2F4EA

N-terminal domain of fkbp42 from arabidopsis thaliana
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
b'GNVPPKVDSEAEVLDEKVSKQIIKEGHGSKPSKYSTCFLHYRAWTKNSQHKFEDTWHEQQPIELVLGKEKKELAGLAIGVASMKSGERALVHVGWELAYGKEGNFSFPNVPPMADLLYEVEVIGFDETKEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AtFKBP42
publication title Crystal structure of a plant immunophilin domain involved in regulation of MDR-type ABC transporters.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
total genus 30
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2f4eA00
2DG3A 3O5KA 3OOBA 1ZK6A 4JFIA 4QT2A 2F2DA 2ITKA 3CGNA 2MLZA 4DH0A 3O5LA 4TNSA 1D7IA 1JNSA 4GIVA 4TW8A 3JXVA 2F4EA 3O5RA 3KABA 3O5MA 1QPFA 1TCOC 1YW5A 2FKEA 2ZR4A 4MGVA 1T11A 2KE0A 3KZ7A 4TW6A 4DRJA 3KAGA 4DRPA 2AWGA 1Q1CA 1KT0A 1FKSA 1Y0OA 2MLYA 4BF8A 4DRHA 3O5QA 2KO7A 4MSPA 4ODNA 3IKGA 4IQCA 3I6CA 1FKRA 2PPOA 2PV2A 1FAPA 3UQIA 4C02B 3O5FA 5I98A 2D9FA 1F40A 5HUAA 4U85A 2XP7A 3UI6A 1Q6HA 3JYJA 4TW7A 5GPGA 2ZQTA 4ODRA 3WH0A 4U86A 1FKBA 5DITA 3NTPA 1B6CA 4QT3A 1FKJA 4J4OA 3UQAA 3FAPA 2PPNA 4IPXA 3NRKA 4R0XA 2LKNA 1FKKA 1J4HA 2DG9A 3O5EA 1A7XA 1R9HA 2XP9A 1F8AB 5D75A 1FKHA 3UF8A 5DIVA 4DRQA 4DRKA 4ODOA 1YATA 2RQSA 2ZQVA 2M1IA 4DT4A 1HXVA 4TYOA 1ROTA 1FJDA 1J6YA 1PINA 1QPLA 1ROUA 1JVWA 1FKGA 3GPKA 2PV1A 3O5JA 4DRNA 2MPHA 5HWCA 4DROA 2JZVA 3O5DA 4N19A 3H9RB 2FAPA 4O2TA 3O5PA 2Q5AA 2XP6A 3NI6A 2XP8A 4NNRA 2RURA 3ODKA 3TDBA 3TC5A 3KAIA 5J6EA 4ODLA 2KGJA 4IQ2A 3KAFA 1BKFA 4W9OA 2LGOA 2VCDA 2MLXA 1PBKA 4J4NA 2KFWA 3PA7A 2XP5A 4DZ3A 1N1AA 4JFKA 1BL4A 1NSGA 2XPBA 1NMWA 3O5IA 4FAPA 2RUQA 2MNTA 4JFLA 5HW7A 2Y78A 2OFNA 1JNTA 2RUCA 5HKGA 4G2PA 4JFJA 1C9HA 2KI3A 3B7XA 5HW8A 4U84A 1P5QA 2RSEA 3CGMA 1NMVA 1L1PA 1FKDA 3O5OA 4JFMA 2ZQUA 3UI5A 3TCZA 3PRDA 1W26A 2MF9A 4LAXA 3IKDA 4DRMA 1D7JA 4QIBA 5HT1A 3UQBA 1EQ3A 1D7HA 3KACA 2XP4A 1QZ2A 5HW6A 1EYMA 2ZQSA 4LAYA 2M08A 1U79A 4ODKA 4W9QA 3MDYB 4ITZA 3UI4A 1FKFA 2VN1A 2KR7A 4LAWA 4ODPA 4DRIA 4DZ2A 5B8IC 1KT1A 2LJ4A 3O5GA 4FN2A 2L2SA 1M5YA 2LPVA 3EY6A 2XPAA 4W9PA 2ZR5A 4ODQA 3PRBA 5BXJA 4LAVA 2ZR6A 1D6OA 4G50A 1ZCNA 4GGQA 1Q6UA 5HWBA 5HTGA 3RFWA 2RUDA 2XP3A 1J4RA 2F21A 5DIUA 3KADA 3IK8A 4ODMA 3JYMA 4DIPA 1FKIA 2IF4A 3VAWA 2N87A 3KAHA 2DG4A 2PPPA 1J4IA 4TX0A 3LUOA 2PBCA 1FKTA 2K8IA 2M2AA 3RGCA 3KCEA 1FD9A 1FKLA 2UZ5A 3IHZA 2PV3A 1Q6IA 4JYSA
chains in the Genus database with same CATH superfamily
2DG3A 2F2DA 3CGNA 3O5LA 4Z2GA 2FDMA 3ALGA 3JXVA 4MNJA 4IT6A 2F4EA 1TCOC 1YW5A 1T11A 2KE0A 3O5QA 1NH6A 1LG1A 1OWQA 4C02B 2D9FA 2IUZA 3UI6A 1Q6HA 5GPGA 4ODRA 4P8UA 4WJXA 3WH0A 3WL1A 1B6CA 3WQVA 4ZPVR 1FKKA 2DSWA 4MNKA 1F8AB 2DPEA 4ODOA 1YATA 1LG2A 1KFWA 4NZCA 1J6YA 3AROA 3GPKA 1FKGA 3O5JA 3WQWA 4Z2KA 3PRAA 3WD4A 4AY1A 3WD0A 1WAWA 4WKAA 3H9RB 2FAPA 2Q5AA 2RURA 3TC5A 5J6EA 4ODLA 2B31A 1TFVA 4P8XA 2VCDA 2MLXA 3PA7A 4DZ3A 4DWSC 4KQZA 1NSGA 1WB0A 5HW7A 4ZPTR 1W1PA 4G2PA 1ZBCA 3CGMA 1HKMA 4DRMA 1F40A 3IKDA 1D7JA 4MAVA 1HJWA 1QZ2A 1EYMA 4Q22A 4WIWA 3ARYA 3MDYB 4HBOA 4DZ2A 2DT2A 4DRIA 5DO2A 1E6RA 2LJ4A 3O5GA 1M5YA 4L3NA 2LPVA 3EY6A 1W1VA 2A3CA 1D6OA 1Q6UA 5HWBA 1E6ZA 2YBTA 1J4RA 1EIBA 4PTMA 2QF8A 1NWTA 3CHFA 3VAWA 1EHNA 2PPPA 1J4IA 2WM0A 3LUOA 3KCEA 4MNLA 1FD9A 2UZ5A 1OGGA 2PV3A 3IHZA 1LQ0A 1JNDA 1ITXA 2G41A 4QT2A 4DH0A 4TNSA 1JNSA 4TW8A 4DWSB 3BMBA 3CZ8A 4DRJA 3KZ7A 3ARUA 4DRPA 1Q1CA 4BF8A 2KO7A 4MSPA 4WK9A 3IKGA 4IQCA 5DEZA 1FKRA 2PPOA 3UQIA 3O5FA 5HUAA 1LJYA 1HJVA 1CTNA 3AS3A 5DITA 1ZB5A 5GPRA 1GPFA 3UQAA 3FAPA 2PPNA 4IPXA 1ZU8A 2LKNA 2DG9A 1A7XA 5D75A 4DRQA 3ALFA 4Z2HA 2M1IA 3G6LA 4DT4A 1PINA 1ROUA 2PI6A 3ARQA 3AS1A 4DRNA 2MPHA 2DT0A 4DROA 4O2TA 2XP6A 3NI6A 2XP8A 3OA5A 3ODKA 3TDBA 3KAIA 2KGJA 4IQ2A 2B5UB 1ZBWA 3KAFA 1BKFA 4WKHA 2LGOA 2WLZA 1JNEA 4J4NA 2KFWA 2XPBA 1NMWA 3WL0A 5HKGA 2A3AA 1C9HA 2KI3A 2O9OA 3ARTA 3B7XA 1P5QA 5HW8A 4S3KA 3O5OA 1E6PA 4JFMA 3PRDA 4QIBA 1RD6A 5HT1A 3UI4A 4ITZA 4ODPA 5B8IC 1KT1A 1VF8A 2L2SA 3CH9A 1EDQA 2A3BA 3AS2A 4W9PA 2DSVA 5BXJA 1O6IA 4LAVA 2ZR6A 1NWSA 2F23A 5HTGA 2PN0A 1LL7A 2RUDA 2F21A 3IK8A 3JYMA 1FKIA 2IF4A 3CHCA 2N87A 2DG4A 4TX0A 1FKTA 1HKIA 2G8ZA 1UR9A 1FKLA 1W1YA 1Q6IA 3WD3A 1ZK6A 4JFIA 1E6NA 2ITKA 4P8WA 1JCHB 1D7IA 3ARVA 1W1TA 4GIVA 4HBEA 3O5RA 3O5MA 1E9LA 3AQUA 1KT0A 1Y0OA 1GOIA 4ODNA 4ZPWR 1XRVA 3I6CA 1D2KA 1FAPA 2PV2A 5I98A 4MNMA 3RM8A 4U85A 4QT3A 4ML4A 1FKJA 2P4VA 4J4OA 3NRKA 1J4HA 1H0IA 1R9HA 4L72B 2O92A 1FKHA 5DF0A 2ZQVA 3GU0A 2DT1A 4TYOA 1FJDA 1QPLA 1K9TA 2PV1A 1W9UA 2DSZA 5HWCA 1UR8A 4S3JA 4N19A 3O5PA 4NNRA 3B8SA 1LL6A 3ARZA 4W9OA 1GRJA 3QOKA 1PBKA 3ARSA 2XP5A 1LL4A 4MPKA 1GUVA 3O5IA 2RUQA 4JFLA 4Z2JA 4R5EA 2OFNA 1HKJA 4JFJA 2RSEA 1L1PA 3ARRA 3G6MA 2ZQUA 3UQBA 3TCZA 2ESCA 4LAXA 1EQ3A 1HKKA 3ARPA 2ZQSA 3GTYX 4URIA 2M08A 1U79A 4ODKA 1W9VA 1FKFA 2VN1A 2KR7A 4LAWA 4FN2A 3FY1A 3WIJA 1SYTA 2ZR5A 4ODQA 3PRBA 4G50A 2EULA 3ARWA 3B9AA 2XP3A 4MTVA 4ODMA 3WKZA 4ZS6A 4HARA 2K8IA 2M2AA 4QZVB 3B9EA 4JYSA 3O5KA 5GQBA 3OOBA 1FFRA 4P8VA 1IX5A 2MLZA 4DWSA 2OLHA 3KABA 1QPFA 4TW6A 2FKEA 2ZR4A 4MGVA 2WK2A 3KAGA 2AWGA 2MLYA 1FKSA 4DRHA 5JH8A 1NWUA 4Q7NA 4UDMA 3FXYA 2YBUA 2DT3A 4DWSD 4LGXA 2XP7A 1E44A 3JYJA 4TW7A 2ZQTA 4U86A 1OGBA 4KR0B 1FKBA 3NTPA 1E15A 1WNOA 4R0XA 3O5EA 4W5UA 2XP9A 4DRKA 3UF8A 5DIVA 4IT4A 2RQSA 4Z2IA 1HXVA 1ROTA 1JVWA 2WLYA 1ZBVA 3RMEA 3WD1A 4NSBA 2JZVA 3O5DA 2AOSA 1H0GA 4Z2LA 2ETNA 3PR9A 1N1AA 4WKFA 4JFKA 1BL4A 3EIPA 4FAPA 1ZL1A 2A3EA 2MNTA 2Y78A 1JNTA 2RUCA 4U84A 1NMVA 1FKDA 1X6NA 3UI5A 3ARXA 1W26A 2MF9A 3CHEA 1ZBKA 1D7HA 3KACA 2XP4A 3WD2A 5HW6A 3W4RA 4LAYA 1W9PA 1SR0A 4W9QA 3AS0A 3B9DA 2XPAA 1NWRA 1XHGA 1ZCNA 4GGQA 3RFWA 5HBFA 1X6LA 3CHDA 5DIUA 3BXWA 3KADA 4DIPA 4XAKA 2DSUA 3KAHA 1HJXA 2PBCA 3RGCA 3RM4A 1FFQA 3RM9A
chains in the Genus database with same CATH topology
2DG3A 2F2DA 3CGNA 3O5LA 4Z2GA 2FDMA 3ALGA 3JXVA 4MNJA 4IT6A 2F4EA 1TCOC 1YW5A 1T11A 2KE0A 3O5QA 1NH6A 1LG1A 1OWQA 4C02B 2D9FA 2IUZA 3UI6A 1Q6HA 5GPGA 4ODRA 4P8UA 4WJXA 3WH0A 3WL1A 1B6CA 3WQVA 4ZPVR 1FKKA 2DSWA 4MNKA 1F8AB 2DPEA 4ODOA 1YATA 1LG2A 1KFWA 4NZCA 1J6YA 3AROA 3GPKA 1FKGA 3O5JA 3WQWA 4Z2KA 3PRAA 3WD4A 4AY1A 3WD0A 1WAWA 4WKAA 3H9RB 2FAPA 2Q5AA 2RURA 3TC5A 5J6EA 4ODLA 2B31A 1TFVA 4P8XA 2VCDA 2MLXA 3PA7A 4DZ3A 4DWSC 4KQZA 1NSGA 1WB0A 5HW7A 4ZPTR 1W1PA 4G2PA 1ZBCA 3CGMA 1HKMA 4DRMA 1F40A 3IKDA 1D7JA 4MAVA 1HJWA 1QZ2A 1EYMA 4Q22A 4WIWA 3ARYA 3MDYB 4HBOA 4DZ2A 2DT2A 4DRIA 5DO2A 1E6RA 2LJ4A 3O5GA 1M5YA 4L3NA 2LPVA 3EY6A 1W1VA 2A3CA 1D6OA 1Q6UA 5HWBA 1E6ZA 2YBTA 1J4RA 1EIBA 4PTMA 2QF8A 1NWTA 3CHFA 3VAWA 1EHNA 2PPPA 1J4IA 2WM0A 3LUOA 3KCEA 4MNLA 1FD9A 2UZ5A 1OGGA 2PV3A 3IHZA 1LQ0A 1JNDA 1ITXA 2G41A 4QT2A 4DH0A 4TNSA 1JNSA 4TW8A 4DWSB 3CZ8A 4DRJA 3KZ7A 3ARUA 4DRPA 1Q1CA 4BF8A 2KO7A 4MSPA 4WK9A 3IKGA 4IQCA 5DEZA 1FKRA 2PPOA 3UQIA 3O5FA 5HUAA 1LJYA 1HJVA 1CTNA 3AS3A 5DITA 1ZB5A 5GPRA 1GPFA 3UQAA 3FAPA 2PPNA 4IPXA 1ZU8A 2LKNA 2DG9A 1A7XA 5D75A 4DRQA 3ALFA 4Z2HA 2M1IA 3G6LA 4DT4A 1PINA 1ROUA 2PI6A 3ARQA 3AS1A 4DRNA 2MPHA 2DT0A 4DROA 4O2TA 2XP6A 3NI6A 2XP8A 3OA5A 3ODKA 3TDBA 3KAIA 2KGJA 4IQ2A 1ZBWA 3KAFA 1BKFA 4WKHA 2LGOA 2WLZA 1JNEA 4J4NA 2KFWA 2XPBA 1NMWA 3WL0A 5HKGA 2A3AA 1C9HA 2KI3A 2O9OA 3ARTA 3B7XA 1P5QA 5HW8A 4S3KA 3O5OA 1E6PA 4JFMA 3PRDA 4QIBA 1RD6A 5HT1A 3UI4A 4ITZA 4ODPA 5B8IC 1KT1A 1VF8A 2L2SA 3CH9A 1EDQA 2A3BA 3AS2A 4W9PA 2DSVA 5BXJA 1O6IA 4LAVA 2ZR6A 1NWSA 5HTGA 1LL7A 2RUDA 2F21A 3IK8A 3JYMA 1FKIA 2IF4A 3CHCA 2N87A 2DG4A 4TX0A 1FKTA 1HKIA 2G8ZA 1UR9A 1FKLA 1W1YA 1Q6IA 3WD3A 1ZK6A 4JFIA 1E6NA 2ITKA 4P8WA 1D7IA 3ARVA 1W1TA 4GIVA 4HBEA 3O5RA 3O5MA 1E9LA 3AQUA 1KT0A 1Y0OA 1GOIA 4ODNA 4ZPWR 1XRVA 3I6CA 1D2KA 1FAPA 2PV2A 5I98A 4MNMA 3RM8A 4U85A 4QT3A 4ML4A 1FKJA 4J4OA 3NRKA 1J4HA 1H0IA 1R9HA 4L72B 2O92A 1FKHA 5DF0A 2ZQVA 2DT1A 4TYOA 1FJDA 1QPLA 1K9TA 2PV1A 1W9UA 2DSZA 5HWCA 1UR8A 4S3JA 4N19A 3O5PA 4NNRA 3B8SA 1LL6A 3ARZA 4W9OA 3QOKA 1PBKA 3ARSA 2XP5A 1LL4A 4MPKA 1GUVA 3O5IA 2RUQA 4JFLA 4Z2JA 4R5EA 2OFNA 1HKJA 4JFJA 2RSEA 1L1PA 3ARRA 3G6MA 2ZQUA 3UQBA 3TCZA 2ESCA 4LAXA 1EQ3A 1HKKA 3ARPA 2ZQSA 4URIA 2M08A 1U79A 4ODKA 1W9VA 1FKFA 2VN1A 2KR7A 4LAWA 4FN2A 3FY1A 3WIJA 1SYTA 2ZR5A 4ODQA 3PRBA 4G50A 3ARWA 3B9AA 2XP3A 4MTVA 4ODMA 3WKZA 4ZS6A 4HARA 2K8IA 2M2AA 4QZVB 3B9EA 4JYSA 3O5KA 5GQBA 3OOBA 1FFRA 4P8VA 1IX5A 2MLZA 4DWSA 2OLHA 3KABA 1QPFA 4TW6A 2FKEA 2ZR4A 4MGVA 2WK2A 3KAGA 2AWGA 2MLYA 1FKSA 4DRHA 5JH8A 1NWUA 4Q7NA 3FXYA 2YBUA 2DT3A 4DWSD 4LGXA 2XP7A 3JYJA 4TW7A 2ZQTA 4U86A 1OGBA 4KR0B 1FKBA 3NTPA 1E15A 1WNOA 4R0XA 3O5EA 4W5UA 2XP9A 4DRKA 3UF8A 5DIVA 4IT4A 2RQSA 4Z2IA 1HXVA 1ROTA 1JVWA 2WLYA 1ZBVA 3RMEA 3WD1A 4NSBA 2JZVA 3O5DA 2AOSA 1H0GA 4Z2LA 3PR9A 1N1AA 4WKFA 4JFKA 1BL4A 4FAPA 1ZL1A 2A3EA 2MNTA 2Y78A 1JNTA 2RUCA 4U84A 1NMVA 1FKDA 1X6NA 3UI5A 3ARXA 1W26A 2MF9A 3CHEA 1ZBKA 1D7HA 3KACA 2XP4A 3WD2A 5HW6A 3W4RA 4LAYA 1W9PA 1SR0A 4W9QA 3AS0A 3B9DA 2XPAA 1NWRA 1XHGA 1ZCNA 4GGQA 3RFWA 5HBFA 1X6LA 3CHDA 5DIUA 3BXWA 3KADA 4DIPA 4XAKA 2DSUA 3KAHA 1HJXA 2PBCA 3RGCA 3RM4A 1FFQA 3RM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DG3 A;  3O5K A;  3OOB A;  1ZK6 A;  4JFI A;  4QT2 A;  2F2D A;  2ITK A;  3CGN A;  2MLZ A;  4DH0 A;  3O5L A;  4TNS A;  1D7I A;  1JNS A;  4GIV A;  4TW8 A;  3JXV A;  2F4E A;  3O5R A;  3KAB A;  3O5M A;  1QPF A;  1TCO C;  1YW5 A;  2FKE A;  2ZR4 A;  4MGV A;  1T11 A;  2KE0 A;  3KZ7 A;  4TW6 A;  4DRJ A;  3KAG A;  4DRP A;  2AWG A;  1Q1C A;  1KT0 A;  1FKS A;  1Y0O A;  2MLY A;  4BF8 A;  4DRH A;  3O5Q A;  2KO7 A;  4MSP A;  4ODN A;  3IKG A;  4IQC A;  3I6C A;  1FKR A;  2PPO A;  2PV2 A;  1FAP A;  3UQI A;  4C02 B;  3O5F A;  5I98 A;  2D9F A;  1F40 A;  5HUA A;  4U85 A;  2XP7 A;  3UI6 A;  1Q6H A;  3JYJ A;  4TW7 A;  5GPG A;  2ZQT A;  4ODR A;  3WH0 A;  4U86 A;  1FKB A;  5DIT A;  3NTP A;  1B6C A;  4QT3 A;  1FKJ A;  4J4O A;  3UQA A;  3FAP A;  2PPN A;  4IPX A;  3NRK A;  4R0X A;  2LKN A;  1FKK A;  1J4H A;  2DG9 A;  3O5E A;  1A7X A;  1R9H A;  2XP9 A;  1F8A B;  5D75 A;  1FKH A;  3UF8 A;  5DIV A;  4DRQ A;  4DRK A;  4ODO A;  1YAT A;  2RQS A;  2ZQV A;  2M1I A;  4DT4 A;  1HXV A;  4TYO A;  1ROT A;  1FJD A;  1J6Y A;  1PIN A;  1QPL A;  1ROU A;  1JVW A;  1FKG A;  3GPK A;  2PV1 A;  3O5J A;  4DRN A;  2MPH A;  5HWC A;  4DRO A;  2JZV A;  3O5D A;  4N19 A;  3H9R B;  2FAP A;  4O2T A;  3O5P A;  2Q5A A;  2XP6 A;  3NI6 A;  2XP8 A;  4NNR A;  2RUR A;  3ODK A;  3TDB A;  3TC5 A;  3KAI A;  5J6E A;  4ODL A;  2KGJ A;  4IQ2 A;  3KAF A;  1BKF A;  4W9O A;  2LGO A;  2VCD A;  2MLX A;  1PBK A;  4J4N A;  2KFW A;  3PA7 A;  2XP5 A;  4DZ3 A;  1N1A A;  4JFK A;  1BL4 A;  1NSG A;  2XPB A;  1NMW A;  3O5I A;  4FAP A;  2RUQ A;  2MNT A;  4JFL A;  5HW7 A;  2Y78 A;  2OFN A;  1JNT A;  2RUC A;  5HKG A;  4G2P A;  4JFJ A;  1C9H A;  2KI3 A;  3B7X A;  5HW8 A;  4U84 A;  1P5Q A;  2RSE A;  3CGM A;  1NMV A;  1L1P A;  1FKD A;  3O5O A;  4JFM A;  2ZQU A;  3UI5 A;  3TCZ A;  3PRD A;  1W26 A;  2MF9 A;  4LAX A;  3IKD A;  4DRM A;  1D7J A;  4QIB A;  5HT1 A;  3UQB A;  1EQ3 A;  1D7H A;  3KAC A;  2XP4 A;  1QZ2 A;  5HW6 A;  1EYM A;  2ZQS A;  4LAY A;  2M08 A;  1U79 A;  4ODK A;  4W9Q A;  3MDY B;  4ITZ A;  3UI4 A;  1FKF A;  2VN1 A;  2KR7 A;  4LAW A;  4ODP A;  4DRI A;  4DZ2 A;  5B8I C;  1KT1 A;  2LJ4 A;  3O5G A;  4FN2 A;  2L2S A;  1M5Y A;  2LPV A;  3EY6 A;  2XPA A;  4W9P A;  2ZR5 A;  4ODQ A;  3PRB A;  5BXJ A;  4LAV A;  2ZR6 A;  1D6O A;  4G50 A;  1ZCN A;  4GGQ A;  1Q6U A;  5HWB A;  5HTG A;  3RFW A;  2RUD A;  2XP3 A;  1J4R A;  2F21 A;  5DIU A;  3KAD A;  3IK8 A;  4ODM A;  3JYM A;  4DIP A;  1FKI A;  2IF4 A;  3VAW A;  2N87 A;  3KAH A;  2DG4 A;  2PPP A;  1J4I A;  4TX0 A;  3LUO A;  2PBC A;  1FKT A;  2K8I A;  2M2A A;  3RGC A;  3KCE A;  1FD9 A;  1FKL A;  2UZ5 A;  3IHZ A;  2PV3 A;  1Q6I A;  4JYS A; 
#chains in the Genus database with same CATH topology
 2DG3 A;  2F2D A;  3CGN A;  3O5L A;  4Z2G A;  2FDM A;  3ALG A;  3JXV A;  4MNJ A;  4IT6 A;  2F4E A;  1TCO C;  1YW5 A;  1T11 A;  2KE0 A;  3O5Q A;  1NH6 A;  1LG1 A;  1OWQ A;  4C02 B;  2D9F A;  2IUZ A;  3UI6 A;  1Q6H A;  5GPG A;  4ODR A;  4P8U A;  4WJX A;  3WH0 A;  3WL1 A;  1B6C A;  3WQV A;  4ZPV R;  1FKK A;  2DSW A;  4MNK A;  1F8A B;  2DPE A;  4ODO A;  1YAT A;  1LG2 A;  1KFW A;  4NZC A;  1J6Y A;  3ARO A;  3GPK A;  1FKG A;  3O5J A;  3WQW A;  4Z2K A;  3PRA A;  3WD4 A;  4AY1 A;  3WD0 A;  1WAW A;  4WKA A;  3H9R B;  2FAP A;  2Q5A A;  2RUR A;  3TC5 A;  5J6E A;  4ODL A;  2B31 A;  1TFV A;  4P8X A;  2VCD A;  2MLX A;  3PA7 A;  4DZ3 A;  4DWS C;  4KQZ A;  1NSG A;  1WB0 A;  5HW7 A;  4ZPT R;  1W1P A;  4G2P A;  1ZBC A;  3CGM A;  1HKM A;  4DRM A;  1F40 A;  3IKD A;  1D7J A;  4MAV A;  1HJW A;  1QZ2 A;  1EYM A;  4Q22 A;  4WIW A;  3ARY A;  3MDY B;  4HBO A;  4DZ2 A;  2DT2 A;  4DRI A;  5DO2 A;  1E6R A;  2LJ4 A;  3O5G A;  1M5Y A;  4L3N A;  2LPV A;  3EY6 A;  1W1V A;  2A3C A;  1D6O A;  1Q6U A;  5HWB A;  1E6Z A;  2YBT A;  1J4R A;  1EIB A;  4PTM A;  2QF8 A;  1NWT A;  3CHF A;  3VAW A;  1EHN A;  2PPP A;  1J4I A;  2WM0 A;  3LUO A;  3KCE A;  4MNL A;  1FD9 A;  2UZ5 A;  1OGG A;  2PV3 A;  3IHZ A;  1LQ0 A;  1JND A;  1ITX A;  2G41 A;  4QT2 A;  4DH0 A;  4TNS A;  1JNS A;  4TW8 A;  4DWS B;  3BMB A;  3CZ8 A;  4DRJ A;  3KZ7 A;  3ARU A;  4DRP A;  1Q1C A;  4BF8 A;  2KO7 A;  4MSP A;  4WK9 A;  3IKG A;  4IQC A;  5DEZ A;  1FKR A;  2PPO A;  3UQI A;  3O5F A;  5HUA A;  1LJY A;  1HJV A;  1CTN A;  3AS3 A;  5DIT A;  1ZB5 A;  5GPR A;  1GPF A;  3UQA A;  3FAP A;  2PPN A;  4IPX A;  1ZU8 A;  2LKN A;  2DG9 A;  1A7X A;  5D75 A;  4DRQ A;  3ALF A;  4Z2H A;  2M1I A;  3G6L A;  4DT4 A;  1PIN A;  1ROU A;  2PI6 A;  3ARQ A;  3AS1 A;  4DRN A;  2MPH A;  2DT0 A;  4DRO A;  4O2T A;  2XP6 A;  3NI6 A;  2XP8 A;  3OA5 A;  3ODK A;  3TDB A;  3KAI A;  2KGJ A;  4IQ2 A;  2B5U B;  1ZBW A;  3KAF A;  1BKF A;  4WKH A;  2LGO A;  2WLZ A;  1JNE A;  4J4N A;  2KFW A;  2XPB A;  1NMW A;  3WL0 A;  5HKG A;  2A3A A;  1C9H A;  2KI3 A;  2O9O A;  3ART A;  3B7X A;  1P5Q A;  5HW8 A;  4S3K A;  3O5O A;  1E6P A;  4JFM A;  3PRD A;  4QIB A;  1RD6 A;  5HT1 A;  3UI4 A;  4ITZ A;  4ODP A;  5B8I C;  1KT1 A;  1VF8 A;  2L2S A;  3CH9 A;  1EDQ A;  2A3B A;  3AS2 A;  4W9P A;  2DSV A;  5BXJ A;  1O6I A;  4LAV A;  2ZR6 A;  1NWS A;  2F23 A;  5HTG A;  2PN0 A;  1LL7 A;  2RUD A;  2F21 A;  3IK8 A;  3JYM A;  1FKI A;  2IF4 A;  3CHC A;  2N87 A;  2DG4 A;  4TX0 A;  1FKT A;  1HKI A;  2G8Z A;  1UR9 A;  1FKL A;  1W1Y A;  1Q6I A;  3WD3 A;  1ZK6 A;  4JFI A;  1E6N A;  2ITK A;  4P8W A;  1JCH B;  1D7I A;  3ARV A;  1W1T A;  4GIV A;  4HBE A;  3O5R A;  3O5M A;  1E9L A;  3AQU A;  1KT0 A;  1Y0O A;  1GOI A;  4ODN A;  4ZPW R;  1XRV A;  3I6C A;  1D2K A;  1FAP A;  2PV2 A;  5I98 A;  4MNM A;  3RM8 A;  4U85 A;  4QT3 A;  4ML4 A;  1FKJ A;  2P4V A;  4J4O A;  3NRK A;  1J4H A;  1H0I A;  1R9H A;  4L72 B;  2O92 A;  1FKH A;  5DF0 A;  2ZQV A;  3GU0 A;  2DT1 A;  4TYO A;  1FJD A;  1QPL A;  1K9T A;  2PV1 A;  1W9U A;  2DSZ A;  5HWC A;  1UR8 A;  4S3J A;  4N19 A;  3O5P A;  4NNR A;  3B8S A;  1LL6 A;  3ARZ A;  4W9O A;  1GRJ A;  3QOK A;  1PBK A;  3ARS A;  2XP5 A;  1LL4 A;  4MPK A;  1GUV A;  3O5I A;  2RUQ A;  4JFL A;  4Z2J A;  4R5E A;  2OFN A;  1HKJ A;  4JFJ A;  2RSE A;  1L1P A;  3ARR A;  3G6M A;  2ZQU A;  3UQB A;  3TCZ A;  2ESC A;  4LAX A;  1EQ3 A;  1HKK A;  3ARP A;  2ZQS A;  3GTY X;  4URI A;  2M08 A;  1U79 A;  4ODK A;  1W9V A;  1FKF A;  2VN1 A;  2KR7 A;  4LAW A;  4FN2 A;  3FY1 A;  3WIJ A;  1SYT A;  2ZR5 A;  4ODQ A;  3PRB A;  4G50 A;  2EUL A;  3ARW A;  3B9A A;  2XP3 A;  4MTV A;  4ODM A;  3WKZ A;  4ZS6 A;  4HAR A;  2K8I A;  2M2A A;  4QZV B;  3B9E A;  4JYS A;  3O5K A;  5GQB A;  3OOB A;  1FFR A;  4P8V A;  1IX5 A;  2MLZ A;  4DWS A;  2OLH A;  3KAB A;  1QPF A;  4TW6 A;  2FKE A;  2ZR4 A;  4MGV A;  2WK2 A;  3KAG A;  2AWG A;  2MLY A;  1FKS A;  4DRH A;  5JH8 A;  1NWU A;  4Q7N A;  4UDM A;  3FXY A;  2YBU A;  2DT3 A;  4DWS D;  4LGX A;  2XP7 A;  1E44 A;  3JYJ A;  4TW7 A;  2ZQT A;  4U86 A;  1OGB A;  4KR0 B;  1FKB A;  3NTP A;  1E15 A;  1WNO A;  4R0X A;  3O5E A;  4W5U A;  2XP9 A;  4DRK A;  3UF8 A;  5DIV A;  4IT4 A;  2RQS A;  4Z2I A;  1HXV A;  1ROT A;  1JVW A;  2WLY A;  1ZBV A;  3RME A;  3WD1 A;  4NSB A;  2JZV A;  3O5D A;  2AOS A;  1H0G A;  4Z2L A;  2ETN A;  3PR9 A;  1N1A A;  4WKF A;  4JFK A;  1BL4 A;  3EIP A;  4FAP A;  1ZL1 A;  2A3E A;  2MNT A;  2Y78 A;  1JNT A;  2RUC A;  4U84 A;  1NMV A;  1FKD A;  1X6N A;  3UI5 A;  3ARX A;  1W26 A;  2MF9 A;  3CHE A;  1ZBK A;  1D7H A;  3KAC A;  2XP4 A;  3WD2 A;  5HW6 A;  3W4R A;  4LAY A;  1W9P A;  1SR0 A;  4W9Q A;  3AS0 A;  3B9D A;  2XPA A;  1NWR A;  1XHG A;  1ZCN A;  4GGQ A;  3RFW A;  5HBF A;  1X6L A;  3CHD A;  5DIU A;  3BXW A;  3KAD A;  4DIP A;  4XAK A;  2DSU A;  3KAH A;  1HJX A;  2PBC A;  3RGC A;  3RM4 A;  1FFQ A;  3RM9 A; 
#chains in the Genus database with same CATH homology
 2DG3 A;  2F2D A;  3CGN A;  3O5L A;  4Z2G A;  2FDM A;  3ALG A;  3JXV A;  4MNJ A;  4IT6 A;  2F4E A;  1TCO C;  1YW5 A;  1T11 A;  2KE0 A;  3O5Q A;  1NH6 A;  1LG1 A;  1OWQ A;  4C02 B;  2D9F A;  2IUZ A;  3UI6 A;  1Q6H A;  5GPG A;  4ODR A;  4P8U A;  4WJX A;  3WH0 A;  3WL1 A;  1B6C A;  3WQV A;  4ZPV R;  1FKK A;  2DSW A;  4MNK A;  1F8A B;  2DPE A;  4ODO A;  1YAT A;  1LG2 A;  1KFW A;  4NZC A;  1J6Y A;  3ARO A;  3GPK A;  1FKG A;  3O5J A;  3WQW A;  4Z2K A;  3PRA A;  3WD4 A;  4AY1 A;  3WD0 A;  1WAW A;  4WKA A;  3H9R B;  2FAP A;  2Q5A A;  2RUR A;  3TC5 A;  5J6E A;  4ODL A;  2B31 A;  1TFV A;  4P8X A;  2VCD A;  2MLX A;  3PA7 A;  4DZ3 A;  4DWS C;  4KQZ A;  1NSG A;  1WB0 A;  5HW7 A;  4ZPT R;  1W1P A;  4G2P A;  1ZBC A;  3CGM A;  1HKM A;  4DRM A;  1F40 A;  3IKD A;  1D7J A;  4MAV A;  1HJW A;  1QZ2 A;  1EYM A;  4Q22 A;  4WIW A;  3ARY A;  3MDY B;  4HBO A;  4DZ2 A;  2DT2 A;  4DRI A;  5DO2 A;  1E6R A;  2LJ4 A;  3O5G A;  1M5Y A;  4L3N A;  2LPV A;  3EY6 A;  1W1V A;  2A3C A;  1D6O A;  1Q6U A;  5HWB A;  1E6Z A;  2YBT A;  1J4R A;  1EIB A;  4PTM A;  2QF8 A;  1NWT A;  3CHF A;  3VAW A;  1EHN A;  2PPP A;  1J4I A;  2WM0 A;  3LUO A;  3KCE A;  4MNL A;  1FD9 A;  2UZ5 A;  1OGG A;  2PV3 A;  3IHZ A;  1LQ0 A;  1JND A;  1ITX A;  2G41 A;  4QT2 A;  4DH0 A;  4TNS A;  1JNS A;  4TW8 A;  4DWS B;  3CZ8 A;  4DRJ A;  3KZ7 A;  3ARU A;  4DRP A;  1Q1C A;  4BF8 A;  2KO7 A;  4MSP A;  4WK9 A;  3IKG A;  4IQC A;  5DEZ A;  1FKR A;  2PPO A;  3UQI A;  3O5F A;  5HUA A;  1LJY A;  1HJV A;  1CTN A;  3AS3 A;  5DIT A;  1ZB5 A;  5GPR A;  1GPF A;  3UQA A;  3FAP A;  2PPN A;  4IPX A;  1ZU8 A;  2LKN A;  2DG9 A;  1A7X A;  5D75 A;  4DRQ A;  3ALF A;  4Z2H A;  2M1I A;  3G6L A;  4DT4 A;  1PIN A;  1ROU A;  2PI6 A;  3ARQ A;  3AS1 A;  4DRN A;  2MPH A;  2DT0 A;  4DRO A;  4O2T A;  2XP6 A;  3NI6 A;  2XP8 A;  3OA5 A;  3ODK A;  3TDB A;  3KAI A;  2KGJ A;  4IQ2 A;  1ZBW A;  3KAF A;  1BKF A;  4WKH A;  2LGO A;  2WLZ A;  1JNE A;  4J4N A;  2KFW A;  2XPB A;  1NMW A;  3WL0 A;  5HKG A;  2A3A A;  1C9H A;  2KI3 A;  2O9O A;  3ART A;  3B7X A;  1P5Q A;  5HW8 A;  4S3K A;  3O5O A;  1E6P A;  4JFM A;  3PRD A;  4QIB A;  1RD6 A;  5HT1 A;  3UI4 A;  4ITZ A;  4ODP A;  5B8I C;  1KT1 A;  1VF8 A;  2L2S A;  3CH9 A;  1EDQ A;  2A3B A;  3AS2 A;  4W9P A;  2DSV A;  5BXJ A;  1O6I A;  4LAV A;  2ZR6 A;  1NWS A;  5HTG A;  1LL7 A;  2RUD A;  2F21 A;  3IK8 A;  3JYM A;  1FKI A;  2IF4 A;  3CHC A;  2N87 A;  2DG4 A;  4TX0 A;  1FKT A;  1HKI A;  2G8Z A;  1UR9 A;  1FKL A;  1W1Y A;  1Q6I A;  3WD3 A;  1ZK6 A;  4JFI A;  1E6N A;  2ITK A;  4P8W A;  1D7I A;  3ARV A;  1W1T A;  4GIV A;  4HBE A;  3O5R A;  3O5M A;  1E9L A;  3AQU A;  1KT0 A;  1Y0O A;  1GOI A;  4ODN A;  4ZPW R;  1XRV A;  3I6C A;  1D2K A;  1FAP A;  2PV2 A;  5I98 A;  4MNM A;  3RM8 A;  4U85 A;  4QT3 A;  4ML4 A;  1FKJ A;  4J4O A;  3NRK A;  1J4H A;  1H0I A;  1R9H A;  4L72 B;  2O92 A;  1FKH A;  5DF0 A;  2ZQV A;  2DT1 A;  4TYO A;  1FJD A;  1QPL A;  1K9T A;  2PV1 A;  1W9U A;  2DSZ A;  5HWC A;  1UR8 A;  4S3J A;  4N19 A;  3O5P A;  4NNR A;  3B8S A;  1LL6 A;  3ARZ A;  4W9O A;  3QOK A;  1PBK A;  3ARS A;  2XP5 A;  1LL4 A;  4MPK A;  1GUV A;  3O5I A;  2RUQ A;  4JFL A;  4Z2J A;  4R5E A;  2OFN A;  1HKJ A;  4JFJ A;  2RSE A;  1L1P A;  3ARR A;  3G6M A;  2ZQU A;  3UQB A;  3TCZ A;  2ESC A;  4LAX A;  1EQ3 A;  1HKK A;  3ARP A;  2ZQS A;  4URI A;  2M08 A;  1U79 A;  4ODK A;  1W9V A;  1FKF A;  2VN1 A;  2KR7 A;  4LAW A;  4FN2 A;  3FY1 A;  3WIJ A;  1SYT A;  2ZR5 A;  4ODQ A;  3PRB A;  4G50 A;  3ARW A;  3B9A A;  2XP3 A;  4MTV A;  4ODM A;  3WKZ A;  4ZS6 A;  4HAR A;  2K8I A;  2M2A A;  4QZV B;  3B9E A;  4JYS A;  3O5K A;  5GQB A;  3OOB A;  1FFR A;  4P8V A;  1IX5 A;  2MLZ A;  4DWS A;  2OLH A;  3KAB A;  1QPF A;  4TW6 A;  2FKE A;  2ZR4 A;  4MGV A;  2WK2 A;  3KAG A;  2AWG A;  2MLY A;  1FKS A;  4DRH A;  5JH8 A;  1NWU A;  4Q7N A;  3FXY A;  2YBU A;  2DT3 A;  4DWS D;  4LGX A;  2XP7 A;  3JYJ A;  4TW7 A;  2ZQT A;  4U86 A;  1OGB A;  4KR0 B;  1FKB A;  3NTP A;  1E15 A;  1WNO A;  4R0X A;  3O5E A;  4W5U A;  2XP9 A;  4DRK A;  3UF8 A;  5DIV A;  4IT4 A;  2RQS A;  4Z2I A;  1HXV A;  1ROT A;  1JVW A;  2WLY A;  1ZBV A;  3RME A;  3WD1 A;  4NSB A;  2JZV A;  3O5D A;  2AOS A;  1H0G A;  4Z2L A;  3PR9 A;  1N1A A;  4WKF A;  4JFK A;  1BL4 A;  4FAP A;  1ZL1 A;  2A3E A;  2MNT A;  2Y78 A;  1JNT A;  2RUC A;  4U84 A;  1NMV A;  1FKD A;  1X6N A;  3UI5 A;  3ARX A;  1W26 A;  2MF9 A;  3CHE A;  1ZBK A;  1D7H A;  3KAC A;  2XP4 A;  3WD2 A;  5HW6 A;  3W4R A;  4LAY A;  1W9P A;  1SR0 A;  4W9Q A;  3AS0 A;  3B9D A;  2XPA A;  1NWR A;  1XHG A;  1ZCN A;  4GGQ A;  3RFW A;  5HBF A;  1X6L A;  3CHD A;  5DIU A;  3BXW A;  3KAD A;  4DIP A;  4XAK A;  2DSU A;  3KAH A;  1HJX A;  2PBC A;  3RGC A;  3RM4 A;  1FFQ A;  3RM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...