2F4NA

Crystal structure of protein mj1651 from methanococcus jannaschii dsm 2661, pfam duf62
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
256
structure length
237
Chain Sequence
DDILDIITLTTDFGTNEGYVGAMKGRILNILKKYNKDAKIIDISHEIKPFNIYHGAYVLLTAIPYFPPSVHVAVIDPTRKSIVIETKSGYYLVGPDNGLFTYVAEKLGIKRIIKIDEERGRDVYAVVGAEILINNGYDGEELDEMVKIDETKKRVIHIDRFGNIITNIKTFKTIMIKIRHKNGIEKIIKCKFVKSYFEEKNNFICLINSEGFLEISKFMDNASKLLNVDYLDEIEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein MJ1651
publication title Crystal structure of a conserved protein of unknown function (MJ1651) from Methanococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Structural genomics, unknown function
total genus 57
structure length 237
sequence length 256
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2f4nA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2f4nA01
5LMZA 2V7XA 1WU8A 2C4UA 5FIUA 2C2WA 2WR8A 2Q6KA 2ZBVA 4CQJA 2Q6IA 2F4NA 1RQPA 2C5BA 2CW5A 2Q6OA 5B6IA 2ZBUA 2C5HA 2V7VA 1RQRA 2CC2A 2V7TA 2V7UA 2V7WA 2C4TA 2CBXA 2Q6LA
chains in the Genus database with same CATH superfamily
4C7OA 4B31A 1YSCA 2Q4EA 1NT4A 2I2BA 2Z5LA 5T8KC 4RHUA 3L0BA 4QUIA 4R2WA 2YIMA 3U9SA 3C8DA 3ROTA 2YOFA 3KYCA 2FW1A 1N78A 1IVNA 1J8YF 1QH8A 4L2IB 1WLYA 1QHXA 3LPLA 3WI7A 1MTZA 3EG9B 4B6GA 2WNSA 1GLVA 3EGOA 4LJLA 4NEGA 3JWJA 3ZK9A 4BECA 1PNOA 4F2DA 3K5IA 4MLPA 4PHTA 1X2BA 1E5QA 4OU4A 2Q45A 2I4NA 3AZOA 3FKSD 3GA5A 4G0MA 4RA6A 5DNYB 4I8XA 2BUBA 1W59A 1Z06A 2YXNA 3LKZA 4NPHA 5JS1A 2IYFA 2FUEA 3BFKA 1T8WA 1OB2A 4PZPA 4X62B 4YMWA 2G9QA 4Z54A 2X0KA 1U8EA 4KYTA 5BVHA 2HREA 1M76A 3RYFB 1WORA 5CD9A 3K9HA 3OZRA 2I67A 5E1MA 1ISSA 4COKA 2QENA 1GGVA 4ZHQF 2HEIA 1CY1A 1RDFA 4Y2RA 5H4GA 2QYHA 4FLEA 4Y6RA 4B8ZA 4BVKA 2P4EA 5JISA 1DNPA 5L3SB 4GL2A 2GCOA 2FGJA 4B4DA 1XQ6A 1OZHA 2Y76A 2FN8A 2NV6A 3DEIA 3PQ2A 1AM4D 1ADCA 3CPXA 4G85A 4QPZA 4Q3CA 4J0GA 2R44A 3AY7A 3GRYA 1MCZA 3ILYA 3PYLA 4UQOA 3VZCA 2PMBA 4ZO8A 4QLBA 4W82A 1YDMA 2YTZA 1VIYA 2OLJA 1NVKA 4LVOA 1QUFA 1W4AA 3FYCA 1KL7A 2BE9A 1JEQB 1N6KA 3D4BA 4E51A 5FBKA 4CM6A 2YDYA 4F9FA 2ZM5A 1DC7A 1ZXLA 4JQZA 1JG6A 3I2YX 1L6RA 2ORVA 2ZQ5A 1XVVA 1WCIB 5MDHA 2WF7A 1I6MA 4F1KA 3CF4A 5B1SA 5DASA 1RRMA 2O2GA 2PBFA 3K0BA 4HH4A 1E4EA 3CCUB 2DWUA 4JA0A 3DBLA 5DM60 4B40A 2GYWA 5HGJA 2PKRA 1T0IA 1EDOA 4FNMA 1XZNA 5KYGA 3F6YA 1TVCA 2HIAA 4I6JA 3GRPA 1EVKA 3QIAA 2PJDA 5EOVA 1IZ0A 4HBGA 2PUBA 3CRRA 7MHTA 4HS4A 3PCTA 4TKVB 5LVAA 2C9DA 2Y67A 6ABPA 4OGWA 1HUQA 3Q8KA 1ADFA 1Y5LA 2OYNA 1FPMA 1YZ3A 3M70A 4HD8A 4B3BA 5HP4A 2I7VA 4DV3B 3DSRA 1OY1A 2QJFA 3JATB 3QNUA 1G21A 3UJBA 421PA 4DSOA 1LTQA 4FKZA 2DFVA 2FYTA 3KQVA 1Y33E 5HS6A 4E7OA 5L40A 3R20A 1E3JA 2GETA 1S3IA 3QXSA 3FPCA 2FCRA 2YHSA 2YJ3A 4LEIA 1GCUA 1OXSC 2Q3EA 4HUJA 4JB8A 2Q62A 3M3DA 4A03A 5WRFA 1AKEA 3C7TA 1L8QA 3GDFA 2PZJA 4JLNA 1WW3A 4ANFA 4U1RA 4BAGA 4UPEA 5KVSA 4FEAA 2NGRA 3ZQJA 4FFVA 4XQCA 1C9NA 2PQ6A 1P5HA 1XPUA 1EUDB 5KYKA 2FFRA 3U44A 4J91A 1Y82A 3GFVA 4FNAA 4TQGA 3PFNA 5CDTA 5C0OE 3QMVA 5AVRA 1TQ2A 1P19A 3KX2A 3H5VA 3I3OA 4K05A 2P41A 2JG3A 5EERA 5JNWA 3O4FA 4V1CA 4GGMX 2CZCA 5LL6P 1MGPA 1ENYA 3GVPA 3NRJA 4IEEA 3CLUC 3OMWA 4M60A 3VNQA 1IBRA 4UTPA 4JLKA 1ZS9A 4H7HA 5FRDA 2QUAA 3Q41A 4IVQA 5HPYB 1DJLA 4KFSA 2UVDA 3OU7A 1ESMA 3EXIB 2GZSA 2OM2A 4CKWB 3RI3A 2AZDA 3V7UA 4P9NA 5ICCA 1A7AA 1AUVA 1O97D 2HSZA 4P4GA 4Q4HB 2Q2NA 3UGTA 1B2LA 5BNTA 2PSDA 4TX1A 2EW2A 5BSGA 3WZMA 1T1GA 4C4OA 1MG5A 5KREA 3DAOA 4IDHA 4I8DA 4MAFA 2OC9A 4ALLA 2J3IA 2OHFA 3JQFA 2J5XA 1W19A 1E2EA 4KQEA 3WG9A 4RGBA 2DQ4A 3RSZA 4MR7B 5CNJA 1RCFA 3SBEA 1J2YA 1E2QA 1WKCA 2YV3A 1ULAA 4XDYA 2ZDHA 3U4DA 1A4XA 1DFGA 3RSLA 4HAXA 3ZCSA 2H1OA 3R24A 1GEGA 1ICIA 1TL7C 1SG6A 3NM6B 3QE9Y 3SHWA 5A04A 4JBHA 1KA9H 2FPIA 3EYWA 3TQHA 3G8CA 5T41A 1IH8A 4UTXA 3LCJA 3W79A 1UBMS 1VQ9B 1OUMA 2B61A 3FFWA 4DPKA 2K6GA 3K73O 2WD7B 4ZDIA 1DWPA 3KOYA 4FSDA 4GNRA 4DMMA 4QUDA 2QY6A 3OAAA 2RJ3A 2H2HA 3MBKA 5LB2A 1J9ZA 2FWJA 5AIAA 1ZO8A 3WRWA 4EUHA 3GLHE 3G89A 2H07A 1GFZA 3FHCB 2PNJA 4ZIRB 1R8SA 3AEQB 2FPWA 3BBLA 4RCVA 5CM2Z 2HSJA 3LWBA 3NBQA 2QZSA 3IEMA 3LVBA 1VBNA 1IXYA 1QS0B 4YJ3B 3QWFA 1LDNA 3ACBA 1KE2A 4NZNA 4PLGA 4PSVA 1Z73A 3R5KA 1FXWA 1Y80A 3RODA 4EF6A 2VXBA 5B7NA 3R9WA 1GVHA 4GI7A 3TYXA 2H1FA 2A2ZA 3O7MA 2V9PA 3OPQA 1QH1B 2WMOB 3QBEA 3NCHA 3HB9A 3Q85A 4MQBA 3HCOA 1RABA 2PXXA 3SWWA 5IKXA 4HO1X 3ZS9A 2XD9A 3V1TC 3JD0A 1KOFA 3SE0A 3MHTA 3IIEA 4UMEA 4AKGA 2Y27A 3H8SA 1GPAA 3VKHA 1VHTA 2IPMA 2QRVB 2DPYA 3LX5A 3AG6A 2HXGA 4GWGA 4XEUA 3ZWOA 3PNLA 4RTRA 4U2EA 4AJ1A 1IVSA 2HLNA 4QC2A 4O08A 2HA3A 4TUYF 2YZ7A 4GLLA 2Y3IA 1XALA 4AC9A 3FUCA 4ME6A 4TTSA 4AJHA 3ZHTA 3K4PA 4P8RA 1JH9A 2Z4SA 4X6XA 2QAGA 3K2BA 3RABA 1RYHA 2J5BA 3GFBA 3WJAA 2COKA 2B3DA 5G53C 3CCLB 3B8HA 3CZ4A 1Z7BA 4Y18A 4D45A 2KBEA 4DNFA 2CJWB 5DZSA 2B92A 1BS9A 1KDZA 2FA9A 5LUAA 3ORQA 1PZXA 1GKUB 5CYFA 1DPFA 1A8UA 1GEEA 1LLQA 2JAOA 1JEOA 2V7BA 3BK7A 3G2IA 3LQ4A 3OJLA 4PLVA 5KVQA 2DLCX 3AG5A 3OAAD 4F92B 2B6HA 4I8IA 1CP2A 4L4XA 4HV4A 1FFXA 3EWNA 1RJFA 4IRMA 1J9GA 2WRZA 1KZ9A 5FAKA 1E5LA 1R0RE 1WL8A 3CXUA 5IXJA 2HU5A 4MQ5A 1KAGA 1QOZA 1M6NA 3P4XA 2YYZA 3LT1A 4O02B 4ZOEA 1QAMA 1SBHA 4UNNA 2R1UA 1SK9A 3U26A 5CH8A 1SCKA 3KE8A 1RWNA 3T5BA 1U4SA 4FK8A 3O83A 2FZ4A 2RJOA 2WOOA 3FDZB 2HTEA 4KMSA 1B2RA 3HGMA 3TZLA 2AKEA 1YHNA 4TL9A 1O2DA 2Q6KA 5IXSA 4XSGA 2VNAA 1Y8QB 4CPDA 1POXA 2XMSA 1N6PA 4DC9A 3L07A 3WK7A 1YWGO 2QD3A 1R18A 2FN4A 2HTFA 2AVDA 2INGX 3GFSA 1I3OA 5LQKA 3W34A 1U7WA 3UM9A 5ILOA 1Z16A 5B55A 1J25A 3WIEA 1BKYA 4ARAA 4H6WA 1BHQ1 1OC4A 2VF5X 4I9HA 3TQSA 3ZIDA 4D3SA 3BWXA 3I9FA 1ADYA 1VF7A 1YI2B 2Q3HA 4KXMA 4NG5A 3FDJA 3I9KA 2J1LA 3ESDA 1IU9A 1N8KA 2PIDA 1OWOA 2O3RA 2QZZA 3W1EA 3I0NA 3VTZA 3T9AA 1G5RA 2CD7A 5I7AA 1X9HA 1OFVA 4Q21A 1RS0A 4DB4A 2BL4A 4OYRA 2E18A 1QPZA 1LRJA 2GEUA 3GPIA 5EMLA 5M7EA 3QPDA 1WEKA 4HB4A 1ZNQO 1EXNA 2YYAA 2J6IA 3D02A 5HKOA 3OSUA 5L7TA 3ORRA 2PBRA 1BSVA 4FGWA 2ORWA 2ZXEA 4KUGA 4FR2A 3M4XA 2FWMX 3M89A 3T06B 5C1BA 3VA7A 1U8YA 2NO5A 5DYYA 1MEJA 4MUJA 3DAFA 3AR6A 4CM1A 4XKWA 1Q16A 1BX1A 1Z28A 4LSZA 5DULA 3LHSA 4RE5A 3H17A 3RS3A 3WMWA 1E2FA 3GJ5A 3ZDDA 4GNKA 3N07A 2G71A 4D99A 2YN0A 4X6UA 3UUWA 4YT8A 1UD5A 4RJ2A 5JZMA 2CYBA 2OCPA 2GNAA 4MGIR 1WSWA 4BMCA 3WLFA 4DQKA 2CVPA 2W0MA 1GN9A 1VLZA 3JRNA 3ZWBA 3FMOB 4O5AA 1RWPA 1WXGA 4UVGA 4Y6OA 3D4NA 2J6CA 1XNJA 4DFDA 1CEYA 4F71A 4OMCA 3ACCA 2OENG 2VYFA 1EHYA 3QSGA 4MKXA 3RR2A 1L4MA 1P91A 3QV2A 4NBWA 2ZIXA 1N1EA 1EVJA 3DEJA 3D3KA 4P2GA 1FMCA 4GXNA 3JSAA 3QEMA 4R3WA 3SYRA 2HK7A 3HDJA 5E9WA 1K8YB 1PV1A 2NSLA 4DQDA 1TT5A 4CU2A 5LR6A 7GPBA 5IVPA 4R9SA 1YC2A 2Z9DA 5KW9A 1OF1A 3AMVA 4MVWA 3UCFA 4UATA 4MWDA 1P2SA 1WZUA 1NQVA 2HHCA 2QTVA 4I1UA 1V8ZA 5ARDA 5KTRA 1CVRA 2BN4A 2A3NA 3K94A 5JECA 2YICA 2FLWA 2YHBA 3CW9A 5CBKA 2C8JA 2XVZA 3LP6A 1E8MA 4PBSA 3T41A 4Z4RA 2HUPA 3Q4GA 4D9BA 1VHQA 3P4YA 4HUTA 1M1NB 5CEJA 3AUAA 3OQHA 2BGLA 1Q0RA 4YT2A 2G67A 1QDLB 1I4WA 2CCGA 3BC1A 1SKBA 1UZNA 4AY4A 4E0FA 2O7SA 3LY5A 1HQDA 4ZAGA 2BV3A 3VNRA 3HAGA 3F5DA 1UPFA 3AM5A 2V7WA 1GGEA 1XQWA 3WGQA 1NW4A 3A9VA 2W83A 3DNMA 3IEXA 3KT0A 4M3NA 3RTBA 4N39A 4G37A 1RJWA 2QM8A 4OQ4A 1CV2A 1IXZA 3E3LA 1SQ5A 2PRYA 1FP4A 1D1QA 3P2JA 5FBVB 4MICA 3I2KA 2OTLB 1M6VA 4C0SA 1O6BA 1PNQA 3VJMA 4KFCA 3CXRA 4DQXA 4EL0A 2YS6A 4JZYA 5NLLA 4MR8B 4PE5B 4YUAA 3MLAA 3MJTA 4JWKA 5HMLA 5IH3A 3KELA 3TMKA 1CERA 2PWPA 5EKUA 5HBGA 2IIPA 3F78A 3CJTA 1E69A 5DYWA 1SCBA 2P69A 2P4SA 3MYRA 4DSTA 2EJBA 1DLJA 3A2LA 3CLSC 1GPBA 2N1BA 3EIUA 4WXEA 3RC1A 1QB8A 1XZQA 1ULZA 2NU8A 1T2DA 3TECE 1RM3A 1W8DA 2DKOA 3KQLA 3KQPA 5F2NA 1JB9A 3F7NA 1BXRB 3FLEA 2WILA 4ZKEA 4OHBA 1XRMA 1UAAA 3MELA 4DB2A 1SRQA 3EZ7A 3WLTA 1VA5A 4D3ZA 4RK1A 2QK4A 2WLSA 1N5LA 5AOCA 2VIIA 3LUFA 5TF4A 3WAKA 4QU5A 1A69A 1CJTC 3EISA 1GTG1 2R4TA 3NRBA 3QLVC 4Z9AA 3OJXA 2QT9A 3UICA 1BJKA 1VRWA 3PI7A 3W9SA 1JFSA 4D6PA 4KQGA 2O2DA 3A1WA 3AUKA 1G291 1GXSA 1CFJA 2O20A 1QF6A 1CRQA 3LYHA 3G0OA 4QGSA 3IQGX 4R1MA 1P5ZB 4RTSA 2CSUA 1QX3A 1NJID 1ID1A 2YN4A 1ZJ5A 5JPCA 2XTMA 3F3YA 3LM8A 1UWKA 5BSRA 2FG5A 4X3OA 3M5CA 2A7XA 4FFBB 1MW8X 4B75A 3EX7C 3BVPA 3KB1A 3RIYA 4Q16A 3RG8A 3TNYA 2CNWA 4L07A 1GTZA 4LNUA 2LVBA 3GGCA 2AK2A 4BN4A 1W88B 2IGTA 3ED5A 3ZHVA 2VWPA 5AP9A 2BH2A 2PZFA 3EC1A 3DFKA 2O2CA 2QTNA 3GDHA 3RANA 3RSFA 3BXZA 3KJFA 4Q9KA 3CLRD 4J0EA 2EF1A 2BFDA 2VTVA 4D25A 3Q3IA 5GJWC 2ODAA 4PHGA 1FNNA 1DKPA 4D6YA 4TMVA 2ZJYA 5LB4A 2XB2A 5KO2A 4RLQA 1C29B 2UVPB 4QULA 4WZBA 4YWJA 3SQMA 1V9SA 2EJWA 5KVAA 1AF4A 2AMVA 1UL1X 3UJCA 2APJA 2XMBA 1LGYA 1YZVA 3VRHA 2R96A 1HDZA 1WG8A 3H6KA 3ZD9A 4AKHA 3ZZUA 1ZEJA 2ZBEA 3KZOA 1PJ3A 5AVVA 2VUIB 4R3UC 2PX8A 1CX9B 4FFSA 2HPZA 2ANBA 5T4HA 1P1KA 2F1HA 3CUEF 4XQ9A 1IOLA 1YBVA 3I1FA 4FMBB 4WINA 1EDDA 3W9YA 4YMSA 3EVZA 3OUUA 2X0IA 2W4MA 3HADA 4N5LA 3TIIA 4N76A 3A6GA 1JNXX 2HLPA 2OG2A 4Z4EA 4J9VA 2QM0A 3ENVA 3G2OA 1T9ZA 4RDHA 3S5UA 2PD4A 2QVZX 1E3WB 1P45A 2DBZA 3MD9A 5HA5A 4LOJA 3V4ZA 4ZOLF 3GJTA 5FOXA 4DRXB 5KBYA 4Z9BA 1UJMA 3C6YA 1YDFA 1SHTX 3H5IA 5BSKA 5A62A 2OHIA 1V9CA 2X8LA 3MTQA 2B99A 3DBOB 4P92A 2XB6A 3HY6A 3VU3A 4RDKA 1IK6A 1WB4A 2ZI6A 2CNWD 3DAPA 4Q3KA 2QLLA 1ZLXA 4OJMX 4B3FX 4PHHA 5HKAA 2AJLI 5EIAA 1R6AA 2FZEA 3PEWA 1NW3A 4DCMA 3ONWA 3ESYA 2JIZA 3AR9A 1K3TA 3OZIA 1R64A 4NZPA 1UT5A 2BY4A 3PUZA 3DE1X 3TZ6A 3QKUA 2F1LA 4PZLA 3IHKA 3GFRA 3HA3A 4ZALA 3U17A 1AKNA 2FSIA 2D0DA 5E4JA 1ILEA 4WECA 4HJRA 2GF9A 1JT2A 3GFFA 4RADA 4I2VA 2CVFA 3K15A 1F4VA 4HZGA 4XA8A 4J0QA 3U0BA 4JLOA 1KO7A 1V39A 1LBTA 4CIXA 2W2XA 1PJRA 1XSEA 4M21A 4FDUA 2H7YA 5DCWA 5C2JB 2UYGA 1YVUA 2YW2A 3EAGA 4EKGA 4KXYA 2QJOA 2YNMA 3JR7A 1GG8A 3IAFA 4KI7A 4BCCA 4DLLA 4LA4A 4X7CA 3T9DA 3W3AH 4GZ3A 2C00A 5DP2A 3WL3A 3RG2A 1YBMA 4FHDA 3GLVA 5ITWA 3U31A 1K27A 5B3KA 2DSTA 3A6DA 2HX1A 2UYYA 3CKLA 2GHRA 3IAS1 4JP8A 4N7JA 2PUCA 2BP7B 3UK1A 4FT4A 3LQKA 3ZV7A 3FYUC 3VOTA 1IFXA 1SELA 1YONA 2ARKA 4LV6A 1OYWA 1ZHFA 3GU3A 3QTBA 4NOJA 4ARIA 1ZVKA 1ZNZA 2P30A 1K7XB 3L0CA 1G17A 1XKQA 2NXJA 4L0CA 1Z82A 2YVLA 1M6WA 3IAHA 1ML4A 3RBVA 4XLCA 2FSPA 4MI1A 5AK0A 1K8ZB 3QXJA 4IJKA 3UAYA 4JQCA 1NTRA 2GCEA 3GOQA 3I8SA 1SY7A 1W4BA 3MCWA 3WMEA 2JIZD 5FUMA 2TMDA 3A1PA 2I2CA 2BM9A 3QPBA 3E0XA 3V48A 1NJSA 2WAYA 3RUAA 1SBIA 2FE1A 4KC0A 4CF6A 3T3IA 1J09A 2EFYA 4Z7OB 4DSUA 4XN0A 4QYWA 1TZCA 1XC7A 2CHEA 1V2GA 3GZNB 4JD5A 4N7MA 4FQ7A 3LP8A 4HFNA 1NI4A 2PTGA 4Y9UA 3CNBA 2R8PA 3LC7O 4RKFA 3B5JA 4YJ2B 2NSHA 4MHOA 4MKIA 1XGKA 4AT1A 4OATA 2NUAB 4OHRA 4G2NA 2P6OA 1O0CA 2RHBA 2RG7A 1KXZA 3FBTA 1P1FA 2NTNA 3FWPA 4H59A 3MSXA 1Z3CA 3TBKA 1W36B 2WVJA 2OBYA 2WDZA 4Z4SA 1KI8A 1Q83A 2YNMD 5DI3B 1QRUA 1AU9A 1FTQA 1QVWA 4RIEA 4B2IA 2JI7A 4K6OA 3KOWA 4U0KA 1V9LA 1DBPA 2BKAA 1HSZA 4Q1FA 3AF2A 1WNTA 2JLXA 3TIFA 5ALGA 3ROPA 1LV7A 3V00A 1G8JA 2ZSUA 4WFJA 3ILSA 1G4HA 2FEOA 3IUEA 1W75A 4LN1A 3O8OA 1Y4AE 2CNBA 1JU4A 1YNSA 2UZ3A 1T9GR 2WHPA 3H3JA 4YDHB 4YAKA 3FXAA 3MNFA 5FR1A 2H31A 1RZUA 4RS3A 4LF8B 3ABZA 2QL9A 4OHYA 4LYHA 1G2QA 2OZLB 3P2KA 4YVFA 2I0FA 4WN9A 4LZLA 1UMDA 1P5RA 1VG8A 1GGNA 7AT1A 1DQZA 5K4HA 4I5GA 1U9JA 2C4KA 1BEUB 3CKMA 5J4YA 1LU9A 3VC3A 2AJDA 2P77A 4FC6A 3OI7A 5KYVA 3TM5A 2EAUA 2HU8A 3PWSA 8ATCA 3LYUA 5FLXA 3QLUA 3T3GA 2VDLB 3LXMA 4NICA 3U9LA 2G82A 1BCRB 2PL5A 1V4VA 5FR2A 5ICFA 3RQSA 1IEVA 4GP7A 3UMBA 2NG1A 1G8HA 2Z3ZA 3DW1X 2ZL5A 3KU1A 3NYWA 1LVHA 4PIVA 2GDJA 5JQGB 1BWSA 3GVXA 3RHSA 5MFPA 1WPGA 1W85A 3HE3A 2Q21A 2ZWIA 3IA7A 1UPBA 1VP3A 4JR2A 3G0DA 3M34A 2NZVG 5C51B 1GM5A 4IDPA 3WGOA 2L82A 2O3TA 3EARA 4HLUA 4OHUA 3KSZO 3BYZA 2J46A 2JAPA 3R0XA 3S44A 1GUBA 1V71A 3BCDA 2G7MC 1VPDA 4R0NA 4HWRA 3JQ9A 4J4BA 1BA3A 2G04A 1U31A 4JSYA 1W5BA 4Z3DA 2VYQA 1E1CA 1U8TA 5KDLA 4AYWA 2Y6UA 4HKTA 4EEKA 3ITNA 4R9VA 2Q9BA 1IMJA 3ZHQA 2LDBA 3LTEA 1Q7EA 5THKA 5DGDA 3NJ8A 1PO7A 1GSIA 2PAFA 3SHTA 1DTEA 1SBNE 1VQ1A 3E9EA 4DT1A 3A04A 3PNQA 2H2WA 3WGZA 1M2WA 4YI5A 1A4IA 1C1DB 4CE6A 2QQGA 1NG1A 4BNYA 5K0EA 1O95A 1TVMA 5JYBA 2L19A 3U6BA 3ICWA 2WDPA 3HO6A 3GUHA 3KHTA 2JLUA 5EXEA 1YZUA 3HR8A 4IXMA 4LDZA 1J24A 1I8TA 2QSZA 1YO6A 3G4SB 3NHUA 3SR0A 1O8BA 3NTVA 1UMBA 3UJHA 1RAFA 1SBYA 4H6XA 5KYXB 3FVQA 5DOZA 1D04A 1XG5A 1NQAO 1S4MA 4LWQA 4RGQA 2OEPA 4BTEA 1Q7RA 4FYKA 3RFUA 2E21A 3ASUA 3VDQA 2I71A 5IFLA 3W5BA 4W5TA 2VJMA 4IOKA 1QB7A 2WEKA 4MJ3A 5LQJA 2Q2QA 2IWHA 3LLMA 3IV7A 4KIGA 4LCJA 4D0LB 5B64A 1LTKA 1VCMA 2FNAA 4EGAA 2GM4A 4WNYA 1LX6A 2Q6TA 2GERA 1ADGA 2QV7A 4I1PA 4LY0A 3RHZA 2IYVA 3OJOA 5KOYA 1I7QB 4PLHA 3EXEB 2NVUA 3UV3A 4XX0B 3ETLA 3K09C 1GZHB 4QHYA 3PUJA 2DHEA 4V3CA 2EBFX 4X7RA 3SR3A 1QBKC 3RUIA 4CMKA 3ZE6A 2W6NA 5ALIA 3HDYA 3CXCB 2WICA 1KXJA 3KJGA 4B8WA 1N6HA 5FBRB 4H7PA 2HMWA 1FDWA 1UBFA 3H1TA 4ER5A 2XCSB 1H8HA 5TQ2A 2BEWB 4GI1A 4KX5A 4WCFC 4ARZB 3DD1A 1L2TA 2JEZA 3CTPA 3IPLA 4U7JA 3WL8A 3S2ZA 1O95D 1XDDA 2P8JA 5KCZA 2QU8A 3AOEA 3ZLTA 3EQ9A 4GLJA 3LLSA 4EJSB 3MCZA 5T7BA 1BX3A 2WBLC 3H2GA 4BNIA 5ARBA 3CHYA 3LC1O 1FA9A 2YFHA 2IXEA 1YBHA 2OY0A 2W43A 5IULC 3FSEA 1DG9A 4ESVA 1TKBA 1WDKA 4LE2A 5AI5A 1KOLA 3BFVA 2FMIA 3ENKA 1EYZA 1E4OA 2FX2A 2G06A 2PX6A 4P4UA 5I48A 5IDVA 2I76A 3IP6A 2E4WA 3KQMA 1RLIA 3Q12A 4R4JA 4CIWA 1OI3A 2DLNA 5BOSA 3A25A 4UTVA 3QYFA 3IMKA 4PAQA 3A6KA 4JJEA 5GV8A 1L4BA 3LE8A 4PCAA 3N2KA 4WBXC 4GD3Q 4YCNA 1I7PA 4BP8A 3PC2A 3ZWKA 4KVZA 2P27A 5EPUA 5IYWA 3GUUA 4ZU3A 4WLNA 1KMMA 3UOAB 3O4IA 1RZ3A 3V1KA 1XU4A 5T4FA 2PX2A 4DQLA 1V6AA 3AVWA 3DMFA 2C5FA 1YKSA 2GYVA 5K3AA 2XF2A 4EPRA 1GU7A 4NH0A 2WT9A 4KYVA 1LUAA 4MQ4A 2R0QC 2ZSFA 4UUAA 4XRRA 1YZKA 3S1AA 1K86A 4B3IA 2HPAA 4L02A 3WRYC 5ADVA 1IHDA 2R66A 2PEYA 3O84A 3I5XA 2V6FA 4H1UA 4J0HA 1M54A 1DZIA 2QUZA 2QMEA 4O59O 4N6GA 1Z0DA 3AB7A 3G2HA 5KWSA 4DJDC 4LJ8A 3K72B 3ZJVA 1T3LA 5C1OA 4Z53A 1U7UA 5LZ2A 1T2AA 4WEQA 2OHJA 1V8OA 1NE2A 4KOEC 1B14A 1BWRA 1XL1A 1SCIA 1KEPA 1GT91 3C6KA 4OJNA 1NZJA 5CRIA 2YFQA 1TCUA 4J76A 2I7TA 5I8PA 4NJEA 3PLAE 3BULA 2OAEA 3MA0A 5KAPA 1XTJA 3ZK7A 3P27A 1XF9A 2JCBA 1GHTA 2O5VA 2UAGA 2OORA 3OOSA 1C4XA 4P5DA 4ZVQA 3VPAA 3WC4A 2V7GA 4DWJA 1YS6A 1RJDA 1W76A 2GSDA 2JBHA 2WHEA 4YQEA 3RVRA 1W49A 2J87A 3WMXA 2JIPA 1SNYA 4MP8A 1EFTA 4TWZA 3BTSA 2OD9A 2FWIA 1WP4A 4WK2B 2EFGA 5BVGA 1J99A 4C4TA 2JHFA 3DVQX 4OQFA 4AJ9A 5IT0A 1KQPA 1YA8A 4MGHA 3RF6A 4DZZA 2ZRIA 3L1IA 1TQDA 3T6KA 3HO8A 3RRFA 2VBUA 2ZJ3A 1X6VA 2CDRA 2ZI3A 1XCJA 1JI0A 1P7PA 1V6SA 2XUAA 3V1UA 3UG6A 4JKOA 2FWPA 5FFNA 1R8XA 1MJNA 3JARA 2WJAA 1Q84A 4OBEA 1ZQ1A 1G19A 3KVNA 1FX1A 1SVSA 4WA8A 5DM2A 1P1IA 1KFKB 1ZK3A 3C8HA 4KSYA 4IXDA 4P54A 4UUOA 4JI7B 1UXJA 4Y98A 1DKNA 4MGZR 5BY2A 4ZFNA 1H85A 1XMVA 2EWWA 2MT9A 3F8TA 3ASVA 3KHUA 2Q5FA 3L2OB 1MOSA 3LDHA 1M2FA 3ETDA 4NHEA 1P2UA 3TQQA 5A8AA 1LPOA 1TK2A 4M99A 3TLZA 4PZCA 4EHJA 13PKA 5CCDA 2FDXA 5DGXA 3WO1A 4LQLA 2IZ5A 2C3MA 1JIXA 1JE0A 3TFWA 5EMHA 4UXJA 1YQWA 3IP1A 2OAGA 5E8RA 1G2OA 1RAIA 4J0CA 4ZT6A 3VVMA 5J43A 3CM0A 4JN6B 4JIMA 4LS3A 4U00A 2B4KA 4DLZA 1EUYA 4QREA 1JDTA 5J3OA 3TLMA 4M53A 3WWDA 4Y9RA 1WZIA 4IICA 5IDQA 4XLFA 1IWBB 5EYPA 2BFCB 3LFUA 1SU6A 3L8EA 3NU1A 3LQYA 1JDSA 3N3AC 2CBXA 2HSWA 2OE2A 4A6EA 1C7EA 1TB4A 2XA9A 1X14A 2AW5A 2H4XA 4O1IA 1E3ZA 4K9LA 4IHJF 1GNLA 1OX5A 3FCXA 3OA2A 4RE6A 1J42A 2HBYA 3RYFA 3T12A 5JYDA 4W9MC 5LYYA 1NG9A 1UBLS 2I4MA 1M83A 4MUHA 4PU0A 3O4GA 3NHWA 3CX8A 4EYQA 4F2PA 4Q48A 5CYPA 4BNFA 4UCWA 4B6QA 1NDHA 3L84A 3FTCA 3GDWA 1OLXA 2Y8EA 4TTQA 3RSCA 2IP4A 2R6FA 4TMXA 1BEEA 3WYNA 2Q5HA 3NT5A 4R6XA 4BVGA 1GPDG 3O8QB 2OFFA 3D2CA 2H00A 1IWOA 4A6XA 4BCDA 3VVBA 1UUFA 2ETVA 3H83A 2IHJA 3H9JA 4C3OB 6PFKA 5AVJA 3PLNA 1NFQA 3NPAA 1DXOA 4OOSA 1KVUA 2I3BA 3I5MA 4OSOA 1ZM7A 4HX9A 5ALEA 4V1CI 5LXTA 3ZCUA 1ZVVA 1A50B 4Y1RB 3KWLA 1MABA 4Z4CA 2CFSA 1PT7A 3OE7D 1SUIA 3Q88A 4Z4HA 2C3OA 3R9KA 5JSKA 3DZKA 2KVOA 1WVGA 3TE7A 1Q0UA 1S89A 2JIDA 3TW8B 2A67A 4KYUA 2PVPA 1JSCA 1GL7A 3ZLVA 5TQ0A 1Q7GA 2FFQA 1E2BA 2Q5OA 3K0CA 4E33A 4LW8A 4MCHA 3G0GA 2BMJA 1SCQA 1ZSNA 621PA 3OFND 5AIBA 3O8RA 4D80A 4HNQA 3JU3A 3RNLA 4Q18A 2IY7A 4KN9S 1DQYA 1BVRA 4G01B 1YS7A 3MUFA 3AOGA 3V7AA 4H6PA 4BC1A 1KEZA 1T2UA 1QQBA 4MA5A 4YMHA 4M6WB 2XNJA 4YECA 2UZ4A 2V0CA 5JO9A 4OU5A 2RIPA 4R3NA 3ASRA 3EBLA 1QNLA 2OB2A 1D6MA 4UXHA 1S1MA 2HGZA 3QE3A 1CR1A 2B3TA 2CV1A 1I0IA 4TV8F 3O9VA 4CT0A 4E03A 5DGIA 1VOTA 2A4KA 3OZGA 1Z12A 4DKXA 4MYUA 1G5FA 4ZTZB 1N2CA 1QYIA 3L1VA 4MULA 4MZDA 5A9TA 3RO7A 3USCS 5TPWB 4HVLA 3AL0C 1ZCBA 2BHRA 4WJKB 3B48A 3DEKA 2AJ8A 2B1QA 3AJEA 1CZUA 2HF7A 4JP1A 3SDZA 2X22A 2G1AA 3OQNA 3TB6A 3VYUB 1P18A 3PK0A 4GXRA 5AICA 4H1TA 1Y89A 3M2PA 4FGZA 3L0PA 1XZEA 1UC8A 1YBAA 3GIWA 2X8KA 1BMQA 1K4MA 1RHKA 4JLWA 3JZAA 1VLMA 3KJHA 4WKPA 1AO0A 3MCTA 1WHTA 5TVGA 2GN4A 4LYDA 2B9EA 4LDQA 1M6YA 4D4HA 5IUNC 1DFHA 1U6JA 3VNUA 1ZA1A 3PC6A 3O47A 5H83A 4C30A 4A82A 1TW2A 3NHMA 4J0KA 4R05A 1J20A 2X6TA 1WQ4A 3EXIA 3DDHA 3QUSA 4IRUB 3V1YA 1GL9B 3CZ9A 4I9GA 3X43A 5A05A 5K0FA 2HFKA 3PFCA 3RVSA 2VP3A 4R51A 5CMLA 2V6JA 5LZ5A 3EZYA 3AHDA 3AP3A 3GCXA 3K05A 4UHBA 3CLVA 1SXJB 3ZZNA 1AS0A 3DCNA 3UTCA 5GZ3A 3NIFB 4F9EA 2IS6A 2FWAA 4HX2A 4HWTA 3G0BA 2D0PB 2WJZB 5IAGA 2XKAA 3N75A 4A8JC 2J09A 5ADHA 5J40A 1N06A 1Q1QA 3QH4A 3MAJA 4QTXA 4CTOA 1U8FO 3FHTA 4LHZA 1RQRA 3BTUA 1C8BA 8OHMA 4UBKA 3TL2A 2GWRA 2VUTA 3TBFA 1Z4JA 1XWWA 5K0LA 4AX8A 2WNHA 1XL0A 1E9VA 3KHKA 5HF8A 5L46A 3SJ7A 2WPDA 2VBGA 4CVNA 5JRDS 4CMCA 1EEXB 4MYDA 3T4PA 3JQGB 2C20A 1HZEA 4D9MA 3V7FA 5HRAA 3OZWA 4BBAA 5DM4A 3IP3A 5KJ1A 1KKMA 1JMVA 4EG7A 1U1FA 4EVQA 1F3OA 3RRXA 2VPPA 2W2VA 3IE1A 1I1HA 3A6PC 4HZIA 4MUGA 2V7VA 2J6BA 1PS9A 4ZO9A 3V3TA 3S8EA 4EJ0A 5C4GB 4LJAA 3BIJA 3GO4A 4HNVA 2GPAA 1QS0A 4EGSA 1N77A 5TJ9A 3DW3X 4TVSA 3P32A 3AKDA 2JLAA 2YZKA 2ILTA 5KTNA 1EWKA 1LTHR 1AS3A 3K0FB 1XJCA 2OCDA 4B48A 1HQCA 1M2JA 1M2VB 3JQ7A 4P38A 4RM3A 2YWGA 3FCCA 1QH1A 2Y0EA 5AM1A 1RYYA 2B35A 3RLFA 3CE6A 4QICA 1B1AA 3D1JA 5KMGB 4DR1B 1IIBA 4MS1B 2CZQA 3HLKA 3Q3VA 5AJXA 1EP3B 2WTUA 3O90A 4AVYA 3DZJA 1V4BA 2Q4DA 2QRVA 3DB1A 4I4LA 5F73A 1M75A 4JEUA 2HU2A 2I7CA 3AUUA 3H16A 2GO7A 3GT7A 3HUFA 4DV7B 3NMUF 3Q11A 1EMDA 4HXYA 1CQPA 4AUEA 2EBHX 4DNQA 2VCEA 3RYCB 5CM8B 1NSFA 1JXQA 2DIEA 1XTQA 1P39A 3CRW1 1OA0A 2KLBA 1NNLA 4CLHA 4L3WA 3QMPA 1U9IA 1U02A 3RHFA 1SN7A 4KJXA 5H02A 4JL8A 4RJLA 2WPDD 1PFQA 4TTPA 1XDGA 1L8OA 2DTEA 3TLYA 4BLWA 3MM4A 2H1HA 1U3VA 1WHSB 2JIQA 2NQ8A 3DZCA 2WJGA 3FJYA 3LUGA 5C46F 4P53A 3OHPA 4L5IA 4DA4A 5EIWA 1A8QA 3GLUA 1M1KD 3V7NA 1UWLA 2WSSA 4TS4A 3FFAA 2DR2A 1YB1A 3TDKA 1NX6A 4ZT4A 3S2FA 3I2FA 3H97A 1UANA 4CUZA 3H2SA 3JR3A 4H60A 3RARA 4MVJE 3RAFC 3C5WP 3NJ4A 2KYRA 3GL9A 1QVAA 4WD3A 3E7PA 3ZJ5A 1CDEA 4J0IA 3T53B 4QUKA 2QD5A 2IHUA 3C3DA 3W8RA 1YJAA 1RAGA 2B2NA 3QEKA 2DPGA 1FJ2A 2QTHA 1N5OX 1PQPA 1YZLA 4YONB 3UUEA 5KNCH 4ADSG 3LHDA 3ZCTA 3F6SA 2W00A 3KDSE 4GT1A 1TZMA 1PJLA 1XTVA 2MSEB 3ICPA 2IYAA 2PU7A 2J3QA 2JFQA 4LDAA 4CLEA 4DJEC 4ZDKA 5BMOA 1RZRD 4XGQA 1XLTA 1HFJA 3C3JA 1NN0A 3AX6A 1XJ0A 3ZW9A 3I61A 2LZJA 4PSUA 4PX9A 1U7OA 4ACAA 3GRKA 2IEDA 3NOXA 3VGJA 3ZKAA 1KETA 4EGQA 1CZLA 3E8SA 5G2OA 1ZBQA 5BXYA 4QM7A 3EAFA 2BJWA 3H0CA 4KLAA 4OX9Y 2ZWOA 3BZWA 2JAWA 4WIAA 1PZHA 4L95C 1YZYA 1M9NA 1PBNA 16PKA 3SS9X 2PKQO 4W1SA 2AOVA 4CEIB 4UFNA 5T3UA 1ZOPA 2HV8A 1C8LA 5LC1A 1GITA 1OR8A 1FX0B 5C53B 5ILQA 1KERA 1TK9A 4WWVA 2VDNB 3QVVA 4YPFA 1KBZA 5DHSA 5AW3A 2A33A 3QU5A 5DHRA 3V8EA 1G7TA 4C87A 2VUSA 5CDYA 2VF7A 1OIXA 3CB4A 5CLJA 4I50F 4X1YA 4XUDA 2P1DA 5CEFA 3U3JA 3HJFA 1ND5A 4HWGA 2Y9PB 2FDCA 4D4LA 4LCBA 3TPFA 3BIXA 3VKUA 4LQ4A 4D8WA 4B3SB 4G23A 1F3LA 1S2IA 1NDUA 2B5VA 2C83A 3V42A 3HJTA 4KQCA 4H1WA 4PLPA 3QX8A 5FTKA 3UBMA 5HNKA 2UZ1B 1S96A 4QZVA 3BX1A 3WRVA 4WN3A 4B7ZA 1N25A 2ZSEA 3JZFA 1R5OA 4RTMA 3RASA 1ST3A 2HF2A 4IDEA 4TYMA 3B6MA 1Y1RA 3PXDA 2HWYA 4OKIA 5JI3E 1XJ5A 1AZSC 2FPSA 4W5HA 5A1JA 3BWYA 2DBQA 2IXDA 4RSHA 2FPXA 3GMIA 5CHEA 1U28A 2ZQZA 2IIVA 4OGKA 3F9IA 3MOSA 4HFMA 4IXTA 1RKXA 1KD1D 4GG1A 4QLOA 3FNQA 4X1KB 1OVMA 2K2WA 4NENB 3FZYA 3L4KA 4U9UA 3QVXA 2H18A 2HADA 3ZCVA 4OMFG 1XT6A 3ZJTA 1RYNA 2GZ3A 4NU5A 1N2HA 3AESA 4CMBA 5JMOA 1WD7A 2UUOA 2WB4A 3A6HA 4KBYA 1T0HB 2Y0DA 1WZNA 3QWHA 5CA0B 3QXGA 1IZZA 2OO5C 1O7JA 3ADPA 4MO2A 2ZTMA 1XCOA 3HJRA 3T7IA 4F8YA 2O3JA 1UMCB 5JNUA 3A3KA 3EXG1 2AN1A 4RSRA 4YRDA 3DKPA 4ONEA 3SFVA 3UAWA 4WKNA 2FWNA 1E18A 1MIOA 1A5SB 2XDYA 3WLJA 1ECLA 2W4IA 4EZIA 3V3KA 4J2HA 1KK0A 2M1ZA 3OCYA 3L7OA 1J1IA 3HP7A 3LHFA 2QY9A 4INPA 5IMBA 4EW1A 2V5AA 5F9HA 7MDHA 3VNAA 4WK6A 4HUQA 4AZSA 4AROA 1ZJWA 5H9VA 2BF7A 1YS9A 1E7YA 1L4FA 2ZYDA 1Z2DA 3BJZA 1N9GB 4DIOA 1ZMTA 3NWPA 4BO7A 2X53S 5JSZB 4TXHA 5DBHX 4PYLA 2DEUA 4LJ7A 4JJGA 1KVRA 3GT4A 2DCMA 3OCWA 5JO0A 3IQIX 5KJ6A 1MHPA 1IN8A 4WZ6A 2Q2WA 1O6ZA 3CV3A 2WMDA 3GGSA 1C9YA 1A8PA 2X9LA 4MPPA 3DM5A 2X8JB 1T29A 1UFKA 4IHKA 4WFQA 3T7DA 3DBVO 3FLAA 4CV2A 1Y48E 3THYB 2ZYTX 5E3HA 2KPOA 1H69A 4GUDA 3RS8A 3ZDFA 1G4UR 1LK5A 1XA3A 1GA6A 4FZJA 4DCCA 1LI5A 1L4GA 5IARA 1JLMA 1VYVA 2G8NA 1CR4A 3HJHA 1DADA 1Z6ZA 1LZLA 1PR2A 1AZLA 3H5OA 3PJGA 3TAUA 4R0VA 3EB9A 3EQ7A 3KQYA 1HNNA 3LHIA 4I5DA 3D2AA 9LDBA 3K70B 4RU1A 5ALVA 2RC5A 4I36A 1UXHA 4ICIA 4B81A 4JUFA 2NQTA 2X23A 4F6RB 2OLEA 1FXSA 3AU8A 1WMDA 1D2NA 3MMPA 5E3IA 3UA4A 1TVKB 4E3WA 3DOOA 4HC4A 1E5DA 4E5MA 3WDLA 4RC9A 1ORIA 1UBSB 1Z25A 4M4SA 4W4TA 4RO0A 3H11B 2ZFUA 3EWSA 5KCMA 3RGWS 2I6XA 3DUWA 3ZH9B 4BJ3A 821PA 3KT3A 5JWOA 2P0EA 1UD4A 4WGFA 4XUCA 3BL6A 3A4LA 4ENVA 4HMOA 4U8GA 4Z4GA 4BQQA 2GAAA 1M2EA 1WDMA 4HTAA 1YE8A 2ROQA 1KIAA 3QX7A 2XKBA 3IMGA 4HX5A 5FORA 3JCZA 5BR1A 1JQ3A 5HWSA 1CY7A 4NL4H 1EM8B 4UE2A 4UBOA 4YHBA 2OYSA 3FSGA 4TMKA 4HEA6 3C3EA 3CMEB 4G0NA 1XZGA 1OXTA 2XNCA 2LGJA 4BZQA 3D5TA 2XNHA 5BPFA 1BU5A 4OV6B 3D6VA 4WOKA 4IV0A 1KH2A 2PMKA 4Y3UA 3IE2A 1HI9A 4GI5A 1J22A 1SQGA 5HJ2A 3SAJA 2X5NA 3LVQE 4PZDA 1U5BA 3RREA 2IX9A 3LHKA 4QDJA 5IBQA 4GP9A 5I4KA 5CHYA 1T9GS 1BVUA 3L7CA 4MLCA 1IOZA 2OILA 4QA9A 1JZQA 1XROA 3D7KA 4INZA 4P7JA 1X0VA 2YZMA 3HBJA 3G9XA 5I7OA 1YK0A 2DHDA 5A9SB 3GFTA 3E58A 1E5VA 1Y6JA 4RCYA 2ZJ6A 1AZWA 5UKDA 3ZQKA 1P2TA 3CVOA 1ORWA 1QIDA 2PR2A 3ZVNA 2YHIA 4OYLA 4K2AA 3PSAA 2FWRA 3DE2X 4JLUA 3U13A 4X7PA 4CNQA 1KI6B 1JEDA 4FFWA 3SXUB 3HY4A 4BDTA 1HEUA 3ZNQA 2JFNA 5HUHA 5EE3A 4ZCSA 2FSVC 3GARA 1BHO1 2PLAA 3GZTB 1FFWA 1VMIA 1IN4A 1ODCA 5LIRA 1KHHA 3E7DA 4UCXA 3NUQA 1FP6A 3NNNA 5EKXA 1TDJA 1USIA 1RI4A 1TQ8A 2JFUA 2I1WA 1RBQA 4PLYA 5F52A 3PRJA 3C0KA 3QUTA 3IVAA 2ZB4A 2XE6A 3IXQA 4D1YA 2ZITA 3N8HA 1QLWA 4M54A 4JODA 3RU7A 3JWIA 3AUJB 3TVDA 2O05A 4AMUA 4GP6A 4CTNA 3L8YA 5EQDA 4DEVA 3VC7A 4R7GA 4EHNA 1E3WA 2WJ4A 3E8XA 3M4NA 2PQ0A 4UVHA 2ZI5A 4ZQEA 4BFLA 3NOOA 3SZMA 3K5WA 3E3AA 1B23P 3KSUA 4EGJA 1C7QA 4D9HA 3GP8A 1KYTA 2N47A 1OA1A 3E9NA 1NUAA 1K6IA 5KNDA 2YZ2A 4PYKA 1U2PA 5B57C 3HHPA 2L0XA 4MW7A 5E6SB 3RT7A 4WZKA 1PK9A 4Y2YA 5TQVA 1B8UA 3I72A 4J1QA 3IR7A 3AILA 4MV0A 3UUFA 5KTSA 3BNWA 4RDLA 4D5EA 2PWZA 5KU7A 4GVLA 2WINI 1CR0A 3RTCA 3REQB 3RK4A 3ROZA 1LFDB 4PFSA 4JEIA 1TUBB 4MDHA 2V9CA 3GP5A 3S8MA 1IZYA 2P1RA 3CLRC 3K8QA 2ZETA 4C6TB 1X7WB 1IY1A 2JGMA 4TWBA 4EFMA 5L6MB 4DR4B 1AX9A 4GMFA 4EA8A 3CMMA 3EGDB 4PZUA 4BYGA 1A04A 1VLJA 2AFRA 3GJ7A 1VIMA 2WM2A 4U3JA 4TXJA 1ETHA 3E05A 3H05A 5D3QA 1H1LB 5DU2A 2P9TA 3KLPX 2HJWA 4DDVA 2G08A 2XIQA 4C0LA 1MOZA 1REQB 5TE9A 4EG6A 1TK3A 3CSSA 3PXBA 5C4MA 1BZYA 4LJ4A 4ENTA 2Z5FA 2ZCUA 1V0FA 4MB0A 1FL9A 1PDWA 2YUTA 1B4DA 1NRKA 2FLVA 3NX4A 2YIVX 4N6OA 4XR9A 5FYDA 4AY5A 4DMKA 1ZU5A 4OQPA 2J3LA 1XZAA 2ODWA 4UOQA 1AS2A 3D6UA 5DTJA 3SOZA 4JVNA 4LBZA 4CCWA 1AG9A 3QQPA 3QXXA 2X4DA 121PA 4O0LA 4V0SA 3TIXB 1FMFA 4IW3B 4W8HA 5BR4A 1DKQA 2ISSD 4KN6A 3GQBB 3ZXYA 1UPCA 1X3SA 2BCJQ 3ASZA 2RHGB 3B3JA 2N1MA 3LLCA 1JBKA 4C3VA 4MROA 4ISBA 2GLUA 2VDQB 4EH1A 3EGIA 4JVMA 2EKZA 2OHGA 5A4AA 5IEBA 1K4YA 4HY3A 3ZEAA 1BH6A 3CNHA 5KNDD 3JX9A 2Q7XA 1OXUA 1M8PA 4QDTA 2A92A 5LYJA 2EG5A 4DJAA 3RW9A 4PLFA 3TZCA 2AYZA 2WWTA 1D1NA 2RGGA 4FN4A 1DAFA 4WJZA 3WLLA 4YCCA 1PUXA 3D1VA 4NR0A 1MQ9A 1XRQA 1E64A 4D4KA 2QIPA 1L7PA 4MKFA 2HRZA 4I55A 4O2BF 1Q7CA 1GL3A 1KARA 3H86A 4B2LA 4MA0A 1VHLA 3LECA 4FYJA 5E3JA 1FSPA 2BFPA 1OAAA 5HKLA 5K0TA 2H1VA 3C87A 5AJZA 3GP3A 1K7EB 1P4HA 3E9YA 4MUBA 7REQB 1KZYC 4CCSA 1YDGA 2QVLA 5CH3A 5L8VA 4WNAA 4P7FA 4P80A 4A4DA 2QW8A 1SD2A 2VT7A 5ED4A 2HDOA 5ECWA 3AC0A 3QPAA 1UKAA 1G55A 2NYRA 3ZIAD 1QOPB 4WZZA 4QBIA 1QTIA 3DVRX 1E5TA 4DDKA 1KYVA 3JQAA 2CKDA 4ZMRA 5K8UA 3LBNA 1KAOA 3FNRA 4O29A 3WHIA 1AJEA 1JQBA 1FXUA 2PFKA 2ZW9A 4IDGA 4QVAA 5EXPA 2NUPB 5CFQA 1EU1A 5BR8B 1KDYA 1MIHA 1UWVA 1QHNA 2RONA 3PNBA 3X1YA 1NM5A 5LMNB 1LA2A 1EH5A 1VJDA 1S02A 1X1QA 3E5HA 4NAHA 4N9QA 5YASA 2QV0A 1I0ZA 3DOFA 3GMSA 1ZM2A 2DOKA 2NU7A 1PDVA 3RQIA 3SJZA 5KPDA 1LVGA 1CBUA 3ZJUA 3KPYA 1KU6A 2VRNA 3RAPR 4PRKA 3H3FA 2V1UA 1X8JA 3MUEA 1PWYE 4INJA 4O4HA 2J9XB 4O4IB 3KSBC 1R0SA 5BQ3A 3T3OA 1FFSA 2OZEA 3FA2A 4R83A 1K8AD 2P2LA 2Q4RA 4F2WA 4I66A 4DMGA 3UMCA 3COPA 4ZU6X 5FHRA 5CPBA 1TMYA 3LUBA 2VBSA 1E7WA 3A6ZA 3NQ41 4G5RA 5J23A 2FZWA 1FMLA 1BCRA 3BREA 5AUPB 1T9BA 3U5ZB 3HBAA 5FPYA 1R5BA 2BSAA 1DE0A 1JDBC 2R2AA 3O31A 3KE9A 1WA5A 4Y9DA 3X2SA 3OP4A 1X77A 3GIRA 3CCVB 1UM9B 4OFWA 4R1NA 4C5CA 2P40A 1V3VA 4AD8A 4CZ2A 5FOUA 3PNKA 1JJFA 2Y05A 3LCMA 1WP6A 2VC2B 2ZEJA 4BIMA 5DV9A 4O2AA 4X71A 4IS3A 4QQ8A 4XQGA 3CCQB 1X92A 1VQ4B 1YHQB 1SQ6A 2QX6A 1FJHA 2ZJ7A 4FXOA 5LA6A 3WLQA 1KQGA 5IHPA 4D57A 1K7SN 5BQFA 4KPEC 3BCSA 3C4VA 3B1YA 2FZKA 3SEQA 5CFRA 3NIBA 2AG6A 1YJ9B 3BXFA 4HVAA 1R6DA 3IDFA 4OQXA 2HJ9A 4US0R 3R74A 5IAJA 1V16B 1VBKA 4R2KA 5KNLA 3RVPA 3VTFA 2DM6A 1W94A 1Y98A 2F3SA 3PR3A 4ZVTA 1U3FA 1CK4A 1U9YA 4IYRA 2WZNA 3E84A 1V5IA 3GN1A 2VAVA 3QA3E 1MFZA 5DHFA 3G88A 3TZBA 4MVJG 4MUEA 3TLGB 3AH8A 3NOQA 3K9CA 5HXBA 4TZKA 4L8GA 4WCVA 3BCHA 4R84A 1OB5A 3WADA 3ZWMA 1HH4A 4FWIB 1DX6A 1E92A 2P4UA 4QDKA 2BC9A 3WIUA 4GVPA 5HZAA 3LJKA 1PFKA 3AKCA 2MINB 1JR3A 3CUWA 1SC9A 3Q3GE 1Q12A 5EXXA 3UJ7A 5KYXA 5A89A 1RHJA 2YJGA 1F2VA 3VR3A 1GUDA 4Y0NA 1ZZGA 3WGVA 4CFZA 2PIAA 4KOAA 3LP5A 5LQUA 2Y1EA 4BN0A 3UV6A 1O96B 2FZLA 4CXMA 2VXCA 5AKHA 4AN0A 3BMNB 4D9JA 3ZZ0A 1DT3A 1KDTA 4MRNA 4XH9B 1R15A 5F1OA 1LK7A 2PZKA 4FOOA 3TQCA 2A1UA 2GCGA 4G1EB 4MV9A 4CBVA 3CLTC 1OYYA 3TVYA 4KQFA 3AIMA 3THWA 2OV4A 2J85A 2NUTB 3AFHA 1DBVO 5LBIA 5AW4A 4DY4A 4YRRA 4AKIA 4JOQA 3WOVA 4KO2S 2ZZMA 3K32A 3NVAA 1XVAA 2HY7A 3L6OO 2F8LA 4Z2YA 4IDOA 3PUYA 3TPCA 3ZWNA 5K2OA 3SYKA 2C3YA 2XOKD 3QW2A 3IESA 4CKBA 4Y7DA 4N0MA 1GUZA 2MR5A 4XM3A 4WESB 1NXOA 3HDGA 1YOVB 3QLJA 4HNAA 2EKLA 5AKKA 2OAP1 4QNMA 2C5BA 4IFIA 4TS1A 4IDQA 3JTEA 2ONYA 5DK6A 3V2IA 4G63A 1W4LA 2ZAYA 5JD3A 1GZ7A 4U9IS 2ZJFA 4BHTA 2VAWA 1QP0A 3KU4A 4RLFA 3KYIB 4H17A 1MAWA 3F5SA 1BW9B 1R8JA 3GGPA 4TLMB 1EDEA 1YVPA 1XZFA 1JR4A 1S8AA 4CTKA 1O6FA 1RXIA 2NQ2C 4ATNA 5REQA 3JU4A 4ZVSA 1WB9A 2NTEA 3GGDA 4AO6A 3QHAA 3DLCA 3CRMA 4LK3A 5HILA 4E22A 5LNK1 2QRLA 1QJ4A 1U3WA 4L28A 4MS4B 1KMHB 4UCFA 3NWBA 3VMMA 3OHSX 4RY8A 2Q5IA 4X63A 2G4VA 3MXTA 1VJ0A 1CHDA 1JR3D 1RAEA 2C4UA 2I2AA 3CT6A 3EZNA 3NHRA 3Q1LA 1KQOA 4FMCF 4HDSA 5IDYA 3DYBA 2BM8A 4TMTA 1T5SA 1V3QE 3TI7A 4RM2A 4BVHA 5BYKA 4XD7A 5KB3A 2Q4TA 3R8XA 2M9MA 5JE8A 3EIXA 4ES6A 3W5DA 1EP1B 1T9KA 3EW7A 4QBTA 3K0HA 2XCLA 2IDMA 2ET6A 4L51A 2AVNA 3TNFA 4MPDA 4X44A 3F7MA 3WWOA 4GZ6A 1EAYA 1VIVA 4NY1A 4F21A 5BPHA 3BMQA 5AWFC 3W2IA 1CJKC 1EUCA 4JGBA 4KAAA 5JD4A 3ME5A 5K20A 2Q1UA 1OIWA 2P79A 1GGHA 4PX3A 1IY9A 1Z4LA 3AM3A 4UHEA 3RROA 4E5VA 1QDEA 1ESZA 2QR5A 2VHXA 2Z56A 3UT6A 2O1EA 4LYYA 3VJKA 4L4SA 4D0NA 3WO0A 4DIMA 5JS6A 4NYIR 6NULA 4Y2UA 1FFCA 1Z5NA 1I4DD 4JQYA 3I6IA 4OI4A 2NO0A 1AC5A 1S8FA 3TCKA 3BMCB 3MTDA 2GB4A 1KJZA 5LIPA 1ID8A 1DVRA 1LF0A 1E98A 2H2GA 5HE8A 4CL0A 3LDAA 3MJRA 4M9XA 2TMGA 2VQ6A 1N3LA 2BR4A 2YWRA 4BNUA 4UHDA 3P9XA 2CC2A 4IIYA 2JA2A 3IBTA 4MKZA 3BF8A 3CCEB 3HA7A 4GM1A 2ZXIA 3VNVA 5HVNA 2OC4A 1L5RA 4G4IA 2FEPA 1O94A 4N41A 2CHVA 2P91A 3NCTA 5H3CA 3ZGYA 5M29A 1V45E 3G0CA 1XK6A 1HDCA 4HDOB 3P9YA 3R4VA 4HGPA 2XHEA 5BWLA 2AKAB 5JEEA 2NV4A 1SWWA 1ZR2A 3O95A 4BTLA 4Z4FA 5BYJA 1G3RA 4XD7D 3GLIA 3EULA 3PGXA 3ECSA 5JT1A 2DJIA 2K7FA 4RK0A 1JQAA 3DR5A 5CH5A 1VHEA 1ES9A 1P7YA 2FQ1A 3EMKA 3RTEA 4L50A 3C5EA 4RVHA 5JRJA 1JTEA 3EVAA 3WNBA 4M98A 2J9GA 4PR3A 1XUOA 1QO7A 3KBBA 4F86A 5JCZA 3BQJA 4ZMSA 4F5YA 2CL0X 4KQIA 4KDEA 4NEQA 4P4TA 3KWFA 4KSCA 3F6BX 1JLRA 2XTAA 4FYHA 4EVRA 4BV3A 4HNTA 3G2PA 1XO1A 5L3RA 1V11A 3D8HA 1Y5NA 1UIMA 5DWQA 4M36A 3DV2A 4LUCA 3HNPA 2VUUA 1MZPA 1U4NA 1XD8A 2RHTA 4KCGA 3STWA 3UWOA 4FYWA 3AM4A 4HAOA 5KQMA 4YRPA 3AT1A 4IGFA 3CD6B 1YZTA 4QOFA 3T5PA 3MN1A 1XX6A 4OHFA 1VMKA 2OESA 1BU8A 4R40A 3G5LA 3NHLA 2Q3MA 1WBDA 1QUEA 5EJFA 4QBGB 4CMIB 3WLNA 5BNIA 3GJ3A 3OZCA 1H9BA 3IJEB 4EK9A 3FNIA 4C43A 3L93A 1XRRA 3I6MA 3OIGA 1Z56C 3PX2A 4EKDA 4B43A 2ORIA 1UPTA 3PD1A 4MJLA 5FNVB 1IDOA 1Q0ZA 1YNOA 3DAGA 521PA 3OIDA 4LDNA 2RHHA 1RC8A 1KAMA 1O94D 3ND5A 5A5EA 3CINA 5D5QA 2HHHB 1KI1A 4YUWA 1DKUA 1UP7A 5LOVF 1JWLA 2GK6A 1U4OA 3G17A 1GQRA 5EINA 1KY3A 3UHAA 3IJRA 2QQEA 5AMXA 4DR7B 1T15A 4ITRC 1FNCA 5A4KA 2PCJA 3EGWA 5C52B 1WF3A 1BMTA 2C96A 2IZ1A 2D2FA 1P2FA 1PSZA 2QWXA 3HV0A 3S29A 5DT9A 2O8FB 3S7TA 2WVHA 1R74A 3E5RA 4RX1A 5CNIA 3B2NA 3IXLA 1PW7A 3DHEA 4IO0A 4ZU1X 3AHEA 1KORA 2XNKA 1E5XA 3AV3A 1U7XA 3BL8A 2HXSA 3DMTA 4MQMA 4YGXB 4ND2A 1Z34A 3UG7A 1M1YB 3EJWA 1QFXA 1ONNA 1BJTA 1JHAA 4HDRA 1T5IA 2XX3A 3AHCA 3BA6A 4REQA 1A5BB 3WV4A 3ZBPA 3OTIA 3T1NA 2Z1MA 4BNHA 2O14A 1ZJJA 1EPUA 3AIKA 4D82A 1N08A 1GZ6A 2QP9X 1PT8A 1NW9B 4Z3KA 2OK7A 3MBOA 2ZRAA 4PTYA 4P2BA 3LY8A 1QG2A 3CVYA 4N49A 5H7XA 1X80A 2WSIA 3D5QA 1CQIB 2N75A 5ERGB 3WIOA 4K28A 3ZNPA 3M1AA 3CCCA 4B85A 3ER9A 1T13A 1R9NA 1MDBA 2CXPA 3W7AA 2PBLA 2ERCA 4QYIB 3FOAA 3DLBA 1Z0JA 2H65A 1NBME 1R4MB 1NE7A 2O1SA 4GAEA 5JTUA 2PZBA 2WW8A 4WFIA 2W6PA 1TXGA 1RWOA 2ZIUB 4QEDA 3BWDD 5F12A 2OLKA 2C9OA 3O1IC 3QOXA 3L7NA 4HQNA 4B3TB 5LQNA 1XI2A 1DBSA 3WKEA 4TT8A 2FPPA 2J4CA 5F3RA 5HQTA 1F6WA 3CEAA 3EMDA 5KYYA 1NJ5A 1L5WA 3IDOA 4KVFA 5HQJA 5CCBA 4LGVA 2GEJA 4YJGB 1CRWG 4IIJA 3R7BA 3QOFA 2QX8A 3AERB 4KQ9A 4CF5A 5LYJF 2PGLA 1WEHA 3M3HA 1FRZA 1QVFB 3H2HA 3GRAA 3HUTA 3P4UA 4FMDF 4S1NA 3RGGA 4C4SA 5J5AA 1B6RA 1T0JB 1WV0A 2AXNA 4RZ3A 4B45A 1USWA 3C3CA 1D4OA 2IZ7A 3V9AA 1EGAA 4Z4YA 5D3ZA 4CIDA 1U3CA 1NUPA 2RI1A 2JVIA 1SM4A 2HO5A 3O9ZA 1ZNXA 1D5CA 4MITA 1Q0PA 3E53A 4ZEMA 4PINA 4FOPA 3SC2A 4XVUA 1PKVA 1FYWA 3CN9A 2RMKA 4F72A 2XLCA 1XNHA 2JANA 2QUIA 4NDZA 1ILWA 1X3LA 3WGYA 5ISMA 1BG6A 2I66A 2J0UB 1Q11A 2QYTA 1G7RA 1AGNA 4PFKA 3HB5X 4QL3A 4EY4A 5H82A 1YZHA 3WV5A 4F46A 1G8PA 3OKPA 4KZPA 4DN6A 4ND3A 1CUEA 1PLKA 3ZGVA 1EM6A 1ULTA 2B34A 3N6XA 5DMXA 2FEMA 1IPHA 2WIDA 1ZBDA 4MKGA 1P73A 2C61A 4GOOD 4J16C 4JYMA 2NU9B 3T5GA 2SECE 4YJFA 1HY3A 3MMZA 4AZVA 4YUXA 3GLFA 1ARZA 3KKQA 2IY8A 1NLFA 3RBAA 1LBQA 5TPWA 4DG8A 2BJHA 3KR2A 4IMPA 5JLJA 2CFOA 1PZMA 1P5FA 4DUGA 3VAZA 4EYGA 1KWGA 2FJUA 3CMAB 4EG0A 4M2LA 3UWMA 5FWYA 3JRWA 2XUDA 3EEIA 4LQDA 4ISCA 2GBIA 4NBVA 1S5PA 3C2QA 4WOPA 4BQPA 3DUFB 2XT9A 2PUDA 4CQJA 1N6NA 1N5JA 4M37A 2RGNC 5LP6B 3O8DA 1DCFA 2D1YA 8ABPA 5IYNA 5LWQA 4OK5A 3PGA1 5JADA 3DCIA 1VSBA 1DMSA 1EGVB 1LBSA 1UEIA 2OV3A 2WSLA 1E1QD 4URHA 3VYTB 4F8EA 2AN5A 2PGAA 1CEXA 3ODPA 3EXFA 4BNZA 1UQTA 5JQWA 1IXKA 3FWYA 4P34A 2WSYB 2H4YA 1ZAYA 4UJ3A 3EC7A 3DQPA 2ST1A 1ZR4A 3SVLA 2GFIA 3U4IA 1F2DA 1RVDA 2VHEA 1D07A 2GEBA 4BO1A 1ESEA 1S6YA 4Q9AA 5TNXA 5CBPA 2HYDA 4UKDA 1SXJA 2PL3A 3RSOA 2ZYIA 2D7DA 1NVEA 1OE0A 3BFPA 5K99A 1Q92A 2YWJA 3H99A 1NZFA 1P44A 4GM4A 2XODA 2WZPP 3IV9A 4BFXA 2R9VA 2VSNA 1MBZA 4JY7A 1Z5ZA 3OMXA 5BR7A 5AVYA 3IAM6 4YC7A 1P2BA 1A96A 3WK8A 4P26A 1YJBA 4GECA 4XWKA 2P9CA 1Z5UA 3OT1A 4TN5A 3SZRA 5C3MA 3ZDCA 3PG5A 2ONZA 5KQSA 5KX5A 3ANXA 2AFHA 5KSWB 3TD9A 2E6UX 1T36B 1R3UA 2X8WA 3DBHB 1XZJA 4HNHA 5DMHA 4ZD6A 1QRDA 1QE3A 3FIJA 2I2XB 4ITVA 1V5VA 4GRIA 4Q3BA 2IW3A 4TQUS 2R1TB 1SMKA 4UM9D 3TH5A 3TTXA 4EPXA 3GLGB 2BHLA 3Q3HA 3JQGA 3WGGA 3HFRA 2C9BA 3O3OB 4HYYA 1EUQA 1TYEB 2QE6A 4O4JB 3U4HA 3ZOZA 3GPDG 4RLSA 1KE1A 3SC4A 1CR2A 5GGXA 1WABA 1HE3A 1G3UA 2VJQA 4GI2A 5LLDA 2ADOA 4OI0A 1LW7A 3I4CA 1IQRA 1GTL1 4KQJA 4J9UE 4LRXA 4B3XA 1GL6A 1L7XA 3A9SA 3MW8A 1JAXA 1SH7A 3P7MA 5DX8A 4QTYA 1B6GA 2PL1A 4WASA 5I9TA 1PL0A 1WUHS 4PAOA 1HYEA 2WWWA 4PO3X 5CDHA 4GS5A 1QP4A 3ET4A 1X42A 4JVLA 4Q03A 3Q2IA 3HYLA 1M2VA 1F38A 4LX8A 4ZRNA 1XEXA 3RUFA 3V55A 2IEGA 3S40A 3PITA 4IJ6A 3P45A 1EK6A 4UTOA 3UAOA 4JK3A 1LLCA 1W0KA 1NXTA 1SXJD 2AOTB 1ZL2A 2Z2YA 3N53A 4PO1A 3WLIA 3UCXA 2DSNA 4TYNA 2IRWA 1U0SY 4PCVA 5DHAA 1TTTA 1AKMA 1JQEA 3T9BA 1E2KA 3CRNA 4ZI2A 1RXVA 1QZTA 4FE4A 3ZI7A 4XM1A 1SZCA 2A86A 1KAQA 3DFIA 4BGDA 1JECA 1V7PC 2JIMA 2V65A 2BCGY 2H9AA 4NVRA 4M89A 5DBFA 5CVTA 1FTGA 1Z2OX 4TOIA 4JUCA 2E37A 5JS8A 3F97A 3W7VA 1XKTA 3GJ8A 1TM1E 5FV4A 4PHFA 3KQHA 3W5IA 2ZCJA 4WTOA 4AK9A 3GDOA 5CCXA 3BG5A 1C3OB 2Y1GA 4C07A 4E5PA 5JPIA 3HCCA 1IN1A 1NULA 2I34A 4F3CA 5I9IA 3THXA 4Y30A 1X7ZB 2B20A 3HSYA 4JVOA 3BRSA 3JQ6A 4XGRA 3RIGA 4D0GA 1KP3A 2CEAA 1NNEA 3TX2A 4IGAA 2PWBA 1FUIA 4ND7A 3DM9B 3KUXA 3ZQ6A 4Q7LA 5LSAA 2VP9A 3RS0A 4L76A 4YRNA 5A06A 3MCUA 4KWIA 3D59A 1NYQA 5FPPA 3VH1A 1Q1AA 3QBJA 3TSZA 4ERXA 2PGXA 4TLEA 1IQ0A 3ZHYA 5KQGA 4EG4A 3PVDA 3DAHA 5IJXA 1XAIA 4OPVA 2QJTA 1W46A 4LIPD 3DDYA 3QITA 1PKXA 2X9GA 2GPJA 3GBSA 2X13A 3NBFA 3K96A 4PAMA 3S2YA 3AVOA 3ICEA 2AEJA 2NIPA 2A58A 3UH1A 2CL6X 1JQKA 1W2BB 2Y1CA 1JHZA 3CQ9A 4NQZA 4XIJA 4B5KA 2OP1A 4CIBA 1HQYE 3UJNA 4H9GA 2O8EA 1KQNA 2IYTA 2QUJA 3ONUA 4KKTA 1TQ6A 3FZGA 3TZEA 1V41E 2FSFA 4ZVMA 3BC9A 1DC5A 3NHAA 4MV5A 3OP1A 4RHEA 4TKUA 4HE6A 1QG4A 1NVMB 2OFPA 1F8UA 3AUFA 4GX2A 4NJOA 1XAGA 4OK3A 4YGYA 4JC8A 5HF6A 1VG9B 3ZLUA 5GVSA 3R76A 4WXRA 4Z3OA 3OQ6A 4J43A 1FRFS 1T3GA 2WIFA 4PGHA 3PEUA 1KO8A 4PRYA 3ZWAA 2KWIA 4JGIA 3ZVKA 3KSMA 3IOBA 4G67A 4CCYB 4LGCA 3DDOA 4IP0A 4RHYA 2Z2ZA 2GBLC 1OOEA 2QU7A 2VBFA 5AI9A 2CL5A 3R6GA 4PPFA 2ZSHA 4TWJA 5FUWA 1NV9A 4BAUA 1Z18A 3HRHA 4DJ5X 2NN3C 5K9ZA 1PK8A 2ZBQA 5ULLA 1OMOA 3L3BA 3RRZA 2W5UA 2BSXA 3EGVA 4EBBA 3GWGA 4U6NA 4DAOA 2FPOA 1OT5A 1T2VA 2RHOA 3GAMA 3I9NA 4CI0B 4ZI7B 1JQJC 1T4BA 4TYWA 4CU5A 3GMDA 3IMFA 2JJYA 3DOHA 3QELA 1X8KA 3UAVA 2C5GA 2PUWA 2UVQA 5TLSA 1GD1O 1ZD4A 1YCDA 3MJSA 3MWJA 3OIVA 4L9AA 4BATA 3I76A 2MHCA 3PHHA 5DW3A 3H5TA 5EXSA 3CGWA 1L8XA 1RRGA 1S2MA 3HUEA 2PYIA 4EFKA 4AN1A 1X39A 3PXCX 4W5JA 2B21A 4RMGA 5EN4A 2V4MA 5B7GA 2R7MA 1E60A 1Q44A 3PJDA 5JDIC 2HK6A 1N2SA 4PZEA 1VQLB 4PW0A 3ZCXA 3EUEA 4FJ0A 4ZPJA 5LQAA 1ODJA 1NUHA 3E4DA 4XI9A 2MYPA 3BA1A 4IY1A 3CA8A 1KWKA 2JCVA 5BRNA 5CURA 1RSZA 3UWDA 2DF8A 5BUZA 3RK0A 4XSVA 1SPXA 1JKXA 4P6YA 1OASA 1VYTA 3AUSA 3R44A 1CUSA 2CB0A 2Q5EA 5JATA 2CMHA 2IHYA 3AEKB 3FNEA 1SVKA 4NENA 4Y0VA 4AO8A 5DGTA 4J6FA 5DNCA 5KWVA 4ZTUB 5FTMA 5BWCA 4BASA 1BDHA 4QKQA 1F60A 4MIEA 3NTXA 5E4TA 1XXHE 3FMVA 3SMQA 2XY4A 3L5KA 5JWRA 5LD2B 3VR4A 3OZXA 4P31A 4E13A 5IYZB 2YYYA 2C2ZA 1EESA 1UXGA 1JS1X 3AR7A 1VHDA 2NV2B 1UMCA 4FUQA 4GRDA 1GNTA 3TRFA 4CTMA 4AY2A 2BTQB 3HRKA 1OXKB 4RVGA 1LVUA 1FDTA 3THSA 5E9QA 3STVA 1YAHA 4HZUA 5TIIA 2ZJOA 1IJEA 1KIFA 4WERA 5FB3A 4E5KA 5JAHA 4W1PA 1VMEA 1M6EX 2GM5A 4PSAA 2ZULA 2OV8A 4Z4QA 3QPUA 4Z9YA 1K7YA 1ABEA 2JFBA 3NBKA 4Q6WA 3RVMA 2CHUA 1O4WA 2I3AA 2ZJ2A 1N8TA 4LECA 4RHCA 3UXHA 3WLMA 3AR2A 1BRTA 4EQ6B 3FDFA 4IBOA 1R6UA 4RZIA 1MVOA 1CJSA 3JAKA 4EBFA 3A8KA 1ABFA 2EJVA 3EVCA 1BO6A 4N12A 2A9PA 2ADFA 2JHCA 1SB8A 2Y92A 1NR7A 4OHWA 3CUVA 4A27A 2EP5A 3HZHA 1DPGA 3PB3A 4H27A 4M9QA 2YJ4A 3NASA 4RF3A 2F3TA 4OJQA 2IUUA 5D01A 5IJWA 2QRZA 4A0FA 3TRIA 4BRSA 1WTHD 4H3KB 3MK31 4JI1B 1DWQA 4BQNA 4CEHA 4XSHA 5J5VA 3UKJA 4KXUA 3THYA 3OD1A 1GO2A 3PCRB 1EIZA 3EIFA 3HDTA 4M0EA 2X3FA 5ALZA 3SXPA 5IZ4A 5KHOC 4I46A 2H5IA 3K92A 4HDMA 2Z6VA 5BSVA 3QPVA 5EMKA 3TR0A 1YDHA 2QT0A 3PC3A 1IXRC 1NW8A 3KXPA 3T3PB 4QGFA 5ARCA 3T7SA 3VTAA 2FW7A 1C14A 2RIRA 1W2HA 2AE2A 3OQ1A 4B80A 2BIFA 2AZTA 1Y7TA 2NPIA 3FPAA 1KEKA 1CULC 1CE8A 4XDGA 2PMCA 1AKTA 4F6LA 4OB6A 4MW2A 3MS7A 3P9KA 3KZKA 4JLSA 5EGSA 3S27A 3RAEC 3IP8A 5G41A 1EVZA 1Y3BE 1XDSA 4AF8A 4BX9A 1S2LA 5C5DA 1H66A 5FF9A 3NEJA 2OG1A 2B4TO 1C7JA 3QRWA 1DX4A 1X87A 3WYBA 3QLEA 1RE0A 2XYHA 3BL5A 3DC7A 2HCJB 2Q6OA 1HOTA 5B6IA 3FPLA 5DYTA 2GCNA 3WNCA 5CB4F 2VJJA 1D2EA 2ZROA 4LY6A 2QXYA 3ZCQA 3VZPA 4MYHA 1ECCA 4REOA 1IEXA 3AQ4A 1MGOA 3MRXA 3ZV6A 3WBFA 2Z1NA 1QHGA 3DTYA 4OHKA 3WDKA 3LZDA 1SKQA 2XCOA 1Z13A 2H63A 3DGEC 4ZC8A 1WXWA 1GZUA 4X8LA 2WHQA 3CEMA 1Z0IA 2O3SA 2CLCX 1VLQA 1GGJA 3RY8A 3L7BA 4XQ0A 3SVTA 5HKKA 2V31A 1B41A 1ZIXA 3IILA 4E0BA 1T10A 2DX7A 4NJMB 5K6AC 2Y2UA 3C6QA 5C1PA 4XWOA 4WKBA 5U4XA 3DEFA 1FFGA 2XAAA 2C04A 3EVDA 4TUYB 2XDQB 4JCCA 3TEMA 4KR6A 3BF7A 1DC6A 2PSJA 1TEVA 1SD1A 2JGFA 4GL4A 4W5WA 4OGFA 4I99A 1QV9A 5EESA 3L8GA 2KQUA 4MUNA 1DC8A 2PUAA 4LXQA 3SZLA 5FTLA 1XTKA 4GYYA 1ISGA 3ZPNA 2I33A 1RMQA 4OB7A 3ZE8A 4YV2A 4PLWA 4UBNA 4D9NA 1HT2E 2JKYA 3K70D 2BMDA 2YMPA 1SUPA 2H5EA 3WBBA 3M8KA 1KI9A 3CZCA 4MUFA 5DTIA 4S1OA 2MJLA 3DKIA 1WU8A 4YV7A 4M1MA 3C98A 3GGGA 1AHHA 1UF9A 3OCXA 5IS2A 4JWTA 5LM3A 4EI8A 2D1SA 1I3MA 3ANTA 4B3GA 3EAQA 1SRRA 1JEEA 2YBEA 1VLOA 2FE4A 4CIYA 3X1WA 2IHZA 1JRLA 4GMHA 1DOZA 4CUJA 3QEJA 2P9EA 3VSDA 3ZZTA 2G80A 5IVIA 2IW1A 5I45A 3WA7A 4PWYA 4RY0A 4XE5A 2PR7A 3SN6A 5I47A 2O8BA 3GOHA 3BB4A 4N5NA 3MPOA 2IUTA 1FDVA 2PUVA 4YRJA 5K0BA 3RDPA 4CGZA 1P33A 2OHVA 4FLFA 1PJ2A 1Z5PA 1DMRA 3A4MA 3BRWA 4Y2HA 1US8B 4PHCA 1GFIA 1T5DX 3TQRA 3FOCA 2X4GA 1F2UB 4DCSA 4GQAA 2VZLA 4FN5A 3K1JA 4FYIA 5TRDA 4S1TA 3PC8C 4AJKA 2E5WA 4JLBA 5HIJA 5AKGA 1G42A 2XZTA 3BGDA 1JG2A 5BN3B 2OP0A 1E1MA 5JCXA 1Q6YA 4R01A 4RETA 1D3AA 1J70A 1GNQA 2AJTA 5E6SA 3V4SA 1PT6A 5HKKD 1HDIA 2G63A 2I9KA 2QM3A 4AS3A 2VZEA 3JQPA 2FXIA 3HMQA 4KN5A 2BI7A 4RV4A 4WT7A 4ZVNA 4X5OA 3E1SA 4MUKA 4Z4VA 3V4OA 5K5EA 3VKVA 3WR5A 5I3ZA 3REQA 4B7CA 4XR6A 4JYAB 4B3CA 2D7JA 2A59A 4C9BA 2NMVA 1EQ2A 3O8LA 3OWXA 1ISRA 2E48A 4KTVE 1EXVA 2BYTA 2VP2A 2QRHA 4KMOA 3HA5A 3EGDA 4BEJA 1N57A 2BWJA 2VH5R 1T9HA 1F8XA 3B52X 3F71A 5ALMA 3OQIB 3UKDA 1KRWA 5HDBB 4DILA 4MR9A 1QVGB 2PV7A 1PJ7A 3DVLA 2C03A 4HATA 4LQCA 1GKKA 3CG4A 2V7XA 5JFGA 1EZZA 1SBQA 1W34A 3W1VA 4C7VA 3HCNA 4MLZA 3S0JA 1V47A 2HJGA 4TZTA 4ZQGA 5D1NA 1JFLA 1SEPA 2JGKA 3NATA 3L04A 4FZ3A 4LRWA 4TV9F 2FMTA 1HE1C 2D6FA 3F2VA 3ZGNA 3DXXA 3ZJ4A 3IVMA 4LVCA 5F4ZA 1ZD9A 2OQVA 5DNWA 5FULA 4K9QA 4AZ3A 1BLIA 3HCAA 1DBIA 4K9DA 4RJJA 3RIEA 3BRWD 5CXXA 4L3VA 2XD4A 3H13A 5HM6A 1AT1A 1JFVA 3ENQA 1Q15A 3GWZA 3MINB 2QMQA 1WM1A 2EHDA 3KBOA 3Q9SA 1RJ9B 2IV7A 5IDXA 3LL4A 3ZX5A 1I18A 1G20A 5HX7A 3ADKA 5ALLA 1DAKA 1XTRA 1PYGA 1EJ0A 1DRVA 2G7ZA 1OT3A 3BMOA 4PNHA 4Q37A 2GHTA 2H4JA 4LJ6A 1NATA 4O5OA 3UB2A 4BCBA 3MTBA 1Q0LA 1U1CA 2OBTA 4RFSA 4EYOA 1X1CA 5ICGA 1AXGA 3VM6A 3F6EX 5JJ5A 2ASVA 2QPOA 4URWR 3N2YA 5JMPA 3OQOA 1P6QA 1SULA 4QJ5A 5TGTA 2PH1A 3SXJA 2D2EA 1KQFA 1RWVA 2I78A 1QQ7A 2V7PA 3TFQA 3HXLA 2VPQA 1M2OA 2RJNA 3H7IA 1Y7HA 4MRMA 3HN6A 4DVGA 1FFBA 3KB8A 3QVOA 2YDXA 2OOSA 3R7WA 1BDIA 1D1PA 4ZCLA 1TTPB 1V8FA 2CL7X 4L9RA 4XYMA 3SPXA 3TUIC 1UZUA 2F7SA 3DHWC 5FUBA 3UJ8A 4Q1EA 4HRXA 2BEKA 2B8WA 2NU6A 1OZGA 5J1TB 2G36A 5K3FB 3VPCA 3ZGXA 4C7OB 1RRKA 2H29A 2X76A 1CY6A 1RW4A 3B6IA 3NETA 4EPYA 4F56A 2AUNA 3PUMA 3ZPXA 4GW3A 2FQWA 3QXCA 3B12A 4RGYA 721PA 3AEXA 4C7BA 1QH8B 2E4ZA 1O9HA 3NVDA 2GRJA 4PSDA 3OFSA 5L9AA 3B2EA 1X7DA 5SYAA 1YMUA 4QE3A 2ESRA 2XSZA 3A7EA 3FOBA 3ILHA 2B36A 4J3JA 4X00A 4UZSA 5A4FS 3MUNA 4BV8A 1U1DA 2P5UA 5CNMA 4YCBA 3ZR4B 1LSOA 4KHPB 5EJGA 3IX7A 3EPRA 4AZ0A 1ZN7A 3SKBA 5DSTA 1GGKA 3E3OA 4FINA 3ES9A 3TEJA 4U39A 1WW8A 1XNRB 5TMDA 3W8DA 1W0JD 2P2CA 3ZGLA 5IF3A 3PGMA 3COSA 1JT9A 5HTOA 4RY9A 1IQUA 2CFRA 2NNWB 4XL9A 5BVHB 4OXXA 5KS2A 2ZT5A 5KWJA 3KJZA 4ETWA 1O5OA 4A6DA 3GLKA 2OKGA 4GPD1 4US2R 5C7OO 3AV0B 4MS3A 2OECA 5LKAA 3PUNA 4E31A 4KWCA 2GCOB 2P8SA 2YVQA 2E6KA 2GJSA 1JQLB 3HKDB 3ND9A 1E9CA 2WAOA 2F8MA 3HB0A 4FMPA 2C5SA 4HAVA 3UHFA 5DYGA 4N0DA 3UVEA 2ZRQA 4JHXA 2QTLA 2W8ZA 8LDHA 1XPOA 4Y2XA 3HXPA 2MIIA 4YALA 5CTAA 3D8TA 4D8VA 5DEOA 1IM2A 4K6CA 5G0VA 1VKZA 1HC7A 1FP1D 5DYNA 2B7LA 2PFSA 3V2UA 1SXPA 2C92A 2QZ4A 1HE8B 3E81A 4ZANA 1M3SA 4AYXA 2I1VB 2I8CA 4Q7EA 3OT4A 5D1HA 5E7MA 4Q1BA 4TLLB 1Z68A 2YH2A 3PFWO 3QBDA 3RC2A 4UNRA 5J4VA 2ZZQA 4M0FA 3A4VA 5L45A 1E4EB 1R4NB 3DBLB 1D09A 2BDUA 1CY0A 3IAAA 3M49A 4QPCA 4W7IA 2O8CA 1AK2A 4HDKA 4ZT3A 4UNQA 4QBKA 4UBJA 2C5HA 3AF1A 1MAUA 1Q1BA 3M3PA 4IUYA 3OLVA 4K3UA 4ER6A 5I7FA 5KNBH 3HBFA 3V8MA 4DR2B 3AIOA 3RFCA 3ZGOA 1B6TA 1VZ2A 4JI4B 1X19A 221PA 2CLFB 5K8LA 3BE5A 3G5UA 1KYZA 1THGA 2QX7A 2QIOA 3ICVA 4Q12A 3OPYI 3T7JA 3NH6A 4NF2A 5EWJA 4H1VA 4HN9A 4IGIA 2XRZA 4HCJA 2J3EA 1GOTA 3KPJA 4R1TA 5CDFE 5IWAB 2JKVA 2CLIB 4WVFA 1O87A 2I03A 2YWFA 3SHFA 2V58A 4C4AA 2QN8A 5T5QA 2ZP1A 3T8YA 3BILA 3U4GA 1BNCA 1KVTA 2BOVA 2E87A 3MWFA 4PC6A 1O96A 4G8DA 4MWCA 3SF0A 2BMWA 1ZESA 2WVAA 1P0FA 3EEBA 4JENA 4K6HA 4LOIA 3FVRA 5LZ8A 1A7JA 1HZJA 3N0RA 4U9HS 5FBQB 4XFJA 4Q02A 1K6XA 1MNAA 2AQHA 1FDRA 3NHYA 5GAJA 3IEVA 2NUTA 1V0JA 1H23A 2IS2A 4UD6A 4B74A 5JH7F 1ZKDA 4C7MA 1K92A 1THZA 3VV2A 2FFAA 3CVJA 4YFVA 3ZTYA 1KPHA 4HGYA 4BU0A 4F60A 1SCNE 1RWBA 4FS3A 2PEZA 4O6VA 5JVDF 3U44B 1PTJC 2JH3A 5F78A 2E1PA 1GRRA 4M0DA 4OKNA 2X5JO 2ZSIA 3C3AA 4Q4LA 4O4LF 4DMFA 1VJRA 1W36C 1K89A 1GAXA 2QI9C 2RH4A 3G49A 3GRRA 3PQDA 2WR8A 1F6BA 2A0WA 3HO1A 2AN3A 5EMNA 4HDQB 4BJ6A 2PBZA 4C6SA 4V1CB 1I8DA 2HHJA 4KPYA 1JA0A 2J31A 3SSOA 4QTUB 1Z74A 2DP4E 4H35A 1W48A 2CXTA 3O8NA 4BO6A 4S12A 5CJJA 3ZTWA 1L7VC 4AS2A 5AI6A 1SUSA 1HYHA 1JR2A 2G0AA 2IV3A 1WUIS 2ZIAA 3A3GA 4WH0A 4DA9A 1LNSA 2MU1A 3LCCA 2JGNA 2C78A 4YIKA 1TLTA 2Q1TA 3PUHA 1V7QA 2QRNA 1JHPA 5CA1A 3V4RA 1Z29A 2R6JA 1B8OA 1Y9DA 3BAFA 3I73A 5KJE