2F4EA

N-terminal domain of fkbp42 from arabidopsis thaliana
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
GNVPPKVDSEAEVLDEKVSKQIIKEGHGSKPSKYSTCFLHYRAWTKNSQHKFEDTWHEQQPIELVLGKEKKELAGLAIGVASMKSGERALVHVGWELAYGKEGNFSFPNVPPMADLLYEVEVIGFDETKEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a plant immunophilin domain involved in regulation of MDR-type ABC transporters.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
molecule keywords AtFKBP42
total genus 30
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2f4eA00
3VAWA 1P5QA 1ZCNA 4ODQA 4JFMA 5HWCA 1FAPA 1W26A 3PRDA 2OFNA 4DT4A 4DRJA 4DRPA 1PINA 4JFIA 1M5YA 3IKGA 4QIBA 4R0XA 1FKKA 3IK8A 1YW5A 2D9FA 4J4OA 1U79A 4LAYA 2RUDA 3RGCA 4TW7A 2L2SA 2VN1A 3O5LA 3JXVA 1J4IA 2XP4A 4G2PA 2M1IA 2XP6A 1J4RA 3O5GA 4ODKA 2ZR5A 4IQCA 4DRIA 5DIUA 3KAFA 4ODNA 1FJDA 3FAPA 5B8IC 3PA7A 5HT1A 4MSPA 3O5IA 2DG4A 3TDBA 4TNSA 4JFLA 2PV3A 3KADA 3PRBA 4TW6A 4W9OA 3UQAA 3KCEA 4GIVA 5HUAA 1ROUA 1JVWA 1NSGA 1FKLA 2DG9A 2LJ4A 5D75A 2F2DA 5HKGA 2XP5A 5HW6A 4N19A 4G50A 4DZ2A 4JFJA 1BL4A 4W9QA 1TCOC 2XPBA 1NMVA 4IPXA 3KZ7A 3UI4A 5HW8A 1FKSA 1T11A 5HTGA 3NTPA 2XP7A 2RUCA 3LUOA 1FKRA 1HXVA 5BXJA 3CGNA 1QPFA 2MPHA 2RQSA 3B7XA 2ITKA 4MGVA 1FD9A 1Y0OA 2ZQTA 2PV1A 2RUQA 2KGJA 3NRKA 4JFKA 4LAXA 4DRNA 4QT3A 2XP3A 3RFWA 1FKFA 4FAPA 1FKBA 1FKDA 1QPLA 2KO7A 4O2TA 4ODMA 5DITA 1JNTA 2KR7A 1Q6IA 2JZVA 3TCZA 3UI6A 3O5EA 2XP9A 4DIPA 5J6EA 3O5JA 1NMWA 4BF8A 1J4HA 3H9RB 2PPOA 2XP8A 1FKHA 3IKDA 4DZ3A 3GPKA 4DH0A 1F40A 2PPNA 2LGOA 1Q6HA 1Q6UA 4GGQA 5HW7A 4C02B 2MLZA 2UZ5A 3EY6A 3UQIA 4W9PA 2ZR6A 1C9HA 1A7XA 3UI5A 2DG3A 1BKFA 4FN2A 1FKJA 1L1PA 3ODKA 3WH0A 3O5FA 3IHZA 4U85A 1FKGA 1ROTA 1FKTA 2KE0A 4LAWA 2ZR4A 2PV2A 1JNSA 4DROA 1ZK6A 4LAVA 1B6CA 4U84A 4ODPA 2KI3A 3KACA 1N1AA 1KT1A 3KAHA 2FAPA 5HWBA 3KABA 2N87A 2M08A 2MLYA 1QZ2A 2F4EA 5GPGA 4ODRA 1D7HA 4NNRA 2Y78A 2VCDA 3O5OA 5DIVA 1KT0A 1YATA 1D7JA 2K8IA 2PBCA 4U86A 3TC5A 3O5KA 4DRHA 2KFWA 1PBKA 2ZQSA 2F21A 2MF9A 3O5MA 4J4NA 4DRKA 4JYSA 3I6CA 3NI6A 2FKEA 3MDYB 1EYMA 2MNTA 2Q5AA 2RSEA 4TYOA 2ZQVA 2IF4A 2M2AA 2RURA 4TX0A 1R9HA 3JYJA 1D6OA 4ODLA 2PPPA 3KAGA 4ODOA 4ITZA 1Q1CA 2LPVA 4IQ2A 4TW8A 3UF8A 2AWGA 2MLXA 3O5RA 3OOBA 3O5DA 2XPAA 2LKNA 1D7IA 3JYMA 4QT2A 4DRMA 4DRQA 3KAIA 1FKIA 3O5QA 3CGMA 1EQ3A 1F8AB 2ZQUA 5I98A 3UQBA 1J6YA 3O5PA
chains in the Genus database with same CATH superfamily
3VAWA 1EDQA 1P5QA 4MNKA 1SR0A 1H0GA 3CH9A 3FY1A 1ZBWA 4Z2LA 1ZL1A 4JFIA 1YW5A 1H0IA 1U79A 2RUDA 4LAYA 2VN1A 3O5LA 3ALGA 5JH8A 1J4IA 2XP6A 3O5GA 2ZR5A 1HJVA 5DIUA 3FAPA 1LG2A 1K9TA 1WNOA 4JFLA 4UDMA 2DT1A 3AS3A 3KCEA 3RMEA 1LG1A 5HUAA 4Q22A 5HKGA 1EIBA 2XP5A 4LGXA 4N19A 4DZ2A 4AY1A 1TCOC 1NMVA 2YBUA 3KZ7A 3UI4A 3BMBA 2DSVA 4P8XA 1QPFA 2RQSA 4MGVA 1FD9A 4DRNA 3ALFA 3WQVA 5DEZA 2XP3A 4O2TA 4HARA 2KR7A 1FFRA 3UI6A 4DIPA 1XRVA 2XP9A 3O5EA 3O5JA 1NMWA 3H9RB 1E6ZA 4DH0A 3WD4A 2LGOA 4PTMA 1GUVA 4ZPWR 2MLZA 3EY6A 4MTVA 3UQIA 1OGGA 1L1PA 4FN2A 1FKJA 3WIJA 2DT3A 3O5FA 1HKIA 4LAWA 2ZR4A 1UR9A 1ZK6A 4DWSB 2WLYA 1W9UA 1B6CA 1JNDA 1KT1A 2WLZA 2FAPA 2B31A 1QZ2A 1D7HA 5DIVA 1YATA 3TC5A 2K8IA 3CZ8A 4DRHA 3O5KA 2KFWA 1E9LA 4HBOA 3AQUA 3CHCA 4MAVA 2RSEA 1E44A 1Q1CA 2LPVA 4IQ2A 3ARPA 4W5UA 1NH6A 5HBFA 4DRMA 3KAIA 4Z2HA 3WKZA 1EQ3A 2DT0A 5I98A 3O5PA 3WD3A 3B9DA 1HKJA 4JFMA 5HWCA 1FAPA 1W26A 3GU0A 1W9VA 1M5YA 3IKGA 1FKKA 1UR8A 2D9FA 3IK8A 3RGCA 4TW7A 2XP4A 4G2PA 1GPFA 2M1IA 1J4RA 2ESCA 5GQBA 1WB0A 5B8IC 3O5IA 4ZS6A 3TDBA 4TNSA 4DWSA 4DWSD 4W9OA 1ROUA 1JVWA 1NSGA 1JCHB 1ITXA 5DO2A 4W9QA 2DPEA 1T11A 5HTGA 2EULA 1D2KA 5BXJA 3FXYA 1JNEA 3WD1A 4Z2KA 2ZQTA 2PV1A 2RUQA 4JFKA 4LAXA 4QT3A 3RFWA 1FKFA 1FKBA 1FKDA 1Q6IA 2DT2A 2JZVA 1VF8A 3TCZA 5J6EA 1NWUA 1J4HA 3ARSA 1FKHA 2A3EA 4DZ3A 4DWSC 5HW7A 2P4VA 4Z2IA 2UZ5A 2ZR6A 1BKFA 4WIWA 2A3AA 2FDMA 3ODKA 2AOSA 1E6PA 3GTYX 1LJYA 4KR0B 3W4RA 1JNSA 3ARTA 3PR9A 4LAVA 1W1YA 2KI3A 1NWSA 1RD6A 2A3BA 2M08A 5GPGA 1TFVA 4U86A 2PBCA 3WL1A 4ML4A 4URIA 2MF9A 1HJXA 4J4NA 4WKFA 2FKEA 1EYMA 2M2AA 3G6MA 4S3JA 4MNMA 1D6OA 4ODLA 2WK2A 2DSUA 3UF8A 3O5RA 2XPAA 3AS1A 1D7IA 3JYMA 2YBTA 4Z2GA 1FKIA 3CGMA 4P8UA 2ZQUA 1J6YA 1IX5A 3RM8A 2B5UB 1ZCNA 4NZCA 1SYTA 4ODQA 2O9OA 4WKAA 2F23A 4DRJA 4DRPA 5HW8A 3WD2A 4R0XA 3OA5A 4J4OA 2O92A 2L2SA 4WK9A 4DRIA 4IQCA 3CHDA 4MSPA 2DG4A 2PV3A 3PRBA 2PN0A 3UQAA 4KQZA 3B9EA 5HW6A 5D75A 2LJ4A 2F2DA 4G50A 4JFJA 1BL4A 4P8VA 1LQ0A 4IT6A 3NTPA 2XP7A 2RUCA 3LUOA 1FKRA 4MPKA 3AS2A 3CGNA 2MPHA 3B7XA 3NRKA 4IT4A 2KGJA 4S3KA 4FAPA 3CHEA 1NWRA 2PPOA 2XP8A 3IKDA 1HKKA 2PPNA 3ARVA 4L72B 1Q6UA 4GGQA 1HKMA 1WAWA 3AS0A 1W1VA 1OGBA 3UI5A 2DG3A 4U85A 1FKTA 2KE0A 4ZPVR 1XHGA 3KAHA 4Z2JA 5HWBA 2N87A 2F4EA 4ODRA 4QZVB 2VCDA 1KT0A 1D7JA 1W1PA 2PI6A 4WKHA 1OWQA 1ZBCA 1PBKA 3O5MA 4DRKA 4P8WA 3EIPA 3WD0A 3I6CA 2G8ZA 3MDYB 3NI6A 2Q5AA 4TYOA 2ZQVA 2IF4A 4TX0A 3JYJA 1FFQA 2PPPA 4ODOA 4TW8A 1LL6A 2MLXA 1W9PA 5DF0A 3OOBA 1ZB5A 4DRQA 2LKNA 4QT2A 3ARWA 1X6LA 1W1TA 4ZPTR 3B8SA 3PRDA 2OFNA 3ARYA 4DT4A 1PINA 4QIBA 3BXWA 3JXVA 3G6LA 4ODKA 1X6NA 4MNJA 1E6RA 3KAFA 4ODNA 1E6NA 1FJDA 2IUZA 1HJWA 3PA7A 5HT1A 3RM9A 2A3CA 2QF8A 3KADA 4TW6A 2DSWA 4GIVA 2DG9A 1FKLA 2DSZA 2XPBA 4IPXA 1FKSA 3AROA 1HXVA 4Q7NA 2ITKA 1Y0OA 1EHNA 4ODMA 1QPLA 2KO7A 5DITA 1JNTA 2ETNA 1NWTA 3ARRA 4BF8A 1ZU8A 4L3NA 3GPKA 1F40A 3WL0A 1Q6HA 1O6IA 4C02B 3WQWA 4W9PA 3CHFA 1C9HA 3PRAA 1A7XA 5GPRA 3WH0A 3IHZA 1FKGA 1ROTA 4XAKA 2PV2A 4DROA 3ARXA 4U84A 4ODPA 3KACA 1N1AA 2WM0A 3KABA 2MLYA 3QOKA 4R5EA 4NSBA 4NNRA 2Y78A 3O5OA 3RM4A 4WJXA 2ZQSA 1LL7A 2F21A 1KFWA 3ARQA 1GOIA 4JYSA 1E15A 4HBEA 2MNTA 1ZBVA 2RURA 1R9HA 1GRJA 3ARUA 1ZBKA 3KAGA 4ITZA 2AWGA 2G41A 2OLHA 1LL4A 3ARZA 3O5DA 1CTNA 3O5QA 4MNLA 1F8AB 3UQBA 3B9AA
chains in the Genus database with same CATH topology
3VAWA 1EDQA 1P5QA 4MNKA 1SR0A 1H0GA 3CH9A 3FY1A 1ZBWA 4Z2LA 1ZL1A 4JFIA 1YW5A 1H0IA 1U79A 2RUDA 4LAYA 2VN1A 3O5LA 3ALGA 5JH8A 1J4IA 2XP6A 3O5GA 2ZR5A 1HJVA 5DIUA 3FAPA 1LG2A 1K9TA 1WNOA 4JFLA 2DT1A 3AS3A 3KCEA 3RMEA 1LG1A 5HUAA 4Q22A 5HKGA 1EIBA 2XP5A 4LGXA 4N19A 4DZ2A 4AY1A 1TCOC 1NMVA 2YBUA 3KZ7A 3UI4A 2DSVA 4P8XA 1QPFA 2RQSA 4MGVA 1FD9A 4DRNA 3ALFA 3WQVA 5DEZA 2XP3A 4O2TA 4HARA 2KR7A 1FFRA 3UI6A 4DIPA 1XRVA 2XP9A 3O5EA 3O5JA 1NMWA 3H9RB 1E6ZA 4DH0A 3WD4A 2LGOA 4PTMA 1GUVA 4ZPWR 2MLZA 3EY6A 4MTVA 3UQIA 1OGGA 1L1PA 4FN2A 1FKJA 3WIJA 2DT3A 3O5FA 1HKIA 4LAWA 2ZR4A 1UR9A 1ZK6A 4DWSB 2WLYA 1W9UA 1B6CA 1JNDA 1KT1A 2WLZA 2FAPA 2B31A 1QZ2A 1D7HA 5DIVA 1YATA 3TC5A 2K8IA 3CZ8A 4DRHA 3O5KA 2KFWA 1E9LA 4HBOA 3AQUA 3CHCA 4MAVA 2RSEA 1Q1CA 2LPVA 4IQ2A 3ARPA 4W5UA 1NH6A 5HBFA 4DRMA 3KAIA 4Z2HA 3WKZA 1EQ3A 2DT0A 5I98A 3O5PA 3WD3A 3B9DA 1HKJA 4JFMA 5HWCA 1FAPA 1W26A 1W9VA 1M5YA 3IKGA 1FKKA 1UR8A 2D9FA 3IK8A 3RGCA 4TW7A 2XP4A 4G2PA 1GPFA 2M1IA 1J4RA 2ESCA 5GQBA 1WB0A 5B8IC 3O5IA 4ZS6A 3TDBA 4TNSA 4DWSA 4DWSD 4W9OA 1ROUA 1JVWA 1NSGA 1ITXA 5DO2A 4W9QA 2DPEA 1T11A 5HTGA 1D2KA 5BXJA 3FXYA 1JNEA 3WD1A 4Z2KA 2ZQTA 2PV1A 2RUQA 4JFKA 4LAXA 4QT3A 3RFWA 1FKFA 1FKBA 1FKDA 1Q6IA 2DT2A 2JZVA 1VF8A 3TCZA 5J6EA 1NWUA 1J4HA 3ARSA 1FKHA 2A3EA 4DZ3A 4DWSC 5HW7A 4Z2IA 2UZ5A 2ZR6A 1BKFA 4WIWA 2A3AA 2FDMA 3ODKA 2AOSA 1E6PA 1LJYA 4KR0B 3W4RA 1JNSA 3ARTA 3PR9A 4LAVA 1W1YA 2KI3A 1NWSA 1RD6A 2A3BA 2M08A 5GPGA 1TFVA 4U86A 2PBCA 3WL1A 4ML4A 4URIA 2MF9A 1HJXA 4J4NA 4WKFA 2FKEA 1EYMA 2M2AA 3G6MA 4S3JA 4MNMA 1D6OA 4ODLA 2WK2A 2DSUA 3UF8A 3O5RA 2XPAA 3AS1A 1D7IA 3JYMA 2YBTA 4Z2GA 1FKIA 3CGMA 4P8UA 2ZQUA 1J6YA 1IX5A 3RM8A 1ZCNA 4NZCA 1SYTA 4ODQA 2O9OA 4WKAA 4DRJA 4DRPA 5HW8A 3WD2A 4R0XA 3OA5A 4J4OA 2O92A 2L2SA 4WK9A 4DRIA 4IQCA 3CHDA 4MSPA 2DG4A 2PV3A 3PRBA 3UQAA 4KQZA 3B9EA 5HW6A 5D75A 2LJ4A 2F2DA 4G50A 4JFJA 1BL4A 4P8VA 1LQ0A 4IT6A 3NTPA 2XP7A 2RUCA 3LUOA 1FKRA 4MPKA 3AS2A 3CGNA 2MPHA 3B7XA 3NRKA 4IT4A 2KGJA 4S3KA 4FAPA 3CHEA 1NWRA 2PPOA 2XP8A 3IKDA 1HKKA 2PPNA 3ARVA 4L72B 1Q6UA 4GGQA 1HKMA 1WAWA 3AS0A 1W1VA 1OGBA 3UI5A 2DG3A 4U85A 1FKTA 2KE0A 4ZPVR 1XHGA 3KAHA 4Z2JA 5HWBA 2N87A 2F4EA 4ODRA 4QZVB 2VCDA 1KT0A 1D7JA 1W1PA 2PI6A 4WKHA 1OWQA 1ZBCA 1PBKA 3O5MA 4DRKA 4P8WA 3WD0A 3I6CA 2G8ZA 3MDYB 3NI6A 2Q5AA 4TYOA 2ZQVA 2IF4A 4TX0A 3JYJA 1FFQA 2PPPA 4ODOA 4TW8A 1LL6A 2MLXA 1W9PA 5DF0A 3OOBA 1ZB5A 4DRQA 2LKNA 4QT2A 3ARWA 1X6LA 1W1TA 4ZPTR 3B8SA 3PRDA 2OFNA 3ARYA 4DT4A 1PINA 4QIBA 3BXWA 3JXVA 3G6LA 4ODKA 1X6NA 4MNJA 1E6RA 3KAFA 4ODNA 1E6NA 1FJDA 2IUZA 1HJWA 3PA7A 5HT1A 3RM9A 2A3CA 2QF8A 3KADA 4TW6A 2DSWA 4GIVA 2DG9A 1FKLA 2DSZA 2XPBA 4IPXA 1FKSA 3AROA 1HXVA 4Q7NA 2ITKA 1Y0OA 1EHNA 4ODMA 1QPLA 2KO7A 5DITA 1JNTA 1NWTA 3ARRA 4BF8A 1ZU8A 4L3NA 3GPKA 1F40A 3WL0A 1Q6HA 1O6IA 4C02B 3WQWA 4W9PA 3CHFA 1C9HA 3PRAA 1A7XA 5GPRA 3WH0A 3IHZA 1FKGA 1ROTA 4XAKA 2PV2A 4DROA 3ARXA 4U84A 4ODPA 3KACA 1N1AA 2WM0A 3KABA 2MLYA 3QOKA 4R5EA 4NSBA 4NNRA 2Y78A 3O5OA 3RM4A 4WJXA 2ZQSA 1LL7A 2F21A 1KFWA 3ARQA 1GOIA 4JYSA 1E15A 4HBEA 2MNTA 1ZBVA 2RURA 1R9HA 3ARUA 1ZBKA 3KAGA 4ITZA 2AWGA 2G41A 2OLHA 1LL4A 3ARZA 3O5DA 1CTNA 3O5QA 4MNLA 1F8AB 3UQBA 3B9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VAW A;  1P5Q A;  1ZCN A;  4ODQ A;  4JFM A;  5HWC A;  1FAP A;  1W26 A;  3PRD A;  2OFN A;  4DT4 A;  4DRJ A;  4DRP A;  1PIN A;  4JFI A;  1M5Y A;  3IKG A;  4QIB A;  4R0X A;  1FKK A;  3IK8 A;  1YW5 A;  2D9F A;  4J4O A;  1U79 A;  4LAY A;  2RUD A;  3RGC A;  4TW7 A;  2L2S A;  2VN1 A;  3O5L A;  3JXV A;  1J4I A;  2XP4 A;  4G2P A;  2M1I A;  2XP6 A;  1J4R A;  3O5G A;  4ODK A;  2ZR5 A;  4IQC A;  4DRI A;  5DIU A;  3KAF A;  4ODN A;  1FJD A;  3FAP A;  5B8I C;  3PA7 A;  5HT1 A;  4MSP A;  3O5I A;  2DG4 A;  3TDB A;  4TNS A;  4JFL A;  2PV3 A;  3KAD A;  3PRB A;  4TW6 A;  4W9O A;  3UQA A;  3KCE A;  4GIV A;  5HUA A;  1ROU A;  1JVW A;  1NSG A;  1FKL A;  2DG9 A;  2LJ4 A;  5D75 A;  2F2D A;  5HKG A;  2XP5 A;  5HW6 A;  4N19 A;  4G50 A;  4DZ2 A;  4JFJ A;  1BL4 A;  4W9Q A;  1TCO C;  2XPB A;  1NMV A;  4IPX A;  3KZ7 A;  3UI4 A;  5HW8 A;  1FKS A;  1T11 A;  5HTG A;  3NTP A;  2XP7 A;  2RUC A;  3LUO A;  1FKR A;  1HXV A;  5BXJ A;  3CGN A;  1QPF A;  2MPH A;  2RQS A;  3B7X A;  2ITK A;  4MGV A;  1FD9 A;  1Y0O A;  2ZQT A;  2PV1 A;  2RUQ A;  2KGJ A;  3NRK A;  4JFK A;  4LAX A;  4DRN A;  4QT3 A;  2XP3 A;  3RFW A;  1FKF A;  4FAP A;  1FKB A;  1FKD A;  1QPL A;  2KO7 A;  4O2T A;  4ODM A;  5DIT A;  1JNT A;  2KR7 A;  1Q6I A;  2JZV A;  3TCZ A;  3UI6 A;  3O5E A;  2XP9 A;  4DIP A;  5J6E A;  3O5J A;  1NMW A;  4BF8 A;  1J4H A;  3H9R B;  2PPO A;  2XP8 A;  1FKH A;  3IKD A;  4DZ3 A;  3GPK A;  4DH0 A;  1F40 A;  2PPN A;  2LGO A;  1Q6H A;  1Q6U A;  4GGQ A;  5HW7 A;  4C02 B;  2MLZ A;  2UZ5 A;  3EY6 A;  3UQI A;  4W9P A;  2ZR6 A;  1C9H A;  1A7X A;  3UI5 A;  2DG3 A;  1BKF A;  4FN2 A;  1FKJ A;  1L1P A;  3ODK A;  3WH0 A;  3O5F A;  3IHZ A;  4U85 A;  1FKG A;  1ROT A;  1FKT A;  2KE0 A;  4LAW A;  2ZR4 A;  2PV2 A;  1JNS A;  4DRO A;  1ZK6 A;  4LAV A;  1B6C A;  4U84 A;  4ODP A;  2KI3 A;  3KAC A;  1N1A A;  1KT1 A;  3KAH A;  2FAP A;  5HWB A;  3KAB A;  2N87 A;  2M08 A;  2MLY A;  1QZ2 A;  2F4E A;  5GPG A;  4ODR A;  1D7H A;  4NNR A;  2Y78 A;  2VCD A;  3O5O A;  5DIV A;  1KT0 A;  1YAT A;  1D7J A;  2K8I A;  2PBC A;  4U86 A;  3TC5 A;  3O5K A;  4DRH A;  2KFW A;  1PBK A;  2ZQS A;  2F21 A;  2MF9 A;  3O5M A;  4J4N A;  4DRK A;  4JYS A;  3I6C A;  3NI6 A;  2FKE A;  3MDY B;  1EYM A;  2MNT A;  2Q5A A;  2RSE A;  4TYO A;  2ZQV A;  2IF4 A;  2M2A A;  2RUR A;  4TX0 A;  1R9H A;  3JYJ A;  1D6O A;  4ODL A;  2PPP A;  3KAG A;  4ODO A;  4ITZ A;  1Q1C A;  2LPV A;  4IQ2 A;  4TW8 A;  3UF8 A;  2AWG A;  2MLX A;  3O5R A;  3OOB A;  3O5D A;  2XPA A;  2LKN A;  1D7I A;  3JYM A;  4QT2 A;  4DRM A;  4DRQ A;  3KAI A;  1FKI A;  3O5Q A;  3CGM A;  1EQ3 A;  1F8A B;  2ZQU A;  5I98 A;  3UQB A;  1J6Y A;  3O5P A; 
#chains in the Genus database with same CATH topology
 3VAW A;  1EDQ A;  1P5Q A;  4MNK A;  1SR0 A;  1H0G A;  3CH9 A;  3FY1 A;  1ZBW A;  4Z2L A;  1ZL1 A;  4JFI A;  1YW5 A;  1H0I A;  1U79 A;  2RUD A;  4LAY A;  2VN1 A;  3O5L A;  3ALG A;  5JH8 A;  1J4I A;  2XP6 A;  3O5G A;  2ZR5 A;  1HJV A;  5DIU A;  3FAP A;  1LG2 A;  1K9T A;  1WNO A;  4JFL A;  4UDM A;  2DT1 A;  3AS3 A;  3KCE A;  3RME A;  1LG1 A;  5HUA A;  4Q22 A;  5HKG A;  1EIB A;  2XP5 A;  4LGX A;  4N19 A;  4DZ2 A;  4AY1 A;  1TCO C;  1NMV A;  2YBU A;  3KZ7 A;  3UI4 A;  3BMB A;  2DSV A;  4P8X A;  1QPF A;  2RQS A;  4MGV A;  1FD9 A;  4DRN A;  3ALF A;  3WQV A;  5DEZ A;  2XP3 A;  4O2T A;  4HAR A;  2KR7 A;  1FFR A;  3UI6 A;  4DIP A;  1XRV A;  2XP9 A;  3O5E A;  3O5J A;  1NMW A;  3H9R B;  1E6Z A;  4DH0 A;  3WD4 A;  2LGO A;  4PTM A;  1GUV A;  4ZPW R;  2MLZ A;  3EY6 A;  4MTV A;  3UQI A;  1OGG A;  1L1P A;  4FN2 A;  1FKJ A;  3WIJ A;  2DT3 A;  3O5F A;  1HKI A;  4LAW A;  2ZR4 A;  1UR9 A;  1ZK6 A;  4DWS B;  2WLY A;  1W9U A;  1B6C A;  1JND A;  1KT1 A;  2WLZ A;  2FAP A;  2B31 A;  1QZ2 A;  1D7H A;  5DIV A;  1YAT A;  3TC5 A;  2K8I A;  3CZ8 A;  4DRH A;  3O5K A;  2KFW A;  1E9L A;  4HBO A;  3AQU A;  3CHC A;  4MAV A;  2RSE A;  1E44 A;  1Q1C A;  2LPV A;  4IQ2 A;  3ARP A;  4W5U A;  1NH6 A;  5HBF A;  4DRM A;  3KAI A;  4Z2H A;  3WKZ A;  1EQ3 A;  2DT0 A;  5I98 A;  3O5P A;  3WD3 A;  3B9D A;  1HKJ A;  4JFM A;  5HWC A;  1FAP A;  1W26 A;  3GU0 A;  1W9V A;  1M5Y A;  3IKG A;  1FKK A;  1UR8 A;  2D9F A;  3IK8 A;  3RGC A;  4TW7 A;  2XP4 A;  4G2P A;  1GPF A;  2M1I A;  1J4R A;  2ESC A;  5GQB A;  1WB0 A;  5B8I C;  3O5I A;  4ZS6 A;  3TDB A;  4TNS A;  4DWS A;  4DWS D;  4W9O A;  1ROU A;  1JVW A;  1NSG A;  1JCH B;  1ITX A;  5DO2 A;  4W9Q A;  2DPE A;  1T11 A;  5HTG A;  2EUL A;  1D2K A;  5BXJ A;  3FXY A;  1JNE A;  3WD1 A;  4Z2K A;  2ZQT A;  2PV1 A;  2RUQ A;  4JFK A;  4LAX A;  4QT3 A;  3RFW A;  1FKF A;  1FKB A;  1FKD A;  1Q6I A;  2DT2 A;  2JZV A;  1VF8 A;  3TCZ A;  5J6E A;  1NWU A;  1J4H A;  3ARS A;  1FKH A;  2A3E A;  4DZ3 A;  4DWS C;  5HW7 A;  2P4V A;  4Z2I A;  2UZ5 A;  2ZR6 A;  1BKF A;  4WIW A;  2A3A A;  2FDM A;  3ODK A;  2AOS A;  1E6P A;  3GTY X;  1LJY A;  4KR0 B;  3W4R A;  1JNS A;  3ART A;  3PR9 A;  4LAV A;  1W1Y A;  2KI3 A;  1NWS A;  1RD6 A;  2A3B A;  2M08 A;  5GPG A;  1TFV A;  4U86 A;  2PBC A;  3WL1 A;  4ML4 A;  4URI A;  2MF9 A;  1HJX A;  4J4N A;  4WKF A;  2FKE A;  1EYM A;  2M2A A;  3G6M A;  4S3J A;  4MNM A;  1D6O A;  4ODL A;  2WK2 A;  2DSU A;  3UF8 A;  3O5R A;  2XPA A;  3AS1 A;  1D7I A;  3JYM A;  2YBT A;  4Z2G A;  1FKI A;  3CGM A;  4P8U A;  2ZQU A;  1J6Y A;  1IX5 A;  3RM8 A;  2B5U B;  1ZCN A;  4NZC A;  1SYT A;  4ODQ A;  2O9O A;  4WKA A;  2F23 A;  4DRJ A;  4DRP A;  5HW8 A;  3WD2 A;  4R0X A;  3OA5 A;  4J4O A;  2O92 A;  2L2S A;  4WK9 A;  4DRI A;  4IQC A;  3CHD A;  4MSP A;  2DG4 A;  2PV3 A;  3PRB A;  2PN0 A;  3UQA A;  4KQZ A;  3B9E A;  5HW6 A;  5D75 A;  2LJ4 A;  2F2D A;  4G50 A;  4JFJ A;  1BL4 A;  4P8V A;  1LQ0 A;  4IT6 A;  3NTP A;  2XP7 A;  2RUC A;  3LUO A;  1FKR A;  4MPK A;  3AS2 A;  3CGN A;  2MPH A;  3B7X A;  3NRK A;  4IT4 A;  2KGJ A;  4S3K A;  4FAP A;  3CHE A;  1NWR A;  2PPO A;  2XP8 A;  3IKD A;  1HKK A;  2PPN A;  3ARV A;  4L72 B;  1Q6U A;  4GGQ A;  1HKM A;  1WAW A;  3AS0 A;  1W1V A;  1OGB A;  3UI5 A;  2DG3 A;  4U85 A;  1FKT A;  2KE0 A;  4ZPV R;  1XHG A;  3KAH A;  4Z2J A;  5HWB A;  2N87 A;  2F4E A;  4ODR A;  4QZV B;  2VCD A;  1KT0 A;  1D7J A;  1W1P A;  2PI6 A;  4WKH A;  1OWQ A;  1ZBC A;  1PBK A;  3O5M A;  4DRK A;  4P8W A;  3EIP A;  3WD0 A;  3I6C A;  2G8Z A;  3MDY B;  3NI6 A;  2Q5A A;  4TYO A;  2ZQV A;  2IF4 A;  4TX0 A;  3JYJ A;  1FFQ A;  2PPP A;  4ODO A;  4TW8 A;  1LL6 A;  2MLX A;  1W9P A;  5DF0 A;  3OOB A;  1ZB5 A;  4DRQ A;  2LKN A;  4QT2 A;  3ARW A;  1X6L A;  1W1T A;  4ZPT R;  3B8S A;  3PRD A;  2OFN A;  3ARY A;  4DT4 A;  1PIN A;  4QIB A;  3BXW A;  3JXV A;  3G6L A;  4ODK A;  1X6N A;  4MNJ A;  1E6R A;  3KAF A;  4ODN A;  1E6N A;  1FJD A;  2IUZ A;  1HJW A;  3PA7 A;  5HT1 A;  3RM9 A;  2A3C A;  2QF8 A;  3KAD A;  4TW6 A;  2DSW A;  4GIV A;  2DG9 A;  1FKL A;  2DSZ A;  2XPB A;  4IPX A;  1FKS A;  3ARO A;  1HXV A;  4Q7N A;  2ITK A;  1Y0O A;  1EHN A;  4ODM A;  1QPL A;  2KO7 A;  5DIT A;  1JNT A;  2ETN A;  1NWT A;  3ARR A;  4BF8 A;  1ZU8 A;  4L3N A;  3GPK A;  1F40 A;  3WL0 A;  1Q6H A;  1O6I A;  4C02 B;  3WQW A;  4W9P A;  3CHF A;  1C9H A;  3PRA A;  1A7X A;  5GPR A;  3WH0 A;  3IHZ A;  1FKG A;  1ROT A;  4XAK A;  2PV2 A;  4DRO A;  3ARX A;  4U84 A;  4ODP A;  3KAC A;  1N1A A;  2WM0 A;  3KAB A;  2MLY A;  3QOK A;  4R5E A;  4NSB A;  4NNR A;  2Y78 A;  3O5O A;  3RM4 A;  4WJX A;  2ZQS A;  1LL7 A;  2F21 A;  1KFW A;  3ARQ A;  1GOI A;  4JYS A;  1E15 A;  4HBE A;  2MNT A;  1ZBV A;  2RUR A;  1R9H A;  1GRJ A;  3ARU A;  1ZBK A;  3KAG A;  4ITZ A;  2AWG A;  2G41 A;  2OLH A;  1LL4 A;  3ARZ A;  3O5D A;  1CTN A;  3O5Q A;  4MNL A;  1F8A B;  3UQB A;  3B9A A; 
#chains in the Genus database with same CATH homology
 3VAW A;  1EDQ A;  1P5Q A;  4MNK A;  1SR0 A;  1H0G A;  3CH9 A;  3FY1 A;  1ZBW A;  4Z2L A;  1ZL1 A;  4JFI A;  1YW5 A;  1H0I A;  1U79 A;  2RUD A;  4LAY A;  2VN1 A;  3O5L A;  3ALG A;  5JH8 A;  1J4I A;  2XP6 A;  3O5G A;  2ZR5 A;  1HJV A;  5DIU A;  3FAP A;  1LG2 A;  1K9T A;  1WNO A;  4JFL A;  2DT1 A;  3AS3 A;  3KCE A;  3RME A;  1LG1 A;  5HUA A;  4Q22 A;  5HKG A;  1EIB A;  2XP5 A;  4LGX A;  4N19 A;  4DZ2 A;  4AY1 A;  1TCO C;  1NMV A;  2YBU A;  3KZ7 A;  3UI4 A;  2DSV A;  4P8X A;  1QPF A;  2RQS A;  4MGV A;  1FD9 A;  4DRN A;  3ALF A;  3WQV A;  5DEZ A;  2XP3 A;  4O2T A;  4HAR A;  2KR7 A;  1FFR A;  3UI6 A;  4DIP A;  1XRV A;  2XP9 A;  3O5E A;  3O5J A;  1NMW A;  3H9R B;  1E6Z A;  4DH0 A;  3WD4 A;  2LGO A;  4PTM A;  1GUV A;  4ZPW R;  2MLZ A;  3EY6 A;  4MTV A;  3UQI A;  1OGG A;  1L1P A;  4FN2 A;  1FKJ A;  3WIJ A;  2DT3 A;  3O5F A;  1HKI A;  4LAW A;  2ZR4 A;  1UR9 A;  1ZK6 A;  4DWS B;  2WLY A;  1W9U A;  1B6C A;  1JND A;  1KT1 A;  2WLZ A;  2FAP A;  2B31 A;  1QZ2 A;  1D7H A;  5DIV A;  1YAT A;  3TC5 A;  2K8I A;  3CZ8 A;  4DRH A;  3O5K A;  2KFW A;  1E9L A;  4HBO A;  3AQU A;  3CHC A;  4MAV A;  2RSE A;  1Q1C A;  2LPV A;  4IQ2 A;  3ARP A;  4W5U A;  1NH6 A;  5HBF A;  4DRM A;  3KAI A;  4Z2H A;  3WKZ A;  1EQ3 A;  2DT0 A;  5I98 A;  3O5P A;  3WD3 A;  3B9D A;  1HKJ A;  4JFM A;  5HWC A;  1FAP A;  1W26 A;  1W9V A;  1M5Y A;  3IKG A;  1FKK A;  1UR8 A;  2D9F A;  3IK8 A;  3RGC A;  4TW7 A;  2XP4 A;  4G2P A;  1GPF A;  2M1I A;  1J4R A;  2ESC A;  5GQB A;  1WB0 A;  5B8I C;  3O5I A;  4ZS6 A;  3TDB A;  4TNS A;  4DWS A;  4DWS D;  4W9O A;  1ROU A;  1JVW A;  1NSG A;  1ITX A;  5DO2 A;  4W9Q A;  2DPE A;  1T11 A;  5HTG A;  1D2K A;  5BXJ A;  3FXY A;  1JNE A;  3WD1 A;  4Z2K A;  2ZQT A;  2PV1 A;  2RUQ A;  4JFK A;  4LAX A;  4QT3 A;  3RFW A;  1FKF A;  1FKB A;  1FKD A;  1Q6I A;  2DT2 A;  2JZV A;  1VF8 A;  3TCZ A;  5J6E A;  1NWU A;  1J4H A;  3ARS A;  1FKH A;  2A3E A;  4DZ3 A;  4DWS C;  5HW7 A;  4Z2I A;  2UZ5 A;  2ZR6 A;  1BKF A;  4WIW A;  2A3A A;  2FDM A;  3ODK A;  2AOS A;  1E6P A;  1LJY A;  4KR0 B;  3W4R A;  1JNS A;  3ART A;  3PR9 A;  4LAV A;  1W1Y A;  2KI3 A;  1NWS A;  1RD6 A;  2A3B A;  2M08 A;  5GPG A;  1TFV A;  4U86 A;  2PBC A;  3WL1 A;  4ML4 A;  4URI A;  2MF9 A;  1HJX A;  4J4N A;  4WKF A;  2FKE A;  1EYM A;  2M2A A;  3G6M A;  4S3J A;  4MNM A;  1D6O A;  4ODL A;  2WK2 A;  2DSU A;  3UF8 A;  3O5R A;  2XPA A;  3AS1 A;  1D7I A;  3JYM A;  2YBT A;  4Z2G A;  1FKI A;  3CGM A;  4P8U A;  2ZQU A;  1J6Y A;  1IX5 A;  3RM8 A;  1ZCN A;  4NZC A;  1SYT A;  4ODQ A;  2O9O A;  4WKA A;  4DRJ A;  4DRP A;  5HW8 A;  3WD2 A;  4R0X A;  3OA5 A;  4J4O A;  2O92 A;  2L2S A;  4WK9 A;  4DRI A;  4IQC A;  3CHD A;  4MSP A;  2DG4 A;  2PV3 A;  3PRB A;  3UQA A;  4KQZ A;  3B9E A;  5HW6 A;  5D75 A;  2LJ4 A;  2F2D A;  4G50 A;  4JFJ A;  1BL4 A;  4P8V A;  1LQ0 A;  4IT6 A;  3NTP A;  2XP7 A;  2RUC A;  3LUO A;  1FKR A;  4MPK A;  3AS2 A;  3CGN A;  2MPH A;  3B7X A;  3NRK A;  4IT4 A;  2KGJ A;  4S3K A;  4FAP A;  3CHE A;  1NWR A;  2PPO A;  2XP8 A;  3IKD A;  1HKK A;  2PPN A;  3ARV A;  4L72 B;  1Q6U A;  4GGQ A;  1HKM A;  1WAW A;  3AS0 A;  1W1V A;  1OGB A;  3UI5 A;  2DG3 A;  4U85 A;  1FKT A;  2KE0 A;  4ZPV R;  1XHG A;  3KAH A;  4Z2J A;  5HWB A;  2N87 A;  2F4E A;  4ODR A;  4QZV B;  2VCD A;  1KT0 A;  1D7J A;  1W1P A;  2PI6 A;  4WKH A;  1OWQ A;  1ZBC A;  1PBK A;  3O5M A;  4DRK A;  4P8W A;  3WD0 A;  3I6C A;  2G8Z A;  3MDY B;  3NI6 A;  2Q5A A;  4TYO A;  2ZQV A;  2IF4 A;  4TX0 A;  3JYJ A;  1FFQ A;  2PPP A;  4ODO A;  4TW8 A;  1LL6 A;  2MLX A;  1W9P A;  5DF0 A;  3OOB A;  1ZB5 A;  4DRQ A;  2LKN A;  4QT2 A;  3ARW A;  1X6L A;  1W1T A;  4ZPT R;  3B8S A;  3PRD A;  2OFN A;  3ARY A;  4DT4 A;  1PIN A;  4QIB A;  3BXW A;  3JXV A;  3G6L A;  4ODK A;  1X6N A;  4MNJ A;  1E6R A;  3KAF A;  4ODN A;  1E6N A;  1FJD A;  2IUZ A;  1HJW A;  3PA7 A;  5HT1 A;  3RM9 A;  2A3C A;  2QF8 A;  3KAD A;  4TW6 A;  2DSW A;  4GIV A;  2DG9 A;  1FKL A;  2DSZ A;  2XPB A;  4IPX A;  1FKS A;  3ARO A;  1HXV A;  4Q7N A;  2ITK A;  1Y0O A;  1EHN A;  4ODM A;  1QPL A;  2KO7 A;  5DIT A;  1JNT A;  1NWT A;  3ARR A;  4BF8 A;  1ZU8 A;  4L3N A;  3GPK A;  1F40 A;  3WL0 A;  1Q6H A;  1O6I A;  4C02 B;  3WQW A;  4W9P A;  3CHF A;  1C9H A;  3PRA A;  1A7X A;  5GPR A;  3WH0 A;  3IHZ A;  1FKG A;  1ROT A;  4XAK A;  2PV2 A;  4DRO A;  3ARX A;  4U84 A;  4ODP A;  3KAC A;  1N1A A;  2WM0 A;  3KAB A;  2MLY A;  3QOK A;  4R5E A;  4NSB A;  4NNR A;  2Y78 A;  3O5O A;  3RM4 A;  4WJX A;  2ZQS A;  1LL7 A;  2F21 A;  1KFW A;  3ARQ A;  1GOI A;  4JYS A;  1E15 A;  4HBE A;  2MNT A;  1ZBV A;  2RUR A;  1R9H A;  3ARU A;  1ZBK A;  3KAG A;  4ITZ A;  2AWG A;  2G41 A;  2OLH A;  1LL4 A;  3ARZ A;  3O5D A;  1CTN A;  3O5Q A;  4MNL A;  1F8A B;  3UQB A;  3B9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...