2F40A

Structure of a novel protein from backbone-centered nmr data and nmr-assisted structure prediction
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
SKWIKFTTNLTPEEAKIVQYELSTRDEFYRVFINPYAKVAEVVIDDSKVNIEELKEKLKGEVIEEKEITLQELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination of a new protein from backbone-centered NMR data and NMR-assisted structure prediction.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PF1455
total genus 11
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2005-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11491 DUF3213 Protein of unknown function (DUF3213)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1750 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2f40A00
2F40A
chains in the Genus database with same CATH superfamily
4DL6A 3BH6B 1H3DA 2B6AA 5KOWA 3KLVA 2W2OP 3ZZYA 3OR2A 1H74A 1IM6A 3QT8A 1TFYA 2UXDJ 2R42A 4IO9Q 3AT1B 2XCPA 1P9YA 3KLGA 2W9CB 3PX0A 2VQFF 2D41A 2F63A 1JXVA 4DV2F 1N33J 3GIRA 2A3JA 5LJ5Y 1S5ZA 1GX5A 1T9WA 2EWHA 2IBOA 3TANA 2WOMB 4OI6A 4KFBA 2XO7A 2UU9F 1RT4A 3TVKA 1N36F 3JS9A 5KFUA 5J2QB 1NK4A 4DLGA 1M0SA 3NGTA 4NCBA 2NXCA 3BKUA 2B9XA 1C4AA 1UPMB 1KFDA 2CYYA 3DM2A 2L9DA 3L7UA 5KFKA 5KT7A 3TX0A 4QYZK 3EGVA 4ZP9A 1C0TA 3G9CA 4LR7A 2YXLA 2K7JA 5L9XA 5KFLA 1WTBA 2RDIA 1G1XA 1JX4A 3EZOA 2E7WA 1ZZNA 4F02A 3HVWA 1UEVA 3HVTB 3UNGC 1FJEB 1N5VA 2PMWA 1TVRA 3ZTQA 2BQUA 2CPEA 4X4VA 1TL3B 3HSDA 1RTDB 2YNGA 5E33A 5FLXU 4Y00A 2AGPA 2C2MB 4DPWA 3CULA 2Y0SD 2BE9B 3NNAA 2GMJA 4DV1F 2RAQA 4CM2A 1N36J 2ASJA 6FDRA 2FJVA 2CIMA 3WX4A 3TZXA 4QW9A 4CH0S 3QZ7A 2RU9A 5IWAJ 4J9UE 4HI1A 1C1BA 1VQSA 2YPZA 3GMGA 1KQSR 3NNHA 4RBTA 5F3ZA 1NZAA 3Q0AA 4Q8FA 1SL2A 2V8GA 2AP6A 3N4WA 3IM8A 4ELVA 3ZNJ1 2NXUA 2C1EB 3W9JA 4JI5F 4DF8A 1WOOA 1DY3A 3VWSA 2ZUGA 1XMQF 4MKAA 3TP2A 2BRKA 3PYGA 3TA2A 1LFPA 5FLXY 2XEXA 4G1IA 2I2YA 1FRXA 1MW7A 2YQ1A 3L7PA 4F4YA 5IM0B 3PW2A 2C2OB 2MQMA 5DG9A 1EIYB 3RRGA 4ES1A 2E9RX 1KD1T 1RT6A 3CJTA 3IFEA 3LW5C 4DV6J 2DRAA 4F3QA 2MQPA 3MEEB 4LRCA 1VLYA 2VG5B 3TJ8A 2H5EA 1LXJA 4WP3A 3FCHA 4FPRA 1NK0A 2ROPA 3TRGA 3M9OB 2CDQA 3CJ8A 1RHMB 1XMQJ 4MAKA 1BQNA 3BGRA 4IFYB 5DO2A 1UVLA 5B0FA 2GNKA 4X4TA 2M0GB 4DR5F 3RB3A 4PXDA 4E0DA 4LSZB 4DFJA 5L8RC 2K06A 5C25B 3KK1B 1CJUA 3HJFA 4AXIA 2ASDA 5E3QA 3MM6A 1HQEA 3OR1B 4FYXB 2VONA 3VF0B 2HVEA 2DYAA 2JH3A 4K0KJ 1P9QC 3OTOJ 1BD6A 5D4LA 5K5MA 4Q0BB 3D3BJ 2JJ4D 2I9SA 3KG0A 3LP2B 4C7QA 4EZ6A 4X4NA 2IBKA 1TV6A 2HQCA 2HIYA 3OTDA 5CYQB 1HHTP 4AQYF 1Q82T 2EKYA 1JLFB 2QMUB 2R8IA 2CJAA 1F0XA 3AXKA 1HQUA 4DQSA 2FGCA 1G6BA 4ATNA 1T94A 1UEKA 2Q43A 2FY8A 3HFZB 3B78A 3MPVA 4WK1A 5B0GA 3W2WA 4ZN1A 4DSKA 4CYUB 1WG5A 3DC2A 4N7TA 1C1CB 1N88A 4LRFA 2J76E 2WW8A 2QA4G 4DG1A 2ZD1B 1MWZA 1XC9A 2J6TA 4B3RF 4OZ0A 3ENAA 4TN2A 3GTYX 2NPFA 1CQNA 1HBNA 1HBUA 2ZNZA 4DUZJ 1MROA 3UW1A 3UD5A 2KG0A 4ED5A 1JLFA 2OIHA 1DLOA 5LMUF 3A4TA 1HQ2A 3OLAA 1U1RA 2OH2A 4O0NA 1UVKA 3DLEA 3WDOA 3QWPA 1SL0A 4FF3A 2VFTA 3X3UA 2ZUAA 3HP6A 2R2RA 4IOBA 2MEWA 3LP1A 4I69A 4DCPB 3C8YA 5AE3A 5HROA 3Q8YA 5F0UA 4H4MB 1N56A 4ELTA 3C46A 3THVA 2CPDA 2MKCA 4WWSA 3PW4A 5ETPA 2CQIA 4WK3A 1F60B 1FD8A 2IMWP 3Q2TC 4DV4J 4CQ1A 3DLLQ 1VIOA 2VIHA 1T95A 2JL9A 3ZFVA 4HHJA 1NK7A 4KQZA 4DV7F 2C2KB 3W8PA 5E41A 1V3ZA 4PYDA 4ZLJA 3IR6B 3R5JB 1PC4A 2B4UA 2HAFA 2ZWPA 4IKAA 1BQNB 3BGRB 3G87A 4OYMA 4P73A 3MR6A 1VBKA 1UWAA 3CD5A 3MFIA 1N5QA 5F8JA 4KH1B 3OXLA 4IH7A 4YB7A 1RYRA 1O51A 1J5EJ 2UUCJ 4H4MA 1N32J 1KC8T 4MJKA 4RUCA 5EWGA 1SC4B 3DLGB 4G65A 3EVWA 4NA3A 1N5TA 3JSMB 4DSLA 2W01A 2CNLB 1TK5A 1VBXA 4LBIA 4RW6B 2XMTA 4W98A 4ED2A 2XS7A 2QT7A 1JIHA 5I3UA 2IC3A 1CC7A 5E3RA 5BR8F 3I5CA 3Q23A 3BO2A 3BGOP 1RAIB 3FGVA 2B4PA 2XQCA 4GRSA 4A4JA 4OJ3A 3MCMA 3M1VA 1FDDA 3MEDB 4YB1P 1XMOF 1OMSA 3D0IE 2LKZA 4TQSA 4Z7CA 3NEKA 2PC6A 3HHDA 3H2UB 3EDRB 1S79A 1NZ8A 1X4CA 1LNQA 1G7CB 1YK9A 4RNHA 5HO4A 3GV8B 2ZH9A 4USIA 4J5OA 3VAGA 1IBMJ 1ZPVA 5HLFA 2HFVA 1RTIB 2UV8A 4P71A 3UR3C 3CC4S 4A8FA 1N32F 4O3PA 3PEHA 2M88A 2UZAA 3P4UB 1X7VA 3UN5A 1M5PC 2HHUA 1RAJA 2JDJA 2JEIA 2H4YB 1H7WA 2R9LA 4MKYA 3GFZA 4DQPA 4F4KA 4V19J 3CCUS 1RZMA 2QN6B 5KFNA 3ZTPA 4MIBA 4NI2A 3KHGA 3VAHA 1S1UB 5C42A 4X66J 3R5AA 5D8HB 2AIRB 2R2UA 3MECB 2H9ZA 4MYTA 2ZBCA 4PYAA 1EX8A 1FKAF 2LA4A 1XTZA 2MHEA 4EYHB 2OAUA 1U02A 1YRUA 1NRKA 3FQLA 4DJBA 1TL7B 4ETZA 3KLHB 2PMZD 3D2WA 1DFDA 1JXLA 5KG4A 3MM7B 2R7WA 2QC3A 1FFGB 3OVAA 2EG1A 3IGNA 4P72A 3GIKA 3CTRA 1XIQA 1Z2ZA 1TTHB 2POKA 2H54B 2JNJA 3HKWA 3OSPA 4X4PA 1S1UA 5C42B 1VRUB 2V63A 4RKUC 5CYMB 4BLGA 2CQ1A 4NLVA 2BYCA 3FJ2A 2UVUA 1P1TA 2V9WA 2KG1A 2OI2A 1QTNB 2ZH7A 3N5FA 3H7HB 3O1LA 5DDRC 1T03B 2B4OA 1X9MA 2R8GA 1LW2A 1AZSB 5LMUJ 2RILA 1Y3JA 3MR7A 3NAIA 2E5JA 3S8SA 1RT4B 2BABA 2YNHB 3KJNB 1HD1A 3C6TB 1NNDA 1W25A 3S7RA 3LP0B 4CTAA 1S1WA 2RDDA 4M5DA 1IWAA 1NEEA 5L1JA 1VC0A 2F8MA 4LBHA 3CCRS 2ACMA 3I5BA 1LW0A 5DM7Q 1RABB 1SVDA 4ZLLA 4OI0A 2QGFB 4QWDA 5M2RA 3DYAB 3H4DA 1XQIA 1S7HA 1FVSA 3M1VB 4BC7A 2A6MA 2L48A 3MCOA 3Q8UA 5J1PA 2R8JA 1H98A 2NXEA 2QA1A 3ZO7A 5MLCV 4OZLA 5AT1B 1M1HA 2AKWB 3PG9A 2OEJA 3MOZA 1X0PA 2V2QA 2W2PP 4Y2CA 4DR7F 5D0HA 2Z58B 3Q8PB 4ECQA 1OYDA 3BR8A 5J1EA 2JLGA 4WXOA 4RNFA 4ANCA 3SIPB 3H25A 3PR5B 3I0SA 3AB4B 3GFHA 4CM0A 2RRNA 2BV3A 4ID5A 4M8LA 4P7VA 2AJQA 3TAQA 3FSYA 1QVFR 2R7RA 2OPQB 4Z37A 1BHNA 4M5NA 1TKXB 2FUG9 4B3OB 5F9LA 2A0FB 3SSSA 2B51A 2A2DA 3K17A 1R8BA 5ETRA 2DXEA 3M4XA 3JAMU 4DFPA 3DGPA 3M8SA 2C2ZB 1GFWB 2WSEC 2P5VA 3CIMA 3MMBB 4P2MA 4MK8A 1Y00A 2QL5B 1OIAA 4WYWA 1GTHA 3KFWX 1FXLA 4ZJOA 1EKSA 1UJ6A 3C2PA 4NZ6A 1KDNA 1K47A 2YWWA 4BCAA 5THWA 3DU5A 3OXFA 4JV2A 4LF7J 1MU2B 4F4XA 5CD4A 2XMMA 3CC2S 2I6WA 2FJWA 2E5HA 2GMLA 3AJ1A 3DM2B 4JI2F 2Q79A 1Q8LA 5J2NB 2DGWA 2ZJPQ 2V2KA 3ZXWA 4DR1J 1S0VA 4DHVA 1RT2A 2AX1A 3EJMA 1FRKA 4Q2MA 4IH6A 3KNGA 3FEXB 3VZHA 3J80U 3BGUA 1NB7A 4LF8F 5DM6Q 3D1HA 3G8TA 4ZVFA 3MUTP 1SJ3P 4E2FB 4PWUA 2XTJP 3GCWP 1KLMA 1KONA 4LRDA 4DPTA 4R5PA 2OFHX 4CO5A 4GMKA 4DX7A 1FKPA 2KYXA 1KP6A 1U8WA 3LGHA 3NWRA 3MPYA 5KTQA 3CGIA 2HMIB 1GH8A 3CJ4A 4W92B 5KG2A 1KS2A 4S0MA 1RT5B 3TR5A 2GJ2A 3SBMA 1KQGB 5A8RA 3M8YA 3MAHA 2GJIA 1HMVB 4C8NA 3HJVA 5CQGA 2ZOFA 4ZKAA 2NPIA 3K5NA 2CVIA 1DQAA 3R7NB 3ENWA 4QBUA 1WG4A 3HHLC 4R0EA 1VQ7S 4M94A 2C42A 4UY85 1Q0NA 5ETNA 4ZJLA 1IKYA 2DY9A 4RNNA 4ZN3A 1RAFB 2ZH2A 3V6DA 3MPUB 1QSYA 2Y8WA 4HH1A 2CPXA 1VQ9S 2NREA 5BYQA 4YQWA 4U7CA 2V68A 1QLNA 2P6SA 4DL2A 2LLZA 4M5HA 4LVNP 1LXNA 3H2VE 1HNWJ 5AXNA 4LFAF 4ED7A 4F3OA 3QRPA 1L5UA 2HZAA 4ZCMA 4UY8T 1UWBA 1JB0C 1FXRA 1NM2A 3NCRA 2KRBA 4RBUA 4ZPVR 2UVVA 5D6GA 4F2SA 4DV5J 2X1FA 3K58A 4L76A 3KJVA 3SCKE 2CUYA 2P9GA 1U1QA 1IBKF 2VUGA 2N4CA 1X4EA 5K9FA 2VG5A 5I42A 1FESA 3OFEA 1WKLA 4F3MA 3TZYA 2DHGA 5K8OA 4U67Q 4F25A 5T7LB 1X4GA 5HN0A 3PIPQ 3JYTA 2AZ3A 2HQGA 1KQFB 1X4HA 2GJFA 2IIHA 1N5YA 4OV6A 3TAMA 5L1LA 3ILJA 2W2QP 5KFVA 3DU6A 1SI9A 2G0IA 4XIUA 2IJNA 1HL6A 1HNWF 2HLTA 2ZH4A 3F44A 4O44A 3HM9A 4C97A 2WK4A 2Z57B 4NX9A 4FKYA 1WF0A 4KGZB 5IC4B 2WZ1A 4EYIB 4FF2A 4RBVA 2XB2D 1Q4RA 3NS5A 3G71S 3T1HJ 2E7VA 5HANA 3NMRA 2M4MA 1S0OA 4KPCA 2ADCA 3SSRA 4J9MA 5E2QA 3KLEA 4DSEA 5CXTA 4QPXA 2DNRA 1T9TA 3H90A 2VBZA 3M32B 1ZTTA 1RGVA 1HIYA 2XLJA 4TLQA 5HBMA 4EMDA 2XC9A 3MR2A 3L4BC 5KFQA 1HPZB 4TLRA 5ETQA 4QU6A 2WHOA 3VCDA 4JI6F 4CH7A 4IYQA 3V6HA 4CH1A 1R43A 2F7VA 4FVCA 2N7YA 1T8EA 3PACA 2ZE2B 1LWEA 1S1TB 2OPSB 4H54A 6AT1B 3TA1A 2MB0B 4BWMA 4WFAQ 2ASLA 4OI3A 1X5SA 5I3UB 3OFGA 1YJRA 4J7CA 5DLGA 1RHUB 2GQ2A 3CD7A 1IJFB 4DR4J 2IRYA 3QNWB 3IP0A 4IDKA 1S9FA 2GQQA 3LQVA 1FE4A 4I2PA 3T5JA 4KO0B 2XLKA 2GHPA 4PQUB 2RT3A 3DI6A 3SDEB 3FFIA 4ZVSB 2MZSA 3VGTA 3A8IA 4KYZA 1U6FA 4PEOA 2VA2A 1D8ZA 2ILZA 2YWFA 1NO8A 3GSIA 3OUYB 3CCES 2J0QD 2YX7A 4ZIVA 1FNOA 2KTQA 2O5DA 2IVYA 3GONA 3T5HA 5KFTA 5F8GA 4WFXA 4A8QA 2ZHOA 5J1EB 1UJ5A 4WJBA 3VAKA 2RUGA 1E6YB 4OI4A 3RRKA 2RQKA 3RB0A 5AXLA 2Q3PA 5T41A 4AYBD 3R2CJ 2HS4A 2C2NA 4NA2A 2MZ1A 1RHQB 1S77D 1KFSA 2O67A 4CO4A 3QLHA 3SMZA 3UVJA 3PW0A 2M52A 1YI2S 3KLGB 4DL0C 3O8WA 2W9CA 4N8NA 4Q5VA 1CC8A 4X64F 4OI1A 2CFXA 1WI6A 4ZDNA 3PKYA 1GMWA 5JMNA 1BWEA 1FJCA 1FWLA 1PC5A 1BLUA 1TQLA 1RUSA 2B9EA 1S48A 2DO4A 2FB0A 1REGX 3NNCA 1LK5A 1NCLA 4E98A 5GAGI 1FK9B 1L3KA 3RYLA 4CLZA 3KJFB 4J9NA 3JSMA 1ZA1B 3R7SB 1ULRA 4OQJA 4H4OB 3CJ0A 3DMJA 3DRSB 2IYIA 2K7KA 1A0OB 1B4SA 4FXDA 3M8PB 2I5JA 5IV4A 2XWYA 2XHWA 4P10A 1D0EA 2DCLA 5U47A 4J9PA 5AE1A 1VBZA 1NJWA 1MU2A 1N0VC 1AUSL 3RG6A 3FBFA 3E01A 3GCXP 2AJ1A 2KO1A 2BBEA 1P8GA 1Y5LB 4CCHA 3D68A 3OJUA 2IM2A 1U0SA 2H3EB 2YNFB 4H4KC 1ZZFA 5KG0A 2QL9B 4OHXA 1R8AA 5KFSA 2VV5A 1OY8A 3C16A 3IWXA 2KXFA 4RW7A 4ECYA 1RI7A 4JV5J 5A76A 4NCAA 4ED6A 2PO4A 3KNAA 3AJ2A 3DOMA 3LGMA 1ZOTA 3D1QA 5AJ3J 1VFJA 4CLYA 3PRBA 5C2GA 4FF1A 3M2UA 4DQRA 3KLIA 4GKKJ 2FJBB 1E6VA 3UQSA 4B9TA 1DQ9A 4GKJF 1PCAA 2XSJB 2DNHA 3U7JA 2VZ9A 3I4HX 1VDHA 1U4BA 1K8AT 2ZBPA 4USJC 2AYBA 3G82B 3ZC4A 2MJUA 1UA1A 4QZVB 5H1SV 2J9CA 3CJKB 3MD1A 5LSRA 1F5CA 4JI8F 1X4FA 3UDEA 1HBMB 3R5GA 1QSLA 2CZVC 2HFZA 2KHCA 4LIWA 3EE3A 1OSCA 4MK9A 4IFVA 4N41A 4FYWB 3M6VA 1TU0B 2AJ4A 4WPAA 4M95A 1TKTB 1JXEA 1KHWA 3BKFA 4ZPCA 2IRUA 1MMDA 3D7SB 3OFFA 2HVHA 4C6AA 3SV3A 4AD6A 3W9IA 1LFWA 2BJDA 2E29A 2KJWA 2O3DA 3EZ5A 1OSDA 1WC0A 4LFBF 2MKYA 3EPIA 1FCAA 2W4PA 3H5UA 3M7VA 3ONQA 4U7UK 1U8SA 4N47A 3OSNA 3CT9A 1QE1B 3CCZA 3VQSA 4TU8A 2FVQA 3PHTA 3GZ7A 3O2IA 2EK6A 4C3LA 4B3RJ 3MI7X 3AD8C 8ATCB 4NLQA 3UE2A 1RQ0A 4CP5A 2W9BB 3KHRA 3NGRA 2BZ2A 3U02A 3W1YC 4NLYA 3C3LA 4JI4F 2UVRA 4LREA 2HBRB 1NPPA 3QAUA 4ZIWA 3RR8A 4F8RA 2M9KA 3KMSA 2EW9A 3DRXA 4ECUA 1AROP 3H42A 1GQEA 2YKQA 2MLXA 3W5XA 1K44A 3NOCA 2HHHJ 3OTBA 5KG5A 1L3TA 2E44A 1XEZA 1ELOA 5EHHA 3H5XA 4J37A 4C3KA 4O3QA 3DHWC 3OL6A 2OEMA 5J2MB 2C3PA 3TEGA 2EEYA 5I3QA 2WSFC 3P49B 1L3SA 2GV1A 2KJVA 3B6BA 3HCXA 3B82A 3QIPA 3R5CA 2CA9A 2DNKA 5HMXA 1NSKL 1YJWS 4LQ3A 2V94A 3BN4A 2W4DA 1U2CA 1FTRA 2HQ3A 2GVZA 3HVTA 4J9KA 1HARA 3KG1A 3MMCB 2OD4A 2VHGA 2VDIA 1Q78A 2RQMA 4IG3B 4DV3F 4QQBA 3GG1A 2DR8A 2MQLA 3A3NB 2ZBIA 4OFZA 1FKPB 3W2VB 3OD2A 2XMWA 1FJ7A 4WU3A 1RWKB 1NMEB 5KFIA 1AB8A 1RBAA 2CRLA 2GC8A 2B7BB 5CZVA 5DLFA 3AOCA 3PW5A 4LSNA 4FF4A 1RT5A 3PJXA 3QFWA 4KGKA 4B9LA 1YBTA 1RTJB 1VHFA 1IM4A 1WTFA 4I0WA 4QJVA 2CQHA 1AA1B 1FWPA 4FNHA 4WBFA 1KVKA 3NBPA 2WVEA 2ZC4A 3WHIA 3KUGA 1VRQC 2HWIA 2FDNA 4GKKF 4KY3A 3W5YA 1KVJA 4PQAA 1YLXA 2D3ZA 1WC6A 4IFVB 4CYUA 5DETA 1G4CA 2MKKA 4P7TA 2BE2B 3ADAC 3IS9B 2BJ3A 2V8HA 3KUEA 2NZ4A 2ATLA 3FKBA 4NZ0A 1SUQB 4CLTA 3L7OA 3AQOA 4DFKA 1JLQB 1FFSB 3TOQA 2K8GA 1WKKA 4LVOP 1FRJA 2V0NA 2YKPA 2CQPA 3MEGA 4ICLA 4OI2A 2DNMA 3S1TA 3CCTA 4ZVEA 2IDEA 5HATA 4A8MP 3CD6S 3HDSA 4O3SA 3B54A 2HHWA 4YR2A 4JI8J 2DRBA 1YQHA 4TY8B 4AE5A 1P6TA 1IBCB 2NQPA 3GJTB 2AYGA 1UVIA 4DPOA 1PGZA 3KWMA 4EI2A 3Q8RB 5F41A 4ZLNA 3F56A 2MLYA 4RUHA 1IVZA 5F8MA 1VQPS 1B0TA 2IVMA 1HWKA 1B70B 2BJEA 1GAOA 4KKOB 3H40A 1S4EA 1YDLA 3DKDA 3GG0A 4NCGB 1SKUB 1DTTB 1RT7A 1I94F 4LF5J 1K0TA 3UN2A 2J0WA 2ZWOA 1ITPA 4TYBA 3DOKA 2ZZMA 4HH0A 2V4JB 3C6UA 4EFAC 5B0BA 4DLEA 2EVZA 3DRPA 4Y65A 1QVGR 2BOPA 2YNIA 4OIXA 4DQIA 1S6QB 4LR8A 3AODA 1MN7A 1JQGA 1X60A 4ZK7M 4IDKB 5IFMA 2XY6A 3QGGA 4XPEA 4OL8A 2BKNA 3AD7C 3BM7A 2VFUA 2Z2LA 4LF5F 5LL6d 1JLGB 1EQ0A 5LMNJ 5KFGA 3G6YA 3QIDA 4B9UA 1GMWD 2IFXA 2B43A 2WAQD 3LP0A 4WYLA 4EU0A 4ZHRB 3EXCX 3Q8SB 2FLLA 2V2ZA 3CEDA 1SJ4P 1RA7A 2W25A 4USMA 1AZSA 2FHJD 2AZ1A 3U1MA 1UFWA 4B3TF 2HNDA 3KHHA 4OHYA 2JLFA 4B08A 3H0PA 4X4QA 2VG7B 2N4DA 4DV0J 3LAKA 4WFBQ 4OYBA 4K4VA 4IQMA 3C14B 4R8UA 4AT1B 3AOAA 4NLWA 2LXUA 3FBBA 2ZVIA 4RWWA 1VK3A 3JAMY 1CEZA 2FYXA 3BPDA 4DL4A 5CD4H 2ZH8A 3DFEA 4B9MA 1DQ8A 5C24B 3HKZD 3HO1A 3HHLB 4ZJQA 3A8EA 4Y2MA 4X4SA 4UF4A 1RACB 1KR4A 3LANA 4TKTA 3SCIE 2HK3A 2XY7A 2A18A 3PR4A 1PILA 2QV6A 4NASA 4F4AA 4DG1B 2QO3A 5EX3A 1U1LA 1RAAB 5BXIA 1CJVA 4ZPAA 5FJ4A 1R0BG 1CJUB 4KSEB 4B3OA 1RTJA 2CQ0A 3MM8A 5G0RB 4CRJA 1FRHA 5ETKA 3S6EA 1KQKA 3FEYB 3HFKA 3K5LA 4KGVB 3HF5A 3KXDA 2KZZA 1H73A 4J9RA 4B3MJ 1BMQB 3A12A 3OXGA 1S59A 5KG6A 4CNZA 5KFWA 3ETOA 2VFSA 4IG0B 2FGOA 4X84A 1HR0F 1DARA 1O6XA 1UFKA 3EGWB 2R3VA 1TV6B 4QW8A 4ED8A 2ZZNA 1EETB 1C4CA 3AOBA 2AX0A 3T6JA 2B6AB 2Q1LA 3MTKA 1XN9A 2IAJA 3EICA 4QR0A 3ZNUA 4KE5A 3I9V9 1SJ1A 3RB6A 4LF8J 3GSDA 3ET6B 2EXUA 2MHNA 4K50A 4DV1J 1HBOB 2ZM6F 2LU1A 2B5JA 2CJYB 1Z4UA 4I2QB 1OO0B 4NMXA 1RAGB 1SKWA 2QLFB 3E3XA 5FDLA 5K14A 2CZ9A 2HNYA 3IAM9 2OO4A 2WW4A 3K5PA 3GB0A 1NPRA 4U8YA 3SCJE 2MYFA 4WE1A 3TJ9A 1ZAXA 3GJQB 2UUAJ 2RH3A 2HSEB 4LF9J 2LXIA 2E5LF 5IC6B 4U8VA 1N8RT 1JWWA 5ETMA 1Q53A 2FTRA 1IKWB 2V9KA 4P75A 4KJIA 4OZ1A 1SC6A 2BANB 2ZC3A 2DIUA 4LF6F 3M30A 2XS2A 3PEJA 1Y5NB 1QSSA 3OVBA 3UFCX 4R5PB 1R8HA 3N01A 3IBCB 1VQNS 1FJGJ 2YNHA 4X4OA 5HJXA 1VRTB 1QAJA 2UVWA 2YQ3A 1RXOB 4DR7J 1RT6B 5BJRA 5IQQA 3OUYA 3CB4A 4K4SA 2UXCJ 4YFUA 1NKEA 2FVCA 1IKWA 2XI2A 1HMVA 1ZM9A 2IDLA 2HAIA 1KEKA 3PVXA 3HHLA 2UUBF 2FHKA 3CDWA 1NJZA 3MPWA 2KT2A 2Y1RI 3QBCA 4QR1A 1LK7A 2F4VF 2OMOA 3MAAB 3TEHB 4C8LA 4URSA 2NCKL 3K0JA 1FNMA 2D9OA 2RUSA 4P9SA 2MJNA 1WC4A 4RNOA 4JI7F 1DTQB 3KG4A 2L3MA 4AL5A 4RUBA 1RU2A 1X9SA 2DNLA 1ZPWX 5HL7Q 2JC0A 2LCWA 4LMZA 2OKQA 4ECXA 2J0SD 1V9OA 4DOZA 1J5OA 4JI2J 2WBRA 3V2UC 3J81j 1SIWB 1RE1B 2F5GA 2UUTA 3VGVA 2W8KA 4A8WA 3TUZC 1M5OC 4PUOB 1NUEA 3EVOA 2VPWB 3BBFA 4IO1A 2RMLA 1XJWB 2V8PA 4WTOB 1UAWA 1QD1A 3RU0A 2KB2A 4CLWA 3RR7A 1FDNA 3IG1B 4KRWA 1R7IA 4OZNA 4B3MF 2XYGB 1CS4A 3QFHA 4I7FA 1FERA 1TL1A 4DCOB 3MCNA 1VYAA 2KDOA 4N5SA 1JK9B 2QLXA 3LPYA 4KR0B 4TYAA 4P6QA 2EBEA 2QRRA 4ECRA 2C2DA 1NJXA 2HBZB 2RHSB 3MMAB 3C16B 1VQ8S 2VF3A 4DPUA 4RUAA 1LWFA 3D3CJ 2EFPA 1ACMB 1UKUA 2J8SA 2V50A 4L75A 2HRYA 3KHLA 2ATCB 2RS2A 1JLEB 4HACB 1HNIB 4MT1A 2KXHA 8RUCA 2IM3A 2BVZA 2HNDB 2QL7B 3J7YI 3N6MA 1TL5A 2EG2A 2OPQA 1I3OB 4CWBA 1AFJA 2DNZA 1TL4A 2GVDB 3CXCR 4DWIA 4LFAJ 4LQ9A 3NXZA 3GILA 2IRXA 1VQ5S 3UO0A 4L72B 4HDHA 1U48A 4NLGA 2EI5A 2OPPA 3VAMA 3MM9A 4IOCQ 1EQMA 3A3PB 1UPPA 2EBGA 1NH8A 3Q2SC 4NRUA 4J9QA 4K8RA 1B7YB 2VJVA 5D3GB 2DITA 2IPOB 2JC1A 1IR1A 2C3UA 2XZDB 3IMQJ 3ZZ0A 3KLFA 3IR5B 1N6QB 2W7PA 2DRDA 4CTAB 2XCAA 4NA1A 2IYGA 2NLWA 2R4FA 2HGNA 2AT1B 2BRLA 4JI6J 1QDUB 1QAYA 3PIOQ 2IAJB 1F9FA 2HQIA 3JB9k 3QLHB 3UVJB 2FZKB 2UUCF 2GX8A 2PGCA 4BBYA 2M5YA 5J1NA 2IC3B 1S1XA 3HT0A 3MEKA 3N6LA 3M32A 4OYWA 2HQFA 1FE0A 1HNVA 2J0XA 3FC9A 4DV6F 2B3TB 1FDBA 4DU7A 3AAWB 5KG1A 1TFWA 2KU7A 3HSGA 2BW2A 4ID8A 3RAMA 4DPYA 3SV4A 4GVBA 2ZNYA 2OEKA 1IUJA 5D0GA 5SZTA 1RWOB 5AJ3F 2KM8B 3KK3A 3MM5A 4NLPA 5G0RA 5M2PA 2DJWA 2ZHBA 1YITS 2O66A 1RP5A 4LJMA 1LKZA 4HDGA 4LRAA 5IWAF 2F8HA 1I6JA 2ZH6A 4ZVHA 1F5BA 2HHVA 3JQMA 5C24A 1TKZB 1X4BA 1X0FA 1N34F 3WQPA 2DGUA 3TAMB 2FC8A 1F5AA 3DLKB 4CLKA 5HVGA 4OX9F 2YNGB 4I2PB 5ETTA 1QTMA 4L6V3 2DGVA 2YH1A 4KTQA 4YY3J 1QAXA 1U2RA 3KDOA 3KK3B 4ILRA 2JEJA 3FK4A 4YMEA 5B7WA 3AB2B 3D6FB 1H6KX 1U1OA 2RRBA 3QGHA 3PFOA 4JUZA 3CMAS 2B4VA 1NSAA 2WONA 3T41A 4TXSA 4B02A 5L9NA 1RISA 2GMHA 1JLCA 5DS7A 5F9NA 2N3LA 2V8VA 2HZVA 4NLSA 4K4UA 1B0VA 1PJ7A 2O01C 2WOMA 2ZEJA 2FQQB 4IRCA 4R8UB 2K3IA 1M1KT 2YNFA 4IUFA 1R0AB 1T05A 3DN9A 1Q95G 2ACYA 2ZDPA 3FQKA 4C8YA 1RAHB 4DEZA 4DF4A 1BY9A 4ZHRA 1DTQA 4X2BA 4LIRA 1LWXA 2HK2A 3FBEA 1RTIA 2Y9HA 1JLBA 3BO4A 3HHKA 2CQBA 4QYRA 5B0DA 4DS5A 5KT2A 2MKHA 4O44B 1P27B 5KFMA 4ILLA 2CPHA 4URQU 4YB5A 4WFNQ 1J5EF 4OX7A 1KBRA 3L3CA 1YKWA 2D1CA 5GMEA 4DZ6A 1RBLA 2XMKA 4X64J 1UTAA 4NLRA 3DLGA 2XSFA 5DZ6A 4YHHF 1QJHA 3P6YC 1SH0A 1NAQA 1WUUA 3VR1A 2GIQA 1FX2A 2J9DA 3EZUA 3G2XA 3QO9A 5CABA 1Y7PA 4NLTA 1KN6A 4M1KA 4O4RA 3S01A 2PA8D 2V2VA 3W2WB 4ED3A 4YR0A 1U49A 1RWVB 2ZHAA 3H5YA 1SCJB 1WD6A 3WBZA 4GC6A 2LP4A 3Q89A 4ZVGA 4JB8B 5K8PA 4BWJA 1IR2A 4OZJA 1VQYA 3F0NA 3MCSA 4PG8A 3V81A 2SXLA 3RAQA 1RKJA 1UZDA 2UP1A 1OQ6A 4I4BA 2D7SA 3GE9A 4Q45A 4K5SA 2RSQA 1LWFB 2GZOA 4IR1A 1NHVA 3WIVA 2B5JB 5HK4A 5H9EK 1T11A 2G0JA 1JJCB 5DG8A 4QWAA 1MN9A 3Q24A 4NXNJ 2E5GA 1TUWA 2HURA 2PMHA 2XYPB 5LOQA 2LEPA 2GO8A 4ILMA 3ZZRA 4HI2A 2J7WA 2L9WA 3BBBA 4LF4F 3D66A 4EZ9A 1TKXA 1NSPA 2LEBA 2HVDA 2AJ2A 1S6OA 2AMCB 1TR0A 2DISA 2ZD1A 3DXSX 3RBEA 2Q66A 2EC2A 1S9EB 2EPIA 1HQUB 1FA0A 2RD5C 2PD1A 2G0CA 3M8PA 5CYJA 1ROFA 3J7ZT 1B7FA 3LTOA 5D4PA 5C7PA 1PBUA 5D77A 4MMOA 5F8IA 3L09A 2AHOB 1WC3A 1WF2A 1WOSA 1WSVA 3QSIA 1A9NB 5D4OA 3TW0A 2R7UA 4NPOA 2KRRA 3T1YJ 3BSAA 4JI7J 4HEA9 2U1AA 2VFRA 5L38A 3OTOF 4PUOA 2PEHA 4YY3F 3CNQP 4WTYA 4NYZA 4K7QA 2R7OA 4L73A 4UTGA 1RLDA 4YB6A 3EX7B 2HNZB 3KTQA 4KC5A 4ZLPA 3LAMA 2XLIA 4HT5A 2LQ8A 1HHQA 1C2PA 3MPDA 4B3SF 1S12A 3KKFA 3M2UB 4PR6A 2OSQA 3R8YA 4ID5B 5L1IA 1N6QA 4DL3A 1VQMS 4YP3A 4M5DB 1I51B 2APOA 2YKNA 1URRA 1VOMA 4AUKA 5BR8J 3CJSA 2GW8A 3IS9A 2OPPB 3QIPB 3MWBA 4K59A 3CF5Q 2LU2A 3BO3A 2DXFA 4UUWA 1N52B 1Q5YA 1WEXA 2GVZB 3QO9B 2G1HA 4DXLA 3K7RA 1R8PA 4DR6F 2OP5A 2PIIA 2W24A 3P3DA 4FKXA 4HR2A 1XMOJ 2FLOA 2RHQB 1YJ7A 1WG1A 5KT4A 1XNQF 3J7A1 3R97A 4CLFA 1TUGB 2DO0A 5E0OA 3ZZPA 3TVZA 3US5A 4CO3A 4NLDA 4TY8A 2DB1A 3J80Y 1A6LA 3NL0A 5B09A 1FWKA 5K20B 2HRTA 3K57A 1FXDA 5ETVA 4RW4A 4V19X 4H4OA 4QR2A 3BQ2A 4M5LA 3EPGA 2HHHF 4ICLB 1BWVA 2CQ3A 3CD0A 1GEHA 2RF2B 2JOQA 3EMTA 2AD9A 4DPXA 3ZZOA 2RIJA 1IJEB 5FD1A 1TL7A 3KLHA 3W61A 1X5OA 3RTVA 2BR0A 1REVB 3LA0A 3PX6A 2GGPA 3L9ZA 2HHTA 4JP8A 3C15B 4EBDA 2LQJA 3IRWP 1R3NA 4UW2A 3NWGA 1LQ9A 3SYZA 1SQEA 3SSQA 2EFVA 1VJWA 4C3MA 3D4JA 4DMZA 1Q16B 3KK2B 4F4ZA 2HMIA 3CMES 1NDPA 5IT9U 2BEFA 3QT6A 3IRXA 5JVGQ 5T7LA 3SZ2A 1S57A 3HHNB 1V3RA 2JVOA 1HFEL 2F4VJ 1CVJA 2IA6A 4HACA 1Q81T 1HNZJ 3C19A 3FVYA 2E66A 4K4YA 2I38A 1WC5A 3V6JA 2QSFA 1E6VB 1BQMB 4OYPA 1HWIA 2GVDA 2P9CA 3BF4A 2C2EA 1GXTA 4BHQA 2CJQA 1WELA 1DZ5A 4QOTA 3CJ2A 6FD1A 3C66A 3PDNA 4RJVA 4F04B 3QAEA 1SJFA 4ZVQB 3GV7B 3CJKA 3PV8A 1F2GA 2QEXS 1OY6A 1JLEA 1T0TV 1UVJA 1KWMA 3EWGA 4ED1A 2HHXA 1Q79A 1TK0A 4ZPTR 1HD0A 3CUNA 1PYOB 4CNYA 1I1GA 1HNZF 1IN0A 2X1GA 1HNXJ 1BXNA 3KLIB 4F67A 3G8QA 1KRPA 5J2NA 1NDCA 2YKOA 3ENQA 3NP5A 3I55S 2ZE2A 2Z8QA 2DVIA 4I1TA 3E8OA 2G9OA 2MZRA 4X65F 4P74A 1U1KA 4LF7F 3TZWA 1R8CA 2KT3A 5LT5A 5KFYA 2BUNA 3BQ1A 2E1PA 4IRDA 1FKOA 1HNVB 2MLZA 3NBPB 1K1QA 1XERA 3RAXA 1U0HA 2VOOA 1KLMB 3D67A 3CCVS 3K5OA 5DDQC 2XY5A 3TI0A 1S10A 5DJBA 2OGUA 2YX4A 1FHTA 1VQOS 5L46A 3QWUA 2AU0A 3THPA 2ZKUA 3NGKA 3MEEA 5KFDA 5IT9Y 1SH2A 1WOPA 2GCFA 4RZRA 4FBUA 3HVAA 5EGYA 2CDRB 4JV1A 3ELHA 1WC1A 2YKMB 4HYKA 3KDNA 5EDWA 5JXSA 1S6QA 2GGPB 4JOUA 2X1AA 3O6QA 4FDFA 4A46A 3MEDA 5CCMA 2ZJQQ 3D0GE 1CG2A 1N0UA 3MFHA 4AL6A 3T19A 2LQ9A 4NEZA 2MTLA 4BS2A 4KV8B 4C4WA 2HWTA 1W7WA 2MQQA 1FFWB 3P5BP 4F4WA 2ROEA 3QJPA 3CCWA 1V6HA 1YJVA 3W66A 3J7AN 2DR6A 3GV5B 1NSQA 1WHXA 4A8SA 2OJ3A 4GKJJ 1N4LA 4NCGA 2OD6A 8AT1B 2ZH3A 1NDKA 1UWBB 1SIZA 2R8KA 2X1BA 1A7GE 3LP1B 4OHZA 5KOXA 5EWEA 3PYDA 5MAOA 3HSZA 2BDPA 4A48A 1BGXT 4WU2A 3H2LA 4C8MA 2E9TA 2HZCA 4WE1B 1FDAA 4KH0B 4ZMMA 3RZAA 1B0PA 2IY5B 2IVFB 2F8EX 1HLWA 3MM8B 4YDXA 3I0RA 3FRZA 3HD2A 3MMBA 4RLEA 3RUBL 3R1HA 1AW0A 2LDYA 2MGZA 2H48B 3W3SA 1VMBA 3DDNA 1HKAA 3HFVA 3M30B 4O4GB 1HW8A 4DL5A 4XK8C 2MQOA 2FHMA 2W7OA 5L39A 4HVZA 2XS5A 1HWLA 3TUIC 2OELA 4C48A 3UR0A 4EEYA 5A0YB 1RHRB 1EETA 5BYSA 1N34J 4B9VA 3G86A 1SPBP 3M8QA 3W7BA 1RBOB 1VC5A 1MROB 1R0CB 4MK7A 2VU5A 2NSBA 2PA3A 2DNPA 4CZCA 2HIQA 4QIWD 4ZP8A 4ZVOB 5F8NA 4D3HA 5HQMA 4O3OA 2W9AA 3WC2A 5B0CA 3TO8A 3MURP 2M3DA 2QZ8A 4ZOSA 1VJQA 1TZ0A 4UOFA 3SI8A 3D6HB 2HG4A 4NXMF 2H65B 2LXFA 3OR2B 4UUXA 3BBCA 2XSJA 3UCUP 1HNXF 3KK2A 4LSLB 2UUAF 3UPFA 3CCJS 4G6VB 1OS5A 3B4DA 4CLUA 3HZEA 5CHCB 5C25A 3KK1A 1YX2A 5KFFA 1JLAB 2UXDF 1KSPA 3CJQA 3TUJC 3FSIA 1KKHA 2Z2YB 2C2RA 4ZPBA 2EK1A 1TUVA 3MAAA 3QATA 3AH6A 1ZTWA 2DBBA 1F3VA 2HFUA 4O3NA 1T7PA 2EFGA 1XNRF 2LYVA 3KJQB 4YR3A 1U7LA 4GVBB 2VBYA 4AFFA 3KJVB 5A8WA 1VISA 2EKNA 2KVIA 3DXBA 4I64A 1VS3A 2BOAA 1WDDA 3W62A 1KLNA 2K2PA 5E3CA 4CIOA 4DN9A 2WVBA 2QFJA 3BSCA 1UL3A 3HSJA 5I42B 3AA8A 1FT8A 1ZA2B 3F73A 2KVQE 2IHR1 3FZ2A 5GAEU 5GAHU 5ITHA 2DHSA 2VBXA 5IT0A 1X4DA 3SXLA 4TY9A 2MY7A 5KFPA 3CWJA 5KFZA 1T02A 1OWXA 1UW4A 2AW0A 2QLBB 2RDJA 5J2QA 3M8WA 3UNYA 4UQTA 2KXNB 5DGAA 4EBCA 2HHSA 4DBQA 5ETLA 3NS6A 3BZQA 4DV4F 4NOHA 2CWKA 3HLUA 4Z7YA 4DCJB 2ABYA 3H20A 4FS1A 3T1AA 3I82A 3CO0P 1WNEA 3OV7A 4ZVUB 1HBOA 5A8RB 3VGUA 1F6TA 2ASYA 2YBVA 1NK5A 4FYDA 1Z2LA 2YNIB 2DT9A 1UEUA 3T9NA 3G6XA 1NKBA 4W4MA 5FDLB 3C15A 1SL1A 1W2IA 3UCGA 5LJ3Y 1IKYB 2L41A 1U25A 2NXNA 2HW3A 3R6LB 3ZZTA 3PKMA 1EB0A 1RWXB 1NK6A 3OL9A 3KLEB 1ZM4A 1LW0B 2QA2A 3R5DA 3MD3A 3RBDA 4K4ZA 1EP4A 2G2ZA 3LH2S 4X62F 1IBKJ 3IAS9 1YSJA 5F8HA 1RWPB 4ENOA 3M9MB 3QYYA 1Y3KA 2HBYB 2VG6A 3O5TB 4C0HA 2AWZA 1FX4A 4IG0A 2M8DB 3NCQA 4FYYB 1U0HB 4RU9A 2XMJA 3CJ5A 1U24A 1CS4B 4I7FB 1YZ7A 5IV3A 1SV5B 2AF6A 3GFYA 4FXWA 2OLWA 2P2CB 3FFIB 3SCLE 3DDKA 2X3GA 1UFLA 2UV8G 4D3GA 4QCLA 1HI8A 2XZWA 2DXDA 2W4CA 2MGZB 1K0VA 3I31A 2P6TA 4Y2AA 4PRFA 3UD4P 2OTJS 4ZCIA 2ROGA 3J7Z5 4O0IA 3MM6B 5E3PA 4MFBA 3CMQA 4USHA 3V4IA 3PY8A 4R25A 4WP9A 1RTDA 2UXBJ 4AL7A 2YWKA 4DL7A 1ZM2A 1EZZB 1VQLS 1QUPA 5KFEA 2BX6A 3UCZP 1UVNA 1OYEA 2YQ0A 3FRYA 4NL5A 2GAGC 4OLPA 3VGSA 3ZTRA 4FBTA 1HHSA 2DHAA 4QPTA 4J9LA 2Y1JA 1PYSB 3OTCA 1MG7A 2WVCA 1QUVA 1HBNB 5HVHA 4A47A 2P9EA 2HWHA 2GIFA 3CJRA 4Q44A 2CJ9A 3K59A 4IH5A 4Q8EA 4IQXA 2FZCB 1FEHA 3AFGA 4OZ2A 4XDDA 4QWEA 2A6OA 4OHVA 2VPZB 3HHLD 4C11A 4OLOA 3OL8A 1NK8A 2QTWA 3E01B 2IMOA 3FZBA 3WX8A 4DSIA 4YS2A 3I87A 2HHQA 1S49A 1VLOA 1GNKA 2PN6A 2WB1D 3IR7B 4KHMA 4WP8A 3UN3A 1VQKS 4HT7A 2VODA 3KOAA 4QIEA 1URNA 1WJ9A 4EUVA 2ZFHA 1XNQJ 4JI0F 4TU7A 3PJWA 1SJRA 2KFYA 2CPIA 2EFNA 2DPIA 3BV8A 1N5YB 5JJBA 1T9VA 5DGBA 4N76A 1TK8A 5D3GA 2C3YA 4O4GA 4P2FA 4I2QA 4NE9C 5GVQA 4GO7X 1VRTA 1PYTA 2KYZA 1I94J 2XHCA 3ILIA 1GX6A 1RWNB 3FNNA 4XAKA 2V8DA 2AJFE 3CIZA 3QSYB 1R0AA 4CT9A 4USUA 3ITHA 3NS7B 3QPIA 3BB5A 5A8KA 2V5HG 2NUUG 3LF0A 2HYIB 2VPXB 3PO5A 3D54A 4ECTA 5H9FJ 3QQCD 2HFOA 1GMUA 1Q8KA 1Y5IB 4ECZA 2Y1IA 2XMUA 1MSWD 1E6YA 4LR9A 1FVQA 5AXKA 1C0UA 2QMWA 1S6PB 3C6TA 1XR5A 3BGFA 4FP9A 4PXBA 4NXNF 4N56A 3UI3A 4M5JA 1WHYA 2JFDA 1W2BR 1RT3B 3AXMA 4UZCA 3QJJA 2JHEA 3GLJA 3DGVA 1CJKA 9RUBA 1HW9A 2KHDA 3EDQB 2J6SA 3ILOA 3NGSA 4DR2J 1VR6A 2NSCA 1WORA 1Q8IA 2ZZTA 2D9PA 2YPYA 4ITSA 1PO6A 2AGOA 4PQUA 1Y10A 5HQLA 3M2RB 2GHWA 2AEFA 3A8JA 1F9HA 3BN7A 1S1VB 1PJ6A 1S4FA 3BQ0A 1WWHA 4OHWA 4CO2A 3ISZA 3N9UC 2ALZA 2D3O1 1GTEA 1CULA 4P2XA 5L1KA 5GAHI 5HLFB 4OYOA 2JLEA 1S1XB 2MPUA 5CZXA 3W9HA 5JUMA 3EXYA 2GA7A 5HQ8A 1YRXA 2NXJA 3CCLS 3T5KA 2LVWA 2VBWA 2DNQA 2LQ5A 4Y0FA 2E1RA 1TKTA 4RNMA 4JI4J 2ERRA 4ELUA 5KFJA 1EKRA 1QM9A 2CG8A 1X5PA 2M7SA 2CNNB 2W2MP 2WBMA 3GYXB 3PTWA 1VQ6S 4Y34A 5GMDA 2MXYA 3ISNC 1YIJS 1EP4B 3TNVA 3V4IB 3O44A 3KLFB 3BGLA 2W8LA 5HAOA 1VI7A 4DU8A 5M2UA 4TU9A 1D3WA 1BC6A 2BKOA 1QY7A 4QWBA 3LGNA 4C0OC 5C2CA 4DV7J 5DRKA 1RKIA 5A0YA 2BQRA 3K8WA 3GIIA 2MKIA 4PPDA 1JNRB 2LQBA 1VHIA 4PXCA 4C98A 4U6PA 4KPYA 4I6YA 2OPRA 4CLLA 3J81Y 5LM7E 3JYTB 1GMVA 3SQOP 2DTJA 3QGIA 2E9ZA 1G2EA 1ZETA 1S0NA 1U1NA 3AD9C 2PI4A 3DNCA 3Q83A 3I0SB 2X51A 3AHPA 1HNIA 4J9VA 4ECSA 3R27A 1S6PA 1U1PA 2FD2A 1Q86T 1SH3A 3R1LA 3O3LA 5KFHA 1CJTB 1S99A 1YWXA 2G1DA 3MMAA 1D9AA 1G3OA 3N5BA 3RW6A 1BE4A 3K89A 5A6PA 2HQDA 4MYUA 2R8HA 2C22A 4OJGA 2OPRB 2KT5A 3HHEA 5EUHA 2H51B 1S6UA 1U26A 4O23A 2MKSA 5KT6A 2Z2ZA 3IA0A 4ANDA 2CQ4A 4PAAA 1RTHA 4DR5J 4B9SA 1AYEA 3TA0A 2J8AA 4CO1A 2JWNA 4NZ7A 3CJ3A 2VD3A 1WI8A 4G1PA 4DV0F 2MQ8A 4ZS6A 4DUYJ 1HA1A 4JBCA 4ANEA 3D1OA 3R7BB 1HBUB 2IJFA 3GPAA 3OHBA 3TZZA 1H7XA 1V5IB 3HVRA 2R7VA 3TAPA 3HZGA 4DZDA 1YBAA 2RVJA 3I5AA 5KG7A 4A8KA 4M5KA 3IWNC 4L3KA 2WONB 4KIAA 2IA0A 2UXCF 3FCWA 2E5IA 4ED0A 1X5TA 2CXEA 4UOCA 3MOJB 5LMNF 5RUBA 1TP7A 2J9EA 3JSYA 2YY3A 3P45B 2V34A 4QIVA 4IOAQ 3GYNA 3MGJA 4HHUA 3OHAA 3A3OB 4ERDA 1SB6A 2XYHB 2YKNB 4PXEA 5CYQA 1S9GA 3M9NB 2KH9A 1CJKB 4EK2A 3G96A 1M5KC 1RT2B 1F9EB 4IRKA 2W2NP 2D3UA 4FXVA 2GO9A 4FVMA 2VQEJ 5GADI 1JJ4A 3FBCA 3MDFA 4MFBB 3Q86A 1RCXB 4IG3A 3DLBA 4MIAA 5K8MA 1CPZA 3FCVA 5GMKa 2U2FA 4RR5A 2HPUA 2VFVA 3MM5B 3AJDA 4NI2B 1UCNA 1D9FA 2CVEA 2YX1A 4WKRA 2XZTB 5E3AA 1U1MA 2CJKA 4RW7B 3GR1A 3NCPA 5DQGA 3E51A 3ITHB 2FJDB 3WZ0A 4KBIA 4X4UA 1IKVA 3N6NA 2PDAA 4YEAA 5LXRA 2HKEA 4LFBJ 1DHMA 2ZVSA 2NR0A 3PFEA 2FZGB 1RB0A 2Z56B 4PWWA 2XI3A 3UDCA 3MUMP 2MKJA 2QFIA 1RWMB 4I6WA 1UETA 4PZVA 4ES3A 1NJIT 1T3NA 2JFKA 1V5VA 2VPYB 3DDIA 1J2VA 4LF9F 3M8QB 2HS3A 2NS1B 2YVSA 4MIWA 4F0HA 5A8KB 5J2PA 4OZ5A 1UA0A 3D6TB 2CPFA 3FDSA 4G1QA 2VJUA 3FEZA 3GIJA 3DYAA 2H5JB 1JLBB 4J90A 3SFUA 4EO6A 3SQGB 4CLSA 4BDPA 2DHXA 4MH8A 3K2YA 5BYRA 4JI3F 2A10A 2DNYA 4ZPWR 4XTTA 2ZKTA 3LOUA 4U96A 2DEIA 1ZBTA 4XO0A 1ZAVA 2D3OR 2QE5A 5I4MA 2OHDA 4QIFA 1P1LA 5HVFA 4DUTA 2C28A 2Q6CA 1AXQA 2DEJA 4FN5A 4C8OA 4WFZA 4JV0A 1RHKB 3PJ9A 1RA6A 2E7XA 2I1RA 3GWCA 1WEZA 3QGPA 1RHJB 1VIXA 3ICLA 3PX4A 1DTTA 1RT7B 4ES2A 1C1BB 2JRSA 2DR5A 3NOGA 3SEOA 2G13A 1YVFA 5KFAA 4PWDA 2J6UA 2ZOMA 4C8ZA 1HWJA 2RU3A 2F3JA 3EVMA 1ZAWA 4P52A 2CZ4A 4H4KA 4F0KA 1PSDA 4ER8A 1FRIA 1Z1ZA 3EGNA 5A2QY 4FZVA 1O0PA 5GADU 1M90T 3CDUA 4U9RA 2ZDOA 2DIVA 2J7UA 2UUWA 1TL3A 4ED4A 3FMBA 1WKJA 5K14B 4DX8H 3R5BA 2VDHA 1MMLA 1RWUA 2GS8A 1EHWA 3M2VA 4IFYA 4EWTA 5DDPC 3T5LA 3KMQA 4W90B 1UZHA 3RGIA 3W60A 2W1BA 1DURA 3PZPA 2F65A 1RYSA 1SKRA 3NGUA 1M5HA 3MECA 3HI9A 1FNXH 2OPSA 3TJAA 3SFGA 4ZP7A 2I8EA 3ET6A 3J7YU 1RADB 4USWA 4QIGA 5KT5A 3AA9A 4KFBB 2PEBA 4OYZA 1FKOB 4EO8A 2KN4A 1IBLF 2GHVC 3P5TL 4QU7A 2AQ4A 2CPJA 2FJXA 4USVA 5IXUA 5HP1A 1HWUA 1BQMA 3IWLA 1NBEB 4Q7AA 2DY1A 4QWCA 3H98A 1KHVA 4NMLA 3U1LA 4FS2A 1H72C 3BPSP 2D69A 2Q6BA 1XNRJ 2KFNA 1F2HA 3D9BA 4PABA 1L3VA 2AYEA 3T6BA 5DQHA 1OJ4A 4DV2J 4I56A 1N48A 2RNEA 1Q7LB 1U6ZA 1D8YA 2H1YA 1H2VZ 5IOLA 2YWEA 4DI6A 4KT0C 3OR1A 3H59A 3LWLA 3VTIA 2CAJA 4DSFA 5ETSA 1RTHB 3DRYA 1PBAA 1BUXA 4WIQA 4V1Ak 5DQIA 1JJ2R 1UVMA 1J27A 2MDAA 5CH7B 2CPZA 4UOGA 1EJ7L 4OYXA 3CPWR 1DBDA 3ZZZA 4MKBA 1WHVA 4K4WA 2F40A 4RU2A 2DH7A 4B9NA 2E1CA 1RAOA 3FSXA 3DRRB 2I5JB 3DLJA 1VBYA 3I0RB 1WF1A 3OTEA 3LO3A 4PPZA 1WHWA 4TNOA 3ZTSA 3HK2A 5HMZA 1Q8BA 4LBPA 1KTQA 2DGSA 2DGXA 4PCQA 5T14A 2B8QA 4X4RA 3BYRA 1PAEX 2E1MC 1K1SA 2VG7A 5KG3A 4E8UA 4ZPDA 4JI1J 5EN1A 3CVKA 1B64A 3C14A 1NLKL 5HMWA 3V6DB 1V3SA 2QMXA 3V6KA 4WF9Q 2JZ5A 3Q22A 1TELA 2HRUA 2B9YA 1R6YA 2BANA 1L3UA 3CC7S 2QYCA 1OQ3A 1C0TB 2KKHA 4ECVA 4RWXA 5HMYA 5IS2A 1K9MT 3IBFB 1KOOA 3SQGA 1NXIA 5IM0A 1T9UA 3RBXA 5KT3A 1RK8A 1EAYC 3U1NA 2DCUB 3OW2R 2LFVA 1D1UA 1H0HB 4F0MA 2QYGA 3MMJA 1UMJA 3PRDA 1QAIA 1IR0A 2BE2A 3MXHP 2PT0A 3IXQA 1FEEA 3ETMA 2CKWA 2VA3A 4OJ1A 4ZCKA 3U27A 1NDLA 1GK8A 4PKDB 4UZBA 1F1BB 1ZM3A 4TVAB 1FI4A 3FUYA 1VCTA 2VICA 5HBMB 5E5NA 2MQNA 4NYPA 1X31C 2VC0A 4K2JA 4F7VA 3LUYA 1PAUB 5FIIA 2HLUA 2WTFA 3L95X 4WIIA 5A8WB 5IT4A 4K0KF 2DGTA 1PJ5A 1IWGA 3J81U 3QZ8A 1DJ0A 3QT5A 3OQ2A 2BACA 1T3OA 1SC3B 2AGQA 2M2BA 1IKVB 3T1HF 2Z4PA 3IGVA 1CLFA 2MMYA 4NEYA 1MWQA 2MSSA 2CJBA 3NAHA 1XBWA 2Z30B 4Y2KA 1T03A 3OT9A 4Y28C 3HX9A 4LUBA 4DN0A 2R2SA 1TMMA 3I96A 3V4MA 2H4WB 2QX0A 2VASA 2RQ4A 2BJ1A 5G4DA 3DI6B 3SDEA 4OX6A 3D28A 1F3FA 4HTIA 3CDAA 3QRRA 4PWDB 3W65A 1RT3A 1DAXA 2BJ8A 2HFSA 2YTCA 2OMLA 3R6GB 1K73T 1ZH5A 3VV2B 1TMJA 2Z0GA 3H8YA 1JNZB 4DQQA 3M6UA 4OMFG 1SJQA 2K1RA 2CQ2A 1SKSA 1UP1A 2HHPA 2YWGA 4O3RA 1XR6A 4ZCLA 3OLBA 2ZM6J 1KNZA 2PFFB 1Q5VA 2D74B 4M63A 1YJ9S 2UXBF 1AFIA 2J9DE 2DGOA 3ILLA 3P8BB 2XGQA 3IN5A 2M8HA 4RX6A 3PRVA 4JYAJ 1YG0A 4F2RA 3IM9A 2YWHA 4FYVB 3B4MA 3GJSB 4NWBA 5ETOA 4YHHJ 4BC9A 1U6BA 1UW9A 2KI2A 3UDVA 4YOEA 3CCQS 5D0RA 2OTLS 3JTNA 4K4XA 2G4BA 4CT8A 1ZS6A 2HS0A 2XO6A 1X9WA 2L08A 3OBIA 1SXLA 3LPEA 2PI5A 4JI1F 2LA6A 4ECWA 2XGPA 2F9DA 4P2SA 3W2VA 2RKIB 3DLHA 1PIEA 2A2CA 2AEJA 1S97A 1NJYA 2B9WA 1MWYA 2V67A 1I5OB 2XWXA 3ULHA 3V81B 2LECA 3DRRA 4C2MA 5HI7A 4OX9J 2OUGA 3JTOA 3OVSA 1HI0P 1O5JA 4J91A 3TYTA 1FTCA 1GXLA 1GXUA 4PG5A 5KFRA 2XM3A 3TUPA 4KB7A 3M6WA 2DGQA 4YUDA 1CSJA 1LW2B 1HBMA 3ZTOA 3A8KA 4ZA1A 5KFBA 1APSA 4WZQA 4URGA 5K8NA 2QA4S 2CNOB 3BKTA 2MZTA 2FLNA 1R89A 3AY0A 4OV1A 5ADZA 2IJRA 3D0HE 2F9JA 4LRBA 2PSZA 1EARA 1Q7YT 5A2QU 2R2TA 1M5VC 3RJMB 4HHHA 3F41A 1FRMA 3EGZA 1Y9OA 1GT8A 3GYGA 1PG5B 2DNGA 2BM1A 1WSRA 4AQYJ 5H9EJ 1RTZA 2GFFA 3DOMB 3CDEA 3WC0A 2B7CB 1DLOB 2VQFJ 3JXOA 5CCLA 2VB6A 3K5MA 4OJHA 5HP1B 1HPZA 2O1PA 2R7SA 3OPKA 4HKQA 1HYSB 2RS8A 4K5RA 1PKUA 3CO9A 3D5MA 4LT6A 5GAEI 2ZBRA 1TKDA 5D15A 2NZCA 5HROB 1S9GB 1LWEB 1S1TA 4WKYA 3CE8A 4CLPA 2V6AA 3MTJA 4OZ3A 3VZIA 4M5IA 1TKZA 2HNZA 2JVRA 2M70A 2E5LJ 4AXJA 3DLEB 4FPIA 1X8DA 2JEGA 1S7IA 2CQGA 3GP9A 1AUDA 2VG6B 4RL1A 5LSOA 3G6ES 1NB2A 3UD3P 5LSLA 3BYPA 3PYEA 4FNIA 3CCSS 4EBEA 1Y0HA 3M2RA 1Y11A 2OFGX 1WDTA 2AYMA 2BA9A 2XNQA 7FD1A 1O8BA 2XMAA 3G6VA 1LV5A 2EFOA 1S1VA 2DHHA 2NYHA 2Y3YA 3POTA 3TVYA 2HGMA 3G82A 4CO0A 1B3TA 3IRXB 1YBUA 3G8SA 3GFXA 3QJLA 3OJSA 3MM9B 3DGPB 5A6WA 3MMCA 3PO4A 5F0WA 1NHKL 1JMTA 2AEMA 1R27B 3DLKA 4Y6IA 4ZVTB 3HMJG 3GR0A 4NRTA 1CQMA 2B0GA 2AJ0A 4HTJA 4WFYA 9ATCB 7FDRA 2QLJB 2JEFA 4JI0J 3H4BA 5HSPA 3EUNA 4LFCJ 1S72S 2BM0A 1OPZA 3FMWA 3NLCA 1SQFA 2XULA 3DOKB 1NHUA 1NU4A 2XG8A 3NY0A 4DR3J 4DFMA 4M5MA 3JSBA 1NK9A 1NPKA 4JYAF 2QG9B 1WACA 3VALA 3IC1A 3D6MB 4MKVA 4GO5X 2K1RB 4RW8B 3VQTA 2BXJA 4KKOA 4RO0A 4OX8A 1LWCA 2BW7A 2V69A 1HI1A 4RW9A 1U47A 4C11B 2FJAB 1JKHA 1XMBA 2DKOB 2HBQB 5F3TA 4LF1A 4DR2F 4HLBA 1TL1B 2GAHC 2ZBQA 1C0UB 2IM0A 1ICEB 2W9BA 2MZQA 4DV3J 2DPJA 4DR6J 1TAUA 5CYMA 2WVFA 1VQ4S 5LXYA 4G3IA 2VC1A 2WCXA 3DRSA 4DUYF 3DOLA 4XPCA 3IBWA 2N3OA 3ENVA 4RW8A 3MEGB 1IBMF 2BQ3A 2DNNA 4NYOA 3CSKA 4KHRA 2ALYB 2FHJA 2C3OA 3NGDA 3MAQA 1D9DA 2BKPA 2VH7A 5F8LA 2H5IB 5D4NA 4DX5A 4JV5F 5H9FK 3HT3A 3C6UB 3GIMA 2RB7A 4XDCA 3N79A 3DRPB 4EGLA 3DHXA 1BQXA 3M8RA 1XWLA 1H2TZ 1KOHA 2PE8A 1XR7A 3K8VA 2BJ7A 5CAAA 1ZYQA 3I4PA 3Q8VA 1JLCB 1YGYA 2HVZA 2F4FA 1D09B 4B17A 4F26A 5CA5A 3GQCA 4K4TA 5DG7A 5B0AA 2NUHA 2FHOB 4I6AA 2VQEF 2GIRA 2WRMA 2MZJA 3Q8QB 2R7QA 2WSCC 1OPIA 2CPYA 4KGMA 4MTPA 3HULA 5SUHA 3W8GA 5C5JA 3VAIA 1S9EA 4L3NA 1H38A 2B56A 2HGLA 1YJUA 1RJJA 2ZH5A 1S76D 4X65J 5GAGU 5DZ7A 5E7OB 4QYZJ 4L74A 2UUBJ 3B8HA 3EYZA 2L9NA 2KL8A 1RSCA 4USKA 2ZITA 2J7KA 1LEOA 3QMQA 3BDEA 3JQJA 3KUHA 4X66F 3I56S 3WIUA 4A8YA 1SV5A 2QIFA 3W64A 2KM8C 1RT1A 5J2MA 1HYSA 4PG6A 2PFDA 2FIUA 5KFXA 2ILYA 1NKCA 2CADA 4KGXB 2RJZA 2DH8A 2HEKA 3NRBA 4C9DA 2Y0BB 1IKXA 1JLQA 2FPHX 2DH9A 2VL1A 4Y2IA 3KYLA 2N82B 2DR9A 2FVRA 2QLWA 3CCMS 2WB4A 1SBRA 3PM9A 2JX2A 2AV5A 3M05A 3BEGB 4DUZF 1J5OB 1LOUA 1RCOB 1RDRA 2I0XA 1FRLA 1U2FA 2IM1A 3BSNA 3TX8A 1YJNS 1KVIA 1OY9A 4DSJA 2V4QA 4CI0B 1N54B 1Y4ZB 2BE7D 2COLA 2BJ9A 3BREA 3GJRB 1N5SA 2LMIA 3HD1A 1CBKA 1FK9A 3A1YG 4LSNB 4DR3F 4LFCF 1YZ6A 3NMAA 1S0MA 2WVDA 3DCAA 4RPFA 2RE1A 3MZIA 1SC1B 3BS9A 2ADBA 2R7XA 3PW7A 3DMJB 4TQRA 5EX0A 3BJYA 2J5AA 1REVA 4NLUA 4ZVRB 2JSXA 5AE2A 2N7CA 3MF5A 3NG8A 3VVTA 3RW7A 5IZHA 4PG7A 1WEYA 3G4SS 2RKIA 4GC7A 2R7TA 2DK2A 2F1FA 2HNYB 3GU0A 4RW4B 2HVIA 1XK8A 2B8PA 1IQZA 1MLAA 4GVLA 5AXMA 2V4JA 2RF2A 5EWFA 1T9XA 4F50A 3P96A 1YTYA 2E1AA 2CQDA 3TARA 2LEAA 3N0VA 4RW6A 3BR9A 3HPOA 2BMBA 5IQ6A 1RWWB 4JI3J 1VGYA 1JKHB 2HFNA 2KFZA 3VVUA 2CQCA 4WXWA 3CW2C 3BDPA 1W26A 3PCOB 4U95A 2RQCA 2VKZG 3MM7A 2Y8YA 2Y1LB 4Q2LA 2XBPA 3RRHA 3CDBA 5KFCA 1FO1A 3I9ZA 4ETXA 2DR7A 5HJYA 4LF4J 4DR1F 1NH7A 4R0JA 3VHQA 5DDOC 2RRAA 1YJTA 1N33F 4F36A 4YDDB 2QJ3A 1RLCL 1JJHA 4I68A 5I3PA 3PXGa 4B3TJ 1MNEA 2XNRA 1R31A 2YH0A 2EFQA 3IG1A 3N28A 7AT1B 3MR5A 1TVRB 4DV5F 4NLOA 4X62J 1M5SA 2X3DA 1UJ4A 2YKAA 4KO0A 2UU9J 3TQEA 1RT1B 3EM1A 4LF2A 3BH7B 4DX6A 4KV8A 2G2YA 1T05B 4UT4A 3POTB 4I67A 1FJGF 4LSLA 4U7UD 3T1YF 1SUQA 2CG4A 2P8IA 3H5SA 4YN3B 4KAIA 1HR0J 3E2EA 5J2PB 4N77A 3THTA 3JQKA 4J9SA 1YRTA 1JLAA 4DDFA 2FJEB 1Q1KA 3PYFA 2XMVA 3IO1A 2YKMA 2VOPA 3RB4A 1T9YA 1SQGA 4K2XA 4Y3CA 5D78A 3OL7A 1AT1B 1RU1A 3M8ZA 1C1CA 1JLGA 4OYIA 2G2OA 1DRZA 1M1GA 3UDLA 4B3SJ 4KHPF 3TWZA 4Q0BA 4DR4F 4C0BA 2C3MA 1CJVB 4IR9A 2MY8A 4N8OA 3W5ZA 1CULB 3MR3A 1YHQS 2FC9A 4USTA 1HQEB 3T3FA 1FF2A 1VK8A 2VKRA 2W7AA 2A1BA 3AQPA 4ZP6A 4ALZA 3TQ1A 4G1QB 2FLPA 1MMNA 1U09A 1IXKA 5B08A 4NXMJ 2QSWA 4ZITA 2Z2MA 3PHEA 3VAJA 3X1LB 1B99A 3R9LA 3M2VB 2FVPA 3UWTA 3LP2A 1IBLJ 2FY1A 2FVSA 1TAQA 3JTPA 2ZH1A 3QRQA 3OFHA 2X7IA 4A8OA 1CJTA 3R3TA 3A13A 1S1WB 3JSRA 5D0EA 5KAKA 4JI5J 3DOLB 2V4RA 4KHPJ 1FD2A 4DS4A 5KFOA 1KTVA 2LDIA 4J9OA 1LWCB 4RW9B 3HXMA 5JVHQ 3W63A 4PG4A 3T9ZA 2EC0A 4WZMA 1IQTA 2KZMA 1X4AA 2ZOGA 2CWXA 4OYAA 1R6VA 2MSTA 3RBZA 3ISND 3M6XA 4M5GA 2GQCA 3MUVP 2ZJRQ 2CNKB 4WCEQ 2DNOA 3I32A 1VRUA 3LALA 3VAFA 2DD8S 2K3KA 3V5RA 1RAEB 3QT7A 4HL9A 4Q43A 1IKXB 4UQGA 1H2UX 3LWMA 4NLXA 4Z2XA 4LF6J 3R2DJ 3MHYA 1U45A 2NYIA 3I6PA 2OSRA 3NKYA 4ZVPB 3ZZUA 4A8XA 1QE1A 2CJXB 3PNIA 4UOHA 4CDIA 4C8KA 1VC6A 3BSOA 5B0EA
chains in the Genus database with same CATH topology
4DL6A 1H3DA 2B6AA 5KOWA 3KLVA 3ZZYA 3OR2A 1TFYA 4IO9Q 2XCPA 3KLGA 2W9CB 3PX0A 2VQFF 2D41A 4DV2F 2A3JA 5LJ5Y 1GX5A 2EWHA 2IBOA 3TANA 2WOMB 4OI6A 4KFBA 2XO7A 2UU9F 1RT4A 3TVKA 1N36F 5KFUA 5J2QB 1NK4A 4DLGA 1M0SA 4NCBA 2B9XA 1C4AA 1KFDA 2CYYA 3DM2A 2L9DA 5KFKA 5KT7A 3G9CA 4ZP9A 1C0TA 1HD1A 1G1XA 5L9XA 2K7JA 5KFLA 1WTBA 2RDIA 1JX4A 1ZZNA 2E7WA 4F02A 3HVWA 1UEVA 3HVTB 3UNGC 1FJEB 1N5VA 1TVRA 4X4VA 2BQUA 2CPEA 1TL3B 1RTDB 2YNGA 5E33A 4Y00A 2AGPA 3CULA 2Y0SD 3NNAA 2GMJA 4DV1F 2ASJA 6FDRA 2FJVA 2CIMA 3WX4A 4QW9A 4CH0S 3QZ7A 2RU9A 4HI1A 1C1BA 1VQSA 3GMGA 1KQSR 3NNHA 4RBTA 5F3ZA 1NZAA 3Q0AA 4Q8FA 1SL2A 2V8GA 2AP6A 3N4WA 4ELVA 2NXUA 4JI5F 4DF8A 3VWSA 2ZUGA 1XMQF 4MKAA 3TP2A 2BRKA 3TA2A 1LFPA 5FLXY 2XEXA 4G1IA 2I2YA 1FRXA 1MW7A 4F4YA 3L7PA 5IM0B 3PW2A 2MQMA 5DG9A 3RRGA 4ES1A 2E9RX 1KD1T 1RT6A 3IFEA 3LW5C 2DRAA 4F3QA 2MQPA 3MEEB 1VLYA 2VG5B 2H5EA 1LXJA 3FCHA 4FPRA 1NK0A 2ROPA 3TRGA 3M9OB 2CDQA 4MAKA 1BQNA 3BGRA 4IFYB 5DO2A 1UVLA 5B0FA 2GNKA 4X4TA 2M0GB 4DR5F 3RB3A 4PXDA 4E0DA 4DFJA 5L8RC 5C25B 3KK1B 3HJFA 4AXIA 2ASDA 5E3QA 3MM6A 1HQEA 3OR1B 2VONA 3VF0B 2JH3A 1P9QC 1BD6A 5D4LA 5K5MA 4Q0BB 2JJ4D 2I9SA 3KG0A 3LP2B 4C7QA 4EZ6A 4X4NA 2IBKA 1TV6A 3OTDA 5CYQB 1HHTP 4AQYF 1Q82T 2EKYA 1JLFB 2R8IA 2CJAA 1F0XA 4DQSA 1HQUA 2FGCA 1G6BA 4ATNA 1T94A 2Q43A 4WK1A 3W2WA 3MPVA 3B78A 5B0GA 2R2SA 4DSKA 1WG5A 3DC2A 1C1CB 1N88A 2J76E 2WW8A 2QA4G 4DG1A 2ZD1B 1MWZA 1XC9A 2J6TA 4B3RF 4OZ0A 4TN2A 2NPFA 1CQNA 1HBNA 1HBUA 2ZNZA 1MROA 3UW1A 2KG0A 4ED5A 1JLFA 2OIHA 1DLOA 5LMUF 2OH2A 3OLAA 1U1RA 1UVKA 3DLEA 3WDOA 3QWPA 1SL0A 4FF3A 2VFTA 3X3UA 3HP6A 2R2RA 4IOBA 3LP1A 4I69A 3C8YA 5AE3A 5HROA 5F0UA 4ELTA 4H4MB 1N56A 3C46A 3THVA 2CPDA 2MKCA 3PW4A 2CQIA 4WK3A 1F60B 1FD8A 2IMWP 3Q2TC 4CQ1A 3DLLQ 1VIOA 1T95A 2JL9A 3ZFVA 4HHJA 1NK7A 4KQZA 4DV7F 5E41A 1V3ZA 3IR6B 1PC4A 2B4UA 4IKAA 1BQNB 3BGRB 3K5MA 3MR6A 3MFIA 3CD5A 5F8JA 1N5QA 3OXLA 4IH7A 4YB7A 1RYRA 1O51A 4H4MA 1KC8T 4MJKA 4RUCA 5EWGA 4NA3A 3DLGB 4DSLA 1N5TA 3JSMB 1TK5A 1VBXA 4RW6B 2XMTA 4ED2A 2XS7A 2QT7A 1JIHA 5I3UA 2IC3A 1CC7A 5E3RA 5BR8F 3I5CA 3Q23A 3BO2A 3FGVA 2B4PA 4A4JA 4OJ3A 3MEDB 3M1VA 1FDDA 4YB1P 1XMOF 3D0IE 2LKZA 4TQSA 2PC6A 3HHDA 3H2UB 1S79A 1X4CA 1G7CB 4RNHA 5HO4A 3GV8B 2ZH9A 4USIA 4J5OA 3VAGA 4A8FA 1ZPVA 5HLFA 2UV8A 1RTIB 3UR3C 3CC4S 1N32F 4O3PA 3PEHA 2M88A 2UZAA 1X7VA 1M5PC 2HHUA 1RAJA 2JDJA 2JEIA 1H7WA 2R9LA 4MKYA 3GFZA 4DQPA 4F4KA 4V19J 3CCUS 5KFNA 4MIBA 3KHGA 3VAHA 1S1UB 5C42A 3R5AA 5D8HB 2R2UA 3MECB 2H9ZA 4MYTA 2ZBCA 1FKAF 2LA4A 1XTZA 2MHEA 4EYHB 2OAUA 4DJBA 1YRUA 1NRKA 3FQLA 4ETZA 3KLHB 3D2WA 2PMZD 1DFDA 1JXLA 5KG4A 3MM7B 2R7WA 3OVAA 3GIKA 2FVSA 2EG1A 3IGNA 3CTRA 1Z2ZA 2POKA 3HKWA 3OSPA 4X4PA 1S1UA 5C42B 1VRUB 4RKUC 5CYMB 2UVUA 2CQ1A 4NLVA 2BYCA 3FJ2A 1P1TA 2V9WA 2KG1A 2ZH7A 1T03B 3N5FA 5DDRC 3O1LA 1X9MA 2B4OA 2R8GA 1LW2A 2RILA 1Y3JA 3NAIA 2E5JA 3S8SA 1RT4B 2BABA 2YNHB 3C6TB 1NNDA 1W25A 3S7RA 3LP0B 4CTAA 1S1WA 4M5DA 1NEEA 5L1JA 1VC0A 2F8MA 3CCRS 3I5BA 1LW0A 5DM7Q 4OI0A 4QWDA 3H4DA 5M2RA 3DYAB 1S7HA 1FVSA 3M1VB 4BC7A 2L48A 5J1PA 2R8JA 1H98A 5MLCV 2QA1A 4OZLA 3MOZA 1X0PA 4Y2CA 4DR7F 3Q8PB 4ECQA 3BR8A 5J1EA 2JLGA 4WXOA 4RNFA 3H25A 3PR5B 3I0SA 3AB4B 3GFHA 2RRNA 2BV3A 4ID5A 4M8LA 4P7VA 2AJQA 3TAQA 3FSYA 1QVFR 2R7RA 2OPQB 4Z37A 1TKXB 2FUG9 4B3OB 5F9LA 3SSSA 2B51A 2A2DA 1R8BA 3M4XA 4DFPA 3DGPA 3M8SA 2WSEC 3CIMA 2P5VA 3MMBB 4MK8A 1Y00A 4WYWA 1OIAA 1FXLA 1GTHA 3KFWX 1UJ6A 3C2PA 4NZ6A 4BCAA 4JV2A 5THWA 3DU5A 3OXFA 1MU2B 4F4XA 2XMMA 3CC2S 2FJWA 2E5HA 2GMLA 3AJ1A 3DM2B 4JI2F 2Q79A 1Q8LA 5J2NB 2DGWA 2ZJPQ 2V2KA 1S0VA 4DHVA 1RT2A 2AX1A 1FRKA 4Q2MA 4IH6A 3KNGA 3FEXB 3VZHA 4LF8F 3BGUA 1NB7A 5DM6Q 3D1HA 3G8TA 4ZVFA 3MUTP 1SJ3P 4PWUA 1KLMA 1KONA 4R5PA 2OFHX 4CO5A 4GMKA 1FKPA 2KYXA 1GH8A 5KTQA 2HMIB 3MPYA 3CGIA 3CJ4A 4W92B 5KG2A 1KS2A 3TR5A 1RT5B 2GJ2A 1KQGB 5A8RA 3MAHA 2GJIA 1HMVB 4C8NA 3K5NA 5CQGA 2ZOFA 4ZKAA 2NPIA 2JEJA 2CVIA 1DQAA 4QBUA 3ENWA 1WG4A 3HHLC 4R0EA 1VQ7S 4M94A 2C42A 4UY85 1IKYA 2ZH2A 3V6DA 1QSYA 4HH1A 2CPXA 1VQ9S 2NREA 5BYQA 4YQWA 4U7CA 1QLNA 2P6SA 4DL2A 2LLZA 4LVNP 1LXNA 3H2VE 5AXNA 4LFAF 4ED7A 1L5UA 4ZCMA 4UY8T 1UWBA 1JB0C 1FXRA 3NCRA 4ZPVR 2KRBA 4RBUA 2UVVA 4F2SA 5D6GA 2X1FA 3K58A 3KJVA 3SCKE 2P9GA 1U1QA 1IBKF 2VUGA 2N4CA 1X4EA 5K9FA 2VG5A 5I42A 1FESA 3OFEA 4F3MA 1NJWA 5IT9Y 2DHGA 5K8OA 4U67Q 4F25A 5T7LB 1X4GA 5HN0A 3PIPQ 3JYTA 1KQFB 1X4HA 1N5YA 3TAMA 5L1LA 5KFVA 3DU6A 1SI9A 4XIUA 2IJNA 1HL6A 1HNWF 2HLTA 2ZH4A 3F44A 4O44A 3HM9A 4C97A 2WK4A 4NX9A 1WF0A 4EYIB 4FF2A 4RBVA 2XB2D 1Q4RA 3NS5A 3G71S 2M4MA 1S0OA 2ADCA 3SSRA 4J9MA 5E2QA 3KLEA 4DSEA 5CXTA 4QPXA 2DNRA 2VBZA 3M32B 1ZTTA 1RGVA 2XLJA 4TLQA 5HBMA 2XC9A 3MR2A 5KFQA 1HPZB 4TLRA 4QU6A 2WHOA 3VCDA 4JI6F 4CH7A 4IYQA 3V6HA 1R43A 2F7VA 4FVCA 2N7YA 1T8EA 3PACA 2ZE2B 1LWEA 1S1TB 2OPSB 4H54A 2MB0B 3TA1A 4BWMA 4WFAQ 2ASLA 4OI3A 1X5SA 5I3UB 3OFGA 1YJRA 5DLGA 2GQ2A 3CD7A 1IJFB 2IRYA 1S9FA 4IDKA 2GQQA 3LQVA 1FE4A 4I2PA 3T5JA 4KO0B 2XLKA 2GHPA 4PQUB 2RT3A 3DI6A 3SDEB 3FFIA 2MZSA 1U6FA 2VA2A 1D8ZA 2YWFA 2ILZA 1NO8A 3OUYB 3CCES 2J0QD 2YX7A 2KTQA 1FNOA 2O5DA 2IVYA 3T5HA 5KFTA 5F8GA 4WFXA 4A8QA 2ZHOA 5J1EB 1UJ5A 4WJBA 3VAKA 2RUGA 1E6YB 4OI4A 3RRKA 2RQKA 3RB0A 5AXLA 2Q3PA 5T41A 4AYBD 2HS4A 4NA2A 2MZ1A 1S77D 1KFSA 2O67A 4CO4A 3QLHA 3SMZA 3PW0A 1YI2S 2M52A 4GKJF 3KLGB 4DL0C 3O8WA 2W9CA 4N8NA 4Q5VA 1CC8A 4X64F 4OI1A 2CFXA 1WI6A 4ZDNA 3PKYA 1BWEA 1FJCA 1PC5A 1BLUA 1TQLA 1S48A 2DO4A 2FB0A 3NNCA 1LK5A 4E98A 5GAGI 1FK9B 1L3KA 3RYLA 4J9NA 3JSMA 1ULRA 4OQJA 4H4OB 3CJ0A 3DMJA 3DRSB 2IYIA 2K7KA 4FXDA 3M8PB 2I5JA 2XWYA 2XHWA 1D0EA 2DCLA 5U47A 4J9PA 5AE1A 1VBZA 1MU2A 1N0VC 3E01A 2AJ1A 2KO1A 2BBEA 1P8GA 1Y5LB 4CCHA 3OJUA 2IM2A 4H4KC 2YNFB 1ZZFA 5KG0A 4OHXA 1R8AA 5KFSA 2VV5A 4RW7A 4ECYA 3IWXA 2KXFA 1RI7A 4NCAA 4ED6A 2PO4A 3KNAA 3AJ2A 3DOMA 3LGMA 1ZOTA 3D1QA 1VFJA 3PRBA 4FF1A 3M2UA 4DQRA 3KLIA 2FJBB 1E6VA 3UQSA 4B9TA 1DQ9A 2XSJB 2DNHA 3U7JA 2VZ9A 3I4HX 1U4BA 2AYBA 1K8AT 4USJC 3ZC4A 2MJUA 1UA1A 4QZVB 5H1SV 2J9CA 3CJKB 3MD1A 5LSRA 1F5CA 4JI8F 1X4FA 1HBMB 1QSLA 2CZVC 2HFZA 2KHCA 4LIWA 1OSCA 4MK9A 4IFVA 4N41A 3M6VA 2AJ4A 4M95A 1TKTB 1JXEA 1KHWA 4ZPCA 2IRUA 1MMDA 3OFFA 2HVHA 3SV3A 1LFWA 2BJDA 2E29A 2KJWA 2O3DA 3EZ5A 1OSDA 4LFBF 3EPIA 1FCAA 2W4PA 3H5UA 3ONQA 4U7UK 4N47A 1U8SA 3OSNA 3CT9A 1QE1B 3CCZA 3VQSA 4TU8A 2FVQA 3GZ7A 3O2IA 2EK6A 4C3LA 3MI7X 4NLQA 1RQ0A 2W9BB 3KHRA 2BZ2A 3U02A 3C3LA 4NLYA 4JI4F 2UVRA 3QAUA 4F8RA 3RR8A 2M9KA 3KMSA 2EW9A 3DRXA 4ECUA 1AROP 1GQEA 2YKQA 3OTBA 5KG5A 1L3TA 2E44A 1XEZA 1ELOA 5EHHA 3H5XA 4J37A 4C3KA 4O3QA 3DHWC 3OL6A 5J2MB 2C3PA 5I3QA 3P49B 2WSFC 1L3SA 2GV1A 2KJVA 5HMXA 3B82A 3QIPA 3R5CA 2DNKA 1YJWS 4LQ3A 2V94A 3BN4A 2W4DA 4J9KA 1FTRA 2HQ3A 3HVTA 1HARA 3KG1A 3MMCB 2OD4A 1Q78A 2RQMA 4IG3B 4DV3F 4QQBA 3GG1A 2DR8A 2MQLA 4OFZA 2ZBIA 1FKPB 3W2VB 2XMWA 1FJ7A 4WU3A 5KFIA 4CH1A 5DLFA 2GC8A 2CRLA 2B7BB 5CZVA 3PW5A 4LSNA 4FF4A 1RT5A 3PJXA 4KGKA 4B9LA 1RTJB 1VHFA 1IM4A 1WTFA 4I0WA 4QJVA 2CQHA 4FNHA 3NBPA 2ZC4A 2HWIA 2FDNA 4GKKF 1KVJA 4PQAA 2D3ZA 4IFVB 2MKKA 5DETA 4P7TA 2BE2B 3IS9B 2V8HA 2NZ4A 2ATLA 4NZ0A 1SUQB 3L7OA 3AQOA 4DFKA 1JLQB 3TOQA 2K8GA 4LVOP 4RNNA 1FRJA 2V0NA 2YKPA 2CQPA 3MEGA 4ICLA 4OI2A 2DNMA 3S1TA 3CCTA 4ZVEA 4A8MP 3CD6S 3HDSA 4O3SA 2HHWA 4YR2A 2DRBA 1YQHA 4TY8B 4AE5A 1P6TA 2NQPA 2AYGA 1UVIA 4DPOA 1PGZA 3KWMA 3Q8RB 5F41A 3F56A 4RUHA 5F8MA 1VQPS 1B0TA 2IVMA 1HWKA 4KKOB 2BJEA 1GAOA 3H40A 3GG0A 4NCGB 1DTTB 1RT7A 1I94F 1K0TA 2J0WA 4TYBA 3DOKA 2ZZMA 4HH0A 2V4JB 3C6UA 4EFAC 5B0BA 4DLEA 2EVZA 3DRPA 4Y65A 1QVGR 2BOPA 2YNIA 4OIXA 4DQIA 1S6QB 5IFMA 4ZK7M 2XY6A 4IDKB 3QGGA 4XPEA 4OL8A 3BM7A 2VFUA 2Z2LA 4LF5F 5LL6d 1JLGB 5KFGA 3G6YA 3QIDA 4B9UA 3LP0A 2B43A 2IFXA 2WAQD 4EU0A 4WYLA 4ZHRB 3EXCX 3Q8SB 2FLLA 3CEDA 1SJ4P 2W25A 1RA7A 2FHJD 3U1MA 1UFWA 4B3TF 2HNDA 3KHHA 4OHYA 2JLFA 4B08A 4X4QA 2VG7B 2N4DA 4K4VA 3LAKA 4WFBQ 4IQMA 4R8UA 4NLWA 2LXUA 4RWWA 1VK3A 3JAMY 1CEZA 4DL4A 5CD4H 2ZH8A 3DFEA 4B9MA 1DQ8A 5C24B 3HKZD 3HO1A 3HHLB 3A8EA 4Y2MA 4X4SA 1KR4A 3LANA 4TKTA 3SCIE 2XY7A 2A18A 3PR4A 1PILA 2QV6A 4DG1B 2QO3A 5EX3A 1U1LA 4ZPAA 5FJ4A 4KSEB 4B3OA 1RTJA 2CQ0A 3MM8A 5G0RB 1FRHA 3S6EA 1KQKA 3FEYB 3HFKA 3K5LA 3HF5A 2KZZA 4J9RA 3OXGA 5KG6A 4CNZA 5KFWA 3ETOA 2VFSA 4IG0B 2FGOA 4X84A 1HR0F 1DARA 3EGWB 4QW8A 2ZZNA 4ED8A 1TV6B 1EETB 1C4CA 3T6JA 2AX0A 2B6AB 2Q1LA 3MTKA 1XN9A 2IAJA 4QR0A 3RB6A 4KE5A 3I9V9 1SJ1A 3GSDA 2MHNA 4K50A 1HBOB 2ZM6F 2LU1A 2B5JA 1SKWA 1Z4UA 4I2QB 1OO0B 3E3XA 5FDLA 5K14A 3UE2A 2HNYA 3IAM9 2OO4A 3K5PA 3SCJE 3GB0A 4BBYA 2MYFA 4WE1A 1ZAXA 2RH3A 2LXIA 1N8RT 1JWWA 1Q53A 2V9KA 1IKWB 2FTRA 4KJIA 4OZ1A 1SC6A 2BANB 2ZC3A 2DIUA 4LF6F 3M30A 2XS2A 3PEJA 1Y5NB 1QSSA 3OVBA 3UFCX 4R5PB 1R8HA 3N01A 1VQNS 2YNHA 4X4OA 1VRTB 1QAJA 2UVWA 2YQ3A 1RT6B 5BJRA 5IQQA