2F4EA

N-terminal domain of fkbp42 from arabidopsis thaliana
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
GNVPPKVDSEAEVLDEKVSKQIIKEGHGSKPSKYSTCFLHYRAWTKNSQHKFEDTWHEQQPIELVLGKEKKELAGLAIGVASMKSGERALVHVGWELAYGKEGNFSFPNVPPMADLLYEVEVIGFDETKEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AtFKBP42
publication title Crystal structure of a plant immunophilin domain involved in regulation of MDR-type ABC transporters.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
total genus 30
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2f4eA00
1FKRA 2RQSA 4JFJA 4DRHA 4ODNA 2DG4A 1QZ2A 3O5JA 4ODLA 1D7IA 1D7JA 1FKTA 2PPPA 1FKIA 1FKJA 2UZ5A 2Q5AA 3EY6A 4LAXA 5BXJA 5HTGA 2IF4A 2MLXA 3OOBA 1N1AA 2PPOA 3B7XA 3KAHA 1Q6IA 3KACA 2K8IA 4FN2A 4DH0A 1JNSA 3PRBA 2ZR6A 4DRKA 3TDBA 1J4IA 2XP5A 1FKKA 3CGNA 3H9RB 4JFLA 2DG9A 2FAPA 3ODKA 3TCZA 2ITKA 1YW5A 3IHZA 3PA7A 1R9HA 3KADA 2AWGA 2KGJA 2MLZA 4C02B 3UQAA 1Q6UA 1U79A 3WH0A 4ODQA 2MPHA 5I98A 2L2SA 2RURA 4JFKA 2PV3A 3PRDA 4DRPA 4LAVA 1A7XA 4QT3A 2KO7A 3JYJA 3IKGA 4ODKA 2LKNA 3IKDA 5DITA 1D6OA 4DRIA 2XP6A 4TYOA 3NTPA 2ZQSA 2LGOA 4O2TA 5D75A 2KI3A 2M1IA 1NMVA 1J4HA 2M08A 2RUCA 2FKEA 4GIVA 4J4NA 2MLYA 4DIPA 3O5EA 2ZQUA 1PBKA 4U85A 1FKHA 1Q6HA 1L1PA 2ZR4A 3UF8A 3CGMA 3O5PA 3O5FA 5HWBA 1P5QA 2PPNA 2VCDA 3GPKA 5HWCA 4MSPA 4ODRA 4DZ2A 2KR7A 4ODMA 3KAFA 4FAPA 1FKDA 1D7HA 4G2PA 2MNTA 4W9PA 3LUOA 3UQBA 1FJDA 2XP4A 3RFWA 4U86A 2XP7A 3O5QA 4IQ2A 1ROUA 4QT2A 5B8IC 1FKBA 1PINA 4MGVA 4IPXA 1NMWA 4DRNA 1T11A 4IQCA 2F21A 4TW8A 4TW6A 1FD9A 1F40A 4J4OA 5J6EA 5DIUA 2RSEA 1FKSA 2RUQA 4ITZA 1ZK6A 3KABA 1EYMA 1FKFA 1QPFA 1TCOC 3NRKA 2LPVA 1FKLA 1HXVA 1BKFA 1W26A 4DRJA 3UI5A 1YATA 2XP3A 2Y78A 4TNSA 3O5RA 4ODPA 3O5GA 4N19A 1Q1CA 1Y0OA 1ZCNA 2JZVA 3KZ7A 2ZQVA 2ZR5A 3I6CA 4DRMA 2RUDA 4JFIA 4R0XA 5HW7A 1QPLA 4NNRA 1JNTA 2MF9A 3JXVA 4DZ3A 5HKGA 2PV1A 2LJ4A 1B6CA 3O5OA 5HW6A 2PBCA 1BL4A 2DG3A 4U84A 1KT0A 4TW7A 3UQIA 5HW8A 5DIVA 2XP9A 2PV2A 2M2AA 1EQ3A 1F8AB 2D9FA 3O5IA 3KAGA 4QIBA 3O5KA 4ODOA 2ZQTA 3RGCA 4DRQA 2VN1A 2KFWA 1ROTA 4LAWA 3TC5A 3UI6A 3UI4A 4JYSA 4G50A 1KT1A 2XP8A 3NI6A 3KCEA 3MDYB 4GGQA 2XPAA 3O5MA 4LAYA 1FKGA 1C9HA 1NSGA 3VAWA 1JVWA 3O5LA 2F4EA 2F2DA 5GPGA 4W9OA 4TX0A 5HT1A 3JYMA 1J4RA 2KE0A 3FAPA 2XPBA 3KAIA 3O5DA 4DT4A 5HUAA 4BF8A 3IK8A 1M5YA 1J6YA 2N87A 4W9QA 1FAPA 4DROA 2OFNA 4JFMA
chains in the Genus database with same CATH superfamily
2RQSA 1GUVA 2O9OA 4ODNA 5HBFA 2YBTA 1QZ2A 4ODLA 3RM4A 1FKIA 4IT6A 4LAXA 2IF4A 4LGXA 1EDQA 1XHGA 3KAHA 1JNSA 3KACA 4FN2A 3WL0A 4Z2KA 1FKKA 1ZBWA 3H9RB 5GPRA 1IX5A 1YW5A 2O92A 1Q6UA 3ARZA 4ODQA 2A3CA 5DO2A 2PV3A 2ETNA 1E44A 2KO7A 3ALFA 3JYJA 2LKNA 4WK9A 5DITA 5JH8A 4O2TA 2M1IA 4GIVA 2ZQUA 1FKHA 3ARQA 3OA5A 1XRVA 3O5PA 3RMEA 4L72B 4WKFA 1D7HA 2YBUA 1JCHB 3AS0A 3RFWA 4U86A 3O5QA 1ROUA 5B8IC 1PINA 4IPXA 1NMWA 1ZU8A 3CHFA 1FKSA 4Z2GA 1EHNA 3ARTA 1W1PA 2OLHA 1FKLA 4WKHA 4DRJA 2XP3A 1ZBVA 2Y78A 1GRJA 2DPEA 1Q1CA 1ZCNA 2ZR5A 4ZS6A 3JXVA 4PTMA 1EIBA 2DSWA 2DG3A 4U84A 2A3BA 2XP9A 2PV2A 1EQ3A 3WD3A 1RD6A 3KAGA 1E6ZA 3O5KA 5DF0A 1WAWA 2VN1A 3WQWA 1TFVA 4ZPVR 3ARRA 4LAYA 4Q7NA 3G6MA 5GPGA 2WM0A 4BF8A 4Z2HA 3IK8A 1J6YA 2WK2A 4DIPA 2OFNA 3O5FA 4JFMA 2DG4A 1D7IA 1D7JA 1FKTA 3BMBA 5HTGA 3CH9A 2MLXA 1WB0A 3WD0A 4R5EA 1GOIA 2PPOA 4DH0A 3WQVA 2ZR6A 1OWQA 4DRKA 4NZCA 1E15A 2FAPA 3ODKA 1W1YA 2DT1A 3IHZA 1WNOA 2AWGA 2KGJA 3WIJA 4Z2LA 1HKJA 1VF8A 1U79A 2B31A 2RURA 4JFKA 1UR8A 3IKGA 2XP6A 2KI3A 2FKEA 1ITXA 2QF8A 4P8WA 4QZVB 3ARPA 1L1PA 2ZR4A 1OGBA 4HBEA 2VCDA 1HJVA 3GPKA 4ODRA 4MPKA 3UQBA 2MNTA 1LL4A 4HARA 2FDMA 4KR0B 4MGVA 4W5UA 2F21A 4TW8A 1F40A 4J4OA 1E6NA 1H0GA 3WD2A 3ARWA 1EYMA 1QPFA 1TCOC 3ARUA 2LPVA 1HXVA 1BKFA 1W26A 1W1TA 4ODPA 4N19A 2JZVA 2WLYA 2ZQVA 4DRMA 5HW7A 4DWSA 4NNRA 1JNTA 2MF9A 5HKGA 2LJ4A 4P8UA 2G8ZA 5HW6A 4TW7A 2ESCA 2B5UB 5DIVA 2D9FA 3RGCA 1UR9A 1ROTA 1LG1A 3TC5A 3UI4A 1CTNA 4JYSA 1LL6A 3AQUA 3B9AA 1LG2A 4AY1A 1LL7A 1KT1A 4G50A 2G41A 3NI6A 1NSGA 1JVWA 3O5LA 4KQZA 4DWSB 4MNKA 1J4RA 3O5DA 5HUAA 3WL1A 4DT4A 2DSUA 1E9LA 1HKMA 3ARVA 3QOKA 4WIWA 1FKRA 4JFJA 4IT4A 4DRHA 1NWRA 2PPPA 3EY6A 4WJXA 5I98A 2UZ5A 2Q5AA 4ML4A 1LQ0A 1NWTA 3AS2A 3B7XA 2A3AA 1GPFA 3PRBA 2DT3A 3TDBA 3BXWA 1ZB5A 4DWSC 4JFLA 4MTVA 3PRAA 2ITKA 1HKKA 1R9HA 4URIA 1FFQA 3PR9A 2MPHA 3PRDA 4S3JA 4TYOA 3NTPA 2M08A 3G6LA 4J4NA 2MLYA 4Z2JA 3O5EA 1X6LA 3WD4A 4U85A 4Z2IA 4Q22A 1D2KA 4DZ2A 1HKIA 3KAFA 4FAPA 1FKDA 1FFRA 4NSBA 1K9TA 4W9PA 3B9DA 3LUOA 4WKAA 4MNMA 1KFWA 2XP7A 4QT2A 1NWSA 4DRNA 1T11A 4IQCA 1FD9A 5J6EA 1W9PA 1SR0A 2RUQA 4L3NA 1NWUA 1ZBKA 4HBOA 3NRKA 3GU0A 1YATA 3O5RA 4XAKA 4JFIA 1JNDA 1JNEA 1E6PA 2PBCA 1KT0A 2DSZA 3ARYA 2M2AA 2ZQTA 1SYTA 2KFWA 1HJWA 4LAWA 2DT2A 3MDYB 2XPAA 3O5MA 3RM9A 1C9HA 2F4EA 3WD1A 3ARXA 4TX0A 3W4RA 3FAPA 3KAIA 4P8VA 2DSVA 1M5YA 2F23A 2N87A 4W9QA 1FAPA 3CHCA 4MNJA 1ZBCA 3AS1A 3FY1A 3O5JA 5BXJA 1FKJA 2DT0A 1OGGA 3OOBA 1N1AA 4ZPWR 1Q6IA 5DEZA 2K8IA 3AROA 1J4IA 2A3EA 2XP5A 3CHEA 3CGNA 2DG9A 1LJYA 2PI6A 3TCZA 3PA7A 3KADA 2MLZA 4C02B 3UQAA 3WH0A 2L2SA 4DRPA 3ALGA 1HJXA 4LAVA 1A7XA 4QT3A 4S3KA 4ODKA 3IKDA 5GQBA 4DWSD 1D6OA 4DRIA 2ZQSA 2LGOA 5D75A 1NMVA 1J4HA 2RUCA 3WKZA 3GTYX 2WLZA 4P8XA 1H0IA 1PBKA 1Q6HA 3CHDA 3RM8A 1E6RA 3CGMA 3UF8A 2PN0A 5HWBA 3FXYA 1P5QA 2PPNA 1NH6A 5HWCA 4MSPA 3ARSA 2KR7A 1W9UA 4ODMA 4G2PA 1FJDA 2XP4A 4IQ2A 1FKBA 4TW6A 5DIUA 2RSEA 4ITZA 1ZK6A 3KABA 1FKFA 3B9EA 3EIPA 1X6NA 3B8SA 4MAVA 2IUZA 3UI5A 4TNSA 1ZL1A 4UDMA 3AS3A 3O5GA 1Y0OA 3KZ7A 3I6CA 2RUDA 1QPLA 2P4VA 4DZ3A 2EULA 2PV1A 1B6CA 3O5OA 1BL4A 3UQIA 3CZ8A 1O6IA 5HW8A 1F8AB 3O5IA 4QIBA 4ODOA 4DRQA 1W1VA 3UI6A 4ZPTR 2XP8A 3KCEA 2AOSA 4GGQA 1FKGA 3VAWA 2F2DA 4W9OA 5HT1A 1W9VA 3JYMA 2KE0A 2XPBA 4MNLA 4R0XA 4DROA
chains in the Genus database with same CATH topology
2RQSA 1GUVA 2O9OA 4ODNA 5HBFA 2YBTA 1QZ2A 4ODLA 3RM4A 1FKIA 4IT6A 4LAXA 2IF4A 4LGXA 1EDQA 1XHGA 3KAHA 1JNSA 3KACA 4FN2A 3WL0A 4Z2KA 1FKKA 1ZBWA 3H9RB 5GPRA 1IX5A 1YW5A 2O92A 1Q6UA 3ARZA 4ODQA 2A3CA 5DO2A 2PV3A 2KO7A 3ALFA 3JYJA 4WK9A 2LKNA 5DITA 5JH8A 4O2TA 2M1IA 4GIVA 2ZQUA 1FKHA 3ARQA 3OA5A 1XRVA 3O5PA 3RMEA 4L72B 4WKFA 1D7HA 2YBUA 3AS0A 3RFWA 4U86A 3O5QA 1ROUA 5B8IC 1PINA 4IPXA 1NMWA 1ZU8A 3CHFA 1FKSA 4Z2GA 1EHNA 3ARTA 1W1PA 2OLHA 1FKLA 4WKHA 4DRJA 2XP3A 1ZBVA 2Y78A 2DPEA 1Q1CA 1ZCNA 2ZR5A 4ZS6A 3JXVA 4PTMA 1EIBA 2DSWA 2DG3A 4U84A 2A3BA 2XP9A 2PV2A 1EQ3A 3WD3A 1RD6A 3KAGA 1E6ZA 3O5KA 5DF0A 1WAWA 2VN1A 3WQWA 1TFVA 4ZPVR 3ARRA 4LAYA 4Q7NA 3G6MA 5GPGA 2WM0A 4BF8A 4Z2HA 3IK8A 1J6YA 2WK2A 4DIPA 2OFNA 3O5FA 4JFMA 2DG4A 1D7IA 1D7JA 1FKTA 5HTGA 3CH9A 2MLXA 1WB0A 3WD0A 4R5EA 1GOIA 2PPOA 4DH0A 3WQVA 2ZR6A 1OWQA 4DRKA 4NZCA 1E15A 2FAPA 3ODKA 1W1YA 2DT1A 3IHZA 1WNOA 2AWGA 2KGJA 3WIJA 4Z2LA 1HKJA 1VF8A 1U79A 2B31A 2RURA 4JFKA 1UR8A 3IKGA 2XP6A 2KI3A 2FKEA 1ITXA 2QF8A 4P8WA 4QZVB 3ARPA 1L1PA 2ZR4A 1OGBA 4HBEA 2VCDA 1HJVA 3GPKA 4ODRA 4MPKA 3UQBA 2MNTA 1LL4A 4HARA 2FDMA 4KR0B 4MGVA 4W5UA 2F21A 4TW8A 1F40A 4J4OA 1E6NA 1H0GA 3WD2A 3ARWA 1EYMA 1QPFA 1TCOC 3ARUA 2LPVA 1HXVA 1BKFA 1W26A 1W1TA 4ODPA 4N19A 2JZVA 2WLYA 2ZQVA 4DRMA 5HW7A 4DWSA 4NNRA 1JNTA 2MF9A 5HKGA 2LJ4A 4P8UA 2G8ZA 5HW6A 4TW7A 2ESCA 5DIVA 2D9FA 3RGCA 1UR9A 1ROTA 1LG1A 3TC5A 3UI4A 1CTNA 4JYSA 1LL6A 3AQUA 3B9AA 1LG2A 4AY1A 1LL7A 1KT1A 4G50A 2G41A 3NI6A 1NSGA 1JVWA 3O5LA 4KQZA 4DWSB 4MNKA 1J4RA 3O5DA 5HUAA 3WL1A 4DT4A 2DSUA 1E9LA 1HKMA 3ARVA 3QOKA 4WIWA 1FKRA 4JFJA 4IT4A 4DRHA 1NWRA 2PPPA 3EY6A 4WJXA 5I98A 2UZ5A 2Q5AA 4ML4A 1LQ0A 1NWTA 3AS2A 3B7XA 2A3AA 1GPFA 3PRBA 2DT3A 3TDBA 3BXWA 1ZB5A 4DWSC 4JFLA 4MTVA 3PRAA 2ITKA 1HKKA 1R9HA 4URIA 1FFQA 3PR9A 2MPHA 3PRDA 4S3JA 4TYOA 3NTPA 2M08A 3G6LA 4J4NA 2MLYA 4Z2JA 3O5EA 1X6LA 3WD4A 4U85A 4Z2IA 4Q22A 1D2KA 4DZ2A 1HKIA 3KAFA 4FAPA 1FKDA 1FFRA 4NSBA 1K9TA 4W9PA 3B9DA 3LUOA 4WKAA 4MNMA 1KFWA 2XP7A 4QT2A 1NWSA 4DRNA 1T11A 4IQCA 1FD9A 5J6EA 1W9PA 1SR0A 2RUQA 4L3NA 1NWUA 1ZBKA 4HBOA 3NRKA 1YATA 3O5RA 4XAKA 4JFIA 1JNDA 1JNEA 1E6PA 2PBCA 1KT0A 2DSZA 3ARYA 2M2AA 2ZQTA 1SYTA 2KFWA 1HJWA 4LAWA 2DT2A 3MDYB 2XPAA 3O5MA 3RM9A 1C9HA 2F4EA 3WD1A 3ARXA 4TX0A 3W4RA 3FAPA 3KAIA 4P8VA 2DSVA 1M5YA 2N87A 4W9QA 1FAPA 3CHCA 4MNJA 1ZBCA 3AS1A 3FY1A 3O5JA 5BXJA 1FKJA 2DT0A 1OGGA 3OOBA 1N1AA 4ZPWR 1Q6IA 5DEZA 2K8IA 3AROA 1J4IA 2A3EA 2XP5A 3CHEA 3CGNA 2DG9A 1LJYA 2PI6A 3TCZA 3PA7A 3KADA 2MLZA 4C02B 3UQAA 3WH0A 2L2SA 4DRPA 3ALGA 1HJXA 4LAVA 1A7XA 4QT3A 4S3KA 4ODKA 3IKDA 5GQBA 4DWSD 1D6OA 4DRIA 2ZQSA 2LGOA 5D75A 1NMVA 1J4HA 2RUCA 3WKZA 2WLZA 4P8XA 1H0IA 1PBKA 1Q6HA 3CHDA 3RM8A 1E6RA 3CGMA 3UF8A 5HWBA 3FXYA 1P5QA 2PPNA 1NH6A 5HWCA 4MSPA 3ARSA 2KR7A 1W9UA 4ODMA 4G2PA 1FJDA 2XP4A 4IQ2A 1FKBA 4TW6A 5DIUA 2RSEA 4ITZA 1ZK6A 3KABA 1FKFA 3B9EA 1X6NA 3B8SA 4MAVA 2IUZA 3UI5A 4TNSA 1ZL1A 3AS3A 3O5GA 1Y0OA 3KZ7A 3I6CA 2RUDA 1QPLA 4DZ3A 2PV1A 1B6CA 3O5OA 1BL4A 3UQIA 3CZ8A 1O6IA 5HW8A 1F8AB 3O5IA 4QIBA 4ODOA 4DRQA 1W1VA 3UI6A 4ZPTR 2XP8A 3KCEA 2AOSA 4GGQA 1FKGA 3VAWA 2F2DA 4W9OA 5HT1A 1W9VA 3JYMA 2KE0A 2XPBA 4MNLA 4R0XA 4DROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKR A;  2RQS A;  4JFJ A;  4DRH A;  4ODN A;  2DG4 A;  1QZ2 A;  3O5J A;  4ODL A;  1D7I A;  1D7J A;  1FKT A;  2PPP A;  1FKI A;  1FKJ A;  2UZ5 A;  2Q5A A;  3EY6 A;  4LAX A;  5BXJ A;  5HTG A;  2IF4 A;  2MLX A;  3OOB A;  1N1A A;  2PPO A;  3B7X A;  3KAH A;  1Q6I A;  3KAC A;  2K8I A;  4FN2 A;  4DH0 A;  1JNS A;  3PRB A;  2ZR6 A;  4DRK A;  3TDB A;  1J4I A;  2XP5 A;  1FKK A;  3CGN A;  3H9R B;  4JFL A;  2DG9 A;  2FAP A;  3ODK A;  3TCZ A;  2ITK A;  1YW5 A;  3IHZ A;  3PA7 A;  1R9H A;  3KAD A;  2AWG A;  2KGJ A;  2MLZ A;  4C02 B;  3UQA A;  1Q6U A;  1U79 A;  3WH0 A;  4ODQ A;  2MPH A;  5I98 A;  2L2S A;  2RUR A;  4JFK A;  2PV3 A;  3PRD A;  4DRP A;  4LAV A;  1A7X A;  4QT3 A;  2KO7 A;  3JYJ A;  3IKG A;  4ODK A;  2LKN A;  3IKD A;  5DIT A;  1D6O A;  4DRI A;  2XP6 A;  4TYO A;  3NTP A;  2ZQS A;  2LGO A;  4O2T A;  5D75 A;  2KI3 A;  2M1I A;  1NMV A;  1J4H A;  2M08 A;  2RUC A;  2FKE A;  4GIV A;  4J4N A;  2MLY A;  4DIP A;  3O5E A;  2ZQU A;  1PBK A;  4U85 A;  1FKH A;  1Q6H A;  1L1P A;  2ZR4 A;  3UF8 A;  3CGM A;  3O5P A;  3O5F A;  5HWB A;  1P5Q A;  2PPN A;  2VCD A;  3GPK A;  5HWC A;  4MSP A;  4ODR A;  4DZ2 A;  2KR7 A;  4ODM A;  3KAF A;  4FAP A;  1FKD A;  1D7H A;  4G2P A;  2MNT A;  4W9P A;  3LUO A;  3UQB A;  1FJD A;  2XP4 A;  3RFW A;  4U86 A;  2XP7 A;  3O5Q A;  4IQ2 A;  1ROU A;  4QT2 A;  5B8I C;  1FKB A;  1PIN A;  4MGV A;  4IPX A;  1NMW A;  4DRN A;  1T11 A;  4IQC A;  2F21 A;  4TW8 A;  4TW6 A;  1FD9 A;  1F40 A;  4J4O A;  5J6E A;  5DIU A;  2RSE A;  1FKS A;  2RUQ A;  4ITZ A;  1ZK6 A;  3KAB A;  1EYM A;  1FKF A;  1QPF A;  1TCO C;  3NRK A;  2LPV A;  1FKL A;  1HXV A;  1BKF A;  1W26 A;  4DRJ A;  3UI5 A;  1YAT A;  2XP3 A;  2Y78 A;  4TNS A;  3O5R A;  4ODP A;  3O5G A;  4N19 A;  1Q1C A;  1Y0O A;  1ZCN A;  2JZV A;  3KZ7 A;  2ZQV A;  2ZR5 A;  3I6C A;  4DRM A;  2RUD A;  4JFI A;  4R0X A;  5HW7 A;  1QPL A;  4NNR A;  1JNT A;  2MF9 A;  3JXV A;  4DZ3 A;  5HKG A;  2PV1 A;  2LJ4 A;  1B6C A;  3O5O A;  5HW6 A;  2PBC A;  1BL4 A;  2DG3 A;  4U84 A;  1KT0 A;  4TW7 A;  3UQI A;  5HW8 A;  5DIV A;  2XP9 A;  2PV2 A;  2M2A A;  1EQ3 A;  1F8A B;  2D9F A;  3O5I A;  3KAG A;  4QIB A;  3O5K A;  4ODO A;  2ZQT A;  3RGC A;  4DRQ A;  2VN1 A;  2KFW A;  1ROT A;  4LAW A;  3TC5 A;  3UI6 A;  3UI4 A;  4JYS A;  4G50 A;  1KT1 A;  2XP8 A;  3NI6 A;  3KCE A;  3MDY B;  4GGQ A;  2XPA A;  3O5M A;  4LAY A;  1FKG A;  1C9H A;  1NSG A;  3VAW A;  1JVW A;  3O5L A;  2F4E A;  2F2D A;  5GPG A;  4W9O A;  4TX0 A;  5HT1 A;  3JYM A;  1J4R A;  2KE0 A;  3FAP A;  2XPB A;  3KAI A;  3O5D A;  4DT4 A;  5HUA A;  4BF8 A;  3IK8 A;  1M5Y A;  1J6Y A;  2N87 A;  4W9Q A;  1FAP A;  4DRO A;  2OFN A;  4JFM A; 
#chains in the Genus database with same CATH topology
 2RQS A;  1GUV A;  2O9O A;  4ODN A;  5HBF A;  2YBT A;  1QZ2 A;  4ODL A;  3RM4 A;  1FKI A;  4IT6 A;  4LAX A;  2IF4 A;  4LGX A;  1EDQ A;  1XHG A;  3KAH A;  1JNS A;  3KAC A;  4FN2 A;  3WL0 A;  4Z2K A;  1FKK A;  1ZBW A;  3H9R B;  5GPR A;  1IX5 A;  1YW5 A;  2O92 A;  1Q6U A;  3ARZ A;  4ODQ A;  2A3C A;  5DO2 A;  2PV3 A;  2ETN A;  1E44 A;  2KO7 A;  3ALF A;  3JYJ A;  2LKN A;  4WK9 A;  5DIT A;  5JH8 A;  4O2T A;  2M1I A;  4GIV A;  2ZQU A;  1FKH A;  3ARQ A;  3OA5 A;  1XRV A;  3O5P A;  3RME A;  4L72 B;  4WKF A;  1D7H A;  2YBU A;  1JCH B;  3AS0 A;  3RFW A;  4U86 A;  3O5Q A;  1ROU A;  5B8I C;  1PIN A;  4IPX A;  1NMW A;  1ZU8 A;  3CHF A;  1FKS A;  4Z2G A;  1EHN A;  3ART A;  1W1P A;  2OLH A;  1FKL A;  4WKH A;  4DRJ A;  2XP3 A;  1ZBV A;  2Y78 A;  1GRJ A;  2DPE A;  1Q1C A;  1ZCN A;  2ZR5 A;  4ZS6 A;  3JXV A;  4PTM A;  1EIB A;  2DSW A;  2DG3 A;  4U84 A;  2A3B A;  2XP9 A;  2PV2 A;  1EQ3 A;  3WD3 A;  1RD6 A;  3KAG A;  1E6Z A;  3O5K A;  5DF0 A;  1WAW A;  2VN1 A;  3WQW A;  1TFV A;  4ZPV R;  3ARR A;  4LAY A;  4Q7N A;  3G6M A;  5GPG A;  2WM0 A;  4BF8 A;  4Z2H A;  3IK8 A;  1J6Y A;  2WK2 A;  4DIP A;  2OFN A;  3O5F A;  4JFM A;  2DG4 A;  1D7I A;  1D7J A;  1FKT A;  3BMB A;  5HTG A;  3CH9 A;  2MLX A;  1WB0 A;  3WD0 A;  4R5E A;  1GOI A;  2PPO A;  4DH0 A;  3WQV A;  2ZR6 A;  1OWQ A;  4DRK A;  4NZC A;  1E15 A;  2FAP A;  3ODK A;  1W1Y A;  2DT1 A;  3IHZ A;  1WNO A;  2AWG A;  2KGJ A;  3WIJ A;  4Z2L A;  1HKJ A;  1VF8 A;  1U79 A;  2B31 A;  2RUR A;  4JFK A;  1UR8 A;  3IKG A;  2XP6 A;  2KI3 A;  2FKE A;  1ITX A;  2QF8 A;  4P8W A;  4QZV B;  3ARP A;  1L1P A;  2ZR4 A;  1OGB A;  4HBE A;  2VCD A;  1HJV A;  3GPK A;  4ODR A;  4MPK A;  3UQB A;  2MNT A;  1LL4 A;  4HAR A;  2FDM A;  4KR0 B;  4MGV A;  4W5U A;  2F21 A;  4TW8 A;  1F40 A;  4J4O A;  1E6N A;  1H0G A;  3WD2 A;  3ARW A;  1EYM A;  1QPF A;  1TCO C;  3ARU A;  2LPV A;  1HXV A;  1BKF A;  1W26 A;  1W1T A;  4ODP A;  4N19 A;  2JZV A;  2WLY A;  2ZQV A;  4DRM A;  5HW7 A;  4DWS A;  4NNR A;  1JNT A;  2MF9 A;  5HKG A;  2LJ4 A;  4P8U A;  2G8Z A;  5HW6 A;  4TW7 A;  2ESC A;  2B5U B;  5DIV A;  2D9F A;  3RGC A;  1UR9 A;  1ROT A;  1LG1 A;  3TC5 A;  3UI4 A;  1CTN A;  4JYS A;  1LL6 A;  3AQU A;  3B9A A;  1LG2 A;  4AY1 A;  1LL7 A;  1KT1 A;  4G50 A;  2G41 A;  3NI6 A;  1NSG A;  1JVW A;  3O5L A;  4KQZ A;  4DWS B;  4MNK A;  1J4R A;  3O5D A;  5HUA A;  3WL1 A;  4DT4 A;  2DSU A;  1E9L A;  1HKM A;  3ARV A;  3QOK A;  4WIW A;  1FKR A;  4JFJ A;  4IT4 A;  4DRH A;  1NWR A;  2PPP A;  3EY6 A;  4WJX A;  5I98 A;  2UZ5 A;  2Q5A A;  4ML4 A;  1LQ0 A;  1NWT A;  3AS2 A;  3B7X A;  2A3A A;  1GPF A;  3PRB A;  2DT3 A;  3TDB A;  3BXW A;  1ZB5 A;  4DWS C;  4JFL A;  4MTV A;  3PRA A;  2ITK A;  1HKK A;  1R9H A;  4URI A;  1FFQ A;  3PR9 A;  2MPH A;  3PRD A;  4S3J A;  4TYO A;  3NTP A;  2M08 A;  3G6L A;  4J4N A;  2MLY A;  4Z2J A;  3O5E A;  1X6L A;  3WD4 A;  4U85 A;  4Z2I A;  4Q22 A;  1D2K A;  4DZ2 A;  1HKI A;  3KAF A;  4FAP A;  1FKD A;  1FFR A;  4NSB A;  1K9T A;  4W9P A;  3B9D A;  3LUO A;  4WKA A;  4MNM A;  1KFW A;  2XP7 A;  4QT2 A;  1NWS A;  4DRN A;  1T11 A;  4IQC A;  1FD9 A;  5J6E A;  1W9P A;  1SR0 A;  2RUQ A;  4L3N A;  1NWU A;  1ZBK A;  4HBO A;  3NRK A;  3GU0 A;  1YAT A;  3O5R A;  4XAK A;  4JFI A;  1JND A;  1JNE A;  1E6P A;  2PBC A;  1KT0 A;  2DSZ A;  3ARY A;  2M2A A;  2ZQT A;  1SYT A;  2KFW A;  1HJW A;  4LAW A;  2DT2 A;  3MDY B;  2XPA A;  3O5M A;  3RM9 A;  1C9H A;  2F4E A;  3WD1 A;  3ARX A;  4TX0 A;  3W4R A;  3FAP A;  3KAI A;  4P8V A;  2DSV A;  1M5Y A;  2F23 A;  2N87 A;  4W9Q A;  1FAP A;  3CHC A;  4MNJ A;  1ZBC A;  3AS1 A;  3FY1 A;  3O5J A;  5BXJ A;  1FKJ A;  2DT0 A;  1OGG A;  3OOB A;  1N1A A;  4ZPW R;  1Q6I A;  5DEZ A;  2K8I A;  3ARO A;  1J4I A;  2A3E A;  2XP5 A;  3CHE A;  3CGN A;  2DG9 A;  1LJY A;  2PI6 A;  3TCZ A;  3PA7 A;  3KAD A;  2MLZ A;  4C02 B;  3UQA A;  3WH0 A;  2L2S A;  4DRP A;  3ALG A;  1HJX A;  4LAV A;  1A7X A;  4QT3 A;  4S3K A;  4ODK A;  3IKD A;  5GQB A;  4DWS D;  1D6O A;  4DRI A;  2ZQS A;  2LGO A;  5D75 A;  1NMV A;  1J4H A;  2RUC A;  3WKZ A;  3GTY X;  2WLZ A;  4P8X A;  1H0I A;  1PBK A;  1Q6H A;  3CHD A;  3RM8 A;  1E6R A;  3CGM A;  3UF8 A;  2PN0 A;  5HWB A;  3FXY A;  1P5Q A;  2PPN A;  1NH6 A;  5HWC A;  4MSP A;  3ARS A;  2KR7 A;  1W9U A;  4ODM A;  4G2P A;  1FJD A;  2XP4 A;  4IQ2 A;  1FKB A;  4TW6 A;  5DIU A;  2RSE A;  4ITZ A;  1ZK6 A;  3KAB A;  1FKF A;  3B9E A;  3EIP A;  1X6N A;  3B8S A;  4MAV A;  2IUZ A;  3UI5 A;  4TNS A;  1ZL1 A;  4UDM A;  3AS3 A;  3O5G A;  1Y0O A;  3KZ7 A;  3I6C A;  2RUD A;  1QPL A;  2P4V A;  4DZ3 A;  2EUL A;  2PV1 A;  1B6C A;  3O5O A;  1BL4 A;  3UQI A;  3CZ8 A;  1O6I A;  5HW8 A;  1F8A B;  3O5I A;  4QIB A;  4ODO A;  4DRQ A;  1W1V A;  3UI6 A;  4ZPT R;  2XP8 A;  3KCE A;  2AOS A;  4GGQ A;  1FKG A;  3VAW A;  2F2D A;  4W9O A;  5HT1 A;  1W9V A;  3JYM A;  2KE0 A;  2XPB A;  4MNL A;  4R0X A;  4DRO A; 
#chains in the Genus database with same CATH homology
 2RQS A;  1GUV A;  2O9O A;  4ODN A;  5HBF A;  2YBT A;  1QZ2 A;  4ODL A;  3RM4 A;  1FKI A;  4IT6 A;  4LAX A;  2IF4 A;  4LGX A;  1EDQ A;  1XHG A;  3KAH A;  1JNS A;  3KAC A;  4FN2 A;  3WL0 A;  4Z2K A;  1FKK A;  1ZBW A;  3H9R B;  5GPR A;  1IX5 A;  1YW5 A;  2O92 A;  1Q6U A;  3ARZ A;  4ODQ A;  2A3C A;  5DO2 A;  2PV3 A;  2KO7 A;  3ALF A;  3JYJ A;  4WK9 A;  2LKN A;  5DIT A;  5JH8 A;  4O2T A;  2M1I A;  4GIV A;  2ZQU A;  1FKH A;  3ARQ A;  3OA5 A;  1XRV A;  3O5P A;  3RME A;  4L72 B;  4WKF A;  1D7H A;  2YBU A;  3AS0 A;  3RFW A;  4U86 A;  3O5Q A;  1ROU A;  5B8I C;  1PIN A;  4IPX A;  1NMW A;  1ZU8 A;  3CHF A;  1FKS A;  4Z2G A;  1EHN A;  3ART A;  1W1P A;  2OLH A;  1FKL A;  4WKH A;  4DRJ A;  2XP3 A;  1ZBV A;  2Y78 A;  2DPE A;  1Q1C A;  1ZCN A;  2ZR5 A;  4ZS6 A;  3JXV A;  4PTM A;  1EIB A;  2DSW A;  2DG3 A;  4U84 A;  2A3B A;  2XP9 A;  2PV2 A;  1EQ3 A;  3WD3 A;  1RD6 A;  3KAG A;  1E6Z A;  3O5K A;  5DF0 A;  1WAW A;  2VN1 A;  3WQW A;  1TFV A;  4ZPV R;  3ARR A;  4LAY A;  4Q7N A;  3G6M A;  5GPG A;  2WM0 A;  4BF8 A;  4Z2H A;  3IK8 A;  1J6Y A;  2WK2 A;  4DIP A;  2OFN A;  3O5F A;  4JFM A;  2DG4 A;  1D7I A;  1D7J A;  1FKT A;  5HTG A;  3CH9 A;  2MLX A;  1WB0 A;  3WD0 A;  4R5E A;  1GOI A;  2PPO A;  4DH0 A;  3WQV A;  2ZR6 A;  1OWQ A;  4DRK A;  4NZC A;  1E15 A;  2FAP A;  3ODK A;  1W1Y A;  2DT1 A;  3IHZ A;  1WNO A;  2AWG A;  2KGJ A;  3WIJ A;  4Z2L A;  1HKJ A;  1VF8 A;  1U79 A;  2B31 A;  2RUR A;  4JFK A;  1UR8 A;  3IKG A;  2XP6 A;  2KI3 A;  2FKE A;  1ITX A;  2QF8 A;  4P8W A;  4QZV B;  3ARP A;  1L1P A;  2ZR4 A;  1OGB A;  4HBE A;  2VCD A;  1HJV A;  3GPK A;  4ODR A;  4MPK A;  3UQB A;  2MNT A;  1LL4 A;  4HAR A;  2FDM A;  4KR0 B;  4MGV A;  4W5U A;  2F21 A;  4TW8 A;  1F40 A;  4J4O A;  1E6N A;  1H0G A;  3WD2 A;  3ARW A;  1EYM A;  1QPF A;  1TCO C;  3ARU A;  2LPV A;  1HXV A;  1BKF A;  1W26 A;  1W1T A;  4ODP A;  4N19 A;  2JZV A;  2WLY A;  2ZQV A;  4DRM A;  5HW7 A;  4DWS A;  4NNR A;  1JNT A;  2MF9 A;  5HKG A;  2LJ4 A;  4P8U A;  2G8Z A;  5HW6 A;  4TW7 A;  2ESC A;  5DIV A;  2D9F A;  3RGC A;  1UR9 A;  1ROT A;  1LG1 A;  3TC5 A;  3UI4 A;  1CTN A;  4JYS A;  1LL6 A;  3AQU A;  3B9A A;  1LG2 A;  4AY1 A;  1LL7 A;  1KT1 A;  4G50 A;  2G41 A;  3NI6 A;  1NSG A;  1JVW A;  3O5L A;  4KQZ A;  4DWS B;  4MNK A;  1J4R A;  3O5D A;  5HUA A;  3WL1 A;  4DT4 A;  2DSU A;  1E9L A;  1HKM A;  3ARV A;  3QOK A;  4WIW A;  1FKR A;  4JFJ A;  4IT4 A;  4DRH A;  1NWR A;  2PPP A;  3EY6 A;  4WJX A;  5I98 A;  2UZ5 A;  2Q5A A;  4ML4 A;  1LQ0 A;  1NWT A;  3AS2 A;  3B7X A;  2A3A A;  1GPF A;  3PRB A;  2DT3 A;  3TDB A;  3BXW A;  1ZB5 A;  4DWS C;  4JFL A;  4MTV A;  3PRA A;  2ITK A;  1HKK A;  1R9H A;  4URI A;  1FFQ A;  3PR9 A;  2MPH A;  3PRD A;  4S3J A;  4TYO A;  3NTP A;  2M08 A;  3G6L A;  4J4N A;  2MLY A;  4Z2J A;  3O5E A;  1X6L A;  3WD4 A;  4U85 A;  4Z2I A;  4Q22 A;  1D2K A;  4DZ2 A;  1HKI A;  3KAF A;  4FAP A;  1FKD A;  1FFR A;  4NSB A;  1K9T A;  4W9P A;  3B9D A;  3LUO A;  4WKA A;  4MNM A;  1KFW A;  2XP7 A;  4QT2 A;  1NWS A;  4DRN A;  1T11 A;  4IQC A;  1FD9 A;  5J6E A;  1W9P A;  1SR0 A;  2RUQ A;  4L3N A;  1NWU A;  1ZBK A;  4HBO A;  3NRK A;  1YAT A;  3O5R A;  4XAK A;  4JFI A;  1JND A;  1JNE A;  1E6P A;  2PBC A;  1KT0 A;  2DSZ A;  3ARY A;  2M2A A;  2ZQT A;  1SYT A;  2KFW A;  1HJW A;  4LAW A;  2DT2 A;  3MDY B;  2XPA A;  3O5M A;  3RM9 A;  1C9H A;  2F4E A;  3WD1 A;  3ARX A;  4TX0 A;  3W4R A;  3FAP A;  3KAI A;  4P8V A;  2DSV A;  1M5Y A;  2N87 A;  4W9Q A;  1FAP A;  3CHC A;  4MNJ A;  1ZBC A;  3AS1 A;  3FY1 A;  3O5J A;  5BXJ A;  1FKJ A;  2DT0 A;  1OGG A;  3OOB A;  1N1A A;  4ZPW R;  1Q6I A;  5DEZ A;  2K8I A;  3ARO A;  1J4I A;  2A3E A;  2XP5 A;  3CHE A;  3CGN A;  2DG9 A;  1LJY A;  2PI6 A;  3TCZ A;  3PA7 A;  3KAD A;  2MLZ A;  4C02 B;  3UQA A;  3WH0 A;  2L2S A;  4DRP A;  3ALG A;  1HJX A;  4LAV A;  1A7X A;  4QT3 A;  4S3K A;  4ODK A;  3IKD A;  5GQB A;  4DWS D;  1D6O A;  4DRI A;  2ZQS A;  2LGO A;  5D75 A;  1NMV A;  1J4H A;  2RUC A;  3WKZ A;  2WLZ A;  4P8X A;  1H0I A;  1PBK A;  1Q6H A;  3CHD A;  3RM8 A;  1E6R A;  3CGM A;  3UF8 A;  5HWB A;  3FXY A;  1P5Q A;  2PPN A;  1NH6 A;  5HWC A;  4MSP A;  3ARS A;  2KR7 A;  1W9U A;  4ODM A;  4G2P A;  1FJD A;  2XP4 A;  4IQ2 A;  1FKB A;  4TW6 A;  5DIU A;  2RSE A;  4ITZ A;  1ZK6 A;  3KAB A;  1FKF A;  3B9E A;  1X6N A;  3B8S A;  4MAV A;  2IUZ A;  3UI5 A;  4TNS A;  1ZL1 A;  3AS3 A;  3O5G A;  1Y0O A;  3KZ7 A;  3I6C A;  2RUD A;  1QPL A;  4DZ3 A;  2PV1 A;  1B6C A;  3O5O A;  1BL4 A;  3UQI A;  3CZ8 A;  1O6I A;  5HW8 A;  1F8A B;  3O5I A;  4QIB A;  4ODO A;  4DRQ A;  1W1V A;  3UI6 A;  4ZPT R;  2XP8 A;  3KCE A;  2AOS A;  4GGQ A;  1FKG A;  3VAW A;  2F2D A;  4W9O A;  5HT1 A;  1W9V A;  3JYM A;  2KE0 A;  2XPB A;  4MNL A;  4R0X A;  4DRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...