2F4VF

30s ribosome + designer antibiotic
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 16
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2f4vF00
1IJEB 4NXMF 4DV3F 1G7CB 4JI8F 1RISA 1N32F 4DUYF 2HHHF 1LOUA 2VQEF 4OX9F 5LMUF 4DR5F 1XNRF 4DV1F 4LF4F 4LF9F 4GKKF 5BR8F 1IBLF 5AJ3F 4LFAF 2F4VF 4X64F 4LF7F 2KJVA 1IBKF 1XMOF 4DV4F 2ZM6F 4YY3F 4JI2F 2RJZA 4JI7F 1IBMF 4DV5F 3T1YF 4B3SF 2UUBF 3OTOF 4DUZF 4LF8F 4JI5F 4DR6F 4JI6F 4X62F 4X66F 1XNQF 4LFBF 1HNXF 1CQMA 4DR1F 4LFCF 2YY3A 4DV6F 4DV7F 1GH8A 4AQYF 1N36F 2E5LF 1N33F 4JI0F 4JV5F 1F60B 4JI4F 4JI3F 5LMNF 4DR4F 1HR0F 4K0KF 5IWAF 2UU9F 4DR7F 4YHHF 4B3TF 1G1XA 1HNZF 2UXDF 1FJGF 1N34F 1I94F 4LF5F 4KHPF 2KJWA 2BVZA 4B3RF 3T1HF 4GKJF 1CQNA 4JYAF 4B3MF 1XMQF 2B7BB 4NXNF 1FKAF 4DV2F 3ZZPA 4X65F 1HNWF 4JI1F 4DR2F 2UUAF 2UUCF 3R3TA 2B7CB 2BXJA 4DR3F 1VMBA 1J5EF 2UXCF 2UXBF 1QJHA 4LF6F 4DV0F 1IJFB 2VQFF 2J5AA 1B64A
chains in the Genus database with same CATH superfamily
3DFEA 3PY8A 4ANCA 1Q4RA 3UD4P 4PQAA 3OFEA 4DQRA 3W66A 1GFWB 4IH7A 4ZVEA 1Q78A 2CFXA 3DOLB 2XS7A 2VJVA 1RBAA 4IR1A 3FCWA 4M5HA 1Y5IB 2DTJA 5DGAA 4FF3A 3DM2B 3HPOA 3CNQP 3G86A 4C2MA 3TVZA 1VRTB 1UJ4A 3F0NA 3FCVA 4F02A 1FX2A 2DGOA 2EC0A 1Y3KA 3V6JA 1EKRA 2Z2MA 2HFZA 2CDRB 1AZSB 1Q8KA 2L08A 3VZHA 1ZTWA 2UV8G 1U4BA 1UTAA 5IS2A 2BE2A 2C2KB 4J5OA 2RS8A 3UVJA 1NK7A 2UP1A 2OUGA 1NB2A 5KFYA 4MYUA 1R8BA 4F3QA 4C8OA 1X4FA 3ET6A 1REVB 2I9SA 3NGDA 3DLEB 3VCDA 3RW7A 4Y2IA 2VQFJ 3GTYX 3FUYA 3ADAC 4NASA 4HVZA 2L48A 3D4JA 1HNIA 3EMTA 4USUA 3HP6A 1TKTB 3X1LB 2Y1IA 4OYAA 2KHCA 2PI5A 3GYXB 4UZBA 3EVWA 3PW2A 2KU7A 2EBGA 3NLCA 2MKSA 5KFRA 4V19J 4QOTA 2M88A 5IT9U 3MD3A 4G1IA 3MR7A 4O4GB 1RTJB 5HATA 5HI7A 3FRZA 2GAGC 5A6PA 5KFPA 2R7WA 4DV5F 4DSIA 2RRAA 2KZZA 3SMZA 3VGVA 2B8PA 2QSWA 4UTGA 2HWIA 4IQMA 3G9CA 3DMJA 1HNZJ 2CPFA 2OFGX 2V9KA 1RTHA 3FRYA 1SV5A 1S10A 4C98A 5GAEU 5HO4A 1K1SA 1OSCA 2VU5A 5FD1A 5ETPA 4UOCA 3HULA 5KG6A 2NSCA 3CDWA 1BWEA 1NMEB 4CTAB 1N6QA 2E5LF 3F56A 1QM9A 4NL5A 2W2PP 3MDFA 4QIGA 5KG1A 3X3UA 2KG0A 4CZCA 2PEBA 3IRXA 1F60B 2KKHA 4JI4F 2DEJA 3JSRA 2H54B 3GV8B 3I82A 5ETOA 1R43A 1UW9A 4NZ0A 4WU3A 5KTQA 2HGLA 4K4ZA 3EDRB 4J90A 1F3VA 3CJ3A 1TK5A 1LXNA 1R8AA 2VPWB 3NS5A 1SBRA 2HS0A 4KV8B 1YJNS 4GVBA 4HL9A 3VVTA 2D3O1 2JEJA 2VC1A 2HHXA 1FNOA 1SXLA 2MLZA 1JMTA 1S1WB 1NSQA 4DI6A 3M2RA 2IAJB 1OQ6A 4OI4A 2FZCB 3OVSA 1EX8A 2KXNB 1R6VA 1PAEX 3AB2B 3DRRA 4BWJA 3BBCA 4YS2A 3T1HF 1S6QA 2ZD1A 3MTJA 1JXLA 3H40A 2YNFA 5J2NA 2DNGA 4CLSA 5E33A 5K14A 5CYMB 1R8CA 5A6WA 4PYDA 4ZLJA 3DLHA 2UV8A 1KQGB 1EQ0A 1X4GA 3SYZA 1FNXH 3AHPA 3R5AA 2BE7D 3D3BJ 3D6MB 3IGVA 4U67Q 3B4MA 3TO8A 1MMNA 3QSYB 3GFXA 4U6PA 2QTWA 3NRBA 5E0OA 2KFYA 3KLEB 4B9UA 1JJ4A 1V5IB 2DHAA 5J2PA 3PVXA 3JS9A 4RU2A 4A47A 5DDQC 2GIRA 4NX9A 2MQOA 2Q6BA 4A4JA 1NRKA 4WK1A 5F3TA 2Y9HA 3AD8C 2FY8A 2GV1A 5KFLA 4PWUA 4ZCMA 3G6ES 4B3SJ 2HAIA 3C6UB 3R1LA 3ZNJ1 3M32A 1SV5B 3CJTA 3UCZP 3UDCA 1UEVA 1HYSB 4ZLNA 2WVDA 2OD4A 2F8EX 2J8SA 2HHHF 1HNWJ 1S1TB 1R0AA 5I3UA 1UWAA 4KGVB 1D3WA 3V4IB 4OZJA 3RR7A 2IVYA 2PMHA 3CGIA 4DMZA 1LFPA 1RTZA 2QT7A 4NRUA 2V68A 3TQEA 4AT1B 1RACB 1RBLA 3MUMP 3IM9A 4MKBA 2A2DA 4LFAF 4PZVA 1K73T 4RNFA 4YR0A 3PYEA 2B6AB 2B43A 3K5LA 1W2IA 1YRUA 3OTEA 1YJRA 3KDNA 2FJVA 4DU7A 4PG4A 4IFYB 2YX1A 4QR0A 4ZVGA 5CA5A 2DKOB 2FLLA 3IWLA 3ZZZA 4DV4F 2DNHA 4DPOA 5IM0A 1GMWA 2I1RA 4QYZJ 1IR1A 2KG1A 2PMWA 1HHSA 1R6YA 2DT9A 4WYWA 1TUWA 2B9XA 4JI7F 3TI0A 4CP5A 1FKOB 1XR7A 3BR9A 2ACMA 4DV3J 4FXDA 1WG1A 4URQU 3CCES 2IM0A 2H51B 2QFIA 4PCQA 5IT4A 1ZH5A 1HNVA 2VFSA 2HLUA 3FSXA 1QSYA 3Q86A 4HHUA 5DLGA 1RT6B 5KT3A 4G65A 1Q82T 3LP1B 4FYWB 3SDEA 2DH9A 4TLRA 5HSPA 5KFOA 1F0XA 2BW7A 4DX5A 4OZ0A 4YB5A 1EETA 3C19A 1E6VB 4Q7AA 3A13A 5ETQA 3CCUS 4EO8A 3PRBA 2KYXA 3CULA 1HW9A 4UW2A 1KD1T 1J5EJ 3BREA 4A8OA 4DL6A 5FLXY 4X4NA 3QT6A 4K7QA 2UXCJ 4ILRA 5A2QU 4F8RA 3TZXA 1HNVB 4P6QA 3MMAA 1JXVA 4EBEA 3VGSA 3EGVA 3UN5A 2FDNA 4CT9A 4DV0J 3H5XA 3A8IA 4IRKA 4K0KF 2ZEJA 3R7BB 4E8UA 3J81U 4HHHA 3R6GB 2D3OR 4R25A 4KBIA 1QLNA 1M5SA 2FTRA 4U8VA 4Q8FA 4F0KA 2E5GA 2M8HA 2OFHX 2EG1A 2VDHA 4GVLA 4ED8A 2MQPA 1D8YA 3P8BB 1B0VA 4I6YA 2VQEJ 5J2QB 3BPDA 3I5BA 2PI4A 3RBDA 1VQOS 2JEIA 1FFSB 1WWHA 1C4CA 3T5JA 2A18A 1PGZA 4BS2A 5KFKA 4Q44A 1ZOTA 4ECTA 2Z56B 2CQ0A 1HWIA 4I67A 2EWHA 4Q5VA 1I3OB 1RBOB 2B7CB 2MQLA 4KGZB 4QQBA 5B0DA 4DWIA 1GXTA 1HWJA 1RWMB 2E1AA 2B8QA 2WAQD 4OJHA 4OQJA 2ADBA 1MN9A 1T05A 1UVMA 3L9ZA 4XTTA 4EUVA 1CJVA 4C3KA 1FVSA 2LFVA 2E44A 1YZ6A 1TL1A 3KJFB 1I5OB 3DKDA 3KFWX 4K59A 1UW4A 4ES1A 2FVPA 1FI4A 4C3MA 3KK1A 3O6QA 4YQWA 1GX5A 1VQ4S 4ELVA 3PYGA 5KFBA 2J9DA 1T9WA 1UJ5A 2BJEA 1NH8A 2HS3A 1EP4B 3ZTQA 4WFZA 2QL5B 3T1YJ 2C28A 1VQ8S 4IFVA 2AJQA 4RNNA 1PO6A 3NGRA 3P3DA 4EWTA 1IWAA 3RB6A 1VQSA 2IVMA 2JFDA 4FYXB 4P7VA 1NNDA 5CQGA 3MEEA 4QBUA 4DV2J 1NB7A 1S1VB 3LQVA 1PCAA 5RUBA 3G6XA 1GTEA 2CPYA 4ILLA 4DR5F 2V8PA 1RAFB 3AJ2A 4DR2J 3OR2A 2OJ3A 3NNCA 2UUWA 5IT9Y 2F1FA 4FYVB 2FLNA 4DCJB 1F3FA 2RKIB 3KUEA 2AHOB 4XAKA 2DCLA 2V2KA 3DOKB 2UVWA 2DRAA 1GAOA 1Q1KA 2D9OA 4F7VA 3GCXP 3ZZOA 4LFBJ 5AXNA 2ZHAA 3PV8A 3LALA 2PA8D 3BGRA 3GIIA 1NSAA 3NS7B 4NYZA 2CZ4A 2MB0B 2Y1LB 1LWFB 1UPMB 4NPOA 1U1PA 2GO8A 4Z7CA 2EFPA 1VRTA 4DL2A 4CO1A 1R7IA 3PX0A 4MKVA 3CT9A 3NWRA 2CNNB 1Q7LB 1ZAVA 1JQGA 3MEKA 4LRDA 4M8LA 2XS5A 4OZ1A 2ASLA 3AOCA 2ZBRA 1TUVA 4JBCA 4OI1A 3KJVB 4B9NA 2HRYA 1X9WA 2P8IA 2PEHA 4I2PA 3QJJA 4DUZF 2R8HA 3O2IA 3AXMA 3M9NB 1VGYA 1KLMA 1YJ7A 4W98A 3CCSS 3HJFA 1NHKL 2K1RB 3GWCA 4AL6A 4JUZA 3AAWB 2IBKA 4HACA 2R7UA 2O01C 5KFZA 1CJTB 1RT6A 3MR5A 1SJ3P 1TVRB 3R5CA 2YY3A 1N5YB 1FRJA 3BKFA 3Q2SC 2B9EA 4LT6A 5DQGA 2OP5A 3FMWA 3P5TL 1N33F 1HPZB 1DQAA 1HBUA 2ILZA 2KRBA 4YB1P 3L7PA 1F2GA 1KFSA 3W7BA 3KNAA 3NEKA 3TA1A 2W2QP 3SSQA 1AFIA 3FKBA 2ATLA 3DHXA 3G82A 3MOJB 1BQXA 2BMBA 2GMJA 1UEKA 3OW2R 1TR0A 3MR2A 1LXJA 2DGVA 2JC1A 4ZN1A 3OV7A 2VPYB 2L41A 5CD4A 1Z4UA 5IWAF 3QSIA 4CH1A 4ZPVR 2K2PA 2LDIA 3AB4B 3BGRB 4QU6A 1HBMB 1NBEB 3K5NA 4EZ6A 2WVFA 4USIA 2RUGA 1RT1A 2VG5B 4KE5A 4AFFA 1ZA1B 1PSDA 4EEYA 1J27A 2EPIA 4P52A 4UF4A 4DL4A 2ZZNA 1YBTA 3AOBA 4G1QB 2XMAA 2CJBA 5GMEA 3ILIA 2GA7A 1OSDA 4C6AA 4RU9A 3CC7S 1TKZB 5IC6B 1XERA 2Z2LA 2A2CA 4A46A 4JV5J 1YBAA 2FUG9 3HSDA 4QIWD 4NLYA 4UT4A 2OIHA 2FGCA 3KLGB 3VTIA 2XQCA 3CIMA 3BSNA 2NYIA 3CE8A 2HNYA 3L7OA 3RG6A 2F40A 4AL7A 3Q0AA 3P6YC 2MGZB 3CCJS 2WBMA 1C2PA 4CO4A 3M32B 3HHLA 4RW7B 3F73A 1WOPA 2CQDA 5LSOA 1VQ6S 3K0JA 4G1PA 3M2UA 3MM5B 3N28A 4YN3B 1QAIA 3DLJA 2B56A 3T5HA 3IWXA 3QT7A 2FJXA 4DN0A 3NBPB 4G6VB 2YWKA 4M5NA 4LF5J 2P9CA 3HSGA 3MECB 4ITSA 4J9VA 2QMUB 2ZITA 4D3GA 4CRJA 1EETB 5DG7A 2VHGA 4MT1A 2YWHA 4CLKA 3JSYA 2HW3A 4ZPAA 3QJPA 3MCMA 4WIIA 1U6FA 2IPOB 4WTYA 3RBZA 3GB0A 4X65J 2ZH2A 1D9FA 3PO4A 2XLKA 1NSKL 1ZM2A 1RT4B 1U8WA 3HHLD 3TR5A 1SC1B 3JB9k 1IBMJ 4DF4A 3J81Y 2B3TB 2VOOA 3ICLA 4FF4A 3PIPQ 4Z7YA 5BYSA 1J5OA 2JWNA 3UDEA 1KTVA 1T7PA 3PO5A 1Y7PA 1A6LA 1CC7A 2DNLA 3KLIA 3MFIA 3DC2A 3AXKA 3NKYA 1F1BB 1Q0NA 1IQTA 1WEZA 3J7Z5 3VAGA 1K1QA 2N7YA 3B6BA 1AROP 5C42A 3BQ1A 2QZ8A 1IKVA 4USJC 3NOCA 2E5LJ 2BJDA 2W01A 4R8UA 5H9EJ 4R5PB 3ZTPA 4ZPCA 2GQCA 4XO0A 1ZM3A 3AFGA 1F9FA 3POTA 4XDDA 3C16A 1FDAA 3BGLA 4O3NA 3E01B 3FSYA 3MPVA 3EICA 2R8KA 2A6OA 2V8VA 3UDLA 4DXLA 1CJKA 2H48B 4C48A 3OVBA 1S49A 3GIMA 3D1HA 1JLFA 4NLVA 4ICLB 4X84A 1X4CA 1T11A 2P9EA 3LGHA 4CQ1A 4ZVRB 4JI6F 3K59A 2XCPA 1KBRA 3OQ2A 4KQZA 4R5PA 2YTCA 5IOLA 4M5KA 4QW9A 2QA4G 1X31C 3CO9A 1Y5LB 4LFCF 3SCKE 3MAAA 2HFUA 2OELA 4CO2A 4YFUA 2B4UA 3DN9A 4ANDA 4O3RA 4PYAA 2NPIA 3ETOA 4PEOA 4X4SA 4ZP9A 3RBXA 2BW2A 4K5SA 3LP0A 4BBYA 3CDEA 1S0OA 3H2UB 2IM1A 4JV5F 5EX3A 3EXYA 3UPFA 2G4BA 4JI3F 5LM7E 2CQ2A 1S9FA 3QWPA 1RHJB 1O51A 2K06A 1ZZFA 2G13A 1KLNA 5HMWA 2NLWA 1U1RA 1SJQA 2OO4A 2KRRA 1KFDA 3TJ9A 4CM2A 1NDLA 1VC0A 1AYEA 4IFYA 2XGPA 1ULRA 1KKHA 1HW8A 3B78A 1MU2A 3AQOA 1UEUA 2GQ2A 2HLTA 3LP2A 3A8JA 2VBYA 4I4BA 4NRTA 2RU9A 5F3ZA 4OHYA 3BYPA 1AT1B 1FTRA 3GIRA 3PNIA 4I56A 3T41A 2PO4A 5D0EA 2HHVA 3CJKA 1FO1A 3M30B 3LW5C 1T9XA 1I94F 4C9DA 2ZKUA 5LSLA 3KLFA 4LSNA 3BQ2A 3P4UB 4DSEA 2GVZB 2MKJA 3T6BA 1DQ8A 2ZJQQ 2LDYA 2EFQA 3D2WA 2IA6A 3GJQB 1RDRA 4ILMA 3GONA 3EGZA 3W65A 4U7UK 3G82B 3OJSA 4FXWA 4F4YA 4IRDA 2HHHJ 2CPXA 1HNWF 1R3NA 3GJSB 4CLYA 4C8YA 4LRFA 3RZAA 2MGZA 1EB0A 4ETZA 1JNZB 5A8RB 4K50A 1S4FA 3M6XA 4BDPA 4C11B 1UFWA 2GJIA 4ZP8A 3IC1A 5IV4A 2DY1A 1VC5A 4URSA 5CYQB 4DJBA 4J9PA 4DR7J 3ILJA 4HACB 2OD6A 3M6VA 1JLGB 2DNOA 2RNEA 4RX6A 3ULHA 3C2PA 1JNRB 2VQFF 1D8ZA 4X2BA 1B64A 1OJ4A 1U0HB 2EKNA 1NHVA 2Z2ZA 4DL3A 1T0TV 2W2OP 4PG8A 3D1OA 3CC2S 1HQUA 5K9FA 5KG2A 2DPJA 4C11A 3ENWA 2CQIA 3Q83A 4RWXA 4USWA 5LSRA 4CH0S 1WSVA 4ED4A 2Y8WA 3OR1A 4Y3CA 4YR2A 1C1BA 3MTKA 4DL0C 1I1GA 2RDDA 4DV1F 2MYFA 4LF9F 1TFWA 1YJUA 1U1LA 2R7QA 1HI8A 2P9GA 4J91A 3TEGA 2LA6A 4HYKA 1OWXA 5MAOA 4FNIA 1QAJA 2NXNA 5HL7Q 3AJDA 3KUGA 3H0PA 3C6UA 1DURA 2R2UA 2R7TA 5DQIA 3OL6A 1HNXJ 2ZE2A 4XPCA 3H2VE 3MMAB 3VQTA 2XLIA 3MPDA 3H25A 2YQ0A 4FS2A 3RB4A 3FMBA 1GMUA 1ZPVA 4IOCQ 3U7JA 4DUTA 4IQXA 1VRUA 5B0GA 5F8GA 1KN6A 3QFWA 4WE1A 1H0HB 4C0OC 5HROA 4RW4A 4ZJQA 4DQIA 2RUSA 2HFSA 1PYOB 2HK3A 1S97A 3F44A 4NYPA 4ECUA 4FF2A 3SCJE 3US5A 4YY3F 4JI3J 4B3OB 2X3GA 3R1HA 1SUQA 3V4IA 3UVJB 2XLJA 3I0RB 2WZ1A 3PW0A 4DBQA 3OXGA 4A8MP 3D7SB 4WK3A 1TKXB 1N6QB 1BGXT 5ETLA 5HP1A 1EZZB 3IAS9 4NLPA 5EX0A 2QV6A 4KT0C 4LF8F 4ZDNA 3HKWA 4JI5F 2DNPA 4M5IA 4DL5A 1XNQF 2GMLA 4RUBA 1TL7B 1YJVA 4ZK7M 4ZCIA 2FHMA 2OPRA 4UOHA 2AU0A 3CTRA 4A48A 2HQDA 4O0NA 2YWEA 1CG2A 5IXUA 4M5LA 1G4CA 3DGPA 3N6LA 2BDPA 2KL8A 4EYIB 5EWGA 3PZPA 3D0IE 2IRUA 4WFAQ 2CG4A 1RHUB 2MKYA 1UL3A 4XPEA 4CIOA 4KV8A 4C8NA 1F9HA 4PAAA 1WEXA 3EE3A 1H38A 2IYIA 3ZTSA 2UUTA 1ZZNA 1R0BG 2YKOA 3M8QA 1RI7A 1CJKB 2M70A 3MAHA 4EZ9A 3NGKA 1LW0A 1NZAA 3GV7B 5B0CA 3G8SA 1SB6A 1W26A 4ECWA 4DSKA 3FDSA 4ZLPA 2V6AA 2VZ9A 2UU9F 1X4DA 5F8LA 1X5SA 1AW0A 2YPZA 1YLXA 1R89A 4DZ6A 1U2FA 2ADCA 1TFYA 3TVYA 2IDEA 3V5RA 3GU0A 4U7UD 2YX7A 2ZH1A 1CVJA 3J7A1 4LRBA 3PR5B 1Y3JA 3CD7A 3DGPB 4GVBB 2XYPB 4UOFA 2CZVC 3MPYA 3VAIA 2KJWA 1APSA 2KB2A 4GO7X 2JVOA 3FZBA 3I4PA 5ETRA 2I0XA 3B4DA 1CJVB 2DISA 4B3MF 2XSJB 1KOHA 4JI4J 4BC7A 3DOLA 4ZPDA 1WHWA 2BRLA 4U9RA 4A8QA 2DR6A 1RHKB 2XM3A 4O23A 2AD9A 2FB0A 4ZCKA 4DR3F 5F9LA 2AQ4A 3KLEA 2VODA 3UQSA 3DOMB 1DRZA 4B3OA 5I4MA 1U48A 2DJWA 1CPZA 2Y1RI 4P2MA 5DS7A 2MMYA 3MI7X 3Q2TC 2XG8A 1KS2A 3SQGB 1X0PA 5DO2A 4ED0A 3BM7A 4JP8A 2Q79A 1U6ZA 5H1SV 2E5IA 1TK8A 3DLEA 1Y00A 2FVCA 1RE1B 3ENAA 2C2DA 1RHQB 1KVKA 1WEYA 2V0NA 3EGNA 1NPPA 3ILLA 3ISND 1IJEB 4OJ3A 1MW7A 1EAYC 2BE2B 2OPQB 5F0UA 4UQGA 5DETA 3RAQA 3GCWP 1G7CB 4RL1A 4CLWA 3DYAA 4NYOA 4B08A 5FDLA 2DRBA 3LWLA 2D9PA 1S9GA 4TU9A 1RSCA 2X1AA 1UWBA 1U49A 4JI7J 1YDLA 3UNGC 1T8EA 2XMVA 2R7VA 2Z4PA 2KVIA 2E7XA 1SC3B 3FEXB 3LF0A 4CO0A 5HMXA 5JUMA 2QA1A 4ZKAA 3NL0A 3B8HA 3GSIA 5J1EA 4GC7A 4QCLA 2E5JA 4Y28C 5BR8F 5JMNA 3R97A 3MGJA 1T9YA 1HA1A 2GMHA 4HEA9 4CLFA 4EI2A 3GE9A 5U47A 5KFEA 2YWFA 2F4VF 2ROEA 1QUPA 3PEHA 2XMTA 3R5DA 4DF8A 1S1VA 3R5GA 2F9JA 3OL9A 1DBDA 4OZ5A 5D0RA 4ZN3A 2DXEA 2EXUA 3BZQA 4IFVB 5L8RC 2YQ1A 2IVFB 4ZVSB 2CPDA 1T9VA 4MFBA 3J80U 4B9LA 2B4PA 2NXUA 3HHKA 1LWCA 2QLWA 5DDRC 1JLEA 4Q0BA 1S7HA 1W7WA 3ZZTA 4FYDA 4ED1A 4B3TJ 1N52B 5L1JA 1FRKA 1T3OA 2W7AA 1FVQA 2XMJA 1FWPA 4KFBB 2RHQB 2A6MA 4YP3A 2GHVC 1NM2A 1FRIA 4P73A 3OD2A 5CABA 4RUCA 3NOGA 2DNNA 4P2FA 4LIRA 2EBEA 2CPIA 2EVZA 2QLJB 2ZWOA 3GFYA 4NA3A 7FDRA 3OTOF 2DNRA 1HWUA 4KO0B 4FPIA 2GQQA 1TV6A 4OV6A 3TOQA 2HNZB 1D1UA 3FQLA 2ZHOA 5IM0B 4W4MA 2GVDA 1M0SA 2BJ9A 3R5BA 3VHQA 4X62F 4X66F 1M5VC 3TNVA 4PRFA 2PE8A 1P1LA 1YSJA 2FHKA 2H65B 3I6PA 1CC8A 2P6SA 4PABA 5E5NA 5K20B 5J2PB 5KFNA 4DR1F 5F8JA 1CJUB 4IH5A 4OYWA 4ER8A 4NLUA 3QFHA 2VBXA 1N36F 3OFGA 3PX4A 2HHTA 3R5JB 2HQIA 1ZYQA 5F8MA 4E98A 1NO8A 3HHNB 2V8GA 3H2LA 1MLAA 1S59A 3M2VA 1E6YB 5K14B 2OAUA 1CULB 1DLOA 3ZZUA 2WCXA 4RNOA 4ENOA 2ZE2B 3AA9A 2FD2A 3A12A 5ETSA 5DLFA 4Z2XA 4C8KA 2NQPA 2QN6B 3U1NA 5KT2A 2HFOA 5HLFA 3RAXA 2WVEA 2YNIB 3GP9A 2OLWA 2Q43A 1X9SA 4X4RA 2CWXA 2VD3A 1H2TZ 2VFUA 1FF2A 3VAKA 1U6BA 2E7WA 3HVAA 2Y1JA 4XDCA 5D15A 5EHHA 5T41A 1N34F 2DPIA 3CJQA 1LW2A 3R9LA 1AUDA 2BVZA 2VH7A 4LREA 3QQCD 3V6KA 2F3JA 2ZBIA 1VBZA 4FS1A 3D6HB 1Z2ZA 4DL7A 2I8EA 4OHWA 2OMLA 3SEOA 2V63A 1SUQB 4D3HA 1FKAF 2VOPA 3N4WA 1RTIA 4K4TA 1BLUA 3W9JA 2KXFA 4DV2F 3M8PA 1Q95G 4PXBA 3IR7B 4X65F 3KMQA 4O4RA 2KT3A 3K5MA 2J0QD 1NCLA 4F3MA 4WKRA 3I56S 2QX0A 3PFEA 4C8ZA 2DK2A 1YG0A 4QPTA 2JDJA 1TK0A 3ZZYA 1SKWA 2WTFA 1LW2B 3W2VA 1RWXB 3TQ1A 3HFVA 2N82B 2L3MA 1BWVA 1FJ7A 1Z1ZA 3QGGA 4J9QA 3G96A 3EXCX 1EHWA 1HQEA 2QLBB 3IBFB 1XQIA 1NK8A 2UXBF 4ZVQB 3MCOA 3OBIA 5D78A 1UFLA 2BABA 2J5AA 1FK9B 1P27B 4Y2CA 5KG3A 1VQYA 2HHQA 1S6PA 4ZP6A 2UVUA 3QPIA 2NXEA 2UUBJ 3CCLS 4K4WA 2GZOA 1E6YA 1UETA 2RF2B 1LK7A 4FPRA 4CNZA 2R9LA 2UXDJ 3OVAA 1RISA 3VVUA 2BV3A 2FJEB 4DUYF 4JV1A 1LOUA 2AJ2A 1SQGA 3PDNA 5KFCA 4LF4F 1IXKA 5KFSA 5GAHU 1Q8LA 1UVLA 2ZOFA 2FGOA 3O44A 2X51A 1YITS 1HBOA 4PG6A 5J1EB 3UR3C 1JLGA 1UVNA 1FRHA 2U2FA 1PJ5A 4KGKA 4IG0B 4OJ1A 4OYXA 1YBUA 1SH2A 4EU0A 2DHSA 4H4KC 4HKQA 1KVJA 1RU2A 1HNXF 1NXIA 3I31A 1ZS6A 2CJYB 1IKXB 3QLHB 3LGMA 2DHXA 1VR6A 3OJUA 2OPQA 4A8XA 1VBXA 5KFMA 2DR5A 3UNYA 2D41A 3CCQS 4J9MA 1H2UX 2B51A 3U1LA 1H2VZ 2CPZA 2RT3A 3SIPB 2HKEA 5D4PA 2L9WA 2YKQA 3M7VA 5E2QA 1QAXA 3O5TB 2M7SA 1JXEA 2GX8A 2PGCA 3SSSA 1SIWB 1WKKA 2MJUA 4CYUB 2W8LA 5F8HA 2Q3PA 3JTOA 2UVRA 1HD1A 5KFQA 3AQPA 3PM9A 1WDDA 1BY9A 5C25A 3C3LA 2IM2A 3DRPA 1GMVA 1RTIB 2KVQE 3MMBB 4G3IA 4DR6F 2IM3A 1RLDA 4ZA1A 1K47A 2C2OB 1EIYB 4E0DA 2DHHA 4ZIWA 3RTVA 4NXNJ 1JLBA 1RB0A 5D6GA 2X1FA 5LMUJ 2EFGA 2MSTA 2OMOA 5IC4B 4KH0B 4NA2A 1RT1B 2H4WB 1X0FA 4C0BA 4WP3A 4DV7F 1FRMA 3Q8VA 3EZ5A 3V81A 2WSCC 4LQ3A 4LFAJ 4HR2A 5FDLB 4Q43A 3CJ5A 1F5AA 3C6TB 4N41A 1DTQB 2AEFA 2HZAA 4USHA 2VJUA 5B0BA 3RB3A 1WI6A 1O8BA 3AJ1A 3BN4A 4DPYA 2AZ1A 2V4QA 1P9YA 1RUSA 1BE4A 5LXRA 1RADB 1JWWA 3HVWA 4H54A 1PYSB 3MAAB 4UOGA 1NK9A 3BKTA 3MZIA 2YXLA 3CJ0A 3F41A 2YNHA 1L3KA 1EJ7L 2AW0A 5HK4A 4OYOA 4YHHF 2UXBJ 3C15A 1H98A 2JLEA 3NS6A 5H9FJ 5E7OB 3PXGa 3OTBA 4QWCA 1V9OA 1CJUA 2ZBCA 4JI8J 4W92B 2BKNA 3BF4A 2PA3A 2GJFA 1F5CA 3JSBA 1WACA 3PJWA 4MIWA 3ZFVA 1ZETA 3JQKA 4TY8A 3P5BP 3E8OA 4NI2A 5B7WA 3P96A 3DRSA 5T14A 4LSLB 4X4PA 4OYZA 1P8GA 4F04B 3WX8A 3JYTB 1XMQF 4KRWA 1RT3B 3M9MB 1VDHA 3GIKA 3QRRA 1S6OA 4OYPA 1AUSL 3HZEA 3CEDA 2OPRB 1NK0A 4RW9A 1S77D 1VOMA 3N6MA 4DFJA 4KFBA 3M6WA 2QL7B 4L73A 3IP0A 2E9ZA 2G0JA 2HFVA 3QT5A 2V2ZA 2QMWA 2HIQA 3TUJC 3OL8A 1J5EF 5DG9A 2BX6A 2DD8S 2DR8A 2CVEA 3UDVA 4W90B 1GX6A 4JI2J 2C2NA 4ID8A 1OIAA 3KUHA 2GVZA 3K2YA 3DLKA 3RW6A 5CH7B 4EO6A 2J7WA 1VHFA 2VG7A 1XEZA 5ETVA 4MK7A 3VAHA 4J9OA 1F2HA 3NNAA 1GT8A 4Q2LA 3KXDA 2CADA 4OLPA 2W8KA 3EGWB 3ZO7A 3RU0A 4DV3F 1LEOA 3A8EA 1RAIB 2EW9A 3QZ8A 4YY3J 1MU2B 3GFZA 3LP2B 2DNKA 3SV3A 2KO1A 1URNA 3BH7B 3KHGA 2G0CA 2JSXA 4P9SA 2ZH7A 5LMUF 3R7SB 2DH8A 1RCXB 1RCOB 1MROA 1VHIA 3EUNA 1SKSA 3HDSA 2UUAJ 4PUOA 5EN1A 5LXYA 1PJ6A 1VS3A 3HHLC 4OZ2A 5M2PA 2XGQA 1UZHA 3CF5Q 2CQ1A 2N4DA 1RWKB 2XI3A 3MEDB 3PIOQ 1UKUA 3M4XA 4L74A 2C1EB 4F2SA 3SI8A 3DHWC 3TAPA 5B0FA 4OFZA 2ZNYA 5AJ3F 4B9TA 1OMSA 3G87A 4K4VA 1UVKA 4DFMA 2B4OA 1WC5A 4ZOSA 1AFJA 2FJAB 1TELA 4PG7A 2NXCA 3B54A 3MM9A 3H98A 3H42A 5FJ4A 4NCBA 4DV6J 1H7XA 5SZTA 1FX4A 3LH2S 1A0OB 3HVTA 3A4TA 2FIUA 1M5HA 4MIBA 5AT1B 2IJNA 3HZGA 4P2SA 3DOMA 2NCKL 2HRUA 3BS9A 4HH1A 5K8OA 1WHYA 3B82A 4C7QA 3IN5A 2RU3A 1CJTA 4ERDA 2K3KA 4N5SA 2MTLA 3TRGA 4CLTA 4NI2B 2EFNA 3T1YF 1D9DA 1N48A 1YVFA 2ZJPQ 2HVHA 4DCOB 3ENQA 2HQGA 4ED5A 1ICEB 4ED3A 2D3UA 4MK8A 2XY6A 2G2ZA 4ECZA 2PD1A 3MUVP 3M8QB 4PR6A 3BV8A 3RR8A 1K44A 1I51B 3QGIA 2ZH6A 4AL5A 2KTQA 5C42B 4FP9A 1V5VA 5KFIA 2MZJA 6FDRA 3FEYB 3DLBA 2XMKA 3TA2A 4ZHRA 3BGUA 2ZH5A 2E9TA 3H8YA 4DG1B 4HDGA 1FJCA 2DHGA 4IO9Q 4GKJJ 1XTZA 1SQEA 2IHR1 4K2JA 4NLQA 1Y10A 2F4FA 3OR1B 3HSJA 3RRHA 1YTYA 4IR9A 3W63A 3IA0A 1JLCB 2WSEC 1J5OB 4H4MA 1VQ7S 1WOOA 3N9UC 4KB7A 2ZJRQ 4IH6A 2JZ5A 3FEZA 5C24B 2AMCB 3PKMA 2F9DA 1WNEA 4GC6A 5KFHA 4DU8A 1N0VC 1YI2S 1TVRA 3BSCA 1N5YA 1JJHA 2EG2A 1FD8A 1ZAWA 3GMGA 5IQ6A 2XO6A 1NJYA 3W61A 4ECXA 1W2BR 2HMIB 1U1KA 2KDOA 4B3TF 1FT8A 5DRKA 2GW8A 4FXVA 3WQPA 4AE5A 1MSWD 1S4EA 4KY3A 4AXIA 5HROB 1RT5B 2V4RA 3NBPA 1XNRJ 4E2FB 4ELTA 5EUHA 4JV2A 1U24A 5G0RB 3CB4A 5JJBA 2JLFA 3M2UB 4X62J 3MM5A 3SBMA 1KRPA 4JYAF 2ZDOA 2DRDA 2MKCA 2JEGA 1ZPWX 2BM0A 4I1TA 4QIFA 1M5PC 2LQBA 2CKWA 2C3YA 2MQ8A 1TKXA 1MWQA 1NDCA 1U02A 2ZVSA 3UWTA 2JH3A 5DJBA 2W24A 4Z37A 6FD1A 4X4OA 2BXJA 1VLOA 3CMQA 4QZVB 5J1PA 1N33J 1K8AT 3J7YI 2X3DA 1RT5A 4HLBA 5BXIA 2DVIA 5D4OA 2R8GA 5CXTA 2PIIA 1RA6A 5C2CA 4UQTA 2PT0A 4F26A 5KOWA 2BKOA 5KFUA 2LMIA 1PBUA 3WHIA 1VBYA 1FJGJ 3CCMS 1A9NB 3G8QA 2DXFA 4L6V3 4OLOA 3T5KA 5AE2A 1IBKJ 3FGVA 2HQFA 3PFOA 4GO5X 4OI2A 2CAJA 4QYRA 3BPSP 4MAKA 2JNJA 4DEZA 2RDJA 2XNRA 3OPKA 1DAXA 3M8RA 4DDFA 3PCOB 1TUGB 2Z58B 1WF1A 2WW4A 4LF1A 4DUZJ 4I6WA 1MWZA 3FJ2A 1JKHA 3JSMB 1FXDA 2HIYA 1T9TA 3MAQA 5B0EA 1B7FA 3H5YA 4IUFA 2BEFA 5K5MA 2HVZA 3HHDA 2ILYA 4CLPA 1WKJA 1FK9A 5EWFA 4RUAA 2DNZA 2RQ4A 3V6DA 4KPYA 1RT7A 1OO0B 2CG8A 1HQEB 1NPKA 1CLFA 1LKZA 4H4KA 4X4QA 5L1LA 3CPWR 2FC9A 1FDDA 1RKIA 1SCJB 5KAKA 1RTDA 2FHJA 1TL3B 3N0VA 2J0SD 1U0HA 4J9NA 2AJ4A 3ZC4A 3TX0A 2JFKA 5F8NA 1RWNB 5M2UA 4PPDA 4WXWA 5D0HA 3LO3A 4LSLA 5ADZA 1XWLA 3KLFB 4DS4A 2M3DA 1XN9A 4ZVFA 2VFRA 2DO0A 3OTDA 2QG9B 1VI7A 1Y9OA 4B9MA 1KNZA 3AT1B 3PW5A 4NXMF 4ZLLA 3MMCB 5K8NA 2QFJA 1NLKL 5HJYA 2R2TA 4L76A 2FJWA 1UP1A 1FERA 2GS8A 1M5OC 3C46A 2ZH3A 2CQPA 1KONA 2MLXA 3RAMA 1IBMF 4B3SF 2MY7A 4N77A 4N8OA 1C4AA 1R27B 4CT8A 1FEEA 1XR6A 3DDIA 3OSNA 2ATCB 2XY5A 1SIZA 4WFXA 4BHQA 3I96A 5J2NB 2OHDA 3S6EA 1HMVB 1Z2LA 1U2CA 1PYTA 1UAWA 2HEKA 3IR6B 3HT3A 3TAQA 5A8WA 1SJ4P 1RLCL 2ZUAA 5HLFB 3H5SA 4DG1A 4ECQA 1RYRA 1TL4A 1WC1A 4J9UE 2M4MA 3MXHP 3P49B 4OIXA 3GV5B 2VBZA 3TX8A 5L1KA 4NLWA 4WYLA 1U1OA 4A8WA 2QEXS 1V6HA 4DR3J 3RYLA 4ECRA 1LQ9A 2ZC4A 4ECSA 1Q53A 4UZCA 2YX4A 1LWEA 4IG3A 4WP9A 3TW0A 2R7RA 2RF2A 4UUWA 2MSSA 1S0MA 2J0WA 2LA4A 3D0HE 1N8RT 3I5AA 1C0UA 1RT2A 2E1MC 1PC4A 1RWPB 1T9UA 3POTB 2X7IA 3C8YA 7AT1B 1WF0A 1VYAA 2NZCA 4ZHRB 4PXEA 2HHPA 2V50A 1R0CB 1DJ0A 2Z2YB 3KK1B 1SJFA 1NUEA 1REGX 3SQOP 3WZ0A 3E51A 2IBOA 2CJKA 4DSJA 4OL8A 1GNKA 2B7BB 3KG4A 1JK9B 2PSZA 1M1KT 2AZ3A 2JLGA 2BJ3A 1S1UB 1RAJA 4HTJA 1JKHB 2BQ3A 1R31A 4YMEA 2DYAA 3I87A 2OTJS 4CO3A 4LF4J 3D9BA 2CXEA 4TVAB 1TZ0A 2CQGA 9ATCB 2QIFA 3KK3B 2VB6A 2BZ2A 4CH7A 4CTAA 4I2PB 1VMBA 1PKUA 2M9KA 1FFGB 4PWWA 2UXCF 4XK8C 3K17A 3TVKA 5CCMA 2GC8A 2BANB 2HPUA 5L9NA 5J2QA 1JLCA 4I64A 1BUXA 2ALYB 5CAAA 3LOUA 3TARA 3RB0A 4NLSA 1TAQA 3MM9B 4DN9A 5KFTA 4K4XA 1REVA 4OI6A 3W3SA 1RAAB 3FK4A 4DV5J 1S6QB 2ZD1B 2XB2D 4LUBA 3SCIE 5BJRA 1M5KC 3GJRB 4IKAA 3HXMA 2ZDPA 1SPBP 5CCLA 4JI8F 2FVSA 2MQMA 4RW8A 1WC3A 5ETKA 3JTNA 4U95A 3W64A 3OL7A 4KHPJ 1X5OA 4TNOA 1T3NA 5T7LB 2CNKB 2RSQA 1RT4A 1H74A 2V69A 3D6TB 2OEMA 5I42B 1DQ9A 3ONQA 2R42A 4H4OA 4O0IA 2FHOB 3CC4S 3FZ2A 4I7FA 3HO1A 2CQBA 3C14A 1GTHA 2C3MA 3RRKA 4F4ZA 4Y2KA 2HZVA 1RXOB 1WJ9A 1Q16B 5B0AA 5LL6d 2I2YA 3K8VA 1NEEA 4QYZK 3D54A 3M8PB 2VG7B 5HVHA 4LF7F 4FZVA 2KJVA 3LA0A 3SDEB 4X4UA 1HFEL 4ECVA 3R7NB 3AD9C 1VLYA 1X60A 1DARA 3MF5A 3Q8QB 4JI0J 4N56A 4RNHA 1QE1B 4Q2MA 3QRQA 4CLUA 2HNZA 3WIVA 2QYGA 1HBMA 3JQJA 2V94A 2MZQA 1BQNB 1MWYA 4WXOA 2VKRA 1ROFA 2WK4A 2LU1A 2YKMA 3IM8A 3SFGA 2CNLB 4P72A 2O67A 1GXUA 1LNQA 4TN2A 3VAMA 2Y0BB 2D1CA 3CVKA 1X4AA 5AE3A 4F2RA 3CJSA 2DGSA 4LF9J 3H4DA 3A3OB 2A0FB 4LF6F 1BQMA 2B5JB 1NK6A 2GIFA 2HGNA 1RT3A 3H90A 4OHZA 1X4HA 2R3VA 2I6WA 1NDKA 2WVBA 3LAKA 4MFBB 4IG0A 3TUZC 3HI9A 1KSPA 1U47A 2XS2A 3IFEA 1CULA 5CZXA 1NHUA 3DI6B 2LQ9A 3KNGA 2IRXA 4LR8A 2ZFHA 1IR0A 2QA4S 4QWBA 2VG5A 3H59A 2GIQA 5KFJA 2CNOB 4TU7A 2W9CB 2JRSA 4N47A 5EGYA 2FC8A 3L4BC 2KM8C 5IV3A 4ID5A 1H73A 1S7IA 1T94A 2GGPB 2OEJA 1WD6A 3LANA 4NEYA 4RUHA 1VQ5S 2R2SA 2H1YA 1OY9A 2HWTA 2M0GB 2RD5C 1YJ9S 3BKUA 2QJ3A 3WX4A 2RB7A 2W2MP 3CMAS 1S72S 2WOMA 2OTLS 4V19X 4CM0A 3ZXWA 1WTFA 1Y0HA 4HI2A 3GG0A 3GPAA 4WFYA 2HYIB 2IC3B 4WFNQ 4J7CA 1JB0C 1JIHA 2O5DA 1BQMB 2B5JA 4I0WA 1TTHB 5A8RA 3CDBA 4K2XA 3VQSA 2YKNB 2DGWA 3RUBL 4DSLA 4DQSA 4OX8A 1HYSA 1KHWA 1VQLS 3PYDA 4LF8J 1U1NA 1S12A 2E29A 4C8LA 4PG5A 2D3ZA 3P45B 3TZWA 5H9EK 1G1XA 2A3JA 1IKWB 4RJVA 1WC6A 3NP5A 5AXMA 4KYZA 2JOQA 1WORA 3NCPA 4ZJLA 1VFJA 1WDTA 1HBNB 2LEPA 2E5HA 2AJ0A 4LJMA 1SKRA 4KHPF 1FDBA 3GIJA 3K5PA 3Q89A 2DR7A 1RWVB 4M5GA 4B3RF 4ELUA 5CZVA 5AXLA 5B08A 2MKKA 1ZBTA 5GMDA 1MMDA 3NY0A 2DB1A 3G6VA 4QPXA 2HMIA 1GXLA 3PACA 2NS1B 3LPEA 3C15B 2KYZA 1HL6A 2UUAF 4RW4B 2HWHA 1FESA 4QIEA 4LF7J 2CA9A 3OR2B 4CNYA 3CIZA 1HHQA 1T95A 2I5JA 2CJAA 2LYVA 2ZUGA 3R8YA 1SH0A 1N54B 3MEEB 4OHVA 3K57A 5AJ3J 1SL0A 1L3TA 3BDEA 1UWBB 3SXLA 4UY85 3CJ2A 3QGHA 4KKOB 3GR1A 3Q22A 3M2RB 4DV0F 2YVSA 1DFDA 4I68A 2ALZA 1SKUB 1S79A 3IO1A 1X4BA 3D1QA 1KR4A 4TKTA 1UJ6A 2G0IA 5HQLA 1L3UA 2Y0SD 2ZM6J 2PFFB 1KOOA 4Y6IA 4DOZA 1FJEB 3TYTA 4B02A 2NZ4A 2W9AA 4KH1B 3MMCA 3UFCX 3UE2A 3BO3A 2VQEF 2NREA 3TUPA 2K8GA 2CPHA 2HQCA 3FBEA 3DLLQ 2YPYA 3LTOA 2ASDA 1B0TA 2UVVA 5LT5A 2NR0A 2QLFB 2SXLA 4OI3A 2YNGA 3A3NB 4DLEA 3E01A 2VV5A 4NLOA 3L95X 2FZKB 2OSRA 3MCSA 4DPUA 1TL3A 1H72C 1CS4B 2MEWA 1FEHA 4LIWA 3DLGB 1S1UA 3EWGA 4RZRA 2ZHBA 4Y0FA 2W25A 2ZBPA 3DXSX 3Q8SB 3KHRA 3IWNC 1IBKF 4M5DA 5C2GA 1EQMA 4AQYJ 3TANA 1XMOF 1SI9A 3V6HA 2DNYA 4ZITA 3Q23A 1S57A 3V4MA 1VISA 2ROGA 2Y8YA 2HHUA 3CD0A 2KH9A 5DGBA 3RJMB 1G3OA 4HHJA 5DZ6A 2C2MB 3C6TA 4DPWA 1YJTA 2F8MA 1O0PA 8RUCA 2RAQA 3VGTA 3IBCB 4O44A 2HAFA 2WRMA 4WTOB 5KOXA 4QWAA 2COLA 3H20A 2XTJP 2BQRA 2QE5A 4NLTA 2WB1D 1T02A 5ETMA 3M2VB 2E9RX 1QUVA 1WOSA 4USMA 1TKTA 2LEAA 3BB5A 4YEAA 1N5TA 2NUUG 2QSFA 1KEKA 1U0SA 4ANEA 1CQMA 5DQHA 4Y00A 1S48A 1VRUB 2IYGA 2Z57B 2XYHB 3HD2A 1T03B 1P6TA 3TP2A 5BR8J 2P5VA 3DNCA 3KLHB 4PKDB 4QWDA 4O44B 3GSDA 3GYGA 1ZTTA 1U26A 3FFIB 1AZSA 3JAMU 2RQKA 4ZPTR 4YB7A 1TV6B 4WZMA 2MPUA 3G2XA 3OXLA 3KHHA 5FLXU 1TL7A 5AE1A 1HMVA 4IDKA 4ZPWR 2JC0A 1UFKA 2CJQA 2HG4A 3A1YG 3MPWA 3BR8A 1PBAA 4OYBA 3G4SS 1N56A 2HFNA 3BSOA 1DTTA 2BM1A 2MZSA 1A7GE 5KFDA 4LBIA 3QT8A 4MK9A 2DGQA 2UZAA 3TWZA 3DLGA 2QRRA 2CPJA 3QZ7A 4ED6A 2X1GA 3CJRA 4NZ7A 1MG7A 4ZS6A 3NGUA 3KLVA 4WCEQ 3OFFA 4TY8B 2WBRA 4TYAA 1LK5A 4JV0A 1NJIT 2CJXB 3TJ8A 5HBMB 2V67A 1RWOB 1CQNA 4LBHA 1X5PA 4WE1B 5CYQA 1VCTA 4FVCA 3SFUA 1DTTB 1TMJA 3UR0A 3UD5A 5F9NA 1NKCA 3UI3A 8ATCB 2RH3A 2XSJA 3CSKA 2CDQA 3EDQB 1C0TA 2V2VA 3MEGA 1IKWA 3MM6B 1FKOA 4O3QA 2DCUB 4DR2F 2UUCF 3R3TA 1LWXA 1XBWA 3CW2C 2MKHA 3TZZA 3I9V9 3G6YA 1S6PB 1IVZA 2N7CA 2W2NP 3V2UC 3EZOA 3IGNA 3CCRS 1XK8A 4RKUC 1Q81T 1JLEB 2ZZTA 4EMDA 1LWCB 1C1CA 2D74B 3QGPA 1XMOJ 4OYMA 4MH8A 1IBLJ 1NKBA 2QMXA 3R2CJ 3NMRA 4DLGA 2KFZA 2F4VJ 3GLJA 3U02A 2HVEA 1WF2A 2VA2A 4LVOP 1RJJA 1V3ZA 2GGPA 2LKZA 3MM8B 2MQQA 1CEZA 1NZ8A 1QY7A 2ABYA 2W7PA 3VGUA 3W1YC 1WC0A 2JHEA 2W9CA 1S9EA 2F65A 5CYJA 4PUOB 1JLBB 3UW1A 2PC6A 1YHQS 5CHCB 2V4JB 3ITHA 3TAMA 1QSLA 1QD1A 2VPZB 2J9EA 2BOAA 4HT7A 1O6XA 2FVQA 4M94A 2LXIA 2B9YA 1B70B 1OS5A 1BHNA 2ZH9A 3OTOJ 3BGOP 4WFBQ 1HHTP 2N3OA 2AYBA 4PWDB 2DIVA 5GAHI 2W9BA 4FKXA 1TAUA 1YWXA 3EVMA 3NGTA 3BQ0A 1G2EA 1K0TA 2YKMB 5A2QY 3AH6A 3FBFA 3FBBA 4KIAA 4MJKA 4MKAA 4P2XA 2C42A 4NLDA 5LMNJ 2O66A 1NPRA 3HKZD 2VONA 5HP1B 3OLBA 1ELOA 2YNIA 4L72B 4TQSA 4OHXA 1QE1A 2E1CA 2DGUA 4TU8A 2WVCA 3MR3A 4FYYB 2KZMA 2BRKA 2XO7A 3FSIA 2DIUA 4U8YA 1U2RA 3WDOA 2OSQA 2I38A 2HRTA 3CJKB 1U1QA 1NJZA 1RABB 1N32J 3W8GA 3IG1B 3KJQB 3O3LA 4QJVA 5A0YB 2XWXA 4QR2A 3U27A 1LW0B 1RAOA 3HLUA 1SJRA 3MM8A 4L3NA 1VQMS 2KT2A 3W8PA 1EARA 2YBVA 1BC6A 1OYDA 4NA1A 1N5VA 3D68A 3DRXA 4I6AA 4ED7A 1R8PA 2AIRB 5C24A 4ED2A 3D66A 4FN5A 2J6UA 3HJVA 2ASJA 1N34J 4DV1J 4OJGA 5ETNA 4ZVPB 1RAGB 4OMFG 2AWZA 4KKOA 2CPEA 1HWLA 1OY6A 1HBNA 5CD4H 1KDNA 3JTPA 4ZIVA 2J6SA 3DCAA 2J9CA 1Y4ZB 4DQQA 2CZ9A 1B0PA 3N79A 5D0GA 4JI0F 2J76E 3KK2B 2VA3A 2K3IA 2VPXB 2W9BB 3D3CJ 5E3RA 3DMJB 1AB8A 2H5IB 1KTQA 5JVHQ 4OYIA 1NH7A 2D7SA 4LF2A 2UUCJ 1S1XB 1CS4A 3QYYA 1B4SA 3IAM9 5FIIA 5A8KA 3GR0A 3L7UA 2YWGA 3DRSB 3EYZA 3EZUA 4DV4J 1QAYA 3SZ2A 1RYSA 3NMAA 3ETMA 2YH1A 1JJCB 2F5GA 1HLWA 4ES3A 3EX7B 1O5JA 2GNKA 2CQ3A 1FRLA 2JJ4D 2J9DE 1QSSA 4LRAA 2NYHA 2MXYA 3LGNA 2YKPA 4NMLA 3QWUA 5A76A 1FJGF 4C0HA 2MY8A 1HKAA 1MNEA 3BBFA 4LF5F 2GHPA 4O3SA 1SVDA 2V8HA 1LV5A 3PKYA 3KJVA 4A8SA 3KK2A 7FD1A 1OQ3A 1SC4B 4GKJF 4KC5A 5D3GB 4NXNF 4IRCA 2XYGB 3K5OA 4B17A 2VF3A 4F4AA 3BEGB 4DSFA 4OZ3A 4LR9A 2IC3A 4AYBD 2JL9A 3DYAB 1C0UB 1RT2B 2CQCA 2KN4A 2G9OA 4QIVA 2RDIA 5KFXA 2IRYA 2IIHA 4RW6B 4L3KA 2XZTB 1U25A 2HNYB 2NPFA 3I0RA 2R2RA 1KWMA 2FY1A 4IG3B 3BN7A 1YX2A 2MZRA 4LSNB 2LECA 4PQUA 1HR0J 4ZPBA 3QJLA 5B09A 1T03A 2HS4A 2RQMA 4ID5B 2KM8B 3E2EA 3PRDA 2XMMA 5DG8A 5BYRA 3J7AN 3T3FA 2WHOA 2B0GA 3H5UA 4IOBA 4EGLA 4C8MA 4YHHJ 1K9MT 2WONA 1FRXA 2C2ZB 4USVA 1TQLA 3E3XA 3SV4A 4A8FA 1FHTA 2QA2A 2RKIA 3ET6B 3DRPB 3MMBA 5HVGA 4MKYA 3DRYA 2M5YA 1OPZA 1S76D 3MOZA 3I0SA 1FE4A 4GRSA 4NOHA 4P74A 4YR3A 3M05A 4J9LA 5E3AA 2HBRB 3OUYA 4RLEA 1Q79A 2D69A 1IUJA 1IR2A 1HWKA 1HI1A 1WUUA 2BJ1A 4K4UA 2B9WA 2HVDA 4RW6A 4WWSA 5EDWA 1L3SA 1XNQJ 2BA9A 2OI2A 4FBTA 3IMQJ 4B3RJ 2EC2A 3DM2A 3IR5B 2XY7A 4IDKB 4DPTA 3HHLB 4OX6A 4RW7A 3QRPA 4GKKF 2Z30B 2NUHA 2XZDB 4M63A 2C22A 4I2QA 4JI6J 3G71S 2R7XA 1TL1B 2AEMA 4JI1J 4F50A 2BQUA 1ZAXA 2POKA 3CDAA 2A1BA 4P10A 5GADU 4QW8A 2AF6A 3DU5A 2MZ1A 3MFHA 5J2MA 2DBBA 5HVFA 2AGPA 3TAMB 4DR4J 2HBZB 1XR5A 5LOQA 2RQCA 2O3DA 1N5SA 3D28A 1TKZA 4DX7A 1HQ2A 2NSBA 2LXFA 5ITHA 1S9EB 1J2VA 5KFWA 3UD3P 3KJNB 1Q8IA 4ZVTB 5E41A 1RWWB 2MLYA 4RO0A 2DITA 3OT9A 4H4OB 4NCGA 3WBZA 2U1AA 2UU9J 2VG6B 4LBPA 5IT0A 2QGFB 3C16B 3UCGA 4USKA 5I3QA 1YIJS 1U1MA 1RTDB 2X1BA 3K89A 1VC6A 4ETXA 2C2EA 2N4CA 3V6DB 2Q6CA 2V5HG 4CO5A 4MIAA 3QNWB 1TU0B 2HK2A 2VUGA 2YQ3A 3KDOA 3M8YA 1SJ1A 3RBEA 3T5LA 1XC9A 3KLIB 4WJBA 1TKDA 1YRXA 2LU2A 2IDLA 1IN0A 2HURA 1WG5A 2AYEA 3ENVA 3FC9A 4M5DB 3UN2A 4YUDA 3K58A 3M30A 3W2VB 4DV6F 1HQUB 1B7YB 1NAQA 3D5MA 3WC0A 3BJYA 1GH8A 4AQYF 3CCTA 1NKEA 2H5JB 3CO0P 1UA1A 1JLAA 3D6FB 5HBMA 5KG4A 2J7KA 3C66A 4BLGA 4CWBA 3SQGA 3T9ZA 1M1HA 2YNGB 2XC9A 3O1LA 1YKWA 2HBQB 5F8IA 1Q8BA 3G8TA 4DR4F 2VC0A 3CJ4A 2QYCA 3FBCA 2DGXA 3NG8A 4ATNA 4ICLA 3U1MA 1KC8T 1JLFB 1N4LA 2CIMA 9RUBA 1HR0F 3C14B 4A8KA 4WZQA 3ILOA 4C4WA 4ZVOB 2KI2A 2CJ9A 3QO9B 4DR7F 3HVTB 3M9OB 4QR1A 3KTQA 2ZVIA 3KHLA 1HNZF 3PHEA 2C3OA 3M8ZA 3THTA 1GMWD 5T7LA 4X66J 4LF6J 1YK9A 3PJXA 4V1Ak 3CCZA 3LAMA 3W9HA 4RR5A 1MMLA 2HSEB 8AT1B 1I94J 4YDDB 1S1WA 4JI5J 3MM7A 2L9DA 5HANA 2AGOA 1N0UA 5D77A 3NGSA 3QLHA 1LWEB 3QATA 3TA0A 2CVIA 2PN6A 4F67A 1DLOB 3GYNA 4Y2MA 2IMWP 3O8WA 4JI1F 3JSMA 3IBWA 3HX9A 3MUTP 3GJTB 2VFTA 2FLOA 1MN7A 3L09A 5KG7A 5D4NA 2F8HA 3FCHA 3M1VB 3TEHB 5E3CA 2DH7A 3T9NA 1WTBA 3N5BA 1VBKA 3CJ8A 4P7TA 4DFPA 1RA7A 1QJHA 5HQMA 5HN0A 3OFHA 4H4MB 1IKYB 1NDPA 2L9NA 2MJNA 3EVOA 3CUNA 3K7RA 5THWA 2QC3A 3NAHA 3OLAA 1HARA 1RHRB 1G6BA 3MD1A 4LQ9A 4ALZA 1VQPS 1GK8A 5D4LA 5DDPC 5H9FK 1V3SA 5EWEA 1YQHA 3ZTRA 3JQMA 4F36A 4DS5A 1VIXA 4WBFA 3Q24A 2ZOMA 3HD1A 3BYRA 4RW9B 5HMZA 4U7CA 1XNRF 2ZBQA 4M5JA 4CI0B 2AV5A 4J37A 4AXJA 3CMES 3DU6A 2LLZA 4O4GA 1T05B 1IBCB 1FFWB 1H7WA 4FBUA 3OTCA 4NLGA 2CYYA 1AA1B 2WSFC 3NNHA 2R4FA 3R2DJ 4MTPA 1FNMA 1TL5A 1UZDA 4F0HA 1WHVA 1JJ2R 3M6UA 2LEBA 1XJWB 2M8DB 1FA0A 2BE9B 4KGMA 3IXQA 5J2MB 2W4DA 2M52A 3N6NA 4WP8A 5K8MA 1S5ZA 2DR9A 3R27A 1B99A 3PRVA 2GO9A 3S8SA 2V2QA 5I42A 2JVRA 2MQNA 3HMJG 4OV1A 2BYCA 2V34A 2OPSA 2W4PA 2HHSA 4AUKA 4K4YA 1QTNB 5IQQA 2EFOA 5HJXA 3RGIA 1GQEA 2G2YA 2RJZA 2XZWA 2R7OA 4KR0B 1HI0P 3MM7B 5GAGI 2C2RA 4KPCA 2UUBF 3MEDA 3GG1A 5KT7A 4KJIA 2B4VA 3FFIA 5IWAJ 2K7JA 3HHEA 2QO3A 3QIPB 4KTQA 3MHYA 3NCQA 3BH6B 4ZVUB 3PW4A 1HD0A 2FJDB 2QL9B 1PG5B 3QAEA 1WG4A 4Q8EA 1P9QC 5E3PA 1L5UA 4WU2A 2HVIA 1ZM9A 2LP4A 2XBPA 2VIHA 5JVGQ 5KT6A 2JX2A 3KK3A 2VICA 2ZZMA 2IY5B 5C7PA 1D0EA 2HHWA 4PPZA 3VR1A 2K7KA 3JAMY 2H5EA 3AOAA 3D67A 1S6UA 4HTIA 5GVQA 4FNHA 2XHWA 4I7FB 1KLMB 3GZ7A 1IM4A 3N01A 4GMKA 5LMNF 2ERRA 4ZMMA 1RK8A 2GVDB 2HNDB 3DDNA 3Q8YA 3WC2A 1EP4A 3GFHA 1B3TA 1R0AB 2IJFA 1RQ0A 1L3VA 2CQ4A 1PC5A 3CWJA 5L46A 3T19A 2F63A 3VWSA 2A10A 4PXDA 2MZTA 4C3LA 3KWMA 1KQFB 1HPZA 3MR6A 2BKPA 2E1PA 4RBTA 3T6JA 3TJAA 4KAIA 1DZ5A 2UXDF 4QU7A 2IJRA 1X4EA 2XI2A 2PMZD 1S99A 4ZCLA 5LJ3Y 1UA0A 2WOMB 3LUYA 1LWFA 1FKPB 1VIOA 2AX0A 4LFCJ 4CDIA 1IKYA 2AEJA 5DM7Q 4N76A 1RTJA 3TUIC 1GEHA 2V8DA 5F41A 3W5YA 4L75A 1WELA 2LCWA 3ZNUA 3I0SB 3K8WA 2FHJD 4N7TA 1CSJA 2GAHC 5J1NA 3UO0A 3AD7C 4EFAC 2V9WA 2OEKA 5L39A 5DDOC 1QVGR 4DR1J 4NCGB 2FVRA 1YZ7A 2GFFA 2E66A 2XSFA 3NCRA 4M1KA 4AD6A 4BC9A 2FPHX 4I69A 3PW7A 1HNIB 1FE0A 1KHVA 3HFKA 1YGYA 3IS9A 3OXFA 3HFZB 4RBUA 3DGVA 2XCAA 3QIDA 4C97A 2VBWA 4F25A 1FKPA 1RU1A 3KKFA 2VKZG 1QVFR 3HSZA 4RNMA 1NJWA 1NK4A 4F4KA 3N5FA 2EI5A 1ZA2B 5G4DA 4DHVA 4IOAQ 1F9EB 1VK3A 4EBCA 1KQSR 2ROPA 5I3UB 1S1TA 3HF5A 3LP0B 4IYQA 3FQKA 2W1BA 1DTQA 4NE9C 2HQ3A 2AP6A 4ES2A 3VAFA 4O3OA 1BXNA 1HBUB 1R8HA 1XMBA 3CD5A 4NWBA 4OZNA 5E3QA 2ZH8A 1WSRA 4TLQA 1QDUB 1WHXA 5D3GA 2RIJA 2FZGB 3ZZ0A 1FDNA 3M8WA 1NJXA 5IZHA 4F3OA 4DR6J 3QO9A 3KLGA 4PXCA 3J7YU 4TY9A 4LVNP 4M95A 3R6LB 2QLXA 2RILA 2P6TA 1U45A 4M5MA 3J7ZT 3H7HB 4JB8B 1TP7A 1E6VA 4BWMA 3CXCR 3S01A 2YKAA 2GHWA 4KHRA 2RRBA 3LWMA 3BO2A 3OHAA 2W4CA 4G1QA 2APOA 4X4TA 2RVJA 3S7RA 3NWGA 3IRXB 3CCWA 3W62A 3OSPA 2C3PA 3ISNC 1S0NA 1D09B 1D9AA 2ZKTA 4R0JA 4CYUA 4DX6A 3H4BA 3PEJA 2HGMA 1S1XA 5CYMA 1IQZA 1FWKA 1UVIA 1S0VA 2MDAA 1OYEA 1H6KX 2ZNZA 1Y11A 2BJ8A 5GADI 1PAUB 3NAIA 2RRNA 1N36J 3L3CA 3I32A 1CBKA 1UPPA 2ACYA 5JXSA 1SL1A 3MWBA 2G2OA 2Q66A 2ZM6F 3SSRA 1NU4A 3EJMA 2VFVA 4JI2F 2DNQA 3ELHA 4WPAA 5LJ5Y 2W7OA 2BJ7A 2OPPA 1MROB 2XNQA 3Q8PB 2CQHA 3IS9B 4J9KA 2LVWA 5SUHA 2H3EB 5M2RA 2ZH4A 3DOKA 4R0EA 4EBDA 4EK2A 3V81B 1DHMA 1ZM4A 2YH0A 1WI8A 4ZVHA 2HZCA 5KT4A 1DY3A 1N88A 2DNMA 3BO4A 5KFVA 3T1HJ 3T1AA 2KXHA 4RPFA 5K8PA 5DZ7A 2E1RA 2IFXA 4OX9J 4LFBF 2IMOA 4CLZA 2K1RA 5KG0A 5F0WA 2Z0GA 4X64J 5L1IA 1RAEB 4RWWA 1KP6A 5D8HB 2AKWB 2LQ5A 4WIQA 1PJ7A 6AT1B 2IA0A 4DFKA 1Q7YT 2LQ8A 3PG9A 3ZZRA 4YOEA 1RZMA 2M2BA 3VZIA 5L38A 4I2QB 4NEZA 1JLQB 1RTHB 1Q86T 3UN3A 5KT5A 2PFDA 2RE1A 3PJ9A 2PDAA 5HMYA 2HNDA 3DDKA 4Y34A 4P71A 3Q8RB 5G0RA 1OPIA 3JYTA 3PYFA 1IKXA 3A3PB 4DPXA 3OUYB 3FNNA 5KG5A 1UCNA 4USTA 1WC4A 1NSPA 5DM6Q 3THPA 4S0MA 3I9ZA 4ZJOA 4ECYA 2OPSB 2DO4A 1H3DA 1HIYA 3I55S 2R8JA 2AGQA 2EKYA 1EKSA 2ASYA 3S1TA 5KFFA 5I3PA 5A0YA 4KGXB 4DX8H 3PX6A 1N5QA 3KG1A 3W5ZA 3BSAA 4GKKJ 2KHDA 2J7UA 5KFAA 1IWGA 2N3LA 3QIPA 1IM6A 1W25A 3ZZPA 4XIUA 2YNFB 3I5CA 2FQQB 3DLKB 3EPIA 3W9IA 4DUYJ 1ITPA 3PHTA 4LR7A 4OI0A 1FXLA 1S9GB 5HAOA 3TZYA 4RW8B 4QWEA 2XWYA 3CDUA 2OKQA 3PR4A 1TMMA 1C1CB 1YJWS 3NXZA 4B9SA 5HQ8A 1X8DA 2Q1LA 4F0MA 2GJ2A 2JEFA 2CUYA 4F4XA 3KYLA 1C1BB 2R7SA 2XEXA 3SCLE 1BMQB 4NMXA 1IJFB 1AXQA 1C0TB 1UMJA 2BANA 1Y5NB 3MEGB 3MM6A 2MKIA 1M90T 4K0KJ 2B6AA 2BUNA 1U09A 1VJQA 1VQNS 1WKLA 3MPUB 4DQPA 1Q5YA 1URRA 3PTWA 1FXRA 4JYAJ 5GMKa 4F4WA 2V4JA 3ITHB 3LP1A 2EK6A 4UY8T 1N32F 4KSEB 4WKYA 4CCHA 3A8KA 4FKYA 4OX9F 4EYHB 4X4VA 2AJ1A 4IO1A 2J6TA 1V3RA 1XIQA 3W2WB 4R8UB 2FYXA 4O3PA 3W5XA 2YNHB 3HVRA 1VRQC 1RT7B 2EK1A 1SC6A 2EEYA 1IBLF 4OZLA 2CWKA 3M8SA 4YB6A 1UVJA 3BGFA 3JXOA 3IRWP 3W60A 5MLCV 1YRTA 1K0VA 4X64F 2HBYB 2R8IA 2AYMA 4LRCA 5ETTA 4DCPB 4DV7J 3J81j 3HT0A 4A8YA 3QMQA 2OH2A 4ZP7A 3Q8UA 1ACMB 3AODA 1HBOB 3ISZA 1PILA 4URGA 3KLHA 1KVIA 3QAUA 2EFVA 2XHCA 3M1VA 4J9SA 1RP5A 4J9RA 3RRGA 2WW8A 3UCUP 4K4SA 2RHSB 2WB4A 1LFWA 2O1PA 4NLRA 4Y2AA 1RHMB 2WONB 2XMUA 3EM1A 4FF1A 2E7VA 5C5JA 3BBBA 2NXJA 2VL1A 3IG1A 4JOUA 4TQRA 1M1GA 3KG0A 4LSZB 3MECA 1BD6A 1SL2A 1VQKS 4KHMA 5C25B 5KFGA 4HI1A 3VF0B 1XMQJ 1RWUA 3D0GE 4DR5J 2AX1A 2YWWA 3HM9A 4K5RA 1P1TA 2VDIA 3WIUA 4HH0A 2J8AA 5A8WB 2AYGA 4MYTA 3FVYA 1NK5A 3QBCA 1Q5VA 2DGTA 2J0XA 2ZOGA 3HCXA 4FDFA 1FCAA 2G1HA 1F6TA 4DZDA 1RAHB 3AA8A 4BCAA 4B3MJ 3VV2B 4HT5A 2BOPA 2AT1B 2Z8QA 1FWLA 5GAGU 3BDPA 1JLQA 4PWDA 1RGVA 4N8NA 4K8RA 4WF9Q 1JX4A 3LPYA 5IFMA 2BR0A 2P2CB 3MURP 3CCVS 4TXSA 1SQFA 1OY8A 2DY9A 1SH3A 3KMSA 2LXUA 2KFNA 4U96A 2GCFA 4MMOA 3J80Y 1VK8A 1JLAB 2F7VA 2OGUA 4Y65A 2ZWPA 5BYQA 3MCNA 2MHEA 2RS2A 4LMZA 1F5BA 2AJFE 2DEIA 4P75A 2DXDA 2BBEA 4HDHA 5GAEI 4PQUB 4RBVA 3GILA 3ZTOA 1FTCA 2Y3YA 3DRRB 4NXMJ 2IAJA 2RMLA 1IKVB 1VJWA 4B9VA 2G1DA 1U8SA 1FD2A 2YKNA 2OPPB 4FVMA 4KO0A 2H4YB 1X7VA 2ZC3A 3VAJA 4CLLA 1X9MA 3CD6S 3THVA 1QTMA 2FJBB 4TYBA 1PIEA 2MHNA 1KQKA 2CRLA 5AXKA 2KT5A 4NZ6A 2VASA 2XULA 3DXBA 3HK2A 3KOAA 4OX7A 2FLPA 2VG6A 3W2WA 1BQNA 4Q45A 2I5JB 4NCAA 3GQCA 1I6JA 2BACA 4Q0BB 3OHBA 5L9XA 3EPGA 3VALA 4UUXA 1RKJA 2C3UA 1U7LA 1VQ9S 3AY0A 2LQJA 3DI6A 2H9ZA 4YDXA 4NLXA 3I4HX 3MMJA 5A8KB 2XMWA 1X5TA
chains in the Genus database with same CATH topology
3DFEA 3PY8A 1Q4RA 3UD4P 4PQAA 3OFEA 4DQRA 4IH7A 4ZVEA 1Q78A 2CFXA 3DOLB 2XS7A 4IR1A 1Y5IB 2DTJA 4FF3A 3DM2B 3HPOA 3G86A 4C2MA 3TVZA 1VRTB 1UJ4A 4F02A 2DGOA 2EC0A 1Y3KA 3V6JA 3VZHA 2Z2MA 2HFZA 2L08A 1ZTWA 2UV8G 1U4BA 5IS2A 2BE2A 4J5OA 2UP1A 2RS8A 1NK7A 4C8OA 5KFYA 4MYUA 1R8BA 4F3QA 1X4FA 1REVB 2I9SA 3NGDA 3DLEB 3VCDA 3RW7A 4Y2IA 4HVZA 2L48A 3HP6A 1HNIA 1TKTB 3X1LB 2Y1IA 2PI5A 2KHCA 3GYXB 3PW2A 2KU7A 2EBGA 3NLCA 2MKSA 5KFRA 4V19J 4QOTA 2M88A 3MD3A 4G1IA 4O4GB 2R7WA 1RTJB 5HI7A 5A6PA 3FRZA 5KFPA 4DV5F 1AUDA 2KZZA 2RRAA 2QSWA 2HWIA 4IQMA 3G9CA 3DMJA 2CPFA 2OFGX 2V9KA 1RTHA 3FRYA 1SV5A 1S10A 4C98A 5GAEU 5HO4A 1K1SA 1OSCA 5FD1A 4UOCA 5KG6A 2NSCA 3CDWA 1N6QA 4CTAB 2E5LF 3F56A 1QM9A 4NL5A 3MDFA 4QIGA 5KG1A 3X3UA 2KG0A 4CZCA 3IRXA 1F60B 2KKHA 4JI4F 3JSRA 3GV8B 3I82A 1R43A 4NZ0A 4WU3A 5KTQA 2HGLA 4K4ZA 3CJ3A 1TK5A 1LXNA 1R8AA 2VPWB 3NS5A 1SBRA 2HS0A 4KV8B 1YJNS 4HL9A 2HHXA 2JEJA 2VC1A 1FNOA 1SXLA 1JMTA 1S1WB 3M2RA 2IAJB 1OQ6A 4OI4A 3OVSA 2AGOA 2KXNB 4BWJA 3AB2B 3DRRA 3T1HF 1JXLA 1S6QA 2ZD1A 3MTJA 3H40A 2YNFA 5J2NA 2DNGA 5E33A 5K14A 5CYMB 1R8CA 5A6WA 3DLHA 2UV8A 1KQGB 1X4GA 3SYZA 1FNXH 3AHPA 3R5AA 3IGVA 4U67Q 3B4MA 3TO8A 1MMNA 3GFXA 4U6PA 4B9UA 3NRBA 5E0OA 2KFYA 3KLEB 1JJ4A 2DHAA 5J2PA 3PVXA 4RU2A 4A47A 5DDQC 2GIRA 4NX9A 2MQOA 2Q6BA 4A4JA 1NRKA 4WK1A 5F3TA 2GV1A 5KFLA 4PWUA 4ZCMA 3G6ES 2HAIA 3C6UB 3R1LA 3M32A 1SV5B 3UCZP 3UDCA 1UEVA 1HYSB 2OD4A 2F8EX 2HHHF 1S1TB 1R0AA 5I3UA 3V4IB 1D3WA 4OZJA 3RR7A 2IVYA 2PMHA 3CGIA 4DMZA 1LFPA 2QT7A 4NRUA 3MUMP 4MKBA 2A2DA 4LFAF 1K73T 4RNFA 4YR0A 2B6AB 2B43A 3K5LA 1W2IA 1YRUA 3OTEA 1YJRA 2FJVA 4PG4A 4IFYB 2YX1A 4QR0A 4ZVGA 5CA5A 2FLLA 3IWLA 3ZZZA 4DV4F 2DNHA 4DPOA 5IM0A 2I1RA 4QYZJ 2KG1A 1HHSA 1R6YA 2DT9A 4WYWA 2B9XA 4JI7F 3TI0A 1FKOB 1XR7A 3BR9A 4FXDA 1WG1A 4URQU 3CCES 2IM0A 4PCQA 5IT4A 1ZH5A 1HNVA 2VFSA 2HLUA 3FSXA 1QSYA 5DLGA 1HNXF 5KT3A 1RT6B 1Q82T 3LP1B 3SDEA 2DH9A 4TLRA 5KFOA 1F0XA 4OZ0A 4YB5A 1EETA 1E6VB 4Q7AA 3CCUS 4EO8A 3PRBA 2KYXA 3CULA 1HW9A 4UW2A 1KD1T 3BREA 4A8OA 4DL6A 5FLXY 4ILRA 4F8RA 1HNVB 4P6QA 3MMAA 4EBEA 4CT9A 2FDNA 3H5XA 4IRKA 4K0KF 4E8UA 2D3OR 4R25A 4KBIA 1QLNA 1M5SA 2FTRA 4Q8FA 2E5GA 2M8HA 2OFHX 2EG1A 4ED8A 1D8YA 2MQPA 1B0VA 4I6YA 5J2QB 3I5BA 2PI4A 3RBDA 1VQOS 2JEIA 1WWHA 1C4CA 3T5JA 2A18A 1PGZA 4BS2A 5KFKA 4Q44A 1ZOTA 4ECTA 2CQ0A 1HWIA 4I67A 2EWHA 4Q5VA 2B7CB 4QQBA 2MQLA 4DWIA 5B0DA 1GXTA 1HWJA 4OJHA 2E1AA 2WAQD 4OQJA 2ADBA 1T05A 5CXTA 1UVMA 4EUVA 4C3KA 1FVSA 2E44A 1TL1A 4ES1A 3KFWX 4LF6F 4K59A 1UW4A 4B9LA 4C3MA 3KK1A 4ELVA 3O6QA 4YQWA 1GX5A 1VQ4S 5KFBA 2J9DA 1UJ5A 2BJEA 1NH8A 2HS3A 1EP4B 2C28A 4WFZA 1VQ8S 4IFVA 2AJQA 4RNNA 1PO6A 3P3DA 4EWTA 3RB6A 1VQSA 2IVMA 2JFDA 4P7VA 1NNDA 5CQGA 3MEEA 4QBUA 1NB7A 1S1VB 3LQVA 3G6XA 1GTEA 2CPYA 4ILLA 4DR5F 2OJ3A 3AJ2A 3OR2A 3NNCA 2UUWA 5IT9Y 2F1FA 2FLNA 2RKIB 4XAKA 2DCLA 2V2KA 3DOKB 2UVWA 2DRAA 1GAOA 1Q1KA 2D9OA 3ZZOA 5AXNA 2ZHAA 3PV8A 3LALA 2PA8D 3BGRA 3GIIA 4NYZA 2CZ4A 2MB0B 1LWFB 4NPOA 1U1PA 2GO8A 2EFPA 1VRTA 4DL2A 4CO1A 1R7IA 3PX0A 3CT9A 1Q7LB 1ZAVA 3MEKA 4M8LA 2XS5A 4OZ1A 2ASLA 1TUVA 4JBCA 4OI1A 3KJVB 4B9NA 2HRYA 1X9WA 2PEHA 4I2PA 3QJJA 4DUZF 2R8HA 3O2IA 3M9NB 1VGYA 1KLMA 3CCSS 3HJFA 2IBKA 2K1RB 3GWCA 4AL6A 4JUZA 3AAWB 2R7UA 2O01C 5KFZA 1RT6A 3MR5A 1SJ3P 1TVRB 3R5CA 2YY3A 1N5YB 1FRJA 3Q2SC 4LT6A 5DQGA 2OP5A 3FMWA 3P5TL 1N33F 1HPZB 1DQAA 1HBUA 2ILZA 2KRBA 4YB1P 3L7PA 1F2GA 1KFSA 3W7BA 3KNAA 3TA1A 3SSQA 1AFIA 2ATLA 3MOJB 3DHXA 1BQXA 2GMJA 3OW2R 1TR0A 3MR2A 1LXJA 2DGVA 2JC1A 3OV7A 2VPYB 2L41A 1Z4UA 5IWAF 4CH1A 4ZPVR 2K2PA 2LDIA 3AB4B 3BGRB 4QU6A 1HBMB 3K5NA 4EZ6A 4USIA 2RUGA 1RT1A 2VG5B 4KE5A 4AFFA 4EEYA 1PSDA 4DL4A 5DGAA 2EPIA 2ZZNA 4G1QB 2CJBA 4RU9A 2GA7A 1OSDA 3CC7S 1TKZB 1XERA 2Z2LA 2A2CA 4A46A 1YBAA 2FUG9 4QIWD 2OIHA 4NLYA 2FGCA 3KLGB 3VTIA 3CIMA 3BSNA 2NYIA 3CE8A 2HNYA 3L7OA 2F40A 4AL7A 3Q0AA 3P6YC 2MGZB 3CCJS 2WBMA 1C2PA 4CO4A 3M32B 3HHLA 4RW7B 3F73A 2CQDA 5LSOA 1VQ6S 4G1PA 3M2UA 3MM5B 3N28A 1QAIA 3DLJA 2B56A 3T5HA 3IWXA 2FJXA 4DN0A 3NBPB 4G6VB 2YWKA 2P9CA 3MECB 4ITSA 2ZITA 4D3GA 1EETB 5DG7A 2YWHA 3JSYA 2HW3A 4ZPAA 4DSIA 4WIIA 1U6FA 4WTYA 2ZH2A 1D9FA 3GB0A 2XLKA 3PO4A 1RT4B 1ZM2A 3HHLD 3TR5A 3JB9k 4DF4A 3J81Y 2B3TB 2VOOA 3ICLA 4FF4A 3PIPQ 5BYSA 1J5OA 2JWNA 1KTVA 1T7PA 3PO5A 1Y7PA 1A6LA 1CC7A 2DNLA 3KLIA 3MFIA 3DC2A 3NKYA 1IQTA 1WEZA 3J7Z5 3VAGA 1K1QA 2N7YA 1AROP 5C42A 3BQ1A 2QZ8A 1IKVA 4USJC 2BJDA 5H9EJ 4R8UA 4R5PB 4ZPCA 2GQCA 4XO0A 1ZM3A 1F9FA 3POTA 4XDDA 1FDAA 3BGLA 4O3NA 3E01B 3FSYA 3MPVA 2R8KA 2V8VA 3UDLA 3OVBA 1S49A 3GIMA 3D1HA 1JLFA 4NLVA 4ICLB 4X84A 1X4CA 2P9EA 4CQ1A 4JI6F 3K59A 2XCPA 3OQ2A 4KQZA 4R5PA 2YTCA 4QW9A 2QA4G 3CO9A 1Y5LB 4LFCF 3SCKE 4CO2A 4YFUA 2B4UA 3DN9A 4O3RA 2NPIA 3ETOA 4X4SA 4ZP9A 4BBYA 2BW2A 4K5SA 3LP0A 1S0OA 3CDEA 4JV5F 3H2UB 2IM1A 5EX3A 3EXYA 3UPFA 2G4BA 4JI3F 2CQ2A 1S9FA 3QWPA 1O51A 1KLNA 1ZZFA 2G13A 5HMWA 2NLWA 1U1RA 1SJQA 2OO4A 2KRRA 1KFDA 1VC0A 4IFYA 2XGPA 1ULRA 3B78A 1HW8A 1MU2A 3AQOA 1UEUA 2GQ2A 2HLTA 3LP2A 4I4BA 2VBYA 4NRTA 5F3ZA 2RU9A 4OHYA 4I56A 1FTRA 3PNIA 2PO4A 2HHVA 3CJKA 1FO1A 3M30B 3LW5C 1I94F 4C9DA 2ZKUA 5LSLA 3KLFA 4LSNA 3BQ2A 4DSEA 2MKJA 3T6BA 1DQ8A 2ZJQQ 2LDYA 2EFQA 3D2WA 2IA6A 1RDRA 4ILMA 3EGZA 4U7UK 3OJSA 4FXWA 4F4YA 4IRDA 1HNWF 2CPXA 1R3NA 4C8YA 3RZAA 2MGZA 5A8RB 4ETZA 1JNZB 1S4FA 3M6XA 4BDPA 4C11B 1UFWA 2GJIA 4ZP8A 3IC1A 1VC5A 4URSA 5CYQB 4DJBA 4J9PA 2OD6A 3M6VA 1JLGB 2DNOA 2RNEA 4RX6A 3ULHA 3C2PA 1JNRB 2VQFF 1D8ZA 4X2BA 1B64A 4DL3A 1NHVA 4PG8A 3D1OA 3CC2S 1HQUA 5K9FA 5KG2A 2DPJA 4C11A 3ENWA 2CQIA 4RWXA 5LSRA 4CH0S 3OR1A 4Y3CA 4YR2A 1C1BA 3MTKA 4DL0C 1I1GA 4DV1F 1TFWA 2MYFA 4LF9F 1YJUA 1U1LA 2R7QA 1HI8A 2P9GA 2LA6A 4HYKA 1OWXA 5MAOA 4FNIA 1QAJA 5HL7Q 2R2UA 3C6UA 1DURA 2R7TA 5DQIA 3OL6A 2ZE2A 4XPCA 3H2VE 3MMAB 3VQTA 2XLIA 4FS2A 3H25A 3RB4A 3FMBA 4IOCQ 1ZPVA 3U7JA 4IQXA 1VRUA 5B0GA 5F8GA 1KN6A 4WE1A 1H0HB 4C0OC 5HROA 4RW4A 4DQIA 1S97A 3F44A 4NYPA 4ECUA 4FF2A 3SCJE 3US5A 4YY3F 4B3OB 2X3GA 3R1HA 1SUQA 3V4IA 2XLJA 3PW0A 3I0RB 4DBQA 3OXGA 4A8MP 4WK3A 1TKXB 1N6QB 1BGXT 5HP1A 4NLPA 3IAS9 5EX0A 2QV6A 4KT0C 4LF8F 4ZDNA 3HKWA 4JI5F 2DNPA 4DL5A 1XNQF 2GMLA 4ZK7M 1YJVA 4ZCIA 2FHMA 2OPRA 2AU0A 3CTRA 4A48A 2YWEA 1CG2A 5IXUA 3DGPA 3N6LA 2BDPA 4EYIB 5EWGA 3PZPA 3D0IE 2IRUA 4WFAQ 2CG4A 1UL3A 4XPEA 4CIOA 4KV8A 4C8NA 1WEXA 2IYIA 1ZZNA 2UUTA 2YKOA 3M8QA 1RI7A 2M70A 3MAHA 4EZ9A 3NGKA 1LW0A 1NZAA 3GV7B 5B0CA 3G8SA 1SB6A 4ECWA 4DSKA 3FDSA 4ZLPA 2VZ9A 2UU9F 1X4DA 5F8LA 1X5SA 1AW0A 1TFYA 1R89A 1U2FA 2ADCA 3TVYA 3V5RA 2YX7A 2ZH1A 1CVJA 3J7A1 3PR5B 1Y3JA 3CD7A 3VAIA 2CZVC 3MPYA 2KJWA 1APSA 2KB2A 4GO7X 2JVOA 3FZBA 3I4PA 2I0XA 3B4DA 2DISA 4B3MF 2XSJB 1KOHA 4BC7A 3DOLA 4ZPDA 1WHWA 2BRLA 4U9RA 4A8QA 4O23A 2AD9A 2FB0A 4ZCKA 4DR3F 5F9LA 2AQ4A 3KLEA 2VODA 3UQSA 1DRZA 4B3OA 5I4MA 1U48A 2DJWA 1CPZA 2Y1RI 5DS7A 2MMYA 3MI7X 3Q2TC 2XG8A 1KS2A 3SQGB 1X0PA 5DO2A 4ED0A 3BM7A 2Q79A 1U6ZA 5H1SV 2E5IA 1TK8A 3DLEA 1Y00A 2FVCA 2C2DA 3BO2A 3EGNA 1WEYA 2V0NA 4OJ3A 3TAPA 3ISND 5F0UA 1IJEB 2R8JA 1MW7A 2BE2B 2OPQB 4UQGA 4NXMF 3RAQA 5DETA 1G7CB 3DYAA 4NYOA 4B08A 5FDLA 2DRBA 3LWLA 2D9PA 1S9GA 4TU9A 2X1AA 1U49A 1UWBA 3UNGC 1T8EA 2XMVA 2R7VA 2Z4PA 2KVIA 2E7XA 3FEXB 3LF0A 4CO0A 5HMXA 5JUMA 2QA1A 4ZKAA 3NL0A 3B8HA 5J1EA 4GC7A 4QCLA 2E5JA 4Y28C 5BR8F 3MGJA 1HA1A 2GMHA 4HEA9 3GE9A 5U47A 5KFEA 2YWFA 2F4VF 2ROEA 1QUPA 3PEHA 2XMTA 3R5DA 4DF8A 1S1VA 2F9JA 3OL9A 1DBDA 4OZ5A 3BZQA 4IFVB 5L8RC 2IVFB 2CPDA 4MFBA 2B4PA 2NXUA 3HHKA 1LWCA 2QLWA 5DDRC 1JLEA 4Q0BA 1S7HA 3ZZTA 4FYDA 4ED1A 1N52B 5L1JA 1FRKA 1T3OA 2XMJA 1FVQA 2W7AA 4KFBB 4YP3A 2GHVC 1FRIA 4RUCA 2FVPA 2DNNA 4LIRA 2EBEA 2CPIA 2EVZA 3GFYA 7FDRA 3OTOF 4NA3A 3MXHP 2DNRA 1HWUA 4KO0B 2GQQA 1TV6A 3TOQA 2HNZB 1D1UA 3FQLA 2ZHOA 5IM0B 4X62F 3R5BA 1M0SA 4X66F 1M5VC 3TNVA 4PRFA 2PE8A 1P1LA 1YSJA 2FHKA 3I6PA 5E5NA 1CC8A 2P6SA 3SMZA 5J2PB 5KFNA 4DR1F 5F8JA 4IH5A 4NLUA 2VBXA 1N36F 3OFGA 3PX4A 2HHTA 2HQIA 1ZYQA 5F8MA 4E98A 1NO8A 3HHNB 2V8GA 3H2LA 3M2VA 1E6YB 5K14B 2OAUA 1DLOA 3ZZUA 2WCXA 4RNOA 2ZE2B 3AA9A 2FD2A