The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
57
|
sequence length |
256
|
structure length |
237
|
Chain Sequence |
DDILDIITLTTDFGTNEGYVGAMKGRILNILKKYNKDAKIIDISHEIKPFNIYHGAYVLLTAIPYFPPSVHVAVIDPTRKSIVIETKSGYYLVGPDNGLFTYVAEKLGIKRIIKIDEERGRDVYAVVGAEILINNGYDGEELDEMVKIDETKKRVIHIDRFGNIITNIKTFKTIMIKIRHKNGIEKIIKCKFVKSYFEEKNNFICLINSEGFLEISKFMDNASKLLNVDYLDEIEIE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of a conserved protein of unknown function (MJ1651) from Methanococcus jannaschii.
pubmed doi rcsb |
| molecule keywords |
Hypothetical protein MJ1651
|
| source organism |
Methanocaldococcus jannaschii
|
| molecule tags |
Structural genomics, unknown function
|
| total genus |
57
|
| structure length |
237
|
| sequence length |
256
|
| chains with identical sequence |
B, C
|
| ec nomenclature | |
| pdb deposition date | 2005-11-23 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01887 | SAM_adeno_trans | S-adenosyl-l-methionine hydroxide adenosyltransferase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Barrel | Elongation Factor Tu (Ef-tu); domain 3 | Bacterial fluorinating enzyme like | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal |
