2F38A

Crystal structure of prostaglandin f synathase containing bimatoprost
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
319
structure length
319
Chain Sequence
QQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Prostaglandin F2alpha formation from prostaglandin H2 by prostaglandin F synthase (PGFS): crystal structure of PGFS containing bimatoprost.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C3
total genus 115
structure length 319
sequence length 319
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2005-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2f38A00
3T42A 3MC5A 3ONBA 4QR6A 1M9HA 2IPFA 3LEPA 3WBWA 2PDUA 3V35A 1AH0A 3EB3A 2R24A 3R8HA 2ALRA 4JIIX 4JQAA 2FZBA 1GVEA 1RALA 1PZ0A 2PDNA 3UZWA 4YS1A 2NVDA 4XO6A 1UR3M 1T40A 4JTCA 2PDBA 3GHTA 1FRBA 2PDLA 4GQ0A 3ERPA 4AUBA 2HVNA 3MB9A 4EXAA 2FZ8A 2PD5A 3LZ3A 4FA3A 5LIXX 5AZ0A 4WDUA 1HW6A 2PEVA 4OTKA 4PR4A 4YVPA 4GCAA 1OG6A 5LIUX 3H4GA 4LBRA 4DBSA 1AH3A 1LWIA 4JQ3A 4Q3MA 4XVDA 3EAUA 3UFYA 4WDWA 4FZIA 2ISFA 3CAQA 3RX2A 3UZXA 4XZIA 3R8GA 1R38A 3R6IA 2I16A 5JH1A 3GHSA 4WEVX 2HEJA 3M0IA 3R58A 4QXIA 3V0UA 3LQGA 4JIHA 3R43A 3UP8A 1S1PA 4RPQA 4DBWA 1US0A 2HVOA 3H7RA 4GIEA 1ZGDA 1Z9AA 3N2TA 3UWEA 4LB4A 4JTDA 2I17A 3Q67A 4XAPA 3GHRA 3COTA 1AZ2A 3LUTA 2F2KA 5KETA 2IPJA 3LZ5A 2PZNA 2DUZA 2IPGA 2BGQA 1ZUAX 4LAZA 1XF0A 1PWLA 4WGHA 1XJBA 4IGSA 1Q5MA 4R9OA 4QBXA 4WDTA 2IS7A 3CV7A 5LIYX 3V36A 1AFSA 3LBOA 3S3GA 2DUXA 2IKIA 4HBKA 2BGSA 1T41A 2FVLA 5C7HA 1EL3A 4JTRA 4YVVA 1AZ1A 4XO7A 2PD9A 3BV7A 3KRBA 2PDQA 2BP1A 3UZZA 2P5NA 4H8NA 3WCZA 2WZMA 1K8CA 4PRRA 2ACSA 2PFHA 4L1WA 3LN3A 4XVEA 1VBJA 3WBYA 4DZ5A 4JIRA 1Z8AA 3FJNA 3G5EA 4DBUA 3U2CA 3GHUA 3R7MA 2IQ0A 3N6QA 1RY0A 2PDYA 3F7JA 2PDIA 1MZRA 1QRQA 4ASTA 2IQDA 1C9WA 3WBXA 4XZHA 3O0KA 4JTQA 1J96A 3CV6A 2PDPA 3M64A 3LQLA 3LNMA 1PZ1A 2PDFA 3BURA 2HDJA 4F40A 1AH4A 3R94A 3DN5A 2PDWA 3O3RA 4LAUA 1EKOA 1Q13A 3D3FA 2FGBA 1VP5A 4I5XA 3EB4A 3DOPA 4NKCA 1PYFA 5DANA 3WG6A 4PUUA 2CLPA 3CASA 3B3DA 5HNTA 1S2AA 1XGDA 4GACA 2PDMA 2IKJA 2DV0A 1ZSXA 2HE5A 4XZLX 4XZNX 1IEIA 2PDKA 5JH2A 1S1RA 1QWKA 5HNUA 1RY8A 1YE4A 3VXGA 4Q7BA 2ACUA 1SM9A 3BCJA 3LENA 1X98A 2INEA 2PDJA 4LBSA 3H7UA 3GUGA 1Z89A 4PMJA 3FX4A 3V0TA 1ADSA 3M4HA 2QXWA 1X96A 4LB3A 2J8TA 3UZYA 4FAMA 2C91A 1YNPA 4QX4A 2AGTA 4HMNA 2PDHA 2HE8A 4YVXA 3BUVA 4GA8A 4L1XA 4XK2A 3UYIA 1A80A 5LIWX 1X97A 4EXBA 1EF3A 1LQAA 1Z3NA 3QKZA 2A79A 2PDGA 4MHBA 3UGRA 2IPWA 4JQ4A 4IJCA 2WZTA 3LD5A 5M2FX 3V0SA 2FZDA 4GQGA 4JQ1A 3UG8A 1MI3A 5HA7A 4GABA 2INZA 1ZQ5A 4WDXA 1HQTA 5AZ1A 2VDGA 1S2CA 2HV5A 2FZ9A 1EXBA 4IJRA 2PDCA 2PDXA 2R9RA 3CMFA 4ICCX 2NVCA 3P2VA 5LIKX 2F38A 3RX3A 1JEZA 2IKGA 4H7CA 1MRQA 2ACRA 3C3UA 3Q65A 1YE6A 3ONCA 1PWMA 1IHIA 3CAVA 3G1RA 2PF8A 3RX4A 4JQ2A 4YU1A 4G5DA 1YNQA 4PRTA 4ZFCA 4JTAA 4XZMX 4WRHA 4PUWA 2ACQA 4FALA 2IKHA 3NTYA
chains in the Genus database with same CATH superfamily
1P4CA 4C6MA 2CYGA 2VKZG 1R5YA 4GRSA 3AIVA 3GC4A 1XSJA 4NASA 2W92A 4B5SA 3BGAA 2O7SA 5KZ6A 4IFOA 2XH4A 3KTCA 4X0NA 3UZJA 2ALRA 4AD2A 1J0ZA 1MDRA 3FS2A 3K4AA 1MRAA 4Q4OA 5EMUA 3I7QA 1EO5A 2VL4A 4YS1A 3IWPA 4GJJA 3HG3A 4JDYA 3LCIA 2IQTA 2Q8LA 3ZS4A 4NZ5A 4NJGA 1W2PA 1QI0A 5TF0A 4IUGA 1LRQA 3ZSTA 3MP5A 4H8VA 4JHMA 2PWEA 1ZPTA 1D8CA 3CZ8A 3EEZA 1E43A 1EJVC 1TTPA 2E0PA 1SFSA 5CPTA 2HBVA 2GJPA 2AQOA 4NILA 4Y2WA 2RDXA 2JEQA 2ZA3A 1Y5XA 1TIMA 5BRPA 1PKNA 1K4GA 3P60A 4XBJA 3SUWA 3ZT6A 3K5XA 2WSRA 1FTXA 3FHAA 4KBXA 4DZAA 2C19A 4OUIA 3OA5A 3ABXA 3TQKA 2EF9A 3TLLA 3STCA 4JL1A 1OCBA 1FCBA 5C9ZA 5I6SA 5EB8A 4IX0A 2Q3RA 4QXIA 1LZOA 5HMEA 5TBOA 2BGNE 4QQUA 1MEIA 2RDWA 1QASA 3T8QA 1VFLA 4H9ZA 2V9DA 3TTEA 2FZMA 4E4FA 3H7RA 5IDZA 1AQFA 4ZTYA 7REQA 1DJZA 3TJLA 4Y9PA 3Q67A 4IWWA 1L9WA 3O07A 2Q6ZA 4IMAA 3LG3A 1ME8A 4KERA 3URBA 3PY2A 1NELA 1KM1A 4CUCA 2WKLA 2EJAA 3TZFA 2F6KA 4MTVA 1Q5MA 1H1YA 3W3OA 1ML1A 4ADTA 3G1DA 5FI8A 3CV7A 1LJYA 5LIYX 3HPXA 3B8IA 9XIAA 1GUVA 2C1IA 2EHHA 3CIVA 3SURA 3VD3A 4H9TA 3ZR5A 1A0DA 2XVKA 4J3WA 3LU2A 2ZZ4A 4HCHA 3T09A 3CL7A 1S3TC 4DAIA 3PNUA 2UWFA 4H2HA 3WD1A 1GONA 2WCSA 5CC5A 1WDQA 4HJWA 1UR1A 3HG2A 3LHZA 4B5TA 4UFIA 3T0AA 3ZM8A 1G4TA 4AFYA 3SFKA 3NOYA 1DYSA 2R6OA 3NPWA 1Q7ZA 4MY9A 1F7BA 4G1KA 1KGWA 5LNVA 3N73A 2DDXA 3GDRA 1C7SA 3P3BA 2FTPA 1A4LA 1FP8A 1GQKA 4X61A 3LCGA 4MNKA 2J7FA 1DQUA 4J3VA 3CB8A 2CERA 1TWZA 4O13A 4H4IA 4XZHA 1X8CA 3O16A 2AKZA 1HKIA 3RHGA 3QQ0A 3TMLA 1EYEA 3VUSA 2WC7A 1P0DA 1FWSA 1MW1A 3C2OA 4TX9A 3NR0A 1G4PA 4ZB2A 1YYAA 2CLFA 4MWAD 4P7RA 5T8GA 3PZGA 4Q8WA 6XIAA 2QIWA 4IL2A 5D03A 6TIMA 2AOSA 3CYVA 4NZFA 1RVGA 4CNUA 1AJ0A 1DE5A 4GFIA 4UQDA 3A12A 3RFAA 3C0JA 2PDKA 2WSYA 1V7YA 1FHLA 5HNUA 5E9AA 1O94A 2WWCA 4AD4A 1FHDA 2HNEA 4RW3A 3VXGA 1X38A 1RQBA 2FHFA 1K03A 4WR3A 2PDJA 3WO8A 4HSHA 3LY0A 3N04A 1CGYA 4LVAA 2GJXA 4NI8A 1HTIA 3IIVA 4IHCA 1BFNA 3CEUA 1F3TA 2FHCA 1FWFC 1L6YA 2PU0A 4QDPA 1H41A 3WIJA 1FWWA 3LHTA 3TDFA 3QGKC 3VIHA 5C9UA 3MDWA 4FOKA 4GI6A 4GA8A 2OWWA 3ZJ8A 1KCKA 2P3EA 4YYFA 5LIWX 1X97A 2C3ZA 4UNLA 1B3YA 1JZ4A 3IUIA 1XLFA 4A8IA 1R46A 1OC5A 1H1NA 1R30A 2A2IA 1FA2A 3T08A 3QR1A 1RR2A 1NDWA 4HPHA 1NFGA 3GDBA 1UR2A 4IPLA 1BWLA 3SUSA 1POKA 3WLLA 5EMMA 3QOKA 3ZWTA 1BYCA 4K38A 4MYXA 2FTWA 4BQ2A 4AG0A 2FPTA 4YTQA 3LPGA 3IANA 1A4MA 5CPNA 1EIBA 4RXFA 3SY5A 5G1YA 5IDIA 4P7OA 3AHVA 1PX8A 3S1VA 1EJSC 1OT2A 1TJRA 2ZUMA 1KM4A 1F4HA 3PG9A 4GISA 5K9XA 5FJRA 4AMCA 3G1VA 8RUCA 1V5XA 1PTDA 1CI1A 4KFPA 2VI0A 4NJHA 2WW5A 4J3ZA 4AZ5A 1KV5A 4GX8A 4NAEA 2DSVA 1ALDA 1MNSA 1IIHA 1CW2A 1S5VA 5FESA 4P5UA 4HHMA 1XIBA 3T7VA 4S3JA 5AOUA 4CQBA 2PMQA 3M7SA 3T2OA 1W5QA 3HZ3A 5D33A 2XIOA 3QSRA 3LCXA 4ZEPA 1PDYA 3N9RA 2H3DA 1LYXA 4EOUA 5HWJA 1YNQA 4PRTA 4ZFCA 1B30A 1JZ6A 2I5QA 1NAL1 1XKJA 3KFTA 3PWAA 4GZEA 5DELA 4ZMGA 3VCRA 2VP8A 5HQEA 5KZEA 4LALA 4FK9A 2OGJA 5AYXA 1UR9A 1W1PA 1EEPA 3W1PA 2RHGA 1A3HA 2FZBA 2Y63A 4JTSA 3PSVA 1XG4A 2GUBA 4J28A 1B3XA 5GJMA 1I2OA 3IIPA 3B03A 4PFHA 3G24A 3E9AA 1W1YA 3VM7A 4PYSA 4UTFA 1G4SA 2Z6IA 3V4BA 4E38A 3LZ3A 2BY1A 2ZCGA 4AX7A 4JKLA 4HCDA 4OWGA 3VCCA 3AYSA 3W2UA 1EJRC 3CPGA 2VDHA 1IT8A 5LIUX 1MQQA 5K4XA 3ALFA 1TV8A 3H8AA 3UR5A 4DM1A 3MZ2A 3UXAA 1LWIA 1V79A 3DFYA 3VIFA 1RCXB 1GPFA 5FOOA 3KHJA 3W24A 3LHVA 4FZIA 1W9XA 1QJWA 3IARA 4DIAA 4O54A 2DORA 1JXKA 3T4CA 4FOUA 5K3VA 4C6PA 4YPJA 3T4WA 3WDQA 1F73A 1U1HA 4CU8A 4U2YA 3WLIA 4I8YA 3GHSA 4O50A 4MB5A 4NX0A 3MA8A 2ABBA 4GD0A 3BARA 3BLEA 1W3IA 2ZA1A 4MADA 3OVPA 1XLHA 3GXPA 4P7LA 4WHBA 2VC9A 1XRSA 2DGAA 4S3AA 1JDFA 4WY0A 5FKYA 3PULA 2G96A 3WJWA 1OJXA 3GHRA 3GKFA 5JU6A 3S5ZA 1TJ0A 3UR7A 4YIWA 4DUWA 4G1NA 4CQDA 1UUOA 2YIHA 5TQLA 1F8MA 3TE9A 3UCCA 4KWSA 4D8AA 5DBUA 4AF0B 1XJBA 4AHOA 1VBHA 3GH4A 4JN7A 3P5YA 5CSUA 3BAIA 3N4FA 1IWBA 4XAYA 1SR0A 4D6EA 2BVWA 3PZ9A 4IPNB 1JDEA 3VX1A 4GQRA 2GUYA 4FMVA 4KF1A 2VFHA 3M5VA 4GX9A 3BAYA 1K8YA 3HQ1A 5FA5A 5C7HA 1C8VA 4E4PA 5C70A 3AIEA 2B7NA 4IMFA 1RZMA 2XIJA 3SQMA 3L4XA 2WZHA 1D3GA 3E38A 3LGGA 4NUWA 4PUEA 2C13A 2IUZA 4KQNA 4O16A 3MMDA 1F3WA 2AL1A 4RDZA 3USBA 4DBUA 3TIMA 3MWCA 2OQHA 2DIKA 5A8NA 1X8FA 3LBMA 4JTJA 1PIGA 1FX6A 1AW2A 4N9DA 5FEXA 4J1OA 4GMEA 4CQCA 2WHMA 4XKYA 1XH1A 3W0KA 1ME7A 1JULA 1HG3A 1UD4A 5A6MA 4WXYA 1Y5VA 4MYAA 4HPNA 3T0CA 3VM5A 3GNDA 4GPNA 3EOSA 3N11A 3TSBA 4F2BA 5EFFA 2CBJA 2J62A 2CETA 2P0OA 3N2MA 2GVJA 1QVBA 2OVLA 3LNPA 3EPMA 4F40A 1AH4A 4L56A 2RGMA 2FGBA 8XIAA 5CC6A 4V1YA 4QGCA 4IG2B 1ISVA 4RZ4A 2ZRXA 1F07A 1A5CA 1UA7A 1F6PA 2XM2A 3GM8A 5L6UA 2GOUA 4V28A 1PKMA 3TUUA 2NSXA 3WFLA 3UWVA 4G2DA 4US5A 1BPLB 2DZXA 1E3ZA 1HXJA 5HINA 4XZNX 1Q63A 5CBJA 3NO3A 1AQMA 5CSSA 1JPIA 1US3A 3AOFA 4EVZA 1M53A 5FF2A 1GJWA 3CXOA 1SJDA 2EG6A 3TW9A 3GX9A 5F1UA 3BPWA 4NVTA 5I24A 4K37A 4H7VA 3WNLA 2B4GA 1EP1A 3G2GA 2NT1A 1I0DA 1W9UA 1FVPA 1X7IA 4CVWA 5A6BA 1F61A 6ALDA 3UWWA 1PAMA 3PR2A 4PB5A 2QUNA 4MB1A 3NQ6A 5T9CE 1J18A 3PTMA 1BGGA 4LU0A 4JTFA 3THAA 4TTUA 1H09A 4OHQA 3Q58A 4Z1AA 4O17A 2EO7A 1WOAA 3DBPA 4YTUA 4H3DA 3ZVHB 7TIMA 3EDKA 4RE0A 3U7VA 2E25A 2EG7A 4UTWC 1NDVA 3I65A 3M0LA 4Q4MA 3CH9A 2ABAA 4IIEA 1UD2A 1GEHA 3NUKA 4LT9A 1KQYA 3AI0A 4C90A 1EHAA 1Z7AA 4IIFA 1OFDA 1D8WA 1UHVA 4GABA 4UTJA 1J79A 1ZQ5A 3WD2A 4I9TA 3IRSA 1BQCA 3W87A 3W88A 2J7CA 4UNKA 1SO3A 2V30A 3A3HA 3AO0A 2WKJA 4ENLA 1UIOA 4IGHA 2O9OA 2EG8A 2TSYA 4AZIA 3VD9A 3O6DA 1L2UA 5KTLA 4R9XA 1YE6A 3H2FA 4P7NA 5HNNA 3DFHA 2ZZ5A 1SW3A 3W1AA 4H19A 3T40A 4FLSA 1NU5A 1VRXA 3BMVA 4C6JA 1VPYA 4LUTB 3ZR4A 5I3JA 5IOBA 2BBFA 3U4AA 4J5NA 1OZQA 3TOPA 1B0IA 4FALA 4EKJA 3ME3A 1NOWA 4ZQOA 3WNOA 2CU0A 4RKAA 3PUEA 3I6RA 4LUSB 1OCJA 1QCWA 3NZQA 7TAAA 1ICPA 3R8HA 1ISWA 3HGOA 1LORA 4KKXA 4M51A 1G4EA 4UMAA 5D9NA 1QATA 1QNQA 4HYWA 1YDYA 3GHTA 2X2GA 4HK6A 3O1NA 2B7QA 3AMDA 2GQ3A 1OZMA 2PWVA 4LQ1A 5E0KA 2XGZA 3KS6A 4A2RA 3EYPA 3P14A 1R9YA 3W7OA 3WLJA 1YPFA 4EPBC 5LSMA 1VZWA 3CM4A 4WGXA 3ABZA 3QQ1A 1JG9A 2FB2A 5DXYA 1FQ0A 1LT7A 1UROA 1TX2A 4WDWA 3M1ZA 2OO0A 2E5DA 3FW6A 4RZBA 3AUOA 2A3EA 2WXDM 1Y65A 4BKNA 4QLJA 4WEVX 3OVGA 1DTUA 5TNVA 3S1WA 3LQGA 4E3VA 1LQ2A 4GUJA 4RUBA 3LI0A 5MF5A 2DPEA 1FY6A 3T55A 3TA6A 2O0TA 1R0MA 3DH7A 2UV8G 2KX9A 2Y5SA 3RDKA 4FOJA 3W7RA 3VD4A 1MQRA 4KFOA 1U30A 4QE1A 6CGTA 1VPXA 3BG5A 3N1AA 1O5RA 4MDOA 5TIMA 1NQ6A 4HYRA 5CBBA 1R3SA 3ANVA 5D30A 2OO6A 2JE8A 2PLJA 1OF6A 5AN7A 3AXKA 1ZP4A 2VX7A 2Y7EA 4JTGA 4ZODA 1Q3NA 4NAFA 3MBDA 4BF5A 1MW2A 1S5TA 1KBKA 2Z0IA 3JUGA 2QDDA 4YLWA 3N6JA 4W5UA 4CQ8A 4UTTC 3EWBX 1X6LA 3NQVA 4JTRA 4NNBA 5HWMA 2QJNA 2GGIA 2D23A 4JIPA 2G3IA 2PD9A 1VCGA 4JNZA 1ZZMA 2XG9A 3FEMA 1PX4A 3GRIA 1H4PA 2ISWA 1AD1A 3GAKA 1Q45A 2VVNA 3WQEA 4K39A 4D9PA 2NQJA 1YADA 1UH3A 3VOFA 4JIRA 3FHQA 5F4WA 4UZUA 2YBVA 3H23A 1WP6A 3BSMA 5G2WA 1FH7A 4WCJA 3WF3A 4ONVA 5JQ9A 1QDSA 4HK7A 2PPGA 4NRSA 4ADSA 3PUOA 4PMRA 4S3KA 1QRQA 4WKHA 5A6BD 4DXKA 3W7IA 3WFZA 1VQTA 4PCTA 5M3WA 1MYRA 4YN5A 3DGBA 1XV8A 1E9LA 3FKKA 1M7JA 3L65A 4G7EA 3ECQA 4FO4A 4EPEC 5JUVA 5LZLA 1EQPA 1TB3A 2VEKA 3D3FA 1E6ZA 4B91A 1JCTA 1OCQA 2WCGA 3OPSA 2FJKA 1YEYA 2C7FA 2CHOA 3VNLA 4HHHA 3R4IA 3B3DA 1Q6QA 3BQ6A 5FJIA 2WVUA 3WEOA 1XD1A 2PDMA 1YHTA 4ZQPA 5B7ZA 4LUJA 3WX7A 1H5YA 1DIKA 1QOQA 1WXYA 2R1PA 4AIBA 3KBWA 1LP6A 3LENA 1X98A 3UETA 2D0GA 2GL5A 5XIMA 2DP3A 4PMJA 4ZQNA 3QOMA 1G01A 2XZ7A 3AMGA 5K4ZA 2EPHA 3VGFA 3CLWA 1GVFA 1A0CA 1KR0A 3RO8A 2J8TA 3B97A 3LRKA 1WV2A 5CPLA 1YX1A 2D2GA 2GJNA 3JZEA 5FF7A 1Z48A 5FJTA 2H3BA 5U4NA 3GH7A 2AGTA 1OGBA 1UMYA 3AS2A 5TD4A 3TC3A 3SJ3A 2V63A 1GORA 4LEFA 3KX6A 3KRZA 3W86A 5A3HA 1UWTA 1RQEA 4M8UA 4K3ZA 2PGWA 2QPXA 3PPHA 3H2EA 3V7PA 2C14A 4AQLA 2ISSA 3C4UA 1XYZA 3R0UA 1IXNA 1GZ1A 3WMBA 3NEHA 3KLLA 2Q02A 1MEHA 5JMUA 4BZYA 4DNMA 2FGLA 2LLEA 4KFNA 3NOEA 2W61A 2OG9A 3PM6A 4Z0SA 4W8LA 4UCGA 2XVPA 3UY8A 3S2CA 1JCYA 1SO4A 3EDJA 1JVNA 4UQAA 3UBPC 4C7GA 3C8NA 5BCAA 2J4GA 4MWAA 3OLEA 4ORIA 4LCRA 4D2JA 2HXTA 1W5NA 3EWCA 2HS6A 3FSTA 2YL9A 3GDTA 4LS2A 4WJXA 2A7NA 1I4NA 4XG1A 4AB4A 3GC2A 2G50A 1KRAC 1YPIA 1M5WA 2ZX5A 7REQB 3TCEA 2ZRWA 3INPA 2OGYA 3KW3A 1TG7A 4K1GA 4HNUA 3BMXA 4PUDA 3PJXA 2Q09A 3GXMA 2A85A 3MT1A 1EYWA 1QAPA 2PDUA 3KRUA 2YYTA 3KOXA 3WQWA 1E0XA 3RXZA 6XIMA 2VGIA 2VGGA 4HU0A 1QO2A 1KKOA 2V2HA 1XYFA 3VOGA 4TOQA 4INFA 3U8GA 3KWXA 3B9EA 4QLLA 4MJZA 5FEZA 4UR8A 3TTYA 3MI2A 4J3XA 3TU9A 2VM8A 4M7TA 2QCDB 5J04A 5REQB 1S5MA 4Q22A 4NU7A 1YTEA 5MHBA 3B4YA 1FRBA 3NQFA 3T05A 3NPUA 3I68A 3VKDA 1CEOA 3GZAA 2A0NA 4OBSA 3G22A 4H1ZA 4GIAA 3GQYA 4NJJA 2PS2A 4CU6A 3PS7A 4GGHA 1FHUA 3PWIA 4F0SA 4V15A 4H9MA 4JOMA 4AU0A 3MP3A 2BTMA 2O55A 4PODA 4QS6A 2B31A 4IPJA 4C1NA 1TVLA 3CC1A 4QP0A 5A6KA 2BY3A 1IQ8A 4PRWA 3ATZA 2BHUA 3SY8A 3AMLA 4B4FA 3EWZA 4OV4A 3M47A 4AWEA 3WQPA 3R6IA 3GXNA 1QR7A 2NQ5A 2HEJA 1QUMA 3OVQA 3CQ0A 1EXPA 4KPLA 4MPKA 2VFEA 3R43A 4M82A 2KZHA 2ZKMX 1EGMA 3SW6A 1S1PA 3CHFA 3SIMA 4B92A 1US0A 3DHUA 3H21A 3MJYA 3NIYA 4I7WA 3N2BA 3W2LA 5JXQA 4WSJA 3SFWA 4JTDA 5DT7A 3HB9A 2B0MA 4B5XA 5I0DA 4GJ1A 3IJLA 1O4UA 2BVTA 2NXHA 5CC7A 3B9NA 3H4XA 4R88A 5F4SA 2PCEA 3GU1A 3W1MA 4JPGA 3GXTA 1EGVA 4PMVA 1VJZA 4AMAA 4ACZA 3MKVA 1L6SA 2CZDA 2I9UA 2ATMA 3IJ6A 3A4WA 4IG2A 3ZJKA 2JF7A 4N6EA 1K9EA 1UR8A 4MDPA 4AW7A 3F4CA 2WHJA 1Z32X 3NO5A 3VD5A 5AYZA 1UQZA 3WY1A 2E67A 1CIUA 2XN1A 4ZB5A 1BXBA 1QOPA 4W93A 4D1IA 4MF4A 5KEZA 2FDMA 4TIMA 4MAVA 3OA3A 2UY3A 1JNEA 3UY7A 4J3SA 1DWHM 3W1UA 4IFKB 2BWGA 1H2JA 3AQUA 3F03K 3OYZA 4N9EA 1QWGA 3M41A 1JDAA 2YL6A 4H8HA 3CHDA 3AC0A 1HIZA 4MJMA 4HNVA 3PFMA 4RW5A 2IQ0A 3DHPA 1GVQA 1K77A 4B5NA 1JQXA 2L5HA 4A8NA 2PDYA 3HFYA 3EA3A 2BSLA 3V1PA 3IUHA 1L0PA 4ASTA 2XIMA 5D9OA 2PSNA 3CQKA 4YHGA 5LHEA 2VO5A 4PUMA 1V0LA 3WDRA 3GFZA 3EWUA 3MKCA 3PP7A 5BRQA 4TTGA 1FBAA 1Y0EA 5G1MA 3KS5A 3W7PA 5FJUA 2GVGA 4UMBA 4PH6A 4PC8A 3KXQA 4GYFA 1BG9A 3W37A 4Y9MA 3UXIA 1TUXA 3O3RA 6PTDA 2GSEA 3VU2A 3QH2A 1XGZA 5A8PA 1A5NC 2XSAA 4ZOBA 3SR7A 2RUSA 3UWYA 4HGXA 4U3CA 2XU2A 3T2PA 1TPDA 3XISA 4ILSA 3QEZA 3JZUA 1ZSXA 3AZTA 4AZCB 1NJJA 3O6YX 1DORA 1V4YA 5EMJA 1UWIA 1KV8A 4WOZA 4JCLA 4X0VA 4JR5A 5BXPA 3HM7A 1ADSA 5CZSA 4DJEA 2XZ9A 3O63A 4ATDA 3ARQA 4CCZA 5D37A 4ZE5A 4N7QA 3WLPA 2DW7A 1OY0A 3DFQA 1Q6CA 4N9BA 2NV9A 4CEUC 3WLNA 4MAZA 3H70A 3WD4A 2P3ZA 4KRZA 5E9XA 1O1HA 3PTKA 2PURA 1RK6A 3QMRA 2WBKA 1A80A 4N4QA 3GD6A 1KM0A 3WSUA 3EX2A 1HL9A 2WKGA 4GBUA 3TAKA 1XYLA 1TIWA 3QKZA 1JYXA 1EWEA 1BG4A 2ZVIA 2C0HA 4IJCA 3RIKA 3UU0A 4ZA0A 1MMFA 3LD5A 3V0SA 3AIUA 3SCSA 3TYDA 3MKKA 3SCVA 5H1WA 2OXNA 3MJMA 2WB5A 3M5ZA 4ERIA 4MB3A 2ZZ1A 1R2SA 2HJPA 1PV8A 1J0IA 3XINA 2GQ9A 1Q4NX 4IIGA 3MHGA 4LTSA 2VNCA 3POHA 2PWFA 3AJXA 1GVRA 1CXLA 3LHYA 1TR1A 4ZL1A 1FWNA 3QMSA 2PRLA 4NAEB 3BG9A 4JEJA 1H7WA 2Z2BA 1JEZA 6REQB 2GGGA 4JY9A 5D2VA 1LQ0A 1H7PA 5K9DA 5REQA 4H7CA 4JN6A 3UR8A 3PTQA 3C3UA 1J6OA 3CV2A 3L4VA 1P43A 3G1YA 3GIPA 1T99A 3W4RA 3GFYA 3LI1A 4H9UA 3ARTA 3W7KA 4QJ3B 4AIUA 4W7UA 1JDDA 2PTYA 1FWEC 2YCLB 4B4HA 2DH2A 3PJTA 4NZ1A 1JI1A 3QM3A 4P7QA 4K2SA 5GNZA 1EOMA 3SUUA 3DC8A 4MSSA 3HU7A 4IISA 1VJIA 4AX6A 3N14A 2WSPA 4PMQA 3E3HA 1IR1A 2P0IA 4JICA 1E5NA 2TRSA 1OADA 1YXCA 2ZADA 3LV6A 4M1RA 3UZWA 3VINA 3A6OA 4IXHA 1T40A 4I5RA 4DYKA 2R1NA 3KUMA 2ZTJA 3VA8A 4KIRA 2WMJA 2Z29A 2HVNA 4ZXOA 2QGHA 2GDQA 4FA3A 5LIXX 2DT3A 3OLIA 2POTA 3LCLA 1A5MC 2BG5A 5FEWA 3F4NA 1MXSA 2QPSA 4FNPA 2V5BA 5FL1A 4UOZA 1JPHA 1OHLA 1AH3A 1CLXA 2VURA 4OBTA 3IV3A 1BQGA 1RP9A 3KAOA 2E8YA 3L12A 5HNRA 5A8QA 4RCXA 3B8TA 3FLUA 4NJIA 3WENA 3VTRA 5KSWA 1W2VA 1BYBA 1RBOB 2ZWZA 2J75A 4Q4RA 2Y0FA 3TNBA 3V0UA 3KHDA 1B4KA 3KL3A 1PX3A 4WY0F 4WKAA 2E8ZA 3NQ2A 1H49A 1U5JA 5M5DA 3TP4A 3CH0A 1OCNA 2BXVA 2VCAA 4O8RA 3L4UA 1OFRA 1XIIA 3NQGA 3CUFA 1J6PA 4GBDA 3GBEA 3DCPA 2H6RA 1RQHA 4NNAA 5CAKA 4GZIA 2VC6A 3P61A 1TTQA 2VEIA 3GG0A 4L4PA 2XPKA 1XYBA 4XD3A 3TZNA 1H50A 1V02A 2DY3A 4WDTA 4F3HA 1Q85A 1LLOA 3V36A 1GKQA 3G6MA 4JTKA 2J27A 3VE9A 4F79A 1T41A 1IEVA 2DT1A 1TTJA 5CZJA 3SUVA 2DIEA 3REQA 1AZ1A 4GVGA 3C6CA 3W7EA 3LM3A 1UASA 5FF4A 4WX2A 1WXJA 1V6TA 5CGQA 4EACA 2GPTA 1ONXA 4E8GA 1F8IA 2VWTA 5I78A 1EFZA 3KWSA 3NL6A 5DLCA 2WM0A 3DFOA 2EXOA 4REQA 3GSMA 3H55A 5FJPA 2YDAA 3T0TA 1X1OA 4ES4A 8A3HA 3S6OA 3UR2A 5HPOA 5BYWA 1AW5A 3K4WA 1XYMA 1GQLA 1SJCA 1W3TA 1PDZA 4P8VA 2V2DA 4DWSD 2Y8UA 2V67A 4MZYA 4UQEA 4UQCA 4JX6A 4NI3A 4CD8A 1XINA 4XV0A 3CV6A 5IXEA 3NDYA 3GTHA 1YDNA 2E4TA 3NGJA 4DJED 1GVSA 2HDJA 3NURA 4GYPA 2V82A 1I9CB 1E4NA 2YR1A 3IIZA 3M16A 4O10A 4HTBA 1JCXA 3KTXA 1C92A 1W1VA 2W9MA 3HURA 3LLFA 1VKFA 3S2JA 1TMLA 2CLHA 2CLPA 5BROA 4GACA 1M41A 2I9EA 2Y88A 3HPAA 4JN8A 3W38A 1IF2A 4LAMA 3WFAA 1BWVA 3AS3A 4JYDA 4PB3A 4C5ZA 4U28A 6ENLA 3BLKA 3UEQA 1UUMA 4YCOA 3JRKA 4JBRA 3L2MA 1MUCA 4HU3A 4X22A 1TA3B 4UFKA 1U1UA 4V27A 3KVJA 2OSYA 4QISA 3LTYA 3FKRA 1EC9A 3BCDA 1KFWA 2VEFA 1CLKA 3WNNA 2CHNA 1XDMA 4K36A 2FKPA 3B04A 2HE8A 2YDRA 4XK2A 5JBDA 3TSDA 2W3ZA 1J0JA 2QR6A 3K30A 5E1QA 1GOMA 3SRDA 1UKTA 1E1EA 2WQDA 2WJZA 1KCLA 5A5WA 4XSLA 2ZUVA 1TCDA 5DXXA 2PDGA 1EEXA 3EBVA 2WWDA 3P0XA 3QJAA 3R1ZA 1XUZA 5D9PA 1EBGA 3RU6A 4WZHA 5C9RA 2PGFA 4WLCA 2WZTA 4L5ZA 1GKPA 4WD0A 2RJHA 1ZL1A 4FR6A 2OWCA 3RM8A 4UTMA 4XTIA 4W7VA 3SECA 2QLYA 3GVRA 2OSWA 2YCLA 1U5HA 2PB1A 5BMXA 3CV1A 3H2OA 4Q6XA 4F0KA 2OYMA 1HQTA 4HNTA 1X1NA 5SWUA 1RLCL 3G3DA 4RDWA 5KITA 2DVUA 3JVAA 1US2A 4LV4A 1OX4A 2CKRA 3WF0A 3H24A 4QS5A 4IH3A 1LLWA 1KTNA 8TIMA 4B5VA 2BHZA 3WJSA 3OZPA 2GSHA 1M65A 5BNKA 2J47A 3NQDA 1ISYA 2OQLA 2Y61A 1Q2RA 3L67A 3JR2A 1SO6A 2ZDRA 3VNMA 1GGOA 1RJRA 1EDTA 4DO5A 1J2BA 1ZAHA 1KXQA 4LF2A 1FOBA 5FIPA 5JIWA 4MZ8A 1TUFA 3NQMA 1GOWA 1IXQA 3FN9A 4RV3A 1TQJA 1CXKA 2TPSA 2F7FA 4JFSA 3T0DA 3MZNA 5M03A 1THFD 3LCFA 1YXYA 3C86A 4HPJA 2YCJA 3WBWA 1BTMA 1FDZA 2Y1HA 3QY7A 3WL0A 4FXSA 4AC1X 3HJEA 4PTMA 1W91A 1ITQA 3OJGA 3OZMA 4Z08A 5DY3A 5KMYA 4L64A 1XI3A 4JTCA 3MYOA 1FCVA 4PBEA 3B8UA 4H83A 3GBDA 3RLGA 3MB9A 2CWNA 3OBEA 1UZDA 4IIDA 3TYCA 1E56A 4RLIA 3VNZA 2Q8XA 4S39A 3AU2A 1UWAA 4DI8A 1RSCA 1XDJA 3VIIA 2G95A 3PZUA 3S2NA 2ZXQA 1CGXA 3NPVA 3IJQA 2NLIA 1QPKA 4L1GA 3QVQA 3N2XA 3MUCA 3RCYA 4A21A 3FJLA 1UB3A 1E40A 3ANUA 4QFUA 1E6XM 4JQ3A 3NZGA 2PI6A 2X1TA 3MHFA 4DWDA 1OX4B 3DX5A 1HKJA 1PCKA 1HX0A 4EAMA 3SGGA 4PTXA 2XIBA 4NHVA 2HISA 1WAWA 1H51A 4GVFA 3RX2A 4WJ8A 3UZXA 2OLHA 5C71A 5E70A 1EA0A 1ITUA 3MI6A 2QJIA 2I16A 3E6EA 2G41A 5JH1A 4R33A 1HL8A 4A3QA 1W5MA 6A3HA 2DZBA 4CU7A 3P8JA 4XISA 3FA5A 4RPQA 3BO9A 2D69A 4OVXA 5I3GA 1YRRA 1HFBA 4CVUA 1RV8A 1N2VA 4GZJA 5FD0A 3EMQA 4HOWA 4LUSA 1DQWA 2G3FA 2YA1A 4OIFA 5H8PA 2GGJA 3MP4A 5D38A 1B2YA 2QDEA 2R91A 1JYWA 5D02A 3COTA 3ZOAA 3BLOA 1FXPA 2F2KA 4BF7A 1TVNA 3EPOA 4GXPA 3DYMA 3S2LA 1QHOA 1QNRA 4A35A 3PC0A 3WLTA 2W63A 1DJYA 1OGGA 4BF9A 3IV8A 4FLRA 1PZ3A 4R9OA 5AC7A 3K8MA 2P53A 2Z24A 3TKFA 1V93A 3GTIA 4GVIA 1ZFJA 5EPDA 2NUXA 1VAHA 3G8RA 3RCMA 4M3PA 1DPMA 1PO9A 3BGGA 3K1DA 4AYGA 4MGGA 4XKMA 3VNYA 4XO7A 1UJQA 3ARSA 4DXXA 2FHBA 3B8WA 2PDQA 2W6RA 1FWIC 3M0VA 4H8NA 2GVLA 3WCZA 3CQIA 3W82A 1E55A 1F76A 2OYKA 3C3NA 3G1AA 3LN3A 3N15A 3NVTA 3STGA 3KM8A 4FXJA 4YNGA 1V03A 2X0YA 3GC5A 3ITVA 3KOWA 4BS0A 3ZVIA 1DQXA 1FDYA 3G77A 3TWAA 3R7MA 1W17A 1EJ7L 3HN3A 1QK2A 3QC3A 4DEFA 3CPRA 3AJ7A 4GIYA 2QHAA 1JPKA 1SW7A 5H8MA 2IQDA 3LGEA 1EUAA 3L4ZA 1QI5A 1BD0A 4FS9A 4Z42C 2C1GA 2YJQA 4D6JA 3QW4B 4OOUA 2ZICA 3BW4A 3D3AA 3TFCA 1V3JA 3OTRA 3DZ1A 1XW8A 2VZUA 1EJTC 4S3FA 5EY5A 3QZAA 5U7SA 1H11A 1EDQA 3PF3A 3W9ZA 1UH4A 5DANA 1WE5A 4Z1YA 4GC4A 3BJFA 2IXUA 4HA0A 4F9DA 3LSBA 2DSZA 4AEEA 2P8BA 4DXVA 1P0BA 2OEKA 1EC7A 3VKAA 2Z1VA 3W27A 1J01A 4BI5A 2ZOXA 2VC7A 3HV8A 3CU2A 3R0KA 1HO1A 3S2MA 2VT0A 2YW3A 2QJHA 4S3GA 3BCJA 4EANA 2QGYA 2INEA 4LBSA 3KBVA 1SFLA 4TV6A 4LFYA 5E0FA 4YJ5A 1S2WA 4HCLA 3WNMA 2YFOA 2NXGA 3Q2DA 4LB3A 1LOLA 1E0UA 2PC8A 1R47A 4LOCA 3EOLA 1VC4A 1U1JA 2C91A 1J0KA 4O18A 3E5BA 3HMCA 3KBMA 2J8GA 3W53A 3CMGA 1UC5A 2CC0A 1TX0A 1HJSA 4A4AA 3HPFA 3W6MA 4XB3A 4C6DA 3UYIA 4H6QA 1P1XA 3MUAA 2ZZ7A 4HTYA 1ICQA 4UOJA 1OVDA 4N0RA 4B5WA 2HVMA 4W84A 1JZ5A 1LUCA 2A1YA 3IVSA 3R89A 4MHBA 5DN1A 1K1DA 4JQ4A 1G9HA 1SSDA 2O4QA 1J5TA 3QHMA 1EIXA 2OOFA 3HPZA 1KRMA 3WJZA 1XH0A 4E3TA 3GTFA 1NVMA 2ZWYA 2I56A 3LM7A 1OB0A 3LTPA 4L9YA 1W8GA 3ZMRA 3ABQA 5A8GA 1V08A 2GYIA 2WJDA 3G8EA 5GVJA 1CECA 4Z2HA 3P80A 5I23A 1C93A 2D2JA 3AU6A 3I4EA 3G1HA 1E1CA 1ZBWA 1R9XA 1JCMP 1UG6A 1RD5A 3P2VA 3KDOA 2E28A 3A47A 3HQPA 3SAZA 3RX3A 3LLXA 1CPUA 1NARA 2WHKA 1VJSA 1JPDX 3CIWA 4H9XA 4HN4A 2PCQA 3VFLA 4DM2A 3AS1A 4AEOA 1XRFA 5I2UA 1T8QA 4E2BA 1NWRA 1BXNA 5FSDC 2R14A 1TV5A 2F9RA 3GNNA 2OEMA 1XYAA 1YIXA 1W3NA 3E0VA 3MHUA 4H9VA 3S5OA 3MC5A 2EGZA 3B9DA 2IPFA 4A3RA 1R7AA 1D2KA 4OOZA 4U4MA 3KP0A 1MZHA 1PIIA 2XSBA 2F6UA 1TV3A 4JIIX 3S5SA 4RE3A 1W8SA 1BGAA 4DJFC 2TMDA 5CCZA 3TAOA 1J12A 1DVJA 1JYNA 3BAKA 1ZNNA 1PEZA 3VNJA 3WH6A 3IPWA 4MFDA 1RA0A 1K7XA 1I2NA 3VGDA 3UGVA 2FFIA 3T0BA 4OTKA 1BHGA 3GO2A 3LLDA 1V8EA 4JNMA 5H2ZA 3M0MA 1SZFA 3ZJ6A 1GQNA 1W1ZA 4E8DA 4I6VA 5C2CA 4O57A 4R27A 1G5AA 3EAUA 4GYJA 3QV8A 4R5EA 4DX3A 2VWSA 4PGLA 1QTWA 4Y9AA 3W1TA 1Q6DA 1EZWA 4AHQA 2ZC8A 3LCHA 4FB7A 4UFLA 3W7DA 4ZQCA 4PCPA 3BWWA 3LSCA 3QBUA 3M07A 2WC3A 3P62A 4DZHA 1GWJA 2HBXA 4E2OA 1BAGA 1HP4A 4DO7A 3P6LA 2IMRA 1LBLA 4KWWA 2DJLA 3CZEA 3KTSA 5PTDA 4AIOA 4LB4A 4UUIA 4HA3A 3GVGA 5ABFA 4I7UA 4DBEA 3ISIX 3SB0A 4HYVA 1QPNA 3SQLA 3BE7A 3PZMA 3NDOA 3S46A 3LZ5A 3OO2A 3C2YA 1SUXA 1WB0A 1XIDA 3C2EA 2G97A 3QGVA 4FLQA 4WGHA 2OMAA 4AD0A 2VGFA 5G4HC 4IPIA 1KTBA 4CGTA 3WUEA 3RLHA 3UVIA 5A69A 2CZVA 2IS7A 3R79A 4KRUA 3TH6A 1OK6A 1OFQA 1TO3A 3WD3A 3BCFA 4C6FA 4TQTA 3CWNA 3DXIA 2DSUA 5CPMA 3S5NA 3BV7A 1VBUA 3PAOA 4GO8A 1IZCA 2YA0A 3EOUA 3B4UA 4XD6A 3DU0A 4CCCA 5AYYA 1W3LA 2FVMA 1HJXA 3UXKA 4XVEA 3VZZA 1DWAM 1GVIA 3WBYA 5I3DA 1Q2SA 2VZVA 1HGWA 1Z8AA 1DJNA 4RNJA 5D2YA 1B9BA 3DG7A 3HA1A 1H63A 3O06A 5IBXA 1QNOA 3L68A 4L80A 4RDYA 1GOIA 3W2MA 1DL3A 3EWDA 3OIHA 5I77A 3STFA 3W7GA 1EWDA 1LF1A 1F5ZA 2E7FA 2VYOA 1VCFA 1W5OA 5D4YA 1YBQA 2QPUA 3SCRA 2QF7A 4UXDA 1QHZA 2CXEA 3OG2A 4OFCA 2XFRA 4IJBA 3E2QA 5I7GA 3DN5A 3TR2A 1QNPA 2PDWA 4G7EB 2DZAA 5AC5A 1SO5A 2MNRA 2XINA 3ABSA 3A22A 3N6HA 4PCFA 1OWQA 3B9AA 5BRBA 2GFTA 3F2BA 1E3XA 4FR1A 3OGVA 2C71A 2IKJA 1O95A 3M0XA 3FSUA 1S1RA 1E9YB 3RN6A 2GGHA 5GQBA 3GVQA 1MW3A 1SM9A 3CHCA 3N25A 4AC7C 1WAUA 3T2QA 3MVTA 2H9AB 3BICA 1NTHA 3ZT7A 1TPWA 3CUGA 2G4FA 3WELA 1FUYA 4QDMA 3M4HA 3RO6A 1LL6A 3DUGA 1Q8JA 4RZ5A 3VABA 2PWUA 3FAXA 3KZPA 2G8ZA 4LUTA 4D1JA 4FPSA 2WMIB 1W3HA 4BA0A 2GK1B 2OB3A 3TWBA 4IX2A 3QMTA 2BNJA 1O5KA 5D09A 1GZGA 3AXIA 1KO0A 3RUBL 3E02A 3MV01 3KOYA 2H8XA 2XSXA 1CT5A 4TVCA 1IZKA 4ZVJA 3HO8A 1L6GA 5JVLA 3S5YA 4X9YA 3AALA 3EWWA 3F4VA 5AECA 4QIUA 4TV5A 3EEGA 1LRTA 2O9RA 1SSGA 1VFMA 3IGHX 3SN0A 3M46A 4Z2GA 1ENUA 2ZXAA 5C0QA 1IXPA 2JEPA 2XN2A 4NZJA 4DUXA 1R2RA 3ZJ7A 2BXZA 4MNLA 3QSTA 2R9RA 4AISA 3EX3A 1AG1O 5BWFA 2VEMA 5I3IA 1VIZA 3U9IA 2Z1XA 2XH0A 1BLIA 1FWHC 2IKGA 4MUPA 4E0CA 3MS8A 4HK5A 5KZMA 2QV5A 1L2QA 3WDJA 4C6CA 4IICA 2ZQ0A 3GY1A 1TTIA 3APGA 3TN6A 3CAVA 3WQDA 1TKKA 3SCTA 3G1RA 4C7DA 4S1FA 2KAUC 1KXTA 4C7FA 1XISA 3KDNA 3W2NA 2XDFA 4XZMX 4MWAE 3S47A 3AISA 1VPQA 4GVHA 2W5FA 1B5TA 4DHGA 3LPOA 3CAKA 3SN4A 4Z0JA 2R1KA 1C3FA 3IUDA 4LV9A 1XIHA 4DYEA 1MDLA 4DY1A 2NQ9A 1W9PA 4H7ZA 4DLFA 4CD7A 3RLUA 4UQBA 1B3ZA 2D73A 3W00A 4HB7A 3PUDA 3ARUA 1E4LA 4S2BA 4WIWA 3N19B 1BXCA 2V69A 5A95A 1E15A 5HQMA 2A4AA 1J9YA 3B8VA 1SPQA 5TAOA 2BODX 1HW6A 4WOQA 1OSEA 4JKMA 3ITTA 2OLSA 3N4AA 2W67A 5C55A 4R7OA 4ERGA 3H4GA 5D8ZA 4LBRA 4DBSA 5ABFB 4LCSA 4HA4A 4TX8A 3BG3A 4HSNA 2Q71A 3E2VA 1OG0A 4ZXLA 5HPCA 1V3HA 2DH3A 2O92A 3CWHA 3UYCA 3KVKA 4OECA 3I4KA 3WJXA 4Q8MA 3TJ4A 1NF0A 4LWWA 5AY7A 1GYNA 1XD0A 3B0XA 4ACYA 1HP5A 1I75A 4PFMA 1UOKA 3ENLA 1ZTVA 4LVFA 4DVOA 2BY2A 2A3AA 2HROA 3RILA 3PPCA 4CNPA 3FNDA 4IQEA 3WNKA 1DWFM 1DE6A 1F6KA 1G67A 3GNPA 4B15A 1LL4A 3QF0A 4BI6A 2QKFA 1PZ2A 2WMHA 1C7TA 3B05A 3N2TA 2VUNA 3UWEA 3MTWA 4QJ1A 3S1XA 3TXVA 3IVUA 4LVDA 3K4DA 1JIBA 4GY0A 3UPMA 2VD8A 4MWAB 5KETA 2X1IA 1V3LA 1VFOA 1E73M 1LROA 2PBOA 2IW0A 2OOGA 3TYAA 2FVKA 1WDSA 5ABHA 1ZUAX 1ZBKA 1VBGA 4KEVA 5D9MA 1RXOB 3WBAA 4JTTA 4E8CA 3CQJA 3WH7A 3ZZ1A 3VVGA 1PXGA 3W26A 3FDGA 3TR9A 3UA4A 3AYTA 2WMIA 4CCEA 3P82A 3REQB 4OGZA 9CGTA 4HHPA 5IM51 2YXOA 3UF9A 2XFFA 4AD3A 5GNYA 4HNLA 1VEPA 3T9PA 1IEWA 2DZVA 3VZYA 2OX4A 3RMEA 3UT0A 2VJXA 4W89A 1E0TA 3HF3A 3C5QA 3IRDA 5AHLA 2NQZA 2V2CA 4US5D 1UKPA 4UTUA 1E9ZB 3MU7A 1EPXA 4UFMA 1S3HA 2PLCA 3VDCA 5FEPA 5CJ5A 3U2CA 3VFCA 3UNDA 4YWIA 4XIMA 1V6VA 1GNXA 3CQHA 3OQEA 2VHLA 2AQVA 3QXBA 2DT0A 5C2GA 4Z1DA 5FAJA 1PYMA 4BEUA 2B7OA 3KLKA 2Z27A 1DIDA 3O0KA 5DMYA 4HMDA 3RRXA 4O52A 2A3HA 3NNTA 5XINA 3IJ9A 2BY0A 3R94A 4XD4A 4L6HA 1Q13A 2A6NA 1A50A 2WNQA 3ITGA 4C6KA 1V02E 1CGUA 3NXFA 4C60A 2AMXA 4ZOEA 1PYFA 3HBLA 5CLWA 3NG3A 3IAQA 3WLOA 1UKOA 5CZKA 1IWPA 2TYSA 2Z7GA 2ZRYA 3PUGA 1H0GA 2CBVA 1OX6A 1U2YA 2DV0A 4HPGA 1TPEA 3WQCA 3WBEA 5ABTA 4IFRA 5JH2A 1QWKA 3MSRA 1JFXA 1WKDA 2WVVA 1WZMA 1YE4A 3STEA 3VO0A 2MUCA 3NJ3A 3TQ0A 3ZYZA 1XCXA 1XBVA 3UZ5A 4X3ZA 1BVNP 3OVRA 1V6UA 4NYYA 2EEXA 4ZQMA 4GG9A 1Z89A 4RR4A 4M81A 4NT0A 2HRWA 2A3LA 4ZQRA 3H2MA 1Q6FA 3N9KA 1M01A 1OC6A 4IM4A 1UWQA 2QW5A 8XIMA 4QX4A 2D0FA 2PDHA 2GOKA 1KXHA 4RNHA 4XUYA 2BB0A 3B0UX 5HULA 1QT1A 3VNDA 1ZCOA 1WZKA 1R3YA 3SEPA 1QMLA 4EWND 4QSHA 3PZIA 4YL2A 1GHRA 1KLZA 5K9CA 2XTKA 2YL5A 3MDUA 5JBEA 3L4TA 1YBQB 5G5IA 1O6IA 4QJ4B 1L8NA 3SCUA 3BMWA 5FAGA 1QFEA 4C6LA 3CL6A 3H54A 2J66A 2ADAA 5HXMA 2X05A 4POCA 4IP4A 4TXEA 5B7YA 2HPMA 4AZ6A 3R5EA 3WEMA 3VDBA 1JAKA 2INZA 4F0RA 4DUOA 4M6VA 1FWCC 3D6NA 3UG4A 1OINA 5HANA 3TJIA 1TV2A 4DF0A 1SJBA 2CBUA 3AZRA 2Y85A 1BRLA 4NY2A 1HF6A 3FJ6A 4FIRA 3C61A 1A3WA 4H6RA 1NOUA 1UBPC 2G37A 3DFNA 3BL3A 1E4MM 4F0LA 1S2TA 2I1OA 4PE8A 3CUXA 3MO7A 1AQHA 4DZIA 3HJZA 3RLVA 4Q6JA 3UCDA 3WUGA 4GXWA 3II1A 3KBJA 3DEQA 4JFWA 4ZOCA 4YYCA 4XAZA 4ML4A 3C0LA 1ZBVA 4C6QA 2Y2WA 3UXDA 1RJQA 3PZQA 1REQA 1GQJA 3NSMA 4XX6A 4QR6A 4C6NA 1ECQA 2DZUA 4M1BA 4CKQA 4DO4A 1B3VA 2X42A 4AY7A 4F2UA 4Y9NA 6TAAA 2NVDA 1GT8A 1XM3A 3MUXA 3PBUA 4MIMA 1MUMA 3NQCA 2OEJA 3EX1A 3D47A 2X16A 2PD5A 3IGXA 3JW7A 1GG1A 1QXLA 3TTOA 3WLSA 1ITCA 5FF3A 2WPBA 1KWKA 2PEVA 2X30A 4MOZA 4DJDC 4PL2A 2FH8A 3IK4A 2E5BA 2OT0A 2HNHA 1KD0A 3QHOA 4AHPA 4FLOA 4XAGA 1J93A 3R12A 5C9WA 2AAAA 3A13A 3NM1A 1XDLA 2ZUNA 1E6RA 2ODOA 5I5RA 3GYEA 2REQA 2WOQA 4JTEA 3AHZA 5A2BA 1QHPA 3CPUA 1X6UA 3VDAA 3DFTA 2E6YA 4XUGA 1TWSA 1C91A 1H3GA 3IACA 4F0HA 3WDIA 2GDVA 3M0IA 3R58A 3WKZA 1EOKA 4JIHA 1HZYA 2JALA 4OQVA 3MMTA 3RJXA 2E9MA 5G4EA 4UR9A 4BFAA 3C0QA 3S9YA 2HCVA 1B90A 1I8JA 1WUFA 4KGJA 1JQVA 1LDCA 2ESCA 2ISDA 4DWSC 5CPQA 2QJJA 3MUY1 1AZ2A 4ZO6A 3FCPA 3WMLA 4XAFA 3RM4A 3F2DA 2J6VA 1XLBA 3GG7A 4GUIA 4HT3A 3VIJA 1W32A 1UYQA 1G69A 2V5LA 1ZY9A 3EB2A 4QBXA 2VQTA 3MV11 3E2RA 1LOQA 2BASA 4XWUA 3W07A 2XJ7A 2CXGA 4GXMA 1TVPA 3CO8A 3DI0A 1ADOA 4D71A 2YL8A 4GKTA 2Y8VA 4CNNA 4BHYA 1JUKA 4Q7NA 4C6EA 1OFAA 1TPVA 2PP0A 1E6PA 2IKIA 4KWVA 1CX9A 2WPGA 1KGUA 5CLTA 2VMFA 1TREA 4YVVA 1UOZA 4N2YA 1DHPA 4CNOA 2RKXA 4Y6GA 1P6CA 1HO4A 2BVYA 3KOFA 3MCMA 3CGTA 4IP5A 2P5NA 1H7NA 1K8CA 2BOEX 4O1DA 1KRBC 4D6GA 4IGNA 3MCNA 4L1WA 2ISVA 3V18A 4O1CA 1FWJC 3L21A 3VDHA 2YB4A 3TONA 1EB3A 1S38A 1TYGA 1J11A 3WN6A 3BLPX 4Z2KA 1GTEA 1XHGA 4TO8A 3W7JA 1ADDA 2ZDSA 3WQGA 3GHUA 1LTDA 3PBVA 2B81A 5GJPA 1VFFA 3P81A 3LBCA 4E2VA 1GQIA 1XLAA 4W7WA 3BZJA 4Q4QA 4RJEA 3H26A 4DNHA 2EPMX 1KTCA 1J96A 3M64A 3R13A 3BURA 1TPC1 4LY8A 2FFCA 3MO4A 1GEQA 1V0NA 2Z1KA 2G5WA 1EKOA 5FJJA 3MSYA 3TN4A 3S83A 2OQYA 1JYVA 1VP5A 3T78A 4PN2A 3DKJA 3TLQA 3PSWA 2J7DA 3K13A 2J77A 4AWTA 1KQZA 2CEQA 4JD4A 1RCQA 1OM0A 3UWUA 2EKGA 2HQAA 4GUHA 1XGDA 4YTRA 3AIRA 2W66A 3SO7A 2PGRA 5CPSA 1XFBA 2JIEA 4K6AA 5HR7A 1D3HA 1UKQA 2QUVA 2GQ8A 3A5FA 3DKLA 4LRSA 5FCZA 4ZO7A 1YLVA 4FX7A 2YX0A 4NZ3A 3EMZA 3U3HA 1XRTA 3P74A 1D7KA 4FNSA 1VS1A 2ONEA 1H62A 3MQTA 1BSLA 4XD5A 1VCVA 1M7XA 1U83A 1OC7A 1ZRQA 4LPCA 1EDGA 2W0UA 2WBGA 2DZPA 3AMKA 1KGXA 2QT3A 3W84A 4LNCA 2D2OA 1FDJA 3HOJA 3CT7A 1ZENA 1SFTA 4ICNA 3D0CA 1JGIA 3B0VC 4AZHA 3LMZA 4R7WA 4L1XA 2Q3OA 3O2LA 4JCMA 1T96A 3MWAA 1LBFA 1N8IA 2ICSA 4EXQA 3SCQA 5H6HA 1XKYA 1TMQA 2CLIA 3WMCA 1G0CA 1TELA 5F4XA 5D8WA 3I10A 1GOXA 5CKSA 3GW0A 4HHLA 3PB0A 4MFEA 2BXYA 2FZDA 5AHNA 2PUZA 4IIBA 5EBAA 4I9MA 1XSIA 1XFCA 3MUZ1 1LG2A 1OIMA 1R2TA 3U7BA 4H00A 2YSWA 3WYZA 4GCXA 3OLGA 1E51A 3E12A 4C1NB 1P0EA 2V38A 4IJRA 2PDCA 4PEEA 3VD7A 2WMFA 5AB3A 3QR3A 1UJPA 3WQ5A 1VLIA 2RH9A 2Z1SA 4LS0A 1Q6OA 2BHYA 2F38A 1FWTA 3QV7A 3ARWA 1XG3A 3L2IA 4DWSB 3U0HA 1V3MA 2BZNA 4XQ6A 1MRQA 1DHKA 4OZOA 2YPIA 5BOFA 4KT2A 3CJPA 3I7RA 4J7RA 3W7CA 4BJHA 1N82A 3EX6A 1ZS2A 4LC6A 3UWZA 3A4XA 2FPVA 4C5YA 3B8DA 1KM2A 2OZTA 4U2ZA 5IBXC 2CHRA 4G9PA 1W9VA 1M1BA 3CT2A 4KCTA 3XIMA 4V1XA 2JKAA 2FDSA 2Z28A 3W7QA 1W54A 1W1B1 4XKYB 2VFGA 3NTYA 1JCJA 1W1IE 1ODZA 2E1DA 3GVWA 1QNSA 2CLEA 2VRJA 3TV8A 4GHRA 4YWSA 1A49A 1LCOA 1IGSA 3TFXA 4LH8A 4PSPA 1EJWC 2PWGA 1WDRA 3EB3A 1VRDA 3W74A 2ZZ6A 1IEQA 5G2IA 4JQAA 1YTDA 4I9AA 1RALA 3VIPA 4X2RA 1O5QA 1D7FA 1UR3M 4HNCA 2X7WA 3FYOA 2ZX6A 4XSMA 2J78A 2G3NA 4BY3A 1CB7B 3L0GA 3ERPA 3WLQA 3BJSA 1VIWA 1WKFA 2FYMA 1JGMA 1T7LA 3S6TA 4DJFD 2VEGA 4X63A 5I00A 1PTAA 2NXIA 3FXGA 1P5BA 4FNTA 2QV4A 1KCXA 1F9CA 2PC4A 3CZJA 4YVPA 2NSOA 4B3KA 4JZ5A 1OG6A 2QUUA 4LUYA 3WF1A 1UZ4A 1JNDA 4CN4A 2ZIDA 1E70M 5HUOA 4AZCA 3ATYA 1PUDA 4AYSA 1TRIA 4HSOA 4XVDA 1PKLA 1F3XA 3DYOA 1E9IA 3O0FA 1AA1B 2DZTA 5AHFA 3HG5A 3PJWA 1ONEA 4M6UA 4W9TA 1OYCA 3EX4A 4IUOA 4B5UA 1EP3A 3NVDA 3GTNA 3S9ZA 2V3EA 3UNTA 2QCEA 1UD8A 3FVMA 4DBWA 1W9DM 1XBZA 3LYEA 1LG1A 3URAA 4MKVA 1ZGDA 7XIMA 1MXGA 4UCFA 1OK4A 2ANUA 5HWNA 4LYKA 1A53A 1BTCA 1VF8A 4S3CA 3LUTA 3J7HA 3GW3A 5J8LA 1Z42A 4PL1A 3TOYA 1A0EA 3I6TA 4RDVA 1OABA 3SSJA 2YCIX 5AHMA 3SQSA 4X60A 2YFNA 4K8HA 3NSXA 3T8LA 2XISA 3PZVA 5DMLA 4IPPA 4KCUA 1PTGA 1P6WA 4DQWA 1AD4A 1FHVA 2VVSA 2OKOA 3AZSA 4R34A 3ORWA 1IT0A 2Y5EA 3TTSA 1VFHA 3C2VA 2E09A 1NSJA 4AZ7A 2QNEA 4O12A 4PRRA 2ACSA 2XYLA 4FF5A 1UZHA 3JU2A 5HR6A 1JCNA 2J7HA 4A05A 4F8XA 3EA1A 3G1XA 1JF6A 3WLMA 2P50A 3UERA 5AFDA 2PTXA 3FXYA 3VCNA 3VIOA 3GB6A 5E09A 5EMLA 2WVVB 3VGHA 1BKSA 4R7JA 3M0JA 1FFRA 3R25A 3DIPA 3FYYA 2WJEA 3U2ZA 4WXZA 3PK7A 2XVLA 1VHNA 3AWOA 3SZ8A 3NZ1A 1C9WA 2QZRA 4EAYA 1TZ9A 4AVOA 1DJQA 1OFEA 2WNZA 3KBSA 3WQ4A 3ITCA 1NF7A 1PZ1A 2AAMA 3HGSA 4AD1A 4HOZA 1YPXA 3AICA 3BAJA 1TWIA 1FH9A 2FGZA 1KB3A 2VZTA 2ZFAA 3W72A 4Y90A 4GNKB 2WO5A 2OR2A 1GKRA 3A24A 3P8IA 4I5XA 1FCUA 3IEBA 2ALDA 2E6AA 1JUBA 4CD5A 1CXHA 4RL3A 1J8VA 1K9TA 1XIFA 2OPJA 4ATWA 3RCNA 3H22A 1M6JA 1G7VA 3LERA 4QJ5B 1K9FA 3DBNA 4DI9A 3A3WA 1VYRA 1EGZA 1B9ZA 3KCJA 1J0HA 1JZ3A 1H7OA 1V7AA 2EAWA 2PLMA 4ROQA 1BEUA 3URNA 5DO8A 3GU2A 3W85A 4ICMA 2E6DA 3GUGA 3NZPA 1XBYA 4GI9A 3UA3A 1K3UA 3Q94A 1CENA 4ZOAA 1SMDA 4AIEA 1A3XA 2H8ZA 1NH6A 1A5AA 1L6FA 3KCLA 1ODUA 2VDIA 2VCCA 2CLLA 3NL2A 4UC5A 5HQLA 1P48A 2QJMA 5HOSA 4DJFA 1M3UA 3A64A 4L9ZA 4L65A 4LUIA 3GTXA 3PAJA 2V3DA 3LB0A 2B7PA 3QY8A 4BEQA 5I3HA 1NFPA 1DBTA 1TCMA 5LA1A 2V81A 1S2CA 1RLDA 4BQ4A 4U10A 4O19A 1X6NA 1XPYA 5HUPA 2QVNA 2D3NA 4JDBA 1VFTA 4PTVA 1RH9A 3N18A 3VOJA 1O12A 2Z00A 3QR0A 3AUJA 5AC8A 1RBLA 4RNIA 3RPTA 1O60A 3SY1A 1OGSA 2DVXA 4XZWA 4O1BA 1PB0A 3OU8A 1XIGA 2X7VA 2C6QA 1TV4A 3VZXA 1M04A 4HD5A 3ONCA 4QITA 2E9LA 4IT1A 3MANA 3VC5A 3RX4A 5KZDA 4YU1A 3D46A 4PMZA 2EPLX 1OYBA 2E1WA 2J9XA 3GXDA 3ZWSA 3KCOA 4ZSUA 3IS4A 3PB2A 4YXGA 4DJEC 3V35A 1UPPA 2ZX7A 3QPZA 2QCHA 3UJFA 3EMCA 4LAOA 3GK0A 4YTTA 3QTPA 5E93A 3EZ4A 7A3HA 2QCNA 1XCFA 2EPKX 5CH9A 2F84A 4TUFA 1DIEA 4JS3A 1F6YA 4Z1CA 1EX5A 3PBMA 4JHZA 3DHFA 2FZ8A 4BI7A 4AVNA 4QDWA 1EQCA 4GINA 4CN1A 4M7SA 1XR2A 4JNYA 4B2DA 4HNNA 4CD6A 1TV7A 3TEVA 4PR4A 2ZUWA 4S3EA 1OX5A 4ADUA 2WZIA 1MFUA 2WJFA 4JHOA 1VR6A 3L7RA 2NV2A 5C2XA 1OF8A 3M0KA 1OYAA 1NEYA 1WQ5A 3NAVA 3KL0A 4WUIA 3S1UA 3GIYA 4K68A 2I5GA 2V5DA 4Q8TA 4QE5A 3W28A 1S46A 4MY1A 1OIFA 1PHQA 2YDQA 4MUZA 4Q8PA 4O28A 1CCWB 1CZ1A 3OLDA 3QFWA 4QCFA 2HZGA 2FPYA 2CLOA 1FH8A 3DG6A 3W1LA 2SFPA 4GUGA 3VC6A 3OODA 3VGGA 1XXXA 1TRDA 1G1YA 1SZEA 4XBKA 3NQAA 3BW3A 1V3IA 2YGYA 2ZXBA 4R3UA 3V75A 5C8BB 4XAPA 4D6IA 3V1HA 3QYQA 4U33A 3WF2A 4YHEA 3WLRA 4L9XA 1PSCA 3BXWA 4HJFA 4RX0A 3IAPA 3W1XA 4F4RA 1J2WA 1BYDA 1Y8BA 3FY1A 1PIFA 1C8YA 3APTA 4IGSA 1R87A 5DBTA 5ECUA 2XM1A 3SIZA 3E2SA 2DUAA 2NX1A 1V6XA 3PZTA 1FWAC 3C2RA 3C2FA 2BOFX 3HMJG 3ARYA 4J3TA 5ABGA 3LXCA 5DCEA 3LBOA 2OZ0A 1PJ9A 1UWUA 3NZRA 4AXKA 4HBKA 2Z6JA 9RUBA 2WVSA 3OGRA 1EBHA 3CNYA 2QMJA 3NYDA 5CG0A 1A5UA 2VFFA 3WEZA 4UNIA 1E5JA 3NA8A 4PTWA 1F74A 2QULA 5G1TA 3UPWA 1ZP3A 3UD6A 1NP0A 1SU5A 3CYJA 4S3BA 3GR4A 3E0FA 2WZMA 2Q01A 5E6ZA 1PS9A 1K7FA 4FX8A 3G0XA 1JZ2A 3TYUA 4UWMA 3VMNA 2IXVA 1WBJA 1QK0A 1YDVA 1VBJA 3GS6A 3L5LA 1Q65A 4H6KA 4AWUA 3G1FA 4B16A 1Y5WA 1XLDA 4ZO9A 3LPPA 1HJUA 2POZA 3M0ZA 1W9BM 1HKMA 1Q6LA 3HTWA 4G56A 1DKWA 1GVYA 1H60A 3HGJA 4JIQA 4OJYA 2R94A 3KP1A 5AHIA 1TR9A 1F3EA 4LYRA 4MLRA 3FYPA 3TVAA 3P7YA 4JTQA 4Y96A 1SR9A 3PHAA 1UD6A 3LNMA 2C1HA 3EDFA 4W4QA 4D6DA 1XLKA 4UTWA 3PWGA 3QW3A 1R3WA 2F2HA 3Q37A 2XH2A 3RM9A 4TVDA 3EWXA 4XZ9A 1JXJA 3BANA 3ZLFA 1I2RA 1WPCA 1WDDA 3EOEA 3WG6A 1LUCB 8CGTA 1AODA 1O1ZA 1S2AA 2WK2A 1O66A 3PZOA 1F4AA 3AFBA 2JF6A 4F9JA 3V5CA 3PTDA 1P0NA 1O5XA 2ZUUA 4B90A 2ACUA 3S9IA 3AIBA 4O0QA 3W71A 1UP0A 2CZ5A 4ZCWA 3VE7A 2Y8KA 2FH6A 1R85A 4PCNA 5F1VA 3VPLA 1MWOA 3W7HA 1DWJM 1K8XA 2DFAA 4Z1BA 3G0SA 3UZYA 4I8DA 3DGRA 4GOAA 2ASHA 2BOGX 3H2AA 3EXRA 2VX5A 4KESA 3SJNA 3TYBA 3HFTA 2J13A 4S3DA 1GG0A 1J5SA 1UMLA 2NUYA 4O11A 3LX9A 3NQ7A 1L8PA 5E5CA 4H9YA 1HJQA 1RPXA 2FIQA 1U22A 4KEUA 1NWSA 3UG5A 2JGYA 3UGRA 4LXFA 1HL2A 4PSRA 5C54A 5I06A 5M2FX 2J79A 4PTNA 1XC4A 5C9XA 5I09A 4GQGA 1I6NA 2ZUTA 3EA2A 2YBUA 1VGAA 3RYSA 3I7SA 3LOTA 2HK1A 4M6QA 3UPBA 2YYUA 4FP1A 5F7UA 1HVXA 2QCFA 2EJ1A 4Q4SA 3UQNA 1U5VA 2VDGA 3AXMA 3NQ8A 4I3GA 4E4UA 1C9DA 4W87A 1VD6A 2PDXA 3VKCA 2ZZ3A 4GNJA 3CMFA 4FSAA 4TMBA 1FWGC 3UESA 4W85A 5DCDA 1KM6A 1HJVA 1HUVA 3Q65A 1AQ0A 4QM1A 3G3MA 3RR4A 4IF2A 5CGTA 1W0MA 1PWMA 2OFJA 3N34A 3FVDA 1UBSA 1IIGA 4UTLA 2PF8A 3L9CA 5I02A 2NX3A 5AYBA 4JYFA 4O0KA 4QNWA 4WQ6A 2VFIA 4FX6M 2VXNA 1RA5A 3S42A 4D8LA 3T42A 1M9HA 4DN1A 3W73A 4NXKA 1S2VA 2O9PA 1UA3A 1ICSA 3OOQA 1H61A 3B06A 4EF8A 4RPPA 4UQ9A 1WUEA 3IK2A 3QC0A 3ABRA 3PPGA 4KWUA 2X0SA 3SCNA 3U4FA 3PPFA 4L6OA 1QPQA 1LLZA 1H1ZA 3LCWA 2PDBA 3TN3A 1SVDA 3R0DA 3WNPA 1P6BA 4KRTA 3SGZA 4JY8A 4QG6A 2VR5A 4A8RA 2HTMA 3AHYA 1KA9F 2DW6A 2EBNA 2GZXA 3TROA 2PLKA 3GR7A 3RMJA 1JZ8A 3KEHA 3GWQA 3M7WA 4DLMA 1XX1A 3LGDA 2RJGA 1S39A 4JGDA 4S2CA 2ZRZA 2WSKA 2WM1A 3A5VA 3RRAA 1VEMA 4Z2JA 5T26A 4DELA 3WK3A 3W1QA 4GY7A 3LXAA 1GVOA 2QUMA 1E0VA 1E71M 4KWOA 4L61A 3MUIA 3POCA 4CNTA 4XZIA 3SCWA 3BV4A 4FXRA 2I14A 4DPPA 4B3ZA 4N9CA 5LKYA 2JK2A 4Q8VA 3F5JA 1E0WA 1BRLB 3E0LA 1B3WA 4K8GA 4ZE4A 1JJKA 3S0CA 1W1A1 2VOTA 3SRHA 2WLYA 3QPYA 3ITYA 2R8WA 1KLYA 3GKAA 2WVTA 3LS9A 1XS2A 1UD5A 4I5UA 1HNYA 2RGLA 2YZ5A 1Z9AA 4PULA 3BVJA 4Y8EA 4JIEA 2GGEA 1XH2A 1W6TA 4EIVA 2EPOA 4D6CA 4IMGA 5A2AA 3CTTA 2J24A 2YCEA 2Y7FA 2PZNA 3B40A 1I1WA 2IPGA 2OKTA 1PWLA 3L4YA 3M0YA 1G7UA 4KS0A 1ZAJA 1UR4A 3WJYA 2ZX8A 3WZ0E 5EFDA 4BWLA 4HVXA 3FOKA 1PE1A 4NNCA 2J8FA 2X40A 2W79A 4PUNA 1UWRA 2UY2A 2BGSA 4JXCA 3GNRA 5HATA 4GUFA 1EL3A 1VYPX 5CC3A 4HIBA 2OZ8A 3EXSA 4EWJA 3WUBA 3BTNA 4K1WA 4IP7A 2CKSA 2WCAA 4LEQA 1K9DA 3OZYA 5D2WA 4HPXA 2X2YA 4F48A 2PWHA 3LHWA 3BOLA 4DZ5A 3BW2A 5K2ZA 2G0WA 4GNVA 1C8XA 4MNMA 2ZX9A 4PUKA 2YBTA 3E96A 5BZAA 1XQLA 4ERAA 3ZVHA 1IZJA 3ZXWA 2J74A 2RFGA 1PBGA 1ECEA 3G18A 4CD4A 1SQ7A 3HG4A 5FJOA 3PFRA 4P8WA 4W5ZA 1UC4A 1CXFA 2NUWA 3AWNA 4LAKA 3OBKA 1K70A 3H2CA 3L66A 1P7TB 3R10A 3RU8X 5BXSA 4NKCA 3FJ4A 4C1LA 3P84A 1WBHA 3CASA 3MI3A 2CCRA 4WJEA 3AIWA 3GVVA 2E68A 2QJGA 1I2QA 4LSBA 4OE7A 3QLLA 1CB2A 2VRKA 7ENLA 5LHFA 2HE5A 1LWHA 3QPEA 5DRIA 3V5FA 4W88A 3M5YA 2QMKA 1RUSA 2I5IA 5DFAA 1WDPA 2G3MA 4IMDA 2NWRA 3V0TA 1R3RA 3ITLA 2CLMA 2Z2UA 5AYIA 4Y9OA 1ITXA 5I03A 1Q6EA 3A4AA 3W7MA 3Q45A 4KETA 4ECLA 3TQPA 1HKWA 4NX5A 4ZBCA 2GJRA 3RGTA 4DJDA 2BV9A 4HA1A 1J0YA 2UY4A 2HMCA 2GVEA 2F61A 3L2LA 1EF3A 3B9OA 4WSHA 4FNQA 2XN0A 4M0XA 1JCLA 2CIPA 2IPWA 3L5AA 3KVLA 5D05A 1F05A 2YLLA 3QRHA 1RP8A 3O8AA 1FCQA 1NP2A 3W02A 3AXHA 4AF0A 1OFBA 5A2CA 2JKPA 1Q7MA 2PODA 2QCLA 3PBYA 3O7UA 4GO9A 4NG3A 2GWNA 4JQ1A 4M80A 2E5CA 5HA7A 4Q8QA 4HMCA 4NF7A 4IMCA 1ZJHA 3DERA 1B4EA 1DP0A 4DB7A 5AZ1A 1TJ2A 1AMKA 2PTDA 5K7JA 2D1ZA 1XRVA 1LWJA 3SUTA 3ABOA 2D24A 5J5RA 3A3XA 4C6IA 4FXFA 3FA3A 1T6MA 4GYPC 4DJDD 3W23A 2E9BA 3K8LA 3PBWA 3OYXA 4KCWA 4L7ZA 1M03A 1XGEA 1WX0A 2C15A 4LY4A 5B80A 1HKVA 1ELSA 1FWBC 1K6WA 1ESWA 1RBAA 2D2HA 2XVGA 4KEZA 2R1MA 3EWYA 5A6TC 2J88A 1RAKA 4GH3A 2DSKA 4KGLA 3NQBA 3GYCA 3NEVA 1JAEA 3VIKA 1XQKA 4LRTA 4G5DA 2PP1A 3TK7A 1VBRA 2V5JA 4JTAA 4UIOA 2W4XA 1MXDA 2ACQA 2A7RA 1V77A 3BLLA 3L0NA 5AC4A 4ZGYA 5A94A 2GQAA 3THCA 2C0AA 4QEEA 3FA4A 1SZNA 1XIJA 2QCDA 5CJNA 3MY9A 1AL8A 1PZ0A 2PDNA 1KW1A 4GQBA 3BDKA 4NP7A 5CJMA 4MJ4A 4CCDA 2JQXA 2CLKA 4AY1A 4EF9A 3IJ7A 1B31A 1W37A 5CPOA 2A3BA 3LV5A 1BF6A 2F6XA 1EPVA 4AZGA 5BMWA 3W2KA 5LGZA 3BAWA 4CLMA 4MKSA 3WF4A 2ZA2A 4WDUA 1R6WA 2R1LA 1JD7A 4GCAA 1OD0A 4W86A 3W2JA 1ONWA 4YTSA 3RPMA 2Z1WA 3NL3A 4H01A 4US6A 3EKGA 1MO0A 3LHUA 7PTDA 4WK9A 3H7VA 5EBUA 2YZRA 1VHCA 2INFA 4Q3MA 4ZFMA 3D5HA 3SADA 1D3CA 3PBGA 3CEPA 3O6AA 2WHLA 4I7VA 3L5MA 3R8GA 1MNZA 2BVDA 3CL8A 1JL8A 2Y89A 3AYVA 5T91A 1K7EA 3EOOA 1N8WA 3RK8A 4BR1A 1SYTA 5HJYA 4QROA 4WVXA 3UP8A 5CSRA 2VEPA 4MLJA 3NGFA 4FHAA 1R7OA 1KKRA 1BKHA 3NCOA 1YTKA 3IJ8A 2J7EA 3IJDA 1KFLA 2BX7A 4MZ1A 4D8ZA 7CGTA 2I17A 3GLCA 3TA9A 3RJYA 3QQWA 4NZCA 3NM3A 1LBMA 4U31A 3DDMA 2IPJA 1GHSA 2Z1BA 1V6YA 4O4WA 2DUZA 3UCQA 2Y7GA 1MQPA 2PA6A 1OBAA 4B2DD 5EA9A 3WQ8A 3TC7A 1R3QA 2QYGA 3WH8A 2XUCA 4H2CA 5IHRA 2VUYA 4LANA 2XWEA 4FF7A 4JYEA 3OHIA 1Q4WA 3WQOA 3ZLGA 2P1FA 3TQVA 3W6LA 2J25A 3KRSA 4IL0A 4MPQA 3SCOA 1LRNA 1HJWA 2VC5A 3CUHA 4AH7A 2ZE0A 4IFKA 3UZZA 2J9ZA 1GK8A 4DAFA 2GUUA 2WNWA 1P7TA 1HN1A 2HSAA 3L0KA 4LVGA 2YXGA 3NDZA 5GPRA 3FJNA 3G5EA 2QCMA 3ARRA 2YLAA 4IQLA 4XBSA 2DZSA 4BWLC 3N6QA 1W3KA 1BSIA 1RY0A 2WMGA 3RF9A 3PG8A 4L4OA 2PAJA 3LDVA 1E4IA 1JRCA 1EUNA 4PMNA 1Q7QA 1L6WA 5T9BG 3W1NA 3GXIA 2PDPA 1WDWA 2NWSA 3C8FA 4D72A 3QKEA 2Z7KA 3VOIA 1XYCA 1CYGA 3OIXA 3CO4A 4E6MA 3TW6A 4Z2LA 1JPMA 3ELFA 5EYWA 4AVFA 3UG3A 4UTHA 1IGWA 4LGXA 4LNYA 3TCSA 1U33A 3PVFA 5I79A 1CNVA 2A6LA 4DYJA 3V5OA 3F5LA 2XH7A 3SI9A 3W7LA 4RV8A 2OSXA 5CZTA 1IEIA 3O6CA 2CBIA 1A5OC 1CDGA 1RY8A 3A4JA 2VZSA 2NX9A 1QOXA 2X09A 1FP9A 3VGEA 4DF2A 3BLDA 2A3CA 3MSGA 3S6DA 3T07A 1IYXA 4NRRA 3TJXA 1UIPA 5EKYA 2A21A 4A8LA 1XLCA 4PZVA 2NV1A 4FAMA 3O05A 1EP2A 4TU1A 2PZ0A 3GDKA 2VZOA 2D3LA 3DHDA 1GOKA 1POJA 3BQ5A 1XPGA 2ZXDA 4HN8A 4GK8A 3RNDA 1S5WA 2AL2A 1FXQA 2PTZA 4XIAA 1UD3A 3F4DA 1ZU8A 3M44A 5IRPA 2WC4A 1WZAA 1VENA 4PMUA 2XIIA 2GDUA 1DJGA 1GCYA 4I6KA 1E6NA 3P67A 1WNOA 2Z2AA 4MWAC 1S5NA 1W3JA 3UG8A 1MI3A 2VR4A 1VLWA 3CUZA 1KM5A 1DOSA 1LL7A 2GLKA 4QSFA 3ZSSA 2OU4A 3P5ZA 1BVZA 3OG3A 2HV5A 5GNXA 3WK0A 2FZ9A 1W1TA 5DEZA 2VQUA 1A5SA 2DZWA 4ZO8A 1TPFA 6REQA 3SCPA 4J9JA 1IT7A 2XVNA 1TZZA 4K8EA 5CAHA 4HZ6A 4YMZA 4IMEA 4L4MA 4MB4A 4O53A 4MKNA 1TFVA 1ZJAA 1WXZA 1GJPA 1YW1A 5HDRA 3ITOA 4PB4A 1M68A 4M24A 2HWGA 3AAMA 1WZLA 1Q66A 1VH7A 3CUIA 3EKLA 4JFUA 1EX1A 3VI2A 1SW0A 1AK5A 2YB1A 5A6LA 1NWTA 2XGBA 3W01A 2OODA 3N17A 3E49A 2VFDA 2VCBA 5I07A 4NL1A 2FMNA 2AQWA 3QTGA 4PA8A 4Q8UA 4R53A 5HMFA 1B57A 1GW9A 1VFSA 1G94A 2RDUA 3GZ3A 3THDA 3KL5A 1AH0A 5DF0A 4RNFA 1HT6A 4LX4A 1I60A 1B3OA 2V3GA 3M0HA 1KWGA 4UMCA 5C7VA 2X41A 2H90A 3QV6A 4OKDA 1OT1A 3I6EA 5XIAA 4HU8A 3HQOA 3E5PA 1NIUA 3I3BA 4GQ0A 4GQQA 5G2HA 4EXAA 3U2EA 1EZ2A 3QY6A 1SFJA 4LCQA 1XUUA 5AZ0A 4E5TA 2WAGA 2QF8A 2OX1A 1DWIM 3SSZA 1IR2A 2XWDA 2MANA 5A8MA 3VDGA 1CTNA 3U5YA 4LVBA 4MVAA 2BLEA 1W56A 1VB9A 1XCWA 3L4WA 4HOXA 2P88A 1REQB 3N12A 3BAXA 1XSKA 2WNNA 2ZTKA 1HGYA 2CWXA 4KMQA 3UFYA 3EDDA 2J7GA 4FNUA 2ISFA 1Q8AA 4QG9A 3WQ6A 2DQXA 2V3FA 2YW4A 3ZFHA 4C1KA 3H12A 1N7KA 5BWAA 4HQVA 4PMDA 4IZGA 2CFFA 3EPNA 5A6AA 5DQPA 1S2UA 2WV8A 1KXVA 4GGBA 3T44A 2Q8ZA 4CN6A 4GIEA 5ENLA 1YXDA 3IIXA 3W70A 5CXPA 5D32A 2FLIA 1XIEA 3VMPA 1KM3A 3SBFA 1ISXA 1YNYA 1XLEA 4HZMA 2V68A 4O8AA 5EGRA 2CZEA 5D2TA 1P1MA 3JS3A 5E0CA 4AXNA 1A47A 3DFPA 3UJEA 2VD9A 2CESA 1OD8A 1DTNA 2QIIA 4GY1A 4U5IA 4DWSA 1MFVA 1JZ7A 4F66A 3GXFA 2NW0A 1CLVA 1XF0A 3GU9A 2I57A 1XL9A 4NXSA 5IFTA 3NPXA 5G4WA 2QDHA 4UTTA 1A5KC 2FMOA 1QU4A 3IJIA 2WZEA 3AIQA 3F1QA 2JKEA 2D20A 1DJXA 3ZR6A 2XFWA 3U6WA 3VX0A 1FKXA 2ZRVA 4NAFB 4TX6A 1KBBA 4R85A 4MMWA 5HMDA 2CITA 2AGKA 1QNVA 4JX4A 4KH2A 3S1GA 5BXRA 5AVHA 3LTSA 3W25A 2BP1A 2QUTA 2AL2B 4QEHA 4BK9A 2E40A 4I90A 1PCWA 1F2JA 5HJLA 1H7XA 3V16A 3GAYA 4H41A 1BWKA 2QCCA 3CHEA 3GUWA 4JFVA 1V6WA 5HJXA 4GI4A 1SGJA 3LRLA 1M7OA 3THUA 5F2LA 4QCEA 4UOQA 1GTHA 4UBPC 2WANA 4C6OA 2NVAA 2WLZA 5M1TA 1TPB1 2RDTA 1TPUA 2Y24A 1IWAA 4MY8A 5IHSA 2ON3A 4GZ7A 4RXGA 1Z41A 2V6AA 3TN5A 2X1UA 1HKKA 5I3FA 5LA0A 1E6SM 4J3UA 1QBAA 3ZQ9A 3EDEA 4OUEA 1MVYA 5BOOA 2X0HA 3FGCB 2NQHA 3DECA 3VIMA 4GIRA 4D6HA 2DEPA 2DSWA 4F0MA 1G6CA 3MBFA 2NZLA 1J10A 4K7VA 3EB4A 1ZALA 3UJSA 2C79A 1GW1A 2WMKA 5BW6A 2ZUSA 3BZGA 3RITA 3TSMA 3MMUA 5HNTA 1K6AA 3WDHA 4ZB0A 3C0SA 2A5HA 4JTIA 4A6GA 1R8LA 2W62A 1NDYA 4V2XA 1YMYA 3N3MA 5H8UA 3VNKA 3W75A 4A2SA 3WLHA 3SRKA 4GYKA 3U48A 1WOBA 3WUFA 7ODCA 4GKLA 4Q7BA 4NZ4A 2QS8A 1TJPA 5EMYA 2OLAA 4FIQA 4JKKA 1SJAA 1UQYA 4JEQA 3FX4A 4U3AA 2JFEX 2YKKA 2BDQA 2YXXA 2PGEA 2QXWA 1XBXA 1X96A 2ZC1A 4F2TA 2R82A 4UFJA 1DV7A 1K4HA 3N4EA 4N02A 4N6FA 3CK5A 1UR0A 4RE2A 4HMNA 3MYPA 3H53A 3NL5A 1RVKA 4HMEA 2VELA 3YPIA 2ATSA 3P0WA 1JF5A 1W5PA 1C8QA 3HPSA 5HK4A 3U2OA 4C91A 4KEMA 2Z25A 5HMSA 2VX6A 4EP8C 3NQEA 3WMSA 3K1GA 4A29A 5DY2A 4S38A 2GJXB 2TAAA 3NO1A 5FL0A 5RUBA 3OEXA 1TA3A 2W91A 5A1AA 1EO7A 5MKGA 1WKEA 5ECVA 5A6JA 4MJ2A 5E6YA 4RK8A 1EF2A 3ES8A 1UCWA 2PE4A 4IQJA 1RD6A 5JIPA 4WDXA 1Y7VA 4JTUA 2PF0A 4M29A 1RJPA 3AROA 5A8OA 1EHNA 1TE1A 3PZNA 4PTDA 1XLMA 3PJUA 3TYZA 3BGJA 4ATLA 5LNWA 3FAWA 1JD9A 3ZIZA 1N55A 2GK1A 3LXBA 4H6EA 5AHEA 3NWRA 5HBFA 4FNRA 3AMCA 4JL2A 1MW0A 4AY8A 1IHIA 4P8XA 2Y4SA 4ORMA 5AC6A 2VOMA 2RAGA 4QRNA 5CQ1A 1FWDC 4WRHA 1GOOA 4AAJA 2XHYA 3RG6A 1MUWA 4J40A 5BOEA 3UJ2A 3F2CA 1I0BA 2Y70A 3THQA 4PBFA 3ONBA 3FV9A 3WDPP 4N42A 3LEPA 9XIMA 1R3TA 1X39A 5AKQA 1ME9A 3CB3A