2F3MA

Structure of human glutathione s-transferase m1a-1a complexed with 1-(s-(glutathionyl)-2,4,6-trinitrocyclohexadienate anion
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
218
structure length
218
Chain Sequence
MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase Mu 1
publication title Transition state model and mechanism of nucleophilic aromatic substitution reactions catalyzed by human glutathione S-transferase M1a-1a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 75
structure length 218
sequence length 218
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2f3mA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2f3mA01
3VPQA 5ABRA 2H0GA 3QFBC 4D73B 5J4UA 2V32A 5IPGA 1O73A 3KP9A 4V2MA 5F8BA 3EWLA 4OO4A 3TOUA 1V9WA 3HJPA 1YKCA 1XXUA 4TXOB 2E2MA 4LL4B 4WETA 2XBQA 3BOAA 1K0BA 4O32A 5DCHA 5F0GA 2H6XA 1EP7A 3VLNA 3RDWA 1DUGA 3I6AA 3SWLA 3LJRA 1T4YA 3FZ4A 1M99A 1NHOA 4N11A 5KN1A 3H93A 3M8NA 1SYRA 3KMNA 1QK8A 2KHPA 4PNFA 3L9VA 1ERUA 5JWRB 4E8EA 1VF3A 1M9AA 3DVXA 1U6TA 1SENA 1X5DA 3IC4A 4KDUA 3BJ5A 1THOA 3APQA 5AN1A 2IFQA 4MZCA 2GQKA 3VWVA 2HT9A 3HD5A 4ZILA 2DC5A 2QSIA 2TRCP 1OC9A 2DMLA 1OE7A 4ZL7A 2V1MA 2BJXA 1HYUA 2LJKA 1Q98A 5CNWA 4GF0A 2HSMB 1EGOA 2GQLA 3W6GA 4DSSB 2F51A 1OAZA 1QFNA 1TTZA 2GLRA 1F9MA 2JZTA 3FZAA 4HU7A 1ON4A 2CVKA 1MDJA 1G6YA 1M7TA 4ZXGA 2LQOA 18GSA 5CP1A 1UVZA 1KNGA 2NVLA 4KW6A 5ELGA 5ID2B 1X5EA 2B6MA 5H5RA 4AJ8A 1B9YC 3GSTA 4HZ4A 3GH6A 1SD8A 2YV9A 3KH9A 1QXHA 5A4UA 2H74A 4JEDA 1LJRA 4ACSA 2CX4A 2M80A 2FCHA 1OYJA 5F05A 4YAVA 1T3BA 9GSSA 3KP8A 5CRHA 3Q74A 3A3TA 1GLQA 5EVOA 4G2EA 1USBA 5J5NA 5IO2A 2HLSA 3LGCA 4X0XA 4WBRD 3ZFBA 2V2GA 4K0GA 1XWGA 3ZYWA 4HDEA 2ZUPA 5JWQB 2VCQA 3KTBA 3HXSA 1S3CA 2Z9SA 4POKA 5IIZA 3PGTA 3KJYA 3CRTA 3GUSA 1K0AA 2MMNA 2C1YA 4V1Ap 2L4QA 3WT2A 4QL9A 5C04A 5GSTA 1E6BA 1YDKA 2FWGA 1YF1A 3F4RA 3IK9A 4O92A 3GIXA 1AXDA 2PMTA 2N5BA 1EV9A 1S3AA 4TR1B 2GSRA 1Q4JA 4D73A 4PGTA 4I2UA 3ZMLA 3IAS2 2GSTA 2H19A 3WD6A 3H8QA 2ALBA 3HVXA 3PH9A 4TXOA 1JZDA 1OKDA 2KOKA 3KD0A 3H79A 2X64A 3CSIA 1V2AA 3HZ8A 2VCWA 4LL1B 1ML6A 1PN9A 1XBSA 4NPBA 2K9FA 1XVQA 3WGEA 3IRAA 2MMOA 2VCZA 3VWUA 1PL2A 1S3DA 5DCGA 3C1RA 1YY7A 1SKRB 4OD7A 1EP8A 3UEMA 2FA4A 5IMFA 4DSRA 4OCFA 3UJ1A 5DAKB 1THXA 1LU4A 6GSVA 4EDYA 2GZPA 5CAXA 1VRSD 2MMZA 2HFDA 4TKYA 3BD2A 1SK1A 2YV7A 3F6FA 2O89A 5CO3A 4I6XA 4ZB8A 4I2TA 5DBQA 4G0LA 1TK8B 1PGTA 1A2MA 2YNXA 1PX7A 3ZITA 3GYKA 1BX9A 2B3SA 4HS1A 3TKQA 1TI1A 2GGTA 2PERA 2B1LA 4G10A 5HFGA 2A4VA 5EPFA 1U88A 5ECIB 2HSMA 2PWJA 3W8JA 4DSSA 3OR5A 3KM6A 2AUVA 4G0KA 3RPPA 3QFAC 2JSYA 6GSUA 4GCIA 3UARA 11GSA 1GSFA 5A5KA 5F07A 3ZL5A 4IVFA 5DALA 5H5SA 5ID2A 4FIWA 3HYPA 4YH2A 1SD9A 3L4NA 2I81A 1XVWA 4HJ2A 2FY6A 1ILOA 3F4TA 4YQUA 3J7Yk 2RUEA 2HSNB 2VCVA 3F8UA 14GSA 3G9BA 4XTSA 3UIWA 1R26A 1Y25A 4POLA 2ZCTA 3D21A 3M9KA 2LNTA 4Q5FA 4OCEA 2P0GA 2L6DA 5D93A 4FYCA 4EO3A 2WS2A 4EUYA 5G2ZA 4MK3A 2LTKA 2E2GA 5B8AA 1WIKA 3F3RA 1YZXA 3ED3A 1Y6EA 3D4MA 2RLIA 4TR4A 2C3TA 1FO5A 2F8FA 2LEGA 5IMCA 2LS5A 4FYUA 2CVBA 1A24A 3FR6A 4WR5A 4OFNA 2JADA 3VI7A 5CYYA 1GULA 1ZOFA 4JBBA 4EF0A 1V57A 1SKWB 4MDCA 4CHSA 3E3EA 6GSXA 1MDKA 3FY7A 2H70A 1GUKA 1SK2A 1EOGA 2KUCA 1J9BA 4TR1A 5G31A 2EIOA 3DIEA 2FD3A 3CSJA 3WGDA 2YJ7A 4IQ1A 1FOVA 3O76A 5HR3A 1QMVA 4G9HA 4XIHA 5ECOB 1PKZA 5KN0A 1JZRA 3RAZA 2WRTA 3P8WA 2UZ8A 3ZIJA 3HJMA 1GSDA 2LRCA 1ERWA 1QGVA 3GL3A 3GN3A 1K3OA 2CX3A 2N5AA 4F0CA 3ZZXA 4MPFA 1ZL9A 2I4AA 3L9SA 4N10A 2VD0A 2VCXA 3KTLA 4DVCA 2H72A 2GQMA 2WCIA 3TKPA 2L6CA 2VD1A 4WR4A 2NDOA 3LWAA 1IYHA 4IW9A 5J3RA 2HE3A 5J41A 1Z6NA 2P5QA 4LA1A 4K7IA 1CQGA 4WKWA 3AY8A 3D22A 3APSA 1EWXA 1E2YA 1J08A 5IMZA 4KSOA 1KEBA 3TJKA 3QAWA 3ME8A 2O8VB 2YCDA 1FB6A 2DJ1A 5DQSA 4K7OA 2DJ3A 4ULXA 4RQRA 2LSTA 4H86A 1WOUA 5ELAA 1TOFA 3EVIA 5ECSA 2H1AA 5IMAA 4GSTA 2R2JA 3PINA 4NAXA 4IGJA 22GSA 2VM2A 4IELA 4XRAA 2CQ9A 4ZBBA 2J9HA 4ML1A 4NXIA 4X43A 3LEFA 5AIVA 5A4WA 3HHVA 4MJAA 4O5RA 2PPTA 4BVXB 3E0UA 3ZRDA 1Z6MA 3QDNA 1T8EB 2BTOT 4MCUA 4F82A 4LMWA 1TXXA 2R37A 4MJBA 1O85A 4MZBA 4MJEA 2VLTA 2MYGA 3A2WA 2HRFA 1VF2A 2CZ3A 3ZTLA 2RM5A 4OFTA 2VL3A 2DIYA 1SL1B 1G7EA 1XPVA 3UBLA 2M46A 2G2QA 4RI6A 1HNBA 2ES7A 3RHCA 1PRXA 1EOHA 1SK0A 1M2AA 1GUHA 3P90A 2LV3A 4TVEA 3TRQA 8GSSA 4IP1A 2V41A 3TJJA 2A2RA 2C3QA 2LUSA 2LQQA 1I9DA 2WFCA 3MNGA 2FWFA 2HZEB 2O7KA 1ERTA 2PU9C 2WULA 2X99A 3GRXA 3U5RE 1SL2B 2O87A 1ZZYA 5L71A 1GSYA 2QGVA 2B7JA 3F3QA 4DEJA 3GL5A 3L9UA 1U3IA 4ECIA 4CDOA 1OC3A 2H30A 4KDYA 4ZBAA 1B9XC 4J2FA 3G7YA 4HJMA 2E0QA 3DWVA 4J56E 3KCMA 1GTIA 5D9TA 3GV1A 1SJZA 2ON7A 2FWEA 3KXOA 3LQ7A 1R7HA 1TJDA 3TUEA 3CBUA 2VUPA 3LXZA 4BL7B 3R3EA 2YWNA 1ZYQB 1A0RP 13GSA 2OBIA 1Z7RA 4XS6A 1O8WA 1LBKA 3US3A 1EGRA 4K0NA 1A8LA 5LCZA 3HKRA 2RM6A 2R3XA 2YANA 3LYPA 1FVJA 2HSYA 4F9ZA 1TRWA 2YZHA 1TRVA 3HA9A 1XFLA 2IIYA 2JSZA 4X1UA 1ACVA 1GUMA 2RIIA 2OBKA 3VURA 3FKFA 1X0RA 3QAVA 2WZ9A 3ZVJA 1BG5A 4JU5A 4MLYA 3TOTA 4WF4A 3ERWA 4K7NA 3IPZA 3EE2A 3DRNA 3ZFLA 1M9BA 4FH8A 2R4VA 3IDVA 5JWOB 2GDRA 5IPHA 3FR3A 4KCEA 2OACA 3HDCA 4IS0A 3DD3A 4EE0A 2DJKA 2C0DA 4YQMA 1ZGNA 4KX4A 1JHBA 1C72A 2C4JA 3I69A 1JLWA 3GTUB 3GFKA 2H01A 5IMDA 3KGKA 5G1KA 2PN8A 2GSQA 3NIVA 2CAIA 4BWQA 4AF2A 3SBCA 3Q6OA 4L0WA 3D6IA 3GKXA 3V1WA 1A2LA 4I8BA 2YWIA 2LRNA 2DJ0A 3UMAA 1HNCA 1B48A 3TDGA 3CRUA 3LFLA 4Q5RA 4J57E 1GTBA 5HFKA 3TRXA 3IA1A 2FLSA 2YN1A 4K2DA 2IJYA 2GZZA 2AAWA 2OE1A 3JCML 2YOIA 2JZSA 5B8BA 2H73A 5IMVA 2L57A 4XHMA 3DEXA 2B1KA 1JLVA 2NBSA 2B5XA 1O81A 1GSSA 1B4QA 4MMMA 1A23A 2C0EA 4ECJA 3HY2A 3ZIVA 3VK9A 2DIZA 5COHA 2P5RA 1H75A 4MA9A 1F6MC 3MSZA 4N0ZA 4YQVA 3ME7A 3IV4A 4WF5A 4HQSA 4GWRA 1YEPA 4F2IA 1MDIA 1N8JA 3WT1A 2EIRA 1T4ZA 2KLXA 2H1BA 3QR6A 4BL7A 2TRXA 3BBYA 1UA5A 2PBJA 4V2NA 5GZZB 4NHZA 3HCZA 5GSSA 3DGQA 3FZ9A 4IN0A 5JCUA 2HNLA 1DSBA 4POMA 4XS1A 1PX6A 3VPTA 3NOFA 1GWCA 3L0HA 2L59A 4V1Ag 4AJ6A 3H4KA 3GURA 1SKSB 1PQNA 5AGYA 1XWBA 4ECCA 2VOCA 2EIQA 3QMXA 4PQ1A 2NPBA 4RQXA 3C71A 1NM3A 1W89A 2GT5A 1M2DA 4PXOA 2GSSA 5CRWA 2DJ2A 3CTFA 4ECBA 3S9FA 2JZRA 1K0CA 3ZMKA 1ZMAA 3APOA 2F9SA 4K6XA 1R5PA 4WEYA 3IR4A 1U87A 1A8YA 3EINA 3FYGA 4XS4B 3P7XA 4IJ3A 1HNAA 5HFIA 3ERFA 2OE0A 3KIJA 1XWAA 1PD21 4ID0A 4TOPA 4PUAA 1EZKA 1VGLA 3UOMA 1GP1A 1XOAA 3A2XA 4KSMA 2HRKB 1OVNA 4OFMA 3CTGA 1GL8A 1YKAA 1VF4A 2WB9A 3M9JA 2L5OA 1AUCA 3WGXA 2WGRA 5IQYA 4GQCA 4NV5A 1XWCA 3F0IA 3IBHA 4OO5A 2GVPA 3UVHA 2YJHA 3N9JA 1V40A 1R5AA 5DVBA 3TJGA 2OJLA 1H4OA 2I9HA 3R2QA 1MD4A 2IN3A 3IAM2 4MJCA 3F63A 1R4WA 2AJQB 5E4WA 2JU5A 5KN2A 5KEJA 2NTOA 3QD9A 3N5OA 3K8NA 5GAPD 5J9BA 2HRAA 3WYWA 2C80A 1PL1A 1XZOA 4ILFA 3E9JB 1ERVA 4KAEA 3W8SA 3M3MA 4N30A 4TXVA 4F0BA 3FEUA 3MDKA 2FHEA 2IMFA 4GTUA 4PQIA 2AB6A 1F3BA 4GXZA 2L4CA 1TU7A 5C00A 4EL1A 2LJAA 1W4VA 2B5YA 1RK4A 2K8SA 3P2AA 3O6TA 5D9WA 2IMKA 1G7OA 1WMJA 3IE3A 1ZYEA 5IOWA 2I3YA 5DAKA 3IC8A 4FQUA 10GSA 4KGIA 3DVWA 5FWGA 4HOJA 3KEBA 4FYBA 3GX0A 4ZBDA 4PX1A 1V98A 1K0MA 4HI7A 2IFQB 1AQXA 4MH3A 2CT6A 20GSA 4KA0A 5G5FA 1B4PA 5DDLA 1MEKA 2GTUA 5G1LA 5HR1A 1V58A 1JZOA 2YWMA 4MH2A 3PR8A 4KUNA 3QOUA 1HD2A 3DMLA 1GRXA 2HRNA 3EURA 1YF0A 1FB0A 3NZNA 4YAPA 4ML6A 4XS4A 4MZWA 5B7CA 3HJOA 3LORA 3M1GA 3FRCA 3F6DA 4OWYA 3L78A 4E8HA 4JZQA 1WJKA 4IP6A 2MMAA 3F4SA 2IMIA 2VCTA 4HUAA 1M0UA 5ECNB 2XHFA 2FGXA 2HRKA 1O7UA 5KN3A 3Q19A 2OA7A 2WDUA 2HYXA 4JR4A 1XW9A 4ZIJA 2HZFA 5ECMB 2AHEA 1M2BA 5EL8A 1U3AA 4WBJA 3C8EA 4EXJA 6GSYA 1TRUA 4TR0A 2VL2C 2VAFA 4O7HA 3LYKA 19GSA 5B6MA 3RHBA 3TKRA 3C73A 5G30A 2IL3A 4MPGA 4ZB9A 4GQFA 3CYNA 2H6YA 4JE1A 5HR0A 3FR9A 3TRPA 1K0DA 2VLVA 3MAKA 5ECQB 2H76A 5CRDA 4Q5QA 4KE3A 5CREA 2H0IA 1I5GA 5JCGA 2VL2A 3TJBA 2QKEA 1OC8A 4IKHA 3CSHA 2YZUA 3TCOA 1WP0A 3TJFA 3D4TA 2H1GA 2YP6A 3VWWA 2X8CA 1TU8A 7GSSA 4K9ZA 4XCSA 1WRYA 1XW6A 5FHIA 1Z7PA 1G6WA 2MZCA 2YWOA 4L5LA 3UL3A 5ECKB 2ZNMA 1TDIA 1RQMA 2L5LA 4LMVA 2AYTA 4RUVA 4WXTA 2XBIA 1YQ1A 2KP2A 3CMIA 6GSWA 2VLUA 4EDZA 1SJIA 3D0ZA 4PQHA 1HQOA 2ON5A 3J7Yb 3F9UA 3ERGA 2DMMA 4GRFA 2HXKA 4BWSA 3QPMA 5J9CA 1AQVA 3H1NA 1GH2A 5ECPB 1OKTA 2XPEA 6GSSA 3EYTA 4JR6A 4EVMA 4BVXA 3VWXA 2AV4A 3GKMA 2M72A 2DJJA 2I1UA 2K8VA 2FWHA 4KDXA 1SU9A 3ZREA 3A5WA 5IOXA 5DALB 5HQPA 1AQWA 5F06A 2CZ2A 1BJXA 1YEXA 1XW5A 1AIUA 4PUFC 2HI7A 2V6OA 3ZVJD 5INYA 2CAQA 2H8LA 1KBNA 4TW5A 3C7MA 4BPYA 4NMUA 4PTSA 1MTCA 5DJLA 2H66A 3QAGA 1EEJA 1XOBA 5A4VA 2REMA 2HZEA 1JZWA 1XIYA 4KNDA 5D73A 1PKWA 1DE1A 4GLTA 3HVSA 3DYRA 1X9WB 1T00A 3BCKA 3BCIA 3I9V2 1GSQA 2K6VA 3ZLPA 4RI7A 2OADA 4L5OA 2VO4A 2C0FA 1GTAA 4USSA 2H1DA 4KCAA 1ZCPA 4AGSA 4EKZA 4Z7XA 12GSA 2H6ZA 3MWHA 1YJ6A 1TKDB 3GSSA 1XWKA 3GNJA 2B7KA 3TB2A 3RBTA 2PVOC 2MBSA 4Q5NA 4OMVA 4PURA 2XPDA 2FNOA 2FUG2 2V6KA 2IPAA 4MABA 1GNWA 2HQTA 4JRRA 6GSTA 2BMXA 3EU3A 1AAZA 3HZ4A 1G0TA 5IM9A 3D5JA 1QUWA 3KMOA 2DSAA 5GAND 1FHEA 4MF6A 1IYIA 2PVQA 4FO5A 4BA7A 1EEMA 5D9VA 4ZB6A 4XRDA 1RW1A 4KF9A 3IHQA 5HR2A 1PA3A 2QC7A 1Z9HA 3U6VA 2F3MA 1F37A 1BQ7A 5FT3A 1NW2A 3IXRA 2R6KA 4DSQA 3EC3A 1GTUA 3G7JA 1PMTA 2A2SA 3IK7A 2C0GA 1WE0A 1WPIA 5BMUA 4K8MA 4NV2A 2K18A 2D2ZA 4I97A 4P3YB 2XC2A 1O6JA 2HSHA 3LSZA 3Q18A 3GH9A 2WJUA 1Z5YE 1GNEA 5B6NA 4BVYB 1DE2A 1BAYA 4V2LA 2PGTA 1NSWA 2LNSA 3M0FA 2C3NA 2JL4A 4GSSA 2H0HA 1UC7A 2LKUA 1WWJA 3A2VA 1GLPA 2VIMA 2YPMA 3GTUA 3O3TA 4PNGA 4HEA2 2N5FA 1TRSA 3FK8A 2VL9A 1NHYA 2OE3A 3FHKA 5ECHB 4TR3A 1CQHA 4K1FA 4KH7A 1B8XA 1FW1A 5H5QA 2X8GA 2LJRA 1KTEA 4NWYA 2JACA 2H75A 2VM1A 1T1VA 3PPUA 5D96A 3RPNA 1X9SB 4MF5A 1XCCA 2DBCA 3GHAA 3EMPA 1BYEA 1TP9A 4ZL9A 3IOSA 5EY6A 2H71A 4ISDA 3VI5A 4MP4A 5AIXA 3FW2A 1SYXA 2EC4A 1UN2A 4G0IA 2C8UA 3DXBA 4F03A 4LLRA 5D9XA 5DQYA 4HZ2A 5ECRB 1OE8A 4QQ7A 2B5EA 4IJIA 2DLXA 2MBTA 3KZQA 4HQZA 1EV4A 1QQ2A 5G5EA 2P31A 3LG6A 1PSQA 5ENUA 1SL0B 3QCPA 2PUKC 2IWTA 2CA8A 3TKSE 3CXGA 4QL7A 1ST9A 4AJ7A 2GZYA 5CRGA 1VF1A 4G19A 4L0UA 3G7IA 3TKSC 16GSA 1T7PB 4GSNA 3KH7A 3EMXA 3VFIA 4TN8A 1A0FA 1A2JA 1GSEA 3I43A 2GT6A 1K0NA 1TK5B 3GKKA 3GKNA 1X9MB 1X5CA 5LNKe 1MD3A 1GSUA 3C1SA 1TW9A 5IO0A 1FAAA 4IQAA 5ECLB 1FVKA 1OC9B 1AC1A 4HU9A 3TKSA 3ISOA 2F8AA 1Z3EA 2IMDA 2IMEA 3TGZA 2O85A 5D8IA 2G0FA 1K0OA 4IBPA 4N0VA 4I5QA 4ZL8A 2J23A 4POBA 1SJ6A 1JFUA 4KB3A 2RUFA 5JCWA 3UBKA 5LD0A 4TRXA 1DBYA 3GMFA 4NHWA 3GA4A 3UVTA 2LRTA 1BEDA 4BVYA 1N2AA 5DJMA 1URMA 2GS3A 5AISA 1TI3A 17GSA 1J0FA 2OKAA 2KP1A 2E7PA 3LXTA 4CW9A 1TK0B 1F2EA 1K3LA 4MF7A 2X8HA 4EC0A 3UAPA 1AW9A 1O8XA 1K3YA 2CVDA 3FZ5A 1ABAA 1FG4A 2FA8A 3HVVA 2R5GA 5E59A 2TIRA 3EU4A 4L8EA 3DKSA 2CV4A 4IHUA 3GX8A 1F3AA
chains in the Genus database with same CATH superfamily
3VPQA 5ABRA 2H0GA 3QFBC 4D73B 5J4UA 2V32A 5IPGA 1O73A 3KP9A 4V2MA 5F8BA 3EWLA 4OO4A 3TOUA 1V9WA 3HJPA 1YKCA 1XXUA 4TXOB 2E2MA 4LL4B 4WETA 2XBQA 3BOAA 1K0BA 4O32A 5DCHA 5F0GA 2H6XA 1EP7A 3VLNA 3RDWA 1DUGA 3I6AA 3SWLA 2R0CA 3LJRA 1T4YA 3FZ4A 1M99A 1NHOA 4N11A 5KN1A 3H93A 3M8NA 1SYRA 3KMNA 1QK8A 2KHPA 4PNFA 3L9VA 1ERUA 4X4JA 4E8EA 5JWRB 1VF3A 1M9AA 3DVXA 1U6TA 1SENA 1X5DA 3IC4A 4KDUA 3BJ5A 1THOA 3APQA 5AN1A 2IFQA 4MZCA 2GQKA 3VWVA 2HT9A 3HD5A 4ZILA 2DC5A 4N3ZA 2QSIA 2TRCP 1OC9A 2DMLA 1OE7A 4ZL7A 2V1MA 2BJXA 1HYUA 2LJKA 1Q98A 5CNWA 4GF0A 2HSMB 4AI6A 1EGOA 2GQLA 3W6GA 4DSSB 2F51A 1OAZA 1QFNA 1TTZA 2GLRA 1F9MA 2JZTA 3FZAA 4HU7A 1ON4A 2CVKA 1MDJA 1G6YA 1M7TA 4ZXGA 2LQOA 18GSA 5CP1A 1UVZA 1KNGA 2NVLA 4KW6A 5ELGA 5ID2B 1X5EA 2B6MA 5H5RA 4AJ8A 1B9YC 3GSTA 4HZ4A 3GH6A 1SD8A 2YV9A 3KH9A 1QXHA 2WVYA 5A4UA 2H74A 4JEDA 1LJRA 4ACSA 2CX4A 2M80A 2FCHA 1OYJA 5F05A 4YAVA 4AKGA 1T3BA 9GSSA 3KP8A 5CRHA 3Q74A 3A3TA 1GLQA 4PI2C 5EVOA 3HVNA 4G2EA 1USBA 5J5NA 5IO2A 2HLSA 3LGCA 4X0XA 4WBRD 3ZFBA 5KOXA 2V2GA 4K0GA 1XWGA 1SVOA 3ZYWA 4HDEA 2ZUPA 5JWQB 2VCQA 3KTBA 3HXSA 1S3CA 2Z9SA 4POKA 5IIZA 3PGTA 3KJYA 3CRTA 3GUSA 1K0AA 2MMNA 2C1YA 4V1Ap 2L4QA 3WT2A 4QL9A 5C04A 5GSTA 1E6BA 1YDKA 2O3EA 2FWGA 1YF1A 3F4RA 3IK9A 4O92A 3GIXA 4AKXB 1AXDA 2PMTA 2N5BA 1EV9A 1S3AA 4TR1B 2GSRA 1Q4JA 4D73A 4PGTA 4I2UA 3ZMLA 3IAS2 2GSTA 2H19A 3WD6A 3H8QA 2ALBA 3HVXA 3PH9A 4TXOA 1JZDA 1OKDA 2KOKA 3KD0A 3H79A 2X64A 3CSIA 1V2AA 3HZ8A 2VCWA 4LL1B 5J4VA 1ML6A 1PN9A 1XBSA 4NPBA 2K9FA 1XVQA 3WGEA 3IRAA 2MMOA 2VCZA 3VWUA 1PL2A 1S3DA 5DCGA 3C1RA 1YY7A 1SKRB 4OD7A 1EP8A 3UEMA 2FA4A 4PI0C 5IMFA 4DSRA 4OCFA 3UJ1A 5DAKB 1THXA 1M3IA 1LU4A 6GSVA 4EDYA 2GZPA 5CAXA 1VRSD 2MMZA 2HFDA 4TKYA 3BD2A 1SK1A 2YV7A 3F6FA 2O89A 5CO3A 4I6XA 4ZB8A 4I2TA 5DBQA 4G0LA 1TK8B 1PGTA 1A2MA 2YNXA 1PX7A 3ZITA 3GYKA 1BX9A 2B3SA 4HS1A 3TKQA 1TI1A 2GGTA 2PERA 2B1LA 4G10A 5HFGA 2A4VA 5EPFA 1U88A 5ECIB 2HSMA 2DKIA 2PWJA 3W8JA 4DSSA 3OR5A 3KM6A 4Z2RA 2AUVA 4G0KA 3RPPA 3QFAC 2JSYA 4YKFA 6GSUA 4GCIA 3UARA 11GSA 1GSFA 4GDFA 5A5KA 5F07A 3ZL5A 4IVFA 5DALA 5H5SA 5ID2A 4FIWA 3HYPA 4YH2A 1SD9A 3L4NA 2I81A 1XVWA 4HJ2A 2FY6A 1ILOA 1Y1UA 3F4TA 4YQUA 3J7Yk 2RUEA 2HSNB 2VCVA 3F8UA 4QMKA 14GSA 3G9BA 4XTSA 3UIWA 1R26A 1Y25A 4POLA 2ZCTA 3D21A 3M9KA 2LNTA 4Q5FA 4OCEA 2P0GA 2L6DA 5D93A 4FYCA 4EO3A 2WS2A 4EUYA 2OT3A 5G2ZA 4MK3A 2LTKA 2E2GA 5B8AA 1WIKA 2DKHA 3F3RA 1YZXA 3ED3A 1Y6EA 3D4MA 2RLIA 4TR4A 2C3TA 1FO5A 2F8FA 2LEGA 5IMCA 2LS5A 4FYUA 2CVBA 1A24A 3FR6A 4WR5A 4OFNA 2JADA 3VI7A 5CYYA 1GULA 1ZOFA 4JBBA 4EF0A 1V57A 1SKWB 4MDCA 4CHSA 3E3EA 6GSXA 1MDKA 3FY7A 2H70A 1GUKA 1SK2A 1EOGA 2KUCA 1J9BA 4TR1A 5G31A 2EIOA 3DIEA 2FD3A 3CSJA 3WGDA 2YJ7A 4IQ1A 1FOVA 3O76A 5HR3A 1QMVA 4FXYP 4G9HA 4XIHA 5ECOB 1PKZA 5KN0A 1JZRA 3RAZA 2WRTA 3P8WA 2UZ8A 3ZIJA 3HJMA 1GSDA 2LRCA 1ERWA 1QGVA 3GL3A 3GN3A 1K3OA 2CX3A 4Z2TA 2N5AA 4F0CA 3ZZXA 4MPFA 1ZL9A 2I4AA 3L9SA 4N10A 2VD0A 2VCXA 3KTLA 4CY6A 4DVCA 2H72A 2GQMA 2WCIA 3TKPA 2L6CA 2VD1A 4WR4A 2NDOA 3LWAA 1IYHA 4IW9A 5J3RA 2HE3A 5J41A 1Z6NA 2P5QA 4LA1A 4K7IA 1CQGA 4WKWA 3AY8A 3MYDA 3D22A 3APSA 1EWXA 1E2YA 1J08A 5IMZA 4KSOA 1KEBA 3TJKA 3QAWA 3ME8A 2O8VB 2YCDA 1FB6A 2DJ1A 5DQSA 4K7OA 2DJ3A 4ULXA 4RQRA 2LSTA 4H86A 1WOUA 5ELAA 1TOFA 3EVIA 5ECSA 2H1AA 5IMAA 4GSTA 4AKHA 2R2JA 3PINA 4NAXA 4IGJA 22GSA 2VM2A 1M3JA 4IELA 4XRAA 2CQ9A 4ZBBA 2J9HA 4ML1A 4NXIA 4X43A 3LEFA 5AIVA 5A4WA 3HHVA 4MJAA 4O5RA 2PPTA 4BVXB 5J40A 3E0UA 3ZRDA 1Z6MA 1ZYPA 3QDNA 1T8EB 2BTOT 4MCUA 4MNNA 4LMWA 1TXXA 4F82A 2R37A 4MJBA 1O85A 4MZBA 4MJEA 2VLTA 2MYGA 3A2WA 2HRFA 1VF2A 2CZ3A 3ZTLA 2RM5A 4OFTA 2VL3A 2DIYA 1SL1B 1G7EA 1XPVA 3UBLA 2M46A 2G2QA 4RI6A 1HNBA 2ES7A 3RHCA 1PRXA 1EOHA 1SK0A 1M2AA 1GUHA 3P90A 2LV3A 4TVEA 3TRQA 8GSSA 4IP1A 2V41A 3TJJA 2A2RA 2C3QA 2LUSA 2LQQA 1I9DA 2WFCA 3MNGA 2FWFA 2HZEB 2O7KA 1ERTA 2PU9C 2WULA 2X99A 3GRXA 3U5RE 1SL2B 2O87A 2EFEA 1ZZYA 5L71A 1ZYNA 1GSYA 2QGVA 2B7JA 3F3QA 4DEJA 4EIQA 3GL5A 3L9UA 1U3IA 1N25A 4ECIA 2EFHA 4CDOA 1OC3A 2H30A 4KDYA 4ZBAA 1B9XC 4J2FA 2QA2A 3G7YA 4HJMA 2E0QA 3DWVA 4J56E 3KCMA 1GTIA 3MIXA 5D9TA 3GV1A 1SJZA 2ON7A 2FWEA 3KXOA 3LQ7A 1R7HA 1TJDA 3TUEA 4Z2UA 3CBUA 1PFOA 2VUPA 3LXZA 4BL7B 2WW3A 3R3EA 2YWNA 1ZYQB 1A0RP 13GSA 2OBIA 1Z7RA 4XS6A 1O8WA 1LBKA 3US3A 1EGRA 4K0NA 1A8LA 5LCZA 4K5SA 3HKRA 2RM6A 2R3XA 2YANA 3LYPA 4W66A 1FVJA 2HSYA 4F9ZA 1TRWA 2YZHA 1TRVA 2UV8G 3HA9A 1XFLA 2IIYA 2JSZA 4X1UA 1ACVA 1GUMA 1TXUA 2OBKA 2RIIA 3VURA 4YKGA 3FKFA 1X0RA 4O5UA 3QAVA 2WZ9A 3ZVJA 1BG5A 4JU5A 4MLYA 3TOTA 4WF4A 3ERWA 4K7NA 3IPZA 3EE2A 3DRNA 3ZFLA 1M9BA 4FH8A 2R4VA 3IDVA 5JWOB 2GDRA 5IPHA 3FR3A 4KCEA 2OACA 3HDCA 4IS0A 3DD3A 4EE0A 2DJKA 2C0DA 4YQMA 1ZGNA 4KX4A 1JHBA 1C72A 2C4JA 3I69A 1JLWA 4PHZC 2WW2A 3GTUB 3GFKA 2H01A 5IMDA 3KGKA 5G1KA 2PN8A 2GSQA 3NIVA 2CAIA 4BWQA 4AF2A 3SBCA 3Q6OA 4L0WA 3D6IA 3GKXA 3V1WA 1A2LA 4I8BA 1BF5A 2YWIA 2LRNA 2DJ0A 3UMAA 1HNCA 1B48A 3TDGA 3CRUA 3LFLA 4Q5RA 4J57E 1GTBA 5HFKA 4EIPA 3TRXA 3IA1A 2FLSA 2YN1A 4K2DA 2IJYA 2GZZA 2AAWA 2OE1A 3JCML 2YOIA 2X4AA 2JZSA 5B8BA 2H73A 5IMVA 2L57A 4XHMA 3DEXA 5KOWA 2B1KA 1JLVA 2NBSA 2B5XA 1O81A 1GSSA 4K5RA 1B4QA 4MMMA 1A23A 2C0EA 4ECJA 3HY2A 3ZIVA 3VK9A 2DIZA 5COHA 2P5RA 1H75A 4MA9A 1F6MC 3MSZA 4N0ZA 4YQVA 3ME7A 3IV4A 4WF5A 4E68A 4HQSA 4GWRA 1YEPA 4F2IA 1MDIA 1N8JA 3WT1A 2EIRA 1T4ZA 2KLXA 2H1BA 3QR6A 4BL7A 2TRXA 3BBYA 1UA5A 2PBJA 4V2NA 5GZZB 4NHZA 3HCZA 5GSSA 3DGQA 3FZ9A 4IN0A 5JCUA 2HNLA 1DSBA 4POMA 4XS1A 1PX6A 3VPTA 3NOFA 1GWCA 3L0HA 2L59A 4V1Ag 4AJ6A 3H4KA 3GURA 1SKSB 1PQNA 5AGYA 1XWBA 4ECCA 2VOCA 2EIQA 3QMXA 4PQ1A 1YVLA 2NPBA 3HMJG 4RQXA 3C71A 1NM3A 1W89A 2GT5A 1M2DA 4PXOA 2GSSA 5CRWA 2R0GA 2DJ2A 3CTFA 5A5HB 4ECBA 3S9FA 2JZRA 1K0CA 3ZMKA 1ZMAA 3APOA 2F9SA 4K6XA 5BRTA 1R5PA 3EPTA 4WEYA 3IR4A 1U87A 1A8YA 3EINA 3FYGA 1PN0A 4XS4B 3P7XA 4IJ3A 1HNAA 5HFIA 3ERFA 2OE0A 1SVLA 3KIJA 1XWAA 1PD21 4ID0A 4TOPA 4PUAA 4ZB7A 1EZKA 1VGLA 3UOMA 1GP1A 1XOAA 3A2XA 4KSMA 2HRKB 1OVNA 4OFMA 3CTGA 1GL8A 1YKAA 1VF4A 2WB9A 3M9JA 2L5OA 1AUCA 3WGXA 2WGRA 5IQYA 4GQCA 4CY8A 4NV5A 1XWCA 3F0IA 3IBHA 4OO5A 2GVPA 3UVHA 2YJHA 3N9JA 5A34B 1V40A 1R5AA 5DVBA 3TJGA 2OJLA 1H4OA 2I9HA 3R2QA 1MD4A 2IN3A 3IAM2 4MJCA 2A2PA 3F63A 1R4WA 2AJQB 5E4WA 2JU5A 5KN2A 5KEJA 2NTOA 3QD9A 3N5OA 3K8NA 5GAPD 3CHXC 5J9BA 2HRAA 3WYWA 2C80A 1PL1A 1XZOA 4ILFA 3E9JB 1ERVA 4KAEA 3W8SA 1FOHA 3M3MA 4N30A 4TXVA 4F0BA 3FEUA 3MDKA 2FHEA 2IMFA 4GTUA 4PQIA 2AB6A 1F3BA 4GXZA 2L4CA 1TU7A 5C00A 4EL1A 2LJAA 1W4VA 2B5YA 1RK4A 2K8SA 3P2AA 3O6TA 5D9WA 2IMKA 1G7OA 1WMJA 3IE3A 1ZYEA 5IOWA 2I3YA 4K2XA 5DAKA 3IC8A 4FQUA 10GSA 4KGIA 3DVWA 5FWGA 4HOJA 3KEBA 4FYBA 3GX0A 4ZBDA 4PX1A 1V98A 1BG1A 1XG8A 1K0MA 4HI7A 2IFQB 2WW0A 1AQXA 4MH3A 2CT6A 20GSA 4KA0A 5G5FA 1B4PA 5DDLA 1MEKA 2GTUA 5G1LA 5HR1A 1V58A 1S4BP 1JZOA 2YWMA 4MH2A 3PR8A 4KUNA 3QOUA 1HD2A 3DMLA 1GRXA 2HRNA 3EURA 1YF0A 1FB0A 3NZNA 4YAPA 4ML6A 4XS4A 4MZWA 5B7CA 3HJOA 3LORA 3M1GA 4HSCX 3FRCA 3F6DA 4OWYA 3L78A 4E8HA 4JZQA 2WZSA 1WJKA 4IP6A 2MMAA 3F4SA 2IMIA 2VCTA 4HUAA 1M0UA 2HSNA 5ECNB 2XHFA 2FGXA 2HRKA 1O7UA 5KN3A 3Q19A 2OA7A 2WDUA 2HYXA 4JR4A 1XW9A 4ZIJA 2HZFA 5ECMB 2AHEA 1M2BA 5EL8A 1U3AA 4WBJA 3C8EA 4EXJA 6GSYA 1TRUA 4TR0A 2VL2C 2VAFA 4O7HA 5A34A 3LYKA 19GSA 5B6MA 3RHBA 4BIKA 3TKRA 3C73A 5G30A 2IL3A 4MPGA 4ZB9A 4GQFA 3CYNA 2H6YA 4JE1A 5HR0A 3FR9A 3TRPA 1K0DA 2VLVA 3MAKA 5ECQB 2H76A 5CRDA 4Q5QA 4KE3A 5CREA 2H0IA 1I5GA 5JCGA 2VL2A 3TJBA 2QKEA 1OC8A 4IKHA 3CSHA 2YZUA 3TCOA 1WP0A 3TJFA 1YEWC 3D4TA 2H1GA 2YP6A 3VWWA 3RFRC 2X8CA 3IHGA 1TU8A 7GSSA 4K9ZA 4XCSA 1WRYA 1XW6A 5FHIA 1Z7PA 1G6WA 2MZCA 2YWOA 4L5LA 3UL3A 5ECKB 2ZNMA 1TDIA 1RQMA 2L5LA 4LMVA 2AYTA 4O5QA 4RUVA 4WXTA 2XBIA 1YQ1A 2KP2A 3CMIA 1SVMA 6GSWA 2VLUA 4EDZA 1SJIA 3D0ZA 4PQHA 1HQOA 2ON5A 3J7Yb 3F9UA 3ERGA 2DMMA 4GRFA 2HXKA 4BWSA 3QPMA 5J9CA 1AQVA 3H1NA 1GH2A 5ECPB 1OKTA 5A1NB 2XPEA 6GSSA 3EYTA 5BMUB 4JR6A 4EVMA 4BVXA 3VWXA 2AV4A 3GKMA 2M72A 2DJJA 2I1UA 2K8VA 5J47A 2FWHA 4KDXA 1SU9A 3ZREA 3A5WA 5IOXA 5DALB 4ICYA 5HQPA 2VKZG 1AQWA 5F06A 2CZ2A 1BJXA 1YEXA 1XW5A 1AIUA 4PUFC 2HI7A 2V6OA 3ZVJD 5INYA 1S3RA 2CAQA 2H8LA 1KBNA 4TW5A 3C7MA 4BPYA 2A4HA 4NMUA 4PTSA 1MTCA 5DJLA 2EFDA 2H66A 3QAGA 1EEJA 1XOBA 5A4VA 2REMA 2HZEA 1JZWA 1XIYA 4KNDA 5D73A 1PKWA 5J4YA 4GLTA 1DE1A 3HVSA 3DYRA 1X9WB 1T00A 3BCKA 3BCIA 3I9V2 1GSQA 2K6VA 3ZLPA 4RI7A 2OADA 4L5OA 2VO4A 2C0FA 1GTAA 4USSA 2H1DA 4KCAA 1ZCPA 4AGSA 4EKZA 4Z7XA 12GSA 2H6ZA 3MWHA 1YJ6A 1TKDB 4AKIA 3GSSA 1XWKA 3GNJA 2B7KA 3TB2A 3RBTA 2PVOC 2MBSA 4Q5NA 4OMVA 4PURA 2XPDA 2FNOA 2FUG2 2V6KA 2IPAA 4MABA 1GNWA 2HQTA 4JRRA 6GSTA 2BMXA 3EU3A 1AAZA 3HZ4A 1G0TA 5IM9A 3D5JA 2O5VA 1QUWA 3KMOA 2DSAA 5GAND 1FHEA 4MF6A 1IYIA 4G01A 2PVQA 4FO5A 4BA7A 1EEMA 5D9VA 4ZB6A 4XRDA 1RW1A 4A5PA 4KF9A 3IHQA 5HR2A 1PA3A 2QC7A 1Z9HA 3U6VA 2F3MA 1F37A 1BQ7A 5FT3A 1NW2A 3IXRA 2R6KA 4DSQA 3EC3A 1GTUA 3G7JA 2WVXB 5A1NA 1PMTA 2A2SA 3IK7A 2C0GA 1WE0A 1WPIA 5BMUA 4K8MA 4NV2A 2K18A 2D2ZA 4I97A 4P3YB 2XC2A 1O6JA 2HSHA 3LSZA 2R0PA 3Q18A 3GH9A 2WJUA 1Z5YE 3A5IA 1GNEA 5B6NA 4BVYB 1DE2A 1BAYA 4V2LA 2PGTA 1NSWA 2LNSA 3M0FA 2C3NA 2JL4A 4GSSA 2H0HA 3FMWA 1UC7A 2WVZA 2LKUA 1WWJA 3A2VA 1GLPA 2WW1A 2VIMA 2YPMA 3GTUA 3O3TA 4PNGA 4HEA2 2N5FA 1TRSA 3FK8A 2VL9A 1NHYA 2OE3A 3FHKA 5ECHB 4TR3A 1CQHA 4K1FA 4KH7A 1B8XA 1FW1A 5H5QA 2X8GA 2LJRA 1KTEA 4NWYA 2JACA 2H75A 2VM1A 1T1VA 3PPUA 5D96A 3RPNA 3RGBC 1X9SB 4MF5A 1XCCA 2DBCA 2O36A 3LW9A 3GHAA 3EMPA 1BYEA 1TP9A 4ZL9A 3IOSA 5EY6A 2H71A 4ISDA 3VI5A 4MP4A 5AIXA 3FW2A 1SYXA 2EC4A 1UN2A 4G0IA 2C8UA 3DXBA 4F03A 4LLRA 5D9XA 2QA1A 5DQYA 4HZ2A 5ECRB 1OE8A 4QQ7A 2B5EA 4IJIA 2DLXA 2MBTA 3KZQA 4HQZA 1EV4A 1QQ2A 5G5EA 2P31A 3LG6A 1PSQA 5ENUA 1SL0B 3QCPA 2PUKC 2IWTA 2CA8A 3TKSE 3CXGA 4QL7A 1ST9A 4AJ7A 2GZYA 5CRGA 1VF1A 4G19A 4L0UA 3G7IA 3TKSC 16GSA 1T7PB 4GSNA 3KH7A 3CWGA 3EMXA 3VFIA 4TN8A 1A0FA 1A2JA 1GSEA 2H1LA 3I43A 1I1IP 2GT6A 1K0NA 1TK5B 3GKKA 3GKNA 1X9MB 1X5CA 5LNKe 1MD3A 1GSUA 3C1SA 1TW9A 2X49A 5IO0A 1FAAA 3CQFA 4IQAA 5A5HA 5ECLB 1FVKA 1OC9B 1AC1A 4HU9A 3TKSA 3ISOA 2F8AA 1Z3EA 2IMDA 2IMEA 3TGZA 2O85A 5D8IA 2G0FA 1K0OA 4IBPA 4N0VA 4I5QA 4ZL8A 2J23A 4POBA 2WVXA 1SJ6A 1JFUA 4KB3A 2RUFA 5JCWA 3UBKA 5LD0A 4TRXA 1DBYA 3GMFA 4NHWA 3GA4A 3UVTA 2LRTA 1BEDA 4BVYA 1N2AA 5DJMA 1URMA 2GS3A 3TU3B 5AISA 1TI3A 17GSA 1J0FA 2OKAA 2EFCA 2KP1A 2E7PA 3LXTA 4CW9A 1TK0B 1F2EA 1K3LA 4MF7A 2X8HA 4EC0A 3UAPA 1AW9A 1O8XA 1K3YA 2CVDA 3FZ5A 1ABAA 1FG4A 2FA8A 3HVVA 2R5GA 5E59A 2TIRA 3EU4A 4L8EA 3DKSA 2CV4A 4IHUA 3GX8A 1F3AA
chains in the Genus database with same CATH topology
3VPQA 5ABRA 2H0GA 3QFBC 4D73B 5J4UA 2V32A 5IPGA 1O73A 3KP9A 4V2MA 5F8BA 3EWLA 4OO4A 3TOUA 1V9WA 3HJPA 1YKCA 1XXUA 4TXOB 2E2MA 4LL4B 4WETA 2XBQA 3BOAA 1K0BA 4O32A 5DCHA 5F0GA 2H6XA 1EP7A 3VLNA 3RDWA 1DUGA 3I6AA 3SWLA 2R0CA 3LJRA 1T4YA 3FZ4A 1M99A 1NHOA 4N11A 5KN1A 3H93A 3M8NA 1SYRA 3KMNA 1QK8A 2KHPA 4PNFA 3L9VA 1ERUA 4X4JA 4E8EA 5JWRB 1VF3A 1M9AA 3DVXA 1U6TA 1SENA 1X5DA 3IC4A 4KDUA 3BJ5A 1THOA 3APQA 5AN1A 2IFQA 4MZCA 2GQKA 3VWVA 2HT9A 3HD5A 4ZILA 2DC5A 4N3ZA 2QSIA 2TRCP 1OC9A 2DMLA 1OE7A 4ZL7A 2V1MA 2BJXA 1HYUA 2LJKA 1Q98A 5CNWA 4GF0A 2HSMB 4AI6A 1EGOA 2GQLA 3W6GA 4DSSB 2F51A 1OAZA 1QFNA 1TTZA 2GLRA 1F9MA 2JZTA 3FZAA 4HU7A 1ON4A 2CVKA 1MDJA 1G6YA 1M7TA 4ZXGA 2LQOA 18GSA 5CP1A 1UVZA 1KNGA 2NVLA 4KW6A 5ELGA 5ID2B 1X5EA 2B6MA 5H5RA 4AJ8A 1B9YC 3GSTA 4HZ4A 3GH6A 1SD8A 2YV9A 3KH9A 1QXHA 5A4UA 2H74A 4JEDA 1LJRA 4ACSA 2CX4A 2M80A 2FCHA 1OYJA 5F05A 4YAVA 4AKGA 1T3BA 9GSSA 3KP8A 5CRHA 3Q74A 3A3TA 1GLQA 5EVOA 4G2EA 1USBA 5J5NA 5IO2A 2HLSA 3LGCA 4X0XA 4WBRD 3ZFBA 5KOXA 2V2GA 4K0GA 1XWGA 1SVOA 3ZYWA 4HDEA 2ZUPA 5JWQB 2VCQA 3KTBA 3HXSA 1S3CA 2Z9SA 4POKA 5IIZA 3PGTA 3KJYA 3CRTA 3GUSA 1K0AA 2MMNA 2C1YA 4V1Ap 2L4QA 3WT2A 4QL9A 5C04A 5GSTA 1E6BA 1YDKA 2FWGA 1YF1A 3F4RA 3IK9A 4O92A 3GIXA 4AKXB 1AXDA 2PMTA 2N5BA 1EV9A 1S3AA 4TR1B 2GSRA 1Q4JA 4D73A 4PGTA 4I2UA 3ZMLA 3IAS2 2GSTA 2H19A 3WD6A 3H8QA 2ALBA 3HVXA 3PH9A 4TXOA 1JZDA 1OKDA 2KOKA 3KD0A 3H79A 2X64A 3CSIA 1V2AA 3HZ8A 2VCWA 4LL1B 5J4VA 1ML6A 1PN9A 1XBSA 4NPBA 2K9FA 1XVQA 3WGEA 3IRAA 2MMOA 2VCZA 3VWUA 1PL2A 1S3DA 5DCGA 3C1RA 1YY7A 1SKRB 4OD7A 1EP8A 3UEMA 2FA4A 5IMFA 4DSRA 4OCFA 3UJ1A 5DAKB 1THXA 1LU4A 6GSVA 4EDYA 2GZPA 5CAXA 1VRSD 2MMZA 2HFDA 4TKYA 3BD2A 1SK1A 2YV7A 3F6FA 2O89A 5CO3A 4I6XA 4ZB8A 4I2TA 5DBQA 4G0LA 1TK8B 1PGTA 1A2MA 2YNXA 1PX7A 3ZITA 3GYKA 1BX9A 2B3SA 4HS1A 3TKQA 1TI1A 2GGTA 2PERA 2B1LA 4G10A 5HFGA 2A4VA 5EPFA 1U88A 5ECIB 2HSMA 2DKIA 2PWJA 3W8JA 4DSSA 3OR5A 3KM6A 4Z2RA 2AUVA 4G0KA 3RPPA 3QFAC 2JSYA 4YKFA 6GSUA 4GCIA 3UARA 11GSA 1GSFA 4GDFA 5A5KA 5F07A 3ZL5A 4IVFA 5DALA 5H5SA 5ID2A 4FIWA 3HYPA 4YH2A 1SD9A 3L4NA 2I81A 1XVWA 4HJ2A 2FY6A 1ILOA 1Y1UA 3F4TA 4YQUA 3J7Yk 2RUEA 2HSNB 2VCVA 3F8UA 4QMKA 14GSA 3G9BA 4XTSA 3UIWA 1R26A 1Y25A 4POLA 2ZCTA 3D21A 3M9KA 2LNTA 4Q5FA 4OCEA 2P0GA 2L6DA 5D93A 4FYCA 4EO3A 2WS2A 4EUYA 2OT3A 5G2ZA 4MK3A 2LTKA 2E2GA 5B8AA 1WIKA 2DKHA 3F3RA 1YZXA 3ED3A 1Y6EA 3D4MA 2RLIA 4TR4A 2C3TA 1FO5A 2F8FA 2LEGA 5IMCA 2LS5A 4FYUA 2CVBA 1A24A 3FR6A 4WR5A 4OFNA 2JADA 3VI7A 5CYYA 1GULA 1ZOFA 4JBBA 4EF0A 1V57A 1SKWB 4MDCA 4CHSA 3E3EA 6GSXA 1MDKA 3FY7A 2H70A 1GUKA 1SK2A 1EOGA 2KUCA 1J9BA 4TR1A 5G31A 2EIOA 3DIEA 2FD3A 3CSJA 3WGDA 2YJ7A 4IQ1A 1FOVA 3O76A 5HR3A 1QMVA 4G9HA 4XIHA 5ECOB 1PKZA 5KN0A 1JZRA 3RAZA 2WRTA 3P8WA 2UZ8A 3ZIJA 3HJMA 1GSDA 2LRCA 1ERWA 1QGVA 3GL3A 3GN3A 1K3OA 2CX3A 4Z2TA 2N5AA 4F0CA 3ZZXA 4MPFA 1ZL9A 2I4AA 3L9SA 4N10A 2VD0A 2VCXA 3KTLA 4CY6A 4DVCA 2H72A 2GQMA 2WCIA 3TKPA 2L6CA 2VD1A 4WR4A 2NDOA 3LWAA 1IYHA 4IW9A 5J3RA 2HE3A 5J41A 1Z6NA 2P5QA 4LA1A 4K7IA 1CQGA 4WKWA 3AY8A 3MYDA 3D22A 3APSA 1EWXA 1E2YA 1J08A 5IMZA 4KSOA 1KEBA 3TJKA 3QAWA 3ME8A 2O8VB 2YCDA 1FB6A 2DJ1A 5DQSA 4K7OA 2DJ3A 4ULXA 4RQRA 2LSTA 4H86A 1WOUA 5ELAA 1TOFA 3EVIA 5ECSA 2H1AA 5IMAA 4GSTA 4AKHA 2R2JA 3PINA 4NAXA 4IGJA 22GSA 2VM2A 4IELA 4XRAA 2CQ9A 4ZBBA 2J9HA 4ML1A 4NXIA 4X43A 3LEFA 5AIVA 5A4WA 3HHVA 4MJAA 4O5RA 2PPTA 4BVXB 5J40A 3E0UA 3ZRDA 1Z6MA 1ZYPA 3QDNA 1T8EB 2BTOT 4MCUA 4MNNA 4LMWA 1TXXA 4F82A 2R37A 4MJBA 1O85A 4MZBA 4MJEA 2VLTA 2MYGA 3A2WA 2HRFA 1VF2A 2CZ3A 3ZTLA 2RM5A 4OFTA 2VL3A 2DIYA 1SL1B 1G7EA 1XPVA 3UBLA 2M46A 2G2QA 4RI6A 1HNBA 2ES7A 3RHCA 1PRXA 1EOHA 1SK0A 1M2AA 1GUHA 3P90A 2LV3A 4TVEA 3TRQA 8GSSA 4IP1A 2V41A 3TJJA 2A2RA 2C3QA 2LUSA 2LQQA 1I9DA 2WFCA 3MNGA 2FWFA 2HZEB 2O7KA 1ERTA 2PU9C 2WULA 2X99A 3GRXA 3U5RE 1SL2B 2O87A 2EFEA 1ZZYA 5L71A 1ZYNA 1GSYA 2QGVA 2B7JA 3F3QA 4DEJA 4EIQA 3GL5A 3L9UA 1U3IA 1N25A 4ECIA 2EFHA 4CDOA 1OC3A 2H30A 4KDYA 4ZBAA 1B9XC 4J2FA 2QA2A 3G7YA 4HJMA 2E0QA 3DWVA 4J56E 3KCMA 3MIXA 1GTIA 5D9TA 3GV1A 1SJZA 2ON7A 2FWEA 3KXOA 3LQ7A 1R7HA 1TJDA 3TUEA 4Z2UA 3CBUA 2VUPA 3LXZA 4BL7B 3R3EA 2YWNA 1ZYQB 1A0RP 13GSA 2OBIA 1Z7RA 4XS6A 1O8WA 1LBKA 3US3A 1EGRA 4K0NA 1A8LA 5LCZA 4K5SA 3HKRA 2RM6A 2R3XA 2YANA 3LYPA 4W66A 1FVJA 2HSYA 4F9ZA 1TRWA 2YZHA 1TRVA 2UV8G 3HA9A 1XFLA 2IIYA 2JSZA 4X1UA 1ACVA 1GUMA 1TXUA 2OBKA 2RIIA 3VURA 4YKGA 3FKFA 1X0RA 4O5UA 3QAVA 2WZ9A 3ZVJA 1BG5A 4JU5A 4MLYA 3TOTA 4WF4A 3ERWA 4K7NA 3IPZA 3EE2A 3DRNA 3ZFLA 1M9BA 4FH8A 2R4VA 3IDVA 5JWOB 2GDRA 5IPHA 3FR3A 4KCEA 2OACA 3HDCA 4IS0A 3DD3A 4EE0A 2DJKA 2C0DA 4YQMA 1ZGNA 4KX4A 1JHBA 1C72A 2C4JA 3I69A 1JLWA 3GTUB 3GFKA 2H01A 5IMDA 3KGKA 5G1KA 2PN8A 2GSQA 3NIVA 2CAIA 4BWQA 4AF2A 3SBCA 3Q6OA 4L0WA 3D6IA 3GKXA 3V1WA 1A2LA 4I8BA 1BF5A 2YWIA 2LRNA 2DJ0A 3UMAA 1HNCA 1B48A 3TDGA 3CRUA 3LFLA 4Q5RA 4J57E 1GTBA 5HFKA 4EIPA 3TRXA 3IA1A 2FLSA 2YN1A 4K2DA 2IJYA 2GZZA 2AAWA 2OE1A 3JCML 2YOIA 2X4AA 2JZSA 5B8BA 2H73A 5IMVA 2L57A 4XHMA 3DEXA 5KOWA 2B1KA 1JLVA 2NBSA 2B5XA 1O81A 1GSSA 4K5RA 1B4QA 4MMMA 1A23A 2C0EA 4ECJA 3HY2A 3ZIVA 3VK9A 2DIZA 5COHA 2P5RA 1H75A 4MA9A 1F6MC 3MSZA 4N0ZA 4YQVA 3ME7A 3IV4A 4WF5A 4E68A 4HQSA 4GWRA 1YEPA 4F2IA 1MDIA 1N8JA 3WT1A 2EIRA 1T4ZA 2KLXA 2H1BA 3QR6A 4BL7A 2TRXA 3BBYA 1UA5A 2PBJA 4V2NA 5GZZB 4NHZA 3HCZA 5GSSA 3DGQA 3FZ9A 4IN0A 5JCUA 2HNLA 1DSBA 4POMA 4XS1A 1PX6A 3VPTA 3NOFA 1GWCA 3L0HA 2L59A 4V1Ag 4AJ6A 3H4KA 3GURA 1SKSB 1PQNA 5AGYA 1XWBA 4ECCA 2VOCA 2EIQA 3QMXA 4PQ1A 1YVLA 2NPBA 3HMJG 4RQXA 3C71A 1NM3A 1W89A 2GT5A 1M2DA 4PXOA 2GSSA 5CRWA 2R0GA 2DJ2A 3CTFA 5A5HB 4ECBA 3S9FA 2JZRA 1K0CA 3ZMKA 1ZMAA 3APOA 2F9SA 4K6XA 5BRTA 1R5PA 3EPTA 4WEYA 3IR4A 1U87A 1A8YA 3EINA 3FYGA 1PN0A 4XS4B 3P7XA 4IJ3A 1HNAA 5HFIA 3ERFA 2OE0A 1SVLA 3KIJA 1XWAA 1PD21 4ID0A 4TOPA 4PUAA 4ZB7A 1EZKA 1VGLA 3UOMA 1GP1A 1XOAA 3A2XA 4KSMA 2HRKB 1OVNA 4OFMA 3CTGA 1GL8A 1YKAA 1VF4A 2WB9A 3M9JA 2L5OA 1AUCA 3WGXA 2WGRA 5IQYA 4GQCA 4CY8A 4NV5A 1XWCA 3F0IA 3IBHA 4OO5A 2GVPA 3UVHA 2YJHA 3N9JA 5A34B 1V40A 1R5AA 5DVBA 3TJGA 2OJLA 1H4OA 2I9HA 3R2QA 1MD4A 2IN3A 3IAM2 4MJCA 2A2PA 3F63A 1R4WA 2AJQB 5E4WA 2JU5A 5KN2A 5KEJA 2NTOA 3QD9A 3N5OA 3K8NA 5GAPD 5J9BA 2HRAA 3WYWA 2C80A 1PL1A 1XZOA 4ILFA 3E9JB 1ERVA 4KAEA 3W8SA 1FOHA 3M3MA 4N30A 4TXVA 4F0BA 3FEUA 3MDKA 2FHEA 2IMFA 4GTUA 4PQIA 2AB6A 1F3BA 4GXZA 2L4CA 1TU7A 5C00A 4EL1A 2LJAA 1W4VA 2B5YA 1RK4A 2K8SA 3P2AA 3O6TA 5D9WA 2IMKA 1G7OA 1WMJA 3IE3A 1ZYEA 5IOWA 2I3YA 4K2XA 5DAKA 3IC8A 4FQUA 10GSA 4KGIA 3DVWA 5FWGA 4HOJA 3KEBA 4FYBA 3GX0A 4ZBDA 4PX1A 1V98A 1BG1A 1K0MA 4HI7A 2IFQB 1AQXA 4MH3A 2CT6A 20GSA 4KA0A 5G5FA 1B4PA 5DDLA 1MEKA 2GTUA 5G1LA 5HR1A 1V58A 1JZOA 2YWMA 4MH2A 3PR8A 4KUNA 3QOUA 1HD2A 3DMLA 1GRXA 2HRNA 3EURA 1YF0A 1FB0A 3NZNA 4YAPA 4ML6A 4XS4A 4MZWA 5B7CA 3HJOA 3LORA 3M1GA 3FRCA 3F6DA 4OWYA 3L78A 4E8HA 4JZQA 1WJKA 4IP6A 2MMAA 3F4SA 2IMIA 2VCTA 4HUAA 1M0UA 2HSNA 5ECNB 2XHFA 2FGXA 2HRKA 1O7UA 5KN3A 3Q19A 2OA7A 2WDUA 2HYXA 4JR4A 1XW9A 4ZIJA 2HZFA 5ECMB 2AHEA 1M2BA 5EL8A 1U3AA 4WBJA 3C8EA 4EXJA 6GSYA 1TRUA 4TR0A 2VL2C 2VAFA 4O7HA 5A34A 3LYKA 19GSA 5B6MA 3RHBA 3TKRA 3C73A 5G30A 2IL3A 4MPGA 4ZB9A 4GQFA 3CYNA 2H6YA 4JE1A 5HR0A 3FR9A 3TRPA 1K0DA 2VLVA 3MAKA 5ECQB 2H76A 5CRDA 4Q5QA 4KE3A 5CREA 2H0IA 1I5GA 5JCGA 2VL2A 3TJBA 2QKEA 1OC8A 4IKHA 3CSHA 2YZUA 3TCOA 1WP0A 3TJFA 3D4TA 2H1GA 2YP6A 3VWWA 2X8CA 3IHGA 1TU8A 7GSSA 4K9ZA 4XCSA 1WRYA 1XW6A 5FHIA 1Z7PA 1G6WA 2MZCA 2YWOA 4L5LA 3UL3A 5ECKB 2ZNMA 1TDIA 1RQMA 2L5LA 4LMVA 2AYTA 4O5QA 4RUVA 4WXTA 2XBIA 1YQ1A 2KP2A 3CMIA 1SVMA 6GSWA 2VLUA 4EDZA 1SJIA 3D0ZA 4PQHA 1HQOA 2ON5A 3J7Yb 3F9UA 3ERGA 2DMMA 4GRFA 2HXKA 4BWSA 3QPMA 5J9CA 1AQVA 3H1NA 1GH2A 5ECPB 1OKTA 5A1NB 2XPEA 6GSSA 3EYTA 5BMUB 4JR6A 4EVMA 4BVXA 3VWXA 2AV4A 3GKMA 2M72A 2DJJA 2I1UA 2K8VA 5J47A 2FWHA 4KDXA 1SU9A 3ZREA 3A5WA 5IOXA 5DALB 4ICYA 5HQPA 2VKZG 1AQWA 5F06A 2CZ2A 1BJXA 1YEXA 1XW5A 1AIUA 4PUFC 2HI7A 2V6OA 3ZVJD 5INYA 2CAQA 2H8LA 1KBNA 4TW5A 3C7MA 4BPYA 2A4HA 4NMUA 4PTSA 1MTCA 5DJLA 2EFDA 2H66A 3QAGA 1EEJA 1XOBA 5A4VA 2REMA 2HZEA 1JZWA 1XIYA 4KNDA 5D73A 1PKWA 5J4YA 4GLTA 1DE1A 3HVSA 3DYRA 1X9WB 1T00A 3BCKA 3BCIA 3I9V2 1GSQA 2K6VA 3ZLPA 4RI7A 2OADA 4L5OA 2VO4A 2C0FA 1GTAA 4USSA 2H1DA 4KCAA 1ZCPA 4AGSA 4EKZA 4Z7XA 12GSA 2H6ZA 3MWHA 1YJ6A 1TKDB 4AKIA 3GSSA 1XWKA 3GNJA 2B7KA 3TB2A 3RBTA 2PVOC 2MBSA 4Q5NA 4OMVA 4PURA 2XPDA 2FNOA 2FUG2 2V6KA 2IPAA 4MABA 1GNWA 2HQTA 4JRRA 6GSTA 2BMXA 3EU3A 1AAZA 3HZ4A 1G0TA 5IM9A 3D5JA 2O5VA 1QUWA 3KMOA 2DSAA 5GAND 1FHEA 4MF6A 1IYIA 4G01A 2PVQA 4FO5A 4BA7A 1EEMA 5D9VA 4ZB6A 4XRDA 1RW1A 4A5PA 4KF9A 3IHQA 5HR2A 1PA3A 2QC7A 1Z9HA 3U6VA 2F3MA 1F37A 1BQ7A 5FT3A 1NW2A 3IXRA 2R6KA 4DSQA 3EC3A 1GTUA 3G7JA 5A1NA 1PMTA 2A2SA 3IK7A 2C0GA 1WE0A 1WPIA 5BMUA 4K8MA 4NV2A 2K18A 2D2ZA 4I97A 4P3YB 2XC2A 1O6JA 2HSHA 3LSZA 2R0PA 3Q18A 3GH9A 2WJUA 1Z5YE 3A5IA 1GNEA 5B6NA 4BVYB 1DE2A 1BAYA 4V2LA 2PGTA 1NSWA 2LNSA 3M0FA 2C3NA 2JL4A 4GSSA 2H0HA 3FMWA 1UC7A 2LKUA 1WWJA 3A2VA 1GLPA 2VIMA 2YPMA 3GTUA 3O3TA 4PNGA 4HEA2 2N5FA 1TRSA 3FK8A 2VL9A 1NHYA 2OE3A 3FHKA 5ECHB 4TR3A 1CQHA 4K1FA 4KH7A 1B8XA 1FW1A 5H5QA 2X8GA 2LJRA 1KTEA 4NWYA 2JACA 2H75A 2VM1A 1T1VA 3PPUA 5D96A 3RPNA 1X9SB 4MF5A 1XCCA 2DBCA 3LW9A 3GHAA 3EMPA 1BYEA 1TP9A 4ZL9A 3IOSA 5EY6A 2H71A 4ISDA 3VI5A 4MP4A 5AIXA 3FW2A 1SYXA 2EC4A 1UN2A 4G0IA 2C8UA 3DXBA 4F03A 4LLRA 5D9XA 2QA1A 5DQYA 4HZ2A 5ECRB 1OE8A 4QQ7A 2B5EA 4IJIA 2DLXA 2MBTA 3KZQA 4HQZA 1EV4A 1QQ2A 5G5EA 2P31A 3LG6A 1PSQA 5ENUA 1SL0B 3QCPA 2PUKC 2IWTA 2CA8A 3TKSE 3CXGA 4QL7A 1ST9A 4AJ7A 2GZYA 5CRGA 1VF1A 4G19A 4L0UA 3G7IA 3TKSC 16GSA 1T7PB 4GSNA 3KH7A 3CWGA 3EMXA 3VFIA 4TN8A 1A0FA 1A2JA 1GSEA 2H1LA 3I43A 2GT6A 1K0NA 1TK5B 3GKKA 3GKNA 1X9MB 1X5CA 5LNKe 1MD3A 1GSUA 3C1SA 1TW9A 2X49A 5IO0A 1FAAA 4IQAA 5A5HA 5ECLB 1FVKA 1OC9B 1AC1A 4HU9A 3TKSA 3ISOA 2F8AA 1Z3EA 2IMDA 2IMEA 3TGZA 2O85A 5D8IA 2G0FA 1K0OA 4IBPA 4N0VA 4I5QA 4ZL8A 2J23A 4POBA 1SJ6A 1JFUA 4KB3A 2RUFA 5JCWA 3UBKA 5LD0A 4TRXA 1DBYA 3GMFA 4NHWA 3GA4A 3UVTA 2LRTA 1BEDA 4BVYA 1N2AA 5DJMA 1URMA 2GS3A 3TU3B 5AISA 1TI3A 17GSA 1J0FA 2OKAA 2EFCA 2KP1A 2E7PA 3LXTA 4CW9A 1TK0B 1F2EA 1K3LA 4MF7A 2X8HA 4EC0A 3UAPA 1AW9A 1O8XA 1K3YA 2CVDA 3FZ5A 1ABAA 1FG4A 2FA8A 3HVVA 2R5GA 5E59A 2TIRA 3EU4A 4L8EA 3DKSA 2CV4A 4IHUA 3GX8A 1F3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VPQ A;  5ABR A;  2H0G A;  3QFB C;  4D73 B;  5J4U A;  2V32 A;  5IPG A;  1O73 A;  3KP9 A;  4V2M A;  5F8B A;  3EWL A;  4OO4 A;  3TOU A;  1V9W A;  3HJP A;  1YKC A;  1XXU A;  4TXO B;  2E2M A;  4LL4 B;  4WET A;  2XBQ A;  3BOA A;  1K0B A;  4O32 A;  5DCH A;  5F0G A;  2H6X A;  1EP7 A;  3VLN A;  3RDW A;  1DUG A;  3I6A A;  3SWL A;  3LJR A;  1T4Y A;  3FZ4 A;  1M99 A;  1NHO A;  4N11 A;  5KN1 A;  3H93 A;  3M8N A;  1SYR A;  3KMN A;  1QK8 A;  2KHP A;  4PNF A;  3L9V A;  1ERU A;  5JWR B;  4E8E A;  1VF3 A;  1M9A A;  3DVX A;  1U6T A;  1SEN A;  1X5D A;  3IC4 A;  4KDU A;  3BJ5 A;  1THO A;  3APQ A;  5AN1 A;  2IFQ A;  4MZC A;  2GQK A;  3VWV A;  2HT9 A;  3HD5 A;  4ZIL A;  2DC5 A;  2QSI A;  2TRC P;  1OC9 A;  2DML A;  1OE7 A;  4ZL7 A;  2V1M A;  2BJX A;  1HYU A;  2LJK A;  1Q98 A;  5CNW A;  4GF0 A;  2HSM B;  1EGO A;  2GQL A;  3W6G A;  4DSS B;  2F51 A;  1OAZ A;  1QFN A;  1TTZ A;  2GLR A;  1F9M A;  2JZT A;  3FZA A;  4HU7 A;  1ON4 A;  2CVK A;  1MDJ A;  1G6Y A;  1M7T A;  4ZXG A;  2LQO A;  18GS A;  5CP1 A;  1UVZ A;  1KNG A;  2NVL A;  4KW6 A;  5ELG A;  5ID2 B;  1X5E A;  2B6M A;  5H5R A;  4AJ8 A;  1B9Y C;  3GST A;  4HZ4 A;  3GH6 A;  1SD8 A;  2YV9 A;  3KH9 A;  1QXH A;  5A4U A;  2H74 A;  4JED A;  1LJR A;  4ACS A;  2CX4 A;  2M80 A;  2FCH A;  1OYJ A;  5F05 A;  4YAV A;  1T3B A;  9GSS A;  3KP8 A;  5CRH A;  3Q74 A;  3A3T A;  1GLQ A;  5EVO A;  4G2E A;  1USB A;  5J5N A;  5IO2 A;  2HLS A;  3LGC A;  4X0X A;  4WBR D;  3ZFB A;  2V2G A;  4K0G A;  1XWG A;  3ZYW A;  4HDE A;  2ZUP A;  5JWQ B;  2VCQ A;  3KTB A;  3HXS A;  1S3C A;  2Z9S A;  4POK A;  5IIZ A;  3PGT A;  3KJY A;  3CRT A;  3GUS A;  1K0A A;  2MMN A;  2C1Y A;  4V1A p;  2L4Q A;  3WT2 A;  4QL9 A;  5C04 A;  5GST A;  1E6B A;  1YDK A;  2FWG A;  1YF1 A;  3F4R A;  3IK9 A;  4O92 A;  3GIX A;  1AXD A;  2PMT A;  2N5B A;  1EV9 A;  1S3A A;  4TR1 B;  2GSR A;  1Q4J A;  4D73 A;  4PGT A;  4I2U A;  3ZML A;  3IAS 2;  2GST A;  2H19 A;  3WD6 A;  3H8Q A;  2ALB A;  3HVX A;  3PH9 A;  4TXO A;  1JZD A;  1OKD A;  2KOK A;  3KD0 A;  3H79 A;  2X64 A;  3CSI A;  1V2A A;  3HZ8 A;  2VCW A;  4LL1 B;  1ML6 A;  1PN9 A;  1XBS A;  4NPB A;  2K9F A;  1XVQ A;  3WGE A;  3IRA A;  2MMO A;  2VCZ A;  3VWU A;  1PL2 A;  1S3D A;  5DCG A;  3C1R A;  1YY7 A;  1SKR B;  4OD7 A;  1EP8 A;  3UEM A;  2FA4 A;  5IMF A;  4DSR A;  4OCF A;  3UJ1 A;  5DAK B;  1THX A;  1LU4 A;  6GSV A;  4EDY A;  2GZP A;  5CAX A;  1VRS D;  2MMZ A;  2HFD A;  4TKY A;  3BD2 A;  1SK1 A;  2YV7 A;  3F6F A;  2O89 A;  5CO3 A;  4I6X A;  4ZB8 A;  4I2T A;  5DBQ A;  4G0L A;  1TK8 B;  1PGT A;  1A2M A;  2YNX A;  1PX7 A;  3ZIT A;  3GYK A;  1BX9 A;  2B3S A;  4HS1 A;  3TKQ A;  1TI1 A;  2GGT A;  2PER A;  2B1L A;  4G10 A;  5HFG A;  2A4V A;  5EPF A;  1U88 A;  5ECI B;  2HSM A;  2PWJ A;  3W8J A;  4DSS A;  3OR5 A;  3KM6 A;  2AUV A;  4G0K A;  3RPP A;  3QFA C;  2JSY A;  6GSU A;  4GCI A;  3UAR A;  11GS A;  1GSF A;  5A5K A;  5F07 A;  3ZL5 A;  4IVF A;  5DAL A;  5H5S A;  5ID2 A;  4FIW A;  3HYP A;  4YH2 A;  1SD9 A;  3L4N A;  2I81 A;  1XVW A;  4HJ2 A;  2FY6 A;  1ILO A;  3F4T A;  4YQU A;  3J7Y k;  2RUE A;  2HSN B;  2VCV A;  3F8U A;  14GS A;  3G9B A;  4XTS A;  3UIW A;  1R26 A;  1Y25 A;  4POL A;  2ZCT A;  3D21 A;  3M9K A;  2LNT A;  4Q5F A;  4OCE A;  2P0G A;  2L6D A;  5D93 A;  4FYC A;  4EO3 A;  2WS2 A;  4EUY A;  5G2Z A;  4MK3 A;  2LTK A;  2E2G A;  5B8A A;  1WIK A;  3F3R A;  1YZX A;  3ED3 A;  1Y6E A;  3D4M A;  2RLI A;  4TR4 A;  2C3T A;  1FO5 A;  2F8F A;  2LEG A;  5IMC A;  2LS5 A;  4FYU A;  2CVB A;  1A24 A;  3FR6 A;  4WR5 A;  4OFN A;  2JAD A;  3VI7 A;  5CYY A;  1GUL A;  1ZOF A;  4JBB A;  4EF0 A;  1V57 A;  1SKW B;  4MDC A;  4CHS A;  3E3E A;  6GSX A;  1MDK A;  3FY7 A;  2H70 A;  1GUK A;  1SK2 A;  1EOG A;  2KUC A;  1J9B A;  4TR1 A;  5G31 A;  2EIO A;  3DIE A;  2FD3 A;  3CSJ A;  3WGD A;  2YJ7 A;  4IQ1 A;  1FOV A;  3O76 A;  5HR3 A;  1QMV A;  4G9H A;  4XIH A;  5ECO B;  1PKZ A;  5KN0 A;  1JZR A;  3RAZ A;  2WRT A;  3P8W A;  2UZ8 A;  3ZIJ A;  3HJM A;  1GSD A;  2LRC A;  1ERW A;  1QGV A;  3GL3 A;  3GN3 A;  1K3O A;  2CX3 A;  2N5A A;  4F0C A;  3ZZX A;  4MPF A;  1ZL9 A;  2I4A A;  3L9S A;  4N10 A;  2VD0 A;  2VCX A;  3KTL A;  4DVC A;  2H72 A;  2GQM A;  2WCI A;  3TKP A;  2L6C A;  2VD1 A;  4WR4 A;  2NDO A;  3LWA A;  1IYH A;  4IW9 A;  5J3R A;  2HE3 A;  5J41 A;  1Z6N A;  2P5Q A;  4LA1 A;  4K7I A;  1CQG A;  4WKW A;  3AY8 A;  3D22 A;  3APS A;  1EWX A;  1E2Y A;  1J08 A;  5IMZ A;  4KSO A;  1KEB A;  3TJK A;  3QAW A;  3ME8 A;  2O8V B;  2YCD A;  1FB6 A;  2DJ1 A;  5DQS A;  4K7O A;  2DJ3 A;  4ULX A;  4RQR A;  2LST A;  4H86 A;  1WOU A;  5ELA A;  1TOF A;  3EVI A;  5ECS A;  2H1A A;  5IMA A;  4GST A;  2R2J A;  3PIN A;  4NAX A;  4IGJ A;  22GS A;  2VM2 A;  4IEL A;  4XRA A;  2CQ9 A;  4ZBB A;  2J9H A;  4ML1 A;  4NXI A;  4X43 A;  3LEF A;  5AIV A;  5A4W A;  3HHV A;  4MJA A;  4O5R A;  2PPT A;  4BVX B;  3E0U A;  3ZRD A;  1Z6M A;  3QDN A;  1T8E B;  2BTO T;  4MCU A;  4F82 A;  4LMW A;  1TXX A;  2R37 A;  4MJB A;  1O85 A;  4MZB A;  4MJE A;  2VLT A;  2MYG A;  3A2W A;  2HRF A;  1VF2 A;  2CZ3 A;  3ZTL A;  2RM5 A;  4OFT A;  2VL3 A;  2DIY A;  1SL1 B;  1G7E A;  1XPV A;  3UBL A;  2M46 A;  2G2Q A;  4RI6 A;  1HNB A;  2ES7 A;  3RHC A;  1PRX A;  1EOH A;  1SK0 A;  1M2A A;  1GUH A;  3P90 A;  2LV3 A;  4TVE A;  3TRQ A;  8GSS A;  4IP1 A;  2V41 A;  3TJJ A;  2A2R A;  2C3Q A;  2LUS A;  2LQQ A;  1I9D A;  2WFC A;  3MNG A;  2FWF A;  2HZE B;  2O7K A;  1ERT A;  2PU9 C;  2WUL A;  2X99 A;  3GRX A;  3U5R E;  1SL2 B;  2O87 A;  1ZZY A;  5L71 A;  1GSY A;  2QGV A;  2B7J A;  3F3Q A;  4DEJ A;  3GL5 A;  3L9U A;  1U3I A;  4ECI A;  4CDO A;  1OC3 A;  2H30 A;  4KDY A;  4ZBA A;  1B9X C;  4J2F A;  3G7Y A;  4HJM A;  2E0Q A;  3DWV A;  4J56 E;  3KCM A;  1GTI A;  5D9T A;  3GV1 A;  1SJZ A;  2ON7 A;  2FWE A;  3KXO A;  3LQ7 A;  1R7H A;  1TJD A;  3TUE A;  3CBU A;  2VUP A;  3LXZ A;  4BL7 B;  3R3E A;  2YWN A;  1ZYQ B;  1A0R P;  13GS A;  2OBI A;  1Z7R A;  4XS6 A;  1O8W A;  1LBK A;  3US3 A;  1EGR A;  4K0N A;  1A8L A;  5LCZ A;  3HKR A;  2RM6 A;  2R3X A;  2YAN A;  3LYP A;  1FVJ A;  2HSY A;  4F9Z A;  1TRW A;  2YZH A;  1TRV A;  3HA9 A;  1XFL A;  2IIY A;  2JSZ A;  4X1U A;  1ACV A;  1GUM A;  2RII A;  2OBK A;  3VUR A;  3FKF A;  1X0R A;  3QAV A;  2WZ9 A;  3ZVJ A;  1BG5 A;  4JU5 A;  4MLY A;  3TOT A;  4WF4 A;  3ERW A;  4K7N A;  3IPZ A;  3EE2 A;  3DRN A;  3ZFL A;  1M9B A;  4FH8 A;  2R4V A;  3IDV A;  5JWO B;  2GDR A;  5IPH A;  3FR3 A;  4KCE A;  2OAC A;  3HDC A;  4IS0 A;  3DD3 A;  4EE0 A;  2DJK A;  2C0D A;  4YQM A;  1ZGN A;  4KX4 A;  1JHB A;  1C72 A;  2C4J A;  3I69 A;  1JLW A;  3GTU B;  3GFK A;  2H01 A;  5IMD A;  3KGK A;  5G1K A;  2PN8 A;  2GSQ A;  3NIV A;  2CAI A;  4BWQ A;  4AF2 A;  3SBC A;  3Q6O A;  4L0W A;  3D6I A;  3GKX A;  3V1W A;  1A2L A;  4I8B A;  2YWI A;  2LRN A;  2DJ0 A;  3UMA A;  1HNC A;  1B48 A;  3TDG A;  3CRU A;  3LFL A;  4Q5R A;  4J57 E;  1GTB A;  5HFK A;  3TRX A;  3IA1 A;  2FLS A;  2YN1 A;  4K2D A;  2IJY A;  2GZZ A;  2AAW A;  2OE1 A;  3JCM L;  2YOI A;  2JZS A;  5B8B A;  2H73 A;  5IMV A;  2L57 A;  4XHM A;  3DEX A;  2B1K A;  1JLV A;  2NBS A;  2B5X A;  1O81 A;  1GSS A;  1B4Q A;  4MMM A;  1A23 A;  2C0E A;  4ECJ A;  3HY2 A;  3ZIV A;  3VK9 A;  2DIZ A;  5COH A;  2P5R A;  1H75 A;  4MA9 A;  1F6M C;  3MSZ A;  4N0Z A;  4YQV A;  3ME7 A;  3IV4 A;  4WF5 A;  4HQS A;  4GWR A;  1YEP A;  4F2I A;  1MDI A;  1N8J A;  3WT1 A;  2EIR A;  1T4Z A;  2KLX A;  2H1B A;  3QR6 A;  4BL7 A;  2TRX A;  3BBY A;  1UA5 A;  2PBJ A;  4V2N A;  5GZZ B;  4NHZ A;  3HCZ A;  5GSS A;  3DGQ A;  3FZ9 A;  4IN0 A;  5JCU A;  2HNL A;  1DSB A;  4POM A;  4XS1 A;  1PX6 A;  3VPT A;  3NOF A;  1GWC A;  3L0H A;  2L59 A;  4V1A g;  4AJ6 A;  3H4K A;  3GUR A;  1SKS B;  1PQN A;  5AGY A;  1XWB A;  4ECC A;  2VOC A;  2EIQ A;  3QMX A;  4PQ1 A;  2NPB A;  4RQX A;  3C71 A;  1NM3 A;  1W89 A;  2GT5 A;  1M2D A;  4PXO A;  2GSS A;  5CRW A;  2DJ2 A;  3CTF A;  4ECB A;  3S9F A;  2JZR A;  1K0C A;  3ZMK A;  1ZMA A;  3APO A;  2F9S A;  4K6X A;  1R5P A;  4WEY A;  3IR4 A;  1U87 A;  1A8Y A;  3EIN A;  3FYG A;  4XS4 B;  3P7X A;  4IJ3 A;  1HNA A;  5HFI A;  3ERF A;  2OE0 A;  3KIJ A;  1XWA A;  1PD2 1;  4ID0 A;  4TOP A;  4PUA A;  1EZK A;  1VGL A;  3UOM A;  1GP1 A;  1XOA A;  3A2X A;  4KSM A;  2HRK B;  1OVN A;  4OFM A;  3CTG A;  1GL8 A;  1YKA A;  1VF4 A;  2WB9 A;  3M9J A;  2L5O A;  1AUC A;  3WGX A;  2WGR A;  5IQY A;  4GQC A;  4NV5 A;  1XWC A;  3F0I A;  3IBH A;  4OO5 A;  2GVP A;  3UVH A;  2YJH A;  3N9J A;  1V40 A;  1R5A A;  5DVB A;  3TJG A;  2OJL A;  1H4O A;  2I9H A;  3R2Q A;  1MD4 A;  2IN3 A;  3IAM 2;  4MJC A;  3F63 A;  1R4W A;  2AJQ B;  5E4W A;  2JU5 A;  5KN2 A;  5KEJ A;  2NTO A;  3QD9 A;  3N5O A;  3K8N A;  5GAP D;  5J9B A;  2HRA A;  3WYW A;  2C80 A;  1PL1 A;  1XZO A;  4ILF A;  3E9J B;  1ERV A;  4KAE A;  3W8S A;  3M3M A;  4N30 A;  4TXV A;  4F0B A;  3FEU A;  3MDK A;  2FHE A;  2IMF A;  4GTU A;  4PQI A;  2AB6 A;  1F3B A;  4GXZ A;  2L4C A;  1TU7 A;  5C00 A;  4EL1 A;  2LJA A;  1W4V A;  2B5Y A;  1RK4 A;  2K8S A;  3P2A A;  3O6T A;  5D9W A;  2IMK A;  1G7O A;  1WMJ A;  3IE3 A;  1ZYE A;  5IOW A;  2I3Y A;  5DAK A;  3IC8 A;  4FQU A;  10GS A;  4KGI A;  3DVW A;  5FWG A;  4HOJ A;  3KEB A;  4FYB A;  3GX0 A;  4ZBD A;  4PX1 A;  1V98 A;  1K0M A;  4HI7 A;  2IFQ B;  1AQX A;  4MH3 A;  2CT6 A;  20GS A;  4KA0 A;  5G5F A;  1B4P A;  5DDL A;  1MEK A;  2GTU A;  5G1L A;  5HR1 A;  1V58 A;  1JZO A;  2YWM A;  4MH2 A;  3PR8 A;  4KUN A;  3QOU A;  1HD2 A;  3DML A;  1GRX A;  2HRN A;  3EUR A;  1YF0 A;  1FB0 A;  3NZN A;  4YAP A;  4ML6 A;  4XS4 A;  4MZW A;  5B7C A;  3HJO A;  3LOR A;  3M1G A;  3FRC A;  3F6D A;  4OWY A;  3L78 A;  4E8H A;  4JZQ A;  1WJK A;  4IP6 A;  2MMA A;  3F4S A;  2IMI A;  2VCT A;  4HUA A;  1M0U A;  5ECN B;  2XHF A;  2FGX A;  2HRK A;  1O7U A;  5KN3 A;  3Q19 A;  2OA7 A;  2WDU A;  2HYX A;  4JR4 A;  1XW9 A;  4ZIJ A;  2HZF A;  5ECM B;  2AHE A;  1M2B A;  5EL8 A;  1U3A A;  4WBJ A;  3C8E A;  4EXJ A;  6GSY A;  1TRU A;  4TR0 A;  2VL2 C;  2VAF A;  4O7H A;  3LYK A;  19GS A;  5B6M A;  3RHB A;  3TKR A;  3C73 A;  5G30 A;  2IL3 A;  4MPG A;  4ZB9 A;  4GQF A;  3CYN A;  2H6Y A;  4JE1 A;  5HR0 A;  3FR9 A;  3TRP A;  1K0D A;  2VLV A;  3MAK A;  5ECQ B;  2H76 A;  5CRD A;  4Q5Q A;  4KE3 A;  5CRE A;  2H0I A;  1I5G A;  5JCG A;  2VL2 A;  3TJB A;  2QKE A;  1OC8 A;  4IKH A;  3CSH A;  2YZU A;  3TCO A;  1WP0 A;  3TJF A;  3D4T A;  2H1G A;  2YP6 A;  3VWW A;  2X8C A;  1TU8 A;  7GSS A;  4K9Z A;  4XCS A;  1WRY A;  1XW6 A;  5FHI A;  1Z7P A;  1G6W A;  2MZC A;  2YWO A;  4L5L A;  3UL3 A;  5ECK B;  2ZNM A;  1TDI A;  1RQM A;  2L5L A;  4LMV A;  2AYT A;  4RUV A;  4WXT A;  2XBI A;  1YQ1 A;  2KP2 A;  3CMI A;  6GSW A;  2VLU A;  4EDZ A;  1SJI A;  3D0Z A;  4PQH A;  1HQO A;  2ON5 A;  3J7Y b;  3F9U A;  3ERG A;  2DMM A;  4GRF A;  2HXK A;  4BWS A;  3QPM A;  5J9C A;  1AQV A;  3H1N A;  1GH2 A;  5ECP B;  1OKT A;  2XPE A;  6GSS A;  3EYT A;  4JR6 A;  4EVM A;  4BVX A;  3VWX A;  2AV4 A;  3GKM A;  2M72 A;  2DJJ A;  2I1U A;  2K8V A;  2FWH A;  4KDX A;  1SU9 A;  3ZRE A;  3A5W A;  5IOX A;  5DAL B;  5HQP A;  1AQW A;  5F06 A;  2CZ2 A;  1BJX A;  1YEX A;  1XW5 A;  1AIU A;  4PUF C;  2HI7 A;  2V6O A;  3ZVJ D;  5INY A;  2CAQ A;  2H8L A;  1KBN A;  4TW5 A;  3C7M A;  4BPY A;  4NMU A;  4PTS A;  1MTC A;  5DJL A;  2H66 A;  3QAG A;  1EEJ A;  1XOB A;  5A4V A;  2REM A;  2HZE A;  1JZW A;  1XIY A;  4KND A;  5D73 A;  1PKW A;  1DE1 A;  4GLT A;  3HVS A;  3DYR A;  1X9W B;  1T00 A;  3BCK A;  3BCI A;  3I9V 2;  1GSQ A;  2K6V A;  3ZLP A;  4RI7 A;  2OAD A;  4L5O A;  2VO4 A;  2C0F A;  1GTA A;  4USS A;  2H1D A;  4KCA A;  1ZCP A;  4AGS A;  4EKZ A;  4Z7X A;  12GS A;  2H6Z A;  3MWH A;  1YJ6 A;  1TKD B;  3GSS A;  1XWK A;  3GNJ A;  2B7K A;  3TB2 A;  3RBT A;  2PVO C;  2MBS A;  4Q5N A;  4OMV A;  4PUR A;  2XPD A;  2FNO A;  2FUG 2;  2V6K A;  2IPA A;  4MAB A;  1GNW A;  2HQT A;  4JRR A;  6GST A;  2BMX A;  3EU3 A;  1AAZ A;  3HZ4 A;  1G0T A;  5IM9 A;  3D5J A;  1QUW A;  3KMO A;  2DSA A;  5GAN D;  1FHE A;  4MF6 A;  1IYI A;  2PVQ A;  4FO5 A;  4BA7 A;  1EEM A;  5D9V A;  4ZB6 A;  4XRD A;  1RW1 A;  4KF9 A;  3IHQ A;  5HR2 A;  1PA3 A;  2QC7 A;  1Z9H A;  3U6V A;  2F3M A;  1F37 A;  1BQ7 A;  5FT3 A;  1NW2 A;  3IXR A;  2R6K A;  4DSQ A;  3EC3 A;  1GTU A;  3G7J A;  1PMT A;  2A2S A;  3IK7 A;  2C0G A;  1WE0 A;  1WPI A;  5BMU A;  4K8M A;  4NV2 A;  2K18 A;  2D2Z A;  4I97 A;  4P3Y B;  2XC2 A;  1O6J A;  2HSH A;  3LSZ A;  3Q18 A;  3GH9 A;  2WJU A;  1Z5Y E;  1GNE A;  5B6N A;  4BVY B;  1DE2 A;  1BAY A;  4V2L A;  2PGT A;  1NSW A;  2LNS A;  3M0F A;  2C3N A;  2JL4 A;  4GSS A;  2H0H A;  1UC7 A;  2LKU A;  1WWJ A;  3A2V A;  1GLP A;  2VIM A;  2YPM A;  3GTU A;  3O3T A;  4PNG A;  4HEA 2;  2N5F A;  1TRS A;  3FK8 A;  2VL9 A;  1NHY A;  2OE3 A;  3FHK A;  5ECH B;  4TR3 A;  1CQH A;  4K1F A;  4KH7 A;  1B8X A;  1FW1 A;  5H5Q A;  2X8G A;  2LJR A;  1KTE A;  4NWY A;  2JAC A;  2H75 A;  2VM1 A;  1T1V A;  3PPU A;  5D96 A;  3RPN A;  1X9S B;  4MF5 A;  1XCC A;  2DBC A;  3GHA A;  3EMP A;  1BYE A;  1TP9 A;  4ZL9 A;  3IOS A;  5EY6 A;  2H71 A;  4ISD A;  3VI5 A;  4MP4 A;  5AIX A;  3FW2 A;  1SYX A;  2EC4 A;  1UN2 A;  4G0I A;  2C8U A;  3DXB A;  4F03 A;  4LLR A;  5D9X A;  5DQY A;  4HZ2 A;  5ECR B;  1OE8 A;  4QQ7 A;  2B5E A;  4IJI A;  2DLX A;  2MBT A;  3KZQ A;  4HQZ A;  1EV4 A;  1QQ2 A;  5G5E A;  2P31 A;  3LG6 A;  1PSQ A;  5ENU A;  1SL0 B;  3QCP A;  2PUK C;  2IWT A;  2CA8 A;  3TKS E;  3CXG A;  4QL7 A;  1ST9 A;  4AJ7 A;  2GZY A;  5CRG A;  1VF1 A;  4G19 A;  4L0U A;  3G7I A;  3TKS C;  16GS A;  1T7P B;  4GSN A;  3KH7 A;  3EMX A;  3VFI A;  4TN8 A;  1A0F A;  1A2J A;  1GSE A;  3I43 A;  2GT6 A;  1K0N A;  1TK5 B;  3GKK A;  3GKN A;  1X9M B;  1X5C A;  5LNK e;  1MD3 A;  1GSU A;  3C1S A;  1TW9 A;  5IO0 A;  1FAA A;  4IQA A;  5ECL B;  1FVK A;  1OC9 B;  1AC1 A;  4HU9 A;  3TKS A;  3ISO A;  2F8A A;  1Z3E A;  2IMD A;  2IME A;  3TGZ A;  2O85 A;  5D8I A;  2G0F A;  1K0O A;  4IBP A;  4N0V A;  4I5Q A;  4ZL8 A;  2J23 A;  4POB A;  1SJ6 A;  1JFU A;  4KB3 A;  2RUF A;  5JCW A;  3UBK A;  5LD0 A;  4TRX A;  1DBY A;  3GMF A;  4NHW A;  3GA4 A;  3UVT A;  2LRT A;  1BED A;  4BVY A;  1N2A A;  5DJM A;  1URM A;  2GS3 A;  5AIS A;  1TI3 A;  17GS A;  1J0F A;  2OKA A;  2KP1 A;  2E7P A;  3LXT A;  4CW9 A;  1TK0 B;  1F2E A;  1K3L A;  4MF7 A;  2X8H A;  4EC0 A;  3UAP A;  1AW9 A;  1O8X A;  1K3Y A;  2CVD A;  3FZ5 A;  1ABA A;  1FG4 A;  2FA8 A;  3HVV A;  2R5G A;  5E59 A;  2TIR A;  3EU4 A;  4L8E A;  3DKS A;  2CV4 A;  4IHU A;  3GX8 A;  1F3A A; 
#chains in the Genus database with same CATH topology
 3VPQ A;  5ABR A;  2H0G A;  3QFB C;  4D73 B;  5J4U A;  2V32 A;  5IPG A;  1O73 A;  3KP9 A;  4V2M A;  5F8B A;  3EWL A;  4OO4 A;  3TOU A;  1V9W A;  3HJP A;  1YKC A;  1XXU A;  4TXO B;  2E2M A;  4LL4 B;  4WET A;  2XBQ A;  3BOA A;  1K0B A;  4O32 A;  5DCH A;  5F0G A;  2H6X A;  1EP7 A;  3VLN A;  3RDW A;  1DUG A;  3I6A A;  3SWL A;  2R0C A;  3LJR A;  1T4Y A;  3FZ4 A;  1M99 A;  1NHO A;  4N11 A;  5KN1 A;  3H93 A;  3M8N A;  1SYR A;  3KMN A;  1QK8 A;  2KHP A;  4PNF A;  3L9V A;  1ERU A;  4X4J A;  4E8E A;  5JWR B;  1VF3 A;  1M9A A;  3DVX A;  1U6T A;  1SEN A;  1X5D A;  3IC4 A;  4KDU A;  3BJ5 A;  1THO A;  3APQ A;  5AN1 A;  2IFQ A;  4MZC A;  2GQK A;  3VWV A;  2HT9 A;  3HD5 A;  4ZIL A;  2DC5 A;  4N3Z A;  2QSI A;  2TRC P;  1OC9 A;  2DML A;  1OE7 A;  4ZL7 A;  2V1M A;  2BJX A;  1HYU A;  2LJK A;  1Q98 A;  5CNW A;  4GF0 A;  2HSM B;  4AI6 A;  1EGO A;  2GQL A;  3W6G A;  4DSS B;  2F51 A;  1OAZ A;  1QFN A;  1TTZ A;  2GLR A;  1F9M A;  2JZT A;  3FZA A;  4HU7 A;  1ON4 A;  2CVK A;  1MDJ A;  1G6Y A;  1M7T A;  4ZXG A;  2LQO A;  18GS A;  5CP1 A;  1UVZ A;  1KNG A;  2NVL A;  4KW6 A;  5ELG A;  5ID2 B;  1X5E A;  2B6M A;  5H5R A;  4AJ8 A;  1B9Y C;  3GST A;  4HZ4 A;  3GH6 A;  1SD8 A;  2YV9 A;  3KH9 A;  1QXH A;  2WVY A;  5A4U A;  2H74 A;  4JED A;  1LJR A;  4ACS A;  2CX4 A;  2M80 A;  2FCH A;  1OYJ A;  5F05 A;  4YAV A;  4AKG A;  1T3B A;  9GSS A;  3KP8 A;  5CRH A;  3Q74 A;  3A3T A;  1GLQ A;  4PI2 C;  5EVO A;  3HVN A;  4G2E A;  1USB A;  5J5N A;  5IO2 A;  2HLS A;  3LGC A;  4X0X A;  4WBR D;  3ZFB A;  5KOX A;  2V2G A;  4K0G A;  1XWG A;  1SVO A;  3ZYW A;  4HDE A;  2ZUP A;  5JWQ B;  2VCQ A;  3KTB A;  3HXS A;  1S3C A;  2Z9S A;  4POK A;  5IIZ A;  3PGT A;  3KJY A;  3CRT A;  3GUS A;  1K0A A;  2MMN A;  2C1Y A;  4V1A p;  2L4Q A;  3WT2 A;  4QL9 A;  5C04 A;  5GST A;  1E6B A;  1YDK A;  2O3E A;  2FWG A;  1YF1 A;  3F4R A;  3IK9 A;  4O92 A;  3GIX A;  4AKX B;  1AXD A;  2PMT A;  2N5B A;  1EV9 A;  1S3A A;  4TR1 B;  2GSR A;  1Q4J A;  4D73 A;  4PGT A;  4I2U A;  3ZML A;  3IAS 2;  2GST A;  2H19 A;  3WD6 A;  3H8Q A;  2ALB A;  3HVX A;  3PH9 A;  4TXO A;  1JZD A;  1OKD A;  2KOK A;  3KD0 A;  3H79 A;  2X64 A;  3CSI A;  1V2A A;  3HZ8 A;  2VCW A;  4LL1 B;  5J4V A;  1ML6 A;  1PN9 A;  1XBS A;  4NPB A;  2K9F A;  1XVQ A;  3WGE A;  3IRA A;  2MMO A;  2VCZ A;  3VWU A;  1PL2 A;  1S3D A;  5DCG A;  3C1R A;  1YY7 A;  1SKR B;  4OD7 A;  1EP8 A;  3UEM A;  2FA4 A;  4PI0 C;  5IMF A;  4DSR A;  4OCF A;  3UJ1 A;  5DAK B;  1THX A;  1M3I A;  1LU4 A;  6GSV A;  4EDY A;  2GZP A;  5CAX A;  1VRS D;  2MMZ A;  2HFD A;  4TKY A;  3BD2 A;  1SK1 A;  2YV7 A;  3F6F A;  2O89 A;  5CO3 A;  4I6X A;  4ZB8 A;  4I2T A;  5DBQ A;  4G0L A;  1TK8 B;  1PGT A;  1A2M A;  2YNX A;  1PX7 A;  3ZIT A;  3GYK A;  1BX9 A;  2B3S A;  4HS1 A;  3TKQ A;  1TI1 A;  2GGT A;  2PER A;  2B1L A;  4G10 A;  5HFG A;  2A4V A;  5EPF A;  1U88 A;  5ECI B;  2HSM A;  2DKI A;  2PWJ A;  3W8J A;  4DSS A;  3OR5 A;  3KM6 A;  4Z2R A;  2AUV A;  4G0K A;  3RPP A;  3QFA C;  2JSY A;  4YKF A;  6GSU A;  4GCI A;  3UAR A;  11GS A;  1GSF A;  4GDF A;  5A5K A;  5F07 A;  3ZL5 A;  4IVF A;  5DAL A;  5H5S A;  5ID2 A;  4FIW A;  3HYP A;  4YH2 A;  1SD9 A;  3L4N A;  2I81 A;  1XVW A;  4HJ2 A;  2FY6 A;  1ILO A;  1Y1U A;  3F4T A;  4YQU A;  3J7Y k;  2RUE A;  2HSN B;  2VCV A;  3F8U A;  4QMK A;  14GS A;  3G9B A;  4XTS A;  3UIW A;  1R26 A;  1Y25 A;  4POL A;  2ZCT A;  3D21 A;  3M9K A;  2LNT A;  4Q5F A;  4OCE A;  2P0G A;  2L6D A;  5D93 A;  4FYC A;  4EO3 A;  2WS2 A;  4EUY A;  2OT3 A;  5G2Z A;  4MK3 A;  2LTK A;  2E2G A;  5B8A A;  1WIK A;  2DKH A;  3F3R A;  1YZX A;  3ED3 A;  1Y6E A;  3D4M A;  2RLI A;  4TR4 A;  2C3T A;  1FO5 A;  2F8F A;  2LEG A;  5IMC A;  2LS5 A;  4FYU A;  2CVB A;  1A24 A;  3FR6 A;  4WR5 A;  4OFN A;  2JAD A;  3VI7 A;  5CYY A;  1GUL A;  1ZOF A;  4JBB A;  4EF0 A;  1V57 A;  1SKW B;  4MDC A;  4CHS A;  3E3E A;  6GSX A;  1MDK A;  3FY7 A;  2H70 A;  1GUK A;  1SK2 A;  1EOG A;  2KUC A;  1J9B A;  4TR1 A;  5G31 A;  2EIO A;  3DIE A;  2FD3 A;  3CSJ A;  3WGD A;  2YJ7 A;  4IQ1 A;  1FOV A;  3O76 A;  5HR3 A;  1QMV A;  4FXY P;  4G9H A;  4XIH A;  5ECO B;  1PKZ A;  5KN0 A;  1JZR A;  3RAZ A;  2WRT A;  3P8W A;  2UZ8 A;  3ZIJ A;  3HJM A;  1GSD A;  2LRC A;  1ERW A;  1QGV A;  3GL3 A;  3GN3 A;  1K3O A;  2CX3 A;  4Z2T A;  2N5A A;  4F0C A;  3ZZX A;  4MPF A;  1ZL9 A;  2I4A A;  3L9S A;  4N10 A;  2VD0 A;  2VCX A;  3KTL A;  4CY6 A;  4DVC A;  2H72 A;  2GQM A;  2WCI A;  3TKP A;  2L6C A;  2VD1 A;  4WR4 A;  2NDO A;  3LWA A;  1IYH A;  4IW9 A;  5J3R A;  2HE3 A;  5J41 A;  1Z6N A;  2P5Q A;  4LA1 A;  4K7I A;  1CQG A;  4WKW A;  3AY8 A;  3MYD A;  3D22 A;  3APS A;  1EWX A;  1E2Y A;  1J08 A;  5IMZ A;  4KSO A;  1KEB A;  3TJK A;  3QAW A;  3ME8 A;  2O8V B;  2YCD A;  1FB6 A;  2DJ1 A;  5DQS A;  4K7O A;  2DJ3 A;  4ULX A;  4RQR A;  2LST A;  4H86 A;  1WOU A;  5ELA A;  1TOF A;  3EVI A;  5ECS A;  2H1A A;  5IMA A;  4GST A;  4AKH A;  2R2J A;  3PIN A;  4NAX A;  4IGJ A;  22GS A;  2VM2 A;  1M3J A;  4IEL A;  4XRA A;  2CQ9 A;  4ZBB A;  2J9H A;  4ML1 A;  4NXI A;  4X43 A;  3LEF A;  5AIV A;  5A4W A;  3HHV A;  4MJA A;  4O5R A;  2PPT A;  4BVX B;  5J40 A;  3E0U A;  3ZRD A;  1Z6M A;  1ZYP A;  3QDN A;  1T8E B;  2BTO T;  4MCU A;  4MNN A;  4LMW A;  1TXX A;  4F82 A;  2R37 A;  4MJB A;  1O85 A;  4MZB A;  4MJE A;  2VLT A;  2MYG A;  3A2W A;  2HRF A;  1VF2 A;  2CZ3 A;  3ZTL A;  2RM5 A;  4OFT A;  2VL3 A;  2DIY A;  1SL1 B;  1G7E A;  1XPV A;  3UBL A;  2M46 A;  2G2Q A;  4RI6 A;  1HNB A;  2ES7 A;  3RHC A;  1PRX A;  1EOH A;  1SK0 A;  1M2A A;  1GUH A;  3P90 A;  2LV3 A;  4TVE A;  3TRQ A;  8GSS A;  4IP1 A;  2V41 A;  3TJJ A;  2A2R A;  2C3Q A;  2LUS A;  2LQQ A;  1I9D A;  2WFC A;  3MNG A;  2FWF A;  2HZE B;  2O7K A;  1ERT A;  2PU9 C;  2WUL A;  2X99 A;  3GRX A;  3U5R E;  1SL2 B;  2O87 A;  2EFE A;  1ZZY A;  5L71 A;  1ZYN A;  1GSY A;  2QGV A;  2B7J A;  3F3Q A;  4DEJ A;  4EIQ A;  3GL5 A;  3L9U A;  1U3I A;  1N25 A;  4ECI A;  2EFH A;  4CDO A;  1OC3 A;  2H30 A;  4KDY A;  4ZBA A;  1B9X C;  4J2F A;  2QA2 A;  3G7Y A;  4HJM A;  2E0Q A;  3DWV A;  4J56 E;  3KCM A;  1GTI A;  3MIX A;  5D9T A;  3GV1 A;  1SJZ A;  2ON7 A;  2FWE A;  3KXO A;  3LQ7 A;  1R7H A;  1TJD A;  3TUE A;  4Z2U A;  3CBU A;  1PFO A;  2VUP A;  3LXZ A;  4BL7 B;  2WW3 A;  3R3E A;  2YWN A;  1ZYQ B;  1A0R P;  13GS A;  2OBI A;  1Z7R A;  4XS6 A;  1O8W A;  1LBK A;  3US3 A;  1EGR A;  4K0N A;  1A8L A;  5LCZ A;  4K5S A;  3HKR A;  2RM6 A;  2R3X A;  2YAN A;  3LYP A;  4W66 A;  1FVJ A;  2HSY A;  4F9Z A;  1TRW A;  2YZH A;  1TRV A;  2UV8 G;  3HA9 A;  1XFL A;  2IIY A;  2JSZ A;  4X1U A;  1ACV A;  1GUM A;  1TXU A;  2OBK A;  2RII A;  3VUR A;  4YKG A;  3FKF A;  1X0R A;  4O5U A;  3QAV A;  2WZ9 A;  3ZVJ A;  1BG5 A;  4JU5 A;  4MLY A;  3TOT A;  4WF4 A;  3ERW A;  4K7N A;  3IPZ A;  3EE2 A;  3DRN A;  3ZFL A;  1M9B A;  4FH8 A;  2R4V A;  3IDV A;  5JWO B;  2GDR A;  5IPH A;  3FR3 A;  4KCE A;  2OAC A;  3HDC A;  4IS0 A;  3DD3 A;  4EE0 A;  2DJK A;  2C0D A;  4YQM A;  1ZGN A;  4KX4 A;  1JHB A;  1C72 A;  2C4J A;  3I69 A;  1JLW A;  4PHZ C;  2WW2 A;  3GTU B;  3GFK A;  2H01 A;  5IMD A;  3KGK A;  5G1K A;  2PN8 A;  2GSQ A;  3NIV A;  2CAI A;  4BWQ A;  4AF2 A;  3SBC A;  3Q6O A;  4L0W A;  3D6I A;  3GKX A;  3V1W A;  1A2L A;  4I8B A;  1BF5 A;  2YWI A;  2LRN A;  2DJ0 A;  3UMA A;  1HNC A;  1B48 A;  3TDG A;  3CRU A;  3LFL A;  4Q5R A;  4J57 E;  1GTB A;  5HFK A;  4EIP A;  3TRX A;  3IA1 A;  2FLS A;  2YN1 A;  4K2D A;  2IJY A;  2GZZ A;  2AAW A;  2OE1 A;  3JCM L;  2YOI A;  2X4A A;  2JZS A;  5B8B A;  2H73 A;  5IMV A;  2L57 A;  4XHM A;  3DEX A;  5KOW A;  2B1K A;  1JLV A;  2NBS A;  2B5X A;  1O81 A;  1GSS A;  4K5R A;  1B4Q A;  4MMM A;  1A23 A;  2C0E A;  4ECJ A;  3HY2 A;  3ZIV A;  3VK9 A;  2DIZ A;  5COH A;  2P5R A;  1H75 A;  4MA9 A;  1F6M C;  3MSZ A;  4N0Z A;  4YQV A;  3ME7 A;  3IV4 A;  4WF5 A;  4E68 A;  4HQS A;  4GWR A;  1YEP A;  4F2I A;  1MDI A;  1N8J A;  3WT1 A;  2EIR A;  1T4Z A;  2KLX A;  2H1B A;  3QR6 A;  4BL7 A;  2TRX A;  3BBY A;  1UA5 A;  2PBJ A;  4V2N A;  5GZZ B;  4NHZ A;  3HCZ A;  5GSS A;  3DGQ A;  3FZ9 A;  4IN0 A;  5JCU A;  2HNL A;  1DSB A;  4POM A;  4XS1 A;  1PX6 A;  3VPT A;  3NOF A;  1GWC A;  3L0H A;  2L59 A;  4V1A g;  4AJ6 A;  3H4K A;  3GUR A;  1SKS B;  1PQN A;  5AGY A;  1XWB A;  4ECC A;  2VOC A;  2EIQ A;  3QMX A;  4PQ1 A;  1YVL A;  2NPB A;  3HMJ G;  4RQX A;  3C71 A;  1NM3 A;  1W89 A;  2GT5 A;  1M2D A;  4PXO A;  2GSS A;  5CRW A;  2R0G A;  2DJ2 A;  3CTF A;  5A5H B;  4ECB A;  3S9F A;  2JZR A;  1K0C A;  3ZMK A;  1ZMA A;  3APO A;  2F9S A;  4K6X A;  5BRT A;  1R5P A;  3EPT A;  4WEY A;  3IR4 A;  1U87 A;  1A8Y A;  3EIN A;  3FYG A;  1PN0 A;  4XS4 B;  3P7X A;  4IJ3 A;  1HNA A;  5HFI A;  3ERF A;  2OE0 A;  1SVL A;  3KIJ A;  1XWA A;  1PD2 1;  4ID0 A;  4TOP A;  4PUA A;  4ZB7 A;  1EZK A;  1VGL A;  3UOM A;  1GP1 A;  1XOA A;  3A2X A;  4KSM A;  2HRK B;  1OVN A;  4OFM A;  3CTG A;  1GL8 A;  1YKA A;  1VF4 A;  2WB9 A;  3M9J A;  2L5O A;  1AUC A;  3WGX A;  2WGR A;  5IQY A;  4GQC A;  4CY8 A;  4NV5 A;  1XWC A;  3F0I A;  3IBH A;  4OO5 A;  2GVP A;  3UVH A;  2YJH A;  3N9J A;  5A34 B;  1V40 A;  1R5A A;  5DVB A;  3TJG A;  2OJL A;  1H4O A;  2I9H A;  3R2Q A;  1MD4 A;  2IN3 A;  3IAM 2;  4MJC A;  2A2P A;  3F63 A;  1R4W A;  2AJQ B;  5E4W A;  2JU5 A;  5KN2 A;  5KEJ A;  2NTO A;  3QD9 A;  3N5O A;  3K8N A;  5GAP D;  3CHX C;  5J9B A;  2HRA A;  3WYW A;  2C80 A;  1PL1 A;  1XZO A;  4ILF A;  3E9J B;  1ERV A;  4KAE A;  3W8S A;  1FOH A;  3M3M A;  4N30 A;  4TXV A;  4F0B A;  3FEU A;  3MDK A;  2FHE A;  2IMF A;  4GTU A;  4PQI A;  2AB6 A;  1F3B A;  4GXZ A;  2L4C A;  1TU7 A;  5C00 A;  4EL1 A;  2LJA A;  1W4V A;  2B5Y A;  1RK4 A;  2K8S A;  3P2A A;  3O6T A;  5D9W A;  2IMK A;  1G7O A;  1WMJ A;  3IE3 A;  1ZYE A;  5IOW A;  2I3Y A;  4K2X A;  5DAK A;  3IC8 A;  4FQU A;  10GS A;  4KGI A;  3DVW A;  5FWG A;  4HOJ A;  3KEB A;  4FYB A;  3GX0 A;  4ZBD A;  4PX1 A;  1V98 A;  1BG1 A;  1XG8 A;  1K0M A;  4HI7 A;  2IFQ B;  2WW0 A;  1AQX A;  4MH3 A;  2CT6 A;  20GS A;  4KA0 A;  5G5F A;  1B4P A;  5DDL A;  1MEK A;  2GTU A;  5G1L A;  5HR1 A;  1V58 A;  1S4B P;  1JZO A;  2YWM A;  4MH2 A;  3PR8 A;  4KUN A;  3QOU A;  1HD2 A;  3DML A;  1GRX A;  2HRN A;  3EUR A;  1YF0 A;  1FB0 A;  3NZN A;  4YAP A;  4ML6 A;  4XS4 A;  4MZW A;  5B7C A;  3HJO A;  3LOR A;  3M1G A;  4HSC X;  3FRC A;  3F6D A;  4OWY A;  3L78 A;  4E8H A;  4JZQ A;  2WZS A;  1WJK A;  4IP6 A;  2MMA A;  3F4S A;  2IMI A;  2VCT A;  4HUA A;  1M0U A;  2HSN A;  5ECN B;  2XHF A;  2FGX A;  2HRK A;  1O7U A;  5KN3 A;  3Q19 A;  2OA7 A;  2WDU A;  2HYX A;  4JR4 A;  1XW9 A;  4ZIJ A;  2HZF A;  5ECM B;  2AHE A;  1M2B A;  5EL8 A;  1U3A A;  4WBJ A;  3C8E A;  4EXJ A;  6GSY A;  1TRU A;  4TR0 A;  2VL2 C;  2VAF A;  4O7H A;  5A34 A;  3LYK A;  19GS A;  5B6M A;  3RHB A;  4BIK A;  3TKR A;  3C73 A;  5G30 A;  2IL3 A;  4MPG A;  4ZB9 A;  4GQF A;  3CYN A;  2H6Y A;  4JE1 A;  5HR0 A;  3FR9 A;  3TRP A;  1K0D A;  2VLV A;  3MAK A;  5ECQ B;  2H76 A;  5CRD A;  4Q5Q A;  4KE3 A;  5CRE A;  2H0I A;  1I5G A;  5JCG A;  2VL2 A;  3TJB A;  2QKE A;  1OC8 A;  4IKH A;  3CSH A;  2YZU A;  3TCO A;  1WP0 A;  3TJF A;  1YEW C;  3D4T A;  2H1G A;  2YP6 A;  3VWW A;  3RFR C;  2X8C A;  3IHG A;  1TU8 A;  7GSS A;  4K9Z A;  4XCS A;  1WRY A;  1XW6 A;  5FHI A;  1Z7P A;  1G6W A;  2MZC A;  2YWO A;  4L5L A;  3UL3 A;  5ECK B;  2ZNM A;  1TDI A;  1RQM A;  2L5L A;  4LMV A;  2AYT A;  4O5Q A;  4RUV A;  4WXT A;  2XBI A;  1YQ1 A;  2KP2 A;  3CMI A;  1SVM A;  6GSW A;  2VLU A;  4EDZ A;  1SJI A;  3D0Z A;  4PQH A;  1HQO A;  2ON5 A;  3J7Y b;  3F9U A;  3ERG A;  2DMM A;  4GRF A;  2HXK A;  4BWS A;  3QPM A;  5J9C A;  1AQV A;  3H1N A;  1GH2 A;  5ECP B;  1OKT A;  5A1N B;  2XPE A;  6GSS A;  3EYT A;  5BMU B;  4JR6 A;  4EVM A;  4BVX A;  3VWX A;  2AV4 A;  3GKM A;  2M72 A;  2DJJ A;  2I1U A;  2K8V A;  5J47 A;  2FWH A;  4KDX A;  1SU9 A;  3ZRE A;  3A5W A;  5IOX A;  5DAL B;  4ICY A;  5HQP A;  2VKZ G;  1AQW A;  5F06 A;  2CZ2 A;  1BJX A;  1YEX A;  1XW5 A;  1AIU A;  4PUF C;  2HI7 A;  2V6O A;  3ZVJ D;  5INY A;  1S3R A;  2CAQ A;  2H8L A;  1KBN A;  4TW5 A;  3C7M A;  4BPY A;  2A4H A;  4NMU A;  4PTS A;  1MTC A;  5DJL A;  2EFD A;  2H66 A;  3QAG A;  1EEJ A;  1XOB A;  5A4V A;  2REM A;  2HZE A;  1JZW A;  1XIY A;  4KND A;  5D73 A;  1PKW A;  5J4Y A;  4GLT A;  1DE1 A;  3HVS A;  3DYR A;  1X9W B;  1T00 A;  3BCK A;  3BCI A;  3I9V 2;  1GSQ A;  2K6V A;  3ZLP A;  4RI7 A;  2OAD A;  4L5O A;  2VO4 A;  2C0F A;  1GTA A;  4USS A;  2H1D A;  4KCA A;  1ZCP A;  4AGS A;  4EKZ A;  4Z7X A;  12GS A;  2H6Z A;  3MWH A;  1YJ6 A;  1TKD B;  4AKI A;  3GSS A;  1XWK A;  3GNJ A;  2B7K A;  3TB2 A;  3RBT A;  2PVO C;  2MBS A;  4Q5N A;  4OMV A;  4PUR A;  2XPD A;  2FNO A;  2FUG 2;  2V6K A;  2IPA A;  4MAB A;  1GNW A;  2HQT A;  4JRR A;  6GST A;  2BMX A;  3EU3 A;  1AAZ A;  3HZ4 A;  1G0T A;  5IM9 A;  3D5J A;  2O5V A;  1QUW A;  3KMO A;  2DSA A;  5GAN D;  1FHE A;  4MF6 A;  1IYI A;  4G01 A;  2PVQ A;  4FO5 A;  4BA7 A;  1EEM A;  5D9V A;  4ZB6 A;  4XRD A;  1RW1 A;  4A5P A;  4KF9 A;  3IHQ A;  5HR2 A;  1PA3 A;  2QC7 A;  1Z9H A;  3U6V A;  2F3M A;  1F37 A;  1BQ7 A;  5FT3 A;  1NW2 A;  3IXR A;  2R6K A;  4DSQ A;  3EC3 A;  1GTU A;  3G7J A;  2WVX B;  5A1N A;  1PMT A;  2A2S A;  3IK7 A;  2C0G A;  1WE0 A;  1WPI A;  5BMU A;  4K8M A;  4NV2 A;  2K18 A;  2D2Z A;  4I97 A;  4P3Y B;  2XC2 A;  1O6J A;  2HSH A;  3LSZ A;  2R0P A;  3Q18 A;  3GH9 A;  2WJU A;  1Z5Y E;  3A5I A;  1GNE A;  5B6N A;  4BVY B;  1DE2 A;  1BAY A;  4V2L A;  2PGT A;  1NSW A;  2LNS A;  3M0F A;  2C3N A;  2JL4 A;  4GSS A;  2H0H A;  3FMW A;  1UC7 A;  2WVZ A;  2LKU A;  1WWJ A;  3A2V A;  1GLP A;  2WW1 A;  2VIM A;  2YPM A;  3GTU A;  3O3T A;  4PNG A;  4HEA 2;  2N5F A;  1TRS A;  3FK8 A;  2VL9 A;  1NHY A;  2OE3 A;  3FHK A;  5ECH B;  4TR3 A;  1CQH A;  4K1F A;  4KH7 A;  1B8X A;  1FW1 A;  5H5Q A;  2X8G A;  2LJR A;  1KTE A;  4NWY A;  2JAC A;  2H75 A;  2VM1 A;  1T1V A;  3PPU A;  5D96 A;  3RPN A;  3RGB C;  1X9S B;  4MF5 A;  1XCC A;  2DBC A;  2O36 A;  3LW9 A;  3GHA A;  3EMP A;  1BYE A;  1TP9 A;  4ZL9 A;  3IOS A;  5EY6 A;  2H71 A;  4ISD A;  3VI5 A;  4MP4 A;  5AIX A;  3FW2 A;  1SYX A;  2EC4 A;  1UN2 A;  4G0I A;  2C8U A;  3DXB A;  4F03 A;  4LLR A;  5D9X A;  2QA1 A;  5DQY A;  4HZ2 A;  5ECR B;  1OE8 A;  4QQ7 A;  2B5E A;  4IJI A;  2DLX A;  2MBT A;  3KZQ A;  4HQZ A;  1EV4 A;  1QQ2 A;  5G5E A;  2P31 A;  3LG6 A;  1PSQ A;  5ENU A;  1SL0 B;  3QCP A;  2PUK C;  2IWT A;  2CA8 A;  3TKS E;  3CXG A;  4QL7 A;  1ST9 A;  4AJ7 A;  2GZY A;  5CRG A;  1VF1 A;  4G19 A;  4L0U A;  3G7I A;  3TKS C;  16GS A;  1T7P B;  4GSN A;  3KH7 A;  3CWG A;  3EMX A;  3VFI A;  4TN8 A;  1A0F A;  1A2J A;  1GSE A;  2H1L A;  3I43 A;  1I1I P;  2GT6 A;  1K0N A;  1TK5 B;  3GKK A;  3GKN A;  1X9M B;  1X5C A;  5LNK e;  1MD3 A;  1GSU A;  3C1S A;  1TW9 A;  2X49 A;  5IO0 A;  1FAA A;  3CQF A;  4IQA A;  5A5H A;  5ECL B;  1FVK A;  1OC9 B;  1AC1 A;  4HU9 A;  3TKS A;  3ISO A;  2F8A A;  1Z3E A;  2IMD A;  2IME A;  3TGZ A;  2O85 A;  5D8I A;  2G0F A;  1K0O A;  4IBP A;  4N0V A;  4I5Q A;  4ZL8 A;  2J23 A;  4POB A;  2WVX A;  1SJ6 A;  1JFU A;  4KB3 A;  2RUF A;  5JCW A;  3UBK A;  5LD0 A;  4TRX A;  1DBY A;  3GMF A;  4NHW A;  3GA4 A;  3UVT A;  2LRT A;  1BED A;  4BVY A;  1N2A A;  5DJM A;  1URM A;  2GS3 A;  3TU3 B;  5AIS A;  1TI3 A;  17GS A;  1J0F A;  2OKA A;  2EFC A;  2KP1 A;  2E7P A;  3LXT A;  4CW9 A;  1TK0 B;  1F2E A;  1K3L A;  4MF7 A;  2X8H A;  4EC0 A;  3UAP A;  1AW9 A;  1O8X A;  1K3Y A;  2CVD A;  3FZ5 A;  1ABA A;  1FG4 A;  2FA8 A;  3HVV A;  2R5G A;  5E59 A;  2TIR A;  3EU4 A;  4L8E A;  3DKS A;  2CV4 A;  4IHU A;  3GX8 A;  1F3A A; 
#chains in the Genus database with same CATH homology
 3VPQ A;  5ABR A;  2H0G A;  3QFB C;  4D73 B;  5J4U A;  2V32 A;  5IPG A;  1O73 A;  3KP9 A;  4V2M A;  5F8B A;  3EWL A;  4OO4 A;  3TOU A;  1V9W A;  3HJP A;  1YKC A;  1XXU A;  4TXO B;  2E2M A;  4LL4 B;  4WET A;  2XBQ A;  3BOA A;  1K0B A;  4O32 A;  5DCH A;  5F0G A;  2H6X A;  1EP7 A;  3VLN A;  3RDW A;  1DUG A;  3I6A A;  3SWL A;  2R0C A;  3LJR A;  1T4Y A;  3FZ4 A;  1M99 A;  1NHO A;  4N11 A;  5KN1 A;  3H93 A;  3M8N A;  1SYR A;  3KMN A;  1QK8 A;  2KHP A;  4PNF A;  3L9V A;  1ERU A;  4X4J A;  4E8E A;  5JWR B;  1VF3 A;  1M9A A;  3DVX A;  1U6T A;  1SEN A;  1X5D A;  3IC4 A;  4KDU A;  3BJ5 A;  1THO A;  3APQ A;  5AN1 A;  2IFQ A;  4MZC A;  2GQK A;  3VWV A;  2HT9 A;  3HD5 A;  4ZIL A;  2DC5 A;  4N3Z A;  2QSI A;  2TRC P;  1OC9 A;  2DML A;  1OE7 A;  4ZL7 A;  2V1M A;  2BJX A;  1HYU A;  2LJK A;  1Q98 A;  5CNW A;  4GF0 A;  2HSM B;  4AI6 A;  1EGO A;  2GQL A;  3W6G A;  4DSS B;  2F51 A;  1OAZ A;  1QFN A;  1TTZ A;  2GLR A;  1F9M A;  2JZT A;  3FZA A;  4HU7 A;  1ON4 A;  2CVK A;  1MDJ A;  1G6Y A;  1M7T A;  4ZXG A;  2LQO A;  18GS A;  5CP1 A;  1UVZ A;  1KNG A;  2NVL A;  4KW6 A;  5ELG A;  5ID2 B;  1X5E A;  2B6M A;  5H5R A;  4AJ8 A;  1B9Y C;  3GST A;  4HZ4 A;  3GH6 A;  1SD8 A;  2YV9 A;  3KH9 A;  1QXH A;  5A4U A;  2H74 A;  4JED A;  1LJR A;  4ACS A;  2CX4 A;  2M80 A;  2FCH A;  1OYJ A;  5F05 A;  4YAV A;  4AKG A;  1T3B A;  9GSS A;  3KP8 A;  5CRH A;  3Q74 A;  3A3T A;  1GLQ A;  5EVO A;  4G2E A;  1USB A;  5J5N A;  5IO2 A;  2HLS A;  3LGC A;  4X0X A;  4WBR D;  3ZFB A;  5KOX A;  2V2G A;  4K0G A;  1XWG A;  1SVO A;  3ZYW A;  4HDE A;  2ZUP A;  5JWQ B;  2VCQ A;  3KTB A;  3HXS A;  1S3C A;  2Z9S A;  4POK A;  5IIZ A;  3PGT A;  3KJY A;  3CRT A;  3GUS A;  1K0A A;  2MMN A;  2C1Y A;  4V1A p;  2L4Q A;  3WT2 A;  4QL9 A;  5C04 A;  5GST A;  1E6B A;  1YDK A;  2FWG A;  1YF1 A;  3F4R A;  3IK9 A;  4O92 A;  3GIX A;  4AKX B;  1AXD A;  2PMT A;  2N5B A;  1EV9 A;  1S3A A;  4TR1 B;  2GSR A;  1Q4J A;  4D73 A;  4PGT A;  4I2U A;  3ZML A;  3IAS 2;  2GST A;  2H19 A;  3WD6 A;  3H8Q A;  2ALB A;  3HVX A;  3PH9 A;  4TXO A;  1JZD A;  1OKD A;  2KOK A;  3KD0 A;  3H79 A;  2X64 A;  3CSI A;  1V2A A;  3HZ8 A;  2VCW A;  4LL1 B;  5J4V A;  1ML6 A;  1PN9 A;  1XBS A;  4NPB A;  2K9F A;  1XVQ A;  3WGE A;  3IRA A;  2MMO A;  2VCZ A;  3VWU A;  1PL2 A;  1S3D A;  5DCG A;  3C1R A;  1YY7 A;  1SKR B;  4OD7 A;  1EP8 A;  3UEM A;  2FA4 A;  5IMF A;  4DSR A;  4OCF A;  3UJ1 A;  5DAK B;  1THX A;  1LU4 A;  6GSV A;  4EDY A;  2GZP A;  5CAX A;  1VRS D;  2MMZ A;  2HFD A;  4TKY A;  3BD2 A;  1SK1 A;  2YV7 A;  3F6F A;  2O89 A;  5CO3 A;  4I6X A;  4ZB8 A;  4I2T A;  5DBQ A;  4G0L A;  1TK8 B;  1PGT A;  1A2M A;  2YNX A;  1PX7 A;  3ZIT A;  3GYK A;  1BX9 A;  2B3S A;  4HS1 A;  3TKQ A;  1TI1 A;  2GGT A;  2PER A;  2B1L A;  4G10 A;  5HFG A;  2A4V A;  5EPF A;  1U88 A;  5ECI B;  2HSM A;  2DKI A;  2PWJ A;  3W8J A;  4DSS A;  3OR5 A;  3KM6 A;  4Z2R A;  2AUV A;  4G0K A;  3RPP A;  3QFA C;  2JSY A;  4YKF A;  6GSU A;  4GCI A;  3UAR A;  11GS A;  1GSF A;  4GDF A;  5A5K A;  5F07 A;  3ZL5 A;  4IVF A;  5DAL A;  5H5S A;  5ID2 A;  4FIW A;  3HYP A;  4YH2 A;  1SD9 A;  3L4N A;  2I81 A;  1XVW A;  4HJ2 A;  2FY6 A;  1ILO A;  1Y1U A;  3F4T A;  4YQU A;  3J7Y k;  2RUE A;  2HSN B;  2VCV A;  3F8U A;  4QMK A;  14GS A;  3G9B A;  4XTS A;  3UIW A;  1R26 A;  1Y25 A;  4POL A;  2ZCT A;  3D21 A;  3M9K A;  2LNT A;  4Q5F A;  4OCE A;  2P0G A;  2L6D A;  5D93 A;  4FYC A;  4EO3 A;  2WS2 A;  4EUY A;  2OT3 A;  5G2Z A;  4MK3 A;  2LTK A;  2E2G A;  5B8A A;  1WIK A;  2DKH A;  3F3R A;  1YZX A;  3ED3 A;  1Y6E A;  3D4M A;  2RLI A;  4TR4 A;  2C3T A;  1FO5 A;  2F8F A;  2LEG A;  5IMC A;  2LS5 A;  4FYU A;  2CVB A;  1A24 A;  3FR6 A;  4WR5 A;  4OFN A;  2JAD A;  3VI7 A;  5CYY A;  1GUL A;  1ZOF A;  4JBB A;  4EF0 A;  1V57 A;  1SKW B;  4MDC A;  4CHS A;  3E3E A;  6GSX A;  1MDK A;  3FY7 A;  2H70 A;  1GUK A;  1SK2 A;  1EOG A;  2KUC A;  1J9B A;  4TR1 A;  5G31 A;  2EIO A;  3DIE A;  2FD3 A;  3CSJ A;  3WGD A;  2YJ7 A;  4IQ1 A;  1FOV A;  3O76 A;  5HR3 A;  1QMV A;  4G9H A;  4XIH A;  5ECO B;  1PKZ A;  5KN0 A;  1JZR A;  3RAZ A;  2WRT A;  3P8W A;  2UZ8 A;  3ZIJ A;  3HJM A;  1GSD A;  2LRC A;  1ERW A;  1QGV A;  3GL3 A;  3GN3 A;  1K3O A;  2CX3 A;  4Z2T A;  2N5A A;  4F0C A;  3ZZX A;  4MPF A;  1ZL9 A;  2I4A A;  3L9S A;  4N10 A;  2VD0 A;  2VCX A;  3KTL A;  4CY6 A;  4DVC A;  2H72 A;  2GQM A;  2WCI A;  3TKP A;  2L6C A;  2VD1 A;  4WR4 A;  2NDO A;  3LWA A;  1IYH A;  4IW9 A;  5J3R A;  2HE3 A;  5J41 A;  1Z6N A;  2P5Q A;  4LA1 A;  4K7I A;  1CQG A;  4WKW A;  3AY8 A;  3MYD A;  3D22 A;  3APS A;  1EWX A;  1E2Y A;  1J08 A;  5IMZ A;  4KSO A;  1KEB A;  3TJK A;  3QAW A;  3ME8 A;  2O8V B;  2YCD A;  1FB6 A;  2DJ1 A;  5DQS A;  4K7O A;  2DJ3 A;  4ULX A;  4RQR A;  2LST A;  4H86 A;  1WOU A;  5ELA A;  1TOF A;  3EVI A;  5ECS A;  2H1A A;  5IMA A;  4GST A;  4AKH A;  2R2J A;  3PIN A;  4NAX A;  4IGJ A;  22GS A;  2VM2 A;  4IEL A;  4XRA A;  2CQ9 A;  4ZBB A;  2J9H A;  4ML1 A;  4NXI A;  4X43 A;  3LEF A;  5AIV A;  5A4W A;  3HHV A;  4MJA A;  4O5R A;  2PPT A;  4BVX B;  5J40 A;  3E0U A;  3ZRD A;  1Z6M A;  1ZYP A;  3QDN A;  1T8E B;  2BTO T;  4MCU A;  4MNN A;  4LMW A;  1TXX A;  4F82 A;  2R37 A;  4MJB A;  1O85 A;  4MZB A;  4MJE A;  2VLT A;  2MYG A;  3A2W A;  2HRF A;  1VF2 A;  2CZ3 A;  3ZTL A;  2RM5 A;  4OFT A;  2VL3 A;  2DIY A;  1SL1 B;  1G7E A;  1XPV A;  3UBL A;  2M46 A;  2G2Q A;  4RI6 A;  1HNB A;  2ES7 A;  3RHC A;  1PRX A;  1EOH A;  1SK0 A;  1M2A A;  1GUH A;  3P90 A;  2LV3 A;  4TVE A;  3TRQ A;  8GSS A;  4IP1 A;  2V41 A;  3TJJ A;  2A2R A;  2C3Q A;  2LUS A;  2LQQ A;  1I9D A;  2WFC A;  3MNG A;  2FWF A;  2HZE B;  2O7K A;  1ERT A;  2PU9 C;  2WUL A;  2X99 A;  3GRX A;  3U5R E;  1SL2 B;  2O87 A;  2EFE A;  1ZZY A;  5L71 A;  1ZYN A;  1GSY A;  2QGV A;  2B7J A;  3F3Q A;  4DEJ A;  4EIQ A;  3GL5 A;  3L9U A;  1U3I A;  1N25 A;  4ECI A;  2EFH A;  4CDO A;  1OC3 A;  2H30 A;  4KDY A;  4ZBA A;  1B9X C;  4J2F A;  2QA2 A;  3G7Y A;  4HJM A;  2E0Q A;  3DWV A;  4J56 E;  3KCM A;  3MIX A;  1GTI A;  5D9T A;  3GV1 A;  1SJZ A;  2ON7 A;  2FWE A;  3KXO A;  3LQ7 A;  1R7H A;  1TJD A;  3TUE A;  4Z2U A;  3CBU A;  2VUP A;  3LXZ A;  4BL7 B;  3R3E A;  2YWN A;  1ZYQ B;  1A0R P;  13GS A;  2OBI A;  1Z7R A;  4XS6 A;  1O8W A;  1LBK A;  3US3 A;  1EGR A;  4K0N A;  1A8L A;  5LCZ A;  4K5S A;  3HKR A;  2RM6 A;  2R3X A;  2YAN A;  3LYP A;  4W66 A;  1FVJ A;  2HSY A;  4F9Z A;  1TRW A;  2YZH A;  1TRV A;  2UV8 G;  3HA9 A;  1XFL A;  2IIY A;  2JSZ A;  4X1U A;  1ACV A;  1GUM A;  1TXU A;  2OBK A;  2RII A;  3VUR A;  4YKG A;  3FKF A;  1X0R A;  4O5U A;  3QAV A;  2WZ9 A;  3ZVJ A;  1BG5 A;  4JU5 A;  4MLY A;  3TOT A;  4WF4 A;  3ERW A;  4K7N A;  3IPZ A;  3EE2 A;  3DRN A;  3ZFL A;  1M9B A;  4FH8 A;  2R4V A;  3IDV A;  5JWO B;  2GDR A;  5IPH A;  3FR3 A;  4KCE A;  2OAC A;  3HDC A;  4IS0 A;  3DD3 A;  4EE0 A;  2DJK A;  2C0D A;  4YQM A;  1ZGN A;  4KX4 A;  1JHB A;  1C72 A;  2C4J A;  3I69 A;  1JLW A;  3GTU B;  3GFK A;  2H01 A;  5IMD A;  3KGK A;  5G1K A;  2PN8 A;  2GSQ A;  3NIV A;  2CAI A;  4BWQ A;  4AF2 A;  3SBC A;  3Q6O A;  4L0W A;  3D6I A;  3GKX A;  3V1W A;  1A2L A;  4I8B A;  1BF5 A;  2YWI A;  2LRN A;  2DJ0 A;  3UMA A;  1HNC A;  1B48 A;  3TDG A;  3CRU A;  3LFL A;  4Q5R A;  4J57 E;  1GTB A;  5HFK A;  4EIP A;  3TRX A;  3IA1 A;  2FLS A;  2YN1 A;  4K2D A;  2IJY A;  2GZZ A;  2AAW A;  2OE1 A;  3JCM L;  2YOI A;  2X4A A;  2JZS A;  5B8B A;  2H73 A;  5IMV A;  2L57 A;  4XHM A;  3DEX A;  5KOW A;  2B1K A;  1JLV A;  2NBS A;  2B5X A;  1O81 A;  1GSS A;  4K5R A;  1B4Q A;  4MMM A;  1A23 A;  2C0E A;  4ECJ A;  3HY2 A;  3ZIV A;  3VK9 A;  2DIZ A;  5COH A;  2P5R A;  1H75 A;  4MA9 A;  1F6M C;  3MSZ A;  4N0Z A;  4YQV A;  3ME7 A;  3IV4 A;  4WF5 A;  4E68 A;  4HQS A;  4GWR A;  1YEP A;  4F2I A;  1MDI A;  1N8J A;  3WT1 A;  2EIR A;  1T4Z A;  2KLX A;  2H1B A;  3QR6 A;  4BL7 A;  2TRX A;  3BBY A;  1UA5 A;  2PBJ A;  4V2N A;  5GZZ B;  4NHZ A;  3HCZ A;  5GSS A;  3DGQ A;  3FZ9 A;  4IN0 A;  5JCU A;  2HNL A;  1DSB A;  4POM A;  4XS1 A;  1PX6 A;  3VPT A;  3NOF A;  1GWC A;  3L0H A;  2L59 A;  4V1A g;  4AJ6 A;  3H4K A;  3GUR A;  1SKS B;  1PQN A;  5AGY A;  1XWB A;  4ECC A;  2VOC A;  2EIQ A;  3QMX A;  4PQ1 A;  1YVL A;  2NPB A;  3HMJ G;  4RQX A;  3C71 A;  1NM3 A;  1W89 A;  2GT5 A;  1M2D A;  4PXO A;  2GSS A;  5CRW A;  2R0G A;  2DJ2 A;  3CTF A;  5A5H B;  4ECB A;  3S9F A;  2JZR A;  1K0C A;  3ZMK A;  1ZMA A;  3APO A;  2F9S A;  4K6X A;  5BRT A;  1R5P A;  3EPT A;  4WEY A;  3IR4 A;  1U87 A;  1A8Y A;  3EIN A;  3FYG A;  1PN0 A;  4XS4 B;  3P7X A;  4IJ3 A;  1HNA A;  5HFI A;  3ERF A;  2OE0 A;  1SVL A;  3KIJ A;  1XWA A;  1PD2 1;  4ID0 A;  4TOP A;  4PUA A;  4ZB7 A;  1EZK A;  1VGL A;  3UOM A;  1GP1 A;  1XOA A;  3A2X A;  4KSM A;  2HRK B;  1OVN A;  4OFM A;  3CTG A;  1GL8 A;  1YKA A;  1VF4 A;  2WB9 A;  3M9J A;  2L5O A;  1AUC A;  3WGX A;  2WGR A;  5IQY A;  4GQC A;  4CY8 A;  4NV5 A;  1XWC A;  3F0I A;  3IBH A;  4OO5 A;  2GVP A;  3UVH A;  2YJH A;  3N9J A;  5A34 B;  1V40 A;  1R5A A;  5DVB A;  3TJG A;  2OJL A;  1H4O A;  2I9H A;  3R2Q A;  1MD4 A;  2IN3 A;  3IAM 2;  4MJC A;  2A2P A;  3F63 A;  1R4W A;  2AJQ B;  5E4W A;  2JU5 A;  5KN2 A;  5KEJ A;  2NTO A;  3QD9 A;  3N5O A;  3K8N A;  5GAP D;  5J9B A;  2HRA A;  3WYW A;  2C80 A;  1PL1 A;  1XZO A;  4ILF A;  3E9J B;  1ERV A;  4KAE A;  3W8S A;  1FOH A;  3M3M A;  4N30 A;  4TXV A;  4F0B A;  3FEU A;  3MDK A;  2FHE A;  2IMF A;  4GTU A;  4PQI A;  2AB6 A;  1F3B A;  4GXZ A;  2L4C A;  1TU7 A;  5C00 A;  4EL1 A;  2LJA A;  1W4V A;  2B5Y A;  1RK4 A;  2K8S A;  3P2A A;  3O6T A;  5D9W A;  2IMK A;  1G7O A;  1WMJ A;  3IE3 A;  1ZYE A;  5IOW A;  2I3Y A;  4K2X A;  5DAK A;  3IC8 A;  4FQU A;  10GS A;  4KGI A;  3DVW A;  5FWG A;  4HOJ A;  3KEB A;  4FYB A;  3GX0 A;  4ZBD A;  4PX1 A;  1V98 A;  1BG1 A;  1K0M A;  4HI7 A;  2IFQ B;  1AQX A;  4MH3 A;  2CT6 A;  20GS A;  4KA0 A;  5G5F A;  1B4P A;  5DDL A;  1MEK A;  2GTU A;  5G1L A;  5HR1 A;  1V58 A;  1JZO A;  2YWM A;  4MH2 A;  3PR8 A;  4KUN A;  3QOU A;  1HD2 A;  3DML A;  1GRX A;  2HRN A;  3EUR A;  1YF0 A;  1FB0 A;  3NZN A;  4YAP A;  4ML6 A;  4XS4 A;  4MZW A;  5B7C A;  3HJO A;  3LOR A;  3M1G A;  3FRC A;  3F6D A;  4OWY A;  3L78 A;  4E8H A;  4JZQ A;  1WJK A;  4IP6 A;  2MMA A;  3F4S A;  2IMI A;  2VCT A;  4HUA A;  1M0U A;  2HSN A;  5ECN B;  2XHF A;  2FGX A;  2HRK A;  1O7U A;  5KN3 A;  3Q19 A;  2OA7 A;  2WDU A;  2HYX A;  4JR4 A;  1XW9 A;  4ZIJ A;  2HZF A;  5ECM B;  2AHE A;  1M2B A;  5EL8 A;  1U3A A;  4WBJ A;  3C8E A;  4EXJ A;  6GSY A;  1TRU A;  4TR0 A;  2VL2 C;  2VAF A;  4O7H A;  5A34 A;  3LYK A;  19GS A;  5B6M A;  3RHB A;  3TKR A;  3C73 A;  5G30 A;  2IL3 A;  4MPG A;  4ZB9 A;  4GQF A;  3CYN A;  2H6Y A;  4JE1 A;  5HR0 A;  3FR9 A;  3TRP A;  1K0D A;  2VLV A;  3MAK A;  5ECQ B;  2H76 A;  5CRD A;  4Q5Q A;  4KE3 A;  5CRE A;  2H0I A;  1I5G A;  5JCG A;  2VL2 A;  3TJB A;  2QKE A;  1OC8 A;  4IKH A;  3CSH A;  2YZU A;  3TCO A;  1WP0 A;  3TJF A;  3D4T A;  2H1G A;  2YP6 A;  3VWW A;  2X8C A;  3IHG A;  1TU8 A;  7GSS A;  4K9Z A;  4XCS A;  1WRY A;  1XW6 A;  5FHI A;  1Z7P A;  1G6W A;  2MZC A;  2YWO A;  4L5L A;  3UL3 A;  5ECK B;  2ZNM A;  1TDI A;  1RQM A;  2L5L A;  4LMV A;  2AYT A;  4O5Q A;  4RUV A;  4WXT A;  2XBI A;  1YQ1 A;  2KP2 A;  3CMI A;  1SVM A;  6GSW A;  2VLU A;  4EDZ A;  1SJI A;  3D0Z A;  4PQH A;  1HQO A;  2ON5 A;  3J7Y b;  3F9U A;  3ERG A;  2DMM A;  4GRF A;  2HXK A;  4BWS A;  3QPM A;  5J9C A;  1AQV A;  3H1N A;  1GH2 A;  5ECP B;  1OKT A;  5A1N B;  2XPE A;  6GSS A;  3EYT A;  5BMU B;  4JR6 A;  4EVM A;  4BVX A;  3VWX A;  2AV4 A;  3GKM A;  2M72 A;  2DJJ A;  2I1U A;  2K8V A;  5J47 A;  2FWH A;  4KDX A;  1SU9 A;  3ZRE A;  3A5W A;  5IOX A;  5DAL B;  4ICY A;  5HQP A;  2VKZ G;  1AQW A;  5F06 A;  2CZ2 A;  1BJX A;  1YEX A;  1XW5 A;  1AIU A;  4PUF C;  2HI7 A;  2V6O A;  3ZVJ D;  5INY A;  2CAQ A;  2H8L A;  1KBN A;  4TW5 A;  3C7M A;  4BPY A;  2A4H A;  4NMU A;  4PTS A;  1MTC A;  5DJL A;  2EFD A;  2H66 A;  3QAG A;  1EEJ A;  1XOB A;  5A4V A;  2REM A;  2HZE A;  1JZW A;  1XIY A;  4KND A;  5D73 A;  1PKW A;  5J4Y A;  4GLT A;  1DE1 A;  3HVS A;  3DYR A;  1X9W B;  1T00 A;  3BCK A;  3BCI A;  3I9V 2;  1GSQ A;  2K6V A;  3ZLP A;  4RI7 A;  2OAD A;  4L5O A;  2VO4 A;  2C0F A;  1GTA A;  4USS A;  2H1D A;  4KCA A;  1ZCP A;  4AGS A;  4EKZ A;  4Z7X A;  12GS A;  2H6Z A;  3MWH A;  1YJ6 A;  1TKD B;  4AKI A;  3GSS A;  1XWK A;  3GNJ A;  2B7K A;  3TB2 A;  3RBT A;  2PVO C;  2MBS A;  4Q5N A;  4OMV A;  4PUR A;  2XPD A;  2FNO A;  2FUG 2;  2V6K A;  2IPA A;  4MAB A;  1GNW A;  2HQT A;  4JRR A;  6GST A;  2BMX A;  3EU3 A;  1AAZ A;  3HZ4 A;  1G0T A;  5IM9 A;  3D5J A;  2O5V A;  1QUW A;  3KMO A;  2DSA A;  5GAN D;  1FHE A;  4MF6 A;  1IYI A;  4G01 A;  2PVQ A;  4FO5 A;  4BA7 A;  1EEM A;  5D9V A;  4ZB6 A;  4XRD A;  1RW1 A;  4A5P A;  4KF9 A;  3IHQ A;  5HR2 A;  1PA3 A;  2QC7 A;  1Z9H A;  3U6V A;  2F3M A;  1F37 A;  1BQ7 A;  5FT3 A;  1NW2 A;  3IXR A;  2R6K A;  4DSQ A;  3EC3 A;  1GTU A;  3G7J A;  5A1N A;  1PMT A;  2A2S A;  3IK7 A;  2C0G A;  1WE0 A;  1WPI A;  5BMU A;  4K8M A;  4NV2 A;  2K18 A;  2D2Z A;  4I97 A;  4P3Y B;  2XC2 A;  1O6J A;  2HSH A;  3LSZ A;  2R0P A;  3Q18 A;  3GH9 A;  2WJU A;  1Z5Y E;  3A5I A;  1GNE A;  5B6N A;  4BVY B;  1DE2 A;  1BAY A;  4V2L A;  2PGT A;  1NSW A;  2LNS A;  3M0F A;  2C3N A;  2JL4 A;  4GSS A;  2H0H A;  3FMW A;  1UC7 A;  2LKU A;  1WWJ A;  3A2V A;  1GLP A;  2VIM A;  2YPM A;  3GTU A;  3O3T A;  4PNG A;  4HEA 2;  2N5F A;  1TRS A;  3FK8 A;  2VL9 A;  1NHY A;  2OE3 A;  3FHK A;  5ECH B;  4TR3 A;  1CQH A;  4K1F A;  4KH7 A;  1B8X A;  1FW1 A;  5H5Q A;  2X8G A;  2LJR A;  1KTE A;  4NWY A;  2JAC A;  2H75 A;  2VM1 A;  1T1V A;  3PPU A;  5D96 A;  3RPN A;  1X9S B;  4MF5 A;  1XCC A;  2DBC A;  3LW9 A;  3GHA A;  3EMP A;  1BYE A;  1TP9 A;  4ZL9 A;  3IOS A;  5EY6 A;  2H71 A;  4ISD A;  3VI5 A;  4MP4 A;  5AIX A;  3FW2 A;  1SYX A;  2EC4 A;  1UN2 A;  4G0I A;  2C8U A;  3DXB A;  4F03 A;  4LLR A;  5D9X A;  2QA1 A;  5DQY A;  4HZ2 A;  5ECR B;  1OE8 A;  4QQ7 A;  2B5E A;  4IJI A;  2DLX A;  2MBT A;  3KZQ A;  4HQZ A;  1EV4 A;  1QQ2 A;  5G5E A;  2P31 A;  3LG6 A;  1PSQ A;  5ENU A;  1SL0 B;  3QCP A;  2PUK C;  2IWT A;  2CA8 A;  3TKS E;  3CXG A;  4QL7 A;  1ST9 A;  4AJ7 A;  2GZY A;  5CRG A;  1VF1 A;  4G19 A;  4L0U A;  3G7I A;  3TKS C;  16GS A;  1T7P B;  4GSN A;  3KH7 A;  3CWG A;  3EMX A;  3VFI A;  4TN8 A;  1A0F A;  1A2J A;  1GSE A;  2H1L A;  3I43 A;  2GT6 A;  1K0N A;  1TK5 B;  3GKK A;  3GKN A;  1X9M B;  1X5C A;  5LNK e;  1MD3 A;  1GSU A;  3C1S A;  1TW9 A;  2X49 A;  5IO0 A;  1FAA A;  4IQA A;  5A5H A;  5ECL B;  1FVK A;  1OC9 B;  1AC1 A;  4HU9 A;  3TKS A;  3ISO A;  2F8A A;  1Z3E A;  2IMD A;  2IME A;  3TGZ A;  2O85 A;  5D8I A;  2G0F A;  1K0O A;  4IBP A;  4N0V A;  4I5Q A;  4ZL8 A;  2J23 A;  4POB A;  1SJ6 A;  1JFU A;  4KB3 A;  2RUF A;  5JCW A;  3UBK A;  5LD0 A;  4TRX A;  1DBY A;  3GMF A;  4NHW A;  3GA4 A;  3UVT A;  2LRT A;  1BED A;  4BVY A;  1N2A A;  5DJM A;  1URM A;  2GS3 A;  3TU3 B;  5AIS A;  1TI3 A;  17GS A;  1J0F A;  2OKA A;  2EFC A;  2KP1 A;  2E7P A;  3LXT A;  4CW9 A;  1TK0 B;  1F2E A;  1K3L A;  4MF7 A;  2X8H A;  4EC0 A;  3UAP A;  1AW9 A;  1O8X A;  1K3Y A;  2CVD A;  3FZ5 A;  1ABA A;  1FG4 A;  2FA8 A;  3HVV A;  2R5G A;  5E59 A;  2TIR A;  3EU4 A;  4L8E A;  3DKS A;  2CV4 A;  4IHU A;  3GX8 A;  1F3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...