2F3RA

Crystal structure of e.coli guanylate kinase in complex with ap5g
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
205
structure length
201
Chain Sequence
AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of GMP kinase in complex with ganciclovir monophosphate and Ap5G.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Guanylate kinase
total genus 69
structure length 201
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 2f3rA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2f3rA01
1OIVA 3EG5A 1U8YA 3VU9A 3ZIAA 3I61A 4MYCA 2FZ4A 2GNOA 4GMXA 4JJZA 4L8GA 4NP6A 1NMZA 4II7A 1G41A 4UNSA 1G17A 1VCNA 5C4GB 4N1AA 3ZS9A 2F43A 4UXHA 2C99A 2DHRA 1QHIA 1N6HA 4GOKA 1KI2A 4PO8A 4ACBA 5B58C 2ZSAA 3H86A 1FNMA 3IBYA 5J4KA 4JLDA 1UKZA 4LJ5A 1F60A 4JLOA 2A3RA 1SVOA 1Y63A 4KXFB 5FOWA 1YRBA 4B34A 1E2DA 4Z54A 3Q72A 4ILEA 1KJZA 2ZR9A 4JVSB 2IS1A 4NTZA 4JL6A 2YWFA 1IXZA 3TVDA 2V4ZA 3WP0A 3ZH9B 4Z1MD 2D7CA 3CPEA 4X8OA 5FL7D 1BO6A 1W0KD 4ZDJA 4B3XA 2ZU0C 1V43A 3RLFA 1NVVQ 1QVAA 2VEDA 2HJVA 1KI3A 4D82A 5IRCD 2Q6TA 1KIMA 4G5GA 5IK2D 3IEUA 1KO1A 3OEHD 4XSHA 5F2EA 4HDCA 4L15A 3GMTA 1NSTA 5ANRB 1FTNA 4LYJA 3A1SA 2CHQA 4XVQA 4AYXA 3WNDA 1R0YA 2VQSA 3TSOA 4XWKA 1TTTA 2DYKA 4URXR 1DAEA 2OESA 2VRWA 2YINC 4QGFA 4TN1A 1H8HA 2CLSA 2VF7A 4ARZB 4B43A 1OH7A 1Q3HA 3L2OB 4MRRA 2PH1A 3L0IB 1GSIA 4WOPA 3GQBA 3QKRB 1G7RA 2JLRA 1NL3A 3WMFA 2JGNA 3B1YA 1GDDA 4HZUA 4TL9A 4IDQA 1W5SA 1E1QA 4OKSA 3RANA 4NMMA 3SQXA 2W6IA 3KX2A 5FL3A 1EFRD 3TAUA 3ADDA 4DEYA 2XSZD 1G8HA 5DHAA 3NKVA 3LDAA 2HJGA 2YZ2A 3A1UA 3U61B 2R8RA 3IKJA 2RGGA 3HDTA 1RVDA 2HF9A 2QAGA 4JVMA 4OHVA 2XNDA 1G5PA 3OAAA 1FTSA 2LKCA 1NRJB 1FQJA 4EJSA 5KPJA 4AG6A 1EFTA 2AD5A 4ABYA 2J3EA 1AZSC 2GEDA 2YWGA 1COWA 3RS7A 4QGAA 3WYFA 3Q5DA 4DSNA 2ZS8A 1ZUHA 3VMFA 3VNVA 2OCAA 5AUQA 1YZQA 2RAPA 1KGDA 2ZE5A 4O2LA 2BBTA 1A1VA 2D74A 1U0LA 4EDHA 4KFTA 3ADKA 3KFVA 4L5BA 1SVLA 4JBWA 1IONA 4RZ2A 1KK1A 2C9YA 4KLNA 1GRRA 1WBBA 1T4GA 5SZJA 2NGRA 4RD1A 1TL7C 4D26A 1N25A 2O0JA 3LLMA 2AK3A 3BS4A 3EIHA 1U81A 3CH4B 5EUQB 4C0JA 2WWHA 3DMDA 1CJMA 1US8A 4MYHA 5JEEA 5CK4A 1MOZA 2QMEA 1OXVA 4JLPA 4OL0A 5DN6D 3MJHA 2PMDA 1GL9B 2PJZA 1MABB 3FMPB 5EE9A 2PZGA 4CW7A 4RSGA 2ORIA 3HPQA 1E2LA 1I2DA 1ZYUA 2WBLC 3RS0A 4QM6A 2QBYB 1OXSC 1E9EA 2AXNA 4LC0A 3EC2A 4AYWA 2WKQA 1FUUA 2XTZA 1RIFA 2ZRJA 2NQ2C 2CVFA 2NO7A 1JXMA 1IY2A 2WHXA 1F2UB 1CBUA 2IYUA 1E9CA 4MKHA 1SKYE 2JJ1D 1T3SA 1AS3A 2ZU6A 3F0TA 3OF5A 5DHFA 3RC3A 3D8BA 2H16A 3IDQA 2CEAA 3BRWD 1LW7A 4A2QA 1ZAKA 3K09A 2WTUA 3LXRA 5JFGA 5JZVA 2C78A 1LS6A 2V1UA 2R6AA 1ELOA 4XIGS 5AUNB 5FTNA 2HDNB 4DDVA 2ZSDA 3IGFA 4A8JC 2WOOA 4JYBA 4QHTA 4NYMR 3FB4A 3X1WA 2QPAA 5DISB 1ZD8A 4IDHA 2GEVA 3BIFA 2DPXA 1TPZA 3CUEF 1U98A 2B92A 4L9SA 4XWAA 3W34A 4CEIB 2JLZA 3VNUA 1P73A 3KXKA 4US0R 1ZBDA 2P6UA 3UK6A 2BKEA 4IW3B 5GVRA 4DIEA 5J4VA 4HAWA 2YWHA 3FPAA 3DZDA 2ZAMA 1R0XA 1RZ3A 3KXIA 2WIAA 3LBNA 4IOLA 2HXSA 2RCNA 1Z6TA 4OQFA 4DB2A 4TYQA 4TLDA 2I1QA 2QSYA 2XNDD 1AM4D 1N6KA 3K0AB 3HU2A 1JECA 5DI9A 2CL7X 2ORWA 2C2HA 5KSOA 3RS5A 1UKVY 3KZ1E 4DB4A 1F2UA 2OT3B 4GFDA 4LY6A 4NCNA 4ZPXA 1A2KC 4U5XA 3UXMA 3WBJA 3GFPA 2OV2A 2ZRLA 4B3FX 4BFZA 1S3SA 4EQ6B 3KL4A 2QP9X 5AJVB 3AV0B 1JJ7A 5CJ2A 5JI2E 1MO6A 1VDZA 3E70C 3VTKA 3T15A 1NVXQ 2J1LA 4DIDA 4DT1B 3PUYA 4TYYA 1DARA 3QNUA 3SU8A 3WMGA 2QM8A 1ESMA 4AD8A 4EAQA 1H8HD 1RJ9A 1ZP6A 3KKPA 3C41J 4MITA 5CLLA 1NN5A 2E1RA 2G3YA 4NDZA 4OK5A 3A36A 1Z8FA 1VMAA 1S8FA 3M1IA 4DVGA 2JAQA 3DMNA 4QBHA 2ZREA 3LY5A 1KTVA 1XEWY 3OEHA 3LFUA 4TSFD 3Q9LA 1XBTA 1OFIA 2FSFA 2ZS9A 2J41A 2N1BA 3AVOA 3VR2A 2RGAA 1Z08A 2GEUA 3OIUA 5EXSA 3EPJA 2W2XA 3K70D 2PT7A 1KI8A 2F3TA 2CVHA 3B1VA 4Q47A 4CEHA 2ZRDA 3MGCA 1N2CE 1XP8A 3ZVNA 4A1FA 3PEYA 4TLAA 1PUJA 2PBRA 1G6HA 2Z5FA 3H84A 1W48A 4I81A 3GPLA 3CX6A 2ATXA 3QE0A 1ZC3A 2XSZA 4HI0E 4XWOA 2W6ID 1G21E 4PZLA 1G16A 2AL7A 5EZ5A 4OK3A 5JWHA 3VU9B 2OBNA 1J2JA 5EP2A 1JR3A 4F7WA 4US2R 1U9IA 4DT1A 1W1WA 3FHOA 4LYFA 4GP6A 4PPGA 2Q3FA 4DLWA 2B7CA 3QXJA 3LX8A 2GXQA 2D4HA 1AKYA 3W6OA 2ZJ2A 4LCBA 1UBFA 4LK2A 1CLUA 3E5HA 821PA 1AIPA 2RGXA 3EARA 2KBEA 3IIMA 1TUEA 1WP9A 4GSYA 1GAJA 1NF3A 3GLGA 2BBSA 2IYSA 3T5GA 4NCHA 1RC8A 3TUJC 5FR2A 3K0EA 3OIWA 1K5GA 2QRZA 4NONA 1KKLA 3UG7A 4JKYA 2YC4C 2QT1A 2IS6A 1FL9A 1HTWA 2R6FA 2XOKA 3FMIA 3EA0A 4JS0A 4C7OB 1NKSA 2GKSA 1IN8A 1R10A 3LW7A 2XX3A 5TMPA 1E0KA 1HURA 1ZC4A 3IPXA 3ND9A 3ADBA 3ZYCA 4Q18A 4Q4AB 2IHYA 4Y0AA 1SXJA 4P4SA 2H5EA 5FOVA 4Q4LA 1G5TA 3PR1A 2GWHA 3MWYW 2HYIC 1C9KA 2GK7A 1E4VA 3DKVA 2OFWA 1PZNA 2YOFA 1BYUA 2CNWA 2PMKA 4FMDF 2P67A 5L3VA 4GZMA 1ZUIA 4NCJA 3B1ZA 1J90A 3BBPA 4DSOA 1WMSA 1KZGB 3EZ6A 1H8EA 3OFND 4E09A 3KTAB 3B9PA 2FEOA 3PIRA 2GBLA 4M1OA 2PZEA 4LBYA 4DLZA 2GZAA 1IM2A 5HZKA 4DXAA 4NCIA 5G53C 1SGWA 1D6JA 1E96A 2A5DA 3RRMA 1XD2A 1P5ZB 3DM9B 5FPSA 2C95A 4IRUB 1W0JA 3MLEA 1GNPA 1Z0KA 3U44B 4HZIA 3VQTA 2AXPA 2OO7A 3VKWA 2VIIA 3I62A 3CF2A 1QHGA 4LSGA 4D2IA 3EW9A 4RCYA 2ZSFA 3UANA 1EXMA 2QGNA 3AP2A 4DDUA 1DS6A 3LQRA 1JPJA 2QP3A 3K53A 5BWMA 2IYTA 2VBCA 5C4MA 3K8YA 4M1SA 1W36B 2DFNA 1ZNWA 3QF4B 4MKIA 4QBFA 5CM9C 3A6PC 3FVQA 4TLCA 4YONB 3NC1C 2CK3D 3W9YA 1GUAA 1SXJB 2B21A 4LV6A 4TMXA 4PQFA 2GRJA 4DLVA 2GZHA 2BIFA 1OXTA 2Q21A 3WHKA 1E69A 4YDHB 1ZM7A 1K8RA 3HP1A 1DG3A 4MRNA 4IEEA 3W6PA 3BC1A 1BS1A 3MFYA 2PEYA 3I5XA 4A0RA 4P32A 1VCOA 2RH5A 2F7SA 1GL6A 3LBIA 2B8TA 4F4JA 2ZI9A 3K9GA 3BXZA 4OHXA 2IYRA 4D25A 2OEPA 721PA 3K9HA 3TR5A 2KI5A 4OI0A 5BYKA 5DLQC 4NZYA 1T5LA 2GF9A 1XPRA 1GFIA 1VG8A 2QQEA 1G4AE 1GNQA 1OJLA 3UG6A 1NBME 1HE1C 1EK0A 2ZUDA 4F92B 5K8IA 4TZ6A 4CZ2A 4OYHA 1DADA 2J87A 4HUQB 5AJWA 3NEYA 3KB1A 1IN6A 1AGRA 1XPOA 5TV2A 1KJWA 2OHFA 2BCGY 3B13B 1G7SA 1GKUB 1PLLA 1T0HB 4BE7B 4OQMA 1FMJA 4BLPA 2R62A 2CCGA 2ZI4A 2XZLA 1W49A 5F3WB 1R5BA 1GRQA 5K8TA 1E98A 3SI7A 4XVRA 1XEFA 4R2IA 1I4TD 2FV8A 1P9RA 2W2VA 5FBVB 3JVVA 2J0SA 5FOXA 4MA4A 3AP1A 3BB3A 1CJUC 3RRNA 1DAKA 3A4NA 4M1YA 4C0HA 2A2ZA 1P75A 3FKSD 1N0UA 4HAXA 1AK2A 1Z47A 3GCGA 5SZKB 4BEJA 3O8CA 5AUPB 5CB8A 1S96A 3GLIA 2P65A 3QBVA 2F1JA 4LV5B 1SKYB 4IDOA 3SZRA 2ZYWX 1E2FA 1CRQA 3CNOA 2Q0HA 3CH5A 5FOSA 2QA5A 1IXRC 3W8RA 1ZIPA 1KZ7B 4AC9A 4H1VA 1ZCBA 2WAYA 4US1R 3LXXA 4LHYA 3OHMA 1E4YA 3KQNA 3THXB 3E1SA 1G64A 3QOFA 2FFAA 4LJ8A 5H68A 2ZTSA 5KNDA 2WJYA 1KMHB 4M9XA 2GCNA 2BEKA 3B9QA 4ZI2A 1MO4A 3B6EA 4DEXA 4FIDA 2B8WA 2UKDA 2O8EA 3EZFA 1NSFA 1FX0B 3TUZC 4ITRC 2NMVA 4OHYA 2BMJA 4BECA 1P61B 3QKTA 4AWXA 1K5DA 2BKUA 2FOLA 1OLOA 4JMPA 1ZINA 2QTVB 3G82C 2VSOA 2WWWA 3U44A 1IJFA 4UNNA 2NO6A 3AVTA 2X77A 4IVRA 1XJCA 3GLHA 3RSOA 1G4UR 3GLGE 2B6HA 2G0NA 1JI0A 1LS1A 3AF1A 3K0CA 3KKOA 1E9FA 3QKUA 3TQFA 4E22A 1HT2E 1SXJE 1CKEA 1US8B 2KSQA 5SZIA 1ZNZA 3FYHA 421PA 1T6NA 3P4YA 2IT1A 4MH0R 3K0CC 1Q1BA 2ZVQX 3I8XA 4W9MC 3EWAA 2BOVA 5EE3A 5FI0B 4JKIA 1ETUA 1ZNYA 1Z3IX 2PJRA 3FHTA 1IOZA 1AZTA 1YR8A 1I4DD 3QI2A 2J9RA 4NHOA 1KHTA 4G5SA 1LTQA 5KYKA 4HDQB 2DR3A 4OQNA 3KKQA 2P2LA 2MSEB 4GT1A 4JJKA 2GETA 4EPYA 4YC7A 3C7KA 2EFGA 2W0MA 2OCBA 3I8SA 1PUIA 4NCKA 2QE7A 4PTLA 5FPYA 5J4HA 3AVYA 2OLJA 4XTRA 1JEEA 1IN5A 2BDTA 2MMCA 2QMOA 3GEIA 5EUMA 1P9WA 1QHYA 1T8TA 3IPYA 4NE2A 4YMUA 4ZV4A 4C7OA 1PLJA 4TZ0A 3HR7A 4G5OA 2ERXA 1QZXA 1KMQA 3FKQA 1S1CA 2GJSA 2JJ2A 4HYYA 3RDPA 4NU0A 3RAPR 3RS2A 3ZZTA 4OJKA 2J0QA 4QNMA 2JEOA 2R6GA 2ZYUX 4WIAA 2IUSA 4EFMA 1OV4A 4JT4A 4R2HA 1D5CA 2GJ9A 4FMBB 3IILA 2IA5A 3I1FA 3OE7A 5JRZA 4A6PA 2KE5A 4RFVA 4C2UA 1XTIA 4Q02A 2J59A 2VYFA 5KPDA 2AFHE 2FSIA 2QBYA 1Z2CA 1V5WA 3K0FA 1YZTA 4PPNA 4RZ3A 4HAUA 4HUQA 1E0AA 2RGCA 2V9PA 2XJ9A 4XSGA 3GLIE 5FI1B 2CL0X 3VKGA 2QP4A 1P72A 2ZRMA 2CCJA 1KNQA 3QBTA 1VYUA 3QF4A 3QPUA 3X1ZA 2GA8A 1YZKA 4WVFA 3KJIA 4OHWA 3QG1A 4QJ3A 1XX6A 2CE7A 3RS4A 3EZ7A 3PEUA 4PC6A 3ADCA 1HYQA 4ASUA 2RGEA 1GOTA 3PUZA 4WA7A 1QHHA 2UVQA 3Q7PA 4RZUA 3NWJA 4B74A 1CRPA 4DLUA 2GDJA 5TXGA 1XD2B 1QHNA 1ZD9A 2G1JA 1CULC 4TMKA 2WMNB 3TMKA 4ZDKA 1HT1E 5DI3B 3KKNA 4DSUA 1SZPA 3EA5A 1M7HA 4KODA 4MYUA 3GLFB 1E2GA 4LGMA 2QE7D 1N5KA 4B33A 1WDTA 4FN5A 2DWPA 2ZJBA 1KAGA 1YKSA 1G9XA 2W6JA 5H8WA 2VL7A 2WAXA 4EJSB 1VIAA 1YQTA 3KUDA 1DEKA 4LJ4A 2HV8A 1IHUA 1TX4B 3A1WA 3TSWA 4A0HA 4MDFA 3KFXA 3PITA 2ZJOA 1XTSA 1CF4A 3EC1A 2BMFA 2ZYVX 4TQAA 2HLDA 5EXXA 4GMDA 2ZRAA 1Z0AA 2WJGA 1XCPA 4LRWA 5EE5B 5AJYA 4C9BA 1BKDR 2JLWA 4O3MA 2CE2X 2REBA 4P4TA 2EFEB 1RRPA 1R4AA 3L8ZA 5FOUA 4BLOA 4BZXA 5CDFA 3I92A 1MO3A 1L4YA 5JCPA 1YZUA 1G8GA 3AF4A 3NBZC 4ARZA 4QC2A 1LFDB 2IYVA 1O3YA 3SS8A 4DUGD 3K0AA 1XEWX 3LV8A 3IO3A 2WPDA 3WY9A 3I5YA 3SHFA 2BBOA 4ZCLA 3PXGA 5HZHA 1F6BA 3FMFA 4DDWA 2O8DA 1P3JA 1YR6A 5GJBA 1XCGB 4Q4AA 3PUXA 4M1MA 4CVNA 4Q9LA 3D6TB 5JS7A 1DAHA 4Q1EA 4LI0A 5CK5A 3AP3A 2D7DA 4GOXA 4E03A 3H0KA 2IYZA 4PHTA 2OFOA 4JLKA 1OHHD 1E9AA 2FX3A 2PT5A 2GESA 2YHSA 3CKLA 2YV5A 3UKDA 2V7QA 3O8BA 5E4FA 1CR2A 4HB4A 5AJXA 3QEOA 1Z6YA 2VTKA 4PAQA 5JS8A 1G291 2BHRA 1JNYA 1XXHA 3CRW1 3TIFA 5LPNA 4P33A 2I1VB 4WZBE 2AKAB 4TL8A 3KJEA 1O87A 4PXAA 4MYTA 3KQHA 2ASEA 3BGWA 4IKEA 2OM2A 1EX7A 3CRQA 1W36C 2OAQ1 1R5NA 1M74A 1N6RA 1VG9B 3QXHA 4I4LA 5G40A 5KNBA 3IBGA 4OHZA 1CJTC 2WWFA 4BFSA 3SJZA 3M4YA 2JLXA 4CEHB 4F91B 3GLFA 3PEVA 4CT5A 1Z63A 2BCJQ 3K0SA 1X1SA 3NH9A 1XB2A 3MAAC 4PSVA 4Z8XA 5B64A 1A4RA 2E9SA 2OG2A 3TGPA 1Z29A 1L2TA 1SHKA 3QSYA 4HSEA 4JSTA 4GRAA 4WZAE 4DZZA 1WB9A 4W5JA 3PCRB 4HB0A 1RFLA 1YZLA 2A5JA 1CTQA 2WPDD 3WP1B 4URVR 4LHXA 1ODFA 4P0TA 4YMSA 2Z83A 5J5CA 1RKBA 1ZRHA 5BQ5A 4M1TA 2D3WA 5CYPA 5BXQC 4G0NA 2QNRA 4HAZA 3ZZ0A 4D4KA 3KQKA 3CZPA 2XXAA 5FUXA 4JLJA 2ANBA 2JDID 3CIOA 2QQ0A 5FFMA 4DCSA 3QG5A 4NBSA 1S0UA 3K0FB 1S4QA 5EXPA 4IXMA 2GXUA 3DKPA 3WXMA 2CCKA 3BK7A 2ODBA 4RD3A 4FINA 2E87A 5CJPA 3HJNA 3VR6A 5A0FA 2XEXA 2O0KA 2V55B 221PA 2F1HA 3NBXX 4PC3A 4DKXA 3EPLA 3KUCA 3GJ4A 1IAQA 2DBYA 3MCAA 4PHFA 5TARA 2ODNA 4D0GA 4DJTA 1IXSB 2BV3A 1HUQA 2ZANA 4RVCA 5E3HA 1RRGA 5FBLB 5ELXA 4KSBA 1U0HC 2WWYA 3MRSA 2GZDA 3GFOA 3P26A 3SJAA 1NP6A 2XB2A 4DDTA 4TT3A 2J0VA 3GJ3A 4EQ6A 2GF0A 5FUWA 1SVMA 1KDTA 3R9XA 1KAOA 2KBFA 1EWQA 4WAUA 1OSNA 4N3NA 3WYGA 2CJWB 3H4MA 1N0VC 1W0JD 2J0UA 2NPIA 2ZRFA 1FOEB 3C8UA 1DG1G 4KVGA 1E1RD 5H70A 4HDOB 4ZCMA 3VX4A 1E2QA 3MWKA 4MKGA 2R9VA 1KO7A 1H65A 2X1VA 4B75A 1ZU4A 4L4UA 4CEJB 2OAP1 2R6DA 1Q44A 1E2PA 1Q3TA 4URUR 3RNLA 1D8TA 1E94E 2G1KA 4ACAA 2NO0A 2JLVA 4JLVA 3K9LA 4QBIA 1W47A 3W6NA 1OXXK 2G88A 1II8A 4B71A 3FFBA 3PG5A 4B48A 3MJRA 2FG5A 3KQLA 1KK0A 4LC1A 3RWMB 3W3AA 2ZUBA 3OE7D 3S1AB 4JYCA 2H1LA 1SHZA 2IL1A 4M1WA 4AK9A 1P2SA 1TADA 4B35A 4YXWD 1TEVA 1U90A 1OKKA 4XD7D 4A6XA 2QI9C 4D6PA 3TAHA 1N3BA 4GI7A 2PX0A 1TUIA 1FPMA 4IOJA 4DLTA 3NBYC 3U7FB 3GJ7A 5FPTA 4O2RA 4B2LA 3SEAA 2Z4SA 4B47A 2XXAB 1IY0A 2ONJA 3CB4A 5JEDA 3HU3A 2A30A 1G3IA 2R6CA 2TMKA 1UDXA 2EFDB 4C0AC 4Q7KA 1C1YA 1DO2A 3TLXA 3THXA 3FTQA 5HE9A 5UKDA 2ZITA 3LBHA 2O8FB 1HV8A 2H17A 3LRPA 1S2MA 4IJMA 4GZLA 2ZRNA 3TH5A 3U4QB 4W7SA 5K8UA 4UNPA 3TW4A 4B76A 5DIFA 1FUKA 1JAHA 2UZ3A 1UAAA 2MMGA 1M1YE 1X86B 1B0UA 5CDFE 1P62B 3FGNA 2IWRA 4MRPA 1HY3A 2ZQ5A 1NY5A 2ODEA 3LA6A 4BPBA 2QTFA 3GLIB 3KTAA 3TSZA 8OHMA 1EESA 1Q21A 4TTRA 1KO8A 4X8MA 5J4LA 1KYIA 1KDPA 2J45A 1T3HA 4NH0A 4ERNA 3NTUA 4IDPA 3U2QA 1W2GA 5EE1A 1JPNA 1L8QA 5JRJA 2C9CA 2X19A 1Q20A 5CIWA 2LWIA 2BVNA 1S9HA 1GP2A 2BM0A 3CZQA 3ICQB 3B82A 4QJ5A 4ZI3A 1OPXA 2GHIA 4MQBA 1NIPA 3PQCA 3WMEA 4Q48A 2P6RA 5IDVA 1W36D 1LF5A 2P0EA 4M9SA 2CLCX 1W4BA 1N5IA 2HT1A 2PCLA 1DAGA 1F2TB 3LWNA 1VECA 1TQDA 1OYYA 4PFSA 4Q4JB 3JVUA 1UBGA 3SBEA 1J70A 2FEMA 1GITA 1S3GA 2ZJYA 2DFKB 3QENA 4B3GA 4F38A 1NN0A 2JIZA 2FE4A 4JLMA 2HYDA 3NDBB 5D3MB 2F1IA 1E2IA 1MV5A 3HR8A 1XXHE 5AWFC 1W7AA 4EPWA 2WICA 1VHTA 4A8JB 2UZIR 1M7BA 1F2TA 2WV9A 4HZUB 3U3KA 2O5VA 2VF8A 1NMXA 3A58B 1K6MA 4GL2A 4M2LA 1XD8A 5JI3E 1DAMA 4RCZA 5L3QB 3C4JA 4PPFA 2F9LA 2IYWA 4O25A 3HYTA 4R7ZA 2ZUCA 4MGYR 4QRHA 4FXPA 4ZDIA 1QG2A 2JCSA 3QJYA 4LPSA 2FGJA 5DE3A 1VCMA 2QMUA 3AGPA 4UXJA 3EZ2A 2J5XA 2KWIA 3O8RA 3ECCA 1J99A 4Q9JA 4QOSA 4UKDA 3SE0A 1T3LA 1VTKA 3IQWA 1P9NA 3EPKA 4ZCIA 3VAAA 3B1WA 3VR1A 3Q8XB 4LJAA 1KSGA 3R8FA 3UIEA 2ZIAA 3ZVMA 3OIVA 3BJIC 2F3RA 4CRWB 1BOFA 3AKCA 4B44A 4BLTA 1G20E 3R7WA 4C0BA 4EPTA 3KQUA 5EP3A 1KOFA 2QTHA 2CHGA 3G0HA 5L3SA 5FOTA 1XF9A 3TW8B 3TBKA 2GILA 2QAGC 1WE2A 1SVSA 2ZR7A 1JR6A 2ZRGA 4A8JA 3AUXA 5D3QA 2FGKA 4JL8A 2C5LA 1Y3AA 4IVPA 3O47A 4HLCA 2G0TA 4ZKDA 2O8CA 2ZETA 3EIEA 2IC5A 2OZEA 1KNXA 4X8LA 2VP4A 2HXYA 2GCOB 2H8KA 4Q1FA 3QVVA 4HEJA 3J81k 2A78A 2IUTA 1E99A 4FMDB 3PUVA 1KI9A 5GVSA 2DWOA 5JMTA 1ZD1A 2IX3A 5KSPA 2QY9A 4D81A 3RYTC 5K8LA 3T1OA 2XJ4A 4XTCS 3X2SA 1R5OA 4HLQB 3BOSA 4KFSA 2F9MA 4UNQA 1SVIA 5FBWB 2ZJAA 4LWZA 4POAA 2JASA 2AWNA 1RYFA 4Q1AA 3RSLA 4UQOA 1KDOA 1VCIA 2FA9A 3FWYA 4Q9KA 4KCGA 3GJ6A 2PCJA 1HH4A 1E9DA 3JZMA 4IHQA 2V6IA 1W44A 4OJQA 4HLUA 5EZ6B 2ODWA 3VHLB 1P4SA 2EWVA 2WSSA 3E2IA 1XMJA 5DYGA 3OFNA 3SQWA 5KUTA 1H8ED 1AGPA 2YNMA 4OBEA 3VR3A 4KBGA 2CXXA 3FOZA 4WBSA 1KI7A 2NZ8A 3W8NA 4AY2A 5DGXA 3TKLA 3ASZA 2BMEA 1TF7A 1DBSA 3ETLA 5G3ZA 1RPZA 1COWD 3TNFA 2O8FA 4TMZA 4QG7A 4V03A 5L3RA 2RGBA 3PUWA 1R8SA 1FFHA 4BLQA 5BN5A 5C2JB 4PR0A 1X1RA 4I1OA 4Q19A 2QRNA 4HAYA 3OAAD 2P5TB 4LJ6A 4S2EA 4UJ5A 3T1TA 4W5HA 4ESVA 1YE8A 2GJAA 5CLQA 5GJCA 3AF3A 3GLHB 4JZKA 1Q1EA 3LVRE 1EFRA 2AX4A 3GJ0A 3N70A 2VSXA 5FUYA 2VHCA 2FFHA 2IS2A 1E1QD 5BYJA 1PJRA 1U8ZA 4BWYA 4KSCA 4YDSA 1OE0A 2YYZA 3DL0A 5LBIA 1Z0IA 4EPRA 4K46A 1OFHA 1II8B 2OE2A 3QXSA 1GWNA 4B73A 1N6PA 3IIJA 1W5TA 2BJWA 1X3SA 1FMLA 1XTKA 4JVNA 4S35A 2C9OA 5G41A 1E9BA 5IT5A 1E2MA 1A2BA 3U6KA 1NG9A 4H9GA 1RRFA 4XVUA 3SYNA 1AN0A 1YU9A 4AKHA 1U9IC 1JR3D 3LO5A 1WRBA 4PQRA 1WA5A 3EAQA 3THWA 3SFVA 3H2YA 4FCWA 2SHKA 3R8CA 4RFSA 1Q12A 5FL7A 1XJ0A 3KB2A 4JLAA 3OIYA 4GPTA 1Z0DA 4TMWA 2YWEA 3RABA 4B32A 3SJCA 4H1UA 4TLEA 4V0OA 2AWOA 2VHJA 1CR0A 2PEZA 4AKIA 4JIMA 2XB4A 1Z07A 4LJ7A 1P6XA 3G5UA 2BJVA 2C8VA 621PA 1XFAA 3HU1A 4PO9A 1EGAA 4IVQA 4TSFA 3U3JA 4YMVA 2C96A 3RS3A 4M4SA 4JSYA 2NPFA 4Q9IA 4CGZA 2VSFA 4BQSA 5FR1A 2IXGA 5LDDC 4GP7A 2ZYTX 3WRXC 2BMDA 3ZDQA 3QXXA 1S9DA 2QU8A 4B2IA 3U7GA 5BN4A 4KVAA 2D2FA 2OCPA 2W83A 3IQXA 1XD9A 2YC2C 1Q0UA 1XEXA 3VR4A 1J7KA 5CB6A 1OH6A 1X8JA 2WM9B 1UEJA 3ZJYA 1ZJ6A 3AGQA 4Q1CA 4LJYA 1XU4A 1NLYA 4ZIRA 4UNRA 2YOGA 4P4UA 5CIQA 1XRJA 4AI6A 2ZI5A 4UJ3A 3T35A 4C0LA 4DBLC 2AK2A 3A4LA 1GG2A 5IHPA 1MABA 4MRVA 1A82A 4Q66C 2Z43A 2XZOA 4YMWA 3QIAA 4PC7A 1AQYA 2QN6A 1D2NA 4R9UC 4A2PA 4Q7MB 3CF6R 3TRFA 4R98A 2JLQA 2OLKA 4B3CA 3DHWC 3AVPA 2V1XA 5A5GA 1QHSA 3A8TA 3GLHE 3ZGXA 1N6NA 1KMHA 4WZ6A 2WKPA 2WKRA 2W0SA 4M22A 1GTVA 1KSHA 3KKMA 3I72A 1G3MA 2IK8A 3T61A 4TLBA 3ZS8A 2ZSBA 4FCVA 1RE0A 1WF3A 1N5LA 1ZVQA 3F5FA 3S1AA 3SYKA 1XTJA 2WSSD 1XXHB 4D4MA 3DVLA 2F1RA 1TAGA 5DYIA 4QHSA 3BE4A 1JB1A 2G9NA 4CT4B 2WJVA 4NKRA 3LX5A 2R44A 2OBMA 1G3RA 1UDWA 3DEFA 4W5WA 2GK6A 2REOA 1Z6AA 2GJKA 1Z6GA 1OYWA 4URYR 3AF0A 2WSMA 4PHGA 5FPKA 4M53A 1JALA 4CEJA 2OBLA 3AUYA 2QENA 4KV9A 3UPUA 1G7TA 3CWZA 2JJ1A 4IFBA 3R9IA 2ZRBA 1EX6A 3QF7A 2ONKA 3DZ8A 4D0NA 2PZFA 2GVDC 1LV7A 3Q7QA 2FSGA 2LKDA 1II9A 2H7VA 3O8DA 3KJGA 3HWSA 2O0HA 2EW1A 3ND8A 4JLBA 4LZZA 1OFUX 5L3QA 3TR0A 4DLXA 1YZNA 2VO1A 2AD1A 4KYUA 4TTPA 1JQLB 1IN7A 2DFLA 4JBXA 2EQBA 5DN6A 1SVKA 5LB2A 1XMIA 1SXJC 3GJXC 3SFZA 2FPKA 4Q7LA 3GD7A 3AKEA 1XMSA 5AJZA 3THYB 2FU5C 2AFIE 4TQUS 2ZI7A 2D62A 5KDOA 4FI3C 5FPHA 4DC9A 1EFUA 3GLFE 3UATA 4GDFA 2IYYA 2QSZA 2XZPA 3DDCA 4PANA 3U3OA 2JLUA 5JJIA 3K09C 4JL5A 1NVWQ 5DO9A 4G1UC 3UMFA 1SVWA 1ZUNB 5FTKA 4LPKA 1U99A 1T91A 2Y8EA 4DCTA 2RHMA 3QUSA 1HE8B 4PSKA 5TDHA 4F4IA 1U0JA 4A9AA 4E07A 3EZ9A 3ZQ6A 4K81B 3IHLA 1MKYA 1CR1A 2AR7A 4U00A 1E9RA 2WWIA 5LB4A 2WJHA 2HUPA 1TQ6A 3A37A 3SC3A 2ZS7A 4FWTA 1GVNB 4U7DA 1G7CA 1SQ5A 3ZVLA 5JJLA 2FMXA 4J0QA 4MUBA 3I32A 5KSZA 3Q3JB 3KXLA 3NC0C 4MKFA 1E0SA 1KK3A 3FHCB 1QDEA 3VX3A 1E32A 1M2OB 3OEED 1M6NA 4G3XA 3I73A 4A36A 3FE2A 1OFTA 3TVTA 1VPLA 2I3BA 2XTNA 3B7GA 3LW8A 4PSAA 3REFA 3V4FA 4IOMA 1DE0A 3P20A 3P32A 2C98A 1KSJA 1MO5A 1NJFA 5AK0A 4BUJA 1A7JA 3CNLA 1NMYA 3CX7A 3EPHA 1WQ1R 2EVWX 4BFXA 3CF0A 3VFDA 1RRCA 2EYUA 5TY0A 1NY6A 2WVJA 5JHHB 3PENA 2WJIA 3CONA 5JWRA 3NHBA 3WNBA 1KI1A 1R0ZA 2YJTD 1OIWA 2HEIA 2ZJ8A 4PHHA 2W2TA 2NTYC 1GRNA 1DAIA 2JATA 1TQ4A 4QXAA 5H1YA 1W4CA 1DO0A 4KBFA 1QF9A 1NLZA 5TB5A 2JIZD 1F5NA 1CR4A 3KDSE 2CL6X 3U5ZB 1P7CA 1ZM9A 2W00A 3AB3A 3REGA 3PVSA 2MSDB 5FUVA 5D3MA 4D4LA 1P2TA 5IK2A 3V00A 3MUFA 2YVUA 3K1JA 4DLRA 4KJZA 1RJ9B 1E2HA 5JWOA 2QUZA 2WMOB 1G5RA 4B6EA 2OXCA 5E95A 3T34A 1W0KA 4JVLA 4RY2A 1OB2A 4QGGA 4Z1MA 2IYXA 1LVGA 3BFVA 2XGJA 5HE8A 2QPTA 2RB4A 1IY1A 2B7BA 1ZCAA 2IF2A 1CXZA 1KY3A 2YOHA 4HAVA 1ZU5A 1LY1A 4RKFA 2JLSA 4ZIRB 4YXWA 3QY0A 1II0A 3A4MA 1TF5A 4MGKR 1FP6A 3GJ8A 3WHLA 1YHNA 3RVBA 4K8OA 3K9NA 5JSZA 1YR9A 4QM7A 2Z0MA 3TQCA 3GLGB 4KO8A 4KYIB 3C5CA 4LBVA 1WCV1 3BH0A 2P6NA 3CPJB 3WBKA 1VG0B 2Z6VA 4WXPA 4UXIA 2NIPA 4F4CA 3ZIAD 4G01B 4BFYA 5IF9A 4NL4H 4EFLA 1FZQA 4CYMA 1AQUA 3C14C 5JSZB 3B1XA 1J8YF 4I1SA 4BZQA 1ONBA 3CW2A 4KLZA 1QRAA 5L8VA 5JJKA 2VHTA 3WNCA 3AVWA 4Q9HA 2PLRA 3X1DA 1KI6B 1TF2A 4HB2A 2X2FA 1KK2A 2ZRCA 2HF8A 4N0EA 5F9FA 4URWR 2FWRA 4HLUC 1BYIA 1FW6A 1XNJA 2NO1A 4Z8YA 1BMFA 1MR3F 4M0LA 2CDNA 2GCOA 1HQYE 2GTPA 4HATA 4TT3D 2J7PA 2H92A 1WBDA 3NG1A 3AVQA 4TQ9A 1FX0A 1OF1A 1MH1A 1OKKD 3BD9A 4XD7A 2J7KA 3PFIA 4Q21A 2VH5R 3MMPA 3RHFA 3SR0A 5KOYA 1M34E 1T5IA 2CHVA 3RC8A 1PVOA 4X8HA 3AKDA 4GBMA 3JZAA 1N6OA 3BWDD 4FMCB 3EX7C 2Q9BA 3TK1A 2FFBA 1VIYA 3Q5EA 4A92A 5L3SB 3ZZUA 4BLSA 1D9ZA 4LHVA 3LH5A 1AKEA 1TMKA 3LVQE 1W4AA 3R20A 4LYAA 5TVKA 4V0NA 5DH9A 1R0WA 2F55A 4OQLA 3RRZA 1XTQA 4EUNA 5BW8A 1P2VA 2K5UA 3FMOB 2L0XA 2X2EA 4QFMA 2D2EA 4KHZA 2ZSEA 4NYJR 4QBGB 5B30A 1JJVA 1E1RA 1AS2A 4RD6A 2QPOA 2I4IA 1X6VA 4M9QA 2FPMA 4IFEA 4A15A 1UKEA 3B8HA 3T12A 2JA1A 3A1TA 1MRNA 2DY1A 521PA 1GKIA 4ON9A 4QL3A 4C4PA 1Z83A 4BZPA 5EP1A 5FBRB 3W5IA 3BH7A 2R65A 3D3QA 3NVAA 1TU4A 4NPHA 1KKMA 1IN4A 4E5UA 2ZM5A 2FNAA 3T06B 4EIWA 3K70B 1N5JA 4HUTA 1JAIA 1WXQA 3U6BA 3MWJA 4OI1A 3EIQA 1GILA 1D2EA 1XTRA 3F3YA 1Z0FA 4BFVA 2QL6A 2ZR0A 4TWZA 5HR5A 2OSBA 3CRVA 2QAGB 4LX0A 4NYMQ 2A5FA 4C0KA 2A9KA 4KITB 1F3OA 1DOAA 4AYTA 4NYIR 1KDRA 4AG5A 2OXRA 2WZQA 4Q1DA 1G6OA 3THYA 3CO5A 4Q4JA 2C04A 1UKYA 4LHZA 1JQJC 2NO9A 2JDIA 4A2WA 4C2TA 2V7QD 3ZD7A 1UBCA 1ZM4A 2KJQA 2FPLA 4FW9A 3U3RA 3IO5A 1OH8A 1E3MA 2KB0A 1IQPA 1ZW6A 4RKEA 4DCNA 5JCZA 3N2IA 5GJVC 4LBZA 3OESA 3MWLA 2EWWA 2HT6A 1TU3A 4YMTA 3CWQA 3AF2A 3B85A 4EPXA 1YRAA 2IF0A 3BB4A 2JLYA 1U94A 1D2MA 3GP8A 3U3MA 4TYWA 4GNKA 5HTKA 3UMSA 1DVRA 2RGNC 5CM8B 5KTYA 3D7MA 3PJRA 1DPFA 2QAJA 3ONWA 1DAFA 4PC1A 5SZHB 4C3ZA 4DUGA 4EJSC 5KHOC 5C46F 3VHXA 1Q1ZA 1QHXA 2DWQA 4P31A 5GJWC 5E7MA 2OCYC 1KSFX 2C03A 1NG1A 1AA9A 2DCUA 4FD2A 2PX3A 2ZAOA 1T9HA 4RD0A 3SNHA 4M8NE 2XTMA 1NBMD 1R2QA 1YVDA 2R2AA 4Q4HB 2GVZC 2VHQA 1SKQA 3SN6A 2G6BA 3CPHA 1LNZA 3UWOA 2ZI3A 3KJHA 1EWRA 2GAAA 4TMTA 3ZQJA 2HLDD 2EYQA 2IS4A 2A7QA 2QT0A 3L0PA 3SOPA 1LF0A 4F93B 2N42A 3QKSA 4NYJQ 2GJ8A 3CRRA 3QVUA 5EP4A 3EXAA 5J47A 4CDGA 1T0JB 2QGZA 4KU4A 1XWIA 1GL7A 1OHHA 2XNSA 3SJBA 3CX8A 4OI4A 4BLRA 2W6JD 3X1XA 4TL6A 4CIDA 5JLJA 4AIIA 4TL7A 2GXAA 1IJEA 1CJVC 4RD4A 4PQYA 4B3DA 1CP2A 1G18A 4M9ZA 1NNEA 1XDBA 4MDEA 3HYRA 4TYPA 5E7JA 1KO5A 3P1JA 4PZYA 4PC2A 1VG1A 1CEEA 1S1MA 2WJJA 2O8DB 1D9XA 2NZJA 1EFHA 1FNNA 3CNNA 4LOAA 1U8AA 3RRYA 2QEQA 1OIXA 2VP0A 3IUYA 2CMKA 4HLDA 3CBQA 3I3SR 3NIBA 4JT2A 1Z28A 3ZD6A 2VP2A 1OH5A 2EFCB 4V0MA 4LDJA 3CR7A 1GKYA 4B2PA 1E79D 1VHLA 1XZQA 3D31A 1L4UA 3L8YA 3BB1A 2ZE7A 3ZVRA 5CITA 2QG6A 3QEJA 2ZRHA 1XZPA 5HCNA 4DCUA 2DB3A 1EFCA 3IEVA 3UWKA 2Q3MA 1E2JA 2J0UB 4KI0A 4OK6A 1E9SA 4I1VA 4PZZA 2OUKA 5F98A 2WWGA 2CBZA 1GIAA 2ZI6A 1M7GA 5E7IA 5BN3A 1X8KA 4PO1A 1G3QA 1MT0A 2BEJA 5AUOB 4ZKEA 4Q5IA 3SHWA 1P60A 5KNCA 4QKQA 5HKKD 2IWHA 1Z6XA 1B23P 2RGDA 2OFXA 3A1VA 5JHGB 2ERYA 1BMFD 1ZNXA 3N2EA 1HA3A 2GBLC 4ZDWA 3NBFA 1UEIA 1Z22A 1XPUA 3NH6A 4WW0A 1IBRA 5DNYB 1GZSA 4D0LB 5EJEA 3BAFA 5HKKA 1G8YA 4IDNA 5M04A 4B6FA 4IOKA 2VHUA 5P21A 1TEXA 4ASUD 3L0SA 3THOA 3QKSB 3DOEA 5C1BA 4ESHA 4MGZR 2ZJ5A 5KU1A 4QNRA 2IW3A 3EWSA 3P27A 3GJ5A 3AEZA 1KI4A 4BGDA 4Z51A 2ANCA 2EU8A 2Q9AA 5HCIA 4RZXA 2IHBA 2HCJB 3VKHA 1RW4A 3AKYA 3DM5A 2QORA 1YR7A 4L9WA 3L0OA 1KJYA 2WWXA 2A5GA 3WRYC 1QG4A 4KAXA 3SDZA 5F9HA 5CYOA 1UBEA 2RKOA 4DCVA 2NG1A 1G19A 1CU1A 3HPRA 4Y0VA 1EG7A 4GOJA 3U4QA 1E79A 3I4LA 3AVUA 4KFRA 1N6IA 1SULA 2ZJZA 3T1VA 4OI2A 3TUIC 4EKDA 2D06A 1CS4C 2V54A 1UPTA 2FF7A 2O8BA 3N5CA 5J40A 1KO4A 1W2HA 1UFQA 4V02A 4BRWA 4M21A 4R71A 3H1TA 4OQXA 3X1YA 2GAOA 2VP9A 4Q1BA 2JJ2D 2QZ4A 4IXNA 1NN3A 1JR3E 4LHWA 3BH6A 3NHAA 3B2EA 1R8QA 5B2ZA 3MD0A 2O8EB 1RYHA 4P4SB 1ZM3A 3ZLJA 2AN9A 1C4OA 3ASYA 3V4RA 4TYNA 4N0DA 2ZVPX 4I1UA 4IEIA 3NEJA 4Q01A 2WOJA 3LNCA 5EE0A 4FMCF 1KI6A 5G3YA 2PL3A 2ATVA 4Q7JB 4RD2A 2VPPA 4I99A 1JEDA 1UJ2A 5JBQA 1GM5A 2HCBA 3WYAA 3W90A 3DOFA 3U7HB 5HPYB 3W5JA 4MRSA 1XEXB 5FBQB 3F8TA 1L7VC 2FDCA 5LD2C 1G3UA 1NI3A 4A4DA 1LB1B 4C0QC 2FN4A 4A0FA 2MSCB 2G83A 4JLNA 3CR8A 1PLKA 2A5YB 3B5JA 4LUCA 1NBMA 3AVVA 1TNDA 2ZRIA 1HEIA 2ZEJA 2V3CC 4DHEA 1I4LD 4PPQA 2H18A 3LQQA 5FTMA 4D80A 1FQKA 1BH2A 1JBKA 2V8OA 3AQ4A 4RFSB 3LLUA 1BIFA 3GEHA 4LYHA 3LAWA 1VYTA 2QM7A 3OEEA 6Q21A 1ZMXA 1UM8A 1NIJA 3TJZA 5C18A 2IBMA 1CIPA 1E2EA 2P3SA 3P4XA 2FH5B 1ZIOA 2BWJA 3T5DA 2OILA 2F6RA 4QJ4A 3RWOA 1U2RA 2NOAA 2AHOA 2RHDA 1N0WA 3QQ5A 2ZE6A 1TQ2A 4AURA 3SBDA 1VKJA 4LJ9A 2N46A 3CLVA 4BFTA 1G8FA 1NJGA 1XCMA 1X8LA 2VA8A 4C30A 3U7EB 1G8PA 4YQFA 2O8CB 2IXEA 3BERA 2IYQA 1HQCA 4DWJA 3THWB 4V0ME 2ZROA 1W4RA 4TTQA 4DSTA 2G77B 4JBYA 1Q57A 3Q85A 1NKTA 3W3ZB 2Q9CA 1J8MF 1Z06A 4XOIA 2IXFA 2IYLD 5AR1A 2VLIA 1DELA 4G5QA 4PX9A 4BFWA 121PA 2ZPTX 2DFTA 3NDPA 1VYVA 1ANKA 1A5TA 3LD9A 4HB3A 1PV4A 5DI3A 3BFKA 1CJKC 1Z2AA 3BORA 3FKSA 4C0SA 4EFNA 2FFQA 3FFAA 2CK3A 3L82B 3UMRA 3MSXA 3CM0A 4XJXA 4A82A 5DSZA 4FCTA 2BBWA 1NLFA 3CRMA 4V0KA 1FP7A 1R7RA 3DO6A 4YLGA 5LD2B 4TMVA 2ECKA 1W46A 1QHHB 2QROA 2F43B 1P2UA 1NN1A 1YJ5A 4WXRA 1G1MA 2FJUA 1Z0JA 3B78A 3PV0A 2IEYA 1Q22A 1OT3A 1OW3B 1XMVA 2Q3HA 3C16C 4V0LA 2AKYA 3OZXA 5A4JA 4G5RA 4Q03A 3TE6A 5GADl 3ICEA 1AJEA 4XH9B 2CJWA 4Q00A 2PLFA 3M6AA 3AM1A 4B3BA 1GNRA 1OB5A 1T8UA 4DLSA 4DRZA 2FSHA 2GCPA 2IEZA 3QKRA 1ZM2A 3C5HA 4U02A 3IIKA 2ZRKA 4LBWA 4DLYA 2ZE8A 1R6BX 2YKGA 2ZRPA 2X8AA 1E2NA 2C77A 3R9WA 1M8PA 5EXTA 4CF7A 3DPUA 1QVRA 4AKEA 2LCFA 1Z5ZA 4CEIA 2GXSA 4AKGA 2P5SA 3EASA 4M1KA 3V9PA 1NVVR 2V6JA 3C15C 1YZGA 3AVXA 3VR5A 2O52A 2CNWD 3MG9A 4PAMA 5FH9A 2IUUA 4BASA 3FDIA 3AH8A 4QHYA 2REXB 1UF9A 5KDDA 2Z4RA 1XJQA 1F48A 1DTSA 3IHWA 2EFHB 1NVUQ 1E6CA 1E0JA 1SXJD 3GFTA 4MGIR 3BFXA 5FTLA 1KY2A 2RMKA 3PEWA 1UADA 2VP5A 3U60B 1MRSA 5J4YA 2ZXUA 3M0EA 2J7PD 1I2MA 3NXSA 4KFUA 5FTJA 3QPWA 1JXOA 4FWIB 4ZO4A 3L43A 3GEEA 3K70C 4BFUA 4BRUA 1AS0A 2XOKD 1OXUA 2BM1A 5KO2A 4QGHA 3QXCA 1E2KA 4A0GA 2J46A 5EQTA 1QBKC 1ESNA 4D4JA 4BEBA 3SYLA 5B57C 4EPVA 4NYIQ 3QPVA 2JJ8A 2XITA 2XAUA 2FZLA 2BC9A 4O0MA 4PAOA 3T1QA 2O8BB 2RGNA 2WIBA 2QMHA 5JECA 2VP6A 2W58A 4URZR 2H57A 1Q1QA 2ORVA 4MUAA 4RJLA 4Q4HA 3B60A 4L16A 4P3YA 3R7WB 4LV8B 1N6LA 5KSYA 5KDLA 2CLDX
chains in the Genus database with same CATH superfamily
3ZIAA 2C5EA 3I61A 2JI4A 1TM5E 1MX5A 4L8GA 3BCUA 4FKBA 4DMLA 4S04A 1PNTA 3G0CA 3DE4X 4IO0A 2ZULA 1RLJA 4WKNA 5C4GB 5B2EA 1PR4A 3PC8C 4IS2A 4KN5A 1DDOA 2MU1A 4GOLD 3K1YA 4PLYA 2I7CA 2DHRA 4GOKA 4CKBB 3OWOA 3LS2A 5DT2A 1E3LA 1FNMA 1Z45A 4BX9A 1T0BA 2DBVO 1L5RA 4E4TA 4RZQA 5JNRA 5JARA 4UM9B 1XNQB 1F5SA 1VMEA 2JKVA 4DR4B 3KHTA 5FP0A 3ZIUA 3WL5A 2PD6A 1L4BA 3IAAA 3M5WA 5FBHA 1FRZA 3N8HA 3QV1A 2ZR9A 4D8YA 3W2GA 4UHJA 4B1FA 2A1IA 2YWFA 4MQMA 2XDQB 5EY5B 3WP0A 4XKJA 3WS7A 3ZH9B 2CVPA 5JXWA 3CPEA 1T1JA 5EI5A 1EVKA 1BO6A 5FL7D 3T41A 5JQGF 1H9AA 2Y0CA 1FYEA 3I4CA 3RLFA 3TMYA 4COOA 4ECEA 1TAQA 4NBRA 2Q7OE 4GW3A 3AV3A 3KOMA 5CX4A 2JH9A 4D82A 5JADA 3L6DA 3QV2A 3S8YA 3UHFA 5IEJA 2PUTA 3OO1A 1ONOA 2VNIA 4MICA 5C8DA 4XSHA 5JNUA 4HPXB 4CQMD 4MJ7A 2XMGA 1QR2A 3FUVA 3GWGA 1Y37A 3IHTA 4N6GA 3QMPA 4Q3OA 5BORA 4XVQA 2A5LA 3Q8KA 1AUPA 1R0YA 2VQSA 3QW4B 4HFJA 1WUYA 4UBKA 4WGGA 3TSOA 5ITZA 5AKIA 4BXOB 1JQKA 2VRWA 2C2ZA 2YINC 4QGFA 4X3CA 1H8HA 2CLSA 1XP5A 4BNWA 2X9LA 3F7TA 3L2OB 4MRRA 5I9BA 4ZI5A 2PH1A 4HJRA 5DBEX 1GSIA 2PRKA 1V16A 3QWHA 1G4HA 1C4XA 3D2BA 1FVXA 3DWFA 4HGPA 4L9AA 4BO4A 2BL4A 1GPNA 2X0DA 4W6QA 4RIIA 1E1QA 1VE5A 4OKSA 3N0VA 3UAWA 1O0BA 3ROKA 2RGUA 1PFWA 1UC9A 4NMMA 2FW0A 2OBFA 4BGEA 3BSYA 2W6IA 4WY8A 3TAUA 3ADDA 5DHAA 1G8HA 1KZ4A 4WX2B 2YZ2A 3FJ1A 1I3KA 3A1UA 5ALGA 3TW6A 2R6HA 3U61B 1PGQA 3RCBA 3T0FA 1MW8X 2Z3WA 1DCTA 2YY5A 1RXEA 3O1LA 4JVMA 1B00A 1TM7E 2AMLA 1ND6A 2GR9A 1G5PA 1FTSA 3PRJA 1SVNA 2LKCA 1FQJA 4CODB 4DJEC 5EJ6A 2ATCA 3ZDYB 2OCIA 2AD5A 3OZIA 2EKQA 3PICA 4GRDA 1QJCA 3VZSA 4ABYA 3GVXA 2J3EA 1AZSC 2GEDA 4RZSA 3CUSA 2H52A 4QGAA 3Q5DA 5F5NA 5GONB 3ZV3A 3DMYA 2QIPA 5SY9A 5LQAA 3TOSA 1BHQ1 5IKEA 3P9PA 2YN0A 5FFFA 2YIJA 1ZK3A 1QP4A 2C9MA 4KFTA 2PXCA 3ENKA 2QZZA 4GS5A 1IWPB 2BJHA 1K27A 2EOAA 4GUAA 4LF9B 4LGVA 3E22A 3VNQA 4C05A 2C9YA 1ZY2A 1JFLA 2B20A 1WBBA 3AI7A 5K3BA 4UTVA 3ZWOA 4GEGA 3ABOB 1NBEA 1PQ4A 3HO8A 4KMSA 3IC5A 3SIWA 1U81A 4BS9A 4AN1A 5EUQB 5LUBA 4TKVA 3DMPA 2WWHA 3NGXA 4IH4A 1BMQA 1US8A 4I66A 1WXXA 1K75A 2HW8A 5FPQA 1G9TA 3W1EA 2YZGA 4PZUA 4JLPA 4OL0A 1IB0A 1DEHA 2PUWA 3HZOA 2J31A 3MJHA 3R41A 1HDOA 4CW7A 1MABB 1Z62A 1GL3A 2ACEA 3ZOZA 3HPQA 2LPMA 3FNRA 3R6TA 4BNIA 3LE8A 3QFTA 3ST7A 3RS0A 4C76A 4QM6A 3P9QA 1XKTA 2PX8A 1E9EA 3VPHA 3B52X 3EC2A 4HDSB 2XTZA 3QMVA 1TO6A 2C9DA 2CVFA 2PZLA 4V0QA 1JXMA 3F2VA 2WM3A 4XPIA 1EGQA 2PS0A 1V2GA 2C3PA 5H16A 2GPNA 4YT4A 1SKYE 4BO3A 2JJ1D 1KERA 1T3SA 2HQ1A 4JB2A 1ZICA 3OQBA 3NP7A 2XT0A 3PPYA 4GLJA 2YYAA 2PMCA 2KS6A 4EUFA 4IX1A 2AFVA 1HL7A 5JZVA 2V1UA 1NI5A 4H18A 4B3JA 2AUTA 1E4EA 5AUNB 5FTNA 2PZJA 1MB2A 4YV1A 1C81A 3RK0A 4DPKA 4IQ4A 1OZ0A 4A8JC 1CRLA 1D4FA 2DE0X 2IP1A 7GPBA 4JYBA 2I7XA 4QHTA 3ZUGA 2Z2IA 2VWHA 4IV0A 3ROMA 5LUAA 1ZD8A 2RC5A 2WA1A 5FWXA 3ZU5A 4I5DA 3BIFA 2CDBA 5ALRA 4MO2A 4E6EA 1TK3A 1QE5A 2B92A 1BE6A 2PDAA 2AEMA 4CEIB 5KVSA 4X62B 3D4IA 2WTEA 2I3GA 1UC4B 3U4MA 1OQAA 3RUDA 4OGFA 4J0CA 3WFIA 4DIEA 3LCJA 2CC2A 4HAWA 2YZNA 1J0AA 2WHQA 3TVYA 2P1DA 5CA0A 2AUMA 5AW0A 2VUTA 3QUQA 4U5QA 2VXBA 1KRHA 3QH4A 3ONVA 2RCNA 1NTRA 3GRZA 4LF5B 1OWLA 2FW1A 2FN9A 4TLDA 1JFFB 5H3LA 5IM4F 2MHCA 1AM4D 6Q21A 2QD3A 1JJFA 1OX5A 1Z6ZA 1JECA 3HU2A 1S8AA 1ZSYA 2CL7X 2ORWA 4G4IA 3RS5A 3WYEA 4ARBA 1UKAA 2PUBA 4AXXA 1V0JA 4GFDA 1H2FA 2OT3B 1I4OA 2HMVA 4RWEA 4CQJA 1E6WA 2PANA 3DULA 4HYQA 1JG7A 5J2TA 2O5CA 3ZCRA 1LBEA 2OGZA 1JW9B 1WUJS 2WEKA 4WLVA 5DB4A 3QNWA 4KK3A 1DKMA 5C34B 3O4HA 3E1GA 2QP9X 5D1NA 1Y1QA 2H2FA 3GCDA 3JYQA 5AJVB 5EL0A 3AV0B 4CETA 1LPSA 3HI4A 5JI2E 1MO6A 2HA5A 5I48A 4Y1RB 2ZSIA 4REQA 2IHTA 4OXKA 4ND5A 2J1LA 3PUYA 5IZCA 3QNUA 1X92A 1XJWA 2PVCA 3BWBA 3G2NA 4UU0A 1SFRA 4TV8B 4AD8A 2XWJI 2PKWA 4EAQA 1H8HD 3KKPA 1R00A 2P4SA 4KAJA 1NN5A 1P91A 3AM5A 5FI5A 5TPZA 3A36A 1ZK4A 4D99A 1XVAA 3R3HA 3F3SA 1KR5A 3WJ1A 1O9GA 4DVGA 2JAQA 4W5RA 3L8GA 2E89A 3AT1A 4OMUA 2AXEA 1I33A 4O4IB 4HGOA 3UA4A 1XBTA 3AL2A 4EI7A 2CFOA 4M38A 3K2IA 2I03A 4EFKA 1RXUA 3I1YA 1V71A 1N1GA 4R9SA 5EXSA 2W2XA 1XZLA 2PT7A 2F3TA 4GQBA 2WTNA 1MB9A 4Q47A 4CEHA 2H5JA 4ZEMA 3MGCA 5ESWA 1NPYA 1JTFA 1XP8A 4DLPA 3PEYA 1PO7A 1OU0A 4TLAA 1PUJA 2PBRA 3EUAA 1AA6A 1X7HA 4LGYA 2Z2ZA 2C00A 1KVRA 3N0XA 5CDSA 2ATXA 2JGRA 3ME5A 1J33A 3OMXA 1ZC3A 4D46A 1M5RA 2XSZA 3E7DA 3DBLB 4XWOA 1MEJA 3P96A 3IPCA 1TC1A 4ZT4A 4YAIA 1TVKB 2E1PA 3CJTA 4LGCA 4DCPA 1Y8QB 3EN0A 3H6GA 5EZ5A 2MYTA 1RHJA 3K92A 4EM6A 5JBIA 3VU9B 3STXA 3ZNPA 4F7WA 1K7XB 1A50B 1IVNA 2Y2VA 3O84A 4PG5A 5K6AC 1W1WA 3TSAA 3QLTA 5ICFA 4AY4A 3ZWBA 4PPGA 2Q3FA 4MI9A 3QXJA 5CA1A 4KR3A 1PS9A 3MCTA 3BHIA 3TZKA 4IWYA 1SC6A 4MB2A 1AQNA 2CSUA 2BH2A 2CNNA 5E9WA 5ULLA 3JTMA 2ZJ2A 1CLUA 5ALFA 3ZLTA 821PA 3KYBA 4MW6A 4BTLA 1LPAB 1KF0A 3LF1A 4CQLA 2O54A 2H2WA 2KBEA 3INNA 5H3HA 1CYEA 1RAGA 1WP9A 1WP4A 4WV3A 3GQVA 5IJ9A 3T5GA 4NCHA 3U1TA 3WIDA 4C6SA 2X14A 5FR2A 1VSVA 2HK6A 3JX9A 1PFUA 2QRZA 2XE6A 3OIWA 2FE1A 4UCFA 3V8BA 4BIMA 5A9SB 1B2LA 1FL9A 1MENA 2G8NA 4NU8X 4C6TB 4P83A 4YX9A 5BVHA 1UJ4A 2GPAA 3EA0A 2W37A 3NI2A 3FB1A 2GKSA 1IN8A 3LW7A 3A14A 4E12A 3NT4A 1HURA 1ZC4A 3ADBA 1ADJA 5C8YF 5ALEA 2YZMA 1JE1A 3UV6A 4DREA 2IHYA 4Y0AA 4BAUA 2EIHA 1M8GA 4HNAA 3VBCA 3HEBA 4E2ZA 1I6MA 1N1EA 2O3TA 5D8DA 2HYIC 1C9KA 2GK7A 5HOEA 3WDMA 1NVFA 2BZ0A 1KAEA 1PZNA 2FY8A 1T2DA 2OFWA 2YOFA 3NBUA 4IDGA 5EINA 3CCFA 5L3VA 4OHUA 3KYDA 3AW8A 1DTEA 1NXTA 1NT2A 1VL8A 3PL1A 4LN1A 1QQ7A 3B1ZA 1J90A 1M0SA 3E58A 1SB9A 2VK4A 3EPRA 3ETGA 4M0FA 4DSOA 5IG2A 4MCHA 1FB5A 1KYXA 2JW5A 4J0EA 2OHGA 2FW6A 1NKVA 1LSOA 3B9PA 4L0MA 3NGMA 3AUSA 4CN9A 4F4FA 1RFGE 2PZEA 4LBYA 4Z9YA 4DLZA 2A59A 2GBPA 4X0EA 4N0QA 3GLKA 2ODAA 5JT1A 5KYYB 1Y6QA 1T10A 1Z4JA 1D6JA 1YA4A 4FZJA 2IY9A 3V46A 4BNZA 3T3NA 1XD2A 2XVMA 4P5DA 6ADHA 1MLDA 4X41A 1JQ5A 5AKGA 3WIUA 4YJFA 4XB2A 1UJMA 2K4MA 3EDOA 3VQTA 3JQPA 2OV4A 4JJ4A 1JPUA 2FPIA 1D7AA 3S2YA 3EW9A 3WTCA 5DLDA 4HNTA 2PZBA 1M34B 1PNQA 3PNQA 2AMYA 2ZSFA 3UANA 4RAQA 4N9WA 2NO5A 1S2OA 2VTEA 1HYGA 1HEYA 2QP3A 2YMLA 4Z0HO 3T6KA 2IYTA 1NJ8A 2EDCA 3K8YA 4QUDA 3I04A 4DA9A 1U0FA 4M1SA 1CNEA 1OBFO 4CL2A 2DFNA 1ZNWA 1E60A 4MKIA 3A6PC 5A5FA 2G6TA 3MRVA 2WIFA 1M6VA 3LLCA 4LV6A 4LMAA 1X38A 4PQFA 4OOFA 2Q21A 1YACA 1JYSA 1P4JA 2FWAA 2IZ0A 3WHKA 1ZM7A 4FNOA 3WAGA 1DG3A 1KAHA 3AOGA 2QRVB 4KLAA 1HZJA 3GGGA 2VN8A 4ID3A 1Y4AE 4PYQA 1TT7A 2YHIB 3WGTA 2F7SA 4YRIA 2Q5HA 3NJ8A 5HVNA 2QXUA 1MA3A 1ESZA 1WHSA 1RC0A 2F8SA 1ZOSA 3BXZA 2IYRA 2ZJ7A 1L4EA 1W73A 2PT6A 3G7NA 2JZOA 1BXKA 3TR5A 5BW5A 4OI0A 5CLFA 2Q1WA 1CF9A 1KJNA 2J6IA 4YJ3A 2GF9A 1GFIA 5LQSA 2GYVA 1YIOA 5TF4A 5HZGA 1YSCA 1T9AA 1GNQA 2E5WA 4JB3A 5LSAA 3PXAA 1HE1C 4TZ6A 1WY5A 3UV3A 1XQWA 2DQSA 4CZ2A 4FTWA 4OYHA 2J87A 5AJWA 5HM8A 4KR0A 3NEYA 1WQ4A 1TYAE 2X1LA 5AJTA 2W2LD 4LZAA 3PWSA 4ICIA 1AGRA 1KJWA 2NXCA 2BCGY 1G7SA 1T0HB 1TQHA 3JYLA 4AUKA 1Y1LA 4BLPA 4IRMA 3UHOA 4HWRA 4G9GA 2OECA 3N8DA 1PGNA 4FKZA 1MGOA 4ISBA 5A4FS 5K8TA 5BPFA 3L07A 1JQDA 4UDOA 3SI7A 4DQXA 3OIGA 4Y2QA 3DNFA 1M83A 4MRMB 4ARAA 4KUEA 3CKMA 4B7ZA 1U0BB 3H2BA 4AQYB 3SIPA 4BV9A 3AUKA 4CG1A 1I51A 4C0HA 3A4NA 2QL5A 1QGZA 1EA5A 1NR7A 5LXTB 1O9HA 3D6VA 1R1DA 2I67A 3GCGA 3H75A 1CW2B 1NQWA 3PF9A 4FGSA 2P65A 4EP1A 3GLQA 4A0SA 2GH1A 1XDGA 3BZBA 3GVIA 4QYWA 3MBKA 4CF6A 4GX5A 3FNFA 4IDOA 1BFDA 1W5BA 2ZYWX 1E2FA 3C3KA 2I5PO 2D4AA 1GGHA 1IXRC 4IZHA 3SXUA 1ZIPA 3PT5A 1KZ7B 4AC9A 2XUFA 2E48A 1T4DA 2JAUA 3FVVA 4B9AA 4N47A 3Q6IA 1YZHA 4DVJA 5FPPA 1O0SA 2EJTA 4PBRA 1WKVA 3HJRA 3THXB 1G64A 3QOFA 1R6UA 4J49A 4LVCA 3NYRA 1P77A 1LJUA 1IVSA 3K9QO 4TPKA 3KEQA 3WSWA 4M9XA 1PSDA 4UVHA 1STOA 1MO4A 2HUNA 4YP7A 3RTCA 2UKDA 4ZI2A 2O8EA 3TUZC 3R7NA 3V48A 2WD9A 2Q2WA 1GUZA 5EXDA 4AWXA 1R4ZA 1XRSB 1SQGA 1B7GO 2W8BA 4B8ZA 4GOND 2FOLA 1BG6A 3OY2A 5CPBA 5EZYF 3DBIA 4HOYA 4KGDA 5DGIA 2QTVB 3G82C 4G07A 2WWWA 4I5IA 2R68A 1IJFA 3M3HA 4YJFB 1EFPB 1N78A 4C6HA 2JS7A 1FTWA 1THZA 3MMZA 1GCUA 4KK4A 4DA7A 3AVTA 3N39C 1JYEA 3GLHA 4IVRA 3GLGE 2RHLA 4F6LA 1ZHFA 3MT7A 2GZSA 4Z3DA 4AZ3A 3AF1A 3KKOA 3G1WA 3TQIA 3STHA 1L7XA 5DDIP 3QKUA 4EHLA 4ER7A 3TQFA 1CY1A 3O8QA 5CNIA 3MBOA 1US8B 2HMUA 1ZNZA 5CXUA 5B4TA 4WZBA 4MH0R 3PFWO 3K0CC 2XQVA 3I9JA 5EWMB 1Q1BA 2ZVQX 3I8XA 5EKXA 1Q0HA 2BOVA 2TS1A 2Z1DA 3EWAA 3QVXA 3EAFA 4MWDA 4TSRA 3R5JA 4KDFA 5EPEA 3TIIA 1GZUA 2XA9A 4U39A 4YJKA 5FI0B 1QH1A 5K51A 3VUEA 2PJRA 3WLPA 2ZBEA 5JQGB 3FSEA 1PQUA 2BGLA 1AZTA 2DHDA 2PUJA 4HDMA 1I4DD 1UK6A 3U81A 4G5SA 3L7BA 4OU5A 1LTQA 2BFBB 2EX0A 2PWBA 5HG0A 5JANA 2CV0A 2R0QC 4FQ5A 1DIBA 3KKQA 2MSEB 4W82A 3K5HA 1NMEA 4U2DA 4QVIA 2NP6A 3EEYA 2XCOA 4YC7A 3SZOA 3C7KA 4BP9A 2ECPA 5G0UA 2W0MA 1LWNA 4QO8A 4NCKA 4DG9A 5FPYA 5HRCA 1WLYA 4GG1A 2C7GA 5E7QA 1IN1A 3V6LA 2R85A 4UHFA 1ACJA 2QMOA 1WCYA 4A16A 2B36A 3GEIA 1WL8A 1T8TA 3GP5A 5EUMA 4NE2A 4C7OA 1WEKA 2GRUA 5E6SA 3BZUA 1FQOA 2XMSA 4NBVA 2GJSA 3ZZTA 3EMKA 5ALZA 4ZZ3A 1D1TA 4Y9RA 3RWBA 5BUSA 2JEOA 3OFJA 1LX7A 4MQFB 2Y1DA 2IUSA 5IWAB 1EE1A 5DEIA 4XD2A 4HWOA 3ROQA 7ADHA 2J3QA 4DY6A 4NXMB 3OE7A 2WFLB 4A6PA 5JRZA 3W3AD 3VBEA 2V3WA 5JALA 2JBAB 2RC6A 4D74A 4EI2A 5U1PA 4NZPA 1Z4PX 1T5HX 3T7AA 3WQBA 4R81A 1YFLA 5FUMA 4ROTA 1V5WA 3K0FA 4G63A 1C3OB 2AJ8A 4F46A 4HUQA 4BVBA 1CB7A 1QPBA 3K94A 2XJ9A 1N2BA 3DYIA 3WB1A 4GOMD 4CI9A 3PDUA 3F7NA 2YWDA 3QBTA 3QF4A 3QPUA 3IALA 4MQEA 3X1ZA 5KOHB 1GZVA 2WQ6A 2HDOA 2PN1A 3EQ8A 3QG1A 4QJ3A 3VO2A 3H5LA 3EZ7A 4E51A 2NMVA 4KQHA 2VDMB 1HYQA 3PC3A 4K86A 4DV3B 1GOTA 1OY1A 4WY2A 1J7JA 2P0YA 4RZUA 1AVTA 2HSDA 1RWWA 1H6CA 4MCAA 4MPTA 5SYMA 3DLTA 3U19A 1XLWA 3IUBA 4W9RA 3KOOA 4Y6OA 2WUDA 3BGOS 1YQEA 1DOZA 5A05A 4G8BA 5TXGA 2UUAB 2XI4A 1QHNA 1KS2A 4TMKA 1GRCA 2WMNB 1ZK1A 3ZZNA 5DI3B 3KKNA 1XYYA 2B37A 4Q3EA 3KLBA 5JSKA 4KODA 4BMZA 4O2AA 1E2GA 4LGMA 4DYVA 4WNCA 4DAEA 5JR3A 3D7SA 1CCWA 3UBMA 2I8CA 5KNCD 5AJUA 1XTBA 1Z13A 1BGWA 3O8OA 4S24A 4X91A 5H8WA 1ADCA 1KAGA 1YKSA 2W6JA 3HN6A 4BB6A 4AJOA 1C2YA 1CD5A 2GS9A 3X0DA 4EJSB 5A3QA 3FWKA 3G1UA 1UWVA 1T8RA 2ENUA 1GT6A 4MWOA 4LF4B 1ODKA 4MDFA 3CQ9A 2Q49A 2IYPA 4YQZA 3PITA 2ZJOA 1CF4A 4PF1A 1I5EA 2BMFA 2ZYVX 4YGXB 3B3GA 2AIRA 3S1SA 3D4BA 1UBOS 5EXXA 3QPAA 1Z0AA 3WAJA 1J1UA 3L8EA 3LC2O 3HO6A 1VCHA 4CUKA 5JAUA 5AJYA 1BKDR 4DR5B 3NM5A 2G63A 1QRDA 4UEJA 3GH1A 5IDWA 3M6IA 1RRPA 4BZXA 5CDFA 3UJ3X 1SXHA 1JE0A 5AQ1A 1MO3A 2QR2A 3ADCA 2ID9A 2Y4OA 1W9HA 1UT6A 4BGIA 4EHBA 5JCPA 5FNVB 4ARZA 4O4LF 2R8EA 1C1XA 4QC2A 5BSMA 1CZRA 1ZHOA 4DUGD 3LV8A 3IUEA 3WGQA 2G25A 2QSUA 4UOQA 3I5YA 3ZGNA 2UZ1B 3RPEA 4MUIA 4F56A 5HZHA 2HMTA 2O14A 3QX9A 2R1TB 3FMFA 1LDMA 5T6MA 3WMXA 4DDWA 1QE3A 5A02A 2MSWA 4UM7A 1ZGHA 2O59A 3GN2A 4M1MA 1VYHA 2ENWA 4Q9LA 4CVNA 3MTIA 1DAHA 1H0SA 2NM0A 4LI0A 4BNFA 2D7DA 3P19A 1V37A 3SYRA 1GRVA 2W4MA 4INJA 3MQ4A 4ZGGA 4K9SA 3IV7A 2XUZA 1I7SB 1QGAA 2QN7A 2YHSA 2XKAA 2OZLA 3U31A 2CXQA 1VJ1A 1O8CA 1RMQA 2V7QA 4CF4A 3ILXA 1IEXA 5DM70 4C14A 5K8CA 3SEFA 3GYGA 4K6CA 3WK5A 1Z6YA 1FFSA 4RE6A 5JS8A 1I01A 4WUVA 5BWNA 2D5LA 3HSKA 3CRW1 1UWCA 3AUTA 3VJKA 4MWSA 4P33A 4TWAA 4AKSA 4H7PA 1QIGA 1MIHA 2AKAB 4CQMB 4QQKA 1ZD3A 3HFRA 3TLMA 5BSHA 3LUHA 1EP1B 3KQHA 1XV5A 2ASEA 4YT2A 3JQQA 3V7UA 1JR4A 3ERCA 3O8OB 3QXHA 2KM1A 1O58A 2A92A 1J97A 1D2GA 4WXEA 4OHZA 1FSGA 2WWFA 2QVZX 3M4YA 4PLCA 3PEVA 4CT5A 2XVXA 3IQGX 1MVOA 3L1IA 3R0XA 5IJXA 5TPWB 4DQKA 1X1SA 3UK0A 3VM6A 4FIZA 3EF1A 4MOWA 4Z8XA 3D4PA 5LP6C 4RHYA 4D9KA 5CAEA 2AW3A 1Z29A 1HORA 4J1NA 4BMOB 1EFLA 3KDPA 2HRZA 2TMDA 3JQCA 4OAQA 2IHNA 3BX1A 4TMFA 1KETA 4DZZA 4YJHB 5KMGB 1WB9A 1Z56C 1HTBA 1ABEA 3ZLUA 2W2QA 3LUAA 4BNDA 1RBZA 2A5JA 2AYXA 2WSYB 4NRDA 3SLRA 4BECA 4MIEA 4LHXA 5A2GA 4K5QA 5KTMA 4JEUA 1ODFA 3AJ9A 1NDQA 2FFRA 4YMSA 1ZK2A 2DHQA 1THTA 2Z83A 3IAM1 1RKBA 3AM4A 1O54A 1ZRHA 2VF4X 5BQ5A 4E1BA 2D3WA 3ESYA 3G5AA 5CYPA 3DDNA 3ZZ0A 3GL9A 3LBYA 3CZPA 3ESDA 4NG5A 4D4KA 4EWLA 4YCSA 4JLJA 2ANBA 2Y1FA 4QDXA 5EJ4A 4TLMB 4WVLA 4R0NA 3EUFA 1Z4KA 5FFMA 5FWNA 5KC8A 3IDSA 4MV7A 4NBSA 4YV0A 3K0FB 3JQDA 4CF3A 2Z30A 4EHDA 1IHDA 5EXPA 3RBAA 3DKPA 1DLIA 2CCKA 2JFHA 1M6HA 1PJ8A 2ZIGA 2IXBA 1O97C 4FINA 4WZZA 3HJNA 3VR6A 3ZI7A 1FXUA 1NYLA 4U63A 3RH0A 4LF7B 4OX9B 2O19A 2O5EA 2ACKA 2O0KA 2P41A 1GFSA 2E5FA 2ZLBA 1L8XA 4PC3A 3IL2A 3KSUA 3JATB 2ET6A 3KUCA 3OQMA 3HL4A 2HQSA 3EVGA 2XNHA 4DJTA 2ZANA 4FILA 1Z25A 4B3IA 1R88A 1J0CA 1RRGA 5BUZA 4S05A 1U2QA 4UMEA 5ELXA 1U0HC 1NUTA 3C1OA 1I9CA 3JXEA 4JB0A 3GFOA 1JG1A 2EGGA 1J06A 1KC1A 4Y7DA 4KKVA 2XB2A 4Q4CA 4DDTA 1OILA 1QZUA 2A1UB 2PWZA 1QCCA 5AW3A 1FRQA 1W75A 3RFUA 1SVMA 1QTIA 4YP0A 4AX8A 1IBKB 2KBFA 1HDZA 1M67A 3A1CA 1KEVA 1CC1S 3HXMA 1T3GA 2CJWB 2F3SA 5JAOA 5FUBA 3LZ6A 3UOWA 3KZCA 3CNEA 2PSEA 3EE6A 4ND6A 2A88A 5I5GA 1A9SA 5AM5A 1WZ2A 1Y8RB 1I3OA 5H70A 1WWKA 3T4EA 5GONF 5JFTA 5FDFA 1QUEA 4NENB 1P0MA 1ORIA 1CDEA 2J30A 4J7XA 1DXQA 2OC9A 1XF1A 3NHWA 3OZRA 4BNYA 2CXSA 2PQ2A 2CV1A 4M54A 1DKRA 2X1VA 3PYXA 3KR9A 4ZC1A 3RSFA 3Q9NA 4YECA 3R7BA 2QE6A 4L8LA 1U1CA 4C4RA 3E23A 1X1CA 4RS3A 1FRFS 3RNLA 2FPSA 4ACAA 4E70A 9GPBA 4JLVA 1UIRA 2YW2A 3T52A 3G2IA 3I1JA 1OXXK 4LQLA 3FYUC 2PAAA 3PG5A 4QDUA 1B0AA 2MYUA 5D7BA 3UJ6A 3WOVA 3KQLA 5ALPA 4ZYLA 5B6PA 5KYTA 1NZJA 1FFBA 4D6XA 3RWMB 3W3AA 3OE7D 2IYEA 3A32A 4DOMA 2HR1A 2A57A 5F77A 4YXWD 1RLOA 1TEVA 2H1WA 2WHPA 4XD7D 1SK9A 1CHDA 3ZX5A 2QI9C 1S2NA 2ZFUA 4IQ0A 2RBKA 1N3BA 3EQ2A 4MV5A 2O7VA 4E5PA 3VYUB 3A2KA 5BWOA 4J7UA 1BQ4A 1V8FA 3NCTA 3U7FB 2P35A 2VOJA 1NXXA 4M0CA 4B2LA 3RREA 5HXAA 1KQPA 1J8VA 2ONJA 2LR0A 5JEDA 3HU3A 1G6KA 4BO8A 5JU6A 2A9QA 3A6ZA 3C5EA 3MTBA 2ZUWA 3H5VA 3OZGA 1PL7A 4Q7KA 2VYNA 3TNDA 3THXA 3TG2A 1T4BA 2FMIA 4NEQA 5CT8A 2QDKA 4YMIA 4MR9A 2IOFA 4UUMA 1NR5A 5A7GA 5UKDA 4CDNA 3HXQA 2BF7A 2LIPA 1QP0A 2O8FB 1W581 1X7GA 1QF7A 1S2MA 2H17A 3LRPA 4IJMA 4TKLA 3WLJA 4ALMA 2ZRNA 3TH5A 1I9GA 1QTNA 4W7SA 5K8UA 4MQLA 1NP3A 4RTSA 4B76A 2K7FA 3EVDA 4U7WA 1T4MA 3NRCA 2P79A 2NSYA 3HP4A 1UAAA 2D6FA 2YMQA 5CDFE 2AYYA 1THMA 3BE6A 4CMGA 4AW9A 1B8OA 4BPBA 3GLIB 1EESA 3KTAA 3TSZA 3LBFA 2R6ZA 2I99A 3OKPA 1Q21A 4JASB 1BKYA 1WR8A 4MR7B 4TTRA 1JHAA 1GADO 2EV9A 1NULA 2J45A 1ZSVA 3IPAA 3AHIA 1TZKA 3FTPA 2R60A 2X1HA 2PNFA 5AHWA 1NW7A 3NONA 5FI3A 1L8QA 5CBPB 2Q0SA 5J5VA 4LSWA 5CIWA 1WW8A 5IT4A 2AQKA 3HLKA 5F33A 3A9CA 3NYQA 2D2XA 3L7KA 2FRDA 2GHIA 1K4KA 1TIPA 1NIPA 3PQCA 4MQBA 1GGFA 1LLUA 1L5GB 4KR6A 4J0GA 2X6TA 1OFUA 4NEGA 5D87A 4L22A 4TQGA 3OE5A 2RKWA 3F7MA 1L5FA 2DSTA 3BSSA 3JWGA 4KQEA 2DCMA 2CLCX 3VR6H 2HT1A 3GB9A 4LTDA 1F2TB 1XDZA 2F3QA 1WQ3A 3LWNA 5F4BA 3TB4A 1HDEA 3FOFC 4IJWA 4J3JA 2CD7A 1WM1A 3D7RA 1N5DA 4DIBA 4BNGA 5JSUA 3WLAA 3EHEA 3OJFA 4MW1A 1NSYA 1J70A 3HRKA 1VE3A 2R1TA 3IV6A 1Q7GA 1U7UA 4HS4A 3JPWA 2AS0A 2C07A 3KT0A 4JR0A 1ZI9A 5KSOA 4LYGA 4B3GA 4AB1A 2NU9B 1NN0A 4C20A 2FE4A 3ADPA 1A4XA 4RVDA 4E1VA 4H35A 1CUBA 1KPHA 1MG0A 2WTBA 4Y2UA 2CXTA 4DMGA 4OKNA 2Z2JA 2OHJA 1CUGA 1VHTA 2WICA 1M7BA 2OWEA 2YXPX 5HRAA 2WV9A 2C2XA 1JKIA 3EVAA 4HZUB 4QYIB 4RDHA 3U3KA 2CZGA 2VF8A 2WHYA 3GU3A 1PZGA 4AY5A 1K6MA 3RUHA 4UVIA 2ZVDA 4X64B 2NN3C 3FFWA 1DAMA 4RCZA 2HK8A 1N8TA 4GBED 4KIFA 1OAAA 4PPFA 1AXEA 3ABQB 2IYWA 1WMFA 4Q24A 5K01A 2NVOA 3H65A 2N3ZA 2OD2A 4GC9A 5LZ5A 1UBMS 2WU8A 3QJYA 4P1ZA 5DXAA 4OXQA 2CSXA 4BN4A 3IULA 3EULA 2QGFA 1JXQA 1PV1A 4CR7A 3LPLA 4LS3A 3G3EA 2KWIA 1J99A 4J4TA 5AJHA 4ZCPA 5ARBA 5H4GA 3EG9B 3SSOA 1V5GA 5B7QA 3B7WA 2GYUA 2I4MA 1VTKA 2JHCA 1J2RA 3RARA 1OGIA 3RC1A 5I51A 1GAEO 2WJPA 3BMNA 3DBRA 3M82A 4B7XA 3EPKA 4ZCIA 1M1UA 1W6UA 3B1WA 3H6HA 4M7RA 5JNSA 4LJAA 1JWLA 3DO8A 2GN4A 1UQRA 2W6ZA 2O1EA 2VYCA 3D5EA 5CYFA 5EOVA 1JKJA 3BJIC 2F3RA 1EJ0A 3IUSA 1RP7A 3VYRB 4UUAA 5EGSA 3R7WA 2I7TA 2W2LA 4C0BA 3KQUA 3TX6A 1TMYA 3OZFA 4XVHA 2QTHA 1Y5RA 1CLEA 5DP2A 3P9NA 1JHOA 4EDFA 3IVAA 1UOOA 2FETA 1EH5A 1NYQA 5FOTA 1NUAA 1WXDA 3UQZA 4BP8A 1WCXA 3P9RA 5BSVA 1AMOA 1XN1A 5E6UB 2EGUA 2WFAA 3IEXA 1RKQA 1JR6A 3FMVA 4A8JA 5IDXA 2B4YA 2HPHA 1QV6A 1OI4A 4IVPA 2V7GA 3STYA 4HLCA 1DV2A 2OCXA 2W4IA 3EIEA 4K6KA 1BMDA 3UUWA 1N7IA 4YRMA 6REQB 3PQFA 3W2IA 3QEMA 1BDHA 1NW4A 5F3RA 4JYAB 4XQGA 2VPZA 1VA5A 3QVVA 4HEJA 4IILA 4F4DA 2JNWA 3J81k 3Q7RA 3OZWA 4YCBA 4Q39A 1O5IA 2DFDA 3EGXB 2FHSA 1KOGA 1Z5GA 1Y80A 2QL9A 1RNLA 3PUVA 4KAAA 1R9GA 2DWOA 1U63A 1IHYA 4J6EA 4P3PA 5JMTA 5KTOA 2IX3A 1YDFA 5KSPA 2H7YA 3RYTC 4HD8A 3AYXB 3D6MA 5K8LA 4NAVA 4MINA 2XJ4A 3T1OA 2D1YA 5I7EA 1CP3A 1MF7A 2PTHA 3CUWA 1R5OA 3E7XA 4D98A 4HLQB 1E92A 5IVDA 1E1NA 4GIBA 4N7RA 4UNQA 2BMWA 1SVIA 1ZIYA 1V4VA 1R3DA 4R2MA 5FBWB 3U62A 3G8DA 1Z8DA 2PR2A 1EFVB 1ZMTA 1RYFA 1UXJA 2COKA 4Q1AA 5CFQA 4AWAA 3L4JA 1KDOA 3QVGA 3NORA 2AQ8A 3K1TA 3EBLA 1GU1A 3N28A 3NVDA 1E9DA 1N5MA 3GYBA 3DHEA 3JZMA 1C7IA 4N0PA 3GT3A 4WXHA 3R0IA 1ZKDA 4R9VA 4JP2A 3BHNA 1NVTA 1ZBQA 5H0IA 1A77A 1WBJB 2WA2A 2V5UA 4ITUA 4OBEA 4A91A 4I50B 2BP7A 3TG8A 3IERA 5JASA 3ICOA 2V5AA 1SH7A 1KI7A 4CFSA 4ZOQI 3M6WA 2PT9A 3K5IA 3MF4A 1RPZA 1FDVA 3TNFA 1M1XB 3RE1A 5SY6A 3TLGA 4YALA 4BKUA 3SBXA 1T3ZA 3DEKA 3AMVA 4OXIA 1FRNA 3COSA 4V03A 1ZQ9A 1ID1A 1FFHA 1TJ5A 2TMGA 4LZLA 1N77A 4QDOA 1X19A 2ZYAA 5C2JB 1SBZA 2QRNA 4LXGA 3HE3A 3OAAD 1P2FA 2P5TB 2X23A 4JJ8A 2I6UA 2YHAA 1XQYA 4UJ5A 5IKMA 3DLIA 3UMYA 1K8ZB 2V7TA 1ODIA 4B3TB 3EEIA 1QQTA 1T0UA 4FYVA 2C83A 4JQYA 2GJAA 2JI8A 2QMZA 3THRA 1HE2A 1T2AA 2B1IA 3EVFA 1M76A 2C94A 4DR3B 1U5BB 3V1YA 1VBFA 1Q1EA 3TB6A 1LJLA 1TZJA 3N70A 4PRKA 5FUYA 5IKXA 4WINA 5DHSA 3KIPA 3R76A 2NZYA 4YGYA 2IS2A 4UEWA 1OWNA 1ZSNA 3QX3A 3WKEA 1HKHA 4EX7A 3OIDA 4BWYA 2G9ZA 3HDQA 3Q10A 4FVTA 2YYZA 3DL0A 1V11A 4HH1A 4K46A 4GSKA 1II8B 1W34A 3QXSA 1R0LA 5IBRA 5IUJC 2LV8A 4BFXA 3ZGLA 3BYZA 1ZXLA 1YCFA 3C3CA 3PDCA 2FEPA 5CFRA 1SU4A 2LNDA 1XTKA 1T13A 2OZKA 4LI3X 3DZGA 5JROA 5DBGA 1XOIA 5HK8A 5K2OA 3HM9A 2CJPA 2QVXX 5JYCA 1SXPA 1KKUA 4J16A 1E18A 2JH3A 3DEAA 1SQSA 4YAOA 5HWSA 4KREA 2ZPUA 4ZVRA 3FH0A 4I9UA 3GZNA 4XIIA 2BEVA 1ZJ5A 3VZPA 3U09A 2NTNA 3PHJA 3A2LA 1WA5A 4RANA 1CETA 5B53A 4ND4A 4FCWA 1GTG1 3SFVA 4ZVPA 3PZBA 1T8PA 2QN8A 1F2VA 4BNUA 2IV7A 1XJ0A 5DPMA 2EW2A 1WO8A 3HRIA 3KQPA 3OIYA 3KOYA 4JLAA 4F3YA 2OOSA 1HFEL 5BSGA 2I2CA 3VU8A 3SQLA 1Z36A 4TLEA 2AWOA