2F3NA

Crystal structure of the native shank sam domain.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
MLQLWSKFDVGDWLESIHLGEHRDRFEDHEIEGAHLPALTKEDFVELGVTRVGHRENIERALRQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3 and multiple ankyrin repeat domains 3
publication title An architectural framework that may lie at the core of the postsynaptic density.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 23
structure length 65
sequence length 65
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2f3nA00
3TADA 1COKA 1V85A 2D8CA 2Y9UA 1JI7A 1Z1VA 1SV0A 5L1MA 1WWVA 5JU5A 1UQVA 5J8YA 1X66A 2KE7A 2E8MA 2Y9TA 4MHVA 1OXJA 2GLEA 4NL9A 4IS7A 1SXDA 4NL9C 3K1RB 5F3XB 2E8NA 3TADC 2QKQA 1KW4A 1RG6A 5JTIA 2EAPA 4RQNA 2E8PA 1UCVA 4PZOA 1B0XA 5KNIA 1SV0C 3H8MA 2DL0A 2KIVA 2KG5A 2KSOA 2K4PA 5J8YC 2E8OA 3BS5A 2F3NA 2F8KA 1WWUA 2JV3A 1SV4A 2DKZA 2EAMA 1F0MA 2KMDA 3SENA 1OW5A 3IDWA 4NJ8A 4PZNA 2LPEA 4RQMA 2ES6A 2QARA 3TACB 2FE9A 1LKYA 1X40A 2KSOB 2L5YA 1PK1A 2F44A 2K60A 1SGGA 1SXEA 2LMRA 3BQ7A 3BS5B 1DXSA 2QB0B 2B6GA 3HILA 2QB0A 1B4FA 5JRTA 2D3DA 2QB1A 1V38A 1X9XA 2EAOA 2QARB 3KKAA 2DKXA 1LKYB 3KKAC 2EANA 1PK1B 3BS7A 2ESEA 1PK3A 3SEIA 2YTUA
chains in the Genus database with same CATH superfamily
4DL3A 2XGPA 3PW0A 2YN4A 5HHHA 3WKAA 4OJLA 3V7KA 2LKYA 8ICCA 3O0FA 1WCLA 4E0DA 3GV5B 3V6JA 2F2AB 2AHOB 2AGQA 1L3SA 3V7LA 4F50A 4NLBA 2LYHA 3DDHA 1JX4A 1S5LU 3QYPA 2W11A 3OTQA 2PMZC 4FFDA 3E2EA 1YT3A 3EZ5A 5ALPA 4CNQA 2KHVA 4EZ9A 3ETRA 1QSSA 1N56A 1RM6C 2EZXA 3RAQA 4J9LA 3JPQA 9ICFA 4KLGA 5ALSA 5CRXA 3H8MA 2ATLA 4YN4A 2ZIXA 2W9MA 5ALRA 3RB6A 2IBKA 1ZD5A 4FS1A 4QZCA 5DQHA 2BQUA 3JPPA 1SV4A 5BOLA 1C7YA 4J9MA 4C8NA 5IIOA 2A1JB 1NJZA 4UB6U 1ZQAA 5B5EU 4NLCA 4DF8A 2KVCA 1S97A 5HNKA 3RJEA 5J0SA 1N61A 7ICTA 1ZQCA 5J0YA 2KOBA 5D4BA 2Y1IA 9ICIA 5KG7A 2QB1A 4I2IA 1NNLA 3ZDAA 2ZUDA 3WK7A 1ZQEA 4DL7A 3ISDA 4FO6A 2EAOA 3ZD9A 1DGSA 5D49A 3KKAA 4O3PA 5J2KA 4F5NA 4DL2A 3QX7A 2XCAA 4KLSA 4UQGA 1V97A 4QZFA 2EZYA 2J6UA 2AQ0A 2KNJA 3M9MB 2ZXIA 1TKDA 3M6ZA 1SZHA 3RBEA 2WF9A 3Q8MA 1Z1VA 2ZJAA 5DQGA 1N5XA 5J2DA 3C2MA 3PVXA 3Q8LA 2EQYA 4KLLA 5ALOA 2NRXA 2GLEA 3GZFA 5HR7A 2G09A 1JROA 5G5HA 4XA5A 4M0AA 4CF3A 4RQ3A 2F1JA 3BDPA 4LJXA 4I2FA 4KLTA 1WG8A 4M9GA 3CYMA 4ECYA 3BZKA 4US8A 5KG5A 4P0QB 4BJQA 2KIVA 5CP2A 4P0PB 1XSLA 2OXOA 3MGIA 4CF4A 2KFZA 2XGQA 1TK8A 3H7IA 1T8EA 3CW2C 1Z3EB 3H0MB 3PX4A 3IDWA 5KFNA 2IMWP 2ES6A 4I2BA 2AGPA 4F4XA 2P35A 3IHQB 2KSOB 2K4IA 5J2AA 4DQPA 4QZ8A 1ZQKA 2VKQA 1SXEA 1RDFA 3MC1A 4AYBC 3LK9A 4KMUA 2ASJA 3WU2U 4M04A 4BDPA 1L7PA 4XRHA 1PVQA 5JRTA 2D3DA 9ICLA 4KN4A 3B0XA 8ICGA 4IQUA 5KFGA 8ICYA 3PR4A 3G6VA 2YB1A 8ICPA 7ICOA 3CRXA 2H3IA 4RPZA 1KQQA 5AM5A 2WHEA 3IV6A 4LVSA 3RTVA 1UT5A 2RQ5A 2WB1F 4QZAA 3MGVA 2P6RA 3WKDA 1MN8A 4ECUA 2JMGA 1COKA 3LWMA 2Y1JA 2XIDA 3CP8A 4DOAA 1QCKA 4DFKA 5IIJA 3IG5A 1WWVA 2KZMA 4Y2PA 1ZETA 5J8YA 5KT3A 5AI8A 3Q8QB 4PPXA 1VDVA 3ZDBA 4KLEA 4DQQA 1U49A 3QE9Y 4IS7A 4QIWC 2J6SA 4DLGA 4CGZA 3L5KA 5GTIU 4LZGA 2QKQA 1X9WA 2YB4A 4RQNA 4YVZA 1Z4NA 4I27A 2YX8A 5KFHA 1DRGA 3RF9A 2HVIA 3Q8KA 4DFJA 3AU2A 4C7ZA 1ZQQA 1MA7A 2OM6A 1F44A 2I1QA 4EYIB 2LM1A 4OO1J 3ZDDA 1S77D 3H8JA 3T5HA 8ICEA 5BPCA 3ISBA 7ICPA 3UXOA 2ZTEA 1SL1A 2G5IB 4I2EA 4UB8U 3EYZA 2VA2A 3U26A 3N97B 2AH5A 2ZIWA 1ZQUA 2VIXA 2PMZF 1OW5A 4EZ6A 2GO7A 4UASA 4RPYA 2K60A 5HHIA 1ZQPA 4JWNA 4GC7A 2B6GA 3PNCA 4NM2A 1FO4A 2HHTA 1NOMA 1Q3UA 3PW5A 4DFDA 4J03A 3KD3A 2ISPA 2C2RA 4Q44A 1PK3A 4EELA 2FMQA 5CJ7A 3H4BA 1ZQTA 5IINA 5T14A 1T94A 1O03A 2E1EA 4C4SA 4GFJA 4R65A 3PW4A 1Z1BA 2ZTCA 2NO5A 9ICEA 1J2MA 8ICAA 5AM2A 3M6KA 4UB2A 2W03A 3C2KA 1NK4A 2F1IA 3GV8B 1OXJA 4PL2A 1BPDA 4B9LA 2JRZA 4IRDA 1CI4A 8ICIA 1IG6A 5F9LA 3IP4B 4NLKA 3SD7A 2HMXA 4J9SA 5L1LA 2FLPA 3PX0A 1KKXA 1TK0A 1ZQIA 2E8OA 3Q8SB 3KZXA 4Q8EA 1NJXA 4DSEA 4QW9A 1QQ6A 2K4HA 1SKRA 3SZ2A 4P4MA 3KZIU 3N7PD 1B43A 2CRXA 2DPJA 3B9JA 5AI0A 1PK1A 2BCRA 2RHFA 2VA3A 4JWMA 1H38A 9ICUA 2YY6A 2W3SA 5AKKA 4ACOA 1L3VA 1PVPA 4UBBA 8ICJA 2NRWA 3G6XA 4M9JA 3WK9A 4C4RA 4QWDA 5DDMA 1X6JA 5EE1A 4CDGA 5AM4A 4YXJA 1CRXA 1U45A 2ZIVB 3NGDA 1V85A 4AYBF 1Z4OA 1N5WA 2AJQA 2PXIA 3THVA 3ICXA 3ALRA 2A1AA 3M8RA 3QUQA 2AGOA 2KICA 4BXOA 7ICGA 2RLTA 4TUSA 2HOQA 1Z00B 1RYUA 5EE3A 4DSJA 5EWGA 2W54A 3S6JA 3K1RB 3MR2A 4GIBA 4NLNA 4O3QA 1OUQA 1B22A 2N1RA 4ED3A 3NVYA 4TURA 1JXEA 5KT6A 4IC9A 1D9DA 1X6IA 3Q8PB 4I2DA 2W04A 2KV2A 4M6WA 3M8SA 3RBDA 1ZD3A 2MRLA 1KN5A 2G06A 4KTQA 1Q3VA 5D46A 4QIWF 3RH4A 4DS5A 2QARA 2H3FA 3AU6A 8ICVA 4F4WA 5HP4A 1XSNA 2ASLA 1LVHA 4EEKA 2XI9A 5J2HA 5ALIA 3BQ7A 1XNSA 2G07A 4DSKA 1CUKA 2R8KA 3HPOA 4Z6EA 2BDPA 1XS9D 1ZD4A 5CB1A 1NJYA 2BQRA 4HYKA 2FDRA 2OHFA 4RQ1A 3TARA 3BS7A 3NUQA 4CF5A 5KFEA 3J81j 2ZJ8A 5J0RA 1SKSA 3PV8A 3SEIA 3UXPA 3AQEA 2FLNA 4O5KA 2F76X 4UB5A 4K4HA 1RYRA 2D6FC 3KOOA 4IQVA 4RT3A 4O3RA 1RYSA 3L3FX 4B9UA 1DK2A 2HBJA 3AN1A 3C5FA 3H0LB 5AM0A 2KN7A 2ODGA 3MFHA 4ECSA 1SWWA 4ZH4A 1L7MA 4F4YA 3QU9A 2A3VA 5J0XA 2WF5A 3MR5A 3HP6A 4KITB 2BPCA 5KT4A 9ICXA 2AQ4A 7ICQA 1TK5A 4R64A 2G08A 5KFJA 4J9NA 1NKBA 4C80A 4EBEA 5KFUA 3MFIA 2KJ8A 4FZMA 4DF4A 4RQ5A 4YD2A 2R8GA 2BPGA 1WCNA 2P6UA 5KG1A 3RB3A 2KFNA 3I76A 2F8KA 4DO9A 1Z19A 1N60A 4DSIA 1DGJA 5AI6A 3OJUA 5EE9A 5DBBA 2W55A 4ECXA 3HX0A 5AHXA 2MSNA 1X9SA 2KKPA 3MR6A 1L7NA 2K8BB 1S76D 2KVSA 4YD1A 3UMGA 3RAXA 2NRZA 1X2IA 1UA1A 3SYZA 1SGGA 7ICSA 1PVRA 2B21A 3IM1A 4DLEA 1D8YA 1UHUA 4NY8A 1KRPA 2BR0A 4M9HA 3JPOA 3HKZC 2MU2A 4TQSA 5CWRA 1FFVA 4DL4A 4AP9A 2KHQA 3C1ZA 1VJ5A 2BCVA 3RH6A 5DB6A 4Q8FA 3KHGA 1K5OA 9ICVA 3T79A 9ICPA 5KL1B 9ICJA 2R8JA 4NXZA 1ZQRA 1UPHA 2W9CB 4ECQA 2Y0SF 1ZXIA 3FDSA 2W3RA 4ICAA 5AKIA 1S9FA 1BPXA 1EXNA 2FI1A 3SR6A 2UVRA 2DBYA 1WYGA 4C7YA 1XU4A 1HUZA 2MAXA 4UAYA 1V9PA 2CPRA 4M2YA 2XY5A 4B6JA 1RPLA 4NLGA 2VJ4A 4QJFB 1SZPA 5AK5A 4IRCA 2F77X 4GLXA 3TAPA 4Y2XA 3PMLA 3VC8A 1LB2B 3GILA 2GOLA 3OHBA 1L3UA 4ECZA 7ICMA 5AKLA 2A19A 2QLTA 3ED5A 1RQLA 4PH5A 1BNPA 5J8YC 3BS5A 2F3NA 2WF6A 5KFOA 8ICTA 2IOFA 1QTMA 5AKEA 1KDHA 5ALEA 1XO1A 9ICRA 3JPRA 1CEZA 4HAIA 1TE2A 4TUQA 2K4EA 3SAHA 3TACB 4BGDA 4PGYA 3K1ZA 2BPFA 4RQ8A 2HHWA 2L5YA 4QW8A 2ZIXB 5F9NA 3PSTA 9ICQA 3QEBZ 2Q0ZX 4EBDA 3AMZA 1Q46A 3NS1A 1KSPA 9ICNA 3WKEA 5AK6A 4KLMA 5EOZA 4ECWA 3D6JA 1FFUA 2VANA 2FMSA 1X9XA 4DQSA 5ALZA 3T3FA 1U47A 3MBYA 4UBCA 8ICUA 5KFYA 3RB0A 5L1IA 4F92B 5DQIA 4QWEA 2YMLA 4F5RA 1D8LA 1MC8A 2M0NA 4DOCA 5J0TA 1BPBA 4M9NA 2W9BA 5AKGA 5ALKA 1N63A 4DWIA 3EW9A 1ZQGA 4KLFA 1SIJA 4KLJA 2BDUA 3QUBA 2JEIA 2YMQA 2F8LA 8ICXA 1MSWD 5FP0A 4ED6A 4DFPA 4RNOA 3IN5A 3LDAA 4MEYA 2CXYA 4Z6CA 1X9MA 2KE7A 1L5UA 5KFBA 5DB9A 5DGBA 3OHAA 3OSNA 1U4BA 3BQ0A 1ZOLA 2E8NA 2ZIUA 3RJIA 4O0IA 4F72A 3BQ1A 4Q43A 3JPSA 4RQ6A 3G6YA 7ICRA 1NZPA 1NK7A 1N2XA 4EX7A 1RXWA 4EX6A 1AQ6A 2ASDA 4YP3A 7ICJA 3RH5A 1AROP 5AI9A 2VA8A 3C1YA 3AUOA 5KG4A 2XY7A 1URJA 3HW8A 4QZIA 5KG2A 4J9KA 2KP7A 8ICRA 2HHVA 2F44A 2PKEA 4C4TA 4C8MA 2HCFA 4RNNA 2OEHA 3HILA 4RPXA 1A0PA 4EEYA 3TI0A 3EUB2 2KIWA 4O5EA 2JGAA 5K4LA 5DDYA 4O3MA 3T5KA 2WTFA 4FZLA 4MF2A 3VCBA 1ZYQA 5AM1A 5ALLA 1Q8KA 4OJPA 2WAQC 2B0CA 4R8UA 4Y2UA 4RT2A 4DL6A 3PSIA 5ALUA 3MABA 3TADA 3NRWA 2D8CA 4A8EA 3V6HA 2O6KA 1ZRNA 3LVWA 5IIMA 3AQFA 5ALTA 3TFRA 4MF8A 4MEXA 4ELVA 2YMPA 2NV3A 3RRHA 1ZJMA 3HKZF 4YFKA 8ICMA 2G0AA 3SAGA 3E0FA 4R63A 8ICSA 4QZGA 3T5LA 1T4GA 2ZJ5A 3RB4A 5ALQA 5DG9A 5KAFU 5CR0A 4ECVA 1JMSA 1S0MA 3UM9A 1L6NA 5AI5A 3BZCA 4BUGA 4KLQA 1ZQHA 2ZG6A 4Y2JA 3HRDD 4UB3A 5J0UA 7ICVA 3QZ8A 4C8LA 5KFVA 2W43A 2DKZA 4NM1A 3HT3A 3N7SC 4F3OA 2FPLA 3SENA 1ZJNA 3KHHA 5ALHA 4Y2YA 5AICA 5G5GA 5KFSA 2ZUCA 4BX9C 4G3IA 3JPNA 1QSLA 5CHGA 5KT7A 2HVHA 3M1YA 3SV4A 2W8KA 9ICCA 5DG7A 2HOFA 2ZIWB 2G5HB 4IR9A 4JUZA 1JIHA 1BPYA 3JPTA 3C2LA 2Q4TA 2IHMA 4MFAA 5AKYA 3PO4A 2PFQA 4UAVA 2FJ6A 1O08A 3WK5A 2DFLA 2W8LA 2EANA 3R9KA 3TKAA 4CE6A 2V9WA 3GU3A 8ICBA 1ZQOA 2J6TA 1ZD2P 4B9VA 1ZQXA 2E3TA 4MFFA 3PW7A 3NVWA 4JV1A 2KEYA 5KFZA 3H8WA 4OJOA 1SV0A 2R18A 2HHUA 3QEAZ 5KAIU 1Y88A 4ED2A 4Y2SA 5J0QA 3B0YA 1NK6A 2E5SA 4F4ZA 2GWSA 4B9SA 5DB7A 3SI8A 4M47A 4O3SA 3ONNA 3ZD8A 4NLZA 4DSLA 2XC9A 1B0XA 2FLLA 3GV7B 1YZ6A 3RJHA 4B9TA 4DSFA 1BPZA 2W9AA 3C29A 5KNIA 2MUTA 2DL0A 2R8HA 3WK6A 1JALA 2H3QA 4QWBA 1IM4A 2BQ3A 4ECTA 4I2GA 3GIJA 2LPEA 3KTQA 2JZBA 5C0YA 1SB3C 5CA7A 2K89A 1LKYA 4QNLA 1X40A 5J2BA 2JEFA 3TQ1A 3V7JA 2LYBA 3DV9A 1GO3F 2E1FA 5DLFA 4I2CA 4PGQA 4KX3A 1J2NA 4RQ0A 3GFKB 3DEEA 1QSYA 7ICFA 1F5SA 1V38A 2UVUA 4PHDA 1NK8A 3HJEA 3ZI4A 4K4GA 1RQNA 2PFOA 4DOBA 1ZQWA 4F8RA 5ALDA 7ICNA 3UXNA 2JEJA 5B66U 1PK1B 3FC4A 4I2JA 1J97A 5A0LA 1L8LA 2DF4B 2KJ9A 3OGUA 1ZQNA 4JK1A 4OCZA 3N4MB 5J2JA 3LYSA 1T3NA 1U48A 1JI7A 2LYAA 3UMCA 5KT2A 2ISOA 1LV5A 4TUPA 8ICFA 1NKCA 5KFIA 1X66A 4YXMA 1KFDA 9ICHA 4MHVA 1COOA 4I28A 3NASA 2WAQF 1SXDA 2LHTA 5J2GA 9ICMA 3TAQA 2LI6A 5J2IA 1KW4A 3MDAA 2A1JA 4KN7A 4BXOB 2WB1C 5C5JA 3RJGA 4TQRA 4U7CA 2XVTA 3I1YA 3RJJA 4DEZA 1XWLA 7ICHA 2ALZA 1HIWA 4QZ9A 1IXRA 2EAMA 8ICNA 2BCSA 5L1JA 2DWQA 1BVSA 2PFNA 4C0ZA 1JUDA 4RQMA 3EPIA 3GIMA 4QZEA 3WKBA 3QU4A 4M6WB 1XO0A 2I5HA 5KFDA 1DXSA 4IRKA 3AM9A 2QB0A 1B4FA 2RDIA 4PHAA 4KLHA 1BPEA 1NJWA 8ICWA 3WK4A 3UMBA 5AKZA 1K1SA 4BWMA 2W7PA 4CCHA 3H8SA 5JUMA 2QARB 5DKWA 4RNMA 1T3QA 2ZXHA 2NO4A 1QLNA 2P66A 4RUAA 1MQ3A 4DCCA 1S8OA 5AIAA 2H3VA 4I29A 5E79U 4B9MA 3LWLA 3QXGA 8ICQA 5L1MA 3H40A 4P0QA 4GXKA 5J0PA 9ICGA 3F5AA 4P0PA 9ICAA 4F5PA 2HSZA 1HJPA 2JXJA 1QQ7A 1SL0A 3FAHA 4P4PA 2LM4A 4NL9C 2BHNA 4QWAA 1ZQZA 3KBBA 5DLGA 4O9MA 4O3NA 4PZOA 3MDCA 1TAUA 4F71A 2GH1A 2HBMA 1MQ2A 2KSOA 2IOFK 4ED0A 1SWVA 5KG6A 3FM9A 4NWIA 4PL1A 5HMLA 4ELTA 2HHXA 2HOIA 1WWUA 4B9NA 1PZNA 4NV0A 2HHQA 5ALFA 4YR2A 4NJ8A 2W7OA 4GXIA 2H5XA 4Y2RA 3LVVA 3OPXA 1T7PA 4RQ7A 4Q45A 5HMMA 4Y2QA 3RJFA 4IQWA 2PI4A 5KFTA 4WJ3B 3TANA 4F5OA 3ZDCA 3ETLA 4US9A 5KL8B 1D8BA 2QB0B 3ORYA 3ZDEA 2BCQA 2JH1A 4O3OA 2C2EA 3PSFA 2R8IA 2F1HA 4F91B 5J0OA 4P4OA 2CN1A 2OWOA 8ICKA 2ESEA 3NTUA 4UW9A 4PHEA 1RZTA 1K1QA 1FEZA 5KTQA 3HWTA 5KFWA 3GQCA 3C21A 5ALXA 2NRVA 5J2CA 5KG3A 2Y9UA 3F2CA 3F53A 1RXVA 1UQVA 3RFAA 5L9XA 1NI3A 3AEVA 2KZZA 2AXTU 4NL9A 1D9FA 3RR7A 2H3ZA 1S10A 5DBAA 3L4PA 3TADC 4UB1A 1RG6A 3E58A 5JTIA 1HUOA 3M7DA 7ICIA 4QZHA 3QZ7A 2KZ3A 4UAUA 1HEKA 1NK5A 1ZQ1C 4UAWA 4F4KA 1ZQLA 1TFRA 3QNMA 3MR3A 4U6PA 5J2FA 3PR5B 4YR0A 1SKWA 1ZRMA 4J9RA 5AK3A 2HBKA 1S0VA 5TISU 1S0NA 2EH9A 3MGHA 3F5EA 3QUTA 4RUCA 3UQ0A 4EBCA 1NZBA 4ECRA 5ALNA 2MA1A 5AKHA 2JH7A 2WF8A 5AKXA 2OYYA 1A77A 2ZUBA 4DS4A 3Q8RB 4ELUA 3BS5B 4RZRA 3OJSA 3PMNA 3SV3A 4F2RA 1SL2A 3UPQA 1DK3A 5HR6A 1WUDA 1QH9A 2HHSA 4F93B 4OJ6A 9ICTA 2PFPA 4O5CA 4YG2A 5L1KA 2ZTDA 3IG8A 4J9QA 2WFAA 2EZZA 1C20A 5ALMA 2IOHA 2KTQA 4I2AA 1KFTA 4JV0A 2JHDA 3PO5A 4DFMA 3CNHA 4ZOHC 3NVZA 7ICEA 1KFSA 2DUYA 4LZDA 3RJKA 1A6SA 3PSPA 2E8MA 2RDJA 2NYVA 1TV9A 1NK9A 2Y9TA 5KFPA 2W9BB 5CEHA 5KFKA 4BWJA 1KLNA 5TZVA 3C23A 3M9NB 4KX5A 5IIKA 2E8PA 9ICKA 4Y2TA 3RR8A 5KG0A 5KFFA 1S0OA 2KD1A 1ZQJA 1SV0C 4ED7A 3D2QA 4OD0A 2AU0A 4OJ5A 3KFUF 2IHNA 1VLBA 2YQEA 2WF7A 2V4QA 4CRXA 4FBTA 2JV3A 5IILA 1F0MA 2KMDA 2RP5A 2ZIUB 3ISCA 5AI4A 3RRGA 3UQ2A 3NVVA 2DQNB 5EWFA 1KEJA 2HBLA 3T5JA 4YMNA 8ICHA 4DQIA 4FZNA 1N62A 2BZFA 1L8OA 4F2SA 2K8CB 5KFRA 5KFAA 4IR1A 2M9NA 3QU5A 1TAQA 4JV2A 4PGXA 5EE0A 5DB8A 5J2EA 4YR3A 4FE3A 4FS2A 3H0RB 2ZIVA 3F2DA 4KLUA 4QZDA 1ZQDA 1N48A 1QQ5A 2UVVA 4P2HA 3QU7A 4JB3A 2XCPA 1FIQA 2DKXA 3D2SA 4FBUA 1Z00A 4G9BA 9ICOA 1PUZA 2NRTA 4YMOA 1DOQA 2FMPA 3D2NA 2VJ5A 1JN3A 4PJ0U 4J9PA 1BGXT 4UARA 4YQWA 1JXLA 1KBUA 8ICOA 4KLDA 2PI5A 1X42A 5KT5A 4RQ2A 5ALJA 2RRDA 5JU5A 4UB4A 4K4IA 3OSPA 4Z6DA 2JR5A 4R8UB 2C28A 1L7OA 4J9OA 2OH2A 5ALVA 3KHLA 2XO7A 3GDXA 4DQRA 4GXJA 5F3XB 3PW2A 4XQ8A 1UCVA 2FPMA 3GIIA 2C22A 2Y0SC 5ALYA 4F5QA 4KLIA 4EYHB 1ZQMA 5ALWA 3BJYA 3C28A 5DG8A 1TVAA 5J29A 3QUCA 4Z6FA 3PY8A 3GIKA 5AM3A 1M6YA 5KFXA 2KKVA 4X5VA 8ICZA 3I28A 1IV8A 4MFCA 1KL9A 1ED1A 4KLOA 5EWEA 3K4GA 3KHRA 5IIIA 3WK8A 4QWCA 1XC9A 4DL5A 3M9OB 2JEGA 1UA0A 4KMOB 4YCXA 3PX6A 2HI0A 5KFMA 4Y2VA 3N28A 5DBCA 2BCUA 4C8KA 4IL6U 3SAFA 2XICA 3NRZA 2V4RA 5AIBA 5J0WA 4UAZA 2I9GA 1ZQBA 3PZPA 9ICWA 1L3TA 9ICSA 2BGWA 2YTUA 5BOMA 2IA6A 2YMMA 2Z7JA 3A0HU 3SQIA 4ED8A 2DGZA 2KJ5A 3EWAA 7ICLA 3WKCA 1ECWA 1KTQA 3IRUA 4RU9A 3C5GA 2EDUA 5KFCA 4XUSA 1NK0A 4UATA 3V6KA 2HDOA 2K8AA 2FPKA 5H2FU 1A76A 1BNOA 2EAPA 5KFLA 3FYHA 3N7RC 4RQ4A 4YMMA 1UT8A 8ICLA 1ZQFA 7ICUA 4IQTA 5AK4A 2KG5A 3SMVA 2K4PA 1U9LA 7ICKA 2KK0A 1ZQYA 1YZ7A 5DGAA 4I2HA 3V72A 4PZNA 2HW3A 5ALGA 2I6XA 3H4DA 2FE9A 2OCEA 2MUTB 3BQTA 4EENA 1NKEA 2C2DA 2DPIA 4QZBA 3A0BU 2LMRA 2LBOA 5GTHU 2W9CA 4JMUA 2XY6A 3EPGA 4PHPA 1JRPA 1ZQSA 2UVWA 1XSPA 3BQ2A 1ZQVA 2JZBB 1P7DA 3F2BA 5AKJA 4R66A 3K75D 4USAA 1LKYB 3KKAC 3TFSA 3AL0B 9ICBA 2BKEA 4GC6A 1TAMA 5KFQA 4C8OA 1IIPA 4ED1A 4M9LA 3QU2A
chains in the Genus database with same CATH topology
3TADA 1COKA 1V85A 2D8CA 2Y9UA 1JI7A 1Z1VA 1SV0A 5L1MA 1WWVA 5JU5A 1UQVA 5J8YA 1X66A 2KE7A 2E8MA 2Y9TA 4MHVA 1OXJA 2GLEA 4NL9A 4IS7A 1SXDA 4NL9C 3K1RB 5F3XB 2E8NA 3TADC 2QKQA 1KW4A 1RG6A 5JTIA 2EAPA 4RQNA 2E8PA 1UCVA 4PZOA 1B0XA 5KNIA 1SV0C 3H8MA 2DL0A 2KIVA 2KG5A 2KSOA 2K4PA 5J8YC 2E8OA 3BS5A 2F3NA 2F8KA 1WWUA 2JV3A 1SV4A 2DKZA 2EAMA 1F0MA 2KMDA 3SENA 1OW5A 3IDWA 4NJ8A 4PZNA 2LPEA 4RQMA 2ES6A 2QARA 3TACB 2FE9A 1LKYA 1X40A 2KSOB 2L5YA 1PK1A 2F44A 2K60A 1SGGA 1SXEA 2LMRA 3BQ7A 3BS5B 1DXSA 2QB0B 2B6GA 3HILA 2QB0A 1B4FA 5JRTA 2D3DA 2QB1A 1V38A 1X9XA 2EAOA 2QARB 3KKAA 2DKXA 1LKYB 3KKAC 2EANA 1PK1B 3BS7A 2ESEA 1PK3A 3SEIA 2YTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAD A;  1COK A;  1V85 A;  2D8C A;  2Y9U A;  1JI7 A;  1Z1V A;  1SV0 A;  5L1M A;  1WWV A;  5JU5 A;  1UQV A;  5J8Y A;  1X66 A;  2KE7 A;  2E8M A;  2Y9T A;  4MHV A;  1OXJ A;  2GLE A;  4NL9 A;  4IS7 A;  1SXD A;  4NL9 C;  3K1R B;  5F3X B;  2E8N A;  3TAD C;  2QKQ A;  1KW4 A;  1RG6 A;  5JTI A;  2EAP A;  4RQN A;  2E8P A;  1UCV A;  4PZO A;  1B0X A;  5KNI A;  1SV0 C;  3H8M A;  2DL0 A;  2KIV A;  2KG5 A;  2KSO A;  2K4P A;  5J8Y C;  2E8O A;  3BS5 A;  2F3N A;  2F8K A;  1WWU A;  2JV3 A;  1SV4 A;  2DKZ A;  2EAM A;  1F0M A;  2KMD A;  3SEN A;  1OW5 A;  3IDW A;  4NJ8 A;  4PZN A;  2LPE A;  4RQM A;  2ES6 A;  2QAR A;  3TAC B;  2FE9 A;  1LKY A;  1X40 A;  2KSO B;  2L5Y A;  1PK1 A;  2F44 A;  2K60 A;  1SGG A;  1SXE A;  2LMR A;  3BQ7 A;  3BS5 B;  1DXS A;  2QB0 B;  2B6G A;  3HIL A;  2QB0 A;  1B4F A;  5JRT A;  2D3D A;  2QB1 A;  1V38 A;  1X9X A;  2EAO A;  2QAR B;  3KKA A;  2DKX A;  1LKY B;  3KKA C;  2EAN A;  1PK1 B;  3BS7 A;  2ESE A;  1PK3 A;  3SEI A;  2YTU A; 
#chains in the Genus database with same CATH topology
 4DL3 A;  2XGP A;  3PW0 A;  2YN4 A;  5HHH A;  3WKA A;  4OJL A;  3V7K A;  2LKY A;  8ICC A;  3O0F A;  1WCL A;  4E0D A;  3GV5 B;  3V6J A;  2F2A B;  2AHO B;  2AGQ A;  1L3S A;  3V7L A;  4F50 A;  4NLB A;  2LYH A;  3DDH A;  1JX4 A;  1S5L U;  3QYP A;  2W11 A;  3OTQ A;  2PMZ C;  4FFD A;  3E2E A;  1YT3 A;  3EZ5 A;  5ALP A;  4CNQ A;  2KHV A;  4EZ9 A;  3ETR A;  1QSS A;  1N56 A;  1RM6 C;  2EZX A;  3RAQ A;  4J9L A;  3JPQ A;  9ICF A;  4KLG A;  5ALS A;  5CRX A;  3H8M A;  2ATL A;  4YN4 A;  2ZIX A;  2W9M A;  5ALR A;  3RB6 A;  2IBK A;  1ZD5 A;  4FS1 A;  4QZC A;  5DQH A;  2BQU A;  3JPP A;  1SV4 A;  5BOL A;  1C7Y A;  4J9M A;  4C8N A;  5IIO A;  2A1J B;  1NJZ A;  4UB6 U;  1ZQA A;  5B5E U;  4NLC A;  4DF8 A;  2KVC A;  1S97 A;  5HNK A;  3RJE A;  5J0S A;  1N61 A;  7ICT A;  1ZQC A;  5J0Y A;  2KOB A;  5D4B A;  2Y1I A;  9ICI A;  5KG7 A;  2QB1 A;  4I2I A;  1NNL A;  3ZDA A;  2ZUD A;  3WK7 A;  1ZQE A;  4DL7 A;  3ISD A;  4FO6 A;  2EAO A;  3ZD9 A;  1DGS A;  5D49 A;  3KKA A;  4O3P A;  5J2K A;  4F5N A;  4DL2 A;  3QX7 A;  2XCA A;  4KLS A;  4UQG A;  1V97 A;  4QZF A;  2EZY A;  2J6U A;  2AQ0 A;  2KNJ A;  3M9M B;  2ZXI A;  1TKD A;  3M6Z A;  1SZH A;  3RBE A;  2WF9 A;  3Q8M A;  1Z1V A;  2ZJA A;  5DQG A;  1N5X A;  5J2D A;  3C2M A;  3PVX A;  3Q8L A;  2EQY A;  4KLL A;  5ALO A;  2NRX A;  2GLE A;  3GZF A;  5HR7 A;  2G09 A;  1JRO A;  5G5H A;  4XA5 A;  4M0A A;  4CF3 A;  4RQ3 A;  2F1J A;  3BDP A;  4LJX A;  4I2F A;  4KLT A;  1WG8 A;  4M9G A;  3CYM A;  4ECY A;  3BZK A;  4US8 A;  5KG5 A;  4P0Q B;  4BJQ A;  2KIV A;  5CP2 A;  4P0P B;  1XSL A;  2OXO A;  3MGI A;  4CF4 A;  2KFZ A;  2XGQ A;  1TK8 A;  3H7I A;  1T8E A;  3CW2 C;  1Z3E B;  3H0M B;  3PX4 A;  3IDW A;  5KFN A;  2IMW P;  2ES6 A;  4I2B A;  2AGP A;  4F4X A;  2P35 A;  3IHQ B;  2KSO B;  2K4I A;  5J2A A;  4DQP A;  4QZ8 A;  1ZQK A;  2VKQ A;  1SXE A;  1RDF A;  3MC1 A;  4AYB C;  3LK9 A;  4KMU A;  2ASJ A;  3WU2 U;  4M04 A;  4BDP A;  1L7P A;  4XRH A;  1PVQ A;  5JRT A;  2D3D A;  9ICL A;  4KN4 A;  3B0X A;  8ICG A;  4IQU A;  5KFG A;  8ICY A;  3PR4 A;  3G6V A;  2YB1 A;  8ICP A;  7ICO A;  3CRX A;  2H3I A;  4RPZ A;  1KQQ A;  5AM5 A;  2WHE A;  3IV6 A;  4LVS A;  3RTV A;  1UT5 A;  2RQ5 A;  2WB1 F;  4QZA A;  3MGV A;  2P6R A;  3WKD A;  1MN8 A;  4ECU A;  2JMG A;  1COK A;  3LWM A;  2Y1J A;  2XID A;  3CP8 A;  4DOA A;  1QCK A;  4DFK A;  5IIJ A;  3IG5 A;  1WWV A;  2KZM A;  4Y2P A;  1ZET A;  5J8Y A;  5KT3 A;  5AI8 A;  3Q8Q B;  4PPX A;  1VDV A;  3ZDB A;  4KLE A;  4DQQ A;  1U49 A;  3QE9 Y;  4IS7 A;  4QIW C;  2J6S A;  4DLG A;  4CGZ A;  3L5K A;  5GTI U;  4LZG A;  2QKQ A;  1X9W A;  2YB4 A;  4RQN A;  4YVZ A;  1Z4N A;  4I27 A;  2YX8 A;  5KFH A;  1DRG A;  3RF9 A;  2HVI A;  3Q8K A;  4DFJ A;  3AU2 A;  4C7Z A;  1ZQQ A;  1MA7 A;  2OM6 A;  1F44 A;  2I1Q A;  4EYI B;  2LM1 A;  4OO1 J;  3ZDD A;  1S77 D;  3H8J A;  3T5H A;  8ICE A;  5BPC A;  3ISB A;  7ICP A;  3UXO A;  2ZTE A;  1SL1 A;  2G5I B;  4I2E A;  4UB8 U;  3EYZ A;  2VA2 A;  3U26 A;  3N97 B;  2AH5 A;  2ZIW A;  1ZQU A;  2VIX A;  2PMZ F;  1OW5 A;  4EZ6 A;  2GO7 A;  4UAS A;  4RPY A;  2K60 A;  5HHI A;  1ZQP A;  4JWN A;  4GC7 A;  2B6G A;  3PNC A;  4NM2 A;  1FO4 A;  2HHT A;  1NOM A;  1Q3U A;  3PW5 A;  4DFD A;  4J03 A;  3KD3 A;  2ISP A;  2C2R A;  4Q44 A;  1PK3 A;  4EEL A;  2FMQ A;  5CJ7 A;  3H4B A;  1ZQT A;  5IIN A;  5T14 A;  1T94 A;  1O03 A;  2E1E A;  4C4S A;  4GFJ A;  4R65 A;  3PW4 A;  1Z1B A;  2ZTC A;  2NO5 A;  9ICE A;  1J2M A;  8ICA A;  5AM2 A;  3M6K A;  4UB2 A;  2W03 A;  3C2K A;  1NK4 A;  2F1I A;  3GV8 B;  1OXJ A;  4PL2 A;  1BPD A;  4B9L A;  2JRZ A;  4IRD A;  1CI4 A;  8ICI A;  1IG6 A;  5F9L A;  3IP4 B;  4NLK A;  3SD7 A;  2HMX A;  4J9S A;  5L1L A;  2FLP A;  3PX0 A;  1KKX A;  1TK0 A;  1ZQI A;  2E8O A;  3Q8S B;  3KZX A;  4Q8E A;  1NJX A;  4DSE A;  4QW9 A;  1QQ6 A;  2K4H A;  1SKR A;  3SZ2 A;  4P4M A;  3KZI U;  3N7P D;  1B43 A;  2CRX A;  2DPJ A;  3B9J A;  5AI0 A;  1PK1 A;  2BCR A;  2RHF A;  2VA3 A;  4JWM A;  1H38 A;  9ICU A;  2YY6 A;  2W3S A;  5AKK A;  4ACO A;  1L3V A;  1PVP A;  4UBB A;  8ICJ A;  2NRW A;  3G6X A;  4M9J A;  3WK9 A;  4C4R A;  4QWD A;  5DDM A;  1X6J A;  5EE1 A;  4CDG A;  5AM4 A;  4YXJ A;  1CRX A;  1U45 A;  2ZIV B;  3NGD A;  1V85 A;  4AYB F;  1Z4O A;  1N5W A;  2AJQ A;  2PXI A;  3THV A;  3ICX A;  3ALR A;  2A1A A;  3M8R A;  3QUQ A;  2AGO A;  2KIC A;  4BXO A;  7ICG A;  2RLT A;  4TUS A;  2HOQ A;  1Z00 B;  1RYU A;  5EE3 A;  4DSJ A;  5EWG A;  2W54 A;  3S6J A;  3K1R B;  3MR2 A;  4GIB A;  4NLN A;  4O3Q A;  1OUQ A;  1B22 A;  2N1R A;  4ED3 A;  3NVY A;  4TUR A;  1JXE A;  5KT6 A;  4IC9 A;  1D9D A;  1X6I A;  3Q8P B;  4I2D A;  2W04 A;  2KV2 A;  4M6W A;  3M8S A;  3RBD A;  1ZD3 A;  2MRL A;  1KN5 A;  2G06 A;  4KTQ A;  1Q3V A;  5D46 A;  4QIW F;  3RH4 A;  4DS5 A;  2QAR A;  2H3F A;  3AU6 A;  8ICV A;  4F4W A;  5HP4 A;  1XSN A;  2ASL A;  1LVH A;  4EEK A;  2XI9 A;  5J2H A;  5ALI A;  3BQ7 A;  1XNS A;  2G07 A;  4DSK A;  1CUK A;  2R8K A;  3HPO A;  4Z6E A;  2BDP A;  1XS9 D;  1ZD4 A;  5CB1 A;  1NJY A;  2BQR A;  4HYK A;  2FDR A;  2OHF A;  4RQ1 A;  3TAR A;  3BS7 A;  3NUQ A;  4CF5 A;  5KFE A;  3J81 j;  2ZJ8 A;  5J0R A;  1SKS A;  3PV8 A;  3SEI A;  3UXP A;  3AQE A;  2FLN A;  4O5K A;  2F76 X;  4UB5 A;  4K4H A;  1RYR A;  2D6F C;  3KOO A;  4IQV A;  4RT3 A;  4O3R A;  1RYS A;  3L3F X;  4B9U A;  1DK2 A;  2HBJ A;  3AN1 A;  3C5F A;  3H0L B;  5AM0 A;  2KN7 A;  2ODG A;  3MFH A;  4ECS A;  1SWW A;  4ZH4 A;  1L7M A;  4F4Y A;  3QU9 A;  2A3V A;  5J0X A;  2WF5 A;  3MR5 A;  3HP6 A;  4KIT B;  2BPC A;  5KT4 A;  9ICX A;  2AQ4 A;  7ICQ A;  1TK5 A;  4R64 A;  2G08 A;  5KFJ A;  4J9N A;  1NKB A;  4C80 A;  4EBE A;  5KFU A;  3MFI A;  2KJ8 A;  4FZM A;  4DF4 A;  4RQ5 A;  4YD2 A;  2R8G A;  2BPG A;  1WCN A;  2P6U A;  5KG1 A;  3RB3 A;  2KFN A;  3I76 A;  2F8K A;  4DO9 A;  1Z19 A;  1N60 A;  4DSI A;  1DGJ A;  5AI6 A;  3OJU A;  5EE9 A;  5DBB A;  2W55 A;  4ECX A;  3HX0 A;  5AHX A;  2MSN A;  1X9S A;  2KKP A;  3MR6 A;  1L7N A;  2K8B B;  1S76 D;  2KVS A;  4YD1 A;  3UMG A;  3RAX A;  2NRZ A;  1X2I A;  1UA1 A;  3SYZ A;  1SGG A;  7ICS A;  1PVR A;  2B21 A;  3IM1 A;  4DLE A;  1D8Y A;  1UHU A;  4NY8 A;  1KRP A;  2BR0 A;  4M9H A;  3JPO A;  3HKZ C;  2MU2 A;  4TQS A;  5CWR A;  1FFV A;  4DL4 A;  4AP9 A;  2KHQ A;  3C1Z A;  1VJ5 A;  2BCV A;  3RH6 A;  5DB6 A;  4Q8F A;  3KHG A;  1K5O A;  9ICV A;  3T79 A;  9ICP A;  5KL1 B;  9ICJ A;  2R8J A;  4NXZ A;  1ZQR A;  1UPH A;  2W9C B;  4ECQ A;  2Y0S F;  1ZXI A;  3FDS A;  2W3R A;  4ICA A;  5AKI A;  1S9F A;  1BPX A;  1EXN A;  2FI1 A;  3SR6 A;  2UVR A;  2DBY A;  1WYG A;  4C7Y A;  1XU4 A;  1HUZ A;  2MAX A;  4UAY A;  1V9P A;  2CPR A;  4M2Y A;  2XY5 A;  4B6J A;  1RPL A;  4NLG A;  2VJ4 A;  4QJF B;  1SZP A;  5AK5 A;  4IRC A;  2F77 X;  4GLX A;  3TAP A;  4Y2X A;  3PML A;  3VC8 A;  1LB2 B;  3GIL A;  2GOL A;  3OHB A;  1L3U A;  4ECZ A;  7ICM A;  5AKL A;  2A19 A;  2QLT A;  3ED5 A;  1RQL A;  4PH5 A;  1BNP A;  5J8Y C;  3BS5 A;  2F3N A;  2WF6 A;  5KFO A;  8ICT A;  2IOF A;  1QTM A;  5AKE A;  1KDH A;  5ALE A;  1XO1 A;  9ICR A;  3JPR A;  1CEZ A;  4HAI A;  1TE2 A;  4TUQ A;  2K4E A;  3SAH A;  3TAC B;  4BGD A;  4PGY A;  3K1Z A;  2BPF A;  4RQ8 A;  2HHW A;  2L5Y A;  4QW8 A;  2ZIX B;  5F9N A;  3PST A;  9ICQ A;  3QEB Z;  2Q0Z X;  4EBD A;  3AMZ A;  1Q46 A;  3NS1 A;  1KSP A;  9ICN A;  3WKE A;  5AK6 A;  4KLM A;  5EOZ A;  4ECW A;  3D6J A;  1FFU A;  2VAN A;  2FMS A;  1X9X A;  4DQS A;  5ALZ A;  3T3F A;  1U47 A;  3MBY A;  4UBC A;  8ICU A;  5KFY A;  3RB0 A;  5L1I A;  4F92 B;  5DQI A;  4QWE A;  2YML A;  4F5R A;  1D8L A;  1MC8 A;  2M0N A;  4DOC A;  5J0T A;  1BPB A;  4M9N A;  2W9B A;  5AKG A;  5ALK A;  1N63 A;  4DWI A;  3EW9 A;  1ZQG A;  4KLF A;  1SIJ A;  4KLJ A;  2BDU A;  3QUB A;  2JEI A;  2YMQ A;  2F8L A;  8ICX A;  1MSW D;  5FP0 A;  4ED6 A;  4DFP A;  4RNO A;  3IN5 A;  3LDA A;  4MEY A;  2CXY A;  4Z6C A;  1X9M A;  2KE7 A;  1L5U A;  5KFB A;  5DB9 A;  5DGB A;  3OHA A;  3OSN A;  1U4B A;  3BQ0 A;  1ZOL A;  2E8N A;  2ZIU A;  3RJI A;  4O0I A;  4F72 A;  3BQ1 A;  4Q43 A;  3JPS A;  4RQ6 A;  3G6Y A;  7ICR A;  1NZP A;  1NK7 A;  1N2X A;  4EX7 A;  1RXW A;  4EX6 A;  1AQ6 A;  2ASD A;  4YP3 A;  7ICJ A;  3RH5 A;  1ARO P;  5AI9 A;  2VA8 A;  3C1Y A;  3AUO A;  5KG4 A;  2XY7 A;  1URJ A;  3HW8 A;  4QZI A;  5KG2 A;  4J9K A;  2KP7 A;  8ICR A;  2HHV A;  2F44 A;  2PKE A;  4C4T A;  4C8M A;  2HCF A;  4RNN A;  2OEH A;  3HIL A;  4RPX A;  1A0P A;  4EEY A;  3TI0 A;  3EUB 2;  2KIW A;  4O5E A;  2JGA A;  5K4L A;  5DDY A;  4O3M A;  3T5K A;  2WTF A;  4FZL A;  4MF2 A;  3VCB A;  1ZYQ A;  5AM1 A;  5ALL A;  1Q8K A;  4OJP A;  2WAQ C;  2B0C A;  4R8U A;  4Y2U A;  4RT2 A;  4DL6 A;  3PSI A;  5ALU A;  3MAB A;  3TAD A;  3NRW A;  2D8C A;  4A8E A;  3V6H A;  2O6K A;  1ZRN A;  3LVW A;  5IIM A;  3AQF A;  5ALT A;  3TFR A;  4MF8 A;  4MEX A;  4ELV A;  2YMP A;  2NV3 A;  3RRH A;  1ZJM A;  3HKZ F;  4YFK A;  8ICM A;  2G0A A;  3SAG A;  3E0F A;  4R63 A;  8ICS A;  4QZG A;  3T5L A;  1T4G A;  2ZJ5 A;  3RB4 A;  5ALQ A;  5DG9 A;  5KAF U;  5CR0 A;  4ECV A;  1JMS A;  1S0M A;  3UM9 A;  1L6N A;  5AI5 A;  3BZC A;  4BUG A;  4KLQ A;  1ZQH A;  2ZG6 A;  4Y2J A;  3HRD D;  4UB3 A;  5J0U A;  7ICV A;  3QZ8 A;  4C8L A;  5KFV A;  2W43 A;  2DKZ A;  4NM1 A;  3HT3 A;  3N7S C;  4F3O A;  2FPL A;  3SEN A;  1ZJN A;  3KHH A;  5ALH A;  4Y2Y A;  5AIC A;  5G5G A;  5KFS A;  2ZUC A;  4BX9 C;  4G3I A;  3JPN A;  1QSL A;  5CHG A;  5KT7 A;  2HVH A;  3M1Y A;  3SV4 A;  2W8K A;  9ICC A;  5DG7 A;  2HOF A;  2ZIW B;  2G5H B;  4IR9 A;  4JUZ A;  1JIH A;  1BPY A;  3JPT A;  3C2L A;  2Q4T A;  2IHM A;  4MFA A;  5AKY A;  3PO4 A;  2PFQ A;  4UAV A;  2FJ6 A;  1O08 A;  3WK5 A;  2DFL A;  2W8L A;  2EAN A;  3R9K A;  3TKA A;  4CE6 A;  2V9W A;  3GU3 A;  8ICB A;  1ZQO A;  2J6T A;  1ZD2 P;  4B9V A;  1ZQX A;  2E3T A;  4MFF A;  3PW7 A;  3NVW A;  4JV1 A;  2KEY A;  5KFZ A;  3H8W A;  4OJO A;  1SV0 A;  2R18 A;  2HHU A;  3QEA Z;  5KAI U;  1Y88 A;  4ED2 A;  4Y2S A;  5J0Q A;  3B0Y A;  1NK6 A;  2E5S A;  4F4Z A;  2GWS A;  4B9S A;  5DB7 A;  3SI8 A;  4M47 A;  4O3S A;  3ONN A;  3ZD8 A;  4NLZ A;  4DSL A;  2XC9 A;  1B0X A;  2FLL A;  3GV7 B;  1YZ6 A;  3RJH A;  4B9T A;  4DSF A;  1BPZ A;  2W9A A;  3C29 A;  5KNI A;  2MUT A;  2DL0 A;  2R8H A;  3WK6 A;  1JAL A;  2H3Q A;  4QWB A;  1IM4 A;  2BQ3 A;  4ECT A;  4I2G A;  3GIJ A;  2LPE A;  3KTQ A;  2JZB A;  5C0Y A;  1SB3 C;  5CA7 A;  2K89 A;  1LKY A;  4QNL A;  1X40 A;  5J2B A;  2JEF A;  3TQ1 A;  3V7J A;  2LYB A;  3DV9 A;  1GO3 F;  2E1F A;  5DLF A;  4I2C A;  4PGQ A;  4KX3 A;  1J2N A;  4RQ0 A;  3GFK B;  3DEE A;  1QSY A;  7ICF A;  1F5S A;  1V38 A;  2UVU A;  4PHD A;  1NK8 A;  3HJE A;  3ZI4 A;  4K4G A;  1RQN A;  2PFO A;  4DOB A;  1ZQW A;  4F8R A;  5ALD A;  7ICN A;  3UXN A;  2JEJ A;  5B66 U;  1PK1 B;  3FC4 A;  4I2J A;  1J97 A;  5A0L A;  1L8L A;  2DF4 B;  2KJ9 A;  3OGU A;  1ZQN A;  4JK1 A;  4OCZ A;  3N4M B;  5J2J A;  3LYS A;  1T3N A;  1U48 A;  1JI7 A;  2LYA A;  3UMC A;  5KT2 A;  2ISO A;  1LV5 A;  4TUP A;  8ICF A;  1NKC A;  5KFI A;  1X66 A;  4YXM A;  1KFD A;  9ICH A;  4MHV A;  1COO A;  4I28 A;  3NAS A;  2WAQ F;  1SXD A;  2LHT A;  5J2G A;  9ICM A;  3TAQ A;  2LI6 A;  5J2I A;  1KW4 A;  3MDA A;  2A1J A;  4KN7 A;  4BXO B;  2WB1 C;  5C5J A;  3RJG A;  4TQR A;  4U7C A;  2XVT A;  3I1Y A;  3RJJ A;  4DEZ A;  1XWL A;  7ICH A;  2ALZ A;  1HIW A;  4QZ9 A;  1IXR A;  2EAM A;  8ICN A;  2BCS A;  5L1J A;  2DWQ A;  1BVS A;  2PFN A;  4C0Z A;  1JUD A;  4RQM A;  3EPI A;  3GIM A;  4QZE A;  3WKB A;  3QU4 A;  4M6W B;  1XO0 A;  2I5H A;  5KFD A;  1DXS A;  4IRK A;  3AM9 A;  2QB0 A;  1B4F A;  2RDI A;  4PHA A;  4KLH A;  1BPE A;  1NJW A;  8ICW A;  3WK4 A;  3UMB A;  5AKZ A;  1K1S A;  4BWM A;  2W7P A;  4CCH A;  3H8S A;  5JUM A;  2QAR B;  5DKW A;  4RNM A;  1T3Q A;  2ZXH A;  2NO4 A;  1QLN A;  2P66 A;  4RUA A;  1MQ3 A;  4DCC A;  1S8O A;  5AIA A;  2H3V A;  4I29 A;  5E79 U;  4B9M A;  3LWL A;  3QXG A;  8ICQ A;  5L1M A;  3H40 A;  4P0Q A;  4GXK A;  5J0P A;  9ICG A;  3F5A A;  4P0P A;  9ICA A;  4F5P A;  2HSZ A;  1HJP A;  2JXJ A;  1QQ7 A;  1SL0 A;  3FAH A;  4P4P A;  2LM4 A;  4NL9 C;  2BHN A;  4QWA A;  1ZQZ A;  3KBB A;  5DLG A;  4O9M A;  4O3N A;  4PZO A;  3MDC A;  1TAU A;  4F71 A;  2GH1 A;  2HBM A;  1MQ2 A;  2KSO A;  2IOF K;  4ED0 A;  1SWV A;  5KG6 A;  3FM9 A;  4NWI A;  4PL1 A;  5HML A;  4ELT A;  2HHX A;  2HOI A;  1WWU A;  4B9N A;  1PZN A;  4NV0 A;  2HHQ A;  5ALF A;  4YR2 A;  4NJ8 A;  2W7O A;  4GXI A;  2H5X A;  4Y2R A;  3LVV A;  3OPX A;  1T7P A;  4RQ7 A;  4Q45 A;  5HMM A;  4Y2Q A;  3RJF A;  4IQW A;  2PI4 A;  5KFT A;  4WJ3 B;  3TAN A;  4F5O A;  3ZDC A;  3ETL A;  4US9 A;  5KL8 B;  1D8B A;  2QB0 B;  3ORY A;  3ZDE A;  2BCQ A;  2JH1 A;  4O3O A;  2C2E A;  3PSF A;  2R8I A;  2F1H A;  4F91 B;  5J0O A;  4P4O A;  2CN1 A;  2OWO A;  8ICK A;  2ESE A;  3NTU A;  4UW9 A;  4PHE A;  1RZT A;  1K1Q A;  1FEZ A;  5KTQ A;  3HWT A;  5KFW A;  3GQC A;  3C21 A;  5ALX A;  2NRV A;  5J2C A;  5KG3 A;  2Y9U A;  3F2C A;  3F53 A;  1RXV A;  1UQV A;  3RFA A;  5L9X A;  1NI3 A;  3AEV A;  2KZZ A;  2AXT U;  4NL9 A;  1D9F A;  3RR7 A;  2H3Z A;  1S10 A;  5DBA A;  3L4P A;  3TAD C;  4UB1 A;  1RG6 A;  3E58 A;  5JTI A;  1HUO A;  3M7D A;  7ICI A;  4QZH A;  3QZ7 A;  2KZ3 A;  4UAU A;  1HEK A;  1NK5 A;  1ZQ1 C;  4UAW A;  4F4K A;  1ZQL A;  1TFR A;  3QNM A;  3MR3 A;  4U6P A;  5J2F A;  3PR5 B;  4YR0 A;  1SKW A;  1ZRM A;  4J9R A;  5AK3 A;  2HBK A;  1S0V A;  5TIS U;  1S0N A;  2EH9 A;  3MGH A;  3F5E A;  3QUT A;  4RUC A;  3UQ0 A;  4EBC A;  1NZB A;  4ECR A;  5ALN A;  2MA1 A;  5AKH A;  2JH7 A;  2WF8 A;  5AKX A;  2OYY A;  1A77 A;  2ZUB A;  4DS4 A;  3Q8R B;  4ELU A;  3BS5 B;  4RZR A;  3OJS A;  3PMN A;  3SV3 A;  4F2R A;  1SL2 A;  3UPQ A;  1DK3 A;  5HR6 A;  1WUD A;  1QH9 A;  2HHS A;  4F93 B;  4OJ6 A;  9ICT A;  2PFP A;  4O5C A;  4YG2 A;  5L1K A;  2ZTD A;  3IG8 A;  4J9Q A;  2WFA A;  2EZZ A;  1C20 A;  5ALM A;  2IOH A;  2KTQ A;  4I2A A;  1KFT A;  4JV0 A;  2JHD A;  3PO5 A;  4DFM A;  3CNH A;  4ZOH C;  3NVZ A;  7ICE A;  1KFS A;  2DUY A;  4LZD A;  3RJK A;  1A6S A;  3PSP A;  2E8M A;  2RDJ A;  2NYV A;  1TV9 A;  1NK9 A;  2Y9T A;  5KFP A;  2W9B B;  5CEH A;  5KFK A;  4BWJ A;  1KLN A;  5TZV A;  3C23 A;  3M9N B;  4KX5 A;  5IIK A;  2E8P A;  9ICK A;  4Y2T A;  3RR8 A;  5KG0 A;  5KFF A;  1S0O A;  2KD1 A;  1ZQJ A;  1SV0 C;  4ED7 A;  3D2Q A;  4OD0 A;  2AU0 A;  4OJ5 A;  3KFU F;  2IHN A;  1VLB A;  2YQE A;  2WF7 A;  2V4Q A;  4CRX A;  4FBT A;  2JV3 A;  5IIL A;  1F0M A;  2KMD A;  2RP5 A;  2ZIU B;  3ISC A;  5AI4 A;  3RRG A;  3UQ2 A;  3NVV A;  2DQN B;  5EWF A;  1KEJ A;  2HBL A;  3T5J A;  4YMN A;  8ICH A;  4DQI A;  4FZN A;  1N62 A;  2BZF A;  1L8O A;  4F2S A;  2K8C B;  5KFR A;  5KFA A;  4IR1 A;  2M9N A;  3QU5 A;  1TAQ A;  4JV2 A;  4PGX A;  5EE0 A;  5DB8 A;  5J2E A;  4YR3 A;  4FE3 A;  4FS2 A;  3H0R B;  2ZIV A;  3F2D A;  4KLU A;  4QZD A;  1ZQD A;  1N48 A;  1QQ5 A;  2UVV A;  4P2H A;  3QU7 A;  4JB3 A;  2XCP A;  1FIQ A;  2DKX A;  3D2S A;  4FBU A;  1Z00 A;  4G9B A;  9ICO A;  1PUZ A;  2NRT A;  4YMO A;  1DOQ A;  2FMP A;  3D2N A;  2VJ5 A;  1JN3 A;  4PJ0 U;  4J9P A;  1BGX T;  4UAR A;  4YQW A;  1JXL A;  1KBU A;  8ICO A;  4KLD A;  2PI5 A;  1X42 A;  5KT5 A;  4RQ2 A;  5ALJ A;  2RRD A;  5JU5 A;  4UB4 A;  4K4I A;  3OSP A;  4Z6D A;  2JR5 A;  4R8U B;  2C28 A;  1L7O A;  4J9O A;  2OH2 A;  5ALV A;  3KHL A;  2XO7 A;  3GDX A;  4DQR A;  4GXJ A;  5F3X B;  3PW2 A;  4XQ8 A;  1UCV A;  2FPM A;  3GII A;  2C22 A;  2Y0S C;  5ALY A;  4F5Q A;  4KLI A;  4EYH B;  1ZQM A;  5ALW A;  3BJY A;  3C28 A;  5DG8 A;  1TVA A;  5J29 A;  3QUC A;  4Z6F A;  3PY8 A;  3GIK A;  5AM3 A;  1M6Y A;  5KFX A;  2KKV A;  4X5V A;  8ICZ A;  3I28 A;  1IV8 A;  4MFC A;  1KL9 A;  1ED1 A;  4KLO A;  5EWE A;  3K4G A;  3KHR A;  5III A;  3WK8 A;  4QWC A;  1XC9 A;  4DL5 A;  3M9O B;  2JEG A;  1UA0 A;  4KMO B;  4YCX A;  3PX6 A;  2HI0 A;  5KFM A;  4Y2V A;  3N28 A;  5DBC A;  2BCU A;  4C8K A;  4IL6 U;  3SAF A;  2XIC A;  3NRZ A;  2V4R A;  5AIB A;  5J0W A;  4UAZ A;  2I9G A;  1ZQB A;  3PZP A;  9ICW A;  1L3T A;  9ICS A;  2BGW A;  2YTU A;  5BOM A;  2IA6 A;  2YMM A;  2Z7J A;  3A0H U;  3SQI A;  4ED8 A;  2DGZ A;  2KJ5 A;  3EWA A;  7ICL A;  3WKC A;  1ECW A;  1KTQ A;  3IRU A;  4RU9 A;  3C5G A;  2EDU A;  5KFC A;  4XUS A;  1NK0 A;  4UAT A;  3V6K A;  2HDO A;  2K8A A;  2FPK A;  5H2F U;  1A76 A;  1BNO A;  2EAP A;  5KFL A;  3FYH A;  3N7R C;  4RQ4 A;  4YMM A;  1UT8 A;  8ICL A;  1ZQF A;  7ICU A;  4IQT A;  5AK4 A;  2KG5 A;  3SMV A;  2K4P A;  1U9L A;  7ICK A;  2KK0 A;  1ZQY A;  1YZ7 A;  5DGA A;  4I2H A;  3V72 A;  4PZN A;  2HW3 A;  5ALG A;  2I6X A;  3H4D A;  2FE9 A;  2OCE A;  2MUT B;  3BQT A;  4EEN A;  1NKE A;  2C2D A;  2DPI A;  4QZB A;  3A0B U;  2LMR A;  2LBO A;  5GTH U;  2W9C A;  4JMU A;  2XY6 A;  3EPG A;  4PHP A;  1JRP A;  1ZQS A;  2UVW A;  1XSP A;  3BQ2 A;  1ZQV A;  2JZB B;  1P7D A;  3F2B A;  5AKJ A;  4R66 A;  3K75 D;  4USA A;  1LKY B;  3KKA C;  3TFS A;  3AL0 B;  9ICB A;  2BKE A;  4GC6 A;  1TAM A;  5KFQ A;  4C8O A;  1IIP A;  4ED1 A;  4M9L A;  3QU2 A; 
#chains in the Genus database with same CATH homology
 3TAD A;  1COK A;  1V85 A;  2D8C A;  2Y9U A;  1JI7 A;  1Z1V A;  1SV0 A;  5L1M A;  1WWV A;  5JU5 A;  1UQV A;  5J8Y A;  1X66 A;  2KE7 A;  2E8M A;  2Y9T A;  4MHV A;  1OXJ A;  2GLE A;  4NL9 A;  4IS7 A;  1SXD A;  4NL9 C;  3K1R B;  5F3X B;  2E8N A;  3TAD C;  2QKQ A;  1KW4 A;  1RG6 A;  5JTI A;  2EAP A;  4RQN A;  2E8P A;  1UCV A;  4PZO A;  1B0X A;  5KNI A;  1SV0 C;  3H8M A;  2DL0 A;  2KIV A;  2KG5 A;  2KSO A;  2K4P A;  5J8Y C;  2E8O A;  3BS5 A;  2F3N A;  2F8K A;  1WWU A;  2JV3 A;  1SV4 A;  2DKZ A;  2EAM A;  1F0M A;  2KMD A;  3SEN A;  1OW5 A;  3IDW A;  4NJ8 A;  4PZN A;  2LPE A;  4RQM A;  2ES6 A;  2QAR A;  3TAC B;  2FE9 A;  1LKY A;  1X40 A;  2KSO B;  2L5Y A;  1PK1 A;  2F44 A;  2K60 A;  1SGG A;  1SXE A;  2LMR A;  3BQ7 A;  3BS5 B;  1DXS A;  2QB0 B;  2B6G A;  3HIL A;  2QB0 A;  1B4F A;  5JRT A;  2D3D A;  2QB1 A;  1V38 A;  1X9X A;  2EAO A;  2QAR B;  3KKA A;  2DKX A;  1LKY B;  3KKA C;  2EAN A;  1PK1 B;  3BS7 A;  2ESE A;  1PK3 A;  3SEI A;  2YTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...