2JKEA 2P3EA 2Y4SA 1L6GA 1B2YA 1ZBKA 4IIHA 1XBZA 4L6DA 5M3WA 3U7VA 3R6IA 1E0VA 3I4EA 4ZO6A 3S5ZA 3OVRA 3LD5A 3HQOA 4MNJA 4R27A 4IMEA 3QQ1A 2WKGA 1KRMA 5BNKA 4KRTA 1FWNA 4XUYA 3KZSA 5A6MA 4JFTA 3CZJA 5A8OA 3GO2A 3TLQA 4M24A 3E9AA 3NZ1A 3SN0A 3CXOA 4NAEB 3VDCA 4Y7EA 4LVAA 4B91A 1LZOA 1R3WA 1UWSA 4GYJA 3HG4A 3P5ZA 3H26A 4GZ7A 4PB3A 4EX4A 1A5SA 3C6CA 2FDMA 1N55A 1NDWA 1NIUA 1YDYA 1WCGA 3EPOA 1ML1A 2ZRVA 4PRWA 1UKPA 2OLHA 4W8AA 5AHIA 3TWAA 2B7PA 3LX9A 4UTHA 4Q32A 2G0WA 1KV5A 3UCDA 1XLGA 1EYWA 2XM1A 3GHSA 1YE6A 4X63A 5HJXA 2R6OA 2IKJA 2GWGA 1T41A 1LOSA 1LBMA 3KCJA 2O55A 3N73A 2FHCA 5GJNA 4AYGA 6ENLA 4FNQA 1PO9A 4HPGA 4CCEA 1TWIA 2V9DA 4QG8A 3ZXWA 1UA7A 1VD6A 4LBRA 3UG5A 2ZUSA 3ITTA 4WLCA 4EPDC 4C6EA 3FEQA 4B5NA 2VELA 3CAWA 4JD4A 2PRHA 1OZMA 4A3YA 3Q65A 1TMQA 1CGTA 1K7EA 2W92A 1SW7A 3GW3A 5TIMA 5HATA 4PMVA 3B97A 4KEZA 1K02A 2C1GA 4WIWA 4MNLA 3B8VA 1TIWA 1XIMA 3WLKX 1SZNA 2P8BA 4JTIA 4LY4A 5A6BD 1XIJA 4ENLA 1S2TA 1F05A 3FK4A 4JTSA 1IXQA 4UTWA 5GNYA 2BOGX 4HTYA 1ADSA 3GNDA 3ONBA 1JPHA 1OBAA 4RZBA 3TUUA 4TMCA 1QI3A 3NEVA 3QRHA 2QCDA 2PTDA 1PSCA 3GTXA 4MWAC 1M68A 6PTDA 7CGTA 1Q6EA 1X96A 1XUUA 1WZAA 4J5NA 3L7RA 5DRCA 3WLRA 4XG1A 5LIXX 3MBFA 1EC8A 1XIFA 3IVSA 1OK6A 4MB3A 1J4EA 4KFPA 3WLOA 1NARA 2ALDA 3LHZA 4XBSA 4Q4QA 2QJIA 2JIWA 2ISSA 2XSAA 2PP1A 1UQYA 2WNZA 3TN6A 3GHUA 5B80A 4DEFA 5TF0A 3ENLA 1E55A 3BLPX 2OSXA 1ODUA 3QLLA 4OU1A 1VLIA 4Z2JA 3OIXA 3G0SA 4O15A 3LCHA 1YADA 4UQ9A 3ERPA 3BCDA 4I8DA 5A8PA 1QK0A 4WY0A 4LANA 1WKFA 4GUJA 2UV8G 3BAWA 1XRFA 2X30A 3SURA 3GS6A 4DXVA 2ZUUA 1KFLA 1JF5A 1J5SA 2QYGA 1M41A 3PZGA 3KE0A 4DYEA 3WD1A 3L5LA 3M07A 2VGBA 1Q65A 1U5HA 2VZTA 4L4PA 1J0HA 4M3PA 5I6SA 2E7FA 4NUWA 1OX4B 3S2NA 3WH5A 4DWSB 4C1KA 3U5UA 4HCLA 2QQ6A 3KLLA 2VC5A 2FFIA 1W6TA 4LEQA 1E4MM 3RX4A 3LEPA 2XIJA 4WZHA 3L67A 5FEWA 1CTNA 1E1FA 5DRIA 3WQVA 2VL4A 1I8JA 3CPGA 3EWUA 4IFKB 3ITXA 1FWBC 4OE7A 1GQLA 4NRSA 1J2BA 3SI9A 4PB4A 1OFPA 3EX6A 5E9AA 4S39A 3L4YA 3GTFA 4PA8A 4K8GA 4LOCA 5FJIA 2DSVA 4JYFA 5FCZA 2DW6A 1U30A 2GSEA 3W53A 1OHLA 4K1GA 1JGMA 3JR2A 3UCQA 2Y7EA 1G4PA 1QNOA 2XFYA 1UMLA 5HXMA 3VTRA 1XS2A 1M7XA 1BGAA 3HPSA 2Z7GA 1E40A 1MW2A 4W87A 2QCMA 4D6EA 4TIMA 4AY7A 4L6OA 4O13A 3T08A 4AHPA 2GGGA 4DO5A 1JZ5A 4IMDA 3W7HA 1S2WA 4GZEA 3V5CA 2PURA 4MAVA 1KXTA 2PDHA 4P7LA 1TA3A 3MZNA 3MCNA 3B0PA 2GL5A 4NI3A 3WF1A 4NJJA 4B2DD 4GXMA 3RG6A 4A8IA 3HFTA 1YW1A 4QP0A 3B0XA 3ZR5A 1TPWA 3OA5A 3WBEA 3KOXA 1WZKA 1IXOA 6ALDA 1KFCA 2F8QA 5C7HA 4UTMA 1CCWB 3UJSA 4LEFA 2BGNE 3VIPA 1NP2A 7ENLA 2KAUC 1V3LA 3DU0A 4CU7A 1E72M 3UXDA 1OM0A 1WAUA 1Z69A 3W1NA 4WY0F 3A4AA 4RNHA 1IEWA 4CNTA 3HU7A 3P5YA 2J9XA 4I9AA 1C93A 2PLCA 4GFIA 2CHNA 3SJNA 1NSJA 3AO0A 3BG9A 2Y7DA 1ENUA 1Z7AA 1UHVA 3A9BA 4AMCA 3U48A 4O17A 2D24A 4V27A 3VD4A 4YHGA 3EOOA 4JXCA 3ZZ1A 4JTAA 4WDWA 3NJ3A 4TO8A 3R2GA 5MKGA 3CPRA 4ZOEA 1DQXA 1O4UA 4FOJA 2DZBA 3IK4A 1G69A 2QAPA 4JN7A 1P0DA 3BOXA 4Y9AA 3ABQA 3M64A 4GNKB 5G4WA 3CS2A 3R11A 5U7SA 3TW7A 3EA1A 4EE9A 3NG3A 3WYZA 3G3DA 4AEOA 5C71A 1R3QA 1DWHM 1DWIM 4GACA 3P8JA 4I5RA 3RLHA 6XIAA 4QAWA 3SGUA 3AOFA 3H7UA 2FPTA 4RCXA 4BQ3A 2WC4A 1UASA 2NQLA 1POKA 4D8AA 3RPDA 2VVSA 2PDLA 2QNEA 2V69A 4UTIA 3U4AA 5ABTA 1OIFA 3FDKA 3KOFA 4GX9A 1XISA 2W4XA 4GBDA 1GCYA 4AIBA 3WF2A 3SIMA 3CEPA 3CYJA 1X8CA 1CIUA 2PE4A 2YGYA 3VKBA 2POZA 3VGGA 1POJA 3TN3A 3M1ZA 4GGHA 3DHDA 2O9OA 3LM7A 1BWKA 1H41A 3U57A 3GXDA 5IHRA 3VMPA 2PAJA 4GXPA 3BAYA 3P80A 4FIRA 3TQ0A 2WJDA 3ZT6A 1CDGA 3IJ6A 4IJRA 3I3EA 3UWYA 2BY2A 1UR8A 1NEYA 3ONCA 2ABAA 3B9EA 3RMEA 4FLQA 3CIXA 1SUXA 2NQ9A 1M01A 2PTYA 1XIHA 4OECA 4B5TA 3JRKA 1LL4A 1X1OA 1ZJBA 3DYOA 1R3YA 3LZ3A 4ZFCA 2V67A 3VCCA 1DJHA 2VDHA 4A8LA 2QDHA 3INPA 3PWIA 1XV8A 1LRQA 3IJQA 3PPFA 2RUSA 1XG4A 2FZDA 3KTCA 1HIZA 4XZIA 1ZZMA 4ASTA 2BLEA 3QZ6A 1GZ1A 5A6BA 4JTRA 3TEVA 4AZIA 3DI1A 2OEMA 1W1ZA 4L9XA 4OBTA 4WSHA 4MDPA 2XISA 4ONVA 2V6AA 3CB3A 4O1DA 3RILA 4C65A 4BZYA 4XISA 1R46A 3MP5A 3SR7A 2CLLA 3VAVA 2DSUA 4GYFA 2PU1A 1ICSA 1QPRA 2CBVA 3ZJ8A 2Y2WA 2A7RA 4FS9A 2CETA 2Z0IA 4L6HA 4HB7A 4BI5A 3CNYA 1L0PA 4Q8UA 3PS7A 4UR9A 4D6CA 2ZVIA 2Y5EA 4YXGA 2Y63A 3HV8A 5HQLA 3QGVA 3MI2A 2QCDB 4AD0A 1CECA 3I68A 3QW3A 4X2RA 2O7SA 4U33A 1ZSXA 1F8IA 1V0KA 3HA1A 5H91A 5D02A 4J35A 4JIQA 3RM8A 4ZE5A 2RDUA 1RVKA 2WCSA 1OEPA 5HQEA 3L0KA 4XAGA 3EWDA 3AXHA 5FJUA 4P2VA 1ME8A 2FGBA 4V15A 1MW3A 4HJFA 1V3IA 3MWAA 4ZFMA 3B8WA 4D8ZA 3ZLGA 4MSSA 3WUEA 1Q45A 2DQWA 4UTUA 3LRMA 4F79A 4OOUA 4WXYA 4DM1A 3RPMA 4MJMA 3GG0A 3GTNA 5A2AA 3G1SA 4W9TA 2J9ZA 4IMCA 4M7TA 1W17A 4TX8A 3WNMA 4QR6A 4AC1X 3TN5A 3NGFA 3CL8A 4RXFA 1Q85A 4E38A 5C9ZA 5T8GA 2EJAA 3BG3A 3ELFA 1WDPA 4WCJA 3S1VA 1AZ1A 5EMYA 3ANVA 1UR4A 1G94A 1H2JA 3EWCA 4IUGA 1RH9A 3MUAA 3JVAA 4K8HA 4C7FA 5DEZA 4BFAA 3I7SA 2OT1A 1XKJA 2F9RA 3E49A 4GE8A 2POTA 4UTLA 1IWBA 2GUYA 1HZYA 5F7UA 1FWGC 2VX6A 4WUIA 2JE8A 3BOLA 5IFTA 4FALA 2YZ5A 2ODOA 4E8CA 4QJ3B 1B1YA 4IPNB 2DSWA 3N15A 2PTXA 5IXEA 2PRMA 2I56A 2ISFA 4N4QA 1F3WA 4PCPA 4PCTA 4E2VA 1PAMA 2C16A 3BMXA 5B7YA 4R7WA 2OQHA 3P14A 4W5ZA 1RD6A 5DBUA 2GFTA 1B4EA 5G2HA 3EKGA 4P8WA 2A7NA 1VHCA 5I2UA 3FGCB 3WF4A 1XSIA 3NL2A 3CHDA 3WD0A 3BJSA 3SUSA 3AZRA 2OZ3A 2Y5JA 3QZEA 1DIDA 2OJPA 2V8ZA 3E0LA 4B2DA 4O28A 2FIQA 4J3ZA 1R6WA 1V6UA 3FX4A 1E73M 4Y2WA 3UWZA 4GUGA 3AWNA 3L68A 5BU9A 4ZSTA 3MUXA 2XVKA 3LRLA 2H6RA 2NV1A 2WPGA 3W88A 1HP4A 4HTBA 3ZOAA 4JQ2A 4MWAD 4RUBA 4YVPA 3DHFA 1TA3B 4LUIA 1OYAA 2W62A 4MDOA 2C3ZA 4GZJA 4HA4A 5F2LA 3SEPA 2PDWA 1QFEA 1TE6A 4N02A 5D2YA 2HE5A 1HKMA 3EOSA 3LLDA 4B3KA 1S2AA 1QNRA 4M7SA 3PTKA 1TV2A 4E5TA 3LV6A 4PMYA 1TUFA 3CO4A 5K3VA 1XC4A 3LS9A 3AC0A 1XBVA 3TXVA 1KW1A 4AG0A 3KCLA 3DIPA 2DV0A 4QITA 3OGSA 5T26A 4UOJA 2BASA 2PF8A 2WVUA 4WOQA 3H23A 4UCFA 4JR5A 5DMNA 4C7GA 3FDGA 1XDLA 3T8QA 2X41A 4GVHA 1TMHA 2VURA 5B7ZA 2QCNA 5C6MA 2A3HA 2YB4A 1GUVA 5MKGB 3P0XA 3DERA 5CGQA 1XH1A 5E6YA 1HXJA 2LLEA 1FH9A 1FA2A 4RX0A 1HL8A 3CJPA 1EJRC 4GKLA 4RW5A 4HCHA 1FWRA 5EGRA 3TNBA 3CASA 4UQBA 3O05A 3MSGA 4FAMA 3RO6A 5IRPA 2YX0A 3WK2A 2VTFA 2DH2A 1XLFA 3C2EA 3V5OA 3PBGA 1RBLA 5HAOA 4H2HA 3TC6A 5CLWA 5D9PA 3F4DA 1UWIA 1QO2A 1KM0A 4BS0A 3LXAA 4OV9A 4V1YA 4JHOA 1EGVA 1K9EA 1ZNNA 3AHTA 3DAQA 1UIPA 3P6LA 2G41A 2QJJA 3HPAA 3T44A 5FAGA 2PGWA 3G1VA 3WMLA 4NL1A 2QPXA 4IXXA 1UR1A 1EQPA 3TTSA 5BRQA 4DBSA 2Y89A 3EEZA 1F73A 1PZ2A 4Q4OA 1ZP4A 3CIWA 3MKVA 1FHUA 2UWFA 3W26A 4DBEA 3MYOA 4GIEA 3M43A 2J77A 3M0KA 4O50A 5HPOA 4GMEA 2NQHA 4GYKA 5AYBA 4C6IA 3T07A 1W3NA 2C1IA 3HGRA 4LS1A 1J79A 1RBAA 1U83A 1K9DA 2E3ZA 3BLFA 3P60A 3A24A 1M6JA 2J79A 4AD2A 2D2OA 2Y1HA 3AMKA 1US3A 2CBJA 2P76A 2HZGA 2VZOA 3T2OA 1B57A 4DJED 1EYEA 1RQEA 3HG2A 2EKCA 2V2HA 4DNMA 5LKYA 1RP8A 1XIBA 2Z6JA 4F0RA 3GAKA 2P1FA 3ZSTA 1YTDA 3WLLA 2WSQA 3ZSSA 2VUYA 3WH6A 1AL8A 1DORA 1YRRA 4Q7IA 3UA3A 2PZNA 3O07A 1SMDA 5JH2A 4GI6A 3WY1A 3M0HA 1GW9A 1JF6A 2O9PA 2QEZA 4LFYA 3DYMA 3ZWTA 3PG9A 3W1UA 1WB0A 3IWPA 2A21A 5FSDC 4O4WA 3UD6A 2WC7A 3IV8A 4O0ZA 1B9ZA 2HTMA 3QMSA 3GAYA 8A3HA 4OQVA 3M0VA 4JTJA 4K38A 1G7UA 4HU8A 3WKZA 2DIKA 2R1NA 3UXKA 3APYA 5DY3A 2ZE3A 3I3BA 3KL0A 4JKKA 1MQQA 2V3EA 3PSVA 3NQEA 1GPWA 1G01A 4HHPA 2PDXA 1AZ2A 3GNPA 1DJGA 2ZIDA 1X6LA 4AH7A 4K36A 1EP3A 1JPMA 1TPVA 4A3UA 1T5AA 4S2CA 2V5KA 2J7CA 2VJXA 3F2CA 1BXBA 4F2BA 4Q33A 3NAVA 1JVNA 4Z2GA 4GH3A 2GQ3A 5BROA 3XISA 3R1ZA 3KFTA 4NJHA 4PMQA 3IAPA 1JCXA 3ME3A 3POCA 2W63A 4AZBA 2NXHA 1R38A 3MTWA 1QNPA 1GJPA 2CLFA 4HMNA 2P88A 2WJEA 1JCYA 2QAFA 1JNEA 3OBEA 3LMYA 5DMMA 5EFDA 4DHGA 4RKAA 2PWUA 2H8XA 2CHOA 3GXMA 3SCPA 2CW6A 5DBTA 2W79A 2UBPC 3V1HA 3TX9A 5FEXA 2QHAA 2DY3A 3TK7A 4MLJA 2UY3A 4I7VA 3WDPP 1KWKA 5KTLA 1Q63A 3APGA 1IHIA 3CT2A 4O18A 1XP3A 4OV4A 4HT3A 1E3XA 3S5SA 2WNWA 2WHJA 2YBUA 4AEEA 2VFIA 4OVXA 3ANYA 4KCUA 4P7QA 2AL1A 1AK5A 5CZ0A 4MWAA 2YYTA 3LGDA 1Q7QA 4ALDA 3BLEA 2BOFX 2YL6A 1HGYA 1XC6A 1KXHA 3CMFA 2PDMA 3VO0A 4XZWA 2NWRA 4XZNX 3H53A 1D3GA 4F0MA 2O0TA 1S46A 4IPIA 2PWVA 4F0KA 4R7OA 3N6HA 4J9JA 1A0DA 1W1A1 3W7MA 5CC7A 3MJMA 4WD0A 3REQA 1JZ2A 1WKDA 5CJNA 4B9ZA 2P50A 3W75A 3F4WA 4YTTA 2F61A 2NWSA 4AWEA 2JKAA 1A53A 3OJGA 3FYPA 1IT8A 1DXIA 1CNVA 1W8GA 2R24A 3EPMA 4XKYA 4IF2A 2PC4A 5KMYA 4W88A 4HSHA 4M6QA 2VGGA 1EFZA 3B40A 1E9YB 2PS2A 4ORIA 1S5NA 3UPBA 3VFLA 4B9YA 1KTBA 1VYPX 2WQPA 1VLWA 2FYMA 1KC7A 3UXIA 5EA9A 3QLDA 2XWDA 3PBVA 3WJZA 2W3ZA 2BSLA 1WUFA 3GR4A 4V2XA 2CEQA 3QBUA 3SECA 3CLWA 1XR2A 3V16A 4DUWA 4QISA 3UR5A 1E70M 2J8FA 2V5DA 3QEZA 4I7WA 3BGJA 1UB3A 2NVCA 1IZCA 5BOFA 3DG3A 5BYWA 1OINA 4O12A 5LNRA 1ADDA 3NQ8A 5E0KA 4IIEA 3O06A 4UWMA 1EJXC 3OB8A 3RLVA 4BF7A 3PJUA 5KITA 4JQAA 4H2CA 4DYJA 4L61A 3DFQA 2VKZG 1H3GA 3CT7A 5J5RA 4R3UA 3G8RA 4HNNA 1D7KA 3KWSA 2PGRA 4ZOAA 4CLMA 4KF1A 1A5LC 4DIAA 4E8GA 3TYUA 5AC7A 1LWIA 3LDVA 4RPPA 1S5TA 3GVRA 4JTHA 1U1HA 3KCOA 3T9PA 1H7RA 2YJQA 3C0QA 3BK0A 2EXOA 3G1YA 4Z1CA 2FDSA 2O4QA 1K8XA 2E6FA 3W1TA 1JAEA 2OWCA 1PUDA 4AD3A 4CQAA 1Z89A 3T0DA 5CSSA 1WDRA 1V93A 3WDJA 4FLOA 5DMYA 2E6YA 1I4NA 4K37A 3FS2A 2DIJA 4DJFD 2EPOA 4ZZ9A 2J4GA 1JZ3A 1WX0A 5DN1A 2QT3A 3II1A 1NP0A 1VFSA 1L9WA 1UP0A 2XIQA 4GX8A 2VRQA 3HIJA 3EOUA 3TAOA 4L5ZA 1V3JA 1DXEA 5CG0A 4DJEA 4D72A 1S39A 2R82A 5EBUA 5D4YA 4WJEA 5EKYA 3IJLA 4IX0A 1ZAIA 4Q8WA 3BGAA 3LBMA 4KGLA 4UTJA 1QW9A 4Z2IA 2E5DA 1UUQA 2DP3A 3LHTA 1TPFA 3VKCA 2GVJA 2WB5A 3OVQA 1LBLA 4JKMA 2PI6A 3BE7A 3H2NA 4RXGA 1XG3A 2PBGA 1KXQA 4AXKA 4EF9A 3PZUA 3CUJA 1I2RA 5LA0A 1O5XA 1SO3A 1UIOA 3MDUA 3UP8A 3BAIA 3TQPA 2DVUA 1VEPA 3WQGA 2HSAA 3MJYA 3QSTA 4WVXA 5G1YA 1TVPA 2DJXA 2JF7A 2EJ1A 3G5EA 5ABEA 2RJGA 1JEZA 1FX6A 4V1XA 1B31A 1O1ZA 4GFSA 1VHNA 2EPMX 4F0LA 3UT0A 5CBIA 5FF2A 2VHLA 3BOFA 5HMFA 3DOPA 2YCKX 1LT8A 1V5XA 2R91A 4IT1A 2FGZA 1LRNA 1DXFA 5CH9A 2INEA 1SO4A 1ME9A 4YJ5A 1IV8A 3GRIA 3TLLA 3SCRA 2JK2A 3HOJA 3W29A 1TR1A 1GVSA 3OBKA 2JKPA 1XQLA 2V5CA 3BLIA 3HMCA 3F5LA 2VENA 3B9OA 1SFJA 3NQ2A 2WVSA 3W02A 1F5ZA 1DWJM 4F66A 3LHUA 4LW7A 1UZDA 4NZCA 3CQ0A 4FNTA 1EGZA 2X1IA 4X22A 1W5MA 1HG3A 4NJGA 1ZL1A 3EDDA 1VFHA 1G4TA 1I6NA 1YHTA 5E6ZA 5TQLA 4O11A 4KEVA 3TP4A 3FSTA 1T96A 1W1YA 4O52A 4O8AA 5I06A 2R1PA 5F4SA 3PULA 3F2DA 4GO9A 2QKFA 3VIIA 1Q2RA 3W72A 1VB9A 3N9RA 5A2CA 2QMKA 5E1QA 4MJ4A 3DDMA 1IWPA 5HJLA 1TB3A 4UMBA 3R4IA 5G1TA 4FNPA 2VFEA 1TQJA 1EOKA 1B3XA 2VEKA 3RXZA 3N3TA 2UY4A 1UKOA 4N4PA 1GVYA 3G24A 4BI7A 1U1JA 1X1NA 4H6EA 3TH6A 4UQCA 3DENA 2XM2A 1DBTA 2Q01A 2WK2A 1SMAA 4MFEA 1GJUA 3DBPA 2VP8A 2OODA 1UMYA 3EA3A 3ANUA 2BXVA 3M5ZA 5LA2A 3WELA 1XH2A 3ZFHA 4NYUA 3W70A 5GNXA 4CKQA 3H55A 3RMJA 2ZZ1A 4KCWA 5T91A 4TTGA 1YDVA 1O5RA 1UW9A 2P5NA 2DUZA 2AMXA 2EQDA 1VR6A 2A6LA 2HVOA 4AFYA 1LJYA 1VBGA 4JY9A 4MNMA 2YA0A 4JX5A 3M5YA 5DY2A 4N42A 2EKGA 1MQPA 3S5NA 3NQDA 1Q6DA 2ONEA 3U2ZA 3VNLA 2ZA1A 1PKYA 3AYTA 5L6UA 4C1NA 1K7FA 3PZMA 2RAGA 1VP5A 1UCWA 3N2CA 3KOYA 3CHEA 1HVXA 3GK0A 3HF3A 4B5VA 2FZMA 4XUGA 4NP7A 4YHEA 3NVTA 1E9ZB 1V02A 5HQMA 1TWSA 2ZQ0A 1EKOA 3PBWA 3RLGA 3AS3A 2F6KA 3EMCA 4HU3A 4YTRA 4Z1YA 3F1QA 1A5MC 3V5FA 4LS0A 3ARWA 1IEQA 3FAXA 1QI2A 4AD4A 4QNWA 3WLSA 2ZDRA 2IKIA 3AIVA 1C3FA 2FZBA 2CWNA 1CBGA 4L4LA 1A47A 3RF9A 3KRBA 2DEPA 3GNNA 3NURA 1EUAA 4LAUA 4XKYB 3HZ3A 4X2PA 3QPZA 1R87A 3QYSA 4ZQCA 1VIZA 1MRQA 4I9TA 3W7GA 1MO0A 3E2SA 3NQBA 1WYIA 3H4GA 3IJIA 2ACSA 1YYAA 4EXAA 1VC4A 1E9IA 1YPIA 3RU8X 4QTGA 2PDKA 1ZRQA 2WAGA 3IRDA 1CX9A 1US2A 5H8PA 1MMFA 4MUPA 4TTUA 4LC6A 3MKKA 1CT5A 1Q6GA 2VC7A 4AX6A 3S46A 5FD0A 4F48A 5CPSA 1F6PA 4O14A 2B7QA 1CXHA 3WQOA 1BXCA 1X7IA 4OTKA 1V6VA 4ECLA 1BKHA 1JCLA 3TJXA 4ACZB 4Z0JA 1F4HA 3GSMA 2D23A 3LPGA 3L2LA 2FZ8A 4JL2A 3W07A 1MXGA 1P1MA 2DH3A 2D1ZA 3FA4A 4H9ZA 4O53A 4N9DA 3AALA 3URNA 4WDUA 2Q71A 3RCYA 2DIEA 4AU0A 2A4AA 3P74A 4PH6A 3MUIA 3PM6A 1BVNP 1NJJA 1UPPA 4QE1A 4CD7A 1TVNA 3NQGA 1XLKA 4YTSA 5DXYA 1BYAA 2ZUMA 4DBDA 4AC7C 4WSKA 4IICA 4DB7A 4M29A 1PXGA 3LBCA 6TAAA 3ZQ9A 4DJFA 1ZAJA 3TTQA 1QNVA 2GJPA 3HPFA 5KEZA 4OWGA 3SCNA 5EMKA 1V08A 3QQWA 4LB4A 4CGTA 1L2QA 4E2DA 4TVDA 3AICA 3ZJ6A 3IIVA 2WXDM 3EZ4A 3K4WA 3SSZA 3KBSA 3KZPA 3HGSA 1H1ZA 3AWOA 4JQ3A 4HPJA 3UWEA 1M1BA 2E5CA 1S5WA 3IIOA 3VIFA 3CK5A 3WDIA 1TIMA 2WVTA 2Z6IA 3SCVA 1XYBA 3WLNA 2OEKA 3DFHA 2VFFA 4FSAA 4EAYA 5IBXA 3VGFA 1TR9A 4W86A 4A4AA 1G6CA 2ISWA 1JAKA 1E71M 4GY7A 4PSPA 3WD2A 3VVGA 1JCTA 3T09A 4QJ1A 4Q4MA 3B0VC 3TXZA 2E8YA 1DJZA 5H6HA 3PWGA 2WHKA 5K7JA 3GLCA 4IP7A 3LCXA 4KQNA 4XQ6A 3W1RA 2R8WA 2ZTJA 3WMSA 1MVYA 4IQLA 2GVLA 4H4IA 2W0UA 3QV6A 4ZTYA 4KW2A 1SZFA 1CXFA 3MI3A 1F3XA 3QXBA 2ZDSA 3N11A 1PDYA 3T78A 7XIMA 4D1IA 3GDBA 4E6MA 2PP3A 2YXXA 3LCLA 1M7JA 1XW8A 4O16A 1G4SA 4BA0A 3WSUA 3I6EA 4J2MA 4D6IA 1MFVA 1R2SA 5FI8A 5I3IA 2F6XA 3LYEA 1BAGA 2G95A 1BWVA 1XRSA 3DHPA 3S2JA 3RM4A 1P4CA 2J8TA 3IV3A 4KPLA 3QV8A 2OVLA 3FW6A 3EDFA 3QHNA 3CZEA 4JTCA 2X0YA 2FB2A 2ZX7A 5FF0A 1M9HA 3WUFA 4MAZA 3H2AA 2PP0A 3FIGA 4UTWC 4EXBA 3R25A 1GZJA 3BWWA 1RA5A 3W7EA 4RW3A 1YNQA 5JIWA 2CZFA 3PZVA 3A64A 3EMQA 1WZLA 3GHTA 3C0LA 2V5JA 1JPDX 3UXAA 3BSGA 1K77A 4HMEA 5D03A 4IP5A 1LLZA 1V03A 3STPA 1Q8AA 4PFMA 5A69A 1OFEA 1PJ9A 3VE9A 2D22A 2PDGA 1P43A 1B4KA 1ZCCA 2BVWA 4IGSA 3B9NA 3CIVA 1HL9A 2FH8A 3G1HA 3MO7A 3W2KA 4GY1A 2YCJA 1W3LA 2J62A 1FKXA 1AQHA 4URIA 3P84A 3W7KA 3NO1A 2Z2UA 3A47A 4C91A 1IEVA 1RVGA 1REQB 4NXKA 2WJZA 3NPVA 1EDQA 2XN1A 4GQGA 1CZ1A 4UXDA 3LQGA 3MP4A 1I45A 3HV9A 3W82A 4IQDA 1Y5VA 5DCDA 1A3XA 4UB9A 2H9AA 1GT8A 2X7WA 1KM3A 3SY5A 1PL9A 3VKAA 4YMZA 3L4WA 4JQ1A 1HT6A 3THAA 2ZOXA 4XB3A 2C19A 3GDMA 2C7FA 4JBRA 4UR7A 3MSYA 3BLDA 2DW7A 2OLSA 1ONRA 2OU4A 4E2OA 4UTTA 3WEOA 1EF3A 3MT1A 4N9BA 1DJIA 1PYMA 3U2OA 3OLIA 2OSWA 3WUBA 2HBXA 2GQ9A 4YCOA 3UF9A 1VPYA 5DO8A 4ES4A 1QBAA 3KDNA 3VKKA 1KBBA 1IXPA 5J5DA 4O54A 3FKKA 2P10A 4UFIA 2TMDA 1UKTA 3HURA 1LLWA 3O6DA 5A94A 3LHYA 4OT7A 4XO7A 3NO3A 2E5BA 3VE7A 3EKZA 4A2RA 4RZ5A 4RZ4A 1Z44A 3KDOA 1EP1A 3BARA 4C1NB 4ATLA 2DFAA 4L4MA 4DO7A 5E09A 5G4EA 2XUCA 4N0RA 5EYWA 4QLLA 4RNIA 1JI2A 3QJAA 3L2IA 2CERA 3IVTA 2X1TA 3VMNA 3PP7A 3O3RA 5D05A 3OLGA 1P0EA 3CBWA 2XSBA 2ISDA 4ADTA 2VXNA 3G1DA 4B3ZA 4JTUA 2W5FA 4MYAA 2R1KA 1OB0A 4BEQA 2J7BA 5LIWX 2PWEA 4IGMA 5K9CA 3WEZA 4AZ7A 1X6NA 3I7QA 4IZGA 2DPEA 5D8ZA 1VS1A 4WR3A 3URQA 4JCMA 3RR4A 3WLJA 3AMDA 2HISA 1P0NA 1B3OA 1P48A 4WKAA 4UUIA 1ONEA 4PULA 1W1B1 3BANA 5A2BA 2VZVA 2J6XA 2NSXA 4GBUA 5CEWA 5BMWA 1KM2A 4GYPA 1A5AA 4E0CA 4AHOA 2D73A 1W2PA 3MUZ1 3UJEA 2PU0A 1LWJA 3NQAA 1HJUA 2I17A 3N6QA 1QI4A 2EEXA 5M5DA 1F6YA 4HN8A 4HYWA 4PODA 2OYLA 1ZQ5A 3VOFA 1RY8A 3BQ5A 2C1HA 1BEUA 4QSHA 1XFBA 2OZ8A 3PC0A 2YL5A 1VF8A 1QNQA 1RBOB 1AD1A 3STCA 1XD0A 3OA3A 2YXOA 5I24A 4DWSD 4E4PA 5IHSA 3UZWA 1OFRA 1HNYA 1EL3A 2GK1A 3NEHA 3CAQA 3L2MA 4XTDA 4ZXOA 2WW5A 4UFHA 2OTDA 1EXBA 3OZPA 3UWWA 3PR2A 4MOZA 2BP1A 3W2NA 4AF0A 2FZ9A 3W7PA 4WEVX 3TFXA 3EXSA 1OF6A 2ZTKA 3HM7A 1HW6A 1PX8A 4K6AA 1YNPA 1F74A 1DIEA 4MUZA 1WBHA 2CZEA 2WZMA 1TTIA 3K1DA 1VFTA 3QY6A 1TSIA 4BQ2A 4XX6A 5BRBA 1VBHA 4U4MA 4N2YA 3ZVIA 2G5WA 5I3JA 4PMUA 1A0CA 2FTYA 2VR4A 1XIGA 2I5QA 3NDOA 2V82A 4CU8A 2DZWA 1BTCA 1OQFA 4O1EA 2ZWZA 4CD8A 4LXFA 2FMNA 1W8SA 2PFHA 4Y90A 1O7AA 5F2GA 1CLXA 4AY1A 1MRAA 1E6RA 3VABA 4QRNA 4FB7A 5HWMA 4HZ8A 1H11A 1LT7A 4EK7A 2V63A 3W84A 3O63A 2QULA 3IARA 4FX8A 1F2JA 1JZ6A 3T0AA 2GJXA 3TSDA 3TZNA 5GQBA 1J5TA 1W5OA 5HNNA 5FSEC 4B4HA 2XFWA 3O9NA 5AECA 1EX5A 2IQDA 3SAZA 3B0UX 1TV5A 2VO5A 4BKNA 4CD5A 3AMCA 3TJ4A 4NJKA 1A5KC 4BR1A 3E5BA 5RUBA 5FL0A 3WF0A 2VEFA 3M46A 1HVQA 4Q6JA 4KWSA 2DSKA 2AQVA 3EGJA 1R3RA 4AHQA 5LYRA 3ZWSA 1UZHA 2VEGA 2OR2A 2WSRA 3PZNA 1AVAA 1R3VA 3EWZA 3TOYA 2CNCA 4LAMA 4R9OA 1QW7A 3LNMA 3W27A 3GG7A 4MB4A 1GQKA 1LG2A 3WFZA 1ELSA 1BSLA 3PFRA 3C56A 2A3CA 4ZQRA 3CZ8A 2R1MA 4HSNA 4NAEA 3DG6A 4LQ1A 3VZXA 4I6VA 4IISA 3C8FA 2HPMA 1XBYA 4Y8EA 1B5TA 4G7FA 1I9CB 3ZMRA 4JTLA 4QCFA 3TTYA 4KESA 4GK8A 1R8LA 5REQB 2YDRA 1H1YA 1OK4A 4JNZA 1UOKA 3ZVHA 4CU6A 5LNSA 1WXYA 3K1GA 5I79A 4CQCA 1TE1A 5TD4A 3PJXA 2GJLA 3NPXA 1OC6A 4WGXA 2EG7A 1LTDA 3ARQA 3QF0A 3GDKA 1AQMA 3W2UA 1WA3A 2DZUA 4O8RA 4BK9A 1UBPC 1WOBA 1J10A 5LGZA 2PF0A 4GO8A 3UQNA 4MZ8A 3RLUA 2YFNA 4FPSA 3E12A 4NNBA 3TSBA 4Z42C 5C9UA 4JX4A 3NDZA 2EPNA 2NX3A 3AHXA 4G7EB 2Y70A 3NA8A 1Q8JA 1O68A 2XGIA 3UNTA 2JGQA 1DQWA 4PMRA 1OC5A 2WC3A 3I6TA 3PUGA 2WCAA 1QOQA 1GVOA 2B7OA 3KBVA 4IPJA 5E9XA 1UR9A 2SFPA 2PGEA 1LLOA 2BNJA 4HHHA 4PUEA 1KR1A 4NNAA 3W7NA 1R9YA 1NOWA 4OBSA 2OQYA 2O9RA 3AXXA 2WM0A 3VOJA 1EXPA 2AGKA 3GU9A 2ON3A 4J28A 3W0KA 2FHBA 4YL2A 4MPKA 1YTKA 1V3MA 3G3MA 4PBGA 4NKCA 1FY6A 1XRVA 4F3HA 5G4HC 3JW7A 4XZBA 2EPLX 5HDRA 2Z26A 1DYSA 3QGKC 2D2HA 3NZGA 4KIEA 1HF6A 4PCSA 2WLYA 3B8IA 3UR2A 2HEJA 3SCWA 3H4XA 1Z9AA 2BHZA 4ATDA 1YX1A 5BCAA 2J7GA 1D3HA 1GYLA 4QX4A 1QU4A 1LP6A 3ZO9A 1PPIA 3F4CA 4LNCA 4N9CA 1BF2A 2FGLA 4F4RA 2EGZA 5J04A 3S3GA 1Q7ZA 3VOGA 4W7WA 4PMJA 5D2TA 4NAFB 4PTVA 2ZX8A 1QRQA 2PD9A 3IJ9A 4GPNA 2TSYA 2JQXA 5AOUA 5LNWA 2C79A 3LXBA 1BSIA 4FXFA 4JIRA 2QGHA 3STEA 3C61A 2BB0A 4DELA 3D0CA 4IMGA 5FJJA 4DLMA 4AZ6A 4PBEA 1R7AA 1VCVA 3JZEA 2P8CA 4KRUA 5I23A 1V77A 1PHWA 2QDEA 3T0CA 4JFSA 3U6WA 4CD6A 3E6EA 3RRAA 1IGWA 5EL1A 3NOEA 1RXOB 4KIRA 4FA3A 3VUSA 3CU2A 4Q4RA 4D8LA 1AW2A 2DDXA 4AQLA 1G7VA 4PL1A 4W85A 1DTNA 5GPRA 1AJ0A 3HQPA 1FHDA 4UQEA 1ZCOA 3LHVA 3H2CA 2Z28A 1W56A 1OX4A 1D7FA 4DWSA 3WQWA 4IP4A 3QKZA 5FF3A 1MUWA 4XIAA 8RUCA 1NDVA 3ZJ7A 1VEMA 3VX0A 4YWSA 4ICMA 3BICA 3QOMA 4IFKA 5CC6A 1JZ8A 2J27A 4A35A 1FCBA 2NQ5A 4US5A 1SFTA 3ZJKA 4H19A 1KCKA 1CXKA 4JY8A 3O0FA 4WOZA 1SSDA 1SO6A 2ZVRA 3IIXA 4AZCB 2Z7KA 1EB3A 1LUCB 1A3WA 4TV6A 3RAOA 3WNOA 4ZOCA 2GOUA 1DIKA 3S2LA 4AF0B 2OYKA 1X1ZA 2OG9A 2Q8XA 1CGWA 3H54A 1FP8A 2QDGA 3GR8A 2J88A 1GHRA 6REQA 3T2PA 2VWTA 2ALRA 3W9ZA 5I07A 3QPYA 3R94A 1Z48A 5FA5A 3PTQA 1U1UA 3HTWA 2PTWA 4X9SA 3G77A 4DNHA 3HG3A 2D0GA 3DFSA 1UZ1A 4EKJA 4PMOA 3BTNA 3FJNA 1PZ1A 4WX2A 1GOMA 3QH2A 3TE9A 2PDBA 1SFLA 1J12A 4PCNA 1ODZA 3BGGA 3HG5A 3QC3A 1NDZA 3CWNA 5CBJA 1GKQA 1A5OC 4K1WA 4GA8A 3O6CA 2INFA 2X1SA 3Q4DA 4QEEA 5DMLA 4R9XA 3T8LA 3KVMA 5KZMA 2TODA 1IR1A 4PUWA 4HMDA 3BJTA 1C90A 5HNRA 1BLIA 1VZWA 3FKRA 1VCFA 5BU6A 1CENA 2GJXB 2R94A 2Q02A 1UYQA 1Y5WA 5EB8A 2QCLA 2J13A 4JYEA 3TR9A 1BTMA 3RYSA 4NRRA 3IGSA 3JZUA 1ZENA 4ROQA 1XDJA 4ADSA 4EP8C 4K68A 4JCLA 2IPGA 3S6DA 4C6DA 2PWGA 1EWDA 4HHMA 1Y8BA 2X2GA 5F4XA 3BMVA 1EO5A 4HZMA 2DZAA 3LCIA 4A2SA 4LBSA 4Q8MA 4HNUA 4F9DA 4OUEA 4R85A 4DBWA 4LF1A 3GB6A 3IIZA 4NILA 1XYCA 1J01A 5D9NA 3EMZA 1MFUA 4B16A 5I00A 2HVNA 1H5YA 3W71A 3DI0A 4H6QA 1J0YA 5BRPA 3GYEA 4ZMGA 3G1XA 2QVHA 3B06A 1BFNA 7REQA 2OX1A 3W7CA 1PZ0A 1QPOA 4LY8A 3WG6A 5CZKA 1Z32X 4U3AA 2B4GA 2X7VA 4NHVA 4GJJA 3VA8A 1UH3A 1NWRA 2Y5SA 4UFJA 4UOZA 3CO8A 2ZRUA 4O57A 1UR0A 3BZGA 2V30A 3ZVHB 1LM1A 1OX5A 5EY5A 4LV4A 5JMUA 3R8GA 1PKNA 4QIUA 4UIOA 1EH9A 3M0ZA 3TCSA 4HKPA 1E4LA 1WUEA 3KUMA 4BJHA 3F03K 2E6DA 3VM7A 1LQ2A 4HCDA 2P3ZA 2WPBA 4FLSA 3VIMA 1DV7A 4LYKA 4I5XA 4Y9PA 4DBUA 1THFD 5BOOA 3N13A 4DPQA 4K2SA 3D3AA 4Z1AA 3WJWA 3PPGA 1YPFA 1XPYA 3G0UA 1VBJA 2GQ8A 4XV0A 1GOQA 3SIZA 4KT2A 1KBJA 2XYLA 1CYGA 1QWGA 5M03A 4HU0A 4C6QA 1FDJA 1M3UA 2HXUA 2PD5A 4OFCA 1AQFA 3IUHA 2NLYA 4HNLA 4ERAA 4OKDA 3NNTA 1WO2A 3GQYA 4AB4A 5CLTA 3SDOA 4HBKA 1OGBA 1ZP3A 1QAPA 6CGTA 1TZ9A 3CB8A 2FB3A 3P82A 4FI4A 4CNNA 2QPSA 4MTVA 4JTGA 3P7YA 2IXVA 1Q6FA 1GZGA 1EP2A 3T55A 3GU1A 2HPIA 3H22A 3R12A 1W32A 1G5AA 3AIEA 3MKCA 1AG1O 3M9YA 1KBLA 4GVGA 3SRFA 4PUMA 1CLKA 3RNDA 2GDQA 2KX9A 1TV4A 4MZYA 2FPVA 1Z42A 1A5UA 2ADAA 1PWLA 2GOKA 4MMWA 3NM1A 3KHJA 5E0CA 4YS1A 4ZQNA 3DYPA 4BY3A 4XWUA 1QDSA 4BQ5A 1B0IA 3E74A 4RV3A 1JPKA 1OABA 3GXTA 1TPEA 1RA0A 3B4YA 4UZSA 1FWDC 2BY1A 5T9BG 3UVAA 2ZX9A 4KFOA 5DT7A 3PBYA 5I3FA 2BBFA 3S47A 1D8CA 1MZHA 5HPCA 4LGXA 1I2OA 4N6FA 3WNLA 2JGYA 1FHVA 2L5HA 1W5NA 1PZ3A 8XIMA 1JXKA 4ZVJA 3LPPA 3SCSA 3WQ6A 3RM9A 4U3CA 2W61A 1K6AA 4XAYA 4HK5A 3WJYA 3C86A 4GI4A 1ISWA 2G3JA 3B05A 1YQ2A 4LUYA 1EJWC 1XQKA 4I6KA 4C6LA 4S3KA 5AFDA 4NZ3A 4QJ5B 4QSFA 1JXJA 4GQQA 3TVAA 4HVXA 4NIRA 3VNIA 5C2GA 4EWJA 3LN3A 2HXTA 5D8WA 4RPQA 5CC3A 1EA0A 4PYSA 1XLBA 3NQMA 2QJHA 3H7RA 1C7TA 1LQ0A 4QG6A 3ARZA 3DFTA 4ICNA 1JZ7A 3O16A 1DE5A 2CPUA 4QQUA 3UPWA 4HA1A 5HMDA 3A5VA 4AVOA 3VIJA 5JVLA 2Q6ZA 3MYPA 2J7FA 4OJYA 3WH8A 4ZSUA 2ZZ4A 1ONXA 3SZ8A 3T40A 3K4DA 1IYXA 2V2CA 3FGCA 3FA5A 3L5MA 1R85A 3AXMA 3NXLA 3UVIA 4KWUA 1ONWA 1OFDA 1WP6A 2PA6A 1LCOA 6REQB 3E5PA 3V7PA 3GZAA 1GOWA 3UA4A 1E0TA 3DHUA 2IQTA 3WZ0E 4GVIA 1EIXA 1GORA 1BQCA 3RK8A 3BV4A 2RKXA 4QXIA 3OOQA 3O15A 3Q94A 4NZ4A 1I60A 1J11A 1XLEA 1S2UA 1FXPA 3K13A 1M5WA 3IEBA 1KGWA 1V8EA 1I2QA 4TQTA 5LSMA 2GVGA 5HR7A 3ABXA 5A95A 4ZO8A 4PTXA 1A0EA 5J8LA 4Z2KA 1SYTA 4GUFA 4JGDA 4IIBA 5JU6A 1TZZA 1TQXA 1RUSA 3Q58A 3PNZA 4FX7A 4DJEC 1EEXA 4GJIA 1BF6A 4W93A 4WDTA 2CKRA 5M1TA 3KTXA 1S5MA 3T1GA 2QIIA 5IOBA 4OZOA 3GUGA 3V36A 1QJWA 1QHOA 3L4TA 1SW0A 3R8RA 4DAFA 2BXZA 2YPIA 1DJWA 1JCJA 3LCGA 1UJQA 2CZDA 2YR1A 1UROA 1EJ7L 5EMLA 3E3HA 4XVDA 2HE8A 4J3VA 1JDEA 4FX6M 3GVGA 2G37A 2IPFA 2XIOA 1KRCC 2A79A 3NGJA 1JRBA 1SZGA 3EB3A 1QHPA 4Z1BA 1PCKA 3W01A 3AMLA 2A3LA 3AIQA 3OPSA 3PUEA 1SSGA 1UUOA 1DJQA 1K8YA 1FXQA 1R2TA 1BYDA 4IPLA 5DXXA 3MV01 3U3HA 3R10A 3FXYA 4AUBA 4L4OA 1OT2A 5C54A 2OKTA 3N2XA 3TNOA 4KKXA 4GKTA 1K4GA 4B90A 4XSLA 1B9BA 1ZUAX 1H61A 7REQB 1SZEA 1OGSA 1YXCA 1O66A 3VDBA 3GVQA 1L6YA 4K3ZA 1JDFA 3NL5A 3B04A 1W9DM 3CUFA 1KM4A 1NFBA 2Z29A 1I2PA 3O6AA 1VFMA 3MSRA 4GWEA 3OLDA 1PB0A 5HBFA 3WMCA 2WLZA 1QPKA 3WX7A 3E0VA 4Q7NA 1VBRA 1GHSA 3MUY1 1E1CB 1K6WA 4CNUA 1KQYA 2XFRA 1YPXA 5JH1A 4B3LA 1W3JA 1RY0A 1XLMA 4ZQMA 4LAOA 1VFFA 3OW1A 2PZ0A 2I7GA 2J6VA 4IUOA 1J18A 1V0MA 4AY8A 3S1UA 1QPNA 4YIWA 4JHMA 4XZHA 4A29A 2XSXA 2JBMA 3LTPA 1NWTA 3ZR6A 5A8MA 1MWOA 3OO2A 1B3YA 4PTNA 5AHLA 4NQ1A 2Q8LA 4JAWA 1OIMA 5D38A 1CGVA 3QGAC 1FWAC 2WSPA 8XIAA 4LVBA 1XICA 4FOKA 3S6OA 1EC9A 3N12A 4R7JA 3DBNA 2ACQA 7TIMA 1KLZA 3ABZA 1A49A 2YCLA 4RE2A 4B5SA 1TX2A 2HQAA 3KVKA 4GI9A 1MXDA 4S38A 3MDWA 4K7YA 2A6NA 2ASHA 1P6CA 4H8UA 1QXLA 3UEQA 1R86A 3U4FA 3B0YA 4LAZA 3S2CA 1D9EA 4YVVA 2WZIA 4H8NA 4DJDD 3PZTA 4M1RA 1OFBA 1E5JA 4S3FA 4HMCA 4Q4KA 3MUCA 1FHLA 4XZLX 5I03A 2F7FA 3GD6A 4EPBC 3S9YA 3G6MA 3WUGA 5H8MA 3MHFA 3L65A 1NF7A 1P1XA 2PEVA 3L12A 2CITA 3F4NA 3UR8A 4B92A 1ZJAA 1KD0A 1AL7A 4DZIA 1DWGM 2UY5A 3WK0A 2DJLA 4TU1A 1S1PA 2HVMA 2Z00A 3VINA 4N6EA 3W3OA 2ZE0A 1TRIA 2GSHA 1R2RA 3NM3A 1XDMA 1CXEA 3CHFA 1R47A 5D9OA 4P8VA 4RV8A 3WFLA 3M5XA 3PTDA 1RCXB 3MHGA 4MM1A 3R79A 1P7TB 3BW3A 1VEOA 2CLIA 3NR0A 2Z1WA 2X40A 4DM2A 1C92A 2Y8KA 4P7OA 2G3NA 3C2FA 1KBIA 4PZVA 2VGFA 3TFCA 3FSUA 1SR0A 4ZGYA 3NSNA 3JU2A 4HIBA 4RLIA 2YA2A 3BURA 4AX7A 1CGUA 5JBDA 2F38A 4R88A 4J27A 2YCIX 5CPTA 1AFSA 4D2JA 1EGMA 1TTPA 1V0NA 3QR0A 1LOLA 3TOPA 4MFDA 1OY0A 1ISVA 3VNMA 3E96A 2PDYA 4L80A 5K4ZA 4IH3A 2X09A 2IS7A 1BXNA 1GOKA 1M03A 4FF7A 4XBJA 1E1EA 4INFA 1BHGA 3BSHA 3FJLA 1G1YA 5BMXA 1YDNA 3DFYA 1L6FA 1JPIA 4J2PA 2C91A 4TX9A 4OHQA 2ZRYA 1Q6CA 2VDIA 3ZYZA 3W74A 3VD3A 2WJFA 3TMQA 1KA9F 1OCQA 2RH9A 3KEHA 1X97A 5HUPA 1K8CA 1J2WA 2B81A 3GNXA 5BWAA 5G5IA 4AZGA 3FA3A 1UWTA 4RDYA 4L1GA 1IR2A 4GOAA 4IFRA 4KS0A 1GPFA 3LSBA 2PPGA 2Y85A 1OT1A 3PZ9A 3PJTA 4DUVA 4S3BA 1PEZA 2ISVA 5D2WA 4B15A 4TVUA 4PE8A 2J78A 3BLLA 4ZE4A 4IGHA 3NSMA 3W86A 3AI0A 4AIEA 1OF8A 5MHBA 3DC8A 2BOEX 2CLOA 3LY0A 4W84A 2QXWA 2FJUB 4DJFC 3DFNA 3DESA 3CGTA 2WNNA 9RUBA 4HOZA 1XXXA 2QZRA 3W1QA 3GTHA 4F2UA 4GIYA 3MI6A 3LK6A 3NCOA 3GC2A 3V1PA 4R33A 3EBVA 3XINA 2WANA 2O56A 3L9CA 3VCRA 3VC6A 1ZPTA 2OO0A 5T9CE 1TPH1 1QBBA 1EX1A 1Q2SA 3WIJA 1UWAA 2XTKA 4TV5A 4Y96A 2XFFA 1L2UA 2DZVA 4EPEC 1EBHA 2PWHA 1XX1A 2HRWA 2WBGA 4HNOA 1VFLA 1YMYA 2PTZA 5DLCA 5IBXC 3H2EA 2VDGA 4GQRA 1LROA 2INZA 4KERA 3LENA 1R3TA 2PDUA 2ZRWA 5IDIA 4JEJA 4UNKA 2DQXA 5CBBA 4RJEA 4LRSA 4CEXC 1T99A 3NQCA 3WBXA 3KRSA 4KFNA 1S1RA 3ID7A 5FJPA 3OLEA 3WL1A 1XLHA 3WL0A 2CIPA 4IXHA 1J6PA 4IIFA 4ZTXA 5A1AA 5LHEA 3B9DA 5FIPA 3CQIA 4PEKA 3ITVA 1QO5A 1VFUA 2QW5A 5G1MA 3RU6A 4Q4SA 1C91A 3OZYA 1RZMA 1W54A 4US6A 3CQKA 1WAWA 3RO8A 3B8TA 4QEHA 3NUKA 3GM8A 1RV8A 5FF4A 3MO4A 1AJZA 1ZJHA 1H4PA 5AYYA 3WDRA 1QR7A 1NAL1 5ABHA 5DCEA 2X2YA 4POCA 4GINA 1XF0A 3DX5A 2VZUA 3M7SA 4WKHA 1CB7B 4S23A 3CYVA 3IK2A 3ARYA 4I8YA 3EKLA 3M0MA 1WNOA 4PGLA 2DVXA 2XIIA 2WMHA 3KTSA 3A5FA 3GIYA 2QJNA 3WBYA 3AU6A 1NELA 1JYXA 3MMWA 3C2OA 3EX1A 1MYRA 1VJZA 3F4VA 1JD9A 3VNDA 4Q8NA 4JDBA 4AYSA 3S4TA 1BVWA 2RDTA 4AXNA 1QUMA 3ABRA 3L4UA 3VGBA 5CJMA 4MWAE 4LUJA 3N9KA 3WEMA 4DJDA 1QHZA 5DELA 1XBXA 4JIHA 5D32A 4HK7A 2A0NA 4ERIA 1T8XA 2HJPA 5CGTA 1E0WA 3AROA 2YCLB 4HZ6A 3W24A 3AU2A 2BTMA 2FLIA 4Q6XA 3THDA 4QJ4B 2XU2A 1HTIA 1TELA 4QROA 2TAAA 2PC8A 4IIGA 2UZ9A 2FPYA 4PMZA 3GE7A 2BY3A 1OCJA 4IQJA 1W5QA 3UZXA 1XJBA 5I78A 4JTQA 1QI0A 3W23A 1PIGA 1WQ5A 2CLMA 4PR4A 2ZADA 2YXGA 3KP1A 2ZXBA 3W28A 2FVLA 2W91A 3AHYA 3B8UA 2XIMA 4LYPA 3IAQA 4X0NA 4PSRA 3EX3A 2V3DA 4R53A 4QAIA 1RQHA 4YLWA 5HULA 3LLXA 2OCZA 2BVDA 3MWCA 2WMFA 4UTTC 3CC1A 3M0LA 5A8QA 1GTHA 5LZLA 2QR6A 3VD9A 1RP9A 5AYXA 4JPGA 3OVGA 1DVJA 3UU0A 3UYIA 3SQMA 4TOQA 4E4FA 2VX7A 3LTYA 2NVAA 2X1RA 3SUVA 4IGNA 3SADA 1KNWA 3PUOA 2ZFAA 1HKVA 4UR8A 4JIPA 4L9YA 1HFBA 2CZVA 2ZC8A 1V6WA 3GYCA 2IPJA 2EPHA 2WMKA 5GNZA 1DHKA 4M82A 3TZFA 4FXRA 3KP0A 5HR6A 4XD6A 2WKLA 2CU0A 5FESA 3SM0A 2EO7A 3W6LA 1TZ7A 1KM6A 1V3HA 3R0DA 1V6YA 3TW9A 4QM1A 1Z8AA 4Q3MA 3UW6A 4H9MA 1G9HA 4IWWA 5A5WA 3DC0A 4AW7A 1TJRA 3LBOA 2FMOA 2ESCA 3N29A 1J96A 3WLTA 3A9IA 1IXNA 3MBDA 2ZYFA 3RIKA 4PTWA 4M0XA 5AVNA 4ZCWA 1V7YA 4PRRA 3M0JA 2CHRA 3NOYA 3GDTA 3STGA 4XVEA 4S3AA 3TC7A 1GVFA 3ATZA 3HJEA 1KLYA 2O7QA 5A6SA 1EWEA 1XM3A 1IGSA 3F7JA 2CWXA 4LUTB 2GPTA 1BQGA 3BW2A 1L8PA 4YYFA 1TTJA 3W87A 4A3QA 2OLAA 2QCEA 4DX3A 3LG3A 3LSCA 1TV8A 1EPVA 3AHVA 3W1XA 1HGWA 4PL2A 1XLDA 3NXFA 3KXQA 1M7PA 4Q8PA 3GIQA 4GYPC 4RNJA 5TBOA 5I7GA 2WZTA 4B5WA 3EDJA 1DPMA 1JFHA 4AIOA 3V0TA 2CLKA 3GTIA 4XAFA 2E40A 3CM4A 3WQCA 3GX9A 1KO0A 3TQKA 2PDJA 3HQNA 7ODCA 3LNPA 3CV1A 3NPUA 5KZEA 4EPKA 1OGGA 4MKVA 2NV9A 3CAKA 3ARXA 3EAUA 2J24A 1I1WA 4ADUA 4S3GA 3IPWA 2NT1A 3LPFA 3WJSA 4WSJA 4ICCX 3WMBA 3LZ5A 2QCFA 3V0SA 3J7HA 4HD5A 4DN1A 3S8HA 4H01A 1Y0EA 4DUOA 3PBMA 3FAWA 1LDCA 1JD7A 4EF8A 3QFWA 4IPPA 4ZO7A 1DWFM 1E4IA 3CL6A 1CLVA 2J66A 5C9XA 4QDMA 4LBUA 4MY9A 3W1AA 1AW1A 2I16A 3LI0A 3ZLFA 2J47A 5C7VA 1RR2A 3DGBA 5C8BB 1Q4NX 5ABGA 4A6GA 3HBLA 1OG6A 5KZ6A 1JDCA 1K9FA 4L1XA 1YXYA 3SSJA 3OG3A 2MNRA 1I2NA 4JZ5A 1SJBA 4FXSA 2P0OA 4QG9A 3DFOA 3FJ4A 1GW1A 1N82A 3C0JA 1P0KA 1X98A 3TJIA 1UUMA 2VEPA 4GG9A 5E0FA 3F2BA 3W6MA 1XPGA 1I0DA 3N19B 1PIIA 2Z27A 1TV7A 1PVNA 3GG8A 3C2YA 4PTMA 1EJTC 3CUIA 2DGAA 2C18A 5CPLA 1DIOA 1XGEA 2RGMA 4WQ6A 3O2LA 4M5PA 2J9YA 5BZAA 4ACZA 3BSMA 4TR9A 1MUCA 5TNVA 2QUMA 1L6SA 1GQNA 2HCVA 4MZ1A 3SB0A 2HBVA 3OTRA 1O6IA 1AMKA 1SVDA 4UOQA 4YTUA 2XGBA 1SFSA 1TVLA 4H9XA 1E0XA 2YDSA 1IT0A 3SCUA 4N9EA 3LU2A 3BG5A 4PCFA 2JF6A 1MEHA 4G1KA 1Q6RA 3OHMB 4LSBA 1KR0A 3CHCA 3KW3A 2VGIA 3GBEA 5I09A 2PMQA 3BH4A 3FOKA 5BXRA 1DJYA 4JTDA 2NZLA 2FVMA 3VKDA 4JTFA 5BXPA 3WF3A 3T0BA 3GKFA 4RL3A 4HNTA 1ITUA 2BDQA 4O10A 2W9MA 3NPWA 1K4HA 4CUCA 3WQEA 3BLKA 1QASA 4CN1A 3CTTA 2YW4A 4ZENA 1E15A 3U7BA 3WH9A 5D30A 3VDAA 1AODA 2ZA3A 4NY2A 2OZTA 3SBFA 3DZ1A 1E6ZA 1S2CA 3A3XA 2OGJA 3SUUA 4O4VA 4IG2B 3FHQA 3MC5A 4BWLA 2NW0A 2XVNA 5FKYA 1WXZA 3PG8A 1E43A 4YU1A 1HKWA 3OODA 2J7DA 4W8LA 3ITLA 2BVTA 9XIAA 2CCRA 1JR1A 2V81A 5AC5A 2XPKA 3EWBX 3N04A 4RE4A 2DVTA 3VKJA 4WGHA 3L4XA 5XIMA 3N4EA 2X8RA 3TA9A 3BMWA 1D2KA 1VYRA 2GUBA 1FWSA 3W2JA 4A3RA 1TPDA 1QOPA 1JL8A 4LAKA 2ZZ5A 3MS8A 2DU2A 2XINA 3L66A 5IM51 1V02E 1OFAA 3K46A