2F3NA

Crystal structure of the native shank sam domain.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
MLQLWSKFDVGDWLESIHLGEHRDRFEDHEIEGAHLPALTKEDFVELGVTRVGHRENIERALRQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An architectural framework that may lie at the core of the postsynaptic density.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
molecule keywords SH3 and multiple ankyrin repeat domains 3
total genus 23
structure length 65
sequence length 65
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2f3nA00
2QB0B 1SV0A 1WWVA 1B0XA 2EAPA 3IDWA 5L1MA 2GLEA 4RQNA 3BQ7A 2K4PA 1SXDA 1JI7A 2EANA 2E8MA 5KNIA 1LKYB 1PK1A 2KE7A 4PZNA 2D3DA 2YTUA 3TACB 5J8YA 3KKAA 2DKZA 2F8KA 2E8NA 2Y9UA 4NL9C 1SXEA 2E8OA 1X66A 2K60A 1RG6A 2KIVA 4RQMA 1KW4A 2EAMA 2F44A 2L5YA 1LKYA 2QARA 1Z1VA 2KSOA 5F3XB 1OW5A 2QB1A 1F0MA 4IS7A 3KKAC 1B4FA 1UQVA 2QB0A 4NL9A 3SENA 4PZOA 1PK3A 1X40A 2JV3A 2LMRA 3BS5A 5J8YC 2FE9A 2KSOB 3K1RB 1PK1B 1SV4A 2E8PA 2B6GA 1WWUA 3SEIA 4NJ8A 1SV0C 3TADC 5JRTA 1COKA 2ESEA 2EAOA 2ES6A 1UCVA 3BS7A 2QKQA 3HILA 5JTIA 1OXJA 1V85A 2DL0A 1SGGA 3BS5B 2DKXA 3TADA 2KMDA 5JU5A 2KG5A 2D8CA 2QARB 2Y9TA 1DXSA 1V38A 4MHVA 2F3NA 3H8MA 2LPEA 1X9XA
chains in the Genus database with same CATH superfamily
2P6UA 2EZYA 4O3NA 2P66A 2VA2A 5CJ7A 1K1SA 4DL4A 1RXVA 2Q0ZX 3RJJA 3FYHA 3MGVA 5KFXA 2KICA 3ONNA 3GIMA 1CUKA 1TKDA 4EELA 1S0MA 7ICKA 1QSYA 4J9KA 1NK8A 1WCNA 4JK1A 5KNIA 5J0OA 9ICTA 3E0FA 3GU3A 4Y2SA 2KE7A 3UXNA 2GH1A 3QUTA 2A1AA 2NYVA 3R9KA 1BGXT 3QU2A 4R64A 4M9GA 4NLBA 8ICBA 4UBCA 2ZG6A 3Q8SB 3M9MB 4DF8A 1PUZA 5AI5A 1SKRA 9ICCA 3H8JA 3RJGA 4DFJA 3V6JA 4XRHA 4Q8FA 2NV3A 4MFFA 2YY6A 8ICKA 4BDPA 2DPJA 3GIKA 2K8CB 4NL9A 3NVYA 1X40A 2E3TA 1S0VA 5E79U 2KSOB 8ICPA 3AMZA 3C5GA 5KFEA 3M8RA 4GXIA 4DFMA 4RNNA 2ZIUA 4NM1A 3S6JA 3F2CA 1L7PA 1F44A 1XSLA 5DB6A 4ELVA 1JROA 3OSNA 5J2JA 4QZAA 1ZETA 1L3UA 9ICWA 4EYIB 1SZHA 4PGYA 4ED0A 4C0ZA 3GILA 3LK9A 1CRXA 2MUTB 2W7PA 2F8LA 1M6YA 2W3SA 1NJWA 4O5KA 3L3FX 4PPXA 1JXEA 4RNMA 1WCLA 9ICBA 3TKAA 4DSIA 1TV9A 2EANA 5KFJA 4AYBC 4KITB 3HW8A 5BOMA 1QCKA 3G6YA 1K1QA 2HW3A 1ZQCA 4R63A 5J2DA 2NO4A 2PKEA 1Z4OA 1NNLA 4DQSA 2KHVA 1ZQWA 2HVIA 4DSFA 9ICKA 2A3VA 1HUZA 5AI9A 5KG7A 8ICCA 4OCZA 4F71A 4EYHB 2P6RA 1KEJA 4JV2A 4DFPA 5FP0A 2BDPA 4ELTA 1B43A 3N4MB 3WK7A 2AQ4A 2IBKA 3N97B 4NJ8A 1SV0C 1K5OA 5JRTA 2C28A 2DBYA 2ZIWB 3NRZA 3WK5A 5DB8A 4QWEA 3FM9A 3PY8A 1JN3A 1KLNA 1U49A 4KMOB 3U26A 8ICIA 2FPLA 1SWWA 3PX0A 4QZCA 4ACOA 5ALVA 3F2DA 4YXMA 1L8LA 4M9NA 4DQQA 4JWMA 2EH9A 1L7OA 7ICNA 1ZQMA 1YZ7A 1BNOA 4ECZA 1GO3F 5J0PA 2Y1JA 2F76X 2HHWA 4BXOB 3NGDA 1X6IA 9ICAA 2WF7A 4BJQA 5EWEA 1BPXA 3C2KA 4UBBA 2UVVA 3ZDDA 1ZQGA 4GLXA 9ICQA 5HR6A 4AP9A 4M04A 4K4GA 2EDUA 2KVSA 5K4LA 4I2AA 4C7ZA 1XSNA 3HX0A 5CA7A 4QZDA 2FMPA 5KAIU 2H5XA 1RG6A 2IOFK 1L7NA 4R8UA 3HWTA 2KFZA 2HBLA 3B9JA 1NKEA 3WKBA 5F3XB 3PMLA 5KG2A 1KRPA 3WKDA 5J0RA 5B66U 4ELUA 3WK6A 2W9CB 2ZXHA 3RR7A 3WK4A 2M0NA 5DG7A 2ZIVA 3TFRA 1IM4A 5KFZA 1L3TA 5AKKA 7ICJA 1N2XA 4O3QA 4PH5A 4ED3A 3DEEA 3HKZF 4RQ4A 3MBYA 3QYPA 4IRKA 8ICLA 3IHQB 3RR8A 3RFAA 4YR3A 4MFCA 1SL1A 4CF5A 2KIWA 1TK8A 4UB3A 1A77A 4RQ8A 1PVPA 2LHTA 3BDPA 2HBJA 2W9BA 3D2QA 5J2FA 3SV3A 2W9AA 3WKEA 1XNSA 3RBEA 1S0OA 2BKEA 2VKQA 2W03A 4F4XA 3SR6A 3KHGA 2VA8A 5KFKA 1UHUA 1B0XA 4QJFB 2DWQA 3HJEA 2WHEA 5HHIA 2HI0A 1SIJA 2HHUA 4DL6A 5AM0A 1VDVA 3ISCA 3OPXA 4FO6A 1HEKA 2B0CA 4I2JA 5F9NA 1NJZA 2F77X 2OEHA 9ICSA 3EUB2 3HRDD 4Y2UA 2NRVA 4TQRA 5AKZA 4UW9A 4QZ9A 1S0NA 2EAMA 1NKBA 3AN1A 2L5YA 5AK5A 9ICJA 4K4HA 1S8OA 1OW5A 5DB7A 5ALPA 2OM6A 2Q4TA 2ZTDA 4IS7A 2BQUA 3T5KA 4QWBA 2C2EA 9ICOA 2R8JA 3ISBA 4YQWA 4PZOA 4QIWF 1X9MA 3C21A 2CPRA 4QWDA 3ZDCA 4PJ0U 2PMZC 3UMGA 1RYUA 5ALIA 4M6WA 4J9QA 7ICFA 2KZMA 5C0YA 2G09A 3NTUA 1RYSA 2WAQC 4GXKA 4KX5A 2WTFA 1WYGA 3H0MB 4KLSA 3C29A 2K4EA 3PSFA 1WG8A 1OXJA 3SYZA 4DWIA 4NLCA 1L3VA 1PVRA 4R8UB 4P0PB 4KN7A 3N7PD 1T3NA 5EE9A 5JU5A 3L4PA 1J2MA 3SZ2A 4P4PA 4FBUA 4KMUA 4QZIA 4ECSA 4KLOA 4QNLA 5GTHU 2XICA 3SMVA 2GOLA 2ZJ8A 3SAFA 5KFOA 9ICRA 4RPYA 1ZQAA 2KFNA 3C1ZA 3IRUA 4DQRA 4IR1A 4ED6A 3QXGA 9ICHA 4MEYA 2JEJA 4P4MA 4OJ5A 3IN5A 4I2IA 4Q45A 2IA6A 3I76A 2HOFA 4RUCA 5KG1A 4B9SA 5J0XA 2D6FC 3B0XA 1X66A 4EBEA 4O5CA 4C80A 2G0AA 4I2EA 4RQMA 2QLTA 1NZBA 4QIWC 3GIJA 3QUCA 3OHBA 2KSOA 2N1RA 3QU4A 5J0WA 2ISOA 3H8SA 2QB1A 2BCUA 4C4TA 5IINA 2P35A 1MA7A 5DKWA 5J2EA 4IR9A 4GC6A 3SENA 1JUDA 4ED7A 9ICEA 4KLLA 3IG8A 4Y2QA 2DQNB 3MABA 2BZFA 4ECTA 5DGAA 2NO5A 4GFJA 2VJ5A 3QX7A 2WFAA 3TAPA 3KHLA 5AKLA 2IMWP 5KG6A 2MRLA 4US8A 3QEBZ 3NS1A 4CF4A 1V85A 4KLEA 4C4RA 5JUMA 2KZZA 2ZXIA 5A0LA 4PHEA 3RJIA 2XCAA 3AL0B 5ALDA 5AM5A 2BR0A 9ICNA 2KG5A 1XU4A 3N7RC 2XC9A 2AQ0A 4QZ8A 2G5HB 2YMPA 5KG5A 1N60A 2I1QA 3NVWA 3LVVA 5J2CA 2BPCA 2E1EA 4UB2A 4UB6U 2QB0B 2KV2A 2FLLA 1TK5A 3K75D 2DFLA 4DOAA 7ICVA 4UARA 2E5SA 5G5GA 2J6UA 2J6TA 2MSNA 2EZXA 1ZQKA 1KDHA 2E1FA 1C7YA 2D3DA 2F8KA 4MEXA 1ZQIA 1ZRMA 1KW4A 2YMQA 1Z1BA 2KKPA 5IIJA 1L8OA 2F1IA 1QLNA 2ZJAA 2IHMA 2XCPA 4ECXA 3KKAC 2W9BB 1ZYQA 1UPHA 5AKJA 4QW9A 1MSWD 2YB1A 1COOA 1ZQVA 5KTQA 4FZNA 4DO9A 5J8YC 1S9FA 1IV8A 3MDAA 5HR7A 5ALSA 3PO5A 4IRDA 2OYYA 4J03A 4YN4A 1L5UA 2K4IA 3RJEA 4I28A 2KEYA 1AROP 2A1JB 4TQSA 2OXOA 2HMXA 3V72A 5HNKA 4Y2XA 4QZBA 5AK3A 3V6HA 3V6KA 2JH1A 3MFHA 4I2DA 3RRGA 4B9TA 1T7PA 4NXZA 2KNJA 4UAZA 3K4GA 5BPCA 2LPEA 5ALMA 1SB3C 5HP4A 4M2YA 4EEYA 7ICUA 3BZKA 4UAUA 1ZD3A 2GLEA 3AQFA 1SWVA 3ZDBA 4B9MA 1TAMA 2ZUCA 5C5JA 2E8MA 5AKIA 3TQ1A 1LV5A 3RB4A 1BPYA 1S77D 7ICRA 4KX3A 2KKVA 5AI4A 1U47A 2BPFA 2KHQA 4F8RA 5KT7A 1JRPA 5J8YA 2KZ3A 2K4HA 4RQ6A 4LZGA 5KFVA 4U6PA 4JB3A 3UXOA 4OJ6A 2W04A 1DK3A 4PGQA 4YFKA 2JR5A 4CRXA 2QARA 2VJ4A 5KFIA 5AHXA 1KFDA 1MC8A 4UAVA 3KZXA 4OO1J 2YX8A 1XC9A 5GTIU 5T14A 1S97A 3LVWA 5KFYA 1L3SA 4LJXA 3VC8A 4B9UA 1PK3A 2JV3A 3Q8LA 3PZPA 4J9RA 3H4DA 3DV9A 1JALA 3QE9Y 4YG2A 1ZD5A 4GXJA 7ICLA 4R65A 3CNHA 4O3MA 3T3FA 3EPIA 3VCBA 4OD0A 1TK0A 2KJ5A 3BJYA 8ICRA 5CRXA 5D4BA 4ZOHC 2HSZA 2I5HA 1YZ6A 4EX7A 1SGGA 3Q8QB 5DLGA 9ICXA 7ICPA 4PL2A 1J2NA 2HOIA 2Y9TA 2RQ5A 5AM2A 3PW7A 1VLBA 5HMLA 4UATA 4J9SA 2AH5A 1NJYA 4KN4A 5ALRA 1WWVA 4G3IA 4ECQA 1BPBA 5ALLA 3AEVA 3F53A 3AQEA 1SXDA 1X9WA 3Q8RB 4QZHA 4ECRA 4TURA 4NLKA 4JMUA 5HHHA 1QQ5A 1QSLA 4FS2A 1RM6C 1XS9D 3TACB 4CDGA 5L1JA 3IP4B 3PMNA 9ICIA 5L1LA 4P0QB 9ICLA 3SD7A 4I29A 1U9LA 3RTVA 1S76D 4M47A 1VJ5A 2V4RA 4DS4A 1RDFA 3ETRA 3TARA 4J9LA 2F2AB 3ZDEA 1Z19A 1TAUA 1LVHA 3MFIA 4M9JA 3OJSA 1UQVA 3WU2U 5AKXA 2NRWA 4F5RA 2DUYA 4Y2RA 4BX9C 3UQ0A 2B6GA 1ZJNA 2BGWA 2XGQA 4YR0A 1JX4A 2BQRA 4QZGA 3PV8A 3ALRA 3LYSA 1KTQA 3FC4A 3NASA 4Q8EA 5J2AA 3M9OB 4DLEA 1BNPA 2CRXA 5EWGA 1A76A 4M9LA 5DQHA 5KG4A 1IIPA 5KFTA 2MU2A 2ZIXA 5J0YA 1MQ2A 2AGOA 4WJ3B 4FE3A 9ICVA 3JPOA 2GWSA 5DDYA 7ICSA 4C8MA 3RB3A 1Q8KA 4RT3A 4UB4A 2IHNA 1RZTA 1ZQPA 1ECWA 4F91B 4BUGA 2EZZA 4NLGA 5ALXA 2FLNA 3ETLA 2BHNA 5L1MA 5KG3A 2ALZA 1FIQA 4RUAA 4DS5A 2LM1A 1DOQA 4XQ8A 2YMMA 4JUZA 2W8LA 2WB1F 2KD1A 5ALHA 5IIIA 4B6JA 1P7DA 2Y9UA 3KHRA 3PR4A 3GV5B 4DFKA 3C2MA 1N5XA 1AQ6A 1ZQ1C 3GIIA 1N62A 4ECWA 5KT6A 3HP6A 4NLNA 4I27A 8ICXA 4DL3A 8ICNA 1Z1VA 3JPNA 3Q8MA 4US9A 1RYRA 1RXWA 2AGPA 4BXOA 3UXPA 2V4QA 3H4BA 3BQTA 4QZFA 4UASA 3M6KA 9ICFA 2BCRA 5KT2A 3UM9A 4ED1A 2RDIA 4PGXA 3CYMA 4Y2JA 4QWAA 4C8LA 1KFSA 8ICZA 1T8EA 3GV7B 3QUBA 2VIXA 3PR5B 3EPGA 3A0BU 5DGBA 4J9MA 3BS7A 3G6VA 4CE6A 8ICHA 2ZIUB 3B0YA 5J2BA 1BPEA 3KOOA 1EXNA 3QUQA 2XGPA 4KLGA 2KJ8A 2YN4A 4DCCA 1DXSA 3KHHA 2I9GA 3D2NA 1FEZA 2FI1A 1A6SA 3JPQA 1X9XA 4EEKA 2NRTA 3PSIA 3QNMA 3NUQA 2ZUBA 4C8NA 1NK6A 3TFSA 3CW2C 4O3OA 2WF9A 1MN8A 5IILA 3MDCA 2PI5A 4GIBA 4KLQA 4P0PA 5IIMA 1PK1A 1URJA 9ICUA 5ALNA 3OTQA 4B9NA 2PI4A 3QZ7A 1BVSA 4XUSA 1Q3VA 4YR2A 2JXJA 2O6KA 4YMOA 2UVRA 3GDXA 3IV6A 4F4KA 5EWFA 1JMSA 4YD1A 4HYKA 1NK7A 5AIAA 1NOMA 4NWIA 4U7CA 2JEGA 1D8YA 4EZ6A 1F0MA 4CF3A 1N63A 2J6SA 1ZJMA 1KBUA 2BQ3A 3EYZA 7ICEA 2PFOA 2IOHA 4Q44A 1WUDA 2R8KA 3PSPA 2XY7A 1Q3UA 4EZ9A 3BS5A 1V9PA 5AM3A 1QQ7A 3K1RB 3RAXA 2YQEA 3RBDA 1PK1B 1ZQYA 4BWMA 1WWUA 4JV0A 2Z7JA 2VA3A 2HCFA 1Q46A 2EAOA 7ICQA 1O08A 4F5QA 3RJKA 5CHGA 4DL5A 5DLFA 2DL0A 1XWLA 4KLMA 2KN7A 1ZXIA 4X5VA 3RRHA 3C5FA 3E2EA 2UVWA 3N7SC 5DQIA 4RT2A 1NK9A 4KTQA 2XI9A 1XO0A 4IL6U 1FO4A 2VANA 4OJPA 2KP7A 2DGZA 3RJFA 2LYHA 5KFUA 2MAXA 5F9LA 2NRXA 3RB0A 2C22A 2IOFA 4DEZA 4F50A 1TVAA 1DRGA 2W7OA 4LZDA 5KFHA 4ECVA 5ALEA 2ZUDA 1MQ3A 5KT3A 2WB1C 2WAQF 2RDJA 1TFRA 8ICTA 4NLZA 3PX4A 2WF5A 5KFQA 3QU9A 4FZLA 3H8WA 5KFWA 4PHPA 3KKAA 2DKZA 2G08A 5KFLA 8ICJA 2HOQA 4NL9C 2JHDA 1Z4NA 4JV1A 3JPTA 4YVZA 2HHVA 3NVVA 2JZBA 3F2BA 2JZBB 1X6JA 4QW8A 3WKAA 3MR3A 1FFVA 2JEFA 3PW4A 2LM4A 5TZVA 5BOLA 3BQ0A 1NK0A 4UAYA 2JRZA 3ORYA 5J0TA 5DBAA 4Z6CA 5KT5A 2R8HA 8ICQA 1NKCA 3RH4A 3LWLA 3UQ2A 3H0RB 5ALWA 5ALJA 3SV4A 5CR0A 4F2RA 8ICAA 1ZQUA 1D9FA 5J2KA 4YMMA 3TADC 5DG8A 2C2RA 3ICXA 5L9XA 1COKA 5KT4A 2ISPA 4Z6DA 5CP2A 3D6JA 5AKGA 4QZEA 1UA0A 5G5HA 2MUTA 2QKQA 3HILA 1SKSA 1NI3A 4R66A 2FMQA 8ICYA 2DKXA 4KLFA 5KFNA 5DDMA 5DBBA 3RF9A 4RU9A 4F4WA 4QWCA 3AUOA 3M8SA 4C4SA 5EOZA 2CN1A 2QARB 4C8KA 1RQNA 1ZQEA 2EQYA 1V38A 3MGIA 3PW2A 3BQ1A 4C7YA 3EW9A 5KL8B 3LDAA 3Q8KA 1DK2A 3C1YA 2AHOB 4DSJA 3ED5A 2W43A 4Z6FA 4OJOA 4IC9A 3L5KA 5AIBA 2MA1A 2OCEA 4DQIA 4ECYA 2M9NA 3GQCA 3BQ7A 4G9BA 4JWNA 4HAIA 1JI7A 4YD2A 5AK4A 5ALZA 3ZDAA 9ICMA 4IQWA 4PHDA 3LWMA 3KZIU 4J9PA 1RPLA 3D2SA 2H3VA 2JEIA 4F2SA 4FZMA 5DBCA 4F92B 5KFCA 5H2FU 4MFAA 3MR6A 5KFPA 3Q8PB 5KFDA 3K1ZA 1HUOA 2B21A 2CXYA 2F44A 8ICMA 3EWAA 4I2BA 1Z00B 4F4YA 1U45A 1L7MA 4O3RA 2BDUA 1LB2B 3RJHA 4O3SA 1KFTA 1DGSA 8ICSA 3O0FA 1B4FA 5KL1B 5DG9A 1CEZA 5KG0A 5IIOA 3IG5A 2ASDA 8ICWA 5AI0A 1IXRA 4A8EA 2C2DA 1DGJA 2DF4B 3PNCA 3MR2A 9ICPA 2E8PA 3QZ8A 4CNQA 3KTQA 1QH9A 3RH6A 3F5AA 5AKHA 1S10A 3RAQA 4YP3A 2R8IA 4F5NA 4P4OA 1S5LU 4DFDA 3THVA 2ESEA 4KLTA 4TUQA 5AICA 5JTIA 1RQLA 3CP8A 1SL2A 3EZ5A 3HT3A 3T79A 1ZQSA 4ED2A 2JH7A 2BCSA 4DOCA 4KLHA 3H8MA 7ICOA 3AU6A 4KLUA 1XSPA 5D46A 4YCXA 5J2IA 3V7KA 3WK8A 1O03A 2HHQA 1PZNA 2EAPA 4RZRA 7ICTA 2ODGA 3DDHA 4F72A 3UMCA 4DF4A 2Y1IA 5EE0A 3PSTA 4B9LA 3GV8B 4I2HA 3M6ZA 7ICGA 4TUSA 2H3ZA 2H3IA 1D9DA 1IG6A 4NV0A 3FAHA 2ASLA 5J29A 4FBTA 2FPMA 3FDSA 2XVTA 1ZRNA 4RPXA 2K8AA 1CI4A 4J9OA 4Q43A 3OSPA 4UAWA 2W9MA 2V9WA 2HHTA 2PXIA 5IIKA 2KOBA 3I28A 4FFDA 1N56A 4K4IA 1SZPA 1BPZA 1B22A 1QTMA 4ICAA 2OH2A 3PVXA 4NM2A 2KTQA 4RPZA 3SQIA 3QEAZ 3PO4A 1SV4A 2FMSA 3SI8A 2AJQA 3NRWA 1NZPA 4TUPA 4M9HA 4UB8U 5B5EU 3T5LA 1UCVA 1ZQHA 4RQ3A 1T4GA 1HIWA 5J0QA 2ZJ5A 2YB4A 8ICEA 3M7DA 1ZD2P 2KMDA 2R18A 4DSKA 1X2IA 5EE3A 4LVSA 1Y88A 1ZQNA 4F5PA 2W55A 4KLIA 5J0SA 4IQTA 1KKXA 5AI8A 4Y2VA 5CB1A 5KFRA 1XO1A 7ICIA 3KFUF 4KLDA 4DSEA 2KJ9A 3C28A 1ZQTA 4Y2TA 3M1YA 4DLGA 2K89A 4UQGA 4J9NA 1LKYB 1ZQLA 5ALKA 1L6NA 2FPKA 2E8NA 2LYAA 3M9NB 1C20A 1SXEA 2K8BB 1D8BA 2BCVA 2WF8A 3GFKB 5KFBA 2KIVA 3HKZC 1HJPA 2OHFA 4UB1A 3ZI4A 1LKYA 3QU5A 4PL1A 3QU7A 2BCQA 3UPQA 1F5SA 2G5IB 1YT3A 3ZD8A 1FFUA 5KFMA 5ALUA 5L1IA 4BGDA 1SL0A 2QB0A 2RLTA 1OUQA 3KD3A 1D8LA 8ICFA 3PW0A 3TI0A 2G06A 5ALYA 4FS1A 5AK6A 3H40A 2ZIWA 4UB5A 2ZIVB 3WKCA 2AGQA 4RQ5A 2HHXA 2KVCA 2FJ6A 2HBMA 1KSPA 4RQ1A 2W9CA 4MF2A 2H3QA 2DPIA 3BS5B 4EBCA 4DQPA 1KN5A 3H0LB 1A0PA 2D8CA 5D49A 3SAGA 3KBBA 2ASJA 1U48A 5CWRA 5EE1A 1Z3EB 2LKYA 1BPDA 1T94A 5KFGA 2LBOA 1X9SA 8ICGA 4PHAA 5L1KA 3ISDA 3IDWA 5ALOA 3TANA 4XA5A 2JMGA 4RQNA 2W54A 4O3PA 2K4PA 4IRCA 4F5OA 8ICVA 2PFQA 5AI6A 5J2GA 4ZH4A 5J0UA 1UT5A 1UA1A 4RQ0A 4O5EA 2YTUA 2A19A 2HBKA 3A0HU 2GO7A 2PFPA 2R8GA 2HVHA 1ZQJA 2ATLA 1N5WA 1ZOLA 3OJUA 2LYBA 3UMBA 2XO7A 2NRZA 4OJLA 7ICHA 1KQQA 1N61A 2Y0SC 3PW5A 7ICMA 2OWOA 3ZD9A 3RH5A 5DQGA 4ECUA 2G07A 4CCHA 2RRDA 3CRXA 3C23A 2KK0A 4MF8A 2XIDA 4Y2PA 1PVQA 1ZD4A 3J81j 2Y0SF 2LMRA 2FE9A 4RNOA 4RQ2A 4I2GA 2XY5A 9ICGA 5KFFA 3SEIA 2FDRA 4YMNA 2YMLA 2UVUA 1ED1A 1JXLA 4IQVA 1JIHA 4AYBF 4DL7A 4KLJA 1ZQRA 3HPOA 5KAFU 2ES6A 4O9MA 5AKYA 2PMZF 3IM1A 4EBDA 1SKWA 1N48A 2FLPA 4RQ7A 3T5JA 1ZQXA 3V7JA 3G6XA 3AU2A 2HDOA 5ALGA 1UT8A 4F93B 4YXJA 2WF6A 3PX6A 3BQ2A 3N28A 2H3FA 3H7IA 4BWJA 4O0IA 2ZTCA 4GC7A 1QQ6A 4M0AA 3JPRA 3WK9A 3F5EA 4ED8A 1SV0A 2XY6A 2RHFA 1TAQA 1V97A 4DL2A 2PFNA 3JPPA 1NK4A 1H38A 2ZTEA 4M6WB 2F1HA 1ZQBA 4USAA 4PZNA 3T5HA 4C8OA 4F4ZA 2HHSA 2RP5A 4F3OA 8ICOA 2A1JA 3I1YA 1ZQQA 4P2HA 1TE2A 2AXTU 2E8OA 2ZIXB 5KFSA 3E58A 2K60A 4IQUA 4EX6A 2LI6A 5TISU 2AU0A 1NJXA 5ALTA 2W8KA 4DSLA 1Z00A 5KFAA 2JGAA 4EENA 3V7LA 5AM4A 8ICUA 5ALQA 4NY8A 3AM9A 5HMMA 3OGUA 2BPGA 2I6XA 3NVZA 5AM1A 1ZQZA 5ALFA 1X42A 3JPSA 3GZFA 2W3RA 4B9VA 4E0DA 1T3QA 3BZCA 1NK5A 5J2HA 4DOBA 1J97A 2W11A 3TAQA 3SAHA 3C2LA 1ZQFA 4Y2YA 1QSSA 3MGHA 4I2FA 3MR5A 4P0QA 4I2CA 3TADA 5DB9A 4Z6EA 5CEHA 3OHAA 1ZQOA 1KL9A 1ZQDA 5AKEA 3MC1A 4CGZA 3RB6A 4MHVA 2F1JA 2F3NA 1U4BA
chains in the Genus database with same CATH topology
2QB0B 1SV0A 1WWVA 1B0XA 2EAPA 3IDWA 5L1MA 2GLEA 4RQNA 3BQ7A 2K4PA 1SXDA 1JI7A 2EANA 2E8MA 5KNIA 1LKYB 1PK1A 2KE7A 4PZNA 2D3DA 2YTUA 3TACB 5J8YA 3KKAA 2DKZA 2F8KA 2E8NA 2Y9UA 4NL9C 1SXEA 2E8OA 1X66A 2K60A 1RG6A 2KIVA 4RQMA 1KW4A 2EAMA 2F44A 2L5YA 1LKYA 2QARA 1Z1VA 2KSOA 5F3XB 1OW5A 2QB1A 1F0MA 4IS7A 3KKAC 1B4FA 1UQVA 2QB0A 4NL9A 3SENA 4PZOA 1PK3A 1X40A 2JV3A 2LMRA 3BS5A 5J8YC 2FE9A 2KSOB 3K1RB 1PK1B 1SV4A 2E8PA 2B6GA 1WWUA 3SEIA 4NJ8A 1SV0C 3TADC 5JRTA 1COKA 2ESEA 2EAOA 2ES6A 1UCVA 3BS7A 2QKQA 3HILA 5JTIA 1OXJA 1V85A 2DL0A 1SGGA 3BS5B 2DKXA 3TADA 2KMDA 5JU5A 2KG5A 2D8CA 2QARB 2Y9TA 1DXSA 1V38A 4MHVA 2F3NA 3H8MA 2LPEA 1X9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QB0 B;  1SV0 A;  1WWV A;  1B0X A;  2EAP A;  3IDW A;  5L1M A;  2GLE A;  4RQN A;  3BQ7 A;  2K4P A;  1SXD A;  1JI7 A;  2EAN A;  2E8M A;  5KNI A;  1LKY B;  1PK1 A;  2KE7 A;  4PZN A;  2D3D A;  2YTU A;  3TAC B;  5J8Y A;  3KKA A;  2DKZ A;  2F8K A;  2E8N A;  2Y9U A;  4NL9 C;  1SXE A;  2E8O A;  1X66 A;  2K60 A;  1RG6 A;  2KIV A;  4RQM A;  1KW4 A;  2EAM A;  2F44 A;  2L5Y A;  1LKY A;  2QAR A;  1Z1V A;  2KSO A;  5F3X B;  1OW5 A;  2QB1 A;  1F0M A;  4IS7 A;  3KKA C;  1B4F A;  1UQV A;  2QB0 A;  4NL9 A;  3SEN A;  4PZO A;  1PK3 A;  1X40 A;  2JV3 A;  2LMR A;  3BS5 A;  5J8Y C;  2FE9 A;  2KSO B;  3K1R B;  1PK1 B;  1SV4 A;  2E8P A;  2B6G A;  1WWU A;  3SEI A;  4NJ8 A;  1SV0 C;  3TAD C;  5JRT A;  1COK A;  2ESE A;  2EAO A;  2ES6 A;  1UCV A;  3BS7 A;  2QKQ A;  3HIL A;  5JTI A;  1OXJ A;  1V85 A;  2DL0 A;  1SGG A;  3BS5 B;  2DKX A;  3TAD A;  2KMD A;  5JU5 A;  2KG5 A;  2D8C A;  2QAR B;  2Y9T A;  1DXS A;  1V38 A;  4MHV A;  2F3N A;  3H8M A;  2LPE A;  1X9X A; 
#chains in the Genus database with same CATH topology
 2P6U A;  2EZY A;  4O3N A;  2P66 A;  2VA2 A;  5CJ7 A;  1K1S A;  4DL4 A;  1RXV A;  2Q0Z X;  3RJJ A;  3FYH A;  3MGV A;  5KFX A;  2KIC A;  3ONN A;  3GIM A;  1CUK A;  1TKD A;  4EEL A;  1S0M A;  7ICK A;  1QSY A;  4J9K A;  1NK8 A;  1WCN A;  4JK1 A;  5KNI A;  5J0O A;  9ICT A;  3E0F A;  3GU3 A;  4Y2S A;  2KE7 A;  3UXN A;  2GH1 A;  3QUT A;  2A1A A;  2NYV A;  3R9K A;  1BGX T;  3QU2 A;  4R64 A;  4M9G A;  4NLB A;  8ICB A;  4UBC A;  2ZG6 A;  3Q8S B;  3M9M B;  4DF8 A;  1PUZ A;  5AI5 A;  1SKR A;  9ICC A;  3H8J A;  3RJG A;  4DFJ A;  3V6J A;  4XRH A;  4Q8F A;  2NV3 A;  4MFF A;  2YY6 A;  8ICK A;  4BDP A;  2DPJ A;  3GIK A;  2K8C B;  4NL9 A;  3NVY A;  1X40 A;  2E3T A;  1S0V A;  5E79 U;  2KSO B;  8ICP A;  3AMZ A;  3C5G A;  5KFE A;  3M8R A;  4GXI A;  4DFM A;  4RNN A;  2ZIU A;  4NM1 A;  3S6J A;  3F2C A;  1L7P A;  1F44 A;  1XSL A;  5DB6 A;  4ELV A;  1JRO A;  3OSN A;  5J2J A;  4QZA A;  1ZET A;  1L3U A;  9ICW A;  4EYI B;  1SZH A;  4PGY A;  4ED0 A;  4C0Z A;  3GIL A;  3LK9 A;  1CRX A;  2MUT B;  2W7P A;  2F8L A;  1M6Y A;  2W3S A;  1NJW A;  4O5K A;  3L3F X;  4PPX A;  1JXE A;  4RNM A;  1WCL A;  9ICB A;  3TKA A;  4DSI A;  1TV9 A;  2EAN A;  5KFJ A;  4AYB C;  4KIT B;  3HW8 A;  5BOM A;  1QCK A;  3G6Y A;  1K1Q A;  2HW3 A;  1ZQC A;  4R63 A;  5J2D A;  2NO4 A;  2PKE A;  1Z4O A;  1NNL A;  4DQS A;  2KHV A;  1ZQW A;  2HVI A;  4DSF A;  9ICK A;  2A3V A;  1HUZ A;  5AI9 A;  5KG7 A;  8ICC A;  4OCZ A;  4F71 A;  4EYH B;  2P6R A;  1KEJ A;  4JV2 A;  4DFP A;  5FP0 A;  2BDP A;  4ELT A;  1B43 A;  3N4M B;  3WK7 A;  2AQ4 A;  2IBK A;  3N97 B;  4NJ8 A;  1SV0 C;  1K5O A;  5JRT A;  2C28 A;  2DBY A;  2ZIW B;  3NRZ A;  3WK5 A;  5DB8 A;  4QWE A;  3FM9 A;  3PY8 A;  1JN3 A;  1KLN A;  1U49 A;  4KMO B;  3U26 A;  8ICI A;  2FPL A;  1SWW A;  3PX0 A;  4QZC A;  4ACO A;  5ALV A;  3F2D A;  4YXM A;  1L8L A;  4M9N A;  4DQQ A;  4JWM A;  2EH9 A;  1L7O A;  7ICN A;  1ZQM A;  1YZ7 A;  1BNO A;  4ECZ A;  1GO3 F;  5J0P A;  2Y1J A;  2F76 X;  2HHW A;  4BXO B;  3NGD A;  1X6I A;  9ICA A;  2WF7 A;  4BJQ A;  5EWE A;  1BPX A;  3C2K A;  4UBB A;  2UVV A;  3ZDD A;  1ZQG A;  4GLX A;  9ICQ A;  5HR6 A;  4AP9 A;  4M04 A;  4K4G A;  2EDU A;  2KVS A;  5K4L A;  4I2A A;  4C7Z A;  1XSN A;  3HX0 A;  5CA7 A;  4QZD A;  2FMP A;  5KAI U;  2H5X A;  1RG6 A;  2IOF K;  1L7N A;  4R8U A;  3HWT A;  2KFZ A;  2HBL A;  3B9J A;  1NKE A;  3WKB A;  5F3X B;  3PML A;  5KG2 A;  1KRP A;  3WKD A;  5J0R A;  5B66 U;  4ELU A;  3WK6 A;  2W9C B;  2ZXH A;  3RR7 A;  3WK4 A;  2M0N A;  5DG7 A;  2ZIV A;  3TFR A;  1IM4 A;  5KFZ A;  1L3T A;  5AKK A;  7ICJ A;  1N2X A;  4O3Q A;  4PH5 A;  4ED3 A;  3DEE A;  3HKZ F;  4RQ4 A;  3MBY A;  3QYP A;  4IRK A;  8ICL A;  3IHQ B;  3RR8 A;  3RFA A;  4YR3 A;  4MFC A;  1SL1 A;  4CF5 A;  2KIW A;  1TK8 A;  4UB3 A;  1A77 A;  4RQ8 A;  1PVP A;  2LHT A;  3BDP A;  2HBJ A;  2W9B A;  3D2Q A;  5J2F A;  3SV3 A;  2W9A A;  3WKE A;  1XNS A;  3RBE A;  1S0O A;  2BKE A;  2VKQ A;  2W03 A;  4F4X A;  3SR6 A;  3KHG A;  2VA8 A;  5KFK A;  1UHU A;  1B0X A;  4QJF B;  2DWQ A;  3HJE A;  2WHE A;  5HHI A;  2HI0 A;  1SIJ A;  2HHU A;  4DL6 A;  5AM0 A;  1VDV A;  3ISC A;  3OPX A;  4FO6 A;  1HEK A;  2B0C A;  4I2J A;  5F9N A;  1NJZ A;  2F77 X;  2OEH A;  9ICS A;  3EUB 2;  3HRD D;  4Y2U A;  2NRV A;  4TQR A;  5AKZ A;  4UW9 A;  4QZ9 A;  1S0N A;  2EAM A;  1NKB A;  3AN1 A;  2L5Y A;  5AK5 A;  9ICJ A;  4K4H A;  1S8O A;  1OW5 A;  5DB7 A;  5ALP A;  2OM6 A;  2Q4T A;  2ZTD A;  4IS7 A;  2BQU A;  3T5K A;  4QWB A;  2C2E A;  9ICO A;  2R8J A;  3ISB A;  4YQW A;  4PZO A;  4QIW F;  1X9M A;  3C21 A;  2CPR A;  4QWD A;  3ZDC A;  4PJ0 U;  2PMZ C;  3UMG A;  1RYU A;  5ALI A;  4M6W A;  4J9Q A;  7ICF A;  2KZM A;  5C0Y A;  2G09 A;  3NTU A;  1RYS A;  2WAQ C;  4GXK A;  4KX5 A;  2WTF A;  1WYG A;  3H0M B;  4KLS A;  3C29 A;  2K4E A;  3PSF A;  1WG8 A;  1OXJ A;  3SYZ A;  4DWI A;  4NLC A;  1L3V A;  1PVR A;  4R8U B;  4P0P B;  4KN7 A;  3N7P D;  1T3N A;  5EE9 A;  5JU5 A;  3L4P A;  1J2M A;  3SZ2 A;  4P4P A;  4FBU A;  4KMU A;  4QZI A;  4ECS A;  4KLO A;  4QNL A;  5GTH U;  2XIC A;  3SMV A;  2GOL A;  2ZJ8 A;  3SAF A;  5KFO A;  9ICR A;  4RPY A;  1ZQA A;  2KFN A;  3C1Z A;  3IRU A;  4DQR A;  4IR1 A;  4ED6 A;  3QXG A;  9ICH A;  4MEY A;  2JEJ A;  4P4M A;  4OJ5 A;  3IN5 A;  4I2I A;  4Q45 A;  2IA6 A;  3I76 A;  2HOF A;  4RUC A;  5KG1 A;  4B9S A;  5J0X A;  2D6F C;  3B0X A;  1X66 A;  4EBE A;  4O5C A;  4C80 A;  2G0A A;  4I2E A;  4RQM A;  2QLT A;  1NZB A;  4QIW C;  3GIJ A;  3QUC A;  3OHB A;  2KSO A;  2N1R A;  3QU4 A;  5J0W A;  2ISO A;  3H8S A;  2QB1 A;  2BCU A;  4C4T A;  5IIN A;  2P35 A;  1MA7 A;  5DKW A;  5J2E A;  4IR9 A;  4GC6 A;  3SEN A;  1JUD A;  4ED7 A;  9ICE A;  4KLL A;  3IG8 A;  4Y2Q A;  2DQN B;  3MAB A;  2BZF A;  4ECT A;  5DGA A;  2NO5 A;  4GFJ A;  2VJ5 A;  3QX7 A;  2WFA A;  3TAP A;  3KHL A;  5AKL A;  2IMW P;  5KG6 A;  2MRL A;  4US8 A;  3QEB Z;  3NS1 A;  4CF4 A;  1V85 A;  4KLE A;  4C4R A;  5JUM A;  2KZZ A;  2ZXI A;  5A0L A;  4PHE A;  3RJI A;  2XCA A;  3AL0 B;  5ALD A;  5AM5 A;  2BR0 A;  9ICN A;  2KG5 A;  1XU4 A;  3N7R C;  2XC9 A;  2AQ0 A;  4QZ8 A;  2G5H B;  2YMP A;  5KG5 A;  1N60 A;  2I1Q A;  3NVW A;  3LVV A;  5J2C A;  2BPC A;  2E1E A;  4UB2 A;  4UB6 U;  2QB0 B;  2KV2 A;  2FLL A;  1TK5 A;  3K75 D;  2DFL A;  4DOA A;  7ICV A;  4UAR A;  2E5S A;  5G5G A;  2J6U A;  2J6T A;  2MSN A;  2EZX A;  1ZQK A;  1KDH A;  2E1F A;  1C7Y A;  2D3D A;  2F8K A;  4MEX A;  1ZQI A;  1ZRM A;  1KW4 A;  2YMQ A;  1Z1B A;  2KKP A;  5IIJ A;  1L8O A;  2F1I A;  1QLN A;  2ZJA A;  2IHM A;  2XCP A;  4ECX A;  3KKA C;  2W9B B;  1ZYQ A;  1UPH A;  5AKJ A;  4QW9 A;  1MSW D;  2YB1 A;  1COO A;  1ZQV A;  5KTQ A;  4FZN A;  4DO9 A;  5J8Y C;  1S9F A;  1IV8 A;  3MDA A;  5HR7 A;  5ALS A;  3PO5 A;  4IRD A;  2OYY A;  4J03 A;  4YN4 A;  1L5U A;  2K4I A;  3RJE A;  4I28 A;  2KEY A;  1ARO P;  2A1J B;  4TQS A;  2OXO A;  2HMX A;  3V72 A;  5HNK A;  4Y2X A;  4QZB A;  5AK3 A;  3V6H A;  3V6K A;  2JH1 A;  3MFH A;  4I2D A;  3RRG A;  4B9T A;  1T7P A;  4NXZ A;  2KNJ A;  4UAZ A;  3K4G A;  5BPC A;  2LPE A;  5ALM A;  1SB3 C;  5HP4 A;  4M2Y A;  4EEY A;  7ICU A;  3BZK A;  4UAU A;  1ZD3 A;  2GLE A;  3AQF A;  1SWV A;  3ZDB A;  4B9M A;  1TAM A;  2ZUC A;  5C5J A;  2E8M A;  5AKI A;  3TQ1 A;  1LV5 A;  3RB4 A;  1BPY A;  1S77 D;  7ICR A;  4KX3 A;  2KKV A;  5AI4 A;  1U47 A;  2BPF A;  2KHQ A;  4F8R A;  5KT7 A;  1JRP A;  5J8Y A;  2KZ3 A;  2K4H A;  4RQ6 A;  4LZG A;  5KFV A;  4U6P A;  4JB3 A;  3UXO A;  4OJ6 A;  2W04 A;  1DK3 A;  4PGQ A;  4YFK A;  2JR5 A;  4CRX A;  2QAR A;  2VJ4 A;  5KFI A;  5AHX A;  1KFD A;  1MC8 A;  4UAV A;  3KZX A;  4OO1 J;  2YX8 A;  1XC9 A;  5GTI U;  5T14 A;  1S97 A;  3LVW A;  5KFY A;  1L3S A;  4LJX A;  3VC8 A;  4B9U A;  1PK3 A;  2JV3 A;  3Q8L A;  3PZP A;  4J9R A;  3H4D A;  3DV9 A;  1JAL A;  3QE9 Y;  4YG2 A;  1ZD5 A;  4GXJ A;  7ICL A;  4R65 A;  3CNH A;  4O3M A;  3T3F A;  3EPI A;  3VCB A;  4OD0 A;  1TK0 A;  2KJ5 A;  3BJY A;  8ICR A;  5CRX A;  5D4B A;  4ZOH C;  2HSZ A;  2I5H A;  1YZ6 A;  4EX7 A;  1SGG A;  3Q8Q B;  5DLG A;  9ICX A;  7ICP A;  4PL2 A;  1J2N A;  2HOI A;  2Y9T A;  2RQ5 A;  5AM2 A;  3PW7 A;  1VLB A;  5HML A;  4UAT A;  4J9S A;  2AH5 A;  1NJY A;  4KN4 A;  5ALR A;  1WWV A;  4G3I A;  4ECQ A;  1BPB A;  5ALL A;  3AEV A;  3F53 A;  3AQE A;  1SXD A;  1X9W A;  3Q8R B;  4QZH A;  4ECR A;  4TUR A;  4NLK A;  4JMU A;  5HHH A;  1QQ5 A;  1QSL A;  4FS2 A;  1RM6 C;  1XS9 D;  3TAC B;  4CDG A;  5L1J A;  3IP4 B;  3PMN A;  9ICI A;  5L1L A;  4P0Q B;  9ICL A;  3SD7 A;  4I29 A;  1U9L A;  3RTV A;  1S76 D;  4M47 A;  1VJ5 A;  2V4R A;  4DS4 A;  1RDF A;  3ETR A;  3TAR A;  4J9L A;  2F2A B;  3ZDE A;  1Z19 A;  1TAU A;  1LVH A;  3MFI A;  4M9J A;  3OJS A;  1UQV A;  3WU2 U;  5AKX A;  2NRW A;  4F5R A;  2DUY A;  4Y2R A;  4BX9 C;  3UQ0 A;  2B6G A;  1ZJN A;  2BGW A;  2XGQ A;  4YR0 A;  1JX4 A;  2BQR A;  4QZG A;  3PV8 A;  3ALR A;  3LYS A;  1KTQ A;  3FC4 A;  3NAS A;  4Q8E A;  5J2A A;  3M9O B;  4DLE A;  1BNP A;  2CRX A;  5EWG A;  1A76 A;  4M9L A;  5DQH A;  5KG4 A;  1IIP A;  5KFT A;  2MU2 A;  2ZIX A;  5J0Y A;  1MQ2 A;  2AGO A;  4WJ3 B;  4FE3 A;  9ICV A;  3JPO A;  2GWS A;  5DDY A;  7ICS A;  4C8M A;  3RB3 A;  1Q8K A;  4RT3 A;  4UB4 A;  2IHN A;  1RZT A;  1ZQP A;  1ECW A;  4F91 B;  4BUG A;  2EZZ A;  4NLG A;  5ALX A;  2FLN A;  3ETL A;  2BHN A;  5L1M A;  5KG3 A;  2ALZ A;  1FIQ A;  4RUA A;  4DS5 A;  2LM1 A;  1DOQ A;  4XQ8 A;  2YMM A;  4JUZ A;  2W8L A;  2WB1 F;  2KD1 A;  5ALH A;  5III A;  4B6J A;  1P7D A;  2Y9U A;  3KHR A;  3PR4 A;  3GV5 B;  4DFK A;  3C2M A;  1N5X A;  1AQ6 A;  1ZQ1 C;  3GII A;  1N62 A;  4ECW A;  5KT6 A;  3HP6 A;  4NLN A;  4I27 A;  8ICX A;  4DL3 A;  8ICN A;  1Z1V A;  3JPN A;  3Q8M A;  4US9 A;  1RYR A;  1RXW A;  2AGP A;  4BXO A;  3UXP A;  2V4Q A;  3H4B A;  3BQT A;  4QZF A;  4UAS A;  3M6K A;  9ICF A;  2BCR A;  5KT2 A;  3UM9 A;  4ED1 A;  2RDI A;  4PGX A;  3CYM A;  4Y2J A;  4QWA A;  4C8L A;  1KFS A;  8ICZ A;  1T8E A;  3GV7 B;  3QUB A;  2VIX A;  3PR5 B;  3EPG A;  3A0B U;  5DGB A;  4J9M A;  3BS7 A;  3G6V A;  4CE6 A;  8ICH A;  2ZIU B;  3B0Y A;  5J2B A;  1BPE A;  3KOO A;  1EXN A;  3QUQ A;  2XGP A;  4KLG A;  2KJ8 A;  2YN4 A;  4DCC A;  1DXS A;  3KHH A;  2I9G A;  3D2N A;  1FEZ A;  2FI1 A;  1A6S A;  3JPQ A;  1X9X A;  4EEK A;  2NRT A;  3PSI A;  3QNM A;  3NUQ A;  2ZUB A;  4C8N A;  1NK6 A;  3TFS A;  3CW2 C;  4O3O A;  2WF9 A;  1MN8 A;  5IIL A;  3MDC A;  2PI5 A;  4GIB A;  4KLQ A;  4P0P A;  5IIM A;  1PK1 A;  1URJ A;  9ICU A;  5ALN A;  3OTQ A;  4B9N A;  2PI4 A;  3QZ7 A;  1BVS A;  4XUS A;  1Q3V A;  4YR2 A;  2JXJ A;  2O6K A;  4YMO A;  2UVR A;  3GDX A;  3IV6 A;  4F4K A;  5EWF A;  1JMS A;  4YD1 A;  4HYK A;  1NK7 A;  5AIA A;  1NOM A;  4NWI A;  4U7C A;  2JEG A;  1D8Y A;  4EZ6 A;  1F0M A;  4CF3 A;  1N63 A;  2J6S A;  1ZJM A;  1KBU A;  2BQ3 A;  3EYZ A;  7ICE A;  2PFO A;  2IOH A;  4Q44 A;  1WUD A;  2R8K A;  3PSP A;  2XY7 A;  1Q3U A;  4EZ9 A;  3BS5 A;  1V9P A;  5AM3 A;  1QQ7 A;  3K1R B;  3RAX A;  2YQE A;  3RBD A;  1PK1 B;  1ZQY A;  4BWM A;  1WWU A;  4JV0 A;  2Z7J A;  2VA3 A;  2HCF A;  1Q46 A;  2EAO A;  7ICQ A;  1O08 A;  4F5Q A;  3RJK A;  5CHG A;  4DL5 A;  5DLF A;  2DL0 A;  1XWL A;  4KLM A;  2KN7 A;  1ZXI A;  4X5V A;  3RRH A;  3C5F A;  3E2E A;  2UVW A;  3N7S C;  5DQI A;  4RT2 A;  1NK9 A;  4KTQ A;  2XI9 A;  1XO0 A;  4IL6 U;  1FO4 A;  2VAN A;  4OJP A;  2KP7 A;  2DGZ A;  3RJF A;  2LYH A;  5KFU A;  2MAX A;  5F9L A;  2NRX A;  3RB0 A;  2C22 A;  2IOF A;  4DEZ A;  4F50 A;  1TVA A;  1DRG A;  2W7O A;  4LZD A;  5KFH A;  4ECV A;  5ALE A;  2ZUD A;  1MQ3 A;  5KT3 A;  2WB1 C;  2WAQ F;  2RDJ A;  1TFR A;  8ICT A;  4NLZ A;  3PX4 A;  2WF5 A;  5KFQ A;  3QU9 A;  4FZL A;  3H8W A;  5KFW A;  4PHP A;  3KKA A;  2DKZ A;  2G08 A;  5KFL A;  8ICJ A;  2HOQ A;  4NL9 C;  2JHD A;  1Z4N A;  4JV1 A;  3JPT A;  4YVZ A;  2HHV A;  3NVV A;  2JZB A;  3F2B A;  2JZB B;  1X6J A;  4QW8 A;  3WKA A;  3MR3 A;  1FFV A;  2JEF A;  3PW4 A;  2LM4 A;  5TZV A;  5BOL A;  3BQ0 A;  1NK0 A;  4UAY A;  2JRZ A;  3ORY A;  5J0T A;  5DBA A;  4Z6C A;  5KT5 A;  2R8H A;  8ICQ A;  1NKC A;  3RH4 A;  3LWL A;  3UQ2 A;  3H0R B;  5ALW A;  5ALJ A;  3SV4 A;  5CR0 A;  4F2R A;  8ICA A;  1ZQU A;  1D9F A;  5J2K A;  4YMM A;  3TAD C;  5DG8 A;  2C2R A;  3ICX A;  5L9X A;  1COK A;  5KT4 A;  2ISP A;  4Z6D A;  5CP2 A;  3D6J A;  5AKG A;  4QZE A;  1UA0 A;  5G5H A;  2MUT A;  2QKQ A;  3HIL A;  1SKS A;  1NI3 A;  4R66 A;  2FMQ A;  8ICY A;  2DKX A;  4KLF A;  5KFN A;  5DDM A;  5DBB A;  3RF9 A;  4RU9 A;  4F4W A;  4QWC A;  3AUO A;  3M8S A;  4C4S A;  5EOZ A;  2CN1 A;  2QAR B;  4C8K A;  1RQN A;  1ZQE A;  2EQY A;  1V38 A;  3MGI A;  3PW2 A;  3BQ1 A;  4C7Y A;  3EW9 A;  5KL8 B;  3LDA A;  3Q8K A;  1DK2 A;  3C1Y A;  2AHO B;  4DSJ A;  3ED5 A;  2W43 A;  4Z6F A;  4OJO A;  4IC9 A;  3L5K A;  5AIB A;  2MA1 A;  2OCE A;  4DQI A;  4ECY A;  2M9N A;  3GQC A;  3BQ7 A;  4G9B A;  4JWN A;  4HAI A;  1JI7 A;  4YD2 A;  5AK4 A;  5ALZ A;  3ZDA A;  9ICM A;  4IQW A;  4PHD A;  3LWM A;  3KZI U;  4J9P A;  1RPL A;  3D2S A;  2H3V A;  2JEI A;  4F2S A;  4FZM A;  5DBC A;  4F92 B;  5KFC A;  5H2F U;  4MFA A;  3MR6 A;  5KFP A;  3Q8P B;  5KFD A;  3K1Z A;  1HUO A;  2B21 A;  2CXY A;  2F44 A;  8ICM A;  3EWA A;  4I2B A;  1Z00 B;  4F4Y A;  1U45 A;  1L7M A;  4O3R A;  2BDU A;  1LB2 B;  3RJH A;  4O3S A;  1KFT A;  1DGS A;  8ICS A;  3O0F A;  1B4F A;  5KL1 B;  5DG9 A;  1CEZ A;  5KG0 A;  5IIO A;  3IG5 A;  2ASD A;  8ICW A;  5AI0 A;  1IXR A;  4A8E A;  2C2D A;  1DGJ A;  2DF4 B;  3PNC A;  3MR2 A;  9ICP A;  2E8P A;  3QZ8 A;  4CNQ A;  3KTQ A;  1QH9 A;  3RH6 A;  3F5A A;  5AKH A;  1S10 A;  3RAQ A;  4YP3 A;  2R8I A;  4F5N A;  4P4O A;  1S5L U;  4DFD A;  3THV A;  2ESE A;  4KLT A;  4TUQ A;  5AIC A;  5JTI A;  1RQL A;  3CP8 A;  1SL2 A;  3EZ5 A;  3HT3 A;  3T79 A;  1ZQS A;  4ED2 A;  2JH7 A;  2BCS A;  4DOC A;  4KLH A;  3H8M A;  7ICO A;  3AU6 A;  4KLU A;  1XSP A;  5D46 A;  4YCX A;  5J2I A;  3V7K A;  3WK8 A;  1O03 A;  2HHQ A;  1PZN A;  2EAP A;  4RZR A;  7ICT A;  2ODG A;  3DDH A;  4F72 A;  3UMC A;  4DF4 A;  2Y1I A;  5EE0 A;  3PST A;  4B9L A;  3GV8 B;  4I2H A;  3M6Z A;  7ICG A;  4TUS A;  2H3Z A;  2H3I A;  1D9D A;  1IG6 A;  4NV0 A;  3FAH A;  2ASL A;  5J29 A;  4FBT A;  2FPM A;  3FDS A;  2XVT A;  1ZRN A;  4RPX A;  2K8A A;  1CI4 A;  4J9O A;  4Q43 A;  3OSP A;  4UAW A;  2W9M A;  2V9W A;  2HHT A;  2PXI A;  5IIK A;  2KOB A;  3I28 A;  4FFD A;  1N56 A;  4K4I A;  1SZP A;  1BPZ A;  1B22 A;  1QTM A;  4ICA A;  2OH2 A;  3PVX A;  4NM2 A;  2KTQ A;  4RPZ A;  3SQI A;  3QEA Z;  3PO4 A;  1SV4 A;  2FMS A;  3SI8 A;  2AJQ A;  3NRW A;  1NZP A;  4TUP A;  4M9H A;  4UB8 U;  5B5E U;  3T5L A;  1UCV A;  1ZQH A;  4RQ3 A;  1T4G A;  1HIW A;  5J0Q A;  2ZJ5 A;  2YB4 A;  8ICE A;  3M7D A;  1ZD2 P;  2KMD A;  2R18 A;  4DSK A;  1X2I A;  5EE3 A;  4LVS A;  1Y88 A;  1ZQN A;  4F5P A;  2W55 A;  4KLI A;  5J0S A;  4IQT A;  1KKX A;  5AI8 A;  4Y2V A;  5CB1 A;  5KFR A;  1XO1 A;  7ICI A;  3KFU F;  4KLD A;  4DSE A;  2KJ9 A;  3C28 A;  1ZQT A;  4Y2T A;  3M1Y A;  4DLG A;  2K89 A;  4UQG A;  4J9N A;  1LKY B;  1ZQL A;  5ALK A;  1L6N A;  2FPK A;  2E8N A;  2LYA A;  3M9N B;  1C20 A;  1SXE A;  2K8B B;  1D8B A;  2BCV A;  2WF8 A;  3GFK B;  5KFB A;  2KIV A;  3HKZ C;  1HJP A;  2OHF A;  4UB1 A;  3ZI4 A;  1LKY A;  3QU5 A;  4PL1 A;  3QU7 A;  2BCQ A;  3UPQ A;  1F5S A;  2G5I B;  1YT3 A;  3ZD8 A;  1FFU A;  5KFM A;  5ALU A;  5L1I A;  4BGD A;  1SL0 A;  2QB0 A;  2RLT A;  1OUQ A;  3KD3 A;  1D8L A;  8ICF A;  3PW0 A;  3TI0 A;  2G06 A;  5ALY A;  4FS1 A;  5AK6 A;  3H40 A;  2ZIW A;  4UB5 A;  2ZIV B;  3WKC A;  2AGQ A;  4RQ5 A;  2HHX A;  2KVC A;  2FJ6 A;  2HBM A;  1KSP A;  4RQ1 A;  2W9C A;  4MF2 A;  2H3Q A;  2DPI A;  3BS5 B;  4EBC A;  4DQP A;  1KN5 A;  3H0L B;  1A0P A;  2D8C A;  5D49 A;  3SAG A;  3KBB A;  2ASJ A;  1U48 A;  5CWR A;  5EE1 A;  1Z3E B;  2LKY A;  1BPD A;  1T94 A;  5KFG A;  2LBO A;  1X9S A;  8ICG A;  4PHA A;  5L1K A;  3ISD A;  3IDW A;  5ALO A;  3TAN A;  4XA5 A;  2JMG A;  4RQN A;  2W54 A;  4O3P A;  2K4P A;  4IRC A;  4F5O A;  8ICV A;  2PFQ A;  5AI6 A;  5J2G A;  4ZH4 A;  5J0U A;  1UT5 A;  1UA1 A;  4RQ0 A;  4O5E A;  2YTU A;  2A19 A;  2HBK A;  3A0H U;  2GO7 A;  2PFP A;  2R8G A;  2HVH A;  1ZQJ A;  2ATL A;  1N5W A;  1ZOL A;  3OJU A;  2LYB A;  3UMB A;  2XO7 A;  2NRZ A;  4OJL A;  7ICH A;  1KQQ A;  1N61 A;  2Y0S C;  3PW5 A;  7ICM A;  2OWO A;  3ZD9 A;  3RH5 A;  5DQG A;  4ECU A;  2G07 A;  4CCH A;  2RRD A;  3CRX A;  3C23 A;  2KK0 A;  4MF8 A;  2XID A;  4Y2P A;  1PVQ A;  1ZD4 A;  3J81 j;  2Y0S F;  2LMR A;  2FE9 A;  4RNO A;  4RQ2 A;  4I2G A;  2XY5 A;  9ICG A;  5KFF A;  3SEI A;  2FDR A;  4YMN A;  2YML A;  2UVU A;  1ED1 A;  1JXL A;  4IQV A;  1JIH A;  4AYB F;  4DL7 A;  4KLJ A;  1ZQR A;  3HPO A;  5KAF U;  2ES6 A;  4O9M A;  5AKY A;  2PMZ F;  3IM1 A;  4EBD A;  1SKW A;  1N48 A;  2FLP A;  4RQ7 A;  3T5J A;  1ZQX A;  3V7J A;  3G6X A;  3AU2 A;  2HDO A;  5ALG A;  1UT8 A;  4F93 B;  4YXJ A;  2WF6 A;  3PX6 A;  3BQ2 A;  3N28 A;  2H3F A;  3H7I A;  4BWJ A;  4O0I A;  2ZTC A;  4GC7 A;  1QQ6 A;  4M0A A;  3JPR A;  3WK9 A;  3F5E A;  4ED8 A;  1SV0 A;  2XY6 A;  2RHF A;  1TAQ A;  1V97 A;  4DL2 A;  2PFN A;  3JPP A;  1NK4 A;  1H38 A;  2ZTE A;  4M6W B;  2F1H A;  1ZQB A;  4USA A;  4PZN A;  3T5H A;  4C8O A;  4F4Z A;  2HHS A;  2RP5 A;  4F3O A;  8ICO A;  2A1J A;  3I1Y A;  1ZQQ A;  4P2H A;  1TE2 A;  2AXT U;  2E8O A;  2ZIX B;  5KFS A;  3E58 A;  2K60 A;  4IQU A;  4EX6 A;  2LI6 A;  5TIS U;  2AU0 A;  1NJX A;  5ALT A;  2W8K A;  4DSL A;  1Z00 A;  5KFA A;  2JGA A;  4EEN A;  3V7L A;  5AM4 A;  8ICU A;  5ALQ A;  4NY8 A;  3AM9 A;  5HMM A;  3OGU A;  2BPG A;  2I6X A;  3NVZ A;  5AM1 A;  1ZQZ A;  5ALF A;  1X42 A;  3JPS A;  3GZF A;  2W3R A;  4B9V A;  4E0D A;  1T3Q A;  3BZC A;  1NK5 A;  5J2H A;  4DOB A;  1J97 A;  2W11 A;  3TAQ A;  3SAH A;  3C2L A;  1ZQF A;  4Y2Y A;  1QSS A;  3MGH A;  4I2F A;  3MR5 A;  4P0Q A;  4I2C A;  3TAD A;  5DB9 A;  4Z6E A;  5CEH A;  3OHA A;  1ZQO A;  1KL9 A;  1ZQD A;  5AKE A;  3MC1 A;  4CGZ A;  3RB6 A;  4MHV A;  2F1J A;  2F3N A;  1U4B A; 
#chains in the Genus database with same CATH homology
 2QB0 B;  1SV0 A;  1WWV A;  1B0X A;  2EAP A;  3IDW A;  5L1M A;  2GLE A;  4RQN A;  3BQ7 A;  2K4P A;  1SXD A;  1JI7 A;  2EAN A;  2E8M A;  5KNI A;  1LKY B;  1PK1 A;  2KE7 A;  4PZN A;  2D3D A;  2YTU A;  3TAC B;  5J8Y A;  3KKA A;  2DKZ A;  2F8K A;  2E8N A;  2Y9U A;  4NL9 C;  1SXE A;  2E8O A;  1X66 A;  2K60 A;  1RG6 A;  2KIV A;  4RQM A;  1KW4 A;  2EAM A;  2F44 A;  2L5Y A;  1LKY A;  2QAR A;  1Z1V A;  2KSO A;  5F3X B;  1OW5 A;  2QB1 A;  1F0M A;  4IS7 A;  3KKA C;  1B4F A;  1UQV A;  2QB0 A;  4NL9 A;  3SEN A;  4PZO A;  1PK3 A;  1X40 A;  2JV3 A;  2LMR A;  3BS5 A;  5J8Y C;  2FE9 A;  2KSO B;  3K1R B;  1PK1 B;  1SV4 A;  2E8P A;  2B6G A;  1WWU A;  3SEI A;  4NJ8 A;  1SV0 C;  3TAD C;  5JRT A;  1COK A;  2ESE A;  2EAO A;  2ES6 A;  1UCV A;  3BS7 A;  2QKQ A;  3HIL A;  5JTI A;  1OXJ A;  1V85 A;  2DL0 A;  1SGG A;  3BS5 B;  2DKX A;  3TAD A;  2KMD A;  5JU5 A;  2KG5 A;  2D8C A;  2QAR B;  2Y9T A;  1DXS A;  1V38 A;  4MHV A;  2F3N A;  3H8M A;  2LPE A;  1X9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...