2F4FA

Crystal structure of is200 transposase
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
130
structure length
130
Chain Sequence
ELKSTRHTKYLCNYHFVWIPKHRRNTLVNEIAEYTKEVLKSIAEELGCEIIALEVMPDHIHLFVNCPPRYAPSYLANYFKGKSARLILKKFPQLNKGKLWTRSYFVATAGNVSSEVIKKYIEEQWRKEGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transposase, putative
publication title Crystal Structure of a Metal Ion-bound IS200 Transposase
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Gene regulation
total genus 33
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2f4fA00
2FYXA 2VHGA 2VIHA 2XQCA 2A6MA 2XO6A 2VJUA 4ER8A 2A6OA 2VJVA 2XM3A 2XMAA 2EC2A 2F4FA 2F5GA 2VICA
chains in the Genus database with same CATH superfamily
2FTRA 4ZVTB 1HBOA 5F8JA 3NGTA 2ZE2B 4YDDB 1JXVA 4RW7A 4USHA 1FKAF 3K59A 1T9UA 3MUMP 2XS5A 1FRMA 2ZH5A 2VG5B 2FZKB 2DJWA 3H4DA 2RH3A 2GIRA 3VVTA 3GJSB 4KY3A 2W2MP 2FLPA 2V50A 3GIMA 2GZOA 2KYZA 1Y5IB 4DL4A 2UV8A 1AB8A 1VQNS 3KTQA 2KL8A 1E6VA 3MEEB 5F8LA 4WJBA 4X4TA 1M5SA 4ID8A 4ETZA 1N0UA 1QE1A 3OVAA 4J7CA 2N3OA 1KONA 4LF8F 2ZWPA 2ASDA 3GMGA 3IG1A 2B5JA 4WE1A 3P45B 1R43A 2KU7A 3KUHA 2AJ4A 4KT0C 5DRKA 1HMVA 5GADU 1TP7A 1FF2A 3R8YA 3S01A 2Y1RI 2UXDF 5BYQA 1REGX 3M8YA 3S7RA 1RT4A 4KV8A 4DR7F 3CD7A 2YKMB 1NHUA 4HT7A 3NG8A 4K4UA 3ELHA 3ZTRA 1H7WA 4GO7X 1NK8A 2BE7D 4BC7A 1N6QB 3R7SB 3ZC4A 3ENVA 2CUYA 3PJ9A 3T3FA 1LW2B 1RP5A 3BM7A 2DHAA 1HYSB 2OIHA 3IWLA 3ULHA 3ZZ0A 1IBKJ 3VALA 4OZ0A 2Y9HA 3FBCA 2CJAA 5LJ3Y 1M1HA 2RAQA 1SL0A 3CXCR 2J0WA 2IAJA 4RWWA 4U9RA 2EFGA 2FY1A 4NLSA 3FFIB 3JS9A 4XPCA 4OZLA 2ZE2A 3IR7B 2VOOA 5ETRA 1LXNA 1GT8A 3EVMA 1KR4A 3NL0A 3HO1A 5J2NB 1S12A 3ZZTA 5LSLA 4DL2A 4IG0A 3AD8C 3KK3B 1P6TA 3ZZRA 2VZ9A 1FE0A 3A3NB 4LSNB 3K7RA 1SV5B 4BBYA 3W1YC 2GW8A 1F5BA 4CLFA 2XMWA 3IS9A 1KQSR 2CNOB 1HQ2A 5I3UB 2FJBB 3MEEA 4Y2CA 5G4DA 2HVEA 4UOHA 1S4FA 2I5JA 2V8VA 4YR0A 1RT2B 3DLHA 2D9PA 4JI1F 4DV5J 5GAHU 3LPYA 2VFSA 1ZA1B 2BJ7A 2R7RA 4EUVA 4IO1A 1FTCA 3IFEA 2AZ3A 1RADB 1L3KA 2LKZA 2DITA 5KG2A 1RHUB 3PHEA 4NE9C 2EW9A 3EVOA 3VAHA 3HHLD 2LEPA 4ZVUB 1PIEA 2XO7A 2HAIA 4PABA 1WDTA 4ZP9A 5U47A 1N6QA 5A2QY 4I7FA 1I94F 4DWIA 2QL9B 3C19A 1HQEB 2C28A 1LW2A 1HA1A 2MYFA 4EMDA 3KLGB 1C1BB 2GJFA 4P6QA 3EUNA 4ZPVR 3MEDB 4WKYA 3MM5A 1T11A 2ZC4A 1S48A 5KFYA 4CO1A 1GMWD 2NR0A 4JI5F 3FFIA 1YSJA 1UVKA 4ED4A 4B17A 1N48A 3SFUA 4YHHJ 4BHQA 2DYAA 3NRBA 2LQ8A 3EZOA 3MMCB 2HVIA 2VOPA 1YJRA 3KK3A 2EBEA 3EVWA 3IWNC 4ZJQA 5CH7B 3LAMA 3NXZA 2HWIA 3QRRA 2WRMA 3CTRA 3CJ3A 1HFEL 1S76D 1NJYA 2BOAA 4HHUA 1JMTA 3EICA 1FDAA 2YQ1A 4USMA 2Z2ZA 3RTVA 2F5GA 2DR8A 3BQ1A 3C15A 5L1LA 2HHQA 4RBUA 2F9JA 4CLZA 4LRFA 1K1QA 3ETOA 3MPDA 1S6UA 1W7WA 4KC5A 3FZBA 3L7UA 1Q5VA 3CJKB 4GVLA 2WVDA 4RW8B 3ZZUA 3WIVA 1WEZA 2V5HG 4DL0C 1FRLA 2HYIB 4HI2A 4HDGA 2YNFA 2HMIA 2CQHA 1RACB 3PY8A 2H51B 1FE4A 2J6UA 1EHWA 3AT1B 2QMWA 2EBGA 3HD2A 4PPDA 3QNWB 3DU5A 1S6QB 1VRQC 4QIGA 3RBDA 1R31A 5KFQA 2CQ1A 4KE5A 2YTCA 2HRTA 4QCLA 4NA2A 1YHQS 1ROFA 4UOFA 4J9RA 4EEYA 2DGQA 3OUYA 2P2CB 2KXNB 1BWEA 5J2QA 3NBPA 5J1EA 3JSYA 2A2DA 2DNQA 2GMJA 4EZ9A 5D4OA 1DTQB 2VQEF 1CJUB 3KLHB 1RAIB 2ALYB 3UPFA 5DDPC 2ZM6F 2OEMA 5IT4A 4Q7AA 2HW3A 1WF2A 1U6ZA 3GFZA 4Q2MA 2KXFA 4K0KJ 1N5SA 2UUAJ 3LP1A 1TKZB 1B0PA 3R5DA 2AJFE 3RBXA 1JX4A 4WPAA 3M2VB 2HEKA 3FSIA 2WHOA 1F1BB 2KJVA 1LW0A 3RB6A 5IT0A 2NZCA 1S1TA 5IC4B 2G2YA 2WSCC 3UD5A 4RW8A 1MWQA 1YK9A 2AYEA 3V4MA 3PKYA 1X9MA 1EQMA 1AXQA 4FKYA 1RBLA 3IRXB 2LLZA 1JNZB 4V1Ak 2GO9A 3PHTA 2Z30B 4YDXA 2RQMA 1T02A 2VDIA 1WOOA 3M30A 4DL3A 3BPDA 1VC0A 3V6DB 2G9OA 2APOA 2BYCA 4NA3A 2UXCJ 5DETA 4ED2A 4CYUA 2KTQA 2HNDB 5D3GA 4JI2J 4QR0A 1HWUA 4ZJLA 1TAUA 1B7FA 1PYTA 4FS1A 3JB9k 1Q16B 2C3PA 2IMOA 1S0OA 2E5HA 1QM9A 4P2MA 2AX1A 3RAXA 1KSPA 1KLMA 3G8QA 4OZ1A 1F0XA 2D3O1 5GMDA 1KOHA 3M2UA 4ICLA 1IJFB 4WU2A 2HGLA 3R7NB 1CBKA 3SSSA 2XY7A 1TMJA 2MDAA 2NXEA 1HR0F 2HAFA 1Q82T 2BX6A 2FJXA 4CZCA 3TZYA 2F65A 2J76E 3ISZA 4K4YA 3PG9A 2MQPA 2IMWP 4MKBA 1XR7A 4OFZA 2HHWA 2AW0A 2J9DE 1EP4A 3H8YA 2BE2A 1YTYA 4FZVA 3WC2A 3EPGA 3M2VA 4WFBQ 4CLSA 2HBYB 2JWNA 4K4SA 4NEZA 2JEGA 4KGXB 5A76A 3DCAA 3OSNA 4JBCA 3SCIE 2UV8G 3KJVB 3G4SS 1T03A 4IFVA 2HZVA 5DQHA 3SDEA 4FVCA 1SQFA 4MFBB 5HBMA 3IRXA 1GXTA 2XNRA 1VQSA 5ETVA 1UFLA 2LECA 1VQ9S 4RW4A 2QFIA 2OAUA 4U7CA 4CLTA 1F9FA 2A6OA 4WU3A 4DPOA 3IGVA 4U6PA 3E01A 2VA2A 4I2PA 3D0IE 1L3TA 3I96A 4ZKAA 4NLWA 3ZNJ1 3F0NA 2DVIA 2R42A 4ANEA 1WG4A 3M7VA 3MAAA 1BQNB 1URRA 2H4YB 3MR3A 2X1AA 2W1BA 4MIWA 5DJBA 3MCOA 1P27B 1YBTA 2ZH2A 2BJ1A 3A13A 4YMEA 1EETB 1W2IA 3CEDA 3NS6A 4NXMF 2GV1A 3QWUA 4J37A 4TXSA 4WF9Q 1R7IA 3ICLA 1VIOA 2VUGA 2RNEA 1C4CA 4J9MA 2ERRA 2ZDPA 3X3UA 5A0YB 3QT8A 5ETPA 3GU0A 4NXNF 1MROB 1EKSA 1T7PA 2XSJA 1X31C 4YP3A 1VBZA 1X9SA 2ZHAA 1ZH5A 3H42A 4EGLA 1NJWA 5KT3A 3QFHA 3MPYA 4NPOA 4OI2A 3NOGA 4QU6A 2N82B 5E41A 1N8RT 2AJ2A 4DF8A 2FVSA 3PVXA 3DGPB 1S7HA 3OFFA 2J0QD 4RKUC 2VFUA 2WTFA 3KLVA 3CWJA 1SVDA 3GB0A 2FJDB 4BCAA 1T9XA 1SKUB 3RBZA 4DSLA 3DRSA 1IR0A 5DG7A 1JWWA 3EZ5A 3MTJA 2KRBA 1ZBTA 4ZLJA 2EI5A 2R9LA 4M5DB 2NZ4A 5KTQA 1DRZA 2Q43A 2MJNA 2DNOA 1B70B 3KHGA 2MLYA 1HI0P 1U49A 2RIJA 4KHPF 1P1LA 3CCTA 3CIZA 2JOQA 5D0RA 3T6JA 3DDIA 2DNHA 4RO0A 1NEEA 3NGRA 2LQ5A 4M5HA 1EETA 3ENAA 3MM6B 2GO8A 2CDRB 3OVBA 4FNHA 3UCUP 1TU0B 2WSEC 3J80U 1C0TB 1HHSA 2RDDA 3DRYA 3GONA 2QA2A 4HHJA 2W01A 2M7SA 1HBNB 1ZAXA 3US5A 4P2XA 1HD0A 4E98A 1S9GB 4CM0A 2BKOA 3A8IA 1X4EA 3E8OA 2K2PA 1DLOA 5T41A 2BRKA 3WQPA 3CCWA 3S6EA 4WFZA 2VPZB 5HAOA 3RUBL 4DV7F 2P5VA 1XTZA 3QO9B 1VC5A 5B0CA 5DDOC 4K4XA 2HHUA 4AE5A 1NJIT 2NYHA 3LGNA 1VRUB 2CQBA 1FDNA 2WVFA 1RT5A 2W4PA 1AFJA 2LDIA 4DUTA 3VQTA 4Q8EA 4UOCA 2B4UA 1HIYA 3PO5A 1NPRA 1C1CB 1RXOB 1UCNA 3CC2S 3ENQA 3ILIA 2W24A 5KFHA 3Q23A 1IM4A 2F4VJ 2MQMA 3W65A 5BR8F 1RT1B 1U1NA 2YWKA 5CYMA 5KFMA 3DDNA 3CDUA 4IO9Q 1UEVA 4CRJA 2D1CA 1U1OA 4OHXA 2JEJA 2H65B 1HARA 1XIQA 4OLPA 1L3UA 4P2FA 4A48A 1F60B 2R8GA 2UU9J 4XPEA 2EC0A 3ILLA 3EXYA 4O23A 4DU7A 3H5XA 2CPZA 1C0TA 3TUJC 4I68A 1SJ3P 3TA1A 3NNHA 1PG5B 1CJTA 4WYWA 4YY3J 3BGRB 3PO4A 4DR4F 4TU9A 3N28A 3ZTPA 3NKYA 4ILMA 4ILLA 2VHGA 1OSCA 4JV0A 1U45A 2VBZA 2CADA 3M8SA 4YUDA 3M8PB 4Y00A 3KLFA 4OI0A 3SCJE 2XWYA 2CVEA 3BH7B 3RZAA 2CZ9A 1GEHA 2J5AA 3CC4S 1MMDA 1HWJA 3QO9A 5EWGA 1V6HA 2DT9A 4ETXA 4KSEB 2OPRA 3E2EA 3QT7A 1NM2A 5I3PA 2ZH4A 1ZAVA 2FGCA 1GTEA 3T1YJ 2R7SA 3Q0AA 2YKAA 2F8MA 4TY9A 1SUQB 2BQ3A 2GAHC 1C1CA 4ECXA 5JMNA 2Q6CA 3PYGA 3TR5A 2HGNA 1NKBA 1Y11A 4B02A 2QMXA 3JTOA 1AFIA 1DTTB 3CJQA 3CJSA 1FVSA 4AFFA 2FLNA 1N54B 2AYBA 3VHQA 5LXRA 3GV7B 2JVOA 2YX1A 1WC5A 4O3PA 2GJ2A 2YWGA 4O3QA 4H4MB 3DOKB 3L3CA 3GG1A 4XDDA 2DGUA 1JLCA 2JH3A 5KFZA 4KO0B 4C8MA 3CDEA 2P8IA 5DLGA 2BBEA 4B9NA 2J7WA 1HW9A 2NUUG 1RT7B 3BO2A 2FJAB 5IFMA 3MR7A 2K8GA 3CMQA 4B3SJ 1S1XB 2R3VA 4QQBA 1DJ0A 4C3MA 3BGRA 8RUCA 5I42A 3X1LB 2J0SD 1NK5A 2CRLA 4USIA 1NNDA 5DM6Q 1ITPA 4DV3F 4RNOA 3M2RA 4AUKA 4ECRA 2C2RA 2CNKB 4AYBD 3M8PA 5FDLA 3CJ8A 4HTIA 3CCUS 3DMJB 3QLHB 2M4MA 2WB1D 2PIIA 2MB0B 1WKKA 2CWXA 3J7YI 3GR0A 3VCDA 4KGKA 5HMYA 4M5LA 1YQHA 4N56A 3QQCD 4DV2F 3H20A 3MMBB 3UCZP 4HACA 2IM1A 4CH7A 2C1EB 2XGPA 1EZZB 5FD1A 2V8GA 4CDIA 1UTAA 3DXSX 5FLXY 2OH2A 1ICEB 4OZ2A 3M6UA 4DL7A 1FWLA 1Q0NA 2XLKA 4G1PA 3PX6A 2AX0A 1U2FA 3NMRA 4FBUA 2V67A 3CCRS 2B9XA 2L3MA 4DUZF 1SKRA 1S6OA 4FXWA 2YNIA 3HPOA 3NEKA 1QSLA 4AXJA 3KXDA 2JRSA 4H4MA 5CAAA 3HSJA 2FHJA 5DDRC 5M2RA 4JI0F 1NO8A 2UUCJ 1FJCA 2VA3A 4DG1B 2HWHA 5ETKA 4DR5F 4KHRA 2XMTA 1S0VA 1JKHB 2DNMA 2HHXA 1KFSA 1IR1A 5KT5A 1SL2A 3MMAB 5C5JA 1N0VC 2NCKL 4EZ6A 5KT4A 1JXEA 2V0NA 4B3MF 2FPHX 4PWDA 4EYHB 1AUSL 2V94A 4C8NA 2BQRA 2DH9A 2QIFA 4YFUA 3SQGB 2AU0A 2GGPB 4JI6J 5HMZA 4P74A 1IQTA 3RBEA 4DQSA 5C7PA 1NK6A 4LF7J 5JVHQ 1CEZA 3HFVA 4I67A 4DR2J 1J27A 2PSZA 2H5IB 2VPXB 2VJUA 2QFJA 1B0TA 2N7CA 1SJFA 2KFZA 5LMUF 4KHMA 2MEWA 7FDRA 1K0VA 3THTA 2M88A 1JLFA 1OYDA 2RDIA 4F4YA 3IMQJ 2U2FA 2QC3A 1LWFA 2HFZA 3Q2SC 4LF1A 3K8WA 2QLWA 4J9KA 5J1NA 4CO0A 3HF5A 2QLXA 2UUWA 4D3GA 1K47A 3GG0A 2FJEB 4J9VA 4KJIA 3FGVA 2DR7A 3JQMA 3M32B 2PEHA 2K1RB 4DSIA 1C0UA 5A8KB 4DG1A 1M5VC 2ZZNA 3IM9A 2KZZA 1AA1B 2XZTB 1YIJS 4Q45A 2PGCA 1GH8A 2MZRA 2BDPA 1N33F 2FHOB 2ATCB 4WTOB 3QJPA 1WKLA 2MKYA 2R7WA 1HQUA 5F3TA 1OS5A 3RAMA 2A10A 1R6YA 1HI8A 1SCJB 5K8PA 3G6ES 1VISA 3DHXA 1XR6A 3RR8A 4ECQA 4GVBB 1QAIA 2ASJA 2H48B 5AE1A 2HSEB 3CJ5A 4JP8A 4FYYB 1FRKA 1WNEA 3CDAA 4MIAA 4R5PB 4OYBA 2LMIA 2CQ2A 1AROP 3DRPA 2GA7A 3TQEA 2ZD1A 1MMLA 5IM0B 3CVKA 1QDUB 2HFOA 1WUUA 3R5GA 3T1HJ 4N5SA 4LSLB 4RNFA 4ECUA 3UR0A 3K8VA 1UVMA 2V2VA 1RTIB 2G0CA 3QGIA 4X4RA 4DV0J 3R3TA 3EX7B 1J5OA 4J9OA 4C9DA 1JLGA 3M8RA 4B3OA 2NLWA 4C2MA 1R8AA 4PXEA 1FDDA 1TVRB 3PYEA 2QYGA 2BJ3A 3I55S 3CE8A 1QUPA 1HBUB 1RI7A 2PD1A 3UFCX 3D7SB 2RB7A 2VQFF 2HK2A 4ELVA 2XMKA 4LUBA 1T95A 2IYIA 4NWBA 4FF1A 5L38A 5L39A 3AD9C 3O44A 4MT1A 4XTTA 5LXYA 4OX9F 2WZ1A 3G96A 4N41A 3M6VA 3U7JA 1UVNA 1EB0A 4KTQA 1LWCB 2VBXA 1GK8A 2LA6A 4NEYA 2M70A 5F8HA 1HNXF 3OR1B 1KQGB 3R1LA 3T41A 1HWIA 3GIIA 2DISA 1D8ZA 3DLEA 3I0RA 4OJHA 3VGVA 3C16B 2RU3A 4FYDA 4PYAA 5ETMA 2EFPA 2B6AA 1JQGA 3PIPQ 1K44A 1UVIA 5KOWA 4CT8A 3OVSA 5L46A 2Z57B 2M8DB 4P72A 2ROGA 2C3YA 4EO6A 1HNWF 1MMNA 1TKXB 3OBIA 2CQ0A 2E7XA 4CH1A 1Q8LA 4L73A 5HO4A 3QZ7A 3FEZA 3QGGA 3HMJG 1S1WB 3TYTA 3VZHA 3TUZC 2KI2A 2MZ1A 1EIYB 1SQGA 5IM0A 5HROB 2ZUGA 3Q89A 2ADCA 4RUBA 3M9NB 4PWWA 1U48A 2B56A 2OSRA 3I4HX 4LF9J 4DX7A 3LGMA 1DARA 3CGIA 3IXQA 4YB7A 3K0JA 4IDKB 3G8SA 4NYOA 4PR6A 2VODA 3O6QA 3P49B 1KEKA 1U02A 2F4FA 2XYHB 2AYGA 1MWYA 3OFHA 4NA1A 1IBKF 4IOAQ 1RU1A 2AYMA 4GKJJ 1R8PA 4ZIWA 4CTAB 3PRDA 3MAHA 5B08A 2KHCA 2Z58B 2ZNZA 1TK0A 5IQ6A 5GVQA 2OTLS 3S1TA 3M05A 4PQAA 1X5TA 4C48A 1R8HA 4ZITA 4LQ3A 1H72C 4K4WA 4JV5F 3OR1A 4AQYF 1B3TA 2V68A 1SJ4P 1X4CA 5MLCV 1S1UB 1X7VA 1ZPWX 1U1RA 4M63A 1B4SA 1MNEA 3ENWA 3H5SA 3M8QA 1ZPVA 2MKSA 1ZA2B 3QJJA 2OGUA 3G87A 3D6HB 4OI1A 2CPIA 1K8AT 3RAQA 4DV5F 3LANA 3PRVA 1T9VA 1RZMA 4CLUA 4DV4J 3CMAS 3PZPA 4KGMA 2CQ3A 4NCBA 3R5BA 1VMBA 2RSQA 3QIPA 1RB0A 1UW4A 3OLAA 4F8RA 3BJYA 2ZOMA 2CG4A 3FBEA 5LL6d 3SI8A 2D3OR 1U26A 4JYAJ 2OPSB 3C6TB 2JJ4D 1UVJA 1V3SA 3Q8QB 4TU8A 1TL7B 2YWFA 1YBAA 3G6VA 5CD4A 1PYOB 3DLGB 4QWDA 4NLXA 1S77D 5A8RB 4M95A 3GR1A 4X65J 2RVJA 3Q8RB 1NK7A 3MECA 4G3IA 2MTLA 3A3PB 1IBLJ 1NCLA 1SC1B 4ZK7M 3VGTA 3I9ZA 2WCXA 3GIKA 3TZXA 5EX0A 4L72B 3K17A 3G82B 2HS0A 3MCMA 4LREA 2H4WB 1YJVA 2KVIA 2M52A 3GFHA 4DZDA 1LXJA 3N5BA 2HG4A 1N34F 4F0KA 1N32F 3GCWP 5CZXA 4MJKA 2SXLA 3TEHB 3AQPA 3ZTSA 5AXNA 1YRTA 3B8HA 2MQ8A 3M4XA 5KFFA 2W7OA 2NPFA 1SKWA 1FTRA 2K06A 1D1UA 4LFBF 4TQSA 5D0HA 3WHIA 5KFVA 3QT5A 3R7BB 2PC6A 5KFIA 2YNHA 3UQSA 3D1HA 1TFWA 1HNIB 2H5JB 1IKWA 1MU2A 2J9EA 1SKSA 2PN6A 4JI7J 3D9BA 1H7XA 4YR3A 4OV1A 3K5MA 4RUAA 2VD3A 5LMNF 1FEEA 1WC4A 5B0GA 4FKXA 2FC8A 3HSGA 1CQNA 1SJQA 4TQRA 2BKPA 3GWCA 1NDCA 4XK8C 3HCXA 4C8YA 4OYPA 2CVIA 3D66A 1R0BG 5EWEA 2BMBA 1SI9A 1L5UA 4QOTA 2C2OB 1J5EF 4IG3A 3I0SB 5GAHI 3DLGA 4F0HA 1PC5A 3EWGA 1NKCA 2EKNA 4IOBA 3VAFA 2WOMA 2Y3YA 3SZ2A 1OYEA 3C3LA 4K2XA 1UJ5A 3HVTA 4LF5F 3BO4A 4J9NA 1YVFA 2EVZA 5D78A 1DY3A 3GYGA 4JI4F 4NCGA 5RUBA 4LF8J 2E1CA 4EFAC 3FUYA 1VQOS 4LFAJ 4X4NA 1U1LA 3ZFVA 1CJKB 2PO4A 2VFRA 3TAMA 3IP0A 3IBFB 1BGXT 3HHDA 1G4CA 5T7LA 4ZIVA 4CP5A 3DOMB 3JYTB 1TL3A 2PT0A 3MF5A 5A6WA 3J7A1 2UXDJ 3J81Y 5IWAJ 2E7WA 4RX6A 5B0DA 2AJ0A 4DR7J 4ALZA 4L3NA 4U95A 1TKTA 2BA9A 2DRDA 4R8UA 4C7QA 3MCSA 1S4EA 3JSMB 3IO1A 1HBMA 4ZPAA 1GFWB 3N5FA 2OPPB 3BBFA 2DR9A 2VIHA 3RR7A 1FK9A 2YNGA 1ZYQA 1M5KC 5E5NA 3ILOA 3KG4A 4DCOB 2XCAA 1W2BR 4A8WA 2FIUA 2YX4A 3PR4A 3CCSS 2YKOA 2M3DA 2QJ3A 3PIOQ 4ILRA 1KNZA 1BQXA 5J2PB 1MW7A 1IVZA 1FJEB 1X8DA 4RW6B 2X3DA 1AW0A 4N76A 3UD3P 2HQCA 5C42A 3M6XA 1N52B 4F7VA 4O3SA 1HPZB 3TP2A 2E1MC 4B3RJ 5KFAA 1VFJA 4C3LA 1XQIA 3PW7A 2DPIA 4H4OB 4RW9A 3AOCA 3P6YC 4ZPBA 3JAMY 2M8HA 1IN0A 2O67A 1S0MA 4OIXA 2MKJA 3PV8A 4LRAA 4O3NA 2W9BA 2UUBF 2QYCA 4QW9A 4DBQA 1NSPA 5HP1B 5F9LA 1CJVA 3C8YA 2D3ZA 5EUHA 3LP2B 2CJYB 4IKAA 5HVGA 1RBOB 2IVYA 4GRSA 2HHHF 3FEXB 1QAYA 3I6PA 3JTNA 2FDNA 3BKFA 2I2YA 4LF2A 5E2QA 4HT5A 4OMFG 2NPIA 3JSMA 2DEIA 2GJIA 1OY9A 4OHVA 3BKTA 4YS2A 3Q8YA 3TEGA 3LAKA 4QYZK 1NUEA 4I6WA 2IC3A 3QT6A 3TQ1A 4PXDA 1F3FA 2Q1LA 2DNPA 1U1PA 4FPRA 3BBCA 3B4MA 1I94J 1UFWA 4NLRA 5KFEA 1T05B 3ISND 4FYWB 1FI4A 2MLXA 2L9NA 1FKPA 3I9V9 2HFUA 4Y3CA 3QSIA 3L09A 4O3OA 2KHDA 4NRTA 4DZ6A 1V3RA 1YJ9S 1Y5NB 4JI5J 1EX8A 5ETOA 2ZKUA 2WBRA 1APSA 2RKIA 3VAMA 3NCRA 3CJRA 2NXNA 1RTHB 1O8BA 2P9CA 3MFIA 2RDJA 2G0IA 1M5PC 1HPZA 4UZCA 3W66A 3TUPA 4NLVA 4ZCMA 1N5YB 4U67Q 1VQ6S 4I0WA 3MEGA 3DRRA 1XBWA 1XK8A 3ZZPA 4QIEA 1JJHA 2IJNA 3BGFA 3GPAA 3DLKA 3KNGA 1NK4A 1IM6A 5J1PA 3J81j 1ZZFA 1VIXA 4LF4F 3FQKA 1KTVA 3LP2A 3G8TA 1RWUA 3R6LB 3TVYA 1KN6A 2COLA 4X84A 1YZ7A 1AZSB 3C6UB 1YI2S 2OP5A 3HT0A 5T14A 3D6FB 5A2QU 3A4TA 1JXLA 3DYAA 4O44A 2BEFA 1VRTA 4K7QA 3B54A 4PG8A 3V6KA 1FXLA 3AY0A 1LFWA 2M2BA 3J7ZT 3BQ2A 2HRUA 4PPZA 5KFBA 1QY7A 4DR3F 3KDNA 1RAJA 1HWKA 5KFGA 3THPA 2EWHA 2DK2A 4J9SA 4L76A 3BBBA 2E5GA 1H2VZ 2JLFA 4MH8A 1MG7A 4N47A 3AQOA 1UPMB 3W9JA 2FVRA 3SFGA 2N4DA 4WTYA 1NH7A 2KFYA 1EQ0A 2B9YA 2LU2A 3I5AA 3MM9B 3W2VA 1UJ6A 3GIJA 5DQIA 5D0EA 2IIHA 4ZP6A 1XERA 3BR8A 2FGOA 4RU2A 1N5QA 1N5YA 1WC3A 1KP6A 2IBKA 3GYXB 4HHHA 2VQEJ 1VOMA 2GNKA 3CW2C 4WZQA 2RHQB 2ZM6J 3NAIA 2DHHA 4P73A 3IBWA 4URGA 1UWBA 2ABYA 2F1FA 3DDKA 4HR2A 1UZDA 1Z2LA 2O1PA 2W7AA 1NB2A 2XYGB 1H6KX 4MTPA 4RJVA 4HH0A 1GQEA 2Z0GA 4HEA9 4ZVEA 4Y6IA 1RHJB 3JSBA 4N8OA 4ZVRB 4F3QA 2ATLA 4RL1A 1RWXB 4W92B 3KG1A 5GMEA 2AGOA 2KKHA 2B4PA 4E0DA 2ZITA 5DG8A 1KQFB 2WONB 1LWXA 2B51A 2HFVA 1AZSA 5K8OA 1TV6B 1GTHA 1WC0A 4QIWD 2VBYA 1WDDA 4TLRA 1KHWA 1RBAA 2MLZA 1KKHA 4KQZA 3HVAA 4HDHA 4DPUA 2HBZB 3KNAA 2FJWA 3OL9A 2CPJA 3HSDA 1VHIA 5IOLA 2PFDA 1SIZA 2E5LF 3RGIA 5KFPA 2CIMA 2Y1IA 4UQTA 5IC6B 3ITHB 3MAQA 2J6SA 4UTGA 2DGXA 3G2XA 1F2HA 3OXGA 2R4FA 5AXKA 4OJGA 1FX4A 2VC1A 1GAOA 3MM9A 4MK9A 1VS3A 1S72S 3A8KA 5JXSA 2CQDA 4ZHRB 2VG6A 2FHJD 1KLNA 1B7YB 4LBIA 4EWTA 3NLCA 3SCLE 1NMEB 2JDJA 2UU9F 2NS1B 2YX7A 3GV5B 1Y4ZB 1U0SA 1X5PA 4QW8A 2XY5A 1S9EB 2G0JA 5IT9Y 1A9NB 1XN9A 2CPDA 2CWKA 1HR0J 3JSRA 4UQGA 2QA4S 3CD6S 5J2MB 4JOUA 3D1QA 3DM2B 2BM0A 3CPWR 3UVJB 3FVYA 2DNGA 2CQPA 5KFOA 4J9QA 2BUNA 3W8GA 4C97A 3HFZB 4X2BA 1TV6A 3V6HA 2IA0A 1DQAA 3UDLA 1JNRB 4OYOA 2OEKA 3U27A 1ZS6A 4G1QB 4YOEA 2R7XA 1U0HB 3O5TB 3CCMS 4J91A 3EGWB 3UN2A 4X4OA 3JXOA 3DOLA 2VFVA 4TNOA 1BY9A 5DZ7A 1VI7A 1P1TA 3Q8UA 3OTOF 2YY3A 5HATA 3U1MA 3ITHA 2C3MA 3V81A 1JLQA 2LA4A 2UXBF 2WVCA 2W9AA 3MGJA 3T5JA 3RYLA 2RRBA 4OHWA 2OFGX 2C2MB 3D54A 4USTA 3UDVA 3TVKA 4NI2A 1S57A 3R2CJ 2E1RA 4DN9A 1WTBA 4O4GB 3BREA 4NXMJ 2BANB 2RT3A 1V5IB 2WSFC 2A1BA 1M5HA 3I87A 1CSJA 5HL7Q 2LCWA 2VG5A 1UW9A 3DI6B 2J8SA 2N4CA 1X4FA 5HSPA 3QRQA 1XWLA 4NXNJ 1C2PA 1S9EA 3GP9A 4OI6A 5KG1A 4ED3A 2O3DA 4DS5A 1VBYA 4KGZB 3O3LA 4WIQA 4LR7A 3UVJA 7AT1B 1G2EA 3AOBA 2HLTA 3QSYB 2EKYA 1SL1A 4HL9A 4HVZA 1YKWA 7FD1A 2NQPA 2GFFA 2O01C 4RLEA 3I5CA 3TZZA 1NSKL 1LV5A 2MY8A 3HXMA 1ACMB 3C66A 2X1GA 4B9LA 4UT4A 3PEJA 4ZPTR 5GAEU 2R8JA 4G1QA 2YKMA 1PC4A 2CQCA 4ID5B 4EK2A 3AA8A 1UVLA 1IKVB 4M5KA 1UP1A 1PSDA 1TQLA 3HM9A 2HURA 1WI8A 1DZ5A 1N88A 2AV5A 5CZVA 3TJ9A 4A8QA 4IQMA 2IVFB 3H5YA 3AFGA 3GSDA 3MM8B 4X4SA 2FHMA 3PW0A 3QMQA 3OFGA 3WDOA 1HYSA 4KHPJ 1UA1A 2DCUB 1SBRA 2V9WA 2J0XA 2EPIA 2VB6A 2EFOA 3GFXA 4LFCF 1SQEA 2Y8YA 1H2UX 2ZH3A 3SYZA 2ZZMA 3OD2A 1BLUA 2GC8A 1VBXA 5J2NA 3DI6A 2LU1A 1RQ0A 4IH7A 3M9OB 2ZUAA 3MI7X 4IYQA 4PXCA 4LSNA 4KRWA 5AJ3F 4FPIA 1SV5A 2LFVA 4KKOB 2CZVC 3Q22A 5DM7Q 5KFKA 5KT6A 4FP9A 4IUFA 3GYNA 3W7BA 5I3UA 1F5CA 1ZTTA 2WVBA 2JVRA 2KRRA 1UWAA 4X4PA 1RT2A 2OO4A 1S9FA 1DHMA 3PJXA 4DV7J 3FMWA 1OQ3A 4YB5A 3W63A 1VGYA 2HHVA 3L7OA 2W7PA 4WP8A 3SEOA 1VQ4S 4XAKA 3L9ZA 2RF2B 4TYBA 2Y1JA 3RRKA 3AH6A 3H2VE 3IAS9 4G1IA 2ALZA 3FBBA 4P75A 2OMOA 4FF4A 4DUYF 3KLIB 2BJEA 3Q83A 2MKIA 4X4UA 4GKKJ 4X4QA 2Q3PA 1RTJB 2LVWA 1FX2A 3PFOA 6FDRA 8AT1B 4LVNP 1G7CB 3I31A 1NZAA 2GHPA 1WF0A 2W8LA 1HQEA 1U8SA 5CXTA 2OLWA 5BR8J 1IJEB 3K2YA 3KLGA 4PUOB 1C1BA 4P71A 2MQLA 2OMLA 1JJCB 1SH2A 3W60A 3OHBA 3MEDA 1BC6A 5AXMA 1YJ7A 3U1NA 3EGNA 4PXBA 1B0VA 3NMAA 4F0MA 3U02A 2B8PA 4Y2AA 3PYFA 1FRHA 3D0GE 3D68A 2ZOGA 4USJC 3MMCA 3TANA 5F8GA 2Q66A 2ILYA 2XSFA 5KFWA 4DQQA 3T9NA 4TY8B 4B9VA 4ELTA 1FNXH 3W62A 3MR6A 1Z4UA 2UVRA 4K5SA 2Z2YB 4DR4J 1VQ5S 3FC9A 1HKAA 1MN9A 5HQ8A 4J5OA 4UZBA 2MQNA 2JEFA 1YJTA 2DNYA 1WEYA 3EYZA 1SC6A 3ET6B 3HT3A 3LQVA 3O8WA 5E3PA 4O4RA 3UWTA 4U7UK 3BYRA 2XCPA 2M5YA 1N36F 1S6PB 1JK9B 2KN4A 4OZ5A 3W5YA 2WK4A 1NU4A 1NSAA 3CJKA 3P4UB 3NOCA 2RF2A 4AL6A 2M9KA 2PI5A 4QYZJ 4G65A 5ADZA 1TFYA 2RQKA 3LA0A 1U1QA 2HHSA 4Q8FA 2PFFB 3T9ZA 3IA0A 2JLGA 3EDQB 2KB2A 2BRLA 3HKZD 2HVZA 3ETMA 4IRKA 3ONQA 1Y7PA 1GXUA 3UDCA 4ED7A 4H4KA 2GVZB 2UVUA 4QPXA 1N5VA 3BPSP 1OQ6A 4B9SA 4ZLPA 3KLEB 4K2JA 4KFBB 1S6QA 1HNZF 2Y8WA 2F8HA 5EDWA 5HMWA 4C11B 5GMKa 5DG9A 4LF6F 5IS2A 1G1XA 3PM9A 4EBEA 1R27B 4L75A 3LWLA 1WD6A 4R25A 4IH6A 4DV0F 4ZVPB 1HWLA 3VTIA 4DR6F 4LRBA 4ECYA 3I4PA 3FRZA 2HRYA 4QWCA 3MUTP 1HI1A 3AJ2A 2D9OA 3DLJA 4WXWA 1FHTA 2W9CB 1WKJA 4LT6A 1NAQA 5F8IA 1DTQA 2JFDA 4DF4A 1HHQA 1CJUA 2XS2A 3AOAA 2Z2MA 5B0BA 5D4PA 4DS4A 3KLHA 4Q5VA 3FCVA 2QX0A 1BWVA 1R0AB 4A47A 4IQXA 4NL5A 3D6MB 4OYAA 3BSAA 2P6TA 2V63A 2J7KA 3WX4A 1KDNA 1TKZA 3MXHP 1YG0A 4CNYA 1T3OA 3MM7B 3NS5A 3DLLQ 2CFXA 4FVMA 2V8HA 4WZMA 5K14B 4DV1F 3TARA 2DNLA 2OTJS 2I6WA 1V5VA 3AD7C 2DBBA 5C24B 1U2RA 2UUTA 1ZZNA 4DV2J 3N79A 3KWMA 2IA6A 3PX4A 4FXDA 4DR1F 2K3IA 3DHWC 3KUEA 2V2ZA 4NLGA 2DGWA 4X62F 1HL6A 1KFDA 3ZNUA 3H59A 1Q8IA 2GVZA 3KFWX 4NX9A 3LUYA 4JI3F 5HLFB 4KFBA 2YKPA 3LP0B 4DUZJ 3D5MA 1JLEB 1RTDB 3V6DA 1WSVA 5F0UA 4J90A 1N4LA 2XYPB 4JUZA 3WC0A 2HNDA 2HQIA 2UVVA 3E51A 1O6XA 2I8EA 1IKXB 1NH8A 1IBMF 1YLXA 2ZBPA 5E33A 3W2WB 2GVDB 2XC9A 1X9WA 1IWGA 2HNZB 4ZJOA 3BS9A 3N6LA 4JI0J 3HD1A 1X0FA 4URQU 2MMYA 2V8DA 1I51B 1RTZA 4DR5J 3KOAA 3VAGA 3UE2A 2JZ5A 1S1VB 4JI8J 3GV8B 4NMLA 5CQGA 3DRXA 1CVJA 5SZTA 4QZVB 1R0AA 1NHKL 4NASA 5JJBA 3DN9A 1D8YA 4YB1P 4USWA 1CG2A 2CXEA 5F41A 4IOCQ 1XMOF 3KMSA 4U8VA 1FRXA 4Y2KA 3V4IB 3R27A 2ZC3A 3NCQA 3HI9A 2BACA 2LYVA 3A1YG 3CSKA 2XLJA 2RRNA 4RU9A 3BSNA 3QRPA 4DLEA 3FSXA 5FLXU 3BR9A 5C24A 1OY8A 2KT2A 1YDLA 2H1YA 2V69A 4KPCA 4KPYA 3LGHA 3KJVA 3UNYA 1SJRA 4TN2A 5GAGI 3OL6A 4UW2A 4C8LA 1TMMA 4G6VB 4CCHA 3Q8SB 3HHLC 2V4RA 4MFBA 5LSOA 1YZ6A 4UF4A 2F7VA 2R7QA 2PA8D 4RBVA 5LMUJ 3V5RA 2EFNA 4LRDA 2DR6A 4DOZA 1U6FA 2QLBB 3FBFA 4MMOA 2DHSA 2DGTA 3V2UC 4K8RA 1RTDA 4UOGA 4OJ3A 1FJ7A 3CO0P 3BEGB 2VG7B 1IKYB 4ZP8A 4OHZA 1BQNA 2A2CA 3TA0A 5HI7A 2IFXA 3TRGA 1ZAWA 3EZUA 1ZM9A 1HBOB 1Q79A 4RW7B 1OSDA 3OV7A 1N33J 5A0YA 1RWWB 1MROA 2QE5A 4WFYA 2E66A 5DGBA 5D4NA 4PCQA 2PMZD 4ZDNA 4L74A 4LSZB 3TAQA 2BABA 1I1GA 4ZPWR 2MSTA 1RAOA 1P9YA 2DNKA 2R2UA 4NOHA 1EJ7L 2E5JA 2QG9B 1E6VB 1VJWA 4I4BA 1QE1B 2AP6A 4GMKA 3DGPA 1IBCB 3IG1B 1TUVA 2B5JB 1NRKA 2VC0A 4O0NA 1UEKA 2I1RA 4FYXB 1QTMA 1HMVB 4CI0B 4PG7A 1RT4B 3ZTOA 2QGFB 4KV8B 2G2OA 4WCEQ 4M5DA 2E9RX 2GHVC 2IY5B 4WBFA 2AGQA 2R8HA 1GXLA 3UN5A 6AT1B 3RJMB 4NMXA 4DCPB 3QGPA 2DH7A 3KKFA 2J7UA 4OL8A 4PWUA 1RCOB 2JX2A 5SUHA 2G2ZA 3VAJA 4ECTA 2VQFJ 1U6BA 2OPQB 2IAJB 3MM6A 1J2VA 3BV8A 3FDSA 1UA0A 4YEAA 4NRUA 1S49A 1NK0A 4RUHA 4OX9J 5KOXA 1IXKA 5E3CA 2MQOA 1RAGB 4IG0B 1R6VA 3GE9A 1FFGB 1HBNA 2KG1A 1HNXJ 1WHYA 4X66F 1S9GA 4XDCA 9ATCB 1Z2ZA 3J7AN 3KJFB 4Q0BB 4WP3A 4YN3B 5L1KA 3KHHA 2POKA 3IS9B 3R1HA 2F8EX 3OR2B 2B4OA 1RA7A 4LMZA 3H2LA 2R2TA 5D4LA 4P52A 3VGSA 1TKDA 1RDRA 3TUIC 3BSOA 4F2SA 2I5JB 5IQQA 1HNWJ 1P8GA 1RHKB 4AL7A 1RA6A 4ES3A 4LFAF 2LXUA 2W2PP 4O3RA 1VRUA 1KOOA 8ATCB 5IWAF 4CO3A 1SPBP 5LJ5Y 3PW2A 2XMUA 1RWNB 4ZA1A 1UFKA 5KFSA 1Y9OA 1NBEB 2CAJA 1GX6A 3CCQS 3MPVA 3HVRA 1H0HB 2GS8A 3QAUA 4F04B 3C2PA 3BO3A 4I7FB 1RWOB 3FSYA 4KB7A 3QYYA 1RT1A 3K5OA 2DRAA 1S10A 1W25A 5D77A 1C4AA 3KG0A 4DV6F 3HDSA 3OLBA 1VQYA 2MXYA 4A8YA 4WWSA 2ROEA 2BJDA 3MM5B 2OPQA 4CT9A 1MWZA 4FYVB 3AJ1A 1SC3B 1Z1ZA 2O5DA 2YVSA 4TVAB 1NJXA 5LOQA 3FCWA 4GC6A 4ERDA 1T9YA 4DPTA 1WACA 4B3RF 2AJ1A 1LK7A 2W2OP 1FKOB 3BN4A 3MEKA 1FNMA 4AQYJ 4JV5J 4TU7A 3L7PA 3OQ2A 2V2KA 4NLTA 1VYAA 4Q0BA 3GJTB 1SIWB 1QVGR 3O2IA 2BM1A 2RU9A 2AQ4A 3FK4A 3OR2A 3CCZA 2FB0A 4EYIB 2IYGA 2B0GA 3C15B 4M8LA 1B99A 3SBMA 3CJ2A 2HK3A 4A8KA 2I9SA 1F2GA 1KVIA 3SQOP 2L9WA 3R5JB 1V9OA 3S8SA 3CULA 2AKWB 1VHFA 3HX9A 2X7IA 5KFTA 2FD2A 5KAKA 3PNIA 4HI1A 3R9LA 3G6YA 2B7CB 3MR5A 5BYSA 2XY6A 4DXLA 1FJGF 1SUQA 4ANCA 2MKCA 2YNFB 2HMIB 2KYXA 5A8WB 4I56A 5ITHA 5E7OB 1L3SA 1DTTA 4F4AA 5FIIA 4X64F 4QWAA 2E7VA 3DGVA 4IR9A 2XI3A 3TJAA 1XNRF 3CCES 2WW8A 2XGQA 3DOKA 1WF1A 5C2GA 4LIWA 5AE3A 3D3BJ 4KO0A 3RW7A 4IRDA 3DC2A 4L6V3 4MKVA 1RT3B 3OUYB 2CJBA 2DGOA 1NKEA 1RWPB 3W64A 5J2QB 1M1KT 1RT7A 3NBPB 5J1EB 4CO2A 5B7WA 1S1XA 4C98A 1FKOA 2IJRA 3PRBA 2AWZA 1R8CA 4DL6A 4M5GA 2P9GA 3BGUA 5KG7A 2LXIA 2W25A 3HLUA 2Y0BB 5AT1B 1N56A 3B78A 1N34J 1IR2A 2CJ9A 1N32J 3M1VB 3R5CA 1NK9A 2H3EB 3PKMA 3DMJA 1IUJA 3QLHA 5BXIA 3GILA 3RW6A 1H98A 3LP1B 1RWMB 3ZZZA 1GMUA 4DPWA 4WFAQ 1Q78A 1Q7LB 1XEZA 2V8PA 1U4BA 4F26A 3KK1B 4LFBJ 2GX8A 3WZ0A 3H0PA 3NAHA 1FRIA 3HHEA 4UY8T 5D8HB 3NGDA 5THWA 3MMBA 4U96A 1LW0B 1TL4A 4C6AA 1KQKA 5C25B 4OYIA 3SCKE 1QD1A 1S1TB 3OTCA 2MPUA 1QUVA 4ED8A 3HK2A 5LMNJ 1XNQJ 4LJMA 3RB4A 4BS2A 3KDOA 5A8WA 1YJUA 2UZAA 1RJJA 4PG4A 4C3KA 1H74A 5KG5A 1XMQF 1PJ5A 1NZ8A 3JQJA 3M30B 4MKAA 3PDNA 1U2CA 3ZZOA 2HLUA 4CYUB 5D3GB 2QZ8A 1J5EJ 3MOJB 5LT5A 1U24A 4R0EA 4JB8B 4ZLNA 2CJKA 1RWKB 4A8SA 4B08A 1RT3A 3AJDA 1FD2A 1QTNB 1PILA 1SJ1A 1FESA 1JKHA 3M6WA 1D9DA 3QAEA 1KLMB 4LF5J 1MN7A 2KO1A 3MMAA 1HNVB 2A0FB 5D6GA 2R7TA 4JV1A 3MURP 3GTYX 4WP9A 3M2UB 4ICLB 5CCLA 4JI4J 3UD4P 3NGSA 2EG1A 3LALA 3ILJA 4F4ZA 4ECWA 3PYDA 3I82A 5ETQA 5EN1A 3M1VA 2ZJRQ 2HHTA 4MKYA 2F9DA 3SQGA 2ZH8A 2GGPA 2GIQA 1BMQB 2X1FA 1Q5YA 3BSCA 1S0NA 1F6TA 4DL5A 1EP4B 2PE8A 3KK1A 2X1BA 2BE2B 1X4AA 2AZ1A 1VQ8S 2AEMA 3UI3A 2BW7A 1S59A 1VK3A 5F3ZA 3V6JA 2D3UA 4U7UD 5C25A 2R2RA 1PKUA 2DRBA 4K5RA 5BJRA 1T03B 4Z7YA 2EK1A 1N5TA 3W9IA 4IFVB 3SDEB 2W2NP 1LWEB 5HBMB 1JLAB 4RW4B 2DNZA 4ZVGA 3SXLA 4ZOSA 2HVHA 2A18A 4ECSA 4LBHA 4B3TF 3QGHA 3E01B 4I2PB 3PACA 1U09A 1TTHB 2RHSB 1VQKS 5KT7A 1RSCA 1QVFR 3MAAB 5GAGU 4PQUB 3M32A 2K1RA 5L1IA 2B4VA 4RUCA 5A8KA 1YGYA 1DFDA 4FF2A 1NPKA 1CS4B 3AHPA 1NJZA 4MK7A 3MPUB 3Q8PB 1RGVA 1FERA 1YRXA 5HANA 1HNVA 2UUBJ 4C4WA 2QSFA 3OW2R 1Y3KA 2CNLB 1UETA 3J81U 2XSJB 5DQGA 1T9WA 3OL8A 2JC0A 3C14B 1KRPA 1U7LA 4QIVA 1VQ7S 5KFDA 4GVBA 1W26A 2HHHJ 2FUG9 3IWXA 4ZPCA 3R6GB 4BC9A 4K4ZA 2UVWA 2VKRA 4QR1A 4DFKA 4EBCA 5C2CA 1PAEX 2OI2A 2C2NA 4R5PA 1TK8A 2L08A 1O0PA 1G6BA 4F67A 3GFYA 4EU0A 2E1AA 4LQ9A 3F73A 4QWEA 1RK8A 3DRSB 3Q8VA 4DMZA 1LWEA 5E3QA 1JLAA 3A3OB 4LSLA 2QL5B 2ZH1A 4I6AA 1RTIA 3PFEA 3TI0A 1ZM2A 4TLQA 3UW1A 5DDQC 2NYIA 2H54B 4LVOP 1TVRA 2R7UA 5L8RC 3E3XA 4CLKA 3TO8A 2NXJA 3JAMU 1HBUA 3K89A 2WB4A 1EKRA 2CG8A 4PEOA 2YH1A 2BKNA 4PQUA 1X0PA 2HQFA 2QT7A 5H1SV 1TK5A 2R8KA 2IRXA 4N7TA 1NHVA 3HULA 5B0EA 1OJ4A 4M5JA 1CS4A 3M8ZA 5DO2A 2ZWOA 4F02A 4M5NA 1RLDA 3UDEA 3HZEA 1LWCA 5LSRA 3HSZA 2XQCA 2YQ0A 1RCXB 3W3SA 4LF4J 2MSSA 2LEAA 1FCAA 3C14A 3LOUA 2PA3A 4F50A 3C16A 3IR6B 3CMES 1U47A 3VF0B 3TOQA 3PCOB 4ZS6A 2L48A 1DLOB 1TKXA 1WHWA 2OFHX 3NP5A 2CPFA 1S1WA 1A7GE 3T5KA 1URNA 2GHWA 3CUNA 1D09B 1BHNA 1D9AA 2DPJA 5MAOA 5F8NA 1NPPA 3RB3A 5HROA 3M8WA 4DR3J 5AXLA 2Q6BA 3CF5Q 5HN0A 1RT5B 2DY1A 3FJ2A 1Q4RA 2XTJP 4Y2MA 1T3NA 4KYZA 4WK1A 5EHHA 1D3WA 4EBDA 4CLWA 2KM8C 3NY0A 2VJVA 4IDKA 3THVA 3GLJA 2XHCA 2HKEA 3MPWA 2LXFA 1Q7YT 5CYMB 3A8JA 4M5MA 1PBAA 3EXCX 4NZ0A 2YQ3A 4ZP7A 4CTAA 1U1KA 4YQWA 4F3OA 2RILA 4YHHF 4IR1A 3TNVA 3F44A 4CLLA 2EFQA 3U1LA 1YJWS 1TAQA 2ZDOA 1CJTB 1R8BA 2DXDA 1S1UA 4UY85 4WXOA 5CA5A 4F4WA 1FWPA 3GJQB 4FXVA 2CQGA 2FY8A 4NLUA 4OZ3A 2FLLA 1REVB 4DPYA 1FT8A 3KLFB 3D67A 5DGAA 1XR5A 2B3TB 2K7JA 4DI6A 2ZEJA 2GQQA 2IJFA 2F3JA 4F2RA 1I5OB 3A8EA 4FDFA 3DNCA 2IM3A 1UEUA 1X4GA 2OPRB 2XI2A 1S79A 3BDPA 2VPWB 4ZVOB 3RRGA 4I2QB 1SXLA 2E5LJ 2FLOA 5K8MA 1K1SA 4HKQA 5KFNA 2U1AA 2QA4G 4UUWA 4GKKF 4QJVA 3LH2S 4J9UE 4C8OA 4P10A 2OPSA 3C6TA 4AT1B 4OX7A 4OI4A 1TELA 2MZJA 3IC1A 1TL7A 3H5UA 2ZJPQ 1PCAA 4QU7A 2GQ2A 3SIPB 1FA0A 3GCXP 1FVQA 2DXEA 5A8RA 2PMWA 2DY9A 1RE1B 1JLCB 1NB7A 2AJQA 2V4JB 5GAEI 3G71S 4C0BA 4CNZA 4USVA 2DR5A 3VWSA 3L4BC 4WFNQ 3FQLA 2DGSA 3QJLA 1GX5A 2A6MA 3G82A 1UMJA 4Z37A 2BXJA 5IV3A 5I42B 5B0FA 1RWVB 2UP1A 3PW4A 3M2RB 2HWTA 2ZH6A 3D0HE 5KFJA 2HQ3A 5FDLB 4K0KF 2UUAF 1T8EA 2VH7A 1REVA 2G1DA 3N4WA 3OTDA 2CDQA 2EC2A 2ZBIA 2BV3A 2KFNA 4I64A 5H9FK 2WW4A 1YBUA 4CWBA 4YR2A 4WK3A 3DKDA 1RLCL 1HNIA 1GNKA 1TL5A 1SH3A 2CPXA 3KUGA 2HNYB 3RU0A 4HTJA 1ZETA 3IRWP 2EK6A 2RUSA 3LTOA 4I2QA 4HACB 2QL7B 3K57A 2K7KA 3OTOJ 2QRRA 2IM0A 2E5IA 1JJ4A 1X60A 3H7HB 2XNQA 4CLYA 5KT2A 1RYRA 4FF3A 2UXBJ 3IGNA 1X4DA 2PEBA 3TVZA 3VQSA 1JB0C 4QBUA 3D28A 2L9DA 3H98A 1ZM4A 1RU2A 3VAKA 2UXCF 3MTKA 2YNIB 4OJ1A 5KG0A 2E44A 2DNNA 4DPXA 5IT9U 1JIHA 3IM8A 3I0SA 4JI2F 5KFUA 5IXUA 4OI3A 3H25A 3F56A 1I3OB 2J9DA 2G13A 1WC6A 1KC8T 1AT1B 2V4JA 3Q24A 4CQ1A 3EGZA 1SH0A 3CT9A 1X5SA 3BDEA 4NLYA 4LIRA 4DQPA 4Q43A 2DHXA 3BYPA 2ZKTA 2MY7A 5ETNA 1UAWA 3AXMA 1BE4A 4NZ6A 2IBOA 1CC8A 2OKQA 1CJKA 4JI1J 3BQ0A 4PWDB 2JSXA 3DOMA 3JYTA 3QBCA 2K3KA 4FS2A 3CC7S 1B64A 3RRHA 4B9MA 2HVDA 3LO3A 2MJUA 2CPHA 3FNNA 4MYTA 4A8OA 4M94A 2N7YA 3QPIA 2C3UA 4F4KA 2YWWA 3HHKA 1UJ4A 2AEFA 2DIUA 2HNYA 2OPPA 3LF0A 2WVEA 2ZOFA 2CYYA 4NLOA 3ZZYA 3KK2B 4CH0S 4DDFA 1L3VA 4LBPA 2LQJA 3TJ8A 1X5OA 4P2SA 5IV4A 3LWMA 1Q95G 2Q79A 2ZZTA 4DX8H 3TWZA 2OEJA 2VV5A 4ATNA 2CZ4A 3HKWA 3HP6A 2FVPA 5H9EK 1JLFB 2C2DA 2OSQA 1FEHA 5J2PA 2FC9A 4LFCJ 3B4DA 4WIIA 1LWFB 5HJYA 4RW6A 2CJQA 2PI4A 4QIFA 3K58A 4H4OA 1RAHB 5AJ3J 2HHPA 3QZ8A 2KT3A 3JTPA 1C0UB 4LR9A 4E8UA 2JC1A 1KTQA 2OHDA 2H9ZA 2NUHA 1WI6A 1KWMA 3T19A 4DEZA 2VONA 1JJ2R 5HP1A 4OQJA 4Y0FA 3FZ2A 4JI8F 2RQ4A 4MAKA 1FD8A 2ZVIA 1HQUB 1S5ZA 2ASYA 1PO6A 6FD1A 2RD5C 4C8ZA 3QATA 3VAIA 2ZNYA 3J80Y 3OJUA 1Y00A 5K20B 1DBDA 2D69A 3NWRA 4ZN3A 4OZJA 2AIRB 4DFJA 4A4JA 1YJNS 2RMLA 2EFVA 5F0WA 2VASA 3K5PA 3OTEA 3IAM9 1HW8A 3CD0A 4ES1A 3EMTA 4KH0B 2J9CA 4ED1A 4DUYJ 4ZVQB 1FNOA 2W4CA 4PYDA 1A0OB 1EARA 2DB1A 5KG4A 5HQMA 5M2PA 2LDYA 3DRPB 4DFMA 3H40A 2EXUA 1OPIA 3HHLB 4A8XA 2ZD1B 3KK2A 3HZGA 2DHGA 2IRUA 4OX8A 1FO1A 4ZLLA 2ILZA 5KG6A 4H4KC 2CJXB 1T05A 2W8KA 3WIUA 2B9WA 4K59A 2HIQA 2MHEA 4OYZA 2FVQA 1OPZA 4BWJA 2HFNA 3BZQA 3TZWA 1PBUA 5B0AA 3EPIA 3FEYB 3G6XA 1J5OB 2ZBQA 1JLGB 4ES2A 4B3OB 4DCJB 1RTHA 3VR1A 5CCMA 1O51A 4TKTA 3N9UC 3MMJA 1Y0HA 2R2SA 2JFKA 2C2KB 3CD5A 2FYXA 4ECVA 5ETTA 1RUSA 2EEYA 3P8BB 2BOPA 4ZCKA 1ZTWA 4P7TA 3HVWA 1Y3JA 2GAGC 3SSRA 3P5BP 2L41A 2RQCA 3DXBA 3OJSA 2D7SA 3GIRA 1M5OC 3SV3A 1ZM3A 1VLYA 2XM3A 3GZ7A 3W5ZA 4AL5A 3KHLA 4NLQA 2IDEA 3DLEB 2GMLA 2Z8QA 3I0RB 2VFTA 1RHRB 1N36J 4RNNA 2B6AB 4DJBA 2KVQE 3K5LA 3C6UA 3W61A 1FFSB 4N77A 2IHR1 2HQDA 4Q2LA 1NXIA 4OHYA 1T0TV 4LRCA 2PDAA 3EGVA 2YBVA 1HLWA 1S97A 1KBRA 2XEXA 3HHLA 4URSA 4WKRA 1CC7A 3FKBA 1BUXA 2CPEA 1HNZJ 1CPZA 5HVHA 3OFEA 2QO3A 4LF6J 4C0OC 1KVJA 1H73A 4DSEA 2CPYA 4ZPDA 3NNAA 4DR6J 3P3DA 2F4VF 1WG5A 1K0TA 4DX5A 3IN5A 2ROPA 1GMWA 4QPTA 2ZHOA 1OY6A 3QFWA 5CD4H 2N3LA 1T9TA 5I3QA 4IFYB 3I5BA 3GSIA 2G4BA 1OO0B 1SB6A 1FRJA 2E9TA 1Q8KA 3NWGA 4V19J 3W9HA 4Y28C 4DX6A 2DEJA 4NLDA 1H38A 3LPEA 1RYSA 2C2EA 4ZVHA 3T1AA 4MIBA 2YH0A 4M1KA 2J8AA 3CO9A 2J6TA 1U8WA 1LNQA 4YY3F 3C46A 4KIAA 1QLNA 4DV1J 4RR5A 2WONA 1FFWB 1SC4B 5F8MA 3OXLA 2QLFB 1HD1A 4DU8A 3M8QB 5L9XA 4DR1J 1ELOA 4OV6A 1WJ9A 3BF4A 2V6AA 1F9HA 3UO0A 2R8IA 1KHVA 4X62J 2CKWA 4XO0A 4A8MP 3KJNB 4ED0A 4X4VA 4JI3J 2BJ9A 1RKIA 2XZWA 3T1YF 2HZAA 2C3OA 2RUGA 2HZCA 2ZH9A 3QIPB 2FZGB 1Q86T 4OLOA 1VJQA 2MHNA 2AMCB 4K50A 1NDLA 1IBMJ 3HFKA 4I6YA 2LEBA 4C0HA 3N6MA 4FN5A 2VL1A 4V19X 2WAQD 5HK4A 4ZHRA 3CDBA 3TA2A 4IFYA 2HS3A 3MCNA 5E3RA 5LM7E 3CJ0A 1DAXA 3CCLS 2C2ZB 4DN0A 1PYSB 4PZVA 4A46A 4ELUA 4RNMA 1XMBA 3MECB 1OWXA 3B6BA 2BQUA 4N8NA 2OELA 2VICA 4MK8A 2JNJA 2GQCA 3CCJS 5J2MA 4B3SF 1F3VA 2FQQB 3DM2A 3MWBA 4IRCA 1QAXA 3PR5B 1XMOJ 1CLFA 2ZBRA 1NLKL 1Y5LB 1Q81T 3K5NA 2KH9A 2ZHBA 1KD1T 1NDKA 3P5TL 1K73T 3M9MB 5A6PA 2HFSA 2HQGA 4ZVSB 1RT6B 4GC7A 4PAAA 4HLBA 3NS7B 4FBTA 2B7BB 2ZFHA 3D1OA 4RPFA 4CIOA 4OX6A 3OPKA 4XIUA 3MR2A 1XC9A 3OSPA 3F41A 1U0HA 1U25A 2G1HA 1Q1KA 2YNHB 4RZRA 3D6TB 1RAAB 2FJVA 2KG0A 4JV2A 2VF3A 1IKWB 1MU2B 5I4MA 3T5LA 3OL7A 2IDLA 1WOPA 2QN6B 2E29A 3TX8A 2JEIA 3ISNC 1F9EB 2AEJA 2IVMA 3Q2TC 1AYEA 5B09A 2VPYB 1F5AA 5L1JA 5ETLA 3AXKA 4S0MA 3KMQA 2O66A 3TAPA 5HMXA 2R7OA 4IH5A 3FMBA 4OYXA 1YITS 2HGMA 2Z2LA 1EAYC 2DCLA 2IRYA 5DLFA 2WBMA 2YPYA 2X51A 4KGVB 4O4GA 3LW5C 1X4HA 3CCVS 2QSWA 2XBPA 4KBIA 2BANA 1DQ9A 4F36A 1VQPS 4Y34A 1LFPA 1X4BA 1FDBA 4NLPA 3VGUA 1TUGB 1S99A 4IG3B 3ZO7A 2GMHA 5GADI 3UCGA 4DLGA 4ZMMA 2UUCF 1KVKA 2WOMB 3BGOP 5K8NA 4UUXA 2OJ3A 2AD9A 2FHKA 1HHTP 3HVTB 1QAJA 4H54A 3J7Z5 3HJVA 4KAIA 1E6YB 4NCGB 4KR0B 1WC1A 4OZNA 2QEXS 1RT6A 3TAMB 5H9FJ 5KFLA 1VQMS 1TL1B 4JI6F 5T7LB 4NYPA 1NDPA 4MYUA 3I56S 5JVGQ 3NGUA 5K5MA 1TL3B 1D9FA 3ZTQA 4ID5A 3FCHA 4L3KA 2I0XA 1TKTB 1IKVA 4R8UB 2XMVA 4CLPA 4LF7F 3OXFA 4K4VA 1HBMB 4DR2F 1LKZA 2XMAA 4OYMA 2P9EA 3UNGC 2RJZA 3ADAC 4ZCLA 2QLJB 3MM8A 1YRUA 3CJTA 1FK9B 2YNGB 3W8PA 2H5EA 3POTB 2B9EA 1XNQF 2C22A 4DQIA 2IM2A 1IQZA 2W4DA 4AXIA 2X3GA 2KT5A 1VLOA 4RWXA 3EE3A 3N0VA 3J7YU 5BYRA 1UPPA 1M1GA 1NSQA 4F3MA 2CQ4A 4DHVA 4A8FA 4RNHA 2MKKA 5C42B 4YB6A 1VC6A 2XZDB 2Z4PA 2DD8S 1RABB 4RW9B 4E2FB 4X66J 4KKOA 4WFXA 3D2WA 4F4XA 2HPUA 3AA9A 4FNIA 2Z56B 2W9BB 4B9UA 2OD6A 1CJVB 4QYRA 4WYLA 1E6YA 3TX0A 4ECZA 1Q8BA 3SMZA 3T5HA 4BDPA 2AT1B 4Y2IA 4CO5A 2DO4A 1S7IA 3N01A 1G3OA 4ZVFA 2JHEA 4ED6A 4J9PA 1TL1A 4ITSA 5EWFA 1YWXA 1MSWD 4DFPA 4NCAA 3IR5B 2LQ9A 3VV2B 4ENOA 3CIMA 3DLBA 1FXDA 2DNRA 1K9MT 3MD1A 5CYJA 2YWEA 1PGZA 2I38A 3HHNB 3AB2B 2R7VA 1A6LA 3PJWA 3KLIA 2JL9A 3QIDA 1T94A 5JUMA 1QJHA 1BQMB 2VU5A 2HBQB 1ZOTA 1RTJA 1H2TZ 2IC3B 2VDHA 4D3HA 3R2DJ 5KFRA 1DURA 1LK5A 5H9EJ 4PUOA 2D41A 3POTA 3T1HF 2DGVA 3PEHA 3IBCB 1QSYA 4DV6J 2QV6A 3MDFA 4ANDA 1FKPB 3MZIA 1KS2A 2XMJA 3PTWA 1CULB 5KG3A 2XO6A 3AB4B 1BXNA 2DIVA 3RG6A 2RKIB 3D3CJ 3W5XA 4GO5X 3EJMA 5D15A 1U1MA 1PJ7A 3BH6B 3A12A 2B43A 5HJXA 4TY8A 5G0RB 4BLGA 2FZCB 3MEGB 1WORA 4R0JA 2KJWA 3AODA 2Y1LB 4OYWA 3DRRB 2RE1A 1VCTA 1LOUA 4DV3J 2DTJA 5F9NA 1WTFA 3DLKB 5HVFA 1WSRA 2OD4A 5HQLA 2V4QA 3GQCA 3BKUA 2BR0A 3ET6A 3I32A 4F25A 2KDOA 2BVZA 4I69A 1FWKA 5E3AA 3PXGa 1S6PA 1VK8A 2AHOB 2MGZB 2E9ZA 2MKHA 3JQKA 1WHXA 2XB2D 4QR2A 3T6BA 3NCPA 2P6SA 4DQRA 4CM2A 2ACMA 5K9FA 4B9TA 5CABA 1JLBB 5FJ4A 3ZXWA 1UKUA 3DYAB 4O44B 9RUBA 1WWHA 2CNNB 1M0SA 1UL3A 1VRTB 1FJGJ 3WBZA 1IWAA 1BQMA 3CB4A 2NXUA 1Q53A 2FVCA 5E0OA 2DKOB 2E1PA 3QWPA 5IZHA 2RRAA 1O5JA 1M90T 2XULA 4Z7CA 4LR8A 3KLEA 5KFXA 4DSFA 1R3NA 2M0GB 4O0IA 2XWXA 4M5IA 2QA1A 1WG1A 1V3ZA 2HIYA 4X64J 1VR6A 2KZMA 1ULRA 3UR3C 3VVUA 4C11A 4LF9F 2MZTA 2PMHA 1XNRJ 4Z2XA 5D0GA 4J9LA 2XLIA 4EO8A 1CULA 4W4MA 3MUVP 1VBKA 3OTBA 2ZBCA 2XG8A 4TYAA 4W98A 3PX0A 3NNCA 2BE9B 3G9CA 1OMSA 3MOZA 3PW5A 3W2VB 3RB0A 2BZ2A 3KJQB 3MD3A 2W9CA 4PKDB 5ETSA 4HH1A 4PG6A 4GKJF 3HJFA 1P9QC 2HS4A 4AD6A 4USUA 1TR0A 2DH8A 5G0RA 2Y0SD 2LP4A 2D74B 5CYQB 3EDRB 4NZ7A 2ZVSA 3O1LA 4ZCIA 4ED5A 5AE2A 1PJ6A 3BB5A 4B3MJ 1Y10A 1UWBB 1WELA 2A3JA 2JLEA 2XHWA 3CJ4A 2F40A 3MM7A 1D0EA 2B8QA 2MZSA 1R89A 5K14A 1RAFB 2HBRB 3R97A 2BW2A 2DXFA 2MGZA 3GJRB 4CO4A 2ADBA 1FXRA 3VZIA 4PG5A 5L9NA 4C8KA 1JLBA 2OUGA 3NGKA 5EX3A 5KFCA 2DO0A 4Q44A 1RAEB 3KYLA 1RHMB 3B82A 4W90B 3DU6A 2YKNB 4HYKA 4DV4F 2YXLA 5DS7A 2ACYA 5HLFA 3BN7A 2V9KA 2YWHA 1H3DA 3LP0A 1RKJA 1JLEA 1XMQJ 3SV4A 3WX8A 2KM8B 2XS7A 2V34A 3CNQP 1LEOA 4DSKA 3TW0A 1IKXA 1LQ9A 2KXHA 1WEXA 3H4BA 4JYAF 3W2WA 2GVDA 1R0CB 2GIFA 1QSSA 4PRFA 2HNZA 2ZH7A 3P96A 1VDHA 3EM1A 1BD6A 3FRYA 4USKA 1OIAA 2GCFA 2VKZG 2VG6B 1XJWB 1PAUB 1S1VA 2ZJQQ 2IPOB 4EI2A 1TUWA 1RHQB 2F63A 5CYQA 2NREA 4X65F 4K4TA 2CA9A 3DFEA 3D4JA 4ZN1A 4KH1B 2YKQA 2ASLA 1IBLF 2W2QP 1WOSA 2NXCA 2BJ8A 2RS2A 3R5AA 4Y65A 5CHCB 2YPZA 4P9SA 3V4IA 1YX2A 3OT9A 2RS8A 4I1TA 1DQ8A 4BWMA 2NSBA 1VQLS 3N6NA 3MFHA 3KHRA 3UN3A 3AAWB 2NSCA 4WE1B 1AUDA 3G86A 3H90A 3CDWA 1WHVA 4NYZA 4RBTA 4DSJA 2CQIA 2YKNA 1CQMA 3L95X 2XMMA 3BGLA 3H2UB 1UZHA 3DOLB 3OHAA 1TZ0A 2LQBA 4JI7F 2C42A 5EGYA 1I6JA 3SSQA 5M2UA 2VBWA 1MLAA 2AGPA 2QMUB 4B3TJ 1RISA 2QTWA 2EG2A 2VG7A 4ER8A 1IKYA 3V81B 1JLQB 4QWBA 5DZ6A 3Q86A 3MHYA 1GMVA 4U8YA 2AF6A 2MZQA 2V2QA 2MQQA 4P7VA 4NI2B
chains in the Genus database with same CATH topology
2FYXA 2VHGA 2VIHA 2XQCA 2A6MA 2XO6A 2VJUA 4ER8A 2A6OA 2VJVA 2XM3A 2XMAA 2EC2A 2F4FA 2F5GA 2VICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYX A;  2VHG A;  2VIH A;  2XQC A;  2A6M A;  2XO6 A;  2VJU A;  4ER8 A;  2A6O A;  2VJV A;  2XM3 A;  2XMA A;  2EC2 A;  2F4F A;  2F5G A;  2VIC A; 
#chains in the Genus database with same CATH topology
 2FTR A;  4ZVT B;  1HBO A;  5F8J A;  3NGT A;  2ZE2 B;  4YDD B;  1JXV A;  4RW7 A;  4USH A;  1FKA F;  3K59 A;  1T9U A;  3MUM P;  2XS5 A;  1FRM A;  2ZH5 A;  2VG5 B;  2FZK B;  2DJW A;  3H4D A;  2RH3 A;  2GIR A;  3VVT A;  3GJS B;  4KY3 A;  2W2M P;  2FLP A;  2V50 A;  3GIM A;  2GZO A;  2KYZ A;  1Y5I B;  4DL4 A;  2UV8 A;  1AB8 A;  1VQN S;  3KTQ A;  2KL8 A;  1E6V A;  3MEE B;  5F8L A;  4WJB A;  4X4T A;  1M5S A;  4ID8 A;  4ETZ A;  1N0U A;  1QE1 A;  3OVA A;  4J7C A;  2N3O A;  1KON A;  4LF8 F;  2ZWP A;  2ASD A;  3GMG A;  3IG1 A;  2B5J A;  4WE1 A;  3P45 B;  1R43 A;  2KU7 A;  3KUH A;  2AJ4 A;  4KT0 C;  5DRK A;  1HMV A;  5GAD U;  1TP7 A;  1FF2 A;  3R8Y A;  3S01 A;  2Y1R I;  2UXD F;  5BYQ A;  1REG X;  3M8Y A;  3S7R A;  1RT4 A;  4KV8 A;  4DR7 F;  3CD7 A;  2YKM B;  1NHU A;  4HT7 A;  3NG8 A;  4K4U A;  3ELH A;  3ZTR A;  1H7W A;  4GO7 X;  1NK8 A;  2BE7 D;  4BC7 A;  1N6Q B;  3R7S B;  3ZC4 A;  3ENV A;  2CUY A;  3PJ9 A;  3T3F A;  1LW2 B;  1RP5 A;  3BM7 A;  2DHA A;  1HYS B;  2OIH A;  3IWL A;  3ULH A;  3ZZ0 A;  1IBK J;  3VAL A;  4OZ0 A;  2Y9H A;  3FBC A;  2CJA A;  5LJ3 Y;  1M1H A;  2RAQ A;  1SL0 A;  3CXC R;  2J0W A;  2IAJ A;  4RWW A;  4U9R A;  2EFG A;  2FY1 A;  4NLS A;  3FFI B;  3JS9 A;  4XPC A;  4OZL A;  2ZE2 A;  3IR7 B;  2VOO A;  5ETR A;  1LXN A;  1GT8 A;  3EVM A;  1KR4 A;  3NL0 A;  3HO1 A;  5J2N B;  1S12 A;  3ZZT A;  5LSL A;  4DL2 A;  4IG0 A;  3AD8 C;  3KK3 B;  1P6T A;  3ZZR A;  2VZ9 A;  1FE0 A;  3A3N B;  4LSN B;  3K7R A;  1SV5 B;  4BBY A;  3W1Y C;  2GW8 A;  1F5B A;  4CLF A;  2XMW A;  3IS9 A;  1KQS R;  2CNO B;  1HQ2 A;  5I3U B;  2FJB B;  3MEE A;  4Y2C A;  5G4D A;  2HVE A;  4UOH A;  1S4F A;  2I5J A;  2V8V A;  4YR0 A;  1RT2 B;  3DLH A;  2D9P A;  4JI1 F;  4DV5 J;  5GAH U;  3LPY A;  2VFS A;  1ZA1 B;  2BJ7 A;  2R7R A;  4EUV A;  4IO1 A;  1FTC A;  3IFE A;  2AZ3 A;  1RAD B;  1L3K A;  2LKZ A;  2DIT A;  5KG2 A;  1RHU B;  3PHE A;  4NE9 C;  2EW9 A;  3EVO A;  3VAH A;  3HHL D;  2LEP A;  4ZVU B;  1PIE A;  2XO7 A;  2HAI A;  4PAB A;  1WDT A;  4ZP9 A;  5U47 A;  1N6Q A;  5A2Q Y;  4I7F A;  1I94 F;  4DWI A;  2QL9 B;  3C19 A;  1HQE B;  2C28 A;  1LW2 A;  1HA1 A;  2MYF A;  4EMD A;  3KLG B;  1C1B B;  2GJF A;  4P6Q A;  3EUN A;  4ZPV R;  3MED B;  4WKY A;  3MM5 A;  1T11 A;  2ZC4 A;  1S48 A;  5KFY A;  4CO1 A;  1GMW D;  2NR0 A;  4JI5 F;  3FFI A;  1YSJ A;  1UVK A;  4ED4 A;  4B17 A;  1N48 A;  3SFU A;  4YHH J;  4BHQ A;  2DYA A;  3NRB A;  2LQ8 A;  3EZO A;  3MMC B;  2HVI A;  2VOP A;  1YJR A;  3KK3 A;  2EBE A;  3EVW A;  3IWN C;  4ZJQ A;  5CH7 B;  3LAM A;  3NXZ A;  2HWI A;  3QRR A;  2WRM A;  3CTR A;  3CJ3 A;  1HFE L;  1S76 D;  1NJY A;  2BOA A;  4HHU A;  1JMT A;  3EIC A;  1FDA A;  2YQ1 A;  4USM A;  2Z2Z A;  3RTV A;  2F5G A;  2DR8 A;  3BQ1 A;  3C15 A;  5L1L A;  2HHQ A;  4RBU A;  2F9J A;  4CLZ A;  4LRF A;  1K1Q A;  3ETO A;  3MPD A;  1S6U A;  1W7W A;  4KC5 A;  3FZB A;  3L7U A;  1Q5V A;  3CJK B;  4GVL A;  2WVD A;  4RW8 B;  3ZZU A;  3WIV A;  1WEZ A;  2V5H G;  4DL0 C;  1FRL A;  2HYI B;  4HI2 A;  4HDG A;  2YNF A;  2HMI A;  2CQH A;  1RAC B;  3PY8 A;  2H51 B;  1FE4 A;  2J6U A;  1EHW A;  3AT1 B;  2QMW A;  2EBG A;  3HD2 A;  4PPD A;  3QNW B;  3DU5 A;  1S6Q B;  1VRQ C;  4QIG A;  3RBD A;  1R31 A;  5KFQ A;  2CQ1 A;  4KE5 A;  2YTC A;  2HRT A;  4QCL A;  4NA2 A;  1YHQ S;  1ROF A;  4UOF A;  4J9R A;  4EEY A;  2DGQ A;  3OUY A;  2P2C B;  2KXN B;  1BWE A;  5J2Q A;  3NBP A;  5J1E A;  3JSY A;  2A2D A;  2DNQ A;  2GMJ A;  4EZ9 A;  5D4O A;  1DTQ B;  2VQE F;  1CJU B;  3KLH B;  1RAI B;  2ALY B;  3UPF A;  5DDP C;  2ZM6 F;  2OEM A;  5IT4 A;  4Q7A A;  2HW3 A;  1WF2 A;  1U6Z A;  3GFZ A;  4Q2M A;  2KXF A;  4K0K J;  1N5S A;  2UUA J;  3LP1 A;  1TKZ B;  1B0P A;  3R5D A;  2AJF E;  3RBX A;  1JX4 A;  4WPA A;  3M2V B;  2HEK A;  3FSI A;  2WHO A;  1F1B B;  2KJV A;  1LW0 A;  3RB6 A;  5IT0 A;  2NZC A;  1S1T A;  5IC4 B;  2G2Y A;  2WSC C;  3UD5 A;  4RW8 A;  1MWQ A;  1YK9 A;  2AYE A;  3V4M A;  3PKY A;  1X9M A;  1EQM A;  1AXQ A;  4FKY A;  1RBL A;  3IRX B;  2LLZ A;  1JNZ B;  4V1A k;  2GO9 A;  3PHT A;  2Z30 B;  4YDX A;  2RQM A;  1T02 A;  2VDI A;  1WOO A;  3M30 A;  4DL3 A;  3BPD A;  1VC0 A;  3V6D B;  2G9O A;  2APO A;  2BYC A;  4NA3 A;  2UXC J;  5DET A;  4ED2 A;  4CYU A;  2KTQ A;  2HND B;  5D3G A;  4JI2 J;  4QR0 A;  1HWU A;  4ZJL A;  1TAU A;  1B7F A;  1PYT A;  4FS1 A;  3JB9 k;  1Q16 B;  2C3P A;  2IMO A;  1S0O A;  2E5H A;  1QM9 A;  4P2M A;  2AX1 A;  3RAX A;  1KSP A;  1KLM A;  3G8Q A;  4OZ1 A;  1F0X A;  2D3O 1;  5GMD A;  1KOH A;  3M2U A;  4ICL A;  1IJF B;  4WU2 A;  2HGL A;  3R7N B;  1CBK A;  3SSS A;  2XY7 A;  1TMJ A;  2MDA A;  2NXE A;  1HR0 F;  2HAF A;  1Q82 T;  2BX6 A;  2FJX A;  4CZC A;  3TZY A;  2F65 A;  2J76 E;  3ISZ A;  4K4Y A;  3PG9 A;  2MQP A;  2IMW P;  4MKB A;  1XR7 A;  4OFZ A;  2HHW A;  2AW0 A;  2J9D E;  1EP4 A;  3H8Y A;  2BE2 A;  1YTY A;  4FZV A;  3WC2 A;  3EPG A;  3M2V A;  4WFB Q;  4CLS A;  2HBY B;  2JWN A;  4K4S A;  4NEZ A;  2JEG A;  4KGX B;  5A76 A;  3DCA A;  3OSN A;  4JBC A;  3SCI E;  2UV8 G;  3KJV B;  3G4S S;  1T03 A;  4IFV A;  2HZV A;  5DQH A;  3SDE A;  4FVC A;  1SQF A;  4MFB B;  5HBM A;  3IRX A;  1GXT A;  2XNR A;  1VQS A;  5ETV A;  1UFL A;  2LEC A;  1VQ9 S;  4RW4 A;  2QFI A;  2OAU A;  4U7C A;  4CLT A;  1F9F A;  2A6O A;  4WU3 A;  4DPO A;  3IGV A;  4U6P A;  3E01 A;  2VA2 A;  4I2P A;  3D0I E;  1L3T A;  3I96 A;  4ZKA A;  4NLW A;  3ZNJ 1;  3F0N A;  2DVI A;  2R42 A;  4ANE A;  1WG4 A;  3M7V A;  3MAA A;  1BQN B;  1URR A;  2H4Y B;  3MR3 A;  2X1A A;  2W1B A;  4MIW A;  5DJB A;  3MCO A;  1P27 B;  1YBT A;  2ZH2 A;  2BJ1 A;  3A13 A;  4YME A;  1EET B;  1W2I A;  3CED A;  3NS6 A;  4NXM F;  2GV1 A;  3QWU A;  4J37 A;  4TXS A;  4WF9 Q;  1R7I A;  3ICL A;  1VIO A;  2VUG A;  2RNE A;  1C4C A;  4J9M A;  2ERR A;  2ZDP A;  3X3U A;  5A0Y B;  3QT8 A;  5ETP A;  3GU0 A;  4NXN F;  1MRO B;  1EKS A;  1T7P A;  2XSJ A;  1X31 C;  4YP3 A;  1VBZ A;  1X9S A;  2ZHA A;  1ZH5 A;  3H42 A;  4EGL A;  1NJW A;  5KT3 A;  3QFH A;  3MPY A;  4NPO A;  4OI2 A;  3NOG A;  4QU6 A;  2N82 B;  5E41 A;  1N8R T;  2AJ2 A;  4DF8 A;  2FVS A;  3PVX A;  3DGP B;  1S7H A;  3OFF A;  2J0Q D;  4RKU C;  2VFU A;  2WTF A;  3KLV A;  3CWJ A;  1SVD A;  3GB0 A;  2FJD B;  4BCA A;  1T9X A;  1SKU B;  3RBZ A;  4DSL A;  3DRS A;  1IR0 A;  5DG7 A;  1JWW A;  3EZ5 A;  3MTJ A;  2KRB A;  1ZBT A;  4ZLJ A;  2EI5 A;  2R9L A;  4M5D B;  2NZ4 A;  5KTQ A;  1DRZ A;  2Q43 A;  2MJN A;  2DNO A;  1B70 B;  3KHG A;  2MLY A;  1HI0 P;  1U49 A;  2RIJ A;  4KHP F;  1P1L A;  3CCT A;  3CIZ A;  2JOQ A;  5D0R A;  3T6J A;  3DDI A;  2DNH A;  4RO0 A;  1NEE A;  3NGR A;  2LQ5 A;  4M5H A;  1EET A;  3ENA A;  3MM6 B;  2GO8 A;  2CDR B;  3OVB A;  4FNH A;  3UCU P;  1TU0 B;  2WSE C;  3J80 U;  1C0T B;  1HHS A;  2RDD A;  3DRY A;  3GON A;  2QA2 A;  4HHJ A;  2W01 A;  2M7S A;  1HBN B;  1ZAX A;  3US5 A;  4P2X A;  1HD0 A;  4E98 A;  1S9G B;  4CM0 A;  2BKO A;  3A8I A;  1X4E A;  3E8O A;  2K2P A;  1DLO A;  5T41 A;  2BRK A;  3WQP A;  3CCW A;  3S6E A;  4WFZ A;  2VPZ B;  5HAO A;  3RUB L;  4DV7 F;  2P5V A;  1XTZ A;  3QO9 B;  1VC5 A;  5B0C A;  5DDO C;  4K4X A;  2HHU A;  4AE5 A;  1NJI T;  2NYH A;  3LGN A;  1VRU B;  2CQB A;  1FDN A;  2WVF A;  1RT5 A;  2W4P A;  1AFJ A;  2LDI A;  4DUT A;  3VQT A;  4Q8E A;  4UOC A;  2B4U A;  1HIY A;  3PO5 A;  1NPR A;  1C1C B;  1RXO B;  1UCN A;  3CC2 S;  3ENQ A;  3ILI A;  2W24 A;  5KFH A;  3Q23 A;  1IM4 A;  2F4V J;  2MQM A;  3W65 A;  5BR8 F;  1RT1 B;  1U1N A;  2YWK A;  5CYM A;  5KFM A;  3DDN A;  3CDU A;  4IO9 Q;  1UEV A;  4CRJ A;  2D1C A;  1U1O A;  4OHX A;  2JEJ A;  2H65 B;  1HAR A;  1XIQ A;  4OLP A;  1L3U A;  4P2F A;  4A48 A;  1F60 B;  2R8G A;  2UU9 J;  4XPE A;  2EC0 A;  3ILL A;  3EXY A;  4O23 A;  4DU7 A;  3H5X A;  2CPZ A;  1C0T A;  3TUJ C;  4I68 A;  1SJ3 P;  3TA1 A;  3NNH A;  1PG5 B;  1CJT A;  4WYW A;  4YY3 J;  3BGR B;  3PO4 A;  4DR4 F;  4TU9 A;  3N28 A;  3ZTP A;  3NKY A;  4ILM A;  4ILL A;  2VHG A;  1OSC A;  4JV0 A;  1U45 A;  2VBZ A;  2CAD A;  3M8S A;  4YUD A;  3M8P B;  4Y00 A;  3KLF A;  4OI0 A;  3SCJ E;  2XWY A;  2CVE A;  3BH7 B;  3RZA A;  2CZ9 A;  1GEH A;  2J5A A;  3CC4 S;  1MMD A;  1HWJ A;  3QO9 A;  5EWG A;  1V6H A;  2DT9 A;  4ETX A;  4KSE B;  2OPR A;  3E2E A;  3QT7 A;  1NM2 A;  5I3P A;  2ZH4 A;  1ZAV A;  2FGC A;  1GTE A;  3T1Y J;  2R7S A;  3Q0A A;  2YKA A;  2F8M A;  4TY9 A;  1SUQ B;  2BQ3 A;  2GAH C;  1C1C A;  4ECX A;  5JMN A;  2Q6C A;  3PYG A;  3TR5 A;  2HGN A;  1NKB A;  1Y11 A;  4B02 A;  2QMX A;  3JTO A;  1AFI A;  1DTT B;  3CJQ A;  3CJS A;  1FVS A;  4AFF A;  2FLN A;  1N54 B;  2AYB A;  3VHQ A;  5LXR A;  3GV7 B;  2JVO A;  2YX1 A;  1WC5 A;  4O3P A;  2GJ2 A;  2YWG A;  4O3Q A;  4H4M B;  3DOK B;  3L3C A;  3GG1 A;  4XDD A;  2DGU A;  1JLC A;  2JH3 A;  5KFZ A;  4KO0 B;  4C8M A;  3CDE A;  2P8I A;  5DLG A;  2BBE A;  4B9N A;  2J7W A;  1HW9 A;  2NUU G;  1RT7 B;  3BO2 A;  2FJA B;  5IFM A;  3MR7 A;  2K8G A;  3CMQ A;  4B3S J;  1S1X B;  2R3V A;  4QQB A;  1DJ0 A;  4C3M A;  3BGR A;  8RUC A;  5I42 A;  3X1L B;  2J0S D;  1NK5 A;  2CRL A;  4USI A;  1NND A;  5DM6 Q;  1ITP A;  4DV3 F;  4RNO A;  3M2R A;  4AUK A;  4ECR A;  2C2R A;  2CNK B;  4AYB D;  3M8P A;  5FDL A;  3CJ8 A;  4HTI A;  3CCU S;  3DMJ B;  3QLH B;  2M4M A;  2WB1 D;  2PII A;  2MB0 B;  1WKK A;  2CWX A;  3J7Y I;  3GR0 A;  3VCD A;  4KGK A;  5HMY A;  4M5L A;  1YQH A;  4N56 A;  3QQC D;  4DV2 F;  3H20 A;  3MMB B;  3UCZ P;  4HAC A;  2IM1 A;  4CH7 A;  2C1E B;  2XGP A;  1EZZ B;  5FD1 A;  2V8G A;  4CDI A;  1UTA A;  3DXS X;  5FLX Y;  2OH2 A;  1ICE B;  4OZ2 A;  3M6U A;  4DL7 A;  1FWL A;  1Q0N A;  2XLK A;  4G1P A;  3PX6 A;  2AX0 A;  1U2F A;  3NMR A;  4FBU A;  2V67 A;  3CCR S;  2B9X A;  2L3M A;  4DUZ F;  1SKR A;  1S6O A;  4FXW A;  2YNI A;  3HPO A;  3NEK A;  1QSL A;  4AXJ A;  3KXD A;  2JRS A;  4H4M A;  5CAA A;  3HSJ A;  2FHJ A;  5DDR C;  5M2R A;  4JI0 F;  1NO8 A;  2UUC J;  1FJC A;  2VA3 A;  4DG1 B;  2HWH A;  5ETK A;  4DR5 F;  4KHR A;  2XMT A;  1S0V A;  1JKH B;  2DNM A;  2HHX A;  1KFS A;  1IR1 A;  5KT5 A;  1SL2 A;  3MMA B;  5C5J A;  1N0V C;  2NCK L;  4EZ6 A;  5KT4 A;  1JXE A;  2V0N A;  4B3M F;  2FPH X;  4PWD A;  4EYH B;  1AUS L;  2V94 A;  4C8N A;  2BQR A;  2DH9 A;  2QIF A;  4YFU A;  3SQG B;  2AU0 A;  2GGP B;  4JI6 J;  5HMZ A;  4P74 A;  1IQT A;  3RBE A;  4DQS A;  5C7P A;  1NK6 A;  4LF7 J;  5JVH Q;  1CEZ A;  3HFV A;  4I67 A;  4DR2 J;  1J27 A;  2PSZ A;  2H5I B;  2VPX B;  2VJU A;  2QFJ A;  1B0T A;  2N7C A;  1SJF A;  2KFZ A;  5LMU F;  4KHM A;  2MEW A;  7FDR A;  1K0V A;  3THT A;  2M88 A;  1JLF A;  1OYD A;  2RDI A;  4F4Y A;  3IMQ J;  2U2F A;  2QC3 A;  1LWF A;  2HFZ A;  3Q2S C;  4LF1 A;  3K8W A;  2QLW A;  4J9K A;  5J1N A;  4CO0 A;  3HF5 A;  2QLX A;  2UUW A;  4D3G A;  1K47 A;  3GG0 A;  2FJE B;  4J9V A;  4KJI A;  3FGV A;  2DR7 A;  3JQM A;  3M32 B;  2PEH A;  2K1R B;  4DSI A;  1C0U A;  5A8K B;  4DG1 A;  1M5V C;  2ZZN A;  3IM9 A;  2KZZ A;  1AA1 B;  2XZT B;  1YIJ S;  4Q45 A;  2PGC A;  1GH8 A;  2MZR A;  2BDP A;  1N33 F;  2FHO B;  2ATC B;  4WTO B;  3QJP A;  1WKL A;  2MKY A;  2R7W A;  1HQU A;  5F3T A;  1OS5 A;  3RAM A;  2A10 A;  1R6Y A;  1HI8 A;  1SCJ B;  5K8P A;  3G6E S;  1VIS A;  3DHX A;  1XR6 A;  3RR8 A;  4ECQ A;  4GVB B;  1QAI A;  2ASJ A;  2H48 B;  5AE1 A;  2HSE B;  3CJ5 A;  4JP8 A;  4FYY B;  1FRK A;  1WNE A;  3CDA A;  4MIA A;  4R5P B;  4OYB A;  2LMI A;  2CQ2 A;  1ARO P;  3DRP A;  2GA7 A;  3TQE A;  2ZD1 A;  1MML A;  5IM0 B;  3CVK A;  1QDU B;  2HFO A;  1WUU A;  3R5G A;  3T1H J;  4N5S A;  4LSL B;  4RNF A;  4ECU A;  3UR0 A;  3K8V A;  1UVM A;  2V2V A;  1RTI B;  2G0C A;  3QGI A;  4X4R A;  4DV0 J;  3R3T A;  3EX7 B;  1J5O A;  4J9O A;  4C9D A;  1JLG A;  3M8R A;  4B3O A;  2NLW A;  4C2M A;  1R8A A;  4PXE A;  1FDD A;  1TVR B;  3PYE A;  2QYG A;  2BJ3 A;  3I55 S;  3CE8 A;  1QUP A;  1HBU B;  1RI7 A;  2PD1 A;  3UFC X;  3D7S B;  2RB7 A;  2VQF F;  2HK2 A;  4ELV A;  2XMK A;  4LUB A;  1T95 A;  2IYI A;  4NWB A;  4FF1 A;  5L38 A;  5L39 A;  3AD9 C;  3O44 A;  4MT1 A;  4XTT A;  5LXY A;  4OX9 F;  2WZ1 A;  3G96 A;  4N41 A;  3M6V A;  3U7J A;  1UVN A;  1EB0 A;  4KTQ A;  1LWC B;  2VBX A;  1GK8 A;  2LA6 A;  4NEY A;  2M70 A;  5F8H A;  1HNX F;  3OR1 B;  1KQG B;  3R1L A;  3T41 A;  1HWI A;  3GII A;  2DIS A;  1D8Z A;  3DLE A;  3I0R A;  4OJH A;  3VGV A;  3C16 B;  2RU3 A;  4FYD A;  4PYA A;  5ETM A;  2EFP A;  2B6A A;  1JQG A;  3PIP Q;  1K44 A;  1UVI A;  5KOW A;  4CT8 A;  3OVS A;  5L46 A;  2Z57 B;  2M8D B;  4P72 A;  2ROG A;  2C3Y A;  4EO6 A;  1HNW F;  1MMN A;  1TKX B;  3OBI A;  2CQ0 A;  2E7X A;  4CH1 A;  1Q8L A;  4L73 A;  5HO4 A;  3QZ7 A;  3FEZ A;  3QGG A;  3HMJ G;  1S1W B;  3TYT A;  3VZH A;  3TUZ C;  2KI2 A;  2MZ1 A;  1EIY B;  1SQG A;  5IM0 A;  5HRO B;  2ZUG A;  3Q89 A;  2ADC A;  4RUB A;  3M9N B;  4PWW A;  1U48 A;  2B56 A;  2OSR A;  3I4H X;  4LF9 J;  4DX7 A;  3LGM A;  1DAR A;  3CGI A;  3IXQ A;  4YB7 A;  3K0J A;  4IDK B;  3G8S A;  4NYO A;  4PR6 A;  2VOD A;  3O6Q A;  3P49 B;  1KEK A;  1U02 A;  2F4F A;  2XYH B;  2AYG A;  1MWY A;  3OFH A;  4NA1 A;  1IBK F;  4IOA Q;  1RU1 A;  2AYM A;  4GKJ J;  1R8P A;  4ZIW A;  4CTA B;  3PRD A;  3MAH A;  5B08 A;  2KHC A;  2Z58 B;  2ZNZ A;  1TK0 A;  5IQ6 A;  5GVQ A;  2OTL S;  3S1T A;  3M05 A;  4PQA A;  1X5T A;  4C48 A;  1R8H A;  4ZIT A;  4LQ3 A;  1H72 C;  4K4W A;  4JV5 F;  3OR1 A;  4AQY F;  1B3T A;  2V68 A;  1SJ4 P;  1X4C A;  5MLC V;  1S1U B;  1X7V A;  1ZPW X;  1U1R A;  4M63 A;  1B4S A;  1MNE A;  3ENW A;  3H5S A;  3M8Q A;  1ZPV A;  2MKS A;  1ZA2 B;  3QJJ A;  2OGU A;  3G87 A;  3D6H B;  4OI1 A;  2CPI A;  1K8A T;  3RAQ A;  4DV5 F;  3LAN A;  3PRV A;  1T9V A;  1RZM A;  4CLU A;  4DV4 J;  3CMA S;  3PZP A;  4KGM A;  2CQ3 A;  4NCB A;  3R5B A;  1VMB A;  2RSQ A;  3QIP A;  1RB0 A;  1UW4 A;  3OLA A;  4F8R A;  3BJY A;  2ZOM A;  2CG4 A;  3FBE A;  5LL6 d;  3SI8 A;  2D3O R;  1U26 A;  4JYA J;  2OPS B;  3C6T B;  2JJ4 D;  1UVJ A;  1V3S A;  3Q8Q B;  4TU8 A;  1TL7 B;  2YWF A;  1YBA A;  3G6V A;  5CD4 A;  1PYO B;  3DLG B;  4QWD A;  4NLX A;  1S77 D;  5A8R B;  4M95 A;  3GR1 A;  4X65 J;  2RVJ A;  3Q8R B;  1NK7 A;  3MEC A;  4G3I A;  2MTL A;  3A3P B;  1IBL J;  1NCL A;  1SC1 B;  4ZK7 M;  3VGT A;  3I9Z A;  2WCX A;  3GIK A;  3TZX A;  5EX0 A;  4L72 B;  3K17 A;  3G82 B;  2HS0 A;  3MCM A;  4LRE A;  2H4W B;  1YJV A;  2KVI A;  2M52 A;  3GFH A;  4DZD A;  1LXJ A;  3N5B A;  2HG4 A;  1N34 F;  4F0K A;  1N32 F;  3GCW P;  5CZX A;  4MJK A;  2SXL A;  3TEH B;  3AQP A;  3ZTS A;  5AXN A;  1YRT A;  3B8H A;  2MQ8 A;  3M4X A;  5KFF A;  2W7O A;  2NPF A;  1SKW A;  1FTR A;  2K06 A;  1D1U A;  4LFB F;  4TQS A;  5D0H A;  3WHI A;  5KFV A;  3QT5 A;  3R7B B;  2PC6 A;  5KFI A;  2YNH A;  3UQS A;  3D1H A;  1TFW A;  1HNI B;  2H5J B;  1IKW A;  1MU2 A;  2J9E A;  1SKS A;  2PN6 A;  4JI7 J;  3D9B A;  1H7X A;  4YR3 A;  4OV1 A;  3K5M A;  4RUA A;  2VD3 A;  5LMN F;  1FEE A;  1WC4 A;  5B0G A;  4FKX A;  2FC8 A;  3HSG A;  1CQN A;  1SJQ A;  4TQR A;  2BKP A;  3GWC A;  1NDC A;  4XK8 C;  3HCX A;  4C8Y A;  4OYP A;  2CVI A;  3D66 A;  1R0B G;  5EWE A;  2BMB A;  1SI9 A;  1L5U A;  4QOT A;  2C2O B;  1J5E F;  4IG3 A;  3I0S B;  5GAH I;  3DLG A;  4F0H A;  1PC5 A;  3EWG A;  1NKC A;  2EKN A;  4IOB A;  3VAF A;  2WOM A;  2Y3Y A;  3SZ2 A;  1OYE A;  3C3L A;  4K2X A;  1UJ5 A;  3HVT A;  4LF5 F;  3BO4 A;  4J9N A;  1YVF A;  2EVZ A;  5D78 A;  1DY3 A;  3GYG A;  4JI4 F;  4NCG A;  5RUB A;  4LF8 J;  2E1C A;  4EFA C;  3FUY A;  1VQO S;  4LFA J;  4X4N A;  1U1L A;  3ZFV A;  1CJK B;  2PO4 A;  2VFR A;  3TAM A;  3IP0 A;  3IBF B;  1BGX T;  3HHD A;  1G4C A;  5T7L A;  4ZIV A;  4CP5 A;  3DOM B;  3JYT B;  1TL3 A;  2PT0 A;  3MF5 A;  5A6W A;  3J7A 1;  2UXD J;  3J81 Y;  5IWA J;  2E7W A;  4RX6 A;  5B0D A;  2AJ0 A;  4DR7 J;  4ALZ A;  4L3N A;  4U95 A;  1TKT A;  2BA9 A;  2DRD A;  4R8U A;  4C7Q A;  3MCS A;  1S4E A;  3JSM B;  3IO1 A;  1HBM A;  4ZPA A;  1GFW B;  3N5F A;  2OPP B;  3BBF A;  2DR9 A;  2VIH A;  3RR7 A;  1FK9 A;  2YNG A;  1ZYQ A;  1M5K C;  5E5N A;  3ILO A;  3KG4 A;  4DCO B;  2XCA A;  1W2B R;  4A8W A;  2FIU A;  2YX4 A;  3PR4 A;  3CCS S;  2YKO A;  2M3D A;  2QJ3 A;  3PIO Q;  4ILR A;  1KNZ A;  1BQX A;  5J2P B;  1MW7 A;  1IVZ A;  1FJE B;  1X8D A;  4RW6 B;  2X3D A;  1AW0 A;  4N76 A;  3UD3 P;  2HQC A;  5C42 A;  3M6X A;  1N52 B;  4F7V A;  4O3S A;  1HPZ B;  3TP2 A;  2E1M C;  4B3R J;  5KFA A;  1VFJ A;  4C3L A;  1XQI A;  3PW7 A;  2DPI A;  4H4O B;  4RW9 A;  3AOC A;  3P6Y C;  4ZPB A;  3JAM Y;  2M8H A;  1IN0 A;  2O67 A;  1S0M A;  4OIX A;  2MKJ A;  3PV8 A;  4LRA A;  4O3N A;  2W9B A;  2UUB F;  2QYC A;  4QW9 A;  4DBQ A;  1NSP A;  5HP1 B;  5F9L A;  1CJV A;  3C8Y A;  2D3Z A;  5EUH A;  3LP2 B;  2CJY B;  4IKA A;  5HVG A;  1RBO B;  2IVY A;  4GRS A;  2HHH F;  3FEX B;  1QAY A;  3I6P A;  3JTN A;  2FDN A;  3BKF A;  2I2Y A;  4LF2 A;  5E2Q A;  4HT5 A;  4OMF G;  2NPI A;  3JSM A;  2DEI A;  2GJI A;  1OY9 A;  4OHV A;  3BKT A;  4YS2 A;  3Q8Y A;  3TEG A;  3LAK A;  4QYZ K;  1NUE A;  4I6W A;  2IC3 A;  3QT6 A;  3TQ1 A;  4PXD A;  1F3F A;  2Q1L A;  2DNP A;  1U1P A;  4FPR A;  3BBC A;  3B4M A;  1I94 J;  1UFW A;  4NLR A;  5KFE A;  1T05 B;  3ISN D;  4FYW B;  1FI4 A;  2MLX A;  2L9N A;  1FKP A;  3I9V 9;  2HFU A;  4Y3C A;  3QSI A;  3L09 A;  4O3O A;  2KHD A;  4NRT A;  4DZ6 A;  1V3R A;  1YJ9 S;  1Y5N B;  4JI5 J;  1EX8 A;  5ETO A;  2ZKU A;  2WBR A;  1APS A;  2RKI A;  3VAM A;  3NCR A;  3CJR A;  2NXN A;  1RTH B;  1O8B A;  2P9C A;  3MFI A;  2RDJ A;  2G0I A;  1M5P C;  1HPZ A;  4UZC A;  3W66 A;  3TUP A;  4NLV A;  4ZCM A;  1N5Y B;  4U67 Q;  1VQ6 S;  4I0W A;  3MEG A;  3DRR A;  1XBW A;  1XK8 A;  3ZZP A;  4QIE A;  1JJH A;  2IJN A;  3BGF A;  3GPA A;  3DLK A;  3KNG A;  1NK4 A;  1IM6 A;  5J1P A;  3J81 j;  1ZZF A;  1VIX A;  4LF4 F;  3FQK A;  1KTV A;  3LP2 A;  3G8T A;  1RWU A;  3R6L B;  3TVY A;  1KN6 A;  2COL A;  4X84 A;  1YZ7 A;  1AZS B;  3C6U B;  1YI2 S;  2OP5 A;  3HT0 A;  5T14 A;  3D6F B;  5A2Q U;  3A4T A;  1JXL A;  3DYA A;  4O44 A;  2BEF A;  1VRT A;  4K7Q A;  3B54 A;  4PG8 A;  3V6K A;  1FXL A;  3AY0 A;  1LFW A;  2M2B A;  3J7Z T;  3BQ2 A;  2HRU A;  4PPZ A;  5KFB A;  1QY7 A;  4DR3 F;  3KDN A;  1RAJ A;  1HWK A;  5KFG A;  3THP A;  2EWH A;  2DK2 A;  4J9S A;  4L76 A;  3BBB A;  2E5G A;  1H2V Z;  2JLF A;  4MH8 A;  1MG7 A;  4N47 A;  3AQO A;  1UPM B;  3W9J A;  2FVR A;  3SFG A;  2N4D A;  4WTY A;  1NH7 A;  2KFY A;  1EQ0 A;  2B9Y A;  2LU2 A;  3I5A A;  3MM9 B;  3W2V A;  1UJ6 A;  3GIJ A;  5DQI A;  5D0E A;  2IIH A;  4ZP6 A;  1XER A;  3BR8 A;  2FGO A;  4RU2 A;  1N5Q A;  1N5Y A;  1WC3 A;  1KP6 A;  2IBK A;  3GYX B;  4HHH A;  2VQE J;  1VOM A;  2GNK A;  3CW2 C;  4WZQ A;  2RHQ B;  2ZM6 J;  3NAI A;  2DHH A;  4P73 A;  3IBW A;  4URG A;  1UWB A;  2ABY A;  2F1F A;  3DDK A;  4HR2 A;  1UZD A;  1Z2L A;  2O1P A;  2W7A A;  1NB2 A;  2XYG B;  1H6K X;  4MTP A;  4RJV A;  4HH0 A;  1GQE A;  2Z0G A;  4HEA 9;  4ZVE A;  4Y6I A;  1RHJ B;  3JSB A;  4N8O A;  4ZVR B;  4F3Q A;  2ATL A;  4RL1 A;  1RWX B;  4W92 B;  3KG1 A;  5GME A;  2AGO A;  2KKH A;  2B4P A;  4E0D A;  2ZIT A;  5DG8 A;  1KQF B;  2WON B;  1LWX A;  2B51 A;  2HFV A;  1AZS A;  5K8O A;  1TV6 B;  1GTH A;  1WC0 A;  4QIW D;  2VBY A;  1WDD A;  4TLR A;  1KHW A;  1RBA A;  2MLZ A;  1KKH A;  4KQZ A;  3HVA A;  4HDH A;  4DPU A;  2HBZ B;  3KNA A;  2FJW A;  3OL9 A;  2CPJ A;  3HSD A;  1VHI A;  5IOL A;  2PFD A;  1SIZ A;  2E5L F;  3RGI A;  5KFP A;  2CIM A;  2Y1I A;  4UQT A;  5IC6 B;  3ITH B;  3MAQ A;  2J6S A;  4UTG A;  2DGX A;  3G2X A;  1F2H A;  3OXG A;  2R4F A;  5AXK A;  4OJG A;  1FX4 A;  2VC1 A;  1GAO A;  3MM9 A;  4MK9 A;  1VS3 A;  1S72 S;  3A8K A;  5JXS A;  2CQD A;  4ZHR B;  2VG6 A;  2FHJ D;  1KLN A;  1B7Y B;  4LBI A;  4EWT A;  3NLC A;  3SCL E;  1NME B;  2JDJ A;  2UU9 F;  2NS1 B;  2YX7 A;  3GV5 B;  1Y4Z B;  1U0S A;  1X5P A;  4QW8 A;  2XY5 A;  1S9E B;  2G0J A;  5IT9 Y;  1A9N B;  1XN9 A;  2CPD A;  2CWK A;  1HR0 J;  3JSR A;  4UQG A;  2QA4 S;  3CD6 S;  5J2M B;  4JOU A;  3D1Q A;  3DM2 B;  2BM0 A;  3CPW R;  3UVJ B;  3FVY A;  2DNG A;  2CQP A;  5KFO A;  4J9Q A;  2BUN A;  3W8G A;  4C97 A;  3HFZ B;  4X2B A;  1TV6 A;  3V6H A;  2IA0 A;  1DQA A;  3UDL A;  1JNR B;  4OYO A;  2OEK A;  3U27 A;  1ZS6 A;  4G1Q B;  4YOE A;  2R7X A;  1U0H B;  3O5T B;  3CCM S;  4J91 A;  3EGW B;  3UN2 A;  4X4O A;  3JXO A;  3DOL A;  2VFV A;  4TNO A;  1BY9 A;  5DZ7 A;  1VI7 A;  1P1T A;  3Q8U A;  3OTO F;  2YY3 A;  5HAT A;  3U1M A;  3ITH A;  2C3M A;  3V81 A;  1JLQ A;  2LA4 A;  2UXB F;  2WVC A;  2W9A A;  3MGJ A;  3T5J A;  3RYL A;  2RRB A;  4OHW A;  2OFG X;  2C2M B;  3D54 A;  4UST A;  3UDV A;  3TVK A;  4NI2 A;  1S57 A;  3R2C J;  2E1R A;  4DN9 A;  1WTB A;  4O4G B;  3BRE A;  4NXM J;  2BAN B;  2RT3 A;  1V5I B;  2WSF C;  2A1B A;  1M5H A;  3I87 A;  1CSJ A;  5HL7 Q;  2LCW A;  2VG5 A;  1UW9 A;  3DI6 B;  2J8S A;  2N4C A;  1X4F A;  5HSP A;  3QRQ A;  1XWL A;  4NXN J;  1C2P A;  1S9E A;  3GP9 A;  4OI6 A;  5KG1 A;  4ED3 A;  2O3D A;  4DS5 A;  1VBY A;  4KGZ B;  3O3L A;  4WIQ A;  4LR7 A;  3UVJ A;  7AT1 B;  1G2E A;  3AOB A;  2HLT A;  3QSY B;  2EKY A;  1SL1 A;  4HL9 A;  4HVZ A;  1YKW A;  7FD1 A;  2NQP A;  2GFF A;  2O01 C;  4RLE A;  3I5C A;  3TZZ A;  1NSK L;  1LV5 A;  2MY8 A;  3HXM A;  1ACM B;  3C66 A;  2X1G A;  4B9L A;  4UT4 A;  3PEJ A;  4ZPT R;  5GAE U;  2R8J A;  4G1Q A;  2YKM A;  1PC4 A;  2CQC A;  4ID5 B;  4EK2 A;  3AA8 A;  1UVL A;  1IKV B;  4M5K A;  1UP1 A;  1PSD A;  1TQL A;  3HM9 A;  2HUR A;  1WI8 A;  1DZ5 A;  1N88 A;  2AV5 A;  5CZV A;  3TJ9 A;  4A8Q A;  4IQM A;  2IVF B;  3H5Y A;  3AFG A;  3GSD A;  3MM8 B;  4X4S A;  2FHM A;  3PW0 A;  3QMQ A;  3OFG A;  3WDO A;  1HYS A;  4KHP J;  1UA1 A;  2DCU B;  1SBR A;  2V9W A;  2J0X A;  2EPI A;  2VB6 A;  2EFO A;  3GFX A;  4LFC F;  1SQE A;  2Y8Y A;  1H2U X;  2ZH3 A;  3SYZ A;  2ZZM A;  3OD2 A;  1BLU A;  2GC8 A;  1VBX A;  5J2N A;  3DI6 A;  2LU1 A;  1RQ0 A;  4IH7 A;  3M9O B;  2ZUA A;  3MI7 X;  4IYQ A;  4PXC A;  4LSN A;  4KRW A;  5AJ3 F;  4FPI A;  1SV5 A;  2LFV A;  4KKO B;  2CZV C;  3Q22 A;  5DM7 Q;  5KFK A;  5KT6 A;  4FP9 A;  4IUF A;  3GYN A;  3W7B A;  5I3U A;  1F5C A;  1ZTT A;  2WVB A;  2JVR A;  2KRR A;  1UWA A;  4X4P A;  1RT2 A;  2OO4 A;  1S9F A;  1DHM A;  3PJX A;  4DV7 J;  3FMW A;  1OQ3 A;  4YB5 A;  3W63 A;  1VGY A;  2HHV A;  3L7O A;  2W7P A;  4WP8 A;  3SEO A;  1VQ4 S;  4XAK A;  3L9Z A;  2RF2 B;  4TYB A;  2Y1J A;  3RRK A;  3AH6 A;  3H2V E;  3IAS 9;  4G1I A;  2ALZ A;  3FBB A;  4P75 A;  2OMO A;  4FF4 A;  4DUY F;  3KLI B;  2BJE A;  3Q83 A;  2MKI A;  4X4U A;  4GKK J;  4X4Q A;  2Q3P A;  1RTJ B;  2LVW A;  1FX2 A;  3PFO A;  6FDR A;  8AT1 B;  4LVN P;  1G7C B;  3I31 A;  1NZA A;  2GHP A;  1WF0 A;  2W8L A;  1HQE A;  1U8S A;  5CXT A;  2OLW A;  5BR8 J;  1IJE B;  3K2Y A;  3KLG A;  4PUO B;  1C1B A;  4P71 A;  2MQL A;  2OML A;  1JJC B;  1SH2 A;  3W60 A;  3OHB A;  3MED A;  1BC6 A;  5AXM A;  1YJ7 A;  3U1N A;  3EGN A;  4PXB A;  1B0V A;  3NMA A;  4F0M A;  3U02 A;  2B8P A;  4Y2A A;  3PYF A;  1FRH A;  3D0G E;  3D68 A;  2ZOG A;  4USJ C;  3MMC A;  3TAN A;  5F8G A;  2Q66 A;  2ILY A;  2XSF A;  5KFW A;  4DQQ A;  3T9N A;  4TY8 B;  4B9V A;  4ELT A;  1FNX H;  3W62 A;  3MR6 A;  1Z4U A;  2UVR A;  4K5S A;  2Z2Y B;  4DR4 J;  1VQ5 S;  3FC9 A;  1HKA A;  1MN9 A;  5HQ8 A;  4J5O A;  4UZB A;  2MQN A;  2JEF A;  1YJT A;  2DNY A;  1WEY A;  3EYZ A;  1SC6 A;  3ET6 B;  3HT3 A;  3LQV A;  3O8W A;  5E3P A;  4O4R A;  3UWT A;  4U7U K;  3BYR A;  2XCP A;  2M5Y A;  1N36 F;  1S6P B;  1JK9 B;  2KN4 A;  4OZ5 A;  3W5Y A;  2WK4 A;  1NU4 A;  1NSA A;  3CJK A;  3P4U B;  3NOC A;  2RF2 A;  4AL6 A;  2M9K A;  2PI5 A;  4QYZ J;  4G65 A;  5ADZ A;  1TFY A;  2RQK A;  3LA0 A;  1U1Q A;  2HHS A;  4Q8F A;  2PFF B;  3T9Z A;  3IA0 A;  2JLG A;  3EDQ B;  2KB2 A;  2BRL A;  3HKZ D;  2HVZ A;  3ETM A;  4IRK A;  3ONQ A;  1Y7P A;  1GXU A;  3UDC A;  4ED7 A;  4H4K A;  2GVZ B;  2UVU A;  4QPX A;  1N5V A;  3BPS P;  1OQ6 A;  4B9S A;  4ZLP A;  3KLE B;  4K2J A;  4KFB B;  1S6Q A;  1HNZ F;  2Y8W A;  2F8H A;  5EDW A;  5HMW A;  4C11 B;  5GMK a;  5DG9 A;  4LF6 F;  5IS2 A;  1G1X A;  3PM9 A;  4EBE A;  1R27 B;  4L75 A;  3LWL A;  1WD6 A;  4R25 A;  4IH6 A;  4DV0 F;  4ZVP B;  1HWL A;  3VTI A;  4DR6 F;  4LRB A;  4ECY A;  3I4P A;  3FRZ A;  2HRY A;  4QWC A;  3MUT P;  1HI1 A;  3AJ2 A;  2D9O A;  3DLJ A;  4WXW A;  1FHT A;  2W9C B;  1WKJ A;  4LT6 A;  1NAQ A;  5F8I A;  1DTQ A;  2JFD A;  4DF4 A;  1HHQ A;  1CJU A;  2XS2 A;  3AOA A;  2Z2M A;  5B0B A;  5D4P A;  4DS4 A;  3KLH A;  4Q5V A;  3FCV A;  2QX0 A;  1BWV A;  1R0A B;  4A47 A;  4IQX A;  4NL5 A;  3D6M B;  4OYA A;  3BSA A;  2P6T A;  2V63 A;  2J7K A;  3WX4 A;  1KDN A;  1TKZ A;  3MXH P;  1YG0 A;  4CNY A;  1T3O A;  3MM7 B;  3NS5 A;  3DLL Q;  2CFX A;  4FVM A;  2V8H A;  4WZM A;  5K14 B;  4DV1 F;  3TAR A;  2DNL A;  2OTJ S;  2I6W A;  1V5V A;  3AD7 C;  2DBB A;  5C24 B;  1U2R A;  2UUT A;  1ZZN A;  4DV2 J;  3N79 A;  3KWM A;  2IA6 A;  3PX4 A;  4FXD A;  4DR1 F;  2K3I A;  3DHW C;  3KUE A;  2V2Z A;  4NLG A;  2DGW A;  4X62 F;  1HL6 A;  1KFD A;  3ZNU A;  3H59 A;  1Q8I A;  2GVZ A;  3KFW X;  4NX9 A;  3LUY A;  4JI3 F;  5HLF B;  4KFB A;  2YKP A;  3LP0 B;  4DUZ J;  3D5M A;  1JLE B;  1RTD B;  3V6D A;  1WSV A;  5F0U A;  4J90 A;  1N4L A;  2XYP B;  4JUZ A;  3WC0 A;  2HND A;  2HQI A;  2UVV A;  3E51 A;  1O6X A;  2I8E A;  1IKX B;  1NH8 A;  1IBM F;  1YLX A;  2ZBP A;  5E33 A;  3W2W B;  2GVD B;  2XC9 A;  1X9W A;  1IWG A;  2HNZ B;  4ZJO A;  3BS9 A;  3N6L A;  4JI0 J;  3HD1 A;  1X0F A;  4URQ U;  2MMY A;  2V8D A;  1I51 B;  1RTZ A;  4DR5 J;  3KOA A;  3VAG A;  3UE2 A;  2JZ5 A;  1S1V B;  4JI8 J;  3GV8 B;  4NML A;  5CQG A;  3DRX A;  1CVJ A;  5SZT A;  4QZV B;  1R0A A;  1NHK L;  4NAS A;  5JJB A;  3DN9 A;  1D8Y A;  4YB1 P;  4USW A;  1CG2 A;  2CXE A;  5F41 A;  4IOC Q;  1XMO F;  3KMS A;  4U8V A;  1FRX A;  4Y2K A;  3V4I B;  3R27 A;  2ZC3 A;  3NCQ A;  3HI9 A;  2BAC A;  2LYV A;  3A1Y G;  3CSK A;  2XLJ A;  2RRN A;  4RU9 A;  3BSN A;  3QRP A;  4DLE A;  3FSX A;  5FLX U;  3BR9 A;  5C24 A;  1OY8 A;  2KT2 A;  1YDL A;  2H1Y A;  2V69 A;  4KPC A;  4KPY A;  3LGH A;  3KJV A;  3UNY A;  1SJR A;  4TN2 A;  5GAG I;  3OL6 A;  4UW2 A;  4C8L A;  1TMM A;  4G6V B;  4CCH A;  3Q8S B;  3HHL C;  2V4R A;  4MFB A;  5LSO A;  1YZ6 A;  4UF4 A;  2F7V A;  2R7Q A;  2PA8 D;  4RBV A;  5LMU J;  3V5R A;  2EFN A;  4LRD A;  2DR6 A;  4DOZ A;  1U6F A;  2QLB B;  3FBF A;  4MMO A;  2DHS A;  2DGT A;  3V2U C;  4K8R A;  1RTD A;  4UOG A;  4OJ3 A;  1FJ7 A;  3CO0 P;  3BEG B;  2VG7 B;  1IKY B;  4ZP8 A;  4OHZ A;  1BQN A;  2A2C A;  3TA0 A;  5HI7 A;  2IFX A;  3TRG A;  1ZAW A;  3EZU A;  1ZM9 A;  1HBO B;  1Q79 A;  4RW7 B;  1OSD A;  3OV7 A;  1N33 J;  5A0Y A;  1RWW B;  1MRO A;  2QE5 A;  4WFY A;  2E66 A;  5DGB A;  5D4N A;  4PCQ A;  2PMZ D;  4ZDN A;  4L74 A;  4LSZ B;  3TAQ A;  2BAB A;  1I1G A;  4ZPW R;  2MST A;  1RAO A;  1P9Y A;  2DNK A;  2R2U A;  4NOH A;  1EJ7 L;  2E5J A;  2QG9 B;  1E6V B;  1VJW A;  4I4B A;  1QE1 B;  2AP6 A;  4GMK A;  3DGP A;  1IBC B;  3IG1 B;  1TUV A;  2B5J B;  1NRK A;  2VC0 A;  4O0N A;  1UEK A;  2I1R A;  4FYX B;  1QTM A;  1HMV B;  4CI0 B;  4PG7 A;  1RT4 B;  3ZTO A;  2QGF B;  4KV8 B;  2G2O A;  4WCE Q;  4M5D A;  2E9R X;  2GHV C;  2IY5 B;  4WBF A;  2AGQ A;  2R8H A;  1GXL A;  3UN5 A;  6AT1 B;  3RJM B;  4NMX A;  4DCP B;  3QGP A;  2DH7 A;  3KKF A;  2J7U A;  4OL8 A;  4PWU A;  1RCO B;  2JX2 A;  5SUH A;  2G2Z A;  3VAJ A;  4ECT A;  2VQF J;  1U6B A;  2OPQ B;  2IAJ B;  3MM6 A;  1J2V A;  3BV8 A;  3FDS A;  1UA0 A;  4YEA A;  4NRU A;  1S49 A;  1NK0 A;  4RUH A;  4OX9 J;  5KOX A;  1IXK A;  5E3C A;  2MQO A;  1RAG B;  4IG0 B;  1R6V A;  3GE9 A;  1FFG B;  1HBN A;  2KG1 A;  1HNX J;  1WHY A;  4X66 F;  1S9G A;  4XDC A;  9ATC B;  1Z2Z A;  3J7A N;  3KJF B;  4Q0B B;  4WP3 A;  4YN3 B;  5L1K A;  3KHH A;  2POK A;  3IS9 B;  3R1H A;  2F8E X;  3OR2 B;  2B4O A;  1RA7 A;  4LMZ A;  3H2L A;  2R2T A;  5D4L A;  4P52 A;  3VGS A;  1TKD A;  1RDR A;  3TUI C;  3BSO A;  4F2S A;  2I5J B;  5IQQ A;  1HNW J;  1P8G A;  1RHK B;  4AL7 A;  1RA6 A;  4ES3 A;  4LFA F;  2LXU A;  2W2P P;  4O3R A;  1VRU A;  1KOO A;  8ATC B;  5IWA F;  4CO3 A;  1SPB P;  5LJ5 Y;  3PW2 A;  2XMU A;  1RWN B;  4ZA1 A;  1UFK A;  5KFS A;  1Y9O A;  1NBE B;  2CAJ A;  1GX6 A;  3CCQ S;  3MPV A;  3HVR A;  1H0H B;  2GS8 A;  3QAU A;  4F04 B;  3C2P A;  3BO3 A;  4I7F B;  1RWO B;  3FSY A;  4KB7 A;  3QYY A;  1RT1 A;  3K5O A;  2DRA A;  1S10 A;  1W25 A;  5D77 A;  1C4A A;  3KG0 A;  4DV6 F;  3HDS A;  3OLB A;  1VQY A;  2MXY A;  4A8Y A;  4WWS A;  2ROE A;  2BJD A;  3MM5 B;  2OPQ A;  4CT9 A;  1MWZ A;  4FYV B;  3AJ1 A;  1SC3 B;  1Z1Z A;  2O5D A;  2YVS A;  4TVA B;  1NJX A;  5LOQ A;  3FCW A;  4GC6 A;  4ERD A;  1T9Y A;  4DPT A;  1WAC A;  4B3R F;  2AJ1 A;  1LK7 A;  2W2O P;  1FKO B;  3BN4 A;  3MEK A;  1FNM A;  4AQY J;  4JV5 J;  4TU7 A;  3L7P A;  3OQ2 A;  2V2K A;  4NLT A;  1VYA A;  4Q0B A;  3GJT B;  1SIW B;  1QVG R;  3O2I A;  2BM1 A;  2RU9 A;  2AQ4 A;  3FK4 A;  3OR2 A;  3CCZ A;  2FB0 A;  4EYI B;  2IYG A;  2B0G A;  3C15 B;  4M8L A;  1B99 A;  3SBM A;  3CJ2 A;  2HK3 A;  4A8K A;  2I9S A;  1F2G A;  1KVI A;  3SQO P;  2L9W A;  3R5J B;  1V9O A;  3S8S A;  3CUL A;  2AKW B;  1VHF A;  3HX9 A;  2X7I A;  5KFT A;  2FD2 A;  5KAK A;  3PNI A;  4HI1 A;  3R9L A;  3G6Y A;  2B7C B;  3MR5 A;  5BYS A;  2XY6 A;  4DXL A;  1FJG F;  1SUQ A;  4ANC A;  2MKC A;  2YNF B;  2HMI B;  2KYX A;  5A8W B;  4I56 A;  5ITH A;  5E7O B;  1L3S A;  1DTT A;  4F4A A;  5FII A;  4X64 F;  4QWA A;  2E7V A;  3DGV A;  4IR9 A;  2XI3 A;  3TJA A;  1XNR F;  3CCE S;  2WW8 A;  2XGQ A;  3DOK A;  1WF1 A;  5C2G A;  4LIW A;  5AE3 A;  3D3B J;  4KO0 A;  3RW7 A;  4IRD A;  3DC2 A;  4L6V 3;  4MKV A;  1RT3 B;  3OUY B;  2CJB A;  2DGO A;  1NKE A;  1RWP B;  3W64 A;  5J2Q B;  1M1K T;  1RT7 A;  3NBP B;  5J1E B;  4CO2 A;  5B7W A;  1S1X A;  4C98 A;  1FKO A;  2IJR A;  3PRB A;  2AWZ A;  1R8C A;  4DL6 A;  4M5G A;  2P9G A;  3BGU A;  5KG7 A;  2LXI A;  2W25 A;  3HLU A;  2Y0B B;  5AT1 B;  1N56 A;  3B78 A;  1N34 J;  1IR2 A;  2CJ9 A;  1N32 J;  3M1V B;  3R5C A;  1NK9 A;  2H3E B;  3PKM A;  3DMJ A;  1IUJ A;  3QLH A;  5BXI A;  3GIL A;  3RW6 A;  1H98 A;  3LP1 B;  1RWM B;  3ZZZ A;  1GMU A;  4DPW A;  4WFA Q;  1Q78 A;  1Q7L B;  1XEZ A;  2V8P A;  1U4B A;  4F26 A;  3KK1 B;  4LFB J;  2GX8 A;  3WZ0 A;  3H0P A;  3NAH A;  1FRI A;  3HHE A;  4UY8 T;  5D8H B;  3NGD A;  5THW A;  3MMB A;  4U96 A;  1LW0 B;  1TL4 A;  4C6A A;  1KQK A;  5C25 B;  4OYI A;  3SCK E;  1QD1 A;  1S1T B;  3OTC A;  2MPU A;  1QUV A;  4ED8 A;  3HK2 A;  5LMN J;  1XNQ J;  4LJM A;  3RB4 A;  4BS2 A;  3KDO A;  5A8W A;  1YJU A;  2UZA A;  1RJJ A;  4PG4 A;  4C3K A;  1H74 A;  5KG5 A;  1XMQ F;  1PJ5 A;  1NZ8 A;  3JQJ A;  3M30 B;  4MKA A;  3PDN A;  1U2C A;  3ZZO A;  2HLU A;  4CYU B;  5D3G B;  2QZ8 A;  1J5E J;  3MOJ B;  5LT5 A;  1U24 A;  4R0E A;  4JB8 B;  4ZLN A;  2CJK A;  1RWK B;  4A8S A;  4B08 A;  1RT3 A;  3AJD A;  1FD2 A;  1QTN B;  1PIL A;  1SJ1 A;  1FES A;  1JKH A;  3M6W A;  1D9D A;  3QAE A;  1KLM B;  4LF5 J;  1MN7 A;  2KO1 A;  3MMA A;  1HNV B;  2A0F B;  5D6G A;  2R7T A;  4JV1 A;  3MUR P;  3GTY X;  4WP9 A;  3M2U B;  4ICL B;  5CCL A;  4JI4 J;  3UD4 P;  3NGS A;  2EG1 A;  3LAL A;  3ILJ A;  4F4Z A;  4ECW A;  3PYD A;  3I82 A;  5ETQ A;  5EN1 A;  3M1V A;  2ZJR Q;  2HHT A;  4MKY A;  2F9D A;  3SQG A;  2ZH8 A;  2GGP A;  2GIQ A;  1BMQ B;  2X1F A;  1Q5Y A;  3BSC A;  1S0N A;  1F6T A;  4DL5 A;  1EP4 B;  2PE8 A;  3KK1 A;  2X1B A;  2BE2 B;  1X4A A;  2AZ1 A;  1VQ8 S;  2AEM A;  3UI3 A;  2BW7 A;  1S59 A;  1VK3 A;  5F3Z A;  3V6J A;  2D3U A;  4U7U D;  5C25 A;  2R2R A;  1PKU A;  2DRB A;  4K5R A;  5BJR A;  1T03 B;  4Z7Y A;  2EK1 A;  1N5T A;  3W9I A;  4IFV B;  3SDE B;  2W2N P;  1LWE B;  5HBM B;  1JLA B;  4RW4 B;  2DNZ A;  4ZVG A;  3SXL A;  4ZOS A;  2HVH A;  2A18 A;  4ECS A;  4LBH A;  4B3T F;  3QGH A;  3E01 B;  4I2P B;  3PAC A;  1U09 A;  1TTH B;  2RHS B;  1VQK S;  5KT7 A;  1RSC A;  1QVF R;  3MAA B;  5GAG U;  4PQU B;  3M32 A;  2K1R A;  5L1I A;  2B4V A;  4RUC A;  5A8K A;  1YGY A;  1DFD A;  4FF2 A;  1NPK A;  1CS4 B;  3AHP A;  1NJZ A;  4MK7 A;  3MPU B;  3Q8P B;  1RGV A;  1FER A;  1YRX A;  5HAN A;  1HNV A;  2UUB J;  4C4W A;  2QSF A;  3OW2 R;  1Y3K A;  2CNL B;  1UET A;  3J81 U;  2XSJ B;  5DQG A;  1T9W A;  3OL8 A;  2JC0 A;  3C14 B;  1KRP A;  1U7L A;  4QIV A;  1VQ7 S;  5KFD A;  4GVB A;  1W26 A;  2HHH J;  2FUG 9;  3IWX A;  4ZPC A;  3R6G B;  4BC9 A;  4K4Z A;  2UVW A;  2VKR A;  4QR1 A;  4DFK A;  4EBC A;  5C2C A;  1PAE X;  2OI2 A;  2C2N A;  4R5P A;  1TK8 A;  2L08 A;  1O0P A;  1G6B A;  4F67 A;  3GFY A;  4EU0 A;  2E1A A;  4LQ9 A;  3F73 A;  4QWE A;  1RK8 A;  3DRS B;  3Q8V A;  4DMZ A;  1LWE A;  5E3Q A;  1JLA A;  3A3O B;  4LSL A;  2QL5 B;  2ZH1 A;  4I6A A;  1RTI A;  3PFE A;  3TI0 A;  1ZM2 A;  4TLQ A;  3UW1 A;  5DDQ C;  2NYI A;  2H54 B;  4LVO P;  1TVR A;  2R7U A;  5L8R C;  3E3X A;  4CLK A;  3TO8 A;  2NXJ A;  3JAM U;  1HBU A;  3K89 A;  2WB4 A;  1EKR A;  2CG8 A;  4PEO A;  2YH1 A;  2BKN A;  4PQU A;  1X0P A;  2HQF A;  2QT7 A;  5H1S V;  1TK5 A;  2R8K A;  2IRX A;  4N7T A;  1NHV A;  3HUL A;  5B0E A;  1OJ4 A;  4M5J A;  1CS4 A;  3M8Z A;  5DO2 A;  2ZWO A;  4F02 A;  4M5N A;  1RLD A;  3UDE A;  3HZE A;  1LWC A;  5LSR A;  3HSZ A;  2XQC A;  2YQ0 A;  1RCX B;  3W3S A;  4LF4 J;  2MSS A;  2LEA A;  1FCA A;  3C14 A;  3LOU A;  2PA3 A;  4F50 A;  3C16 A;  3IR6 B;  3CME S;  1U47 A;  3VF0 B;  3TOQ A;  3PCO B;  4ZS6 A;  2L48 A;  1DLO B;  1TKX A;  1WHW A;  2OFH X;  3NP5 A;  2CPF A;  1S1W A;  1A7G E;  3T5K A;  1URN A;  2GHW A;  3CUN A;  1D09 B;  1BHN A;  1D9A A;  2DPJ A;  5MAO A;  5F8N A;  1NPP A;  3RB3 A;  5HRO A;  3M8W A;  4DR3 J;  5AXL A;  2Q6B A;  3CF5 Q;  5HN0 A;  1RT5 B;  2DY1 A;  3FJ2 A;  1Q4R A;  2XTJ P;  4Y2M A;  1T3N A;  4KYZ A;  4WK1 A;  5EHH A;  1D3W A;  4EBD A;  4CLW A;  2KM8 C;  3NY0 A;  2VJV A;  4IDK A;  3THV A;  3GLJ A;  2XHC A;  2HKE A;  3MPW A;  2LXF A;  1Q7Y T;  5CYM B;  3A8J A;  4M5M A;  1PBA A;  3EXC X;  4NZ0 A;  2YQ3 A;  4ZP7 A;  4CTA A;  1U1K A;  4YQW A;  4F3O A;  2RIL A;  4YHH F;  4IR1 A;  3TNV A;  3F44 A;  4CLL A;  2EFQ A;  3U1L A;  1YJW S;  1TAQ A;  2ZDO A;  1CJT B;  1R8B A;  2DXD A;  1S1U A;  4UY8 5;  4WXO A;  5CA5 A;  4F4W A;  1FWP A;  3GJQ B;  4FXV A;  2CQG A;  2FY8 A;  4NLU A;  4OZ3 A;  2FLL A;  1REV B;  4DPY A;  1FT8 A;  3KLF B;  3D67 A;  5DGA A;  1XR5 A;  2B3T B;  2K7J A;  4DI6 A;  2ZEJ A;  2GQQ A;  2IJF A;  2F3J A;  4F2R A;  1I5O B;  3A8E A;  4FDF A;  3DNC A;  2IM3 A;  1UEU A;  1X4G A;  2OPR B;  2XI2 A;  1S79 A;  3BDP A;  2VPW B;  4ZVO B;  3RRG A;  4I2Q B;  1SXL A;  2E5L J;  2FLO A;  5K8M A;  1K1S A;  4HKQ A;  5KFN A;  2U1A A;  2QA4 G;  4UUW A;  4GKK F;  4QJV A;  3LH2 S;  4J9U E;  4C8O A;  4P10 A;  2OPS A;  3C6T A;  4AT1 B;  4OX7 A;  4OI4 A;  1TEL A;  2MZJ A;  3IC1 A;  1TL7 A;  3H5U A;  2ZJP Q;  1PCA A;  4QU7 A;  2GQ2 A;  3SIP B;  1FA0 A;  3GCX P;  1FVQ A;  2DXE A;  5A8R A;  2PMW A;  2DY9 A;  1RE1 B;  1JLC B;  1NB7 A;  2AJQ A;  2V4J B;  5GAE I;  3G71 S;  4C0B A;  4CNZ A;  4USV A;  2DR5 A;  3VWS A;  3L4B C;  4WFN Q;  3FQL A;  2DGS A;  3QJL A;  1GX5 A;  2A6M A;  3G82 A;  1UMJ A;  4Z37 A;  2BXJ A;  5IV3 A;  5I42 B;  5B0F A;  1RWV B;  2UP1 A;  3PW4 A;  3M2R B;  2HWT A;  2ZH6 A;  3D0H E;  5KFJ A;  2HQ3 A;  5FDL B;  4K0K F;  2UUA F;  1T8E A;  2VH7 A;  1REV A;  2G1D A;  3N4W A;  3OTD A;  2CDQ A;  2EC2 A;  2ZBI A;  2BV3 A;  2KFN A;  4I64 A;  5H9F K;  2WW4 A;  1YBU A;  4CWB A;  4YR2 A;  4WK3 A;  3DKD A;  1RLC L;  1HNI A;  1GNK A;  1TL5 A;  1SH3 A;  2CPX A;  3KUG A;  2HNY B;  3RU0 A;  4HTJ A;  1ZET A;  3IRW P;  2EK6 A;  2RUS A;  3LTO A;  4I2Q A;  4HAC B;  2QL7 B;  3K57 A;  2K7K A;  3OTO J;  2QRR A;  2IM0 A;  2E5I A;  1JJ4 A;  1X60 A;  3H7H B;  2XNQ A;  4CLY A;  5KT2 A;  1RYR A;  4FF3 A;  2UXB J;  3IGN A;  1X4D A;  2PEB A;  3TVZ A;  3VQS A;  1JB0 C;  4QBU A;  3D28 A;  2L9D A;  3H98 A;  1ZM4 A;  1RU2 A;  3VAK A;  2UXC F;  3MTK A;  2YNI B;  4OJ1 A;  5KG0 A;  2E44 A;  2DNN A;  4DPX A;  5IT9 U;  1JIH A;  3IM8 A;  3I0S A;  4JI2 F;  5KFU A;  5IXU A;  4OI3 A;  3H25 A;  3F56 A;  1I3O B;  2J9D A;  2G13 A;  1WC6 A;  1KC8 T;  1AT1 B;  2V4J A;  3Q24 A;  4CQ1 A;  3EGZ A;  1SH0 A;  3CT9 A;  1X5S A;  3BDE A;  4NLY A;  4LIR A;  4DQP A;  4Q43 A;  2DHX A;  3BYP A;  2ZKT A;  2MY7 A;  5ETN A;  1UAW A;  3AXM A;  1BE4 A;  4NZ6 A;  2IBO A;  1CC8 A;  2OKQ A;  1CJK A;  4JI1 J;  3BQ0 A;  4PWD B;  2JSX A;  3DOM A;  3JYT A;  3QBC A;  2K3K A;  4FS2 A;  3CC7 S;  1B64 A;  3RRH A;  4B9M A;  2HVD A;  3LO3 A;  2MJU A;  2CPH A;  3FNN A;  4MYT A;  4A8O A;  4M94 A;  2N7Y A;  3QPI A;  2C3U A;  4F4K A;  2YWW A;  3HHK A;  1UJ4 A;  2AEF A;  2DIU A;  2HNY A;  2OPP A;  3LF0 A;  2WVE A;  2ZOF A;  2CYY A;  4NLO A;  3ZZY A;  3KK2 B;  4CH0 S;  4DDF A;  1L3V A;  4LBP A;  2LQJ A;  3TJ8 A;  1X5O A;  4P2S A;  5IV4 A;  3LWM A;  1Q95 G;  2Q79 A;  2ZZT A;  4DX8 H;  3TWZ A;  2OEJ A;  2VV5 A;  4ATN A;  2CZ4 A;  3HKW A;  3HP6 A;  2FVP A;  5H9E K;  1JLF B;  2C2D A;  2OSQ A;  1FEH A;  5J2P A;  2FC9 A;  4LFC J;  3B4D A;  4WII A;  1LWF B;  5HJY A;  4RW6 A;  2CJQ A;  2PI4 A;  4QIF A;  3K58 A;  4H4O A;  1RAH B;  5AJ3 J;  2HHP A;  3QZ8 A;  2KT3 A;  3JTP A;  1C0U B;  4LR9 A;  4E8U A;  2JC1 A;  1KTQ A;  2OHD A;  2H9Z A;  2NUH A;  1WI6 A;  1KWM A;  3T19 A;  4DEZ A;  2VON A;  1JJ2 R;  5HP1 A;  4OQJ A;  4Y0F A;  3FZ2 A;  4JI8 F;  2RQ4 A;  4MAK A;  1FD8 A;  2ZVI A;  1HQU B;  1S5Z A;  2ASY A;  1PO6 A;  6FD1 A;  2RD5 C;  4C8Z A;  3QAT A;  3VAI A;  2ZNY A;  3J80 Y;  3OJU A;  1Y00 A;  5K20 B;  1DBD A;  2D69 A;  3NWR A;  4ZN3 A;  4OZJ A;  2AIR B;  4DFJ A;  4A4J A;  1YJN S;  2RML A;  2EFV A;  5F0W A;  2VAS A;  3K5P A;  3OTE A;  3IAM 9;  1HW8 A;  3CD0 A;  4ES1 A;  3EMT A;  4KH0 B;  2J9C A;  4ED1 A;  4DUY J;  4ZVQ B;  1FNO A;  2W4C A;  4PYD A;  1A0O B;  1EAR A;  2DB1 A;  5KG4 A;  5HQM A;  5M2P A;  2LDY A;  3DRP B;  4DFM A;  3H40 A;  2EXU A;  1OPI A;  3HHL B;  4A8X A;  2ZD1 B;  3KK2 A;  3HZG A;  2DHG A;  2IRU A;  4OX8 A;  1FO1 A;  4ZLL A;  2ILZ A;  5KG6 A;  4H4K C;  2CJX B;  1T05 A;  2W8K A;  3WIU A;  2B9W A;  4K59 A;  2HIQ A;  2MHE A;  4OYZ A;  2FVQ A;  1OPZ A;  4BWJ A;  2HFN A;  3BZQ A;  3TZW A;  1PBU A;  5B0A A;  3EPI A;  3FEY B;  3G6X A;  1J5O B;  2ZBQ A;  1JLG B;  4ES2 A;  4B3O B;  4DCJ B;  1RTH A;  3VR1 A;  5CCM A;  1O51 A;  4TKT A;  3N9U C;  3MMJ A;  1Y0H A;  2R2S A;  2JFK A;  2C2K B;  3CD5 A;  2FYX A;  4ECV A;  5ETT A;  1RUS A;  2EEY A;  3P8B B;  2BOP A;  4ZCK A;  1ZTW A;  4P7T A;  3HVW A;  1Y3J A;  2GAG C;  3SSR A;  3P5B P;  2L41 A;  2RQC A;  3DXB A;  3OJS A;  2D7S A;  3GIR A;  1M5O C;  3SV3 A;  1ZM3 A;  1VLY A;  2XM3 A;  3GZ7 A;  3W5Z A;  4AL5 A;  3KHL A;  4NLQ A;  2IDE A;  3DLE B;  2GML A;  2Z8Q A;  3I0R B;  2VFT A;  1RHR B;  1N36 J;  4RNN A;  2B6A B;  4DJB A;  2KVQ E;  3K5L A;  3C6U A;  3W61 A;  1FFS B;  4N77 A;  2IHR 1;  2HQD A;  4Q2L A;  1NXI A;  4OHY A;  1T0T V;  4LRC A;  2PDA A;  3EGV A;  2YBV A;  1HLW A;  1S97 A;  1KBR A;  2XEX A;  3HHL A;  4URS A;  4WKR A;  1CC7 A;  3FKB A;  1BUX A;  2CPE A;  1HNZ J;  1CPZ A;  5HVH A;  3OFE A;  2QO3 A;  4LF6 J;  4C0O C;  1KVJ A;  1H73 A;  4DSE A;  2CPY A;  4ZPD A;  3NNA A;  4DR6 J;  3P3D A;  2F4V F;  1WG5 A;  1K0T A;  4DX5 A;  3IN5 A;  2ROP A;  1GMW A;  4QPT A;  2ZHO A;  1OY6 A;  3QFW A;  5CD4 H;  2N3L A;  1T9T A;  5I3Q A;  4IFY B;  3I5B A;  3GSI A;  2G4B A;  1OO0 B;  1SB6 A;  1FRJ A;  2E9T A;  1Q8K A;  3NWG A;  4V19 J;  3W9H A;  4Y28 C;  4DX6 A;  2DEJ A;  4NLD A;  1H38 A;  3LPE A;  1RYS A;  2C2E A;  4ZVH A;  3T1A A;  4MIB A;  2YH0 A;  4M1K A;  2J8A A;  3CO9 A;  2J6T A;  1U8W A;  1LNQ A;  4YY3 F;  3C46 A;  4KIA A;  1QLN A;  4DV1 J;  4RR5 A;  2WON A;  1FFW B;  1SC4 B;  5F8M A;  3OXL A;  2QLF B;  1HD1 A;  4DU8 A;  3M8Q B;  5L9X A;  4DR1 J;  1ELO A;  4OV6 A;  1WJ9 A;  3BF4 A;  2V6A A;  1F9H A;  3UO0 A;  2R8I A;  1KHV A;  4X62 J;  2CKW A;  4XO0 A;  4A8M P;  3KJN B;  4ED0 A;  4X4V A;  4JI3 J;  2BJ9 A;  1RKI A;  2XZW A;  3T1Y F;  2HZA A;  2C3O A;  2RUG A;  2HZC A;  2ZH9 A;  3QIP B;  2FZG B;  1Q86 T;  4OLO A;  1VJQ A;  2MHN A;  2AMC B;  4K50 A;  1NDL A;  1IBM J;  3HFK A;  4I6Y A;  2LEB A;  4C0H A;  3N6M A;  4FN5 A;  2VL1 A;  4V19 X;  2WAQ D;  5HK4 A;  4ZHR A;  3CDB A;  3TA2 A;  4IFY A;  2HS3 A;  3MCN A;  5E3R A;  5LM7 E;  3CJ0 A;  1DAX A;  3CCL S;  2C2Z B;  4DN0 A;  1PYS B;  4PZV A;  4A46 A;  4ELU A;  4RNM A;  1XMB A;  3MEC B;  1OWX A;  3B6B A;  2BQU A;  4N8N A;  2OEL A;  2VIC A;  4MK8 A;  2JNJ A;  2GQC A;  3CCJ S;  5J2M A;  4B3S F;  1F3V A;  2FQQ B;  3DM2 A;  3MWB A;  4IRC A;  1QAX A;  3PR5 B;  1XMO J;  1CLF A;  2ZBR A;  1NLK L;  1Y5L B;  1Q81 T;  3K5N A;  2KH9 A;  2ZHB A;  1KD1 T;  1NDK A;  3P5T L;  1K73 T;  3M9M B;  5A6P A;  2HFS A;  2HQG A;  4ZVS B;  1RT6 B;  4GC7 A;  4PAA A;  4HLB A;  3NS7 B;  4FBT A;  2B7B B;  2ZFH A;  3D1O A;  4RPF A;  4CIO A;  4OX6 A;  3OPK A;  4XIU A;  3MR2 A;  1XC9 A;  3OSP A;  3F41 A;  1U0H A;  1U25 A;  2G1H A;  1Q1K A;  2YNH B;  4RZR A;  3D6T B;  1RAA B;  2FJV A;  2KG0 A;  4JV2 A;  2VF3 A;  1IKW B;  1MU2 B;  5I4M A;  3T5L A;  3OL7 A;  2IDL A;  1WOP A;  2QN6 B;  2E29 A;  3TX8 A;  2JEI A;  3ISN C;  1F9E B;  2AEJ A;  2IVM A;  3Q2T C;  1AYE A;  5B09 A;  2VPY B;  1F5A A;  5L1J A;  5ETL A;  3AXK A;  4S0M A;  3KMQ A;  2O66 A;  3TAP A;  5HMX A;  2R7O A;  4IH5 A;  3FMB A;  4OYX A;  1YIT S;  2HGM A;  2Z2L A;  1EAY C;  2DCL A;  2IRY A;  5DLF A;  2WBM A;  2YPY A;  2X51 A;  4KGV B;  4O4G A;  3LW5 C;  1X4H A;  3CCV S;  2QSW A;  2XBP A;  4KBI A;  2BAN A;  1DQ9 A;  4F36 A;  1VQP S;  4Y34 A;  1LFP A;  1X4B A;  1FDB A;  4NLP A;  3VGU A;  1TUG B;  1S99 A;  4IG3 B;  3ZO7 A;  2GMH A;  5GAD I;  3UCG A;  4DLG A;  4ZMM A;  2UUC F;  1KVK A;  2WOM B;  3BGO P;  5K8N A;  4UUX A;  2OJ3 A;  2AD9 A;  2FHK A;  1HHT P;  3HVT B;  1QAJ A;  4H54 A;  3J7Z 5;  3HJV A;  4KAI A;  1E6Y B;  4NCG B;  4KR0 B;  1WC1 A;  4OZN A;  2QEX S;  1RT6 A;  3TAM B;  5H9F J;  5KFL A;  1VQM S;  1TL1 B;  4JI6 F;  5T7L B;  4NYP A;  1NDP A;  4MYU A;  3I56 S;  5JVG Q;  3NGU A;  5K5M A;  1TL3 B;  1D9F A;  3ZTQ A;  4ID5 A;  3FCH A;  4L3K A;  2I0X A;  1TKT B;  1IKV A;  4R8U B;  2XMV A;  4CLP A;  4LF7 F;  3OXF A;  4K4V A;  1HBM B;  4DR2 F;  1LKZ A;  2XMA A;  4OYM A;  2P9E A;  3UNG C;  2RJZ A;  3ADA C;  4ZCL A;  2QLJ B;  3MM8 A;  1YRU A;  3CJT A;  1FK9 B;  2YNG B;  3W8P A;  2H5E A;  3POT B;  2B9E A;  1XNQ F;  2C22 A;  4DQI A;  2IM2 A;  1IQZ A;  2W4D A;  4AXI A;  2X3G A;  2KT5 A;  1VLO A;  4RWX A;  3EE3 A;  3N0V A;  3J7Y U;  5BYR A;  1UPP A;  1M1G A;  1NSQ A;  4F3M A;  2CQ4 A;  4DHV A;  4A8F A;  4RNH A;  2MKK A;  5C42 B;  4YB6 A;  1VC6 A;  2XZD B;  2Z4P A;  2DD8 S;  1RAB B;  4RW9 B;  4E2F B;  4X66 J;  4KKO A;  4WFX A;  3D2W A;  4F4X A;  2HPU A;  3AA9 A;  4FNI A;  2Z56 B;  2W9B B;  4B9U A;  2OD6 A;  1CJV B;  4QYR A;  4WYL A;  1E6Y A;  3TX0 A;  4ECZ A;  1Q8B A;  3SMZ A;  3T5H A;  4BDP A;  2AT1 B;  4Y2I A;  4CO5 A;  2DO4 A;  1S7I A;  3N01 A;  1G3O A;  4ZVF A;  2JHE A;  4ED6 A;  4J9P A;  1TL1 A;  4ITS A;  5EWF A;  1YWX A;  1MSW D;  4DFP A;  4NCA A;  3IR5 B;  2LQ9 A;  3VV2 B;  4ENO A;  3CIM A;  3DLB A;  1FXD A;  2DNR A;  1K9M T;  3MD1 A;  5CYJ A;  2YWE A;  1PGZ A;  2I38 A;  3HHN B;  3AB2 B;  2R7V A;  1A6L A;  3PJW A;  3KLI A;  2JL9 A;  3QID A;  1T94 A;  5JUM A;  1QJH A;  1BQM B;  2VU5 A;  2HBQ B;  1ZOT A;  1RTJ A;  1H2T Z;  2IC3 B;  2VDH A;  4D3H A;  3R2D J;  5KFR A;  1DUR A;  1LK5 A;  5H9E J;  4PUO A;  2D41 A;  3POT A;  3T1H F;  2DGV A;  3PEH A;  3IBC B;  1QSY A;  4DV6 J;  2QV6 A;  3MDF A;  4AND A;  1FKP B;  3MZI A;  1KS2 A;  2XMJ A;  3PTW A;  1CUL B;  5KG3 A;  2XO6 A;  3AB4 B;  1BXN A;  2DIV A;  3RG6 A;  2RKI B;  3D3C J;  3W5X A;  4GO5 X;  3EJM A;  5D15 A;  1U1M A;  1PJ7 A;  3BH6 B;  3A12 A;  2B43 A;  5HJX A;  4TY8 A;  5G0R B;  4BLG A;  2FZC B;  3MEG B;  1WOR A;  4R0J A;  2KJW A;  3AOD A;  2Y1L B;  4OYW A;  3DRR B;  2RE1 A;  1VCT A;  1LOU A;  4DV3 J;  2DTJ A;  5F9N A;  1WTF A;  3DLK B;  5HVF A;  1WSR A;  2OD4 A;  5HQL A;  2V4Q A;  3GQC A;  3BKU A;  2BR0 A;  3ET6 A;  3I32 A;  4F25 A;  2KDO A;  2BVZ A;  4I69 A;  1FWK A;  5E3A A;  3PXG a;  1S6P A;  1VK8 A;  2AHO B;  2MGZ B;  2E9Z A;  2MKH A;  3JQK A;  1WHX A;  2XB2 D;  4QR2 A;  3T6B A;  3NCP A;  2P6S A;  4DQR A;  4CM2 A;  2ACM A;  5K9F A;  4B9T A;  5CAB A;  1JLB B;  5FJ4 A;  3ZXW A;  1UKU A;  3DYA B;  4O44 B;  9RUB A;  1WWH A;  2CNN B;  1M0S A;  1UL3 A;  1VRT B;  1FJG J;  3WBZ A;  1IWA A;  1BQM A;  3CB4 A;  2NXU A;  1Q53 A;  2FVC A;  5E0O A;  2DKO B;  2E1P A;  3QWP A;  5IZH A;  2RRA A;  1O5J A;  1M90 T;  2XUL A;  4Z7C A;  4LR8 A;  3KLE A;  5KFX A;  4DSF A;  1R3N A;  2M0G B;  4O0I A;  2XWX A;  4M5I A;  2QA1 A;  1WG1 A;  1V3Z A;  2HIY A;  4X64 J;  1VR6 A;  2KZM A;  1ULR A;  3UR3 C;  3VVU A;  4C11 A;  4LF9 F;  2MZT A;  2PMH A;  1XNR J;  4Z2X A;  5D0G A;  4J9L A;  2XLI A;  4EO8 A;  1CUL A;  4W4M A;  3MUV P;  1VBK A;  3OTB A;  2ZBC A;  2XG8 A;  4TYA A;  4W98 A;  3PX0 A;  3NNC A;  2BE9 B;  3G9C A;  1OMS A;  3MOZ A;  3PW5 A;  3W2V B;  3RB0 A;  2BZ2 A;  3KJQ B;  3MD3 A;  2W9C A;  4PKD B;  5ETS A;  4HH1 A;  4PG6 A;  4GKJ F;  3HJF A;  1P9Q C;  2HS4 A;  4AD6 A;  4USU A;  1TR0 A;  2DH8 A;  5G0R A;  2Y0S D;  2LP4 A;  2D74 B;  5CYQ B;  3EDR B;  4NZ7 A;  2ZVS A;  3O1L A;  4ZCI A;  4ED5 A;  5AE2 A;  1PJ6 A;  3BB5 A;  4B3M J;  1Y10 A;  1UWB B;  1WEL A;  2A3J A;  2JLE A;  2XHW A;  3CJ4 A;  2F40 A;  3MM7 A;  1D0E A;  2B8Q A;  2MZS A;  1R89 A;  5K14 A;  1RAF B;  2HBR B;  3R97 A;  2BW2 A;  2DXF A;  2MGZ A;  3GJR B;  4CO4 A;  2ADB A;  1FXR A;  3VZI A;  4PG5 A;  5L9N A;  4C8K A;  1JLB A;  2OUG A;  3NGK A;  5EX3 A;  5KFC A;  2DO0 A;  4Q44 A;  1RAE B;  3KYL A;  1RHM B;  3B82 A;  4W90 B;  3DU6 A;  2YKN B;  4HYK A;  4DV4 F;  2YXL A;  5DS7 A;  2ACY A;  5HLF A;  3BN7 A;  2V9K A;  2YWH A;  1H3D A;  3LP0 A;  1RKJ A;  1JLE A;  1XMQ J;  3SV4 A;  3WX8 A;  2KM8 B;  2XS7 A;  2V34 A;  3CNQ P;  1LEO A;  4DSK A;  3TW0 A;  1IKX A;  1LQ9 A;  2KXH A;  1WEX A;  3H4B A;  4JYA F;  3W2W A;  2GVD A;  1R0C B;  2GIF A;  1QSS A;  4PRF A;  2HNZ A;  2ZH7 A;  3P96 A;  1VDH A;  3EM1 A;  1BD6 A;  3FRY A;  4USK A;  1OIA A;  2GCF A;  2VKZ G;  2VG6 B;  1XJW B;  1PAU B;  1S1V A;  2ZJQ Q;  2IPO B;  4EI2 A;  1TUW A;  1RHQ B;  2F63 A;  5CYQ A;  2NRE A;  4X65 F;  4K4T A;  2CA9 A;  3DFE A;  3D4J A;  4ZN1 A;  4KH1 B;  2YKQ A;  2ASL A;  1IBL F;  2W2Q P;  1WOS A;  2NXC A;  2BJ8 A;  2RS2 A;  3R5A A;  4Y65 A;  5CHC B;  2YPZ A;  4P9S A;  3V4I A;  1YX2 A;  3OT9 A;  2RS8 A;  4I1T A;  1DQ8 A;  4BWM A;  2NSB A;  1VQL S;  3N6N A;  3MFH A;  3KHR A;  3UN3 A;  3AAW B;  2NSC A;  4WE1 B;  1AUD A;  3G86 A;  3H90 A;  3CDW A;  1WHV A;  4NYZ A;  4RBT A;  4DSJ A;  2CQI A;  2YKN A;  1CQM A;  3L95 X;  2XMM A;  3BGL A;  3H2U B;  1UZH A;  3DOL B;  3OHA A;  1TZ0 A;  2LQB A;  4JI7 F;  2C42 A;  5EGY A;  1I6J A;  3SSQ A;  5M2U A;  2VBW A;  1MLA A;  2AGP A;  2QMU B;  4B3T J;  1RIS A;  2QTW A;  2EG2 A;  2VG7 A;  4ER8 A;  1IKY A;  3V81 B;  1JLQ B;  4QWB A;  5DZ6 A;  3Q86 A;  3MHY A;  1GMV A;  4U8Y A;  2AF6 A;  2MZQ A;  2V2Q A;  2MQQ A;  4P7V A;  4NI2 B; 
#chains in the Genus database with same CATH homology
 2FYX A;  2VHG A;  2VIH A;  2XQC A;  2A6M A;  2XO6 A;  2VJU A;  4ER8 A;  2A6O A;  2VJV A;  2XM3 A;  2XMA A;  2EC2 A;  2F4F A;  2F5G A;  2VIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...