2F4VF

30s ribosome + designer antibiotic
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2f4vF00
4LFCF 4B3RF 4JI6F 2F4VF 4JV5F 2B7BB 2YY3A 4LF9F 1HNXF 1RISA 4JYAF 4B3SF 1I94F 2J5AA 4YY3F 3R3TA 1IJEB 4JI3F 5LMNF 1HR0F 2B7CB 2UU9F 4DUYF 4LF4F 1LOUA 4LF8F 3T1HF 1N34F 4JI8F 1F60B 3T1YF 2UXDF 4X66F 4DV6F 4NXNF 1G7CB 4DUZF 4DV2F 1FJGF 1CQMA 4DR3F 4X65F 4GKKF 2UUCF 2BVZA 4K0KF 4JI5F 4JI4F 4DV3F 2ZM6F 4JI0F 4DR4F 4DR6F 1N33F 1HNWF 4OX9F 1XNQF 4JI2F 4GKJF 4DV5F 4LF6F 1XMQF 2UUBF 4JI1F 1IJFB 2UXCF 2UXBF 4DR7F 1FKAF 2KJWA 2BXJA 4DV0F 5LMUF 1XMOF 5AJ3F 4DR5F 1J5EF 1IBMF 1HNZF 1CQNA 4KHPF 1N36F 5IWAF 3ZZPA 4DV1F 2E5LF 2KJVA 4X64F 2VQEF 4JI7F 4B3MF 2HHHF 2RJZA 4B3TF 4DV7F 4AQYF 4DV4F 1XNRF 4DR2F 2VQFF 2UUAF 1VMBA 1G1XA 3OTOF 1IBKF 1N32F 4LF7F 4LFAF 1IBLF 1QJHA 4LFBF 4LF5F 4DR1F 4NXMF 1B64A 5BR8F 4YHHF 4X62F 1GH8A
chains in the Genus database with same CATH superfamily
2E7XA 4LFCF 4C8OA 3A1YG 1RAJA 1X5PA 2C2EA 4M5KA 1RAOA 1RT4B 3PRVA 2HHPA 2B7CB 2MYFA 3I5CA 1NK4A 2JLFA 4UW2A 3C8YA 3MOJB 1NK6A 4ERDA 1XJWB 2A6MA 1TL7A 1F0XA 4KB7A 1FF2A 3CCMS 3M6WA 2AKWB 3PYEA 1IKVB 4W4MA 4B02A 5DLGA 2KT5A 3R7NB 1JLQB 1VHIA 3KLGA 3ENAA 1VRUA 1S7HA 2HGMA 1WNEA 3ZTSA 1FKOA 1PKUA 4F50A 1TFYA 5B0GA 2M8DB 5AE2A 3OV7A 2OJ3A 2JEFA 3Q8RB 2Y1RI 2CXEA 3TAPA 3IBWA 1VBZA 2J9CA 2RQCA 4OYBA 4Y0FA 2R7WA 3AJDA 4X4TA 4ZP9A 3A8JA 3GILA 3N28A 4M5DA 3HVRA 4JV5F 5AXNA 4B9NA 2FLPA 4UOHA 3GONA 1F3FA 1DARA 1C0TB 5BYRA 4LF4F 4JI5J 4KRWA 1RT2A 2KHCA 2DRAA 1UPPA 4V19X 3VAHA 4F8RA 3IWXA 1TKTA 1CJTA 4DBQA 3TJ8A 4G1PA 5KFDA 3R9LA 1PO6A 4NLGA 4EO6A 5KT3A 1SC1B 3FSIA 3KMQA 4RBTA 4YHHJ 1BHNA 4ID8A 1YBUA 3O1LA 4P52A 3U27A 3ZZTA 2VICA 4DR7F 2M5YA 3HD2A 1RT5A 3DFEA 2XGQA 3W3SA 1VQKS 4OI6A 3GMGA 1H2VZ 4OI3A 2Q1LA 2F7VA 2KB2A 2LEBA 1JB0C 2DNRA 3UFCX 2KM8C 4C6AA 5FJ4A 4EBCA 1IXKA 3DRRA 1MN9A 2NSBA 4E98A 3H2UB 4HI2A 3KMSA 2QT7A 3HJVA 2AYEA 5LT5A 2J76E 2BM0A 1VJWA 1UAWA 1RZMA 2XNQA 2B56A 3A8EA 1U1LA 1SV5A 3FZ2A 2AP6A 3KK2B 2R7OA 3IR5B 4U95A 5HBMB 3AD9C 4LUBA 5IT9U 1Y3JA 4M5MA 5EX0A 2IYIA 4KJIA 1RBLA 1S1VB 4WYLA 5CQGA 4X4SA 2RE1A 4UOCA 3TI0A 4DSJA 2ZBCA 4O44A 3PVXA 3M2RB 1H7WA 5C42B 3GV8B 4CLUA 2PT0A 2ROPA 4ID5A 2GAGC 2J7WA 2VG6A 1M1HA 1SJ4P 2W4DA 5F8HA 4CLYA 1IBLF 4JI3J 1FDNA 5SUHA 3HHNB 1NBEB 4ECWA 2VG7A 2AGQA 7FDRA 1KLMA 5HJYA 5KFIA 2G0CA 3M8QA 3PJ9A 4QWDA 3HLUA 1NK5A 4DI6A 3FCHA 1YRTA 4CH7A 4DV2F 3IR6B 2E9RX 3QQCD 4CLTA 4O4GA 2E1AA 2DNYA 1UVNA 2X1BA 1JJ2R 1T9TA 3QO9A 3GFHA 4DCJB 2XQCA 1YJWS 5KFUA 2O1PA 2DGQA 1UA1A 3DYAA 3ET6B 3OFGA 3HFVA 2OPQB 2XLIA 1CQNA 2GS8A 5D77A 4CT8A 4ZIWA 1C0UA 1VRTB 5D78A 4KV8A 3W8GA 5KG6A 1B3TA 3LP2B 2XCAA 4ECYA 1Q7LB 2VONA 3D68A 4GO7X 2P6TA 2DH7A 3BPSP 1PBAA 3HZEA 1ZAXA 2OTJS 2MQMA 2EC0A 2B4OA 4LF6J 4NLSA 3M2VA 2M8HA 1RT3B 2OPRB 3JS9A 4B9UA 3L95X 1S6PB 1S79A 5E3QA 4DL5A 5IS2A 4PG5A 2GJIA 4C8MA 3UDEA 3QATA 3MMBA 3MMAA 5K8OA 1IUJA 3CD6S 2BANB 2WVEA 2F1FA 4FF2A 4QYZK 2BVZA 3RTVA 1K8AT 2UUAJ 5DDRC 2Y9HA 1K9MT 5A0YA 1J5EJ 1F5AA 3HHLA 2C2OB 4JI2F 4KT0C 1Q81T 4JOUA 1HKAA 3DC2A 2KJWA 1X9WA 4AQYJ 1FRMA 2XMMA 2FJWA 1U1OA 3GPAA 2CYYA 2QSWA 3DU5A 4F36A 3AY0A 2AWZA 2HHHF 1TV6A 4DV4F 1CEZA 1O5JA 2UUCJ 4WP9A 1LWCA 1JIHA 3IGNA 3O5TB 1S97A 1CVJA 1ZTWA 3H4BA 3QGGA 3QWPA 4ZVTB 4RR5A 2WW8A 2UXDJ 5H1SV 2W9CA 2V4QA 2H3EB 2QA4S 1ROFA 3TZZA 3ZTRA 1DZ5A 3S7RA 4C8ZA 3JSRA 4HI1A 2JLEA 2GVDA 2MKYA 2EI5A 2F4FA 3GZ7A 2ZWPA 3N5FA 4J9UE 2GIFA 4P7VA 3VHQA 3HO1A 2C2KB 3W62A 3JXOA 4RLEA 1FI4A 2YKMB 3CC2S 4PG6A 3FFIB 2E1RA 3D28A 4Y34A 1HQ2A 3FQLA 1Q8LA 3C15B 5HQLA 1MROB 1ZM3A 1X0PA 4K4TA 3SEOA 2G4BA 3VZHA 3S8SA 1TMMA 5AE1A 1SBRA 3PHTA 1X4EA 3CPWR 1EB0A 2CQ4A 3MM5B 3V81B 4CP5A 4WF9Q 4JI7F 4F26A 1SKSA 4QYRA 5AT1B 3MPYA 4K4WA 1IBKF 3MMCB 4QU7A 3EZ5A 2HFVA 4RW9B 3UD3P 4HR2A 3FRYA 1NHUA 3OFHA 2RQ4A 3QRPA 2R8JA 1IKWA 3UD5A 1R0CB 3TX8A 3MZIA 5LMNF 3N01A 5C24B 2IJFA 1NPRA 2LKZA 1YJUA 2VJUA 2A0FB 1ELOA 4DN0A 2DPIA 2B9YA 4C8YA 5BYSA 1N56A 5I3UB 2DGWA 4RW4B 2FVPA 3B8HA 1UVJA 1TKDA 4WFBQ 4PXEA 2IVYA 1EARA 3H7HB 2DRBA 1Z2LA 3UCZP 4O23A 1DY3A 2DR6A 2CNKB 4KGVB 1EKRA 3PO5A 2FY8A 2ZHOA 4UUWA 1VBKA 4OV1A 3T1AA 5AJ3F 2PA3A 4H54A 5EGYA 1H72C 2L08A 1NH7A 2U2FA 3HKWA 4YB6A 1P9YA 4OJ3A 2IM2A 1S72S 4EMDA 4M5GA 1S9GB 3K8WA 2R7XA 2ZOMA 2AYMA 2WRMA 3EDQB 4M1KA 4X4NA 4LR8A 2ZBQA 3I0SB 1RWXB 2KI2A 2RQKA 3B6BA 4R0JA 4CM2A 4KSEB 3MEGA 2LYVA 5DDQC 4OZ2A 2DO0A 4RBUA 1CC8A 4C2MA 1Y0HA 4U8VA 1U24A 3EGVA 4C0OC 1DURA 1SUQB 2BKOA 1NLKL 4LMZA 4UOFA 4KHMA 3VAGA 1UW9A 1Y5NB 3AD8C 2C28A 4RL1A 3JSYA 2BW2A 4LQ3A 2V8PA 3OJUA 4OHVA 3V6DB 2RU9A 4ZVEA 1KD1T 2N4CA 5IV4A 3QT8A 3BQ2A 3UQSA 1KN6A 4DR6F 1VBYA 3DRSA 1XQIA 1SH0A 2B6AB 2E29A 4LF9J 1FXDA 4YDXA 4F4AA 3P4UB 2B3TB 2BX6A 2ZUAA 3HFZB 5DM6Q 1M5HA 1N36F 4WFAQ 4KGZB 3CF5Q 3MPWA 4MFBB 2IMOA 1NDKA 2HMIB 4DV7F 1S77D 3DRYA 4JYAJ 1JKHA 3IS9B 1QJHA 2YKAA 3C3LA 4BBYA 2OPSA 5HANA 3M8RA 3N5BA 4EUVA 3R5BA 4U8YA 3W9HA 1UWAA 1D0EA 5M2RA 4ZCMA 4NCGB 1X5OA 4Q8FA 2XLJA 1NDCA 5A2QY 3G86A 1RT1B 1K0TA 2V94A 4OHXA 4USTA 4DPWA 4DL4A 4FF1A 1FDAA 3TZXA 4OX7A 3JYTB 3UDCA 4ED0A 2WHOA 1S57A 3P96A 1YIJS 4KH1B 2ZH2A 4K50A 1HWKA 1SQGA 1YKWA 1TKXA 3DLJA 2DNPA 1M5VC 4B3TJ 3FBFA 1DBDA 3T5LA 4C0HA 4C0BA 3SMZA 5CA5A 4PCQA 4N76A 2L3MA 5KT5A 3ZZRA 1UEKA 4DHVA 1HW9A 3IG1B 3MR7A 2ZC3A 2WK4A 2MGZB 1I94J 1WI8A 1J2VA 5KAKA 3RBEA 2CKWA 5K14B 2GNKA 2XHCA 3R5GA 3RU0A 4HTIA 1VCTA 2HFZA 3K58A 2CZ4A 5G0RA 1QTMA 4DPTA 4MKAA 1WKJA 4DFKA 1YG0A 1C1BB 3IM8A 3TQ1A 3SQGB 3KHHA 4P75A 4QIGA 1XNQJ 5T41A 4ZN3A 1MG7A 3D5MA 1FKPA 3W61A 2C1EB 1UJ4A 3IRWP 3PCOB 5H9EK 2FGOA 3LGMA 4ES3A 1RB0A 1VQ7S 8AT1B 3NBPB 5DQIA 2D9OA 2V8VA 3ZXWA 2V2ZA 4XDDA 4HHUA 1ACMB 4F67A 5EHHA 3Q86A 2DTJA 1TKZA 4TU8A 2HFSA 1UVKA 4FBUA 5A8KA 4IG3A 1TUGB 4DQIA 1KRPA 3RB0A 4RNOA 2CADA 2MQ8A 1U6BA 2DR8A 2EPIA 1VC5A 1EP4B 5DG9A 3KLIB 4OV6A 2F5GA 4JUZA 2KRBA 4TN2A 2LQ5A 1O0PA 1YI2S 3SDEA 3K57A 3I31A 1Y00A 7FD1A 5D8HB 2W01A 2VIHA 3QZ8A 4DL0C 2DT9A 5MAOA 2RNEA 5K20B 5KFEA 3G96A 1BQXA 4P2FA 4FYWB 2YKNA 3RJMB 3D7SB 4KO0B 2M0GB 2VL1A 1CBKA 3C19A 1X9MA 1SKWA 2FY1A 4C7QA 3BQ0A 2BE7D 4EYHB 2BJ8A 3FEZA 2OFGX 2RS8A 4YQWA 3D0IE 3Q8UA 5J1EB 8ATCB 4DFJA 4ZP8A 2EWHA 4PQUB 3HVTA 3IA0A 3TAMA 4I7FA 3N6MA 4CLPA 3FUYA 3BYRA 1QE1A 2MB0B 2PO4A 3BO3A 1T05A 2XMTA 2YWHA 3P6YC 3PFEA 3QYYA 3EUNA 4HYKA 3IRXA 4K5SA 5E3RA 3VAFA 4C8NA 2B7BB 1NK7A 4F4XA 4EBDA 2VOOA 5HN0A 4DR7J 1TK8A 2LP4A 2ZJQQ 4DR3J 4DU7A 4LSLB 4WFNQ 5E3CA 4JI0J 4WU3A 4J9MA 2C2DA 1CS4A 4WFXA 1K47A 1B4SA 3Q23A 2Q79A 2W8LA 3VVTA 3G8TA 1QAXA 3ZFVA 1N33F 1X4GA 1HNZJ 2CPFA 1HD0A 2RUSA 3LP1B 2AV5A 3HHEA 2AJ2A 3GG1A 1NHKL 2VBYA 4Q0BB 2GIQA 2CJ9A 3M30A 1AXQA 3UCGA 2B9EA 3M6VA 5KOXA 1SH3A 3TX0A 2ZBIA 3Q22A 2HWHA 2EW9A 1TAUA 3MOZA 2V9KA 2LU1A 2ILYA 3MR6A 2CDRB 1TVRA 3I0RB 1LW2B 2NCKL 3PW5A 3SYZA 1PG5B 4LSZB 4UQTA 1RISA 3BGOP 4ZVGA 1LV5A 3CMQA 3MM8B 5KG4A 1WEYA 3PZPA 1TUWA 1S9EB 2HQGA 1H7XA 2DNMA 5HROA 4DPUA 3T1YF 2V0NA 3OL6A 2JWNA 4OYOA 4UY8T 5D3GB 4TXSA 4CO3A 1WG5A 4ELUA 3J7Z5 2VFSA 3F73A 2JZ5A 3EM1A 4ECQA 3NOCA 2EVZA 2BJ1A 2W2QP 2FGCA 3PY8A 3HULA 3H90A 1P9QC 1T3NA 2DNOA 4GKJF 4KHPJ 4WXWA 4S0MA 3QT7A 3W9JA 1FRKA 2IM1A 4IYQA 1MMDA 1DFDA 3JAMY 1N32J 1CJKA 3BR9A 1JLFA 5KTQA 2ZHAA 2E1CA 2B0GA 2GA7A 2E5LF 4QIVA 1RCOB 1ZAVA 2PEHA 3VZIA 3CIMA 3L3CA 3RG6A 4NLYA 1JLEB 3MM6B 2CPDA 1PIEA 2HHTA 4DS5A 2VV5A 1MU2A 1NDLA 1U1RA 3UDVA 4PR6A 2MJUA 3K0JA 2DNLA 4EEYA 4A8FA 2EBGA 3K5NA 2RHSB 1KOOA 4ES1A 5KG7A 5LSLA 1B99A 4DX5A 1RP5A 3LTOA 2ZKUA 4C97A 4QWBA 3OLBA 1KOHA 3SQOP 3IFEA 5GMDA 4QPTA 1ZS6A 3CCRS 2R8GA 3A4TA 3OJSA 3HHLC 4WK1A 1RAIB 2C3PA 2QGFB 3TAQA 3AJ2A 3B4MA 4ICLB 3MCOA 4ECRA 3ZNJ1 1HBMB 1Q5YA 4CO0A 3DGPB 3WBZA 3TARA 4Q5VA 3KK1B 1LW0B 4ETZA 4USMA 3S01A 2E66A 2LMIA 4LBIA 5HO4A 4IH7A 1PBUA 1UZDA 1Y7PA 2AYGA 3N79A 2VD3A 4OMFG 3QRRA 1KC8T 4LF5F 2BDPA 4GVLA 2CUYA 5DG8A 1R7IA 5A8WA 4WZQA 4JI2J 2R8KA 2F65A 1I3OB 2AJ1A 1YGYA 2PA8D 3NCQA 2JEGA 2RILA 4GRSA 3J7YI 2UV8G 2FHOB 3RW6A 2HHHJ 2Y3YA 4DV4J 5J2NB 4NYPA 3KG4A 2ZJRQ 3THTA 5ITHA 5LMUJ 3LP0A 2DNNA 4PPZA 3UR0A 4HL9A 1FFWB 1HW8A 5KFKA 4DV0F 4ED8A 1HHTP 3ZNUA 3NGUA 1TL3A 2HRUA 3DOLB 2LVWA 4OZJA 1BC6A 1O8BA 3EVOA 4A8QA 5LSOA 5FDLB 2EFOA 2P6SA 3LAMA 1TP7A 4IQXA 5DQGA 5T7LB 3W63A 4C11B 1PGZA 3UNYA 1WF1A 4K8RA 4B3OA 4DDFA 4DZDA 1H3DA 4J9SA 5KOWA 5DS7A 4NOHA 4XIUA 5A2QU 2VF3A 4MTPA 2CQ2A 4U7CA 4J91A 3QIPB 4WXOA 3JSBA 2HNDB 2RSQA 5F41A 4JI7J 3MF5A 2NPFA 3MEEA 4ZPWR 3V4IA 1DTTA 1IBKJ 1UETA 3M7VA 1X31C 3DLKB 5J2MB 3MPVA 2L9NA 4EK2A 1R89A 1RJJA 2B5JB 3NCRA 1Q8BA 5B0BA 2W4CA 1BLUA 4KHRA 5LMNJ 4WFZA 4AYBD 2JVOA 3DOMB 3P3DA 2N3LA 1VC6A 3NWRA 2W8KA 3DN9A 2DR7A 4WE1A 1UL3A 4F4ZA 3R1LA 5I42B 3CC4S 1QM9A 4AL7A 3I6PA 5SZTA 2U1AA 4ZPDA 1BE4A 1R6VA 4ZVQB 3OR2A 1JNZB 2IYGA 5AJ3J 4Q2LA 3CIZA 1HBUA 2HFOA 4PABA 5EWFA 2DGTA 3FBCA 1N5QA 4USIA 3DNCA 2VDIA 1YVFA 2CNLB 5DGBA 4E8UA 1BQNA 3I4PA 1IR2A 4CO1A 2UUBF 1FVQA 1BUXA 5BXIA 3PDNA 3G71S 1D9DA 2IC3A 3SSRA 4MYUA 4LF7J 4IUFA 3CCLS 1IM4A 4W98A 4Q45A 4DV1F 2AEFA 2E5IA 4FXVA 1S0MA 3H2LA 4P2XA 2P2CB 2QEXS 6FDRA 5HMWA 4OJ1A 4DLGA 4LBHA 5T14A 4RKUC 2QL9B 3QT5A 5L1KA 3CT9A 2X1AA 2K3IA 1XEZA 4DR6J 1IVZA 5D4OA 1JLBB 4ECVA 4L3NA 3UE2A 3FCVA 5CCMA 4DQRA 3JSMA 4RW8A 2QG9B 4JI4J 3UN2A 1N34F 4B9SA 2LXUA 2WOMA 4MIBA 2J9EA 2EFGA 3RW7A 5JUMA 3NS5A 4DV7J 3KK3A 1JLGB 1YJTA 3VALA 3OSNA 2BEFA 1FCAA 4DR5J 4A8XA 2Y1IA 4Z7YA 3HVAA 2LQJA 3RBXA 2FZCB 4ILRA 1IQTA 2ADBA 1VQ5S 2QLFB 4H4MB 2HVDA 1MWZA 2YQ0A 2PI4A 4MKYA 4PXBA 4DL2A 4IO9Q 2A3JA 3BGLA 2ZC4A 3B4DA 3L9ZA 4LQ9A 3J7AN 2ZZNA 1NKEA 2HRYA 2N4DA 4IG0A 1JJCB 1QD1A 2HHVA 3PTWA 1FXRA 4ES2A 4PUOB 2XI2A 2HYIB 3KXDA 4DWIA 1N88A 1RADB 1G2EA 3VR1A 1BWVA 2XG8A 2YWFA 1Y11A 5IOLA 1UJ5A 1HL6A 3K17A 2W9BB 4DV6J 1RT4A 3CW2C 3P49B 3VAIA 2DNKA 3PV8A 3BBFA 1SJ1A 4RNHA 3IC1A 3R27A 3T19A 2Z2ZA 2CJBA 2PE8A 2MPUA 2R7VA 1X8DA 3CEDA 2NQPA 4U67Q 1T9UA 1CG2A 1RHJB 1IKVA 5L9XA 3OW2R 4K0KF 3M32B 5G4DA 4JI5F 3C6UB 3E3XA 1FEEA 5KT7A 4DCOB 4DFPA 2NREA 1JLQA 2VC0A 1M5PC 2M3DA 2BA9A 1BMQB 1FRXA 3GE9A 1IN0A 2XSJA 3GJSB 2AMCB 4GO5X 1SJQA 1FWPA 2AT1B 1XR7A 2YNIB 3M4XA 1LQ9A 5EDWA 1RT7B 2BE2B 3G82B 5IWAF 3ZZPA 4YUDA 4AXIA 2JSXA 4A8MP 3PFOA 1HLWA 2D3O1 2F8MA 1X5SA 1HHQA 5CD4A 2ATCB 3QFHA 2DPJA 4NA2A 4C3LA 1R6YA 2VA3A 1VIOA 2LXFA 1FFSB 2G2ZA 4BWJA 1SC6A 4HHJA 4MIAA 3I96A 1C0TA 4QOTA 3T3FA 4ITSA 3I9V9 4DFMA 2ALYB 3NEKA 3RZAA 1NJXA 4HKQA 1REVB 5F3TA 5IXUA 1GMUA 4YB1P 3EE3A 4X65F 1JQGA 5KFRA 3A12A 1QTNB 3MM9B 2XMWA 3RAMA 4Y2AA 3JAMU 3V4MA 3PIOQ 2BQ3A 2DGVA 3MAQA 1U1QA 1TL7B 2KZMA 5KG5A 4QIFA 2K06A 3BS9A 3F44A 3R6GB 1MSWD 2CFXA 2CZVC 1NJZA 2DGUA 5D4PA 4BWMA 4OLOA 3J7ZT 3MFIA 2VQFJ 3CCTA 5KFNA 3TW0A 3LQVA 3L7UA 3H8YA 3KLGB 5ETKA 4R8UB 4DR2F 1YJNS 1YQHA 2HWIA 2CVEA 4LF8J 3MMJA 1HMVB 2C3MA 4HDGA 5F9LA 3CO9A 2KT2A 1WTFA 2H48B 4OZ0A 4JI3F 1JJHA 1ITPA 4ATNA 3RR7A 4LRFA 4EZ6A 8RUCA 2YNFB 3D67A 4DUTA 2MTLA 3AA9A 2D41A 1LFWA 1CQMA 3A3NB 3KK2A 4YFUA 5HBMA 1C1CB 3TR5A 3NS6A 3K5MA 1Y9OA 3BO2A 1D8ZA 1WHWA 3TVYA 1RT2B 1RDRA 1S1VA 3QAUA 1Z1ZA 3VTIA 1MMNA 5ETLA 1RQ0A 4Q8EA 4H4OB 1K1QA 1IKYB 1TL5A 2OEMA 5JJBA 2JRSA 2CQBA 4NI2B 4KTQA 4N8NA 3RR8A 1V5IB 2VZ9A 3Q2SC 5C42A 3NS7B 3H5SA 3K59A 5IC4B 4FNHA 2KJVA 5IT4A 4IRCA 3R5JB 3RBDA 3W1YC 1YHQS 4RBVA 4E0DA 4DR1F 4NXMF 4RPFA 1B64A 1D9AA 2H5IB 3D54A 2YWGA 1N33J 4R0EA 3N6LA 1S59A 3PHEA 1HWUA 3FSXA 3SSQA 3T9ZA 3AT1B 2BJ9A 2P9EA 1MN7A 4WKRA 1RKIA 1JLCA 3QIDA 3D1OA 1XTZA 1WOOA 3LO3A 4FP9A 5KT2A 4A46A 4AD6A 3DRRB 1FDBA 2XMAA 2XSFA 1SVDA 2OSQA 1NEEA 3D6TB 3G4SS 3CDAA 1KQSR 5J2PA 1FJCA 4EFAC 2PFFB 4RUBA 4J9NA 2KTQA 4O3RA 2UZAA 2YPYA 3CWJA 3I56S 3FK4A 4CH0S 2XY7A 5IM0A 2CJQA 1J5EF 2OPQA 2KYZA 3OR1B 1A0OB 3BGRB 2IY5B 1AB8A 3T1YJ 3I32A 1VRTA 1SIZA 2VPYB 3OVBA 4OYZA 1AFJA 3LOUA 4AQYF 5JVHQ 1PYSB 2RIJA 4CLSA 3WHIA 4O44B 5E41A 1KTVA 1RLCL 4NA3A 2IRXA 4JI6F 5GMKa 3HSGA 3ETMA 4J9OA 2MZJA 2DCUB 4ID5B 3I5BA 1N8RT 1QDUB 2OD4A 2WTFA 1RT3A 2OPRA 5FLXU 2CPIA 1S6PA 3AXMA 1VQ6S 2IBOA 3KLVA 2AW0A 2UXDF 4WTYA 2E5LJ 2V2QA 1JX4A 3KJVA 4DCPB 2K1RB 2CJKA 1FXLA 1TUVA 3CXCR 5KT4A 4QCLA 3C46A 3VGSA 2EK1A 1TL1B 1YJ9S 1F5CA 4OI0A 3UWTA 3BEGB 4CRJA 1IJFB 1HNVA 3TWZA 1GXLA 2ZOFA 1OJ4A 4RWXA 1YTYA 4HACA 1OSDA 2IDEA 3LF0A 1BGXT 3FGVA 2HHQA 1K0VA 4DPYA 4I2PA 4A8WA 4LT6A 1RAHB 3QO9B 4TY9A 4XPEA 1KLNA 3G6ES 1M0SA 4NLDA 4DSLA 3PO4A 2A10A 2R8IA 2K7KA 1YK9A 3DYAB 1Q7YT 1P1TA 4ZN1A 3CDEA 2CAJA 5EUHA 1KKHA 2XLKA 2KFZA 5C25A 1Q8KA 4OYPA 1N0VC 3WC2A 4O3PA 1R0AA 1WOSA 4I64A 3UVJA 1NK8A 3NAIA 3QJJA 2YKQA 2FD2A 2MZQA 2OAUA 5KFZA 1S4EA 4H4KA 3O8WA 2HQIA 2YKPA 1KQGB 3NGKA 2J6SA 4TY8B 5KFXA 4KYZA 4J5OA 4OYWA 4NZ6A 4K4ZA 3PRDA 4NLUA 2QMXA 3RB6A 3HSJA 4FNIA 2HK2A 3FFIA 4LRCA 3NGRA 2WVFA 5ADZA 1MROA 4FPIA 2QFIA 3CJKA 2XO7A 2RU3A 2RDDA 1QVFR 1P1LA 4YS2A 2JHEA 3WX4A 3EPIA 1RGVA 5A0YB 2HPUA 2O01C 4QWEA 3V81A 2CQPA 1FWLA 3FCWA 4MK7A 2C22A 5L1IA 4IRKA 5LXRA 4RW9A 3DLLQ 3K7RA 2YKOA 2ZWOA 3DHWC 4EYIB 4FKXA 4WP8A 1WF0A 3M9NB 1L3VA 2ZNZA 3U02A 1TV6B 1FJGJ 3OQ2A 4LSNA 2OMOA 2V8GA 1LWCB 2FVRA 3WZ0A 2HAFA 5AXLA 1VLOA 5HVGA 5KT6A 4DR4J 2GMHA 1ZM4A 4CT9A 1LWXA 2DXDA 2RH3A 5I3UA 2FJDB 2F8EX 2UXBJ 1GK8A 2YH1A 1H73A 3KFWX 2AGOA 1OWXA 2GVDB 4TKTA 3MR2A 4PXDA 3J81U 2IM0A 2E5GA 4ZOSA 4X4VA 2ZH1A 2OHDA 3PEHA 2XY6A 3BKUA 2HIQA 1I1GA 3FSYA 5JMNA 2IAJB 1RYRA 3DLGB 1G1XA 1RWKB 3KOAA 3AH6A 4HDHA 2V4RA 1RAEB 3LWLA 4FXDA 4B3RF 3CVKA 2OEJA 1BWEA 4JYAF 3GWCA 2FVQA 2GFFA 5H9FK 3UR3C 1SUQA 2XS7A 3BDPA 2XNRA 4OIXA 1QVGR 1CLFA 3MUVP 3OLAA 4EZ9A 3ZTOA 2WSFC 2CA9A 4ZVPB 2R2RA 2J6UA 1UVMA 3BJYA 2CVIA 4JI1J 1T02A 3Q8YA 3IR7B 5L46A 4JBCA 2RRBA 2RAQA 4L72B 2YWWA 5HL7Q 2B6AA 2L48A 3DLEA 2RT3A 2IRYA 2LLZA 2B8PA 2NUHA 5E2QA 3MEKA 1JLAB 3W2VB 5GAHI 4DL3A 5K8NA 2D3UA 2HMIA 1R31A 1FO1A 4B3TF 3CB4A 3BH6B 3NNCA 3JTOA 2AZ1A 2W24A 3C66A 3TOQA 2VHGA 4CI0B 4F2SA 3C16B 2XS2A 3U1NA 1PILA 2RMLA 1GH8A 2EXUA 2GHVC 2J0QD 4F04B 2YY3A 3IAM9 1LKZA 2XO6A 2UUBJ 1OPIA 1I94F 1S6UA 3WC0A 1ZZNA 1S1WA 2MKSA 1ZPWX 5DZ6A 4NCGA 5DM7Q 2DRDA 3C14A 3KDOA 2C3UA 3AB2B 4YEAA 4LRAA 2WCXA 3AHPA 1C4CA 3JYTA 4WTOB 3H98A 2FJVA 4A4JA 1XNQF 1LWFA 2K7JA 5CHCB 5B09A 3ZZUA 5KFHA 4URGA 1PC4A 4FKYA 3U1LA 2IHR1 5J2QA 2DNZA 4O3NA 3M05A 2DISA 2H51B 3PIPQ 1TL4A 1V3SA 1N34J 4A48A 2OI2A 2ILZA 3IG1A 3DRSB 9RUBA 1H6KX 3TEHB 4G1IA 2MGZA 2J9DE 2FLNA 4OJHA 1G6BA 3B78A 2QYCA 1NM2A 1CJVB 3SIPB 3ITHB 4ED7A 1U48A 4OJGA 2GZOA 2R7TA 5DQHA 5U47A 4OQJA 3TA1A 3K5OA 3MWBA 1X4CA 1C1BA 3DRPB 1S1XB 1VK3A 1FD2A 3SQGA 1LWEB 2C3YA 1YBAA 3LPEA 2OPSB 4DMZA 1R8PA 4FF4A 2D1CA 4A47A 3W64A 3MCSA 2ZJPQ 3DRXA 2C3OA 3NBPA 3CJRA 5EWGA 1BY9A 2VPXB 1S99A 1NZ8A 3JTPA 3FBBA 2CG4A 3CCQS 3MAHA 4IDKA 1ZTTA 2ZOGA 2KG0A 4TYBA 2DIUA 5KFYA 1RT6B 4HEA9 3T5JA 2KG1A 5LM7E 2R8HA 4DSFA 2ZD1B 3W60A 4K0KJ 2ZUGA 4C3KA 2I9SA 5DG7A 2MLZA 1X60A 2OP5A 2N82B 1EP4A 1I5OB 3LPYA 3CCUS 4KQZA 4HHHA 3QLHB 2G1DA 1HQUB 3HXMA 4NXNJ 2D69A 1NK0A 3MM7A 5LJ3Y 1S1TB 2VODA 1VDHA 4K59A 5CYQB 2ZNYA 5IWAJ 2LQBA 3U1MA 3HT3A 1SC3B 1WUUA 4DR3F 5G0RB 4LRDA 4KO0A 4P72A 1V9OA 2E5HA 3KLHA 4P10A 4JI0F 3GSDA 1DAXA 2RQMA 3I55S 5J1EA 5D6GA 4OYXA 2VUGA 1FK9A 4K2JA 4OZ1A 4ECTA 2KXHA 1RHMB 3PW7A 2KL8A 3IBFB 2YNGB 1HNZF 4ZIVA 1WG1A 1S1UA 1YZ6A 3TUZC 3LGNA 4X65J 1HI8A 4OHYA 4CYUA 4IFYB 3MD1A 2F40A 1RSCA 4CH1A 1ZYQA 1TKZB 2MJNA 4USWA 3BF4A 1V5VA 1Z4UA 2GCFA 2QSFA 3T6BA 3BSNA 4FPRA 4IG3B 1RHUB 1N52B 4RUAA 1HPZB 1SL2A 3FNNA 3FJ2A 2R3VA 5LSRA 5E5NA 3ETOA 3CDBA 1RWPB 4OX9J 1GMWD 3IM9A 4J9RA 5ETQA 1EQ0A 4J9LA 2G0IA 2FUG9 4KAIA 4DR2J 1M5SA 1A6LA 5ETSA 5LXYA 5KFFA 5HMZA 2LFVA 2BW7A 4Z37A 1WDDA 4OHZA 2I5JA 3KNGA 3LP1A 3HK2A 1U47A 3MECA 3KLFB 1FDDA 4Q0BA 2VG5B 2VH7A 4KHPF 4NLVA 3W2WB 5ETRA 2YXLA 4I2QB 2Q6BA 1ZH5A 2DB1A 1EZZB 3C6TA 2HHXA 2MSTA 3VWSA 2QLJB 4MKBA 2XBPA 4ZHRA 4X2BA 4OX8A 4ZITA 3H25A 3SI8A 3EJMA 1N32F 2R2TA 1HYSB 1H74A 1YJ7A 1YWXA 4I7FB 3I0RA 3POTB 3W65A 1L3TA 3GYGA 2Q66A 1N5YB 3V5RA 3AB4B 1FEHA 3PX4A 1UKUA 3H42A 3MM8A 4U96A 4YY3F 4RU9A 4UOGA 1S9EA 4N47A 3E2EA 3K8VA 1QAYA 1EKSA 4IR9A 3D3CJ 1U7LA 3SZ2A 2AHOB 2F63A 4TQRA 3RB4A 3GCXP 2BRKA 1YRXA 4F0MA 3FMBA 3QNWB 2CJXB 1WC0A 3BSOA 3FQKA 1Y5IB 2HGLA 3VF0B 1X4HA 1Q8IA 3DHXA 4DR1J 2OIHA 1YDLA 4NXMJ 3OXLA 4Z7CA 2FJEB 5HAOA 1WHYA 4URQU 3THVA 4RX6A 4UTGA 3X3UA 4MT1A 4J9QA 3RRHA 2IA0A 2F4VJ 3K89A 3ZZZA 2CNNB 2VJVA 1JLEA 5ETOA 4LFBF 3MM6A 1HR0J 1VQPS 4I67A 4F4YA 3SFUA 2ZFHA 4TU7A 2K3KA 2O3DA 1HNIB 3HZGA 1Q78A 6AT1B 2HHWA 3H5XA 2YX4A 3DLHA 4AL6A 4DV3J 1NKBA 4O3QA 2DD8S 2HFUA 1G7CB 3QGHA 1RTIB 2D74B 5KG1A 2KO1A 4F3QA 2ZDOA 2OLWA 4B08A 2HBZB 3NY0A 3EX7B 2C2RA 1EIYB 4EO8A 1EHWA 4QIEA 3A8KA 1Q79A 4JI6J 1R27B 4DG1B 2GVZB 2E5JA 1Q53A 1WSRA 1XERA 1S6OA 3QT6A 2MY8A 2BKNA 4FZVA 5LMUF 5CXTA 4ZA1A 2FQQB 4UY85 4N56A 1HBMA 4ELVA 3DGPA 2HGNA 4RNFA 3KK1A 1LW0A 4ETXA 5IC6B 2APOA 1X7VA 2VFUA 2W1BA 2CQGA 4QWAA 1TQLA 1HBOB 1N6QB 3EZUA 1T03B 3M1VB 2MY7A 2NUUG 3HD1A 4TQSA 2UU9J 1UVLA 1CJKB 1CPZA 4PEOA 4J7CA 3RAXA 2KHDA 3Q2TC 2W2NP 1RLDA 4KGMA 2XWXA 1IJEB 3OXGA 2W25A 4ZLNA 4GKKJ 3CCZA 1U0HA 2M7SA 4H4KC 1D9FA 1MU2B 3BKTA 4M63A 2WONA 2VFRA 1U25A 5J2NA 4F0HA 4Y2CA 2DGOA 2B4UA 3F56A 2V50A 2ACMA 3FC9A 4FYDA 3GJRB 3UW1A 3EICA 3W5XA 2YQ3A 2E1MC 2DY1A 3MCNA 1Y5LB 1XNRJ 3BN7A 1SJRA 4V1Ak 2G2OA 3U7JA 3DOLA 2J0WA 1VISA 3EMTA 2Z30B 2RD5C 5FDLA 4P9SA 2H5EA 4MH8A 5DRKA 1XMBA 2B9WA 2BJEA 3VV2B 5T7LA 5IT9Y 2N3OA 5DETA 5E3AA 1OY9A 4C11A 2FPHX 2C42A 3CD7A 4HT5A 2AJQA 3NXZA 2JFKA 2XEXA 3H0PA 1EETB 2QA4G 4QR2A 2IDLA 3R7BB 2B4VA 4WIIA 2DH8A 3IO1A 3TYTA 5L8RC 4BC7A 2BQRA 2IJNA 3MPDA 1F60B 1LK5A 4URSA 1NO8A 2HNDA 1WD6A 3CDWA 3TUJC 1NSAA 1OMSA 5KG3A 4ZP6A 3GYNA 2MDAA 1WHVA 2VFVA 2DHGA 1CJUB 2XMKA 2M2BA 3DLBA 3GIJA 2MKKA 1AZSA 3NKYA 2B9XA 2B5JA 4J9KA 4IFVB 1R8AA 4ZVSB 3R8YA 4WBFA 2Z2YB 3X1LB 4FYXB 1UJ6A 5B0CA 5EWEA 3B82A 3KLEB 1IWGA 1VQLS 4X62J 1CC7A 1TELA 1APSA 3CCWA 5HLFA 4LF7F 5B0FA 5I42A 5I3PA 2X3GA 1NJIT 2PDAA 2GJFA 1TL3B 3T1HJ 4ZPTR 2MQLA 2BR0A 1CULB 2NXNA 1UTAA 4QJVA 2BQUA 3ZZ0A 3MUTP 3CJ2A 4CLZA 2XM3A 3CMES 1NAQA 1RAGB 2NR0A 3QGPA 1N54B 2V2VA 4ED5A 5F8MA 4FXWA 1LXNA 3CJ5A 4JP8A 4JI4F 2NXEA 4DX7A 1U1KA 1MLAA 4NEYA 2XULA 1IBMJ 3CJSA 1MNEA 4OZ5A 4B3RJ 2ABYA 1WI6A 1T9VA 1DTQB 5FIIA 4BHQA 4DR5F 3V4IB 1DTTB 2ZH5A 4IQMA 2JC1A 3JTNA 4FYVB 1VQYA 2W7AA 3O44A 2R2SA 1WKLA 1PSDA 1HNXJ 4PG7A 4AFFA 3E01A 3D9BA 3KG1A 3QWUA 4JB8B 1QAJA 2HNZA 2Z0GA 5I3QA 4AL5A 3HM9A 4DUYJ 3SCIE 4DX8H 2QMWA 1NRKA 1JLBA 2W2MP 4XK8C 1UWBB 1SJFA 3G8SA 2OPPB 1NJYA 2V68A 2XGPA 2Y1JA 1ZPVA 4DV6F 3TEGA 2KFNA 2DHSA 3AJ1A 3AQPA 4BDPA 1S6QB 1MMLA 3GSIA 1JLGA 1FFGB 3J7YU 5B0DA 1BQMB 3TZYA 2V4JB 3BN4A 3PKYA 1N5SA 3EGWB 3G6XA 4XPCA 4O0IA 2HNYB 3IN5A 2VQEJ 1LK7A 3ENQA 1GX5A 3RB3A 2XB2D 3UD4P 3M2UA 4ZVRB 3CJ4A 1IBCB 2X3DA 1J5OB 1AUSL 4P74A 2G2YA 2XZDB 1M5OC 3KTQA 1E6YB 4PUOA 2RJZA 2J8SA 4B3SJ 1NXIA 4ALZA 1K1SA 4DSEA 3DOKA 2MQPA 2DR5A 2HVIA 2DHXA 2LDIA 2GGPA 3G6YA 3J81j 4HH1A 2EG1A 2W9BA 2BE9B 2RRAA 2IM3A 3P5BP 3AD7C 4QU6A 2ZVSA 4NLOA 4IR1A 1VHFA 2FVCA 4NRUA 5MLCV 2BMBA 4RW6A 1F2GA 3WIVA 1YRUA 2RB7A 2AJFE 2RRNA 2L41A 2LCWA 4J37A 3F0NA 4IOCQ 3C6UA 2VPWB 4KGKA 3JSMB 4RW8B 5K8MA 1U02A 3ZTPA 2ROGA 3CCVS 2HS4A 3VGVA 2YX1A 3RRGA 2HQFA 4X64J 4IRDA 2OO4A 5L39A 4QW9A 2YNIA 3UDLA 3R6LB 3V6JA 3FVYA 1TFWA 4R25A 3CUNA 3G82A 1FNXH 1YLXA 4F4KA 1S49A 2N7CA 5A6WA 2OELA 2ZEJA 1L3UA 3A8IA 2OEKA 2E7WA 1WORA 2VQFF 4WIQA 4ZJQA 1M1GA 5GAEU 3K5PA 2R7QA 1OY6A 3CMAS 2EKYA 1GEHA 4IKAA 4ZVOB 2Z8QA 5EX3A 4MK9A 3NGDA 4X66J 4NPOA 2QA1A 4ZS6A 3GFYA 2HS0A 1TK0A 4LF8F 1SH2A 4MMOA 2BJ7A 3FBEA 1SL1A 2WBMA 1WHXA 2FTRA 5HI7A 1REVA 3KJFB 3HKZD 3PG9A 3L7PA 2JNJA 3WDOA 4ZCLA 1KP6A 2VU5A 2HAIA 4N7TA 3CULA 2EKNA 4L75A 3MM9A 3BQ1A 4IOBA 3CJ8A 1FVSA 4KPCA 3EPGA 1VQSA 2ZVIA 1RI7A 1NB2A 2X1GA 1WEZA 2EFVA 1RHKB 2W2OP 4N77A 2R7UA 2H9ZA 3P8BB 2AJ4A 5IQQA 4OYIA 2I2YA 3OUYB 5KFVA 1OPZA 2IPOB 4YR3A 3JQKA 4R8UA 2XSJB 2NYHA 4OZ3A 3NWGA 3QMQA 1UPMB 3OL9A 3GJTB 9ATCB 1HMVA 1OSCA 1KFDA 2BBEA 5KFOA 3G6VA 4I6WA 3GIMA 1U26A 3A13A 4NZ0A 1X5TA 1NMEB 2CPYA 3TA0A 1I6JA 1KQKA 4NCBA 2A2CA 1S9FA 4YB5A 1R8HA 2YQ1A 4K4UA 4NEZA 3W66A 2XC9A 3MR5A 2GX8A 3AODA 1WSVA 2YNFA 1IM6A 2GMJA 3OTCA 1HARA 3DXBA 1GMWA 1QSYA 1Q0NA 1VQ9S 1PYOB 1M1KT 4I6AA 1UP1A 4USJC 4PG8A 1C1CA 1B0VA 4QZVB 3TANA 1YITS 3Q8PB 2WB4A 2RF2A 1Y10A 4H4OA 1IKYA 4J9PA 2D3ZA 1RU1A 4B3MJ 2CQDA 4X4UA 3PJXA 4NI2A 4WPAA 4D3HA 4X4OA 5J1NA 3LGHA 1PCAA 2CDQA 1OQ6A 4A8KA 1VQMS 2EK6A 4DS4A 1DLOB 1FTCA 1M5KC 2OH2A 2LXIA 2ZBPA 4RU2A 1IKXA 2X7IA 4MAKA 3UI3A 2QA2A 1QSLA 2KM8B 2VA2A 3FMWA 4KIAA 2ASJA 3ONQA 5A8RA 1WC5A 4R5PA 1P8GA 4K5RA 2ACYA 2HS3A 4WWSA 3Q8QB 4RNNA 4UQGA 5C2GA 3PNIA 2RUGA 2ZM6J 5CYMB 3MURP 1H0HB 2UVVA 4C8KA 1VGYA 5DZ7A 4YMEA 2UXCJ 2N7YA 3ZZOA 1R8BA 2RDIA 1KTQA 1RYSA 5E7OB 5DGAA 3IMQJ 4Y3CA 3SBMA 4HT7A 4YY3J 3WIUA 2DCLA 4GC6A 2JOQA 3PW4A 3OR1A 4UZBA 3BGRA 1N48A 2NXJA 2J0XA 1HFEL 1HA1A 3PR5B 3KDNA 3Q0AA 2HIYA 3GFXA 3CJQA 1N0UA 2BOPA 2WAQD 4L6V3 5C5JA 3EGNA 1E6VA 1AUDA 4CNYA 2E44A 3H59A 3JQJA 5HVFA 3OTEA 2JEIA 1ZETA 3O3LA 3GV7B 1R3NA 4PQAA 5KFBA 2VB6A 3GR0A 3MAAA 1VFJA 4CM0A 4Z2XA 2HVEA 3T5KA 2UVWA 3M8PA 4MKVA 5D4NA 5EN1A 3ULHA 2OSRA 1HWIA 5CAAA 4IH5A 4NE9C 4UUXA 2K1RA 4HH0A 4C9DA 3DI6B 1FE4A 3RGIA 2VBXA 4A8SA 3QRQA 3MDFA 2Z2MA 4LFBJ 1JLCB 2HEKA 1TL1A 2R4FA 2EG2A 2BZ2A 1OQ3A 2CNOB 4ZPCA 1URNA 1AT1B 1EAYC 4E2FB 1S48A 4LR9A 5J2PB 2Y8YA 2Y1LB 2VBWA 3LA0A 5DJBA 1W2IA 4M5HA 4J9VA 3UPFA 2KXNB 3M8SA 1PAEX 3QBCA 1FJ7A 2QLBB 5IM0B 4LREA 3HCXA 3LALA 2BACA 3NGTA 1SJ3P 4KFBB 2LEAA 4CIOA 3H20A 2GV1A 2QRRA 4CQ1A 2W9AA 1IWAA 3FEYB 2BYCA 1VJQA 1L3SA 2QFJA 2X1FA 4ZPVR 1U6ZA 4TY8A 1FJGF 4DEZA 3EGZA 1RXOB 4NL5A 3DM2A 2M52A 3G2XA 2YWEA 1P27B 2VASA 4CTAB 2GQCA 5D0RA 4DR4F 4CNZA 1AW0A 3M8WA 4DV5F 3VQTA 2UXBF 1FA0A 3KJVB 2BXJA 5HK4A 5BJRA 3GLJA 5D0GA 3ENVA 3V6HA 2KRRA 3MD3A 2POKA 5LOQA 1Q16B 2ZHBA 3R5CA 1F6TA 1JNRB 2HWTA 4NZ7A 2IVMA 3HF5A 1GXTA 1HNVB 4D3GA 1VQ4S 1FE0A 1FT8A 4RZRA 4HACB 5CD4H 2MLYA 1W26A 3Q8SB 1NHVA 4C98A 1S76D 3BGFA 2IBKA 4I2PB 4DL6A 3OPKA 1W25A 3CD5A 1RKJA 4HTJA 5HMXA 1HQEB 2HK3A 4AXJA 4NMLA 5B0AA 3EXCX 5C25B 3OFFA 5H9FJ 1R0AB 1WC3A 3H5YA 3UVJB 2LA4A 2AD9A 4DXLA 3UCUP 2RKIA 1F3VA 1ZM2A 4YR2A 1KVJA 2JVRA 1V3RA 3D2WA 1KNZA 4JI1F 1ICEB 5GAEI 3MHYA 4QR1A 3W5ZA 1Y4ZB 4UF4A 3HMJG 1KSPA 2ROEA 4ZCKA 2HLTA 2K2PA 2AYBA 4LIRA 4G1QB 3PACA 3VQSA 2A6OA 3CJKB 4B9TA 4TLQA 2IAJA 2QX0A 3DLGA 1S7IA 2YNHB 2Q43A 4ZKAA 3PX6A 2QJ3A 3QAEA 2V6AA 2ZZMA 4A8OA 3HPOA 1D3WA 4FBTA 2V5HG 3AFGA 3R7SB 2DGSA 2C2MB 3JQMA 4HVZA 4OYAA 3QSIA 4P73A 5K8PA 4ZJOA 4B9VA 1QUPA 3NMRA 1UA0A 1FX4A 2JX2A 4GVBA 4PG4A 2DHAA 4Q2MA 3ISNC 4DUZF 1WWHA 4ED6A 2VC1A 2KH9A 2J7KA 2MQQA 4LSNB 1GT8A 4KKOB 3SXLA 1SC4B 3TZWA 5E0OA 1GTEA 2FZGB 3NG8A 1RTJB 2K8GA 3US5A 4EI2A 3D4JA 2CWXA 2ZE2A 4C48A 1WELA 4L74A 5ETVA 2UV8A 2WB1D 3PXGa 1JLAA 5F0UA 5BR8J 4FVMA 3W2VA 2G13A 2GHPA 3EVWA 1L5UA 2M4MA 1RACB 1URRA 3TA2A 3MEDA 3C16A 3VAKA 4USVA 4ELTA 4LFAF 2VKRA 5ETPA 5D15A 1C2PA 2XWYA 3GQCA 1VK8A 3SFGA 4LRBA 4ANCA 4RUCA 1X4DA 2NS1B 3QZ7A 1LOUA 1SCJB 1SQFA 4F25A 2NYIA 1RU2A 1SKUB 3CC7S 1RAFB 1VQOS 1RTDB 1RTHB 1WTBA 1JK9B 1HBNA 4L3KA 1PJ5A 1REGX 4ED3A 2F8HA 3OFEA 3IBCB 2B43A 3CO0P 2QLXA 2IA6A 2GO8A 1SB6A 3ADAC 4F02A 1F9FA 2AX1A 4PKDB 3EYZA 2R7SA 2AJ0A 4PWDB 3RRKA 3SSSA 4RW7B 3W5YA 2JDJA 3N4WA 3HSDA 3DLEB 1CJVA 2KVQE 3ITHA 4YOEA 3PX0A 2I1RA 3NAHA 3D6FB 4OZLA 4QWCA 2V63A 5KG2A 2PN6A 4DF8A 3DMJB 2DYAA 2IVFB 3KYLA 5A76A 3DRPA 1S1XA 4JI8F 1D1UA 2YPZA 3NNAA 1LWEA 3S1TA 2H65B 4NXNF 1HNWJ 1WACA 2AQ4A 4NYZA 4M5NA 2AF6A 1FRJA 1D8YA 1S1WB 3VGTA 4BCAA 3SV3A 4G6VB 3IXQA 1XMOJ 2FJBB 4KBIA 3G87A 2DEJA 5KFQA 2KU7A 3AXKA 5HMYA 1F5BA 5HP1B 3BM7A 1WC4A 3C14B 3GCWP 4O0NA 5K9FA 2B8QA 2WZ1A 3N6NA 2QV6A 2AU0A 4XAKA 3IWNC 4QBUA 1RT6A 3DXSX 3BYPA 2XS5A 1KWMA 2LDYA 2V69A 1LWFB 5KFMA 4CO5A 2ZD1A 1HIYA 1NDPA 4QQBA 4NLRA 1GXUA 5J2QB 2B4PA 1WC6A 3DKDA 4U9RA 3AAWB 3KWMA 3GU0A 4I0WA 2ERRA 3OTBA 2E7VA 3OT9A 3QLHA 1IR0A 1HQUA 4ZPBA 4JV0A 3KKFA 4OZNA 6FD1A 4ECXA 1HWJA 3D0GE 1S1TA 3G8QA 3HI9A 2CQ1A 2QL5B 2DY9A 1RHRB 5IQ6A 5CYQA 4C8LA 5F0WA 4X4PA 1VS3A 3C2PA 2XMVA 1FNOA 5KFJA 1FRLA 1KFSA 5L1JA 3O6QA 2G9OA 2HG4A 4I6YA 2AEMA 4ED4A 3BSAA 4LVOP 3BZQA 1WOPA 2FC9A 4OX9F 1TMJA 4MK8A 3LANA 1VRUB 4BLGA 2F9DA 1RWOB 1TAQA 1FKOB 1UEVA 1X4FA 2IJRA 4CZCA 4UT4A 1A9NB 2YNGA 3NMAA 2ZKTA 1NSPA 1T7PA 1K44A 4I4BA 1X4AA 2HHSA 4LFCJ 3OSPA 4KGXB 1R8CA 2XMUA 4EWTA 3VAJA 2UVRA 5GAHU 3K2YA 2NLWA 1W7WA 3G9CA 4IFYA 4Y6IA 4IDKB 1Q86T 2HHUA 4M5DB 2DXEA 1OO0B 3K5LA 3SCJE 2WVBA 1RTZA 1KS2A 5KFGA 2MZTA 4IH6A 5B0EA 1DJ0A 5HQMA 1HPZA 3GP9A 4AE5A 3BREA 1ZOTA 5E33A 3DU6A 2DGXA 4I69A 4DJBA 1TKTB 3AQOA 4FF3A 1CJTB 1DHMA 2MXYA 3BR8A 4Q43A 3ENWA 5CH7B 1RWUA 4OFZA 2QIFA 3MM7B 4X84A 3HX9A 2V8HA 3M2RA 3MXHP 2WSEC 5L9NA 1XMQF 2DKOB 2MSSA 5F8LA 2CPEA 3MUMP 3NRBA 3KLFA 4I1TA 4O3OA 2VG5A 1RT5B 1G3OA 2KDOA 3KHRA 2HW3A 5DDOC 1JWWA 3W2WA 4I2QA 3KLHB 2XZWA 3IP0A 4USUA 3SV4A 4NA1A 2FDNA 2LU2A 4JV5J 1NSQA 1PYTA 1SQEA 2CRLA 2R7RA 3J80Y 4IOAQ 1HYSA 1FK9B 2HVZA 4TLRA 5F8JA 4NMXA 5FD1A 4TVAB 2UUWA 1VIXA 4LF4J 3POTA 2KXFA 2PMZD 1N5YA 2F4VF 1PJ7A 1OYEA 1S1UB 1RCXB 3BDEA 5B7WA 1B70B 3KHGA 1HR0F 4CYUB 1X0FA 2DNQA 2GMLA 4M95A 2BKPA 2QN6B 3OL8A 1U2FA 5CYJA 2PMHA 4USHA 1I51B 1SV5B 4B9LA 2KT3A 2XZTB 1GNKA 2NZ4A 1AFIA 3ET6A 3OTDA 2C2NA 2P5VA 4DV3F 2VFTA 2AEJA 4OI2A 2LQ9A 1RE1B 5F8IA 3HJFA 2FHKA 1T11A 3W8PA 5HJXA 3LP2A 2NPIA 2H4YB 1D09B 5CABA 3AOCA 2W7PA 4PRFA 2I0XA 1UZHA 3NP5A 4ZMMA 2I38A 4K2XA 2DH9A 2I5JB 4PWUA 2VG6B 4M8LA 3MTJA 3MECB 2JLGA 4J90A 1T9YA 1B0PA 3OTOF 4JV2A 1O6XA 3UNGC 1UCNA 3OL7A 4ENOA 4U7UD 3TP2A 2EFPA 2MKCA 4OL8A 1PC5A 2VG7B 2BOAA 1KLMB 4ZPAA 3C6TB 2BANA 1HNIA 5C7PA 3L09A 4ZHRB 1RBAA 2CPXA 4OI1A 4KPYA 2GQ2A 3M8QB 2UU9F 4CLFA 1HI1A 1EQMA 1RWNB 2DITA 2YH0A 2R42A 3QJLA 3HP6A 1RTIA 2VOPA 4PXCA 4GKKF 5A6PA 3I9ZA 3MPUB 4O4GB 3LUYA 3KUEA 2VDHA 4Q7AA 2QL7B 4DG1A 3QGIA 2GVZA 1Q82T 3Q83A 2DIVA 3GR1A 2FHJD 4PYDA 1TK5A 4F2RA 3CTRA 1IBLJ 4Y2MA 3OHAA 1LFPA 2VBZA 4NLXA 1C0UB 4Y2IA 3ZTQA 1UW4A 3DDNA 4GMKA 3LAKA 2KVIA 3DGVA 1HBOA 1U0SA 1N6QA 4ILLA 1XNRF 4KV8B 1T03A 3M1VA 3TUPA 3BO4A 2CQ3A 3QSYB 2H5JB 1RK8A 2R9LA 3AOAA 5F8GA 3J7A1 2PEBA 3KUHA 1UEUA 4DV2J 1U1PA 3M2VB 3FZBA 2FC8A 3HHKA 2YKMA 4A8YA 1GX6A 2A1BA 2MZRA 4P2SA 2DO4A 3I87A 1VYAA 3C15A 3GYXB 4ANEA 2MZSA 4FS1A 3MMBB 4M94A 3MMAB 3H4DA 4CLWA 2FZKB 2OKQA 3HSZA 4ED2A 2O66A 3EDRB 4ZCIA 2J9DA 2OTLS 3PYFA 1NH8A 4DLEA 1NPPA 2Z4PA 2H54B 3HHLB 3MM5A 1QSSA 4LR7A 2HVHA 2M88A 1H98A 4ER8A 1PAUB 5J1PA 2KKHA 2V9WA 3MMCA 5KG0A 1OYDA 4WYWA 1WKKA 1M90T 2HRTA 2YVSA 2ASYA 3BV8A 2NXUA 2QE5A 1FTRA 1AA1B 5C24A 1FWKA 2CQHA 1JJ4A 2PMWA 2MLXA 2JH3A 4L73A 1TR0A 4CO2A 4X62F 4PZVA 4QIWD 2W2PP 2MKIA 1EETA 4DL7A 4DV5J 2KYXA 1XBWA 3BSCA 4I68A 2ZZTA 2JEJA 2W9CB 4RW4A 2F9JA 3DCAA 3S6EA 3UO0A 3NNHA 3T1HF 3W7BA 1NU4A 1RABB 2CPZA 2HQDA 1JXLA 2HQCA 1S12A 1U1MA 3CCSS 5D4LA 3A3PB 3UN5A 3A3OB 5HQ8A 3W9IA 2HBYB 1Z2ZA 2EFQA 1CJUA 4KR0B 1GMVA 5HSPA 1U0HB 1RHQB 3CSKA 3T6JA 4MYTA 1YZ7A 2HFNA 1S9GA 3MR3A 3EXYA 4IFVA 3R5AA 5CZVA 3I0SA 2WONB 5IFMA 2PI5A 1U1NA 1S10A 1Q95G 4QPXA 4DSKA 2BJDA 1IBMF 3TVZA 4FN5A 1ZA1B 3KLEA 4DQPA 3L7OA 1UFKA 2GW8A 1VI7A 2Z58B 2ASLA 1KDNA 5F9NA 2UP1A 2FIUA 1SXLA 3OXFA 3FEXB 2O5DA 1LEOA 2RHQB 5C2CA 3GTYX 5K5MA 1KQFB 4WKYA 3PW2A 3ISND 2DHHA 2DJWA 3CJTA 3V6DA 1HNXF 1CULA 3KHLA 1IKWB 4PWWA 4PPDA 3BBCA 2XY5A 3CCJS 2ZH3A 4DUYF 2M9KA 3D0HE 4KE5A 2HKEA 5B08A 1T9WA 3H5UA 3D66A 3CE8A 1VOMA 4KY3A 2ASDA 4Y2KA 1LXJA 4YP3A 4MIWA 1B7FA 2PIIA 4MFBA 3MGJA 4ZLPA 2SXLA 1DTQA 2QC3A 1WDTA 4ZVUB 1KR4A 2ZH8A 3IS9A 5FLXY 2KFYA 4BC9A 2AZ3A 2PGCA 2FVSA 3NCPA 1AZSB 2VQEF 2CPHA 4DUZJ 2MQOA 1VMBA 5M2PA 3HT0A 4UZCA 4EGLA 3MEGB 4LJMA 1GFWB 2Z2LA 5GVQA 1RT1A 3P45B 3TVKA 2NXCA 4N8OA 3THPA 4B3SF 4NWBA 3R3TA 5D0HA 1UWBA 4NYOA 5HLFB 5IV3A 1JXEA 2OPPA 1GQEA 3VGUA 4YDDB 2GHWA 2ZDPA 3WX8A 2EC2A 3R2CJ 3IGVA 1S6QA 3VCDA 1EJ7L 3DDIA 1VC0A 2NZCA 4ZVHA 1BQMA 4LFAJ 3V2UC 2V4JA 2FYXA 3RAQA 1FRHA 1VLYA 1VQNS 2WVDA 4MJKA 2FJXA 1WJ9A 1UMJA 2HNYA 2ATLA 4YR0A 2B51A 3Q8VA 3ILJA 4N5SA 2EFNA 5K14A 5F3ZA 2PC6A 3I5AA 1WEXA 1J5OA 2P9GA 4ZJLA 2WSCC 1U8WA 4FS2A 2LECA 4X64F 1EX8A 1RA6A 1E6YA 2JL9A 1RA7A 3RUBL 1B7YB 1DQ8A 4P2MA 2E9ZA 4LF2A 5AE3A 1JKHB 4WZMA 2J6TA 1HWLA 1V6HA 5KFSA 5M2UA 5L1LA 2JJ4D 1Q1KA 3ILIA 1O51A 3LH2S 4NASA 4DZ6A 3MTKA 1DQ9A 3E01B 5ETTA 4B9MA 3CGIA 2HNZB 4XO0A 4X66F 3D1HA 1KHWA 4NLWA 3SCKE 1ZBTA 2CQCA 1G4CA 1QUVA 3BPDA 2I8EA 2DNGA 2GO9A 1L3KA 1X9SA 3GFZA 2C2ZB 4C4WA 1FD8A 3PYGA 1N36J 5BYQA 2VPZB 1TKXB 2H4WB 3PR4A 4Q44A 3J80U 2RVJA 4JI8J 1KVKA 3KLIA 1OY8A 3JB9k 3ZC4A 1UFWA 5GAGU 4P6QA 1IQZA 3ZZYA 2MKHA 1FERA 4B17A 2KN4A 5KFPA 3HHDA 2A2DA 3M2UB 1T94A 1F9EB 3J81Y 2V34A 1XR5A 2FLOA 2AGPA 3DOKB 1BD6A 3ILLA 5ETMA 5RUBA 1HI0P 2GGPB 5CCLA 4XDCA 3TJ9A 3M9OB 3PM9A 1NNDA 2E9TA 1FKPB 3LWMA 4IO1A 3RBZA 4PQUA 5DLFA 4FYYB 3VVUA 2EEYA 1NJWA 1U09A 1XN9A 1GTHA 1FNMA 2HSEB 4RW6B 2QMUB 2YTCA 1SKRA 1NPKA 5IZHA 2BV3A 2FJAB 1UFLA 2BJ3A 3OUYA 2X51A 5GADU 4B3MF 5A8KB 3Q24A 3EVMA 1T3OA 2D3OR 3D6HB 4LSLA 2DVIA 4BS2A 2CQIA 4YHHF 2DR9A 1U4BA 3LW5C 5IT0A 2Y0SD 3MFHA 2COLA 1T8EA 3EWGA 4AT1B 4F7VA 4U6PA 1F1BB 1ZAWA 1NCLA 3SDEB 1V3ZA 1TU0B 1ZZFA 3CNQP 1U2RA 5DO2A 5KFCA 4TU9A 3E51A 4NLQA 2JFDA 1TZ0A 2FLLA 3QJPA 4FDFA 1UVIA 3MCMA 2YKNB 2WW4A 1W2BR 2XHWA 1Q4RA 2XYGB 4ZDNA 3Q89A 3R97A 2ZM6F 5LL6d 2W7OA 1JMTA 4WCEQ 3QFWA 1WF2A 4NX9A 3OVSA 2UXCF 2IIHA 4YB7A 2ZITA 2J7UA 2RS2A 4FVCA 1T95A 5KFTA 3HVTB 1R0BG 3TAMB 1LW2A 2Z56B 1F9HA 2VKZG 3H2VE 1DLOA 1QE1B 2MQNA 1YX2A 4N41A 3AOBA 4XTTA 1RWVB 3OVAA 3M6XA 2Q3PA 3KUGA 2I6WA 1T05B 1GAOA 1PJ6A 2HZVA 4I56A 1VQ8S 3IRXB 1KHVA 3IWLA 4RWWA 5D3GA 1SPBP 1XMQJ 3BKFA 5HATA 5LJ5Y 1XK8A 1WC1A 2PFDA 3T5HA 1U49A 3KJQB 1MW7A 5CYMA 2OMLA 4K4XA 3PW0A 2ZBRA 1CS4B 1RWWB 3BGUA 4DSIA 2ZH4A 4Y28C 2CG8A 2DNHA 7AT1B 4U7UK 3OBIA 4Y00A 5JXSA 2J0SD 2V2KA 1P6TA 4TYAA 4C3MA 4ANDA 4NLPA 1DRZA 4DOZA 4CLKA 4DU8A 3M30B 3GG0A 3D3BJ 1JXVA 4V19J 3MI7X 2MZ1A 2RF2B 3M8YA 4ZVFA 2ZH6A 2J8AA 4G3IA 2UUTA 4WK3A 4WFYA 3HVWA 2CQ0A 2IRUA 3PEJA 2BRLA 2F3JA 1TVRB 2LEPA 4USKA 4ECZA 1IKXB 2G1HA 1TTHB 4GC7A 4HLBA 3KNAA 1N4LA 5HROB 1X4BA 1Q5VA 3HDSA 1XWLA 1S5ZA 2MKJA 1KBRA 5A8RB 4ICLA 4KC5A 2DXFA 4R5PB 1FX2A 2FHMA 3DI6A 1YBTA 3OTOJ 2V67A 2Q6CA 2W4PA 1SI9A 4F3OA 4RNMA 4OYMA 1AROP 4LF6F 1LNQA 4DN9A 2HBQB 1T0TV 2FHJA 1H2TZ 3T41A 2H1YA 5ETNA 1WG4A 1NSKL 2GC8A 4WP3A 1JLFB 1QY7A 1OS5A 1RBOB 4LIWA 4NRTA 2M70A 4QYZJ 1KONA 2YX7A 5JVGQ 2UUAF 1U8SA 4RO0A 1A7GE 2Z57B 2A18A 4KFBA 4TNOA 4M5IA 4DF4A 1U6FA 4PYAA 1XIQA 3ELHA 2OGUA 1H2UX 4NLTA 2J5AA 2BABA 1YJRA 3UN3A 2KZZA 4F3MA 4ECUA 2HZCA 3P5TL 1E6VB 3FRZA 2XTJP 2XCPA 4GKJJ 4ILMA 1N5VA 2UUCF 3N0VA 2PD1A 3MAAB 1ULRA 2HURA 3BBBA 4CDIA 4CTAA 3M9MB 1RUSA 2CJYB 1CSJA 1T9XA 3HHLD 3OHBA 3M8PB 3CDUA 4ZK7M 3ZO7A 5HVHA 4DPXA 4W92B 3FDSA 1FKAF 2LA6A 2G0JA 5AXMA 4RUHA 3TJAA 4WU2A 4DQSA 1F2HA 4X4QA 3GV5B 2IMWP 3EZOA 4M5LA 1S0VA 2OFHX 4PAAA 2OUGA 2P9CA 4LBPA 1S4FA 3QIPA 4M5JA 1VRQC 2GJ2A 1KVIA 5A8WB 1ZM9A 1S0NA 2CPJA 4OHWA 2GAHC 3NGSA 4CWBA 1HQEA 3DLKA 5J2MA 3KJNB 4O4RA 2L9DA 3GIIA 2QLWA 2QZ8A 2BUNA 2ZH7A 3RYLA 2HLUA 3SCLE 4QR0A 1QAIA 3AA8A 1B0TA 3CCES 5GAGI 3R2DJ 3PJWA 3LP0B 1OIAA 3DOMA 2O67A 2HZAA 4LF1A 3B54A 3V6KA 3CJ0A 2JC0A 5KFAA 3DM2B 4K4SA 5KFWA 4LF5J 4G1QA 2EBEA 2FB0A 3HFKA 2MMYA 5D0EA 3R5DA 3NLCA 2PSZA 2YNHA 4ECSA 2MEWA 4EU0A 2CWKA 5BR8F 3M6UA 1HD1A 1N5TA 4B3OB 3PKMA 1NK9A 2UVUA 4OI4A 1YSJA 1NUEA 3VAMA 1FJEB 4K4VA 4L76A 3O2IA 1RAAB 4P71A 2XMJA 2DK2A 3KG0A 4P7TA 4EBEA 3WQPA 2V8DA 2WVCA 1HHSA 2MHEA 3MEEB 1KEKA 4DV0J 3D6MB 4DQQA 4NCAA 4RJVA 5GADI 3ICLA 2OD6A 4KKOA 3GJQB 2AX0A 1XC9A 4DX6A 4O3SA 3PYDA 1RTJA 3GB0A 2Y0BB 3GIRA 5E3PA 3E8OA 2ZH9A 3M8ZA 4G65A 2RKIB 3ILOA 3IAS9 3I82A 2P8IA 1MWQA 4F4WA 1BXNA 2DBBA 2IFXA 5I4MA 2CZ9A 1FRIA 1K73T 5GMEA 2MHNA 4WE1B 4F0KA 1MWYA 1NKCA 3PRBA 1QLNA 5THWA 2CJAA 4OLPA 1NB7A 4LF9F 2BM1A 4ZLLA 4JV1A 2DEIA 1S0OA 1U2CA 4AUKA 1C4AA 3OR2B 5CZXA 3I4HX 4ZLJA 5L38A 1SIWB 1RTDA 4CO4A 1RTHA 4H4MA 1HBUB 2GQQA 4OX6A 1NZAA 3BB5A 1FHTA 2YWKA 1Y3KA 2XYHB 1HNWF 1BQNB 4LVNP 1VBXA 2RDJA 4GVBB 2YBVA 3N9UC 3L4BC 1AYEA 3H40A 4W90B 2R2UA 1XMOF 3CD0A 4PWDA 2IC3B 5DDPC 1DQAA 3OD2A 1IR1A 4RW7A 3NOGA 2D9PA 1ZA2B 3T9NA 1RWMB 1VR6A 2HQ3A 5AXKA 3DDKA 4ED1A 2LQ8A 2ZE2B 4K7QA 1FESA 2ALZA 3FKBA 5KFLA 5F8NA 3DMJA 3TO8A 3M32A 2QO3A 4YN3B 1SL0A 2XI3A 2QYGA 2NSCA 3MEDB 4DPOA 4CCHA 3GIKA 4KH0B 1XR6A 3D1QA 3F41A 2WOMB 2E1PA 1U45A 3QPIA 4ZP7A 3TRGA 3KK3B 1RT7A 2BE2A 2XYPB 2AIRB 4Y65A 1YJVA 5HP1A 1J27A 2WBRA 3ISZA 4DV1J 3NL0A 3TNVA 1HBNB 2CIMA 3CJ3A 2Y8WA 1R43A 3TQEA 2HBRB 4WJBA 2ADCA 4IG0B 4QW8A 3TUIC 3R1HA 5H9EJ 4CLLA 2GIRA 4X4RA 4K4YA 3BH7B 1H38A 2L9WA 2QTWA 2D7SA
chains in the Genus database with same CATH topology
2E7XA 4LFCF 1N5YA 4C8OA 3A1YG 1RAJA 2F4VF 3CC4S 1X5PA 2C2EA 1QM9A 4AL7A 3I6PA 1S1UB 5SZTA 3RAXA 2KHDA 3BDEA 2U1AA 3Q2TC 4ZPDA 4KGMA 5B7WA 2XWXA 1IJEB 3OXGA 3KHGA 1RT4B 2W25A 3OR2A 1JNZB 1HR0F 2HHPA 2B7CB 2IYGA 3CCZA 2MYFA 3I5CA 1X0FA 4Q2LA 2DNQA 2JLFA 2M7SA 4H4KC 2GMLA 4UW2A 1NK4A 3C8YA 4M95A 3CIZA 3OL8A 1U2FA 5CYJA 2PMHA 1NK6A 3MOJB 1D9FA 1MU2B 4USHA 1HBUA 4ERDA 2HFOA 5EWFA 1F0XA 2DGTA 4KB7A 1FF2A 1SV5B 3M6WA 1N5QA 4USIA 4M63A 2KT3A 3DNCA 3CCMS 4B9LA 2WONA 1GNKA 1YVFA 2VFRA 2NZ4A 1U25A 5J2NA 1IKVB 4Y2CA 1AFIA 2DGOA 2B4UA 3F56A 4B02A 3OTDA 2P5VA 5DLGA 5DGBA 4DV3F 2KT5A 4E8UA 2VFTA 4FYDA 1BQNA 1JLQB 3I4PA 4OI2A 3UW1A 3KLGA 4CO1A 2LQ9A 1VRUA 1S7HA 2HGMA 5F8IA 3HJFA 2FHKA 2UUBF 1WNEA 1FKOA 1FVQA 3PDNA 3LP2A 2YQ3A 4F50A 2NPIA 3G71S 2E1MC 1Y5LB 1D9DA 1TFYA 5B0GA 2IC3A 3BN7A 3SSRA 4MYUA 1SJRA 2M8DB 5AE2A 4IUFA 3CCLS 2W7PA 3U7JA 3DOLA 3OV7A 2OJ3A 2JEFA 3Q8RB 1IM4A 2J0WA 4Q45A 2Y1RI 4PRFA 4DV1F 2I0XA 2RD5C 4ZMMA 3NP5A 2E5IA 4FXVA 3TAPA 5FDLA 2I38A 4K2XA 2DH9A 2I5JB 2H5EA 3IBWA 2J9CA 4MH8A 4PWUA 3H2LA 1VBZA 1S0MA 2RQCA 5DRKA 2VG6B 1XMBA 4M8LA 3MTJA 4Y0FA 2B9WA 2BJEA 3MECB 2JLGA 5T7LA 1B0PA 3OTOF 2N3OA 5DETA 4X4TA 5E3AA 4ZP9A 6FDRA 2R7WA 5HMWA 4C11A 2QEXS 1UVLA 4OJ1A 3GILA 3UNGC 3N28A 2FPHX 2C42A 3CD7A 4HT5A 5T14A 3OL7A 4DLGA 2AJQA 4RKUC 4M5DA 2JFKA 3HVRA 3TP2A 5L1KA 2EFPA 3CT9A 2MKCA 4OL8A 2XEXA 4JV5F 5AXNA 2X1AA 2K3IA 1XEZA 4B9NA 1PC5A 5D4OA 1EETB 2FLPA 2VG7B 1JLBB 2QA4G 1KLMB 4ZPAA 4QR2A 4ECVA 2B4VA 3C6TB 4L3NA 2BANA 1DARA 1HNIA 1C0TB 3UE2A 3L09A 4ZHRB 2CPXA 4OI1A 4WIIA 5BYRA 4KPYA 2DH8A 2GQ2A 3IO1A 5CCMA 3TYTA 5L8RC 3M8QB 4RW8A 3JSMA 4DQRA 2UU9F 4LF4F 4BC7A 2BQRA 2IJNA 4KRWA 1N34F 1RT2A 2KHCA 2DRAA 4B9SA 1HI1A 1F60B 2LXUA 4V19X 3VAHA 1LK5A 4URSA 1NO8A 2DITA 2HNDA 2WOMA 2YH0A 4F8RA 4MIBA 3IWXA 1WD6A 2J9EA 1TKTA 3CDWA 2EFGA 3TUJC 4DBQA 3QJLA 3RW7A 5JUMA 3HP6A 1RTIA 3NS5A 2VOPA 4G1PA 5KFDA 4PXCA 4GKKF 5KG3A 3I9ZA 4ZP6A 5A6PA 3GYNA 3KK3A 4O4GB 2MDAA 3LUYA 1WHVA 2VFVA 2DHGA 1JLGB 1PO6A 4NLGA 1YJTA 2XMKA 2M2BA 3VALA 4EO6A 3DLBA 3GIJA 3OSNA 1FCAA 4Q7AA 4A8XA 5KT3A 3FSIA 2Y1IA 3KMQA 4RBTA 2MKKA 3HVAA 3NKYA 2B9XA 2LQJA 4DG1A 2B5JA 3QGIA 4J9KA 4ID8A 4IFVB 4ILRA 1Q82T 1R8AA 2ADBA 1IQTA 3O1LA 1VQ5S 4H4MB 3U27A 3ZZTA 2DIVA 4DR7F 1MWZA 3GR1A 2PI4A 2M5YA 2FHJD 3X1LB 4MKYA 1RT5A 4PXBA 3DFEA 4DL2A 2XGQA 1TK5A 4F2RA 3W3SA 1UJ6A 1VQKS 3CTRA 4IO9Q 2A3JA 5B0CA 3BGLA 2ZC4A 3B4DA 5EWEA 4LQ9A 2ZZNA 1NKEA 4OI6A 3GMGA 1H2VZ 4Y2MA 3B82A 3OHAA 1LFPA 2HRYA 2VBZA 3KLEB 4NLXA 1C0UB 2N4DA 4IG0A 1VQLS 4Y2IA 1CC7A 1UW4A 1APSA 3DDNA 2HHVA 1FXRA 3LAKA 4GMKA 4ES2A 4PUOB 2KVIA 1HBOA 1N6QA 4ILLA 3CCWA 1XNRF 4KV8B 1T03A 4OI3A 3M1VA 5HLFA 2Q1LA 4LF7F 2F7VA 5B0FA 2XI2A 5I42A 2KB2A 5I3PA 3BO4A 2HYIB 2X3GA 1NJIT 2CQ3A 2LEBA 1JB0C 2DNRA 2PDAA 3UFCX 1TL3B 2KM8C 1N88A 4DWIA 4ZPTR 1G2EA 3VR1A 1RK8A 2XG8A 2MQLA 2R9LA 5FJ4A 2YWFA 5F8GA 4EBCA 1IXKA 3J7A1 1UJ5A 1HL6A 2BR0A 3DRRA 1UEUA 2W9BB 2NSBA 4QJVA 4E98A 2BQUA 3M2VB 3H2UB 1U1PA 4HI2A 3FZBA 3ZZ0A 1RT4A 3KMSA 3MUTP 3CJ2A 2QT7A 3P49B 3CMES 3VAIA 2FC8A 2AYEA 1NAQA 2DNKA 5LT5A 3HHKA 2J76E 2YKMA 3PV8A 4A8YA 1GX6A 2A1BA 1SJ1A 4RNHA 2BM0A 2MZRA 2NR0A 3IC1A 4P2SA 3QGPA 1VJWA 2DO4A 3R27A 3T19A 3I87A 1N54B 1UAWA 2CJBA 2PE8A 3GYXB 2MPUA 2MZSA 4FS1A 2XNQA 2B56A 3A8EA 3MMBB 1U1LA 4M94A 2R7VA 4ED5A 1X8DA 3CEDA 3MMAB 5F8MA 1SV5A 4U67Q 4FXWA 2NQPA 1LXNA 3H4DA 3CJ5A 3FZ2A 2OKQA 2AP6A 1CG2A 4ED2A 1IKVA 5L9XA 2O66A 2R7OA 3KK2B 4ZCIA 3IR5B 3OW2R 4K0KF 3M32B 2J9DA 5G4DA 5HBMB 4JI5F 3C6UB 3E3XA 4JI4F 4LUBA 1FEEA 1Y3JA 5KT7A 1U1KA 4DFPA 2OTLS 2NREA 2XULA 1JLQA 1NH8A 4DLEA 2VC0A 2Z4PA 1M5PC 1MNEA 2IYIA 3HHLB 3MM5A 4OZ5A 5EX0A 1QSSA 1S1VB 4KJIA 2M3DA 2BA9A 2ABYA 1WI6A 4WYLA 1FRXA 2HVHA 5CQGA 4X4SA 2M88A 1IN0A 1H98A 3GE9A 2XSJA 1DTQB 5J1PA 4GO5X 1SJQA 5FIIA 2KKHA 2RE1A 4UOCA 2V9WA 3MMCA 3TI0A 4DSJA 5KG0A 2ZBCA 4BHQA 4O44A 4WYWA 4DR5F 3PVXA 3V4IB 1XR7A 2YNIB 3M4XA 1DTTB 1LQ9A 5EDWA 1M90T 1RT7B 2ZH5A 2BE2B 3M2RB 2JC1A 4IQMA 1H7WA 2YVSA 5C42B 3GV8B 3JTNA 5IWAF 3ZZPA 4YUDA 4AXIA 2ASYA 2JSXA 2PT0A 2ROPA 4A8MP 4ID5A 1VQYA 2NXUA 3PFOA 2QE5A 2W7AA 3O44A 2R2SA 2F8MA 2J7WA 2VG6A 1X5SA 1SJ4P 1FTRA 1PSDA 4PG7A 4AFFA 5C24A 2W4DA 3E01A 5F8HA 3KG1A 2CQHA 3QWUA 1JJ4A 1IBLF 1FDNA 2DPJA 5SUHA 3HHNB 1QAJA 2HNZA 2Z0GA 5I3QA 2JH3A 4NA2A 4AL5A 3HM9A 3SCIE 1TR0A 1R6YA 4C3LA 4CO2A 4DX8H 4X62F 4ECWA 2VA3A 4QIWD 1VIOA 2QMWA 2LXFA 2MKIA 1NRKA 1EETA 2VG7A 4BWJA 1JLBA 1SC6A 1KLMA 4HHJA 3I96A 4MIAA 7FDRA 4DL7A 2KYXA 1XBWA 3BSCA 4I68A 5KFIA 1C0TA 4QOTA 2JEJA 2W9CB 4RW4A 4XK8C 2F9JA 3T3FA 2G0CA 3DCAA 1UWBB 3S6EA 3M8QA 4ITSA 3I9V9 4DFMA 4QWDA 3HLUA 3NNHA 1NK5A 3T1HF 1SJFA 3RZAA 1NJXA 3FCHA 3G8SA 2OPPB 3W7BA 1NU4A 1NJYA 4HKQA 2CPZA 1YRTA 4CH7A 2XGPA 1JXLA 2Y1JA 1ZPVA 4DV6F 1REVB 5F3TA 1U1MA 5IXUA 3CCSS 5D4LA 4DV2F 2KFNA 2DHSA 4YB1P 3IR6B 5HQ8A 3AJ1A 3AQPA 2E9RX 4X65F 4O4GA 4BDPA 1S6QB 1Z2ZA 1MMLA 2EFQA 5KFRA 1JLGA 2E1AA 3J7YU 2DNYA 5B0DA 2X1BA 1UVNA 3MM9B 2XMWA 3RAMA 4KR0B 1JJ2R 1BQMB 3CSKA 2V4JB 3BN4A 4Y2AA 3T6JA 4MYTA 2HFNA 1S9GA 3QO9A 3MR3A 3PKYA 3EXYA 3GFHA 4IFVA 3V4MA 3PIOQ 1N5SA 3R5AA 2BQ3A 3EGWB 2DGVA 5CZVA 3MAQA 1U1QA 3G6XA 4XPCA 4O0IA 1YJWS 5KG5A 2KZMA 2HNYB 4QIFA 3I0SA 3IN5A 3BS9A 5KFUA 1LK7A 3ENQA 3F44A 1GX5A 3RB3A 2XB2D 1MSWD 2O1PA 2DGQA 2CFXA 2WONB 5IFMA 2CZVC 3UD4P 1UA1A 1U1NA 2DGUA 1NJZA 1S10A 5D4PA 4BWMA 4QPXA 3M2UA 3DYAA 4OLOA 3J7ZT 3MFIA 3CCTA 4DSKA 2BJDA 1IBMF 3TVZA 4FN5A 3CJ4A 3OFGA 2OPQB 2XLIA 5KFNA 1CQNA 5D77A 3KLEA 1J5OB 3TW0A 4DQPA 3LQVA 4CT8A 1C0UA 3L7OA 1M5OC 1VRTB 3H8YA 3KTQA 3KLGB 5D78A 1E6YB 4PUOA 2GW8A 2PI5A 1VI7A 2RJZA 2ASLA 4R8UB 4KV8A 5F9NA 2UP1A 2FIUA 4DR2F 5KG6A 3LP2B 1YJNS 2XCAA 4ECYA 1Q7LB 2VONA 4ALZA 1SXLA 3OXFA 1K1SA 4DSEA 1YQHA 2HWIA 3DOKA 2CVEA 3FEXB 2MQPA 2O5DA 4GO7X 2P6TA 2DR5A 2DH7A 3MMJA 1HMVB 2HVIA 3HZEA 1ZAXA 2OTJS 5K5MA 2C3MA 4HDGA 2DHXA 2LDIA 2GGPA 1KQFB 4WKYA 3G6YA 5F9LA 3CO9A 3PW2A 2MQMA 2EG1A 3ISND 4HH1A 2EC0A 2KT2A 2B4OA 2DJWA 2W9BA 3V6DA 1HNXF 1WTFA 2RRAA 2IM3A 4NLSA 4OZ0A 3M2VA 3KHLA 4QU6A 1IKWB 4JI3F 4PPDA 2M8HA 1RT3B 2ZVSA 4NLOA 1JJHA 2XY5A 4ATNA 3CCJS 2OPRB 4IR1A 4B9UA 3RR7A 3L95X 2ZH3A 4DUYF 1VHFA 1S6PB 1S79A 2M9KA 2FVCA 5E3QA 4DL5A 3D0HE 4NRUA 4EZ6A 4KE5A 5IS2A 4PG5A 2GJIA 2YNFB 5MLCV 4C8MA 3MMBA 4RW6A 5B08A 1F2GA 1YRUA 3MMAA 3AA9A 2RB7A 2AJFE 2D41A 2RRNA 5K8OA 1IUJA 3H5UA 2L41A 2LCWA 4J37A 1LFWA 1CQMA 3CE8A 3KK2A 3CD6S 1VOMA 2BANB 2F1FA 4YFUA 4IOCQ 4FF2A 5HBMA 2BVZA 3RTVA 3C6UA 2ASDA 1K8AT 2VPWB 4Y2KA 1C1CB 3TR5A 3NS6A 1LXJA 3K5MA 1Y9OA 4KGKA 5DDRC 3BO2A 4YP3A 3JSMB 4RW8B 1D8ZA 1WHWA 3TVYA 5K8MA 1K9MT 5A0YA 2ROGA 4MIWA 1RT2B 3CCVS 1B7FA 2PIIA 1RDRA 1F5AA 3HHLA 4MFBA 3MGJA 1S1VA 2HS4A 4ZLPA 3QAUA 1Z1ZA 4JI2F 4KT0C 2SXLA 1MMNA 2YX1A 3VTIA 4JOUA 1Q81T 3RRGA 1DTQA 1RQ0A 4Q8EA 4H4OB 1K1QA 3DC2A 1IKYB 1KR4A 2OO4A 2ZH8A 4IRDA 1TL5A 2KJWA 3IS9A 5FLXY 1X9WA 2KFYA 5L39A 1FRMA 2XMMA 5JJBA 4QW9A 2YNIA 3UDLA 2JRSA 2FJWA 2CQBA 4BC9A 3FVYA 3V6JA 1U1OA 4KTQA 1TFWA 4N8NA 3RR8A 2VZ9A 3Q2SC 4R25A 5C42A 3CUNA 3H5SA 3K59A 1FNXH 2CYYA 2PGCA 2QSWA 3DU5A 4F4KA 1S49A 2FVSA 4FNHA 2N7CA 3NCPA 5A6WA 2KJVA 1L3UA 3AY0A 2AWZA 2VQEF 2HHHF 2CPHA 5IT4A 1TV6A 2MQOA 4IRCA 4DV4F 1CEZA 1O5JA 2E7WA 2VQFF 1VMBA 3RBDA 5M2PA 1YHQS 5GAEU 4RBVA 4E0DA 3K5PA 2R7QA 3CMAS 1LWCA 4DR1F 4NXMF 2EKYA 1JIHA 3BSOA 3IGNA 1B64A 4IKAA 4EGLA 3MEGB 1D9AA 2Z8QA 3O5TB 4LJMA 1S97A 5EX3A 1CVJA 1ZTWA 3H4BA 3QGGA 3QWPA 3D54A 4MK9A 2Z2LA 5GVQA 2YWGA 2WW8A 1RT1A 3TVKA 3NGDA 4N8OA 3THPA 4R0EA 3N6LA 4NPOA 2QA1A 5H1SV 4ZS6A 4B3SF 3GFYA 3PHEA 2W9CA 1HWUA 3FSXA 4NWBA 2HS0A 3R3TA 3SSQA 2V4QA 1UWBA 3T9ZA 2QA4S 4NYOA 1ROFA 1TK0A 2P9EA 5HLFB 1DZ5A 4LF8F 4WKRA 1SH2A 4MMOA 3S7RA 1RKIA 1JLCA 3QIDA 1JXEA 3D1OA 2OPPA 1XTZA 3JSRA 4HI1A 1GQEA 4C8ZA 1SL1A 2JLEA 2WBMA 3LO3A 1WHXA 2FTRA 4FP9A 5HI7A 1REVA 2EI5A 3HKZD 5KT2A 4A46A 3GZ7A 4YDDB 2GHWA 2ZDPA 3L7PA 3N5FA 3WDOA 3DRRB 1FDBA 1S6QA 3IGVA 4P7VA 4ZCLA 3VCDA 2HAIA 3HO1A 2XSFA 3CULA 1VC0A 2OSQA 1NEEA 3MM9A 3G4SS 3CDAA 4ZVHA 1BQMA 1KQSR 3V2UC 5J2PA 4RLEA