2F4VF

30s ribosome + designer antibiotic
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
molecule tags Ribosome
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
total genus 16
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2f4vF00
5IWAF 2F4VF 1HR0F 4DR6F 4B3SF 4DR5F 1GH8A 3T1HF 5AJ3F 2VQFF 1G1XA 1CQNA 4AQYF 1IBKF 3ZZPA 4DR1F 4LF8F 4DR4F 1XMQF 4DV1F 1IJFB 1VMBA 4JI5F 4JI2F 4DV7F 4LF7F 4B3MF 4LF4F 4YY3F 4LFCF 4B3RF 1FKAF 4JI8F 4GKKF 4YHHF 4DV3F 4DV2F 4JI3F 4JV5F 1F60B 2HHHF 4NXMF 1IBLF 4X66F 2UUBF 2UXCF 2J5AA 4KHPF 2BXJA 4DV0F 1G7CB 2ZM6F 1LOUA 1XMOF 1CQMA 2UXBF 1N33F 3T1YF 4LF6F 2UUAF 4DR3F 2KJWA 1I94F 1B64A 1QJHA 4GKJF 1FJGF 4JI0F 4X62F 4OX9F 1N32F 4JI1F 4LF9F 3OTOF 4DR7F 4B3TF 4X64F 2UUCF 4JI6F 4DR2F 4JYAF 4K0KF 4NXNF 3R3TA 1HNWF 1XNRF 5LMNF 1IBMF 1N36F 4DUYF 4DV5F 1XNQF 1N34F 2KJVA 4LFBF 4LFAF 2UXDF 2BVZA 2RJZA 4DUZF 4DV6F 2E5LF 4JI7F 2VQEF 1HNZF 4X65F 2UU9F 2B7BB 1J5EF 1IJEB 5BR8F 2YY3A 4DV4F 5LMUF 1HNXF 4JI4F 1RISA 4LF5F 2B7CB
chains in the Genus database with same CATH superfamily
1Q8KA 3F41A 1C2PA 3IXQA 5IWAF 4DQSA 3H59A 1UWBB 3FQKA 5C5JA 2KXNB 1FCAA 3MF5A 3QMQA 4B3SJ 2K06A 4MFBB 4QOTA 4WFXA 2XSFA 2VQFF 2G13A 3M30B 2W2OP 2HMIB 4ELVA 1C1BA 5A8RA 1R0BG 4KV8A 2JZ5A 3KLVA 1HQEB 4KSEB 2HGLA 4OYIA 2BX6A 4IH7A 4PG6A 2RU3A 4K4TA 4RUCA 1N88A 5GAHI 2G4BA 4QWDA 4QPTA 1RCXB 2JC0A 4E98A 4J9RA 1WG4A 1NDCA 1X4DA 3HVTA 4TYBA 3MPWA 4HYKA 2ATCB 3IWXA 2DH7A 4OZ2A 5F8HA 3BZQA 3R5JB 3GYXB 4DF4A 2AJ0A 2CNKB 3MM6A 4LF4J 4IRDA 2NUUG 5T14A 1U6BA 1UVJA 3H7HB 5F8MA 2C2DA 1S77D 4E2FB 1TL7A 1Y10A 2FUG9 3A3NB 4NLVA 3K8VA 1VK3A 1D8ZA 4ZCIA 2P5VA 1NK5A 4FNIA 2CPYA 4I56A 3AODA 2VL1A 1XQIA 3OJUA 2CJ9A 1N5VA 1BWEA 1NPKA 3OTEA 1V3SA 3EGVA 3PJWA 4RBTA 4C0BA 5E3RA 4PXDA 4DU8A 3PO4A 2W7OA 1J27A 2ZBPA 2IBKA 3GG0A 2KRRA 4F25A 2AP6A 1U24A 1R8CA 1BQXA 4U9RA 2HFUA 4ZVSB 2I8EA 3OL7A 3CJ3A 4DV2F 3KLIA 1NKCA 2VF3A 4F4AA 1RTIB 4MK9A 4J9MA 2W2NP 1VQ9S 2MGZB 1X4CA 3CE8A 3HF5A 4NEZA 3ENVA 3WZ0A 1U6FA 2EG1A 4H4KC 5DS7A 3PTWA 3NGSA 4DL3A 1KRPA 1G7CB 2POKA 5AE1A 3OXGA 4LVOP 4QWBA 1NJWA 2OPQA 4PG5A 3PXGa 4Q43A 4ZVOB 4KH1B 1NB7A 1LOUA 1LW2B 3E8OA 3VAHA 1HNVA 2EXUA 1K0TA 2EC0A 4I1TA 3J80Y 2NPIA 2Q43A 4HACB 2IM2A 1SKUB 3DHWC 4DR3F 2B4OA 1NDLA 3RAMA 5J2QB 2AWZA 2HHWA 1C1CB 3R6GB 2P8IA 4M5KA 8AT1B 4JI0F 4ZIWA 4ID5B 3ULHA 2ZHAA 5DRKA 3T3FA 2W01A 4I6WA 1KR4A 3NGKA 2VDHA 4HDHA 1LFPA 1T9XA 1VC5A 3V4IB 1FFGB 4OX8A 3V6DB 1SJRA 4M1KA 1JLAB 2Z30B 3DCAA 3UNYA 4DR2F 2F8EX 4N47A 3GFXA 3B54A 3CJ5A 4NMLA 5HLFA 5IT9Y 1YBAA 2C2KB 1YGYA 2W9CB 4ZPTR 4FBUA 4FF3A 4ZP7A 2V2QA 2CRLA 4QWAA 4OHVA 3W64A 3T5KA 2LU2A 2KJVA 4C8ZA 1MSWD 2RS8A 5THWA 3B8HA 4F26A 1SPBP 4ZP8A 1HBMA 1A0OB 1BUXA 2HLUA 3T5JA 1OSDA 2BKPA 4K2JA 1KD1T 1K47A 4M95A 4KO0B 4U96A 3CVKA 1RHQB 3F44A 4CM0A 3EVWA 4A8KA 2DXDA 4G6VB 4Y00A 1UKUA 4BCAA 4PKDB 1URNA 5ETQA 5KFGA 4AXIA 3O44A 1X9WA 1MNEA 1VBKA 2DCLA 3M9OB 3VV2B 1YG0A 2DO4A 2FC9A 2ADCA 5KT6A 3KK2B 4S0MA 3KMQA 4C7QA 1R0CB 4YMEA 2Z2ZA 1TK0A 3DLGA 4HDGA 2YNGA 3BN4A 1C1CA 1JJHA 1T8EA 3HK2A 1P1LA 4UTGA 4ED6A 1PSDA 4N5SA 1PYSB 4OYZA 1LWFB 1RSCA 2GHWA 5K8PA 1LWEB 1HR0F 4OX9J 1RJJA 1NKEA 2WRMA 1C4CA 3V4IA 4I2PA 3V81B 2B43A 2BJDA 4RW6A 4ZPWR 1DBDA 3ITHA 3PW7A 3QZ8A 1R7IA 5A2QY 4RNNA 4B3SF 3FKBA 1CG2A 3KK1A 3KLEA 4KGVB 5BXIA 1HHTP 4ILMA 4AFFA 3OV7A 3LGNA 2MQMA 5L1LA 3I96A 3CCLS 3HO1A 1MMDA 2HG4A 3MAQA 2CPEA 4KH0B 3VAGA 1P9YA 5EWFA 2OD4A 5KFSA 1SVDA 2MKIA 2DHSA 1U1NA 1SXLA 2MJNA 1R8BA 3QLHB 2CAJA 1B4SA 5HMYA 2XYPB 4DR2J 1MMNA 2CQPA 2LDYA 1BD6A 1RP5A 4NYZA 2YNHA 5AT1B 1SCJB 2XCPA 2FHJD 3MMAB 1X4BA 2FIUA 4ANCA 1IR0A 1KEKA 1LK5A 1CS4A 1VLYA 1U1QA 3GSIA 4A8FA 3J7A1 1FX4A 1ICEB 1JB0C 2A2CA 4CTAB 1CULB 4M5GA 3UR0A 1WEZA 1U0HB 1N6QA 2K3KA 2I6WA 4LF4F 4YR2A 5EX0A 2X3DA 1IKVA 1I3OB 4TY8A 3C19A 4XPEA 4DSEA 1GTEA 1Q7LB 2ZD1B 3IS9A 4FKYA 1NHKL 3DOMB 4J91A 2W2MP 3DKDA 4YHHJ 3R5CA 1D8YA 4RZRA 1KQGB 2YNFB 4NLRA 4CO3A 2KYXA 1JKHA 4ZPAA 3SIPB 5GAGI 2DNLA 4P10A 2IMWP 1CC8A 1CJVB 3KDOA 4HKQA 1RT6A 1SQFA 4LQ3A 4FF2A 2J5AA 1O6XA 3IWNC 1U2FA 1X4AA 2MZTA 4KFBB 1CULA 5C25B 3N6MA 2CPJA 2KT3A 1GX6A 3ENQA 3EPGA 2VA2A 1H98A 1KOHA 2W8KA 4KBIA 2L48A 1YX2A 2AYMA 5BYRA 3UE2A 3UDLA 2KYZA 3BO2A 3Q8SB 2KXHA 2VPWB 3FMWA 1B3TA 2XB2D 1GXTA 4CO2A 3QSYB 3T1YF 5F9NA 4O3NA 3GG1A 1YJVA 3PEJA 3D1QA 4F7VA 1TQLA 5LSOA 3SCJE 3K5NA 4RNFA 4DV4J 3LO3A 2Q1LA 3M1VA 2M8DB 3A8KA 3N01A 1FJ7A 1HARA 3ONQA 1DAXA 1R31A 4NE9C 1AB8A 5B0DA 1V6HA 1VS3A 3MEEB 4U7UK 5M2UA 3IP0A 4ICLB 3PW2A 2I2YA 4DQIA 4X62J 4WF9Q 3D67A 2HURA 1F1BB 2NCKL 1W26A 1EAYC 2R7OA 1GMWD 3AB4B 3DU6A 5DQIA 4DX7A 2HWTA 3UN3A 3F56A 2F4FA 2H5EA 1HNWF 2ZKUA 2EK1A 3DLLQ 2PDAA 2JFDA 1PBAA 2JRSA 2E9RX 4QJVA 5LMNF 1AFJA 3D1OA 1CJVA 3MR5A 2VONA 2YH0A 4ZVHA 3ZTPA 3VVTA 1S9EA 4O44B 4DV5F 3WC2A 1RAJA 2CPFA 2M7SA 2QMUB 3MCNA 2DB1A 1AXQA 5CAAA 4QU6A 1S1VB 3KLIB 3MEGB 1RK8A 2C3MA 1SV5B 4FYWB 2MZJA 2RIJA 1RTHB 5DLFA 2CA9A 4YB7A 1RLDA 2B7BB 3D6MB 4CI0B 3D66A 1H38A 5AE3A 3M8PA 2NZ4A 3LOUA 1WC0A 1WWHA 3PY8A 4OLPA 3G71S 2FZCB 1S0OA 1FD2A 2JNJA 5G4DA 2V67A 3RB0A 5F9LA 4NA2A 2BW2A 3TUJC 2CIMA 1S1UB 1DLOA 2ZBCA 3GPAA 2HAIA 4OZ0A 4I67A 3CJ4A 5GMEA 4MIAA 2XGQA 5I3QA 1LXNA 1IQZA 3NOCA 4NLYA 2DPJA 4CO4A 1TUVA 4ZVTB 2R2TA 4ZLLA 5DGBA 5AJ3F 1EETA 2R42A 2CQCA 4NWBA 1UA0A 4K4WA 1YSJA 2QLJB 1I94J 3TUZC 2V4QA 4TU7A 3LGMA 1YJ7A 4WIIA 1GK8A 1DTQB 1X4HA 1YVFA 3MCMA 2BOAA 5CD4H 4N41A 1KVIA 3S1TA 4YR0A 2OFHX 3QJPA 1PIEA 1XR7A 2MQLA 5J1EA 2ZEJA 5HN0A 2RRNA 1GXLA 1CVJA 2ZOFA 2EWHA 3CC2S 2AV5A 1IJFB 2WONA 3IMQJ 1S9FA 1FNMA 1HBMB 4KPCA 3M2VB 1REVA 2HQDA 3BR8A 2MMYA 2ROEA 4C2MA 4B3MF 5FLXU 4B9MA 1H3DA 4IOBA 2B6AA 4USTA 1BMQB 1FX2A 4ID8A 3SFUA 2C2ZB 3NNCA 4WYLA 1F9FA 3DU5A 2N7YA 4MJKA 1HQ2A 3O6QA 2VG5B 2M8HA 2QEXS 2QO3A 4J9LA 4NXMF 2WVFA 4CLWA 3GLJA 2ZBIA 3VF0B 1IBLF 3FRYA 5KT5A 4JOUA 1D3WA 4J9KA 4C97A 4ES3A 1OSCA 2E7VA 3M2VA 5IQQA 1BC6A 4RO0A 4USIA 1J2VA 3PRVA 4Q0BA 1NJZA 2UVRA 5K14A 4HLBA 4LR9A 1XTZA 5AXKA 1UMJA 5J2MB 5GADI 3OL8A 1SKWA 2HFOA 3AFGA 2GAHC 2PMWA 1CQMA 4HTIA 4P2MA 1R0AB 3NCPA 1HKAA 1SJ1A 3KLEB 4IFYA 1S7HA 1V5IB 2GZOA 2H51B 2WW8A 1S1TA 1YZ7A 1SB6A 2YKMA 1DTTA 4Y2MA 3K5LA 1WTBA 2ZWOA 2DTJA 2L9WA 4QIVA 3G9CA 3EZOA 1HD0A 3B82A 5ETTA 3TW0A 2IM0A 4IOAQ 2VFRA 2EFOA 4YS2A 3Q8RB 1SL1A 1FJGJ 1NHUA 2M70A 1B0PA 4DDFA 5M2RA 2RRAA 5IS2A 4RNMA 3LF0A 1KHWA 3KXDA 4PR6A 3K8WA 3MM5B 1QSSA 4C8LA 4I2PB 3V81A 2Y1IA 1BQMA 4Z37A 2XYHB 2V69A 3RYLA 2FB0A 1GEHA 3K89A 4GO7X 4MIBA 5KAKA 2VU5A 3I5CA 3KK3A 1EP4B 2LQ8A 2YKOA 4OYXA 4DUYF 2ZD1A 3IS9B 4HHJA 3QAUA 2GHPA 4EYHB 1CLFA 4DR6F 4ID5A 4MT1A 3L7PA 2UXDJ 4P2SA 1WEXA 1HNWJ 3H2LA 3B78A 5D8HB 2AGPA 1TK8A 1F0XA 5JXSA 2DITA 3KG0A 5D4NA 3ZXWA 4JI7F 3IGVA 2AJQA 2X51A 4XDCA 5K20B 2LCWA 3EDRB 4EBEA 5HLFB 3NLCA 2P2CB 4KFBA 4ANDA 1TKZA 3PHTA 2UU9J 3PACA 3NAHA 2AJ1A 2OPRB 4EEYA 2UUBJ 2M5YA 2BRKA 4CLYA 4XO0A 4B9SA 2KZMA 4RJVA 1JJCB 2V63A 2QN6B 4KAIA 3I82A 1RISA 3NOGA 4JI4F 1T3OA 1VDHA 1WDTA 3O5TB 3Q8UA 1UW4A 2YNFA 1VIOA 2YNIA 3PRBA 2GW8A 4KY3A 4NI2B 2ZM6J 2W8LA 3L7UA 4KKOA 2HFSA 1NSQA 1YJWS 1UFLA 2DGUA 3NL0A 1RACB 3OFFA 3M6UA 2C28A 3P6YC 2RHSB 4QR0A 2XLJA 1Y5IB 5B0FA 1HNXJ 2VC1A 5CXTA 2FY1A 1ZM9A 2W2QP 4F36A 1B0TA 1SC3B 2Z2YB 3S7RA 1TMMA 3N9UC 2I9SA 4ZPVR 3FCVA 1PC5A 2DO0A 4IR1A 2IMOA 5CD4A 4AQYJ 1U6ZA 4WBFA 5FJ4A 3MM7B 3VWSA 3MR6A 2ASDA 1U8SA 3D0IE 3R97A 1PAEX 4WPAA 2JWNA 4UW2A 1UETA 4HI1A 4OHXA 1WNEA 1PCAA 1NSPA 3G86A 4U6PA 4O0IA 1C0TA 3D6HB 1IKXA 1ZPVA 4FP9A 4DOZA 4ED2A 1BWVA 2HW3A 3UNGC 2VFSA 5KFOA 3GONA 5LJ5Y 2L9DA 4I7FA 2VG7A 3PFEA 5F0WA 4R5PB 4DUYJ 4DV6J 2J0XA 2IY5B 2J9CA 2DGTA 3HM9A 3TI0A 4K59A 2HHHJ 4CO5A 1PJ5A 2XULA 4YY3F 1A7GE 1FKAF 5IQ6A 4N77A 4P71A 1H2TZ 3A8EA 1S1XA 1RTHA 3J7Z5 2V0NA 1CJTA 3OLBA 3PX0A 4QW8A 1NAQA 4FF1A 4DV0J 3W5XA 3M30A 3ZZUA 3JAMU 2KH9A 2X1FA 2VQEJ 2E9TA 3MTJA 4TN2A 4KKOB 1F5BA 5CYQA 5U47A 1T0TV 2MHEA 2DR6A 2OEMA 1S9EB 3C3LA 4TU8A 3MR7A 1EJ7L 3GV8B 1NXIA 2JHEA 4E0DA 3C2PA 2XEXA 3AD7C 3FBEA 4O3PA 4YUDA 2XS2A 1GMWA 2VICA 2ZM6F 2BQUA 3BKTA 1FWKA 4DZDA 4F0MA 5CQGA 3MM9B 1FFSB 4IG0A 4U7UD 5SUHA 7AT1B 4ZVPB 3Q8PB 1OJ4A 3E3XA 4KR0B 1JKHB 1WC5A 2AEFA 3VR1A 2WZ1A 1SJQA 4CLFA 2M0GB 2ACMA 2UUAF 1AT1B 4K7QA 3Q22A 3SQGB 2BW7A 5GVQA 3GJTB 4R5PA 1YJTA 2QZ8A 1VCTA 3CO0P 3ET6A 5LOQA 4NLOA 4GKJJ 2W25A 4F50A 3HFZB 4URQU 5A0YA 4OV1A 2YQ1A 3OR1A 1OIAA 4LF9F 1FESA 2VC0A 2HHSA 1WHYA 2B9EA 2FHKA 2VBXA 2JOQA 4F2SA 4PG8A 4JI6F 2UZAA 4K0KF 3R6LB 1MWZA 4X4QA 3TP2A 5DLGA 3NP5A 2Z2MA 4OZNA 5IC4B 3AD8C 3G96A 3E51A 3G8QA 1TAUA 2B6AB 2JEGA 1P1TA 1NK7A 4ER8A 4F02A 5I4MA 1XNQF 2V8GA 3NS6A 3HHLD 2EC2A 3AOAA 3M4XA 3CD5A 3M8ZA 4Y65A 5KFLA 1JNRB 4CZCA 1N5TA 2HNDA 4LIWA 3T1AA 3K2YA 4Q7AA 3KK1B 3BSOA 1X9MA 1TL1A 4KHPJ 3FCWA 1QY7A 3DDNA 5IT9U 4DSJA 1NH7A 3AOCA 3FUYA 4H4KA 5KG2A 3NCRA 2MY7A 3ISNC 2DYAA 1OQ6A 2VPYB 1RWKB 1DURA 1D9AA 5K14B 2AGQA 1X5OA 4UUXA 2MZQA 1J5EF 4IO1A 1FEHA 3ZTRA 2IYGA 3A4TA 1CJKA 1HWLA 1R27B 2ZDOA 4WTYA 5CH7B 3A13A 2VQFJ 4PEOA 3GJRB 5DGAA 3RAQA 3V5RA 3GTYX 5JVHQ 2PFFB 3P4UB 5LM7E 5A8WA 3HHLB 2K1RA 1SV5A 3BGFA 5JMNA 1U1PA 2VG5A 1MU2A 1N54B 3OR1B 1C0UA 3W61A 4P7TA 5C42B 5J2PB 4OYAA 2HSEB 3E2EA 2LEAA 3BREA 4YB5A 1AYEA 3OFGA 3MPVA 4C8MA 3TA1A 3UDEA 1IN0A 3TRGA 1YLXA 5GMDA 4F4KA 4RU2A 2XHWA 2AQ4A 4LUBA 4ZCLA 3OD2A 4RX6A 4JYAJ 2RSQA 1ZTWA 2RS2A 1EQ0A 3L9ZA 3LP2B 6FD1A 1P27B 4USJC 5AXNA 1FK9A 2ILZA 4X4SA 3GYNA 1ZAXA 4WP8A 2OKQA 4HHUA 3G6VA 2DHAA 3FCHA 3DYAB 1Q8IA 3M8QB 3PYDA 3EZ5A 2K2PA 4IFYB 4JP8A 2ZH7A 1S99A 4OI1A 1VBXA 3RZAA 2XM3A 1WEYA 1HL6A 1RGVA 2BACA 2CQHA 3DN9A 4OYPA 4WFZA 3KHLA 2YNGB 4FNHA 3R2CJ 3DOKA 3H42A 1GMUA 4J5OA 2OPSA 4CLUA 2DNHA 4PUOB 3BH6B 2FLOA 1VHFA 3VQTA 4C9DA 3DGPB 4AE5A 4OX6A 1OY9A 2RDDA 4YN3B 5HMZA 5KFQA 1AUDA 2AX1A 2CUYA 4J9VA 1Y5NB 2MLXA 4DL5A 3M1VB 4RW6B 2QA4S 1RWPB 1TZ0A 1HW9A 1VR6A 3BPDA 3HKZD 4EGLA 2ZH5A 3HJFA 2OMOA 1Q4RA 4U8VA 1U8WA 2A6MA 3BKUA 2LXIA 5L9XA 3HHLA 3M6WA 3BGRB 3V2UC 4N56A 4K4XA 2CZ9A 2BKOA 1IBLJ 3CDBA 4LFCJ 2ATLA 4B9VA 1Z1ZA 3B4MA 3KMSA 1UL3A 2CVIA 3DRPB 2PI5A 4GKKJ 2R7UA 5D6GA 4PXBA 4O3QA 4Q5VA 2VIHA 5CYJA 3LTOA 2ALZA 1VQ7S 2EBGA 5LXYA 4B9LA 3TAMA 2PN6A 4ED4A 1VBYA 2YNHB 4WU3A 3EDQB 3PM9A 2KZZA 2J7UA 4DX5A 1FDDA 2J9EA 1N33J 1RB0A 4ZCMA 2UXBF 3M8QA 3TJ9A 3ILIA 3Q2TC 1RT2A 2XI2A 5CCLA 4DR5J 4A8OA 2A6OA 1N6QB 3MAAA 4H4MB 1SC6A 2H65B 1EKSA 2YBVA 1N0VC 1SH2A 2FJEB 3HSDA 4TLRA 1VOMA 1BQNB 4TU9A 1FVSA 2GO9A 3DGPA 1IKWB 1JQGA 1JXVA 2F40A 4DPUA 1HBOB 3J81Y 3LA0A 2OP5A 3NEKA 1IM6A 1QD1A 3FMBA 3HVRA 3QAEA 2QFJA 1NLKL 1RT6B 1AZSA 4C48A 3M2UA 3NS7B 5F3TA 1EHWA 3BO3A 4DF8A 3MFIA 2CQDA 2FD2A 3MWBA 4ZP9A 2H5JB 3MPDA 4NXNF 2FQQB 2CQGA 3DHXA 4PQAA 2HZCA 1U25A 2HHQA 3GCXP 3QNWB 5LL6d 2BM1A 3CDUA 1IKVB 4N8OA 3G2XA 3CMES 3BSNA 2FJXA 2VKRA 5ETMA 3RB4A 3BDEA 2G2OA 2IVMA 5E3QA 2KN4A 1RYRA 4LFBF 1CEZA 4OYMA 2C2RA 1F9HA 3FQLA 3IR6B 5CYQB 2JLGA 1T05A 5D4OA 5KFRA 1NK6A 2Y8WA 1S72S 4X4TA 1Q86T 1S6UA 3KHHA 1DQ9A 1XNQJ 1ZAVA 2YQ0A 3LW5C 1IXKA 2EFPA 4KGKA 3TZYA 2MXYA 2B5JB 1RWMB 4LMZA 1G2EA 1O0PA 4H4MA 2C3PA 3QQCD 1JLFA 2RRBA 2NXJA 3MM8B 2KHDA 1NPRA 3AOBA 3BO4A 1XBWA 1FRXA 1FRIA 2XYGB 1PO6A 1O51A 1RAIB 5JJBA 5KFNA 2HLTA 2OO4A 2RUSA 5KFCA 4R8UB 3BSCA 2NLWA 2O1PA 1IR2A 3QATA 5J1NA 3RB6A 2OTLS 5EWGA 5C24B 2HNYA 1FRLA 2OH2A 3IBWA 3CJTA 1N52B 1DY3A 4NL5A 3EX7B 1RAGB 2D9PA 3U1LA 3R1HA 2P9GA 2R8JA 4OHYA 1BE4A 2VASA 2P9CA 2V8PA 4PABA 2HBYB 3W1YC 2CQ3A 1EKRA 3U02A 2XSJA 1P9QC 2DKOB 3QT6A 4DI6A 3MEDB 5GADU 3QZ7A 4NMXA 1B70B 1T9VA 3PKYA 1VGYA 1SC1B 3JB9k 2VA3A 2MLZA 1RHRB 1TVRA 5D4LA 2FY8A 2LLZA 1CJUA 1D1UA 1DRZA 2BJ3A 1T03A 3HHEA 2FZKB 3PJXA 4FS1A 2OHDA 3MR2A 1RKJA 2KM8B 4DUZJ 2YKNA 2CFXA 3PR4A 1T11A 3AB2B 3HKWA 3KYLA 2V5HG 5F3ZA 1DTTB 2MDAA 3IBCB 3H4BA 1VQMS 1ZYQA 3D4JA 2L3MA 1U0SA 2BJEA 5DM6Q 3BYRA 2MZRA 3CJ8A 3JS9A 3NNAA 2HK3A 2WCXA 2ZH8A 2XMMA 2BMBA 2K7JA 1WC3A 3L09A 1FRJA 3QFWA 3UW1A 1XR6A 3ZZZA 2CQ1A 3ISND 2O66A 5H9EJ 3R5BA 4ED5A 2DGSA 3HFKA 2J6UA 1RBLA 4G1QB 4X4VA 1T03B 4X66F 2FPHX 2H4YB 5FLXY 3UD4P 2UXCF 3BBBA 5DO2A 2F65A 4LFAJ 4X4RA 2K3IA 2AZ3A 4URSA 2HQFA 1A6LA 4L73A 4KGXB 3T41A 1Q53A 3SV3A 4JI7J 1F5AA 1U26A 3G6XA 2LA4A 4FN5A 5L1JA 2HFNA 1S59A 1SJ4P 2CZVC 2FHOB 5F0UA 2CG4A 1VQSA 1X4GA 3I32A 4A48A 3Q86A 2V2VA 4GVLA 1YBTA 1Q0NA 3G6YA 3ZZOA 4X4NA 1FNOA 3ZO7A 1S49A 2Z56B 3D28A 1FXLA 4IR9A 1RT7A 1VQ5S 2CQ4A 4GKJF 1L3KA 4DUTA 2QLXA 1YJRA 1DHMA 3I5AA 2KDOA 4FZVA 3OTOJ 1RAAB 3DDIA 2RQKA 1NK4A 2JJ4D 3D3BJ 4IG0B 5BYQA 3Q24A 5LXRA 2DGOA 2HZAA 2BV3A 2HNZA 2I0XA 2E5JA 2VH7A 2WOMA 2P9EA 3OFEA 3P3DA 3QPIA 1SKSA 1N8RT 4DSLA 2LMIA 3UVJA 5SZTA 4LR7A 3K5MA 4ED1A 3T5HA 2A1BA 4DFKA 4UY8T 4ECZA 1X5TA 1WUUA 2HRTA 3E01A 1HWIA 3DLKA 3EICA 3OVBA 5T41A 2FLPA 2B9YA 3PFOA 2FZGB 3LALA 4IH5A 2V2KA 5CZVA 4NXNJ 2MSTA 5IFMA 1WC6A 5DJBA 1R8HA 1R6YA 3D6TB 4O0NA 4PXEA 4D3GA 2D41A 4DXLA 5LMUJ 2HYIB 4DV6F 1FO1A 2OJ3A 3EGZA 1HHSA 3FBBA 4X66J 1S6QA 4L74A 2A18A 4OX7A 2O5DA 2GJFA 3MUVP 1XK8A 1Y7PA 3QGIA 1Q7YT 1WTFA 2BM0A 3OTBA 4ANEA 4M63A 4ZKAA 1IKXB 3KFWX 2G9OA 3MMCA 3TEGA 4K4YA 3TZWA 3I31A 1VRUA 3ETOA 3PCOB 4J9PA 1UWAA 2EK6A 4ALZA 4Z2XA 1GTHA 2PFDA 3MPYA 2WBRA 5KG6A 2KG1A 1JXLA 2GMHA 1TL7B 1IWGA 4HT7A 1XIQA 5KT2A 1RLCL 3LWMA 1Q82T 2ZNZA 1BQNA 2JC1A 4DX8H 4WKRA 1UZHA 2MKYA 2MQPA 1NEEA 3CTRA 2BOPA 1SJFA 3CJRA 3HZGA 4Q45A 3O1LA 3LPEA 1KTVA 3ZZPA 3U1MA 3MURP 4CP5A 3ZC4A 4BS2A 4EWTA 4EO8A 1GAOA 2NUHA 2X1BA 3DLBA 3WX8A 3LP0B 2EKYA 1WC1A 1HI1A 1WELA 1XERA 1MU2B 2EEYA 5J2PA 1UCNA 3EGWB 2QRRA 1LNQA 2C1EB 4HH0A 1XMQF 5KG4A 3K7RA 4MH8A 3AH6A 3GCWP 4Y34A 4KQZA 6FDRA 4JI6J 2QX0A 4EFAC 1HWUA 3P8BB 4PXCA 2F8MA 4P52A 4JI5F 2YPYA 4ED3A 4NXMJ 5HL7Q 4OFZA 5KFJA 1N5YB 2HFZA 3CDWA 2R8IA 2GGPA 3BGLA 5KFHA 3M05A 1QVFR 2RHQB 2XMAA 2CVEA 2N82B 4Q2LA 3S8SA 2BYCA 1WACA 4L75A 4V19X 1TFYA 1E6VB 1RT1A 3H8YA 4ICLA 1FE0A 4LRDA 2BRLA 3ZTOA 4KT0C 2D3ZA 4XK8C 1KQFB 1H6KX 4U8YA 5M2PA 2QC3A 2QLBB 1RAFB 2JX2A 5I3UA 4TLQA 3PJ9A 1N5SA 3DMJB 3MCSA 4LSLB 3W5YA 3GIKA 3HSGA 4P7VA 4F67A 5E41A 5DDRC 2BQ3A 4EYIB 4PWUA 2PSZA 4RBVA 2BANB 2WB1D 3DC2A 2HBRB 2RF2A 1ZPWX 2B4UA 2X3GA 3KUGA 1XMOF 2E7XA 2RQMA 1TKTB 3GR0A 4D3HA 5K8OA 1IBKJ 2QE5A 2Q6BA 3CIZA 4LSNA 4YQWA 2R8GA 4LF6F 2LQBA 2Q66A 4HR2A 5H9FK 5ETLA 2B5JA 2NPFA 4XAKA 2ALYB 4ZVRB 4AT1B 4DPTA 1NKBA 1B64A 3FBCA 3OUYB 1LKZA 3CJKB 1NO8A 3I6PA 2EFNA 4CO0A 1HI8A 1T02A 1RWUA 3GWCA 4NCAA 4G1IA 4Z7YA 2MTLA 2VG6A 3KWMA 1SBRA 1HQUA 1DARA 3B4DA 1Q1KA 1U2RA 2FC8A 5DETA 3VAKA 2PT0A 3PHEA 3R7BB 1M5VC 1KLNA 4JYAF 1JWWA 1N56A 1MLAA 2PC6A 4BWMA 1E6VA 1LEOA 1RT1B 2H54B 2IDLA 5KT4A 1RT3A 3NWRA 4Q2MA 4PUOA 3FSXA 2XMVA 3EVMA 3W66A 3H5YA 3SMZA 5IZHA 5KFDA 3CJ2A 1LWCA 3DRSB 3N4WA 4YEAA 3MFHA 2E1PA 2VG6B 4ETXA 2MQQA 4WFYA 1LWEA 1P8GA 2DRDA 1FDNA 1WI6A 2DJWA 3PW0A 3QFHA 5HVHA 1L3UA 2DPIA 4OYWA 3FEZA 2DEJA 2J6TA 3OVAA 2VUGA 3CCJS 4C8OA 3IO1A 3BQ1A 1RWXB 1TU0B 3N6NA 4PWDA 1TV6B 4QCLA 2XQCA 2SXLA 2YY3A 4MTPA 2V6AA 5HQMA 1QTMA 5ETNA 3ILJA 1UVLA 3LWLA 4G65A 4HL9A 4Y3CA 1BGXT 1R43A 3MM9A 4K2XA 4DV4F 2CQBA 1XWLA 3A1YG 2IA0A 3CWJA 1YRTA 1HNXF 1VYAA 5J2QA 2V4JB 4NCGB 2ZE2B 4XPCA 2I5JA 1YITS 3IGNA 1M5PC 4C4WA 4FVMA 2N3OA 3IAM9 3OXFA 3OHBA 4MYTA 3VTIA 1JLQB 1XMBA 4G1QA 4QWCA 1NJXA 3MXHP 3ZZRA 2A2DA 4RNOA 2JVRA 4DR5F 4QPXA 1ACMB 1VK8A 2XO7A 1Q78A 1VQNS 2HAFA 2VB6A 2N7CA 4DFJA 2C2EA 4JI4J 3P5TL 3M7VA 4PG4A 1FFWB 1H73A 5ADZA 4DV1J 2ZJPQ 2BUNA 2L08A 5DZ7A 1FNXH 5LMNJ 1ZH5A 2HHPA 3AT1B 4DMZA 1RHUB 2KFNA 4M5NA 1NU4A 3OT9A 2D9OA 2MQOA 2XNRA 3WDOA 3SYZA 1NPPA 3C16A 5L1IA 4ECWA 3NMAA 5ETRA 2D3O1 2RDIA 3CW2C 1VQOS 3D7SB 4QYZJ 4DR4J 2DNPA 3J80U 1VQ6S 3IG1B 5AE2A 2W9BB 2FGOA 3FFIA 4DPXA 5KG1A 1VMBA 3MZIA 1CBKA 1N32J 2HS3A 3NGTA 4KB7A 2W9CA 2IRXA 2DR5A 5KFAA 1EIYB 1TL1B 1S9GB 1X4EA 4ECUA 1K0VA 3UR3C 3DLHA 2LQJA 3UD3P 4F04B 5MLCV 2ZH9A 4W4MA 4LRFA 1SL0A 5KG0A 3W62A 4YHHF 4DWIA 2EPIA 1S4FA 2H48B 3I0SB 1U4BA 1X8DA 4OZ1A 4OYBA 3LP1A 4BHQA 1VFJA 1NSKL 3DNCA 2MKSA 3W63A 3M6VA 4PPDA 4Y2KA 4DX6A 3DLEB 3ICLA 2PO4A 3T19A 2M9KA 2WVDA 1FJEB 1RUSA 2L9NA 1H74A 4DV0F 1EARA 2DBBA 2RNEA 1JMTA 4C11A 2QTWA 4DCPB 2I38A 2OPRA 4LQ9A 2E5LJ 1UP1A 2K7KA 1JXEA 3GE9A 5DG8A 2LDIA 2RB7A 2ZFHA 3EXCX 1M1HA 2EBEA 2J9DA 3TA0A 4KJIA 1CSJA 1KOOA 5HJYA 3C15B 1VHIA 2ROGA 2AHOB 2YX1A 2IVFB 1S97A 4IRKA 3D0GE 4Y28C 4A8MP 4PPZA 1PAUB 2ZBRA 4NOHA 3K59A 3KJVB 2YXLA 4UOHA 4KHRA 3DLEA 3ZTSA 1T05B 2F4VF 2MEWA 5KFXA 3MMCB 5GAEU 2CJQA 3FGVA 1WD6A 2ZUGA 2QA1A 3WX4A 5A76A 4ES1A 1UJ5A 4ZMMA 4Y0FA 2YWEA 1MROA 4DQQA 1S9GA 3CJ0A 2FJDB 3GYGA 3KDNA 1FI4A 1UWBA 4CLTA 3EGNA 2DT9A 1JLFB 3FZ2A 3IR7B 3MM8A 3QWPA 1EX8A 3R27A 2E66A 2Y3YA 3MMBB 4DHVA 4USUA 3RW7A 3O2IA 3EWGA 3R3TA 3I0SA 3JTOA 5HI7A 3WIVA 1WHWA 2R7TA 4CLPA 2HMIA 1RWWB 3JSYA 2DISA 4OMFG 4CLLA 3NGDA 4F4ZA 2GHVC 1SL2A 2KT2A 2XLKA 1WDDA 3GB0A 4DU7A 2XC9A 3M9MB 3CUNA 5HO4A 1K9MT 1KN6A 3HLUA 5HSPA 1IVZA 3AY0A 3LAMA 4X64J 3DOLA 3VQSA 1WOPA 3KLHA 1RTJA 4CT8A 2AYGA 4M5LA 4N7TA 1HMVB 4LFAF 1NDPA 1GQEA 1H2VZ 3M8WA 3X3UA 2NQPA 1TL3B 3BGOP 3VHQA 2NSCA 1HNZF 4X65F 3V4MA 3PIOQ 4NLQA 4RW9B 1N34J 1EETB 4UF4A 4ETZA 4ERDA 4NPOA 3EZUA 2J9DE 1KFDA 4DSIA 1NJIT 3HHLC 2J8SA 2WVBA 4DV3J 2OELA 1U2CA 4WP3A 3ZNJ1 5CCMA 1HD1A 1YRUA 3HULA 2FJVA 2IVYA 1GXUA 2ZITA 3SFGA 1ROFA 4WIQA 4DLGA 3RU0A 4UT4A 5D3GB 3T5LA 3QRPA 1Q5VA 2GJ2A 2MKJA 4RW9A 2A0FB 2C3YA 1FVQA 1HW8A 3TJ8A 4DR3J 4CH7A 3CC4S 4OI0A 2KVIA 2QYGA 3IRXB 2Z4PA 4OI2A 2OMLA 4EBDA 4X4UA 2DNKA 2YWKA 3HSJA 4O23A 5B09A 3H40A 1HHQA 3Q8YA 2WBMA 1YZ6A 4RLEA 1BXNA 3H5UA 1P6TA 3R5DA 2V9KA 4DR1F 2B3TB 3QIPB 4FPRA 3LH2S 2GS8A 3LUYA 2DXFA 1KTQA 1RHMB 3HT3A 3JSMB 1LV5A 2RE1A 1H2UX 1IWAA 2GO8A 2HRYA 3KJFB 1IKYA 3JQJA 4F0HA 4DV1F 2PA3A 3THVA 1JJ2R 1TL3A 3CJKA 2B56A 2X7IA 2AJ2A 2DNQA 3GJQB 2M3DA 4HI2A 3TNVA 3W9HA 2HK2A 2DH9A 2W9AA 3VVUA 3QJLA 2WSEC 4RBUA 4LFCF 1X5PA 2IM3A 1EB0A 4L72B 5BJRA 4W92B 1RAEB 4H54A 4CH0S 2NXUA 4NA1A 4CM2A 1NJYA 2G0IA 2O3DA 4ZVUB 3CCMS 1IBMJ 3MECA 2Q3PA 4MKVA 2ZWPA 1C4AA 4USVA 3FC9A 2QSWA 4JI3F 4PWDB 1AFIA 5HVGA 2VHGA 1RT3B 4OZJA 4JV5F 2KFZA 1RWNB 3GV7B 3D5MA 2E44A 2HS0A 2OPPA 3AJ2A 5EWEA 1MN9A 1IR1A 3LQVA 3MEDA 3ZZYA 5IM0A 4ECVA 2MKCA 4YFUA 2RVJA 3TYTA 4DL4A 3IRXA 4P2FA 1KSPA 1I5OB 1LWXA 2XBPA 3VAMA 3V6DA 2DR8A 4NASA 2FLNA 3QGPA 3OFHA 1KBRA 3L3CA 2GQ2A 1LW0B 2ZC3A 2V2ZA 3CT9A 2HNDB 4KHMA 2HVDA 2GMLA 3SCIE 3MHYA 4AL5A 1FKOA 2GVDB 3DLGB 2OPPB 3BJYA 4QR2A 1FF2A 1TR0A 2QT7A 2XCAA 2E5GA 1NZ8A 1RAOA 4LSLA 2ZE2A 4ZVQB 4CQ1A 4ECRA 3HI9A 4GC6A 2CPIA 3SDEA 3PIPQ 1VRTA 1ZM4A 2ROPA 1B0VA 4QQBA 1F5CA 3DM2B 4DR1J 4KO0A 2E1RA 3M2RB 1I1GA 3RG6A 5IV3A 4DJBA 5BYSA 4LF8J 2QLFB 1S10A 3BDPA 3WHIA 1XC9A 2GNKA 2CQIA 4LSNB 3KJNB 1IUJA 1IQTA 4OHWA 1E6YA 4K4UA 2YTCA 3UDVA 5GAEI 9ATCB 3MUTP 3SV4A 4LF7J 4IQXA 2DNNA 2MLYA 3TAQA 1S1WA 3UQSA 2XLIA 3TUIC 4J9NA 1WHXA 4DSKA 2IJFA 5GMKa 4CLSA 2AX0A 2R7XA 3SDEB 1CC7A 2YNIB 3TAPA 1LWFA 2OPQB 2MKHA 2GV1A 1EQMA 1ELOA 4PWWA 2C2NA 4I2QB 4R0EA 3R8YA 2EI5A 3S6EA 4LRAA 3SQGA 3UI3A 4UZCA 5HQ8A 3SCKE 2IRYA 5D0EA 2ASLA 4C0OC 4WCEQ 4L3NA 2KTQA 2YKMB 1G4CA 2XHCA 1O8BA 1ZBTA 2B51A 4GVBA 3CD6S 4C8KA 4B9UA 3ISZA 4UQTA 1QLNA 4PYAA 2Z58B 1HBUA 1S5ZA 3MM7A 4TVAB 4V1Ak 4YP3A 3OSPA 3GJSB 3HD1A 3Q8QB 2AKWB 1U1OA 2O01C 3PV8A 3CD7A 3M2RA 3BBCA 2E7WA 5HJXA 3TVKA 3MCOA 4OL8A 3D1HA 1GH8A 3CF5Q 5G0RA 3MR3A 1CS4B 3C8YA 4RPFA 1ZS6A 2XWXA 4K0KJ 2DIUA 5I3PA 2J0SD 4JI0J 2JVOA 2R7QA 2NYIA 4WE1B 5B0BA 2W1BA 4AD6A 2U1AA 1U09A 5F8GA 4BC9A 4FVCA 4OJ3A 1KLMB 3PYGA 3DRPA 1CJTB 2V4JA 3EVOA 4M5HA 4NCGA 5F41A 2PMZD 3X1LB 2FVPA 2J0QD 1WG1A 1NCLA 1Y00A 2M52A 3G87A 3J7ZT 1EZZB 3KJQB 3OTDA 4LF8F 2G0JA 3UVJB 5LSRA 2LXUA 2BE2B 2FGCA 3OL6A 3TVZA 4I2QA 2B8PA 1R6VA 2LYVA 3KKFA 2NS1B 4I69A 3TX8A 2D69A 4WFAQ 1FXDA 3K0JA 2FYXA 2RUGA 3HXMA 1ULRA 2DGQA 1VRUB 4B02A 3UPFA 4F8RA 1RTJB 3ETMA 4RKUC 2R8HA 1W2BR 4FS2A 4V19J 1S6PA 3QYYA 3UDCA 4WZMA 4LF2A 3LAKA 4UOCA 1TP7A 4GVBB 1FJCA 4CT9A 4ELTA 2CZ4A 4KGMA 3B6BA 3MD3A 2QA2A 3CXCR 1WF0A 2IC3B 3ZZTA 3OJSA 1TKDA 4NI2A 1J5OA 1BLUA 1T9TA 4WU2A 5D78A 3CIMA 3SZ2A 2RQ4A 2QV6A 4OV6A 3QWUA 3ZZ0A 2RMLA 1ZZNA 4B3RJ 2HHUA 2JFKA 4GMKA 4TYAA 3H5SA 3Q89A 5BR8J 1PYTA 2GAGC 2DGWA 2FDNA 2KL8A 4ZK7M 4KHPF 3FSYA 3HSZA 3TUPA 5A6WA 1JLEB 2GVZA 2O67A 4JV5J 1UEKA 1T9YA 4MKAA 1HFEL 4ZS6A 4ZHRA 4JV1A 1RAHB 2ACYA 4QBUA 3M32B 1N48A 1XNRF 3PX6A 4AXJA 1YRXA 3TJAA 2G2YA 3W2WA 1VJQA 2KU7A 4IDKA 3G82A 3BSAA 5KFWA 1QSYA 4DQPA 4O3RA 2KRBA 3QO9A 5FIIA 4R8UA 2UVWA 4O3SA 3MUMP 5LT5A 3MMAA 2HNYB 2C22A 3GR1A 1RWOB 3UD5A 2V4RA 2QL7B 3HZEA 3OPKA 5C2CA 4HVZA 2NREA 4ECXA 2LEPA 4NCBA 1U0HA 1OPIA 3OBIA 1RHJB 4ENOA 4DR6J 3SBMA 2DVIA 1FE4A 2BKNA 3GSDA 4A8XA 3TZXA 4F4XA 4OI6A 1YHQS 1L3TA 4DR7F 1H0HB 5ETKA 3KLFB 5DG9A 2IC3A 2QYCA 3CCSS 3ADAC 2MYFA 3W8GA 2R2SA 4F4YA 3FJ2A 4KV8B 3CCTA 1REGX 3SXLA 2QIFA 4DBQA 2MY8A 2JLEA 3W9IA 5KFEA 5EN1A 1C0TB 1SI9A 1Z2LA 2OEKA 3EM1A 4J9UE 2F1FA 3FEYB 4B3MJ 4MK8A 3SSRA 4DCOB 1XN9A 2ABYA 2J0WA 1MROB 3TVYA 5CHCB 2LQ9A 5E33A 5J1EB 4X4OA 1D9DA 2BVZA 1T9WA 3NKYA 2JEFA 2HVZA 4K4SA 3OUYA 2HRUA 4IO9Q 2OGUA 3RRHA 1PGZA 3VZHA 1Q5YA 2UU9F 1NB2A 3TANA 3QGHA 3I56S 3NCQA 4DL2A 2R7VA 4ZN1A 4BC7A 1S0MA 2ZZNA 3LPYA 3R2DJ 1RU1A 1HLWA 3MPUB 3M8YA 3RBXA 2XTJP 4I0WA 3NAIA 4OJ1A 4FBTA 1M5KC 2VOPA 1JLBA 1HPZA 1NRKA 2XNQA 2YKNB 1K8AT 2Y0SD 3JXOA 3PG9A 3AHPA 1WSVA 2V68A 2UXBJ 4L76A 1SUQA 4ZDNA 5K8MA 1FT8A 4X4PA 2NXNA 3GZ7A 1WC4A 5DG7A 4B17A 4MIWA 3DGVA 2VBZA 4CO1A 1Q8LA 2LFVA 1SC4B 3T1HF 1JLCB 1RZMA 1TMJA 1Q16B 2C2MB 4M8LA 1SH0A 3TOQA 2XZDB 2ADBA 1K73T 2Y1JA 5CZXA 2CQ0A 1REVB 3QGGA 3DI6A 1JJ4A 3D9BA 2DNZA 2N3LA 2XMKA 4AQYF 4I68A 1WHVA 3UN5A 3U27A 4CDIA 2BJ1A 3FEXB 2ZHBA 4DS4A 1S1UA 2XZTB 4RUHA 2JEJA 5E3PA 4CNZA 3J7AN 2JSXA 1FXRA 3H2VE 4NLWA 2YH1A 1UPMB 3NWGA 4MK7A 2QSFA 1NBEB 1OS5A 3W8PA 1NZAA 3RAXA 2W7PA 1KHVA 3JAMY 4RR5A 2G1DA 4EBCA 4F4WA 2UUCJ 2AIRB 1AA1B 3CMQA 3N0VA 1YBUA 2FJBB 2HNZB 2WOMB 3PR5B 1M5HA 4DPYA 4JI2F 3CCRS 1T7PA 3PEHA 1UVKA 2QJ3A 4QZVB 4B9NA 2VODA 1HQEA 5ETPA 2HWIA 4NRTA 9RUBA 2AEMA 5L38A 3IM8A 2MJUA 1HI0P 3KTQA 2XY6A 5HANA 2YVSA 3E01B 3TO8A 5B0CA 5KFPA 4QYRA 4DV2J 3PYEA 2Y1RI 1WOOA 4ZPDA 1WI8A 1U7LA 3W3SA 1ZA2B 1WG5A 4A47A 5A2QU 2LQ5A 2UV8A 3UCZP 5E3AA 2XMTA 1S4EA 3MMBA 3BV8A 4NA3A 4P75A 1UJ4A 1VLOA 1F3FA 2B0GA 2IJRA 3LP2A 3O3LA 2RD5C 4P2XA 2IHR1 4RNHA 2W4DA 5IC6B 5KTQA 5L46A 1VBZA 2N4DA 4ZA1A 3BQ0A 2QGFB 4HEA9 1RBOB 3QRRA 5GAGU 2DHXA 1APSA 1QVGR 1S0NA 4BWJA 2OEJA 2ZH4A 3M6XA 1SKRA 4JV2A 4GO5X 4WE1A 1C0UB 5C42A 1I94F 7FDRA 3OSNA 3WIUA 1R89A 3DOKB 5E0OA 4LBPA 2IFXA 3LANA 3MD1A 1QJHA 4RW4A 4U95A 5IWAJ 2F4VJ 3BN7A 2KHCA 3HVWA 4UUWA 3VAJA 2GQCA 3JSBA 4NLTA 4ECYA 3CCQS 2CYYA 2W24A 3GMGA 3L4BC 3CJQA 2ZJRQ 2LXFA 3FFIB 2B4VA 2CNNB 4OHZA 2CDQA 1OY8A 1UEUA 1FDBA 2RKIB 2CQ2A 2EW9A 4C11B 4RU9A 4LBHA 2PI4A 2EG2A 4YOEA 1QAYA 3OR2B 5F8NA 1F9EB 2W2PP 3C6TA 4WP9A 1X5SA 4UOGA 3CDAA 1KC8T 1PJ6A 4Y2IA 1TL5A 4KE5A 2PGCA 4ZCKA 5EHHA 4ZP6A 3UCGA 3IA0A 5DDOC 3LP1B 3AJDA 3BPSP 4I6YA 2AYBA 3Q2SC 4P6QA 2BA9A 3PVXA 5K8NA 2CPHA 2R4FA 3ENWA 3K57A 4ILLA 4FYVB 1YIJS 1S48A 4IG3B 5DDPC 4P72A 2VQEF 3GFZA 3NRBA 4DV5J 1U1KA 1X9SA 1DZ5A 3H0PA 4U7CA 1UA1A 2DRBA 4QR1A 3J81j 3GU0A 2VBWA 2DIVA 5HAOA 5IOLA 1W2IA 1RABB 3CCUS 4RW8B 5HP1B 4YDDB 2V8VA 8ATCB 2ZH2A 2AZ1A 3POTB 4EU0A 3VAFA 2W4CA 2R8KA 3PDNA 1IKWA 2E1MC 2W7AA 1GX5A 3PYFA 2D74B 4X84A 4FXVA 4DS5A 1TK5A 3HMJG 4CRJA 1X0FA 4NRUA 5J2MA 3GFHA 4K5SA 3N79A 1TKTA 5H9EK 1TKZB 2Y1LB 3CJSA 1TELA 1Z4UA 3ELHA 4P73A 4ZN3A 1RTIA 2XGPA 2XMJA 4WFNQ 1UW9A 3C6TB 2XY5A 1TAQA 5KFZA 4RW7A 2IJNA 5IV4A 2APOA 3AXKA 1HNIA 1UAWA 1MW7A 3F0NA 4YDXA 4CLZA 4DN0A 1FDAA 2YQ3A 3VALA 2HKEA 4UOFA 2OUGA 3ENAA 3N28A 2GIFA 4USMA 4A8QA 2W4PA 4KPYA 4NYOA 1S0VA 2D3OR 4RWXA 4K4VA 2AW0A 4ZOSA 1M0SA 2E1AA 4TQRA 2R7RA 1Z2ZA 3DOLB 3W60A 2ZNYA 2RT3A 4LF7F 2PD1A 3MAHA 3MEGA 2OD6A 1JLGB 2GIRA 5HROA 4RW8A 5HP1A 4GKKF 2PMHA 3D68A 3QT8A 3N5FA 1QUPA 2QL9B 1RQ0A 5LSLA 2EFGA 3FNNA 1BY9A 4Z7CA 2MQNA 2YPZA 1LFWA 2UUWA 4M94A 1RA7A 3ILLA 5HBMA 4B3OB 4EUVA 3ZFVA 2RAQA 1F60B 1X7VA 4TY9A 1H7XA 1FRHA 2YKQA 4ZLJA 3BR9A 2D7SA 4KRWA 5MAOA 2UUBF 1R3NA 2DNOA 2NXCA 2WTFA 3RBZA 1WSRA 3CCVS 3W2VB 1RADB 1FTRA 1ZAWA 2DGVA 2KG0A 4NLGA 4K50A 2HHXA 2DH8A 3J7YI 3RRGA 2FTRA 4TQSA 1E6YB 1Y3KA 5A0YB 4ZJQA 2F9JA 2F63A 3H2UB 4W90B 5RUBA 1HNIB 1OY6A 1NSAA 2AU0A 4TKTA 4ZVGA 1TL4A 4CYUB 3CD0A 4EZ6A 4ECSA 1VJWA 3IR5B 2GGPB 2HWHA 4NYPA 5ETVA 2WVEA 3AAWB 1M1KT 1FTCA 4FXWA 4MKYA 5A8KB 1PC4A 2HZVA 1HPZB 2NR0A 3I4HX 4X62F 2FVQA 5C25A 4OX9F 2AJ4A 1M5OC 2GX8A 2HEKA 2NSBA 4FPIA 4O4RA 2V9WA 1V5VA 3OTOF 1IKYB 2VZ9A 5KFTA 3U7JA 3BQ2A 2FHMA 2ASJA 1YJNS 4EI2A 5KFYA 4ZHRB 1L5UA 1KQSR 2G1HA 3NBPA 1XMQJ 4B3TF 4QYZK 3I0RB 3MDFA 3AJ1A 4LFBJ 3BS9A 3TZZA 4OQJA 4LSZB 2K8GA 5CYMB 3DI6B 1RYSA 2KT5A 3BEGB 2L41A 2XO6A 4UZBA 2CDRB 4KYZA 2BANA 2Y9HA 8RUCA 1TTHB 1PJ7A 5A8KA 3I87A 2LU1A 2G0CA 1U49A 2DK2A 2B9XA 3HJVA 2CWKA 1Q81T 3ET6B 1LW0A 2VJVA 4YR3A 3K58A 3BM7A 4HACA 3UWTA 4ECQA 1MWQA 1L3SA 2FHJA 2UXDF 4J9OA 3EYZA 4OI3A 3SQOP 2H1YA 1Y0HA 4Y2CA 2ZBQA 3HCXA 3T9ZA 5DQHA 4LJMA 3BBFA 1NK9A 1BHNA 1V3ZA 2R2RA 3OQ2A 4WXWA 3DLJA 4G3IA 3EUNA 1SJ3P 4LF6J 3HHKA 5B0EA 1TFWA 1HNVB 2Y0BB 4P74A 3NS5A 2B7CB 1HNZJ 4PAAA 4DZ6A 5J1PA 4PYDA 2HVIA 2LECA 2LEBA 5HMXA 1KFSA 1T94A 1QE1A 2ZH6A 2HQIA 4ZLPA 2AD9A 1RA6A 3ILOA 1WF1A 3I0RA 2B4PA 3EJMA 2CADA 2AYEA 3HX9A 2COLA 4M5IA 1RWVB 4DPWA 4IQMA 4WKYA 5GAHU 4NZ7A 2Y8YA 2U2FA 3JYTB 1CQNA 1HA1A 1RT5A 1M90T 3MOJB 3A8IA 4LREA 5KG3A 3TQEA 1XEZA 3AD9C 5HATA 4OJGA 4LR8A 3J7YU 1IBKF 1FWPA 2QFIA 1JLAA 3R7SB 4ES2A 2P6SA 2MB0B 1Y11A 2VKZG 1ZM2A 2EVZA 4KTQA 1UVIA 3G8TA 2WAQD 4UQGA 3KK2A 4M5MA 5D77A 1SUQB 4DPOA 4ED0A 2PA8D 3MAAB 4NEYA 1QE1B 3VGUA 4M5JA 2WSFC 3IAS9 4XIUA 2UP1A 3R9LA 2EFQA 4C8YA 3D3CJ 1V3RA 1HBUB 2E5IA 3D2WA 4RW4B 2J6SA 1Y4ZB 2DY9A 2I5JB 1QAXA 2LP4A 3P96A 2EFVA 3G82B 2VJUA 1NM2A 4MMOA 4FDFA 2PEHA 2GIQA 3P5BP 3W9JA 4B08A 3UN2A 3M9NB 4DL6A 4C98A 4LVNP 3DLKB 4MKBA 3K5PA 1HBNA 1OO0B 5AXMA 1QUVA 1URRA 5KFMA 3KUHA 1KVJA 3JTPA 5EGYA 2ZKTA 4F3MA 5J2NA 2HVHA 4GRSA 4LRCA 2VOOA 1WKJA 4MYUA 2QG9B 4QW9A 2BXJA 3SI8A 2B8QA 5AJ3J 3CPWR 4MAKA 3MTKA 1MMLA 2RDJA 2HIYA 2QA4G 2DR9A 2FLLA 3CGIA 4CIOA 1DQAA 3IG1A 2W9BA 2B9WA 4TXSA 2FVCA 3ITHB 4USWA 4A8WA 1PILA 4CWBA 1QTNB 4HH1A 3AXMA 3W5ZA 3OL9A 2WSCC 4N76A 1S6PB 3CEDA 3K17A 1FRKA 2JL9A 2YX4A 4LIRA 3KHRA 2FJWA 2QMXA 1F2GA 1DQ8A 1NH8A 4ZVEA 3PW4A 4KC5A 4A8YA 4JV0A 4O4GB 2BQRA 1FJGF 3T6JA 3A8JA 2AJFE 4ZIVA 1LWCB 3DRSA 4DG1A 3P49B 1G3OA 1KWMA 3V6JA 6AT1B 1N32F 3DRRA 1YK9A 2KI2A 2HVEA 2V8HA 3IM9A 1X31C 5K9FA 2OLWA 3AA8A 4KGZB 2IPOB 1U48A 2KB2A 2VG7B 3LGHA 2WB4A 4JBCA 4NLPA 3TR5A 3QIPA 4DCJB 2FJAB 2M4MA 3BGRA 4CH1A 2AGOA 1XNRJ 4U67Q 1JLEA 1MN7A 4NZ0A 5H9FJ 2BE9B 2HQGA 4A4JA 5KT7A 3TX0A 3VGTA 4LF1A 1N36F 2R7SA 3NGRA 4C3KA 4CCHA 1NUEA 3DOMA 3PKMA 2UV8G 3M32A 1JLCA 5F8LA 5E3CA 1X60A 3SSSA 2R9LA 3KLGB 1F6TA 2IM1A 1B7YB 3D54A 3BYPA 3THPA 4RUBA 1CJUB 2E5LF 1DTQA 5C2GA 3OW2R 2DY1A 1T3NA 1OWXA 2JH3A 3OHAA 3A3OB 3C6UA 1IJEB 1QDUB 2J7KA 1Q95G 3OXLA 1I51B 4J90A 2ZZTA 4DL7A 4Q8EA 1Y5LB 3OR2A 1A9NB 4N8NA 1JLGA 5HROB 2CWXA 2MGZA 3G4SS 4ITSA 1DFDA 2H4WB 3I5BA 4RUAA 1RHKB 3KLFA 2VFTA 2DHHA 2CJAA 4OYOA 3EPIA 1N4LA 3TWZA 1HBOA 4B3OA 2E5HA 5KFVA 3KLGA 3FSIA 2ZZMA 2HFVA 3R7NB 1AZSB 1AW0A 5HQLA 3HP6A 3TA2A 2XWYA 1V9OA 4ZJOA 4IRCA 4C3MA 2Z8QA 2IAJB 1WKKA 3C14B 3C6UB 4IFVB 3KLHB 5E5NA 1W7WA 4RL1A 2ZOMA 2YWWA 1MG7A 2ZHOA 3WBZA 2DRAA 3QJJA 4PG7A 5D0GA 4G1PA 2CKWA 2HPUA 4WJBA 4C6AA 2E1CA 2WVCA 2VFUA 3HHDA 1Q79A 3QT7A 4IUFA 1FKPA 1PG5B 3IRWP 2UVUA 4Y2AA 4ZPCA 1S7IA 2JEIA 3RBDA 1CPZA 1GNKA 2OTJS 4IKAA 1VRTB 4DQRA 3RJMB 2UVVA 4PRFA 1HQUB 1VC6A 4J7CA 2FVRA 1LQ9A 2Z2LA 1ZM3A 2VD3A 1U02A 5KG7A 2GMJA 2A3JA 1ZA1B 1RU2A 2MZSA 4H4OA 4IFVA 4AYBD 1DLOB 5HVFA 4DFPA 1RKIA 2RILA 3R5GA 2BE7D 4K5RA 5JUMA 4DSFA 4JI8J 4B3RF 5D0RA 3G6ES 1K1QA 3EXYA 2GA7A 1H7WA 2G2ZA 1HIYA 1HWKA 2CPXA 4DV3F 1OQ3A 1VQ8S 2BDPA 4ZLNA 1C1BB 3JSRA 5A8RB 4L3KA 2DGXA 1SH3A 1HWJA 4FXDA 2IYIA 1XMOJ 1B99A 2HBZB 3MM5A 1JLBB 4P9SA 2A10A 2IAJA 3C14A 2ZJQQ 3MM6B 2XS5A 2DNRA 1F3VA 3Q83A 4O3OA 4R0JA 2VPZB 3MECB 4A46A 2C2OB 3PRDA 1QM9A 2E9ZA 2NXEA 2JDJA 2D1CA 4LF5F 1JX4A 5HBMB 1N33F 1AUSL 5E7OB 4J37A 1KS2A 1YWXA 2F8HA 1D0EA 4Q8FA 1U47A 1KQKA 5IXUA 1K1SA 1CJKB 4IG3A 5G0RB 2BJ9A 4FYYB 1KKHA 4CLKA 2R7WA 1SQEA 3N6LA 3TARA 3RB3A 3C46A 2D3UA 3DDKA 1I6JA 2CNOB 1UTAA 4KIAA 3JTNA 2MHNA 1HYSA 4C3LA 4DLEA 2YKPA 1X4FA 3Q23A 2XY7A 3DFEA 1ZTTA 1RDRA 2PE8A 5A6PA 5KT3A 1RT4B 2PEBA 4QIFA 4HHHA 4ED8A 1VQKS 2F7VA 2KXFA 2VV5A 3C16B 3L95X 1S6QB 4XDDA 2OI2A 3KG4A 5K5MA 3U1NA 4GC7A 1IBMF 4QU7A 3JYTA 3NMRA 1KVKA 2CG8A 4USHA 1T95A 2H3EB 3W7BA 1F2HA 4JI5J 2J8AA 3KNGA 4FF4A 2LVWA 1RT7B 5KFKA 2HIQA 4DR7J 5JVGQ 4WYWA 2GFFA 5KFIA 4YY3J 3I9V9 4X2BA 2NZCA 3UO0A 4ZITA 3RTVA 3UCUP 1HYSB 3CNQP 2P6TA 2DXEA 5D0HA 5FD1A 3KNAA 2Z57B 1OYEA 1S12A 3T6BA 3OVSA 2DHGA 5D3GA 1RXOB 5B7WA 3H5XA 4K4ZA 1N36J 2OPSB 1JK9B 2CJYB 4J9SA 1VC0A 1TKXB 2CXEA 3QLHA 1VISA 5F8IA 4M5DA 3L7OA 1JNZB 3IC1A 1J5EJ 2HHVA 2KM8C 3GFYA 4LBIA 4AL7A 2CJKA 3CB4A 1KP6A 3FK4A 3J81U 3RRKA 5C7PA 2MQ8A 4I7FB 2F3JA 3MEKA 2DCUB 4CTAA 2HGNA 2LA6A 4OZLA 3OLAA 1AROP 1S1TB 2QL5B 5D4PA 4LF9J 4L6V3 3I9ZA 3WQPA 1FA0A 2AMCB 1N0UA 1OMSA 5J2NB 3IN5A 5I42B 1RTDA 1TKXA 4F3OA 1TUGB 3ZTQA 2J76E 2CJBA 2MSSA 1RCOB 3HPOA 2ZUAA 1FD8A 3BH7B 1M5SA 2PIIA 4NZ6A 3M8SA 5IT0A 3TAMB 4Y6IA 3KJVA 1QAJA 4PQUA 5F8JA 3Q8VA 3H25A 3QSIA 4HT5A 1NK0A 4YB6A 2DNYA 2H5IB 2RKIA 3F73A 2K1RB 2XMUA 3QIDA 1WOSA 3T1HJ 2YWGA 4DL0C 4BDPA 4DR4F 2GC8A 4WWSA 3KUEA 3QT5A 3BB5A 1O5JA 3FDSA 3US5A 4O4GA 5IM0B 2DR7A 3DMJA 2QLWA 3KOAA 3W2WB 2GCFA 4ILRA 4OLOA 4CYUA 2HBQB 4EO6A 4ED7A 3NY0A 1FRMA 2IA6A 4PCQA 4JI8F 3WC0A 1SIZA 3GIIA 4O44A 1LW2A 4OIXA 4URGA 4QIGA 2BBEA 5KFBA 1R8AA 5EDWA 5L1KA 2BZ2A 3JQKA 3CC7S 2DNGA 2HQCA 1VI7A 4QWEA 4LF5J 2KKHA 3MOZA 4JI2J 1HMVA 3JQMA 1IBCB 4EK2A 3RBEA 1KDNA 1NHVA 2ILYA 2IRUA 3PO5A 3DRYA 4MFBA 3ZNUA 1FHTA 1HR0J 5I42A 2NYHA 2XZWA 3A12A 4PZVA 1RTDB 1SQGA 3VGVA 4ZJLA 1WF2A 2HGMA 4I64A 1Q8BA 1YJUA 3D6FB 5FDLA 4C0HA 1N5YA 4QIWD 2J7WA 5T7LB 4WZQA 3OTCA 4PQUB 4ATNA 1SIWB 2OFGX 3H4DA 4JUZA 1X0PA 2HQ3A 1YKWA 3SSQA 3IBFB 1UEVA 3BGUA 3LP0A 2MKKA 1NMEB 5KOXA 4WFBQ 2XMWA 1XJWB 3NXZA 2KJWA 2N4CA 1GT8A 1S1XB 2ZOGA 5ETSA 3TEHB 2XSJB 3NGUA 3UFCX 4NLXA 2IIHA 1FWLA 2ZH1A 3NNHA 1S1WB 5CABA 1XR5A 1YQHA 4F2RA 2ASYA 5FDLB 1J5OB 3Q0AA 2C42A 4F3QA 4WTOB 3FVYA 3DXSX 3MI7X 1PYOB 1TVRB 3GP9A 4XTTA 2JLFA 1JLQA 4NLUA 2VPXB 5C24A 3GIMA 2CPZA 4IOCQ 4X64F 4H4OB 1RT2B 1LK7A 2M2BA 3FRZA 5A8WB 1NK8A 5KFFA 3P45B 4A8SA 3NG8A 5I3UB 4ECTA 3GIRA 3RGIA 3CCZA 2ZH3A 4J9QA 4DV7J 2RQCA 1N34F 1W25A 5CA5A 2CPDA 4AL6A 2R2UA 4IDKB 2V94A 1U45A 3DRRB 3GIJA 1VIXA 2AT1B 3S01A 5T7LA 3HDSA 1OYDA 3GILA 2IDEA 2RJZA 5AXLA 2RF2B 2OSQA 2QMWA 3GV5B 3W2VA 1NNDA 3MMJA 1N5QA 4FYDA 1KONA 5BR8F 2ERRA 3TQ1A 1Y3JA 2ZDPA 1UFKA 5E2QA 4E8UA 2KVQE 4OI4A 3NBPB 4I6AA 2MZ1A 5LMUF 3CULA 2WONB 3N5BA 1B7FA 2Q6CA 5DQGA 2I1RA 2VDIA 3GQCA 4WK1A 3RUBL 1NDKA 2BEFA 1U1LA 3RR7A 2VBYA 5B0AA 1D09B 3CCES 4ZPBA 2YKAA 1UVMA 3DXBA 3KG1A 3SCLE 1R0AA 3HHNB 4OZ5A 5H1SV 1G1XA 1K44A 2CJXB 1FKOB 2GVDA 3FBFA 1S6OA 2GJIA 1ZZFA 3T1YJ 1YTYA 2BR0A 2XI3A 4HTJA 1PBUA 3C15A 1TUWA 4JI1J 1UZDA 3M8PB 1S76D 2YWHA 2Z0GA 4NLSA 2CNLB 5CYMA 5ITHA 1QAIA 2WHOA 1U1RA 3DM2A 2DD8S 3CO9A 3SEOA 5L9NA 3A3PB 1L3VA 2C3OA 5ETOA 1ZETA 3VCDA 2GQQA 1BQMB 3D0HE 2E29A 3R5AA 3IFEA 5KFUA 4DEZA 3V6HA 4DV7F 1FERA 1TV6A 2BABA 4IH6A 4USKA 1UPPA 5DZ6A 3VGSA 3VZIA 4BBYA 3HD2A 3AA9A 1EP4A 3AQOA 5B08A 2KO1A 2OIHA 2OSRA 5DDQC 1FKPB 1UFWA 4RWWA 2VFVA 1PKUA 5EUHA 5KG5A 1VQLS 2HS4A 1M1GA 2RU9A 2LKZA 3CMAS 1WKLA 2IBOA 2ZVIA 5L39A 1OPZA 2V8DA 3R1LA 4DG1B 1D9FA 1RT5B 3KHGA 5D15A 2BJ7A 1WJ9A 2YX7A 1LXJA 2X1GA 3G8SA 4X65J 2HHHF 2M88A 2KFYA 2UXCJ 3M2UB 1VRQC 2X1AA 3BF4A 3QRQA 3W65A 3I4PA 2FVSA 3DYAA 3PW5A 4K8RA 2WW4A 3VAIA 1UJ6A 1IM4A 2DEIA 3H90A 3K5OA 3CSKA 1T9UA 2AEJA 1H72C 2RH3A 3H98A 1YDLA 3KK3B 2Q79A 1UVNA 3AQPA 4AUKA 5B0GA 2YWFA 1VQ4S 4I4BA 1RTZA 3H20A 4OZ3A 5HMWA 2F9DA 1G6BA 1Y9OA 2V34A 3MGJA 4M5DB 3PX4A 2HHTA 1VQPS 4NX9A 1RBAA 1QSLA 4JB8B 1DJ0A 4W98A 4LT6A 1FK9B 2BJ8A 5EX3A 4B3TJ 3CCWA 3RR8A 1GMVA 1HBNB 1RE1B 1R8PA 1VQYA 1MWYA 3M8RA 1S1VA 2C3UA 3V6KA 4JI1F 2EKNA 1GFWB 2UUTA 4TY8B 2UUAJ 3HFVA 1KLMA 1U1MA 5DM7Q 2UUCF 7FD1A 3POTA 4QIEA 2DNMA 2WK4A 4FKXA 4ZVFA 4Q44A 3CDEA 4LRBA 4F0KA 1YJ9S 4Q0BB 3RW6A 1YI2S 5L8RC 3EMTA 3QBCA 3FZBA 3C66A 2BE2A 4CNYA 1S57A 3EE3A 1JIHA 3PNIA 4R25A 4TNOA 3DRXA 5IT4A 1FEEA 2MPUA 2R3VA 2AF6A 2V50A 4EZ9A 2ZVSA 5HK4A 4EMDA 3JSMA 2F5GA 1ITPA 4ELUA 1WORA 3HT0A 3HVAA 2GVZB 3PZPA 1S79A 3THTA 5LJ3Y 4B9TA 5KOWA 4DUZF 1ZOTA 1KNZA 3O8WA 1RT4A 2ZC4A 4RW7B 4JI3J 4YB1P 4UY85 4C8NA 2XG8A 4OJHA 3T9NA 4FYXB 3I55S 3QO9B 3BKFA 4WXOA 2XS7A 4DFMA 4IYQA 3IWLA 4NLDA 4BLGA 4DN9A 1RI7A 2H9ZA 3MEEA 3HVTB 4WK3A 2OAUA
chains in the Genus database with same CATH topology
3F41A 1C2PA 3IXQA 5IWAF 4DQSA 3H59A 1UWBB 3FQKA 5C5JA 2KXNB 1FCAA 3MF5A 3QMQA 4MFBB 4QOTA 4WFXA 2XSFA 2VQFF 2G13A 3M30B 4ELVA 2HMIB 1C1BA 5A8RA 4KV8A 2JZ5A 3KLVA 1HQEB 4KSEB 2HGLA 2RU3A 4IH7A 4PG6A 4K4TA 4RUCA 1N88A 5GAHI 2G4BA 4QWDA 4QPTA 4E98A 2JC0A 4J9RA 1WG4A 1X4DA 3HVTA 4TYBA 4HYKA 3MPWA 3OVBA 3IWXA 2DH7A 5F8HA 3BZQA 4DF4A 3GYXB 2AJ0A 3MM6A 1UVJA 4IRDA 2NUUG 5T14A 1U6BA 1S77D 5F8MA 2C2DA 2FUG9 4NLVA 3K8VA 1VK3A 1D8ZA 4ZCIA 2P5VA 1NK5A 4FNIA 2CPYA 4I56A 2VL1A 3OJUA 2CJ9A 1N5VA 1BWEA 3OTEA 1V3SA 3PJWA 4RBTA 4C0BA 5E3RA 4PXDA 3PO4A 2W7OA 2IBKA 3GG0A 2KRRA 4F25A 2AP6A 1U24A 1R8CA 1BQXA 4U9RA 3OL7A 4DV2F 2I8EA 1NKCA 3CJ3A 4C8ZA 3KLIA 1RTIB 4MK9A 4J9MA 1VQ9S 2MGZB 1X4CA 3CE8A 3HF5A 3ENVA 3WZ0A 1U6FA 2EG1A 4H4KC 5DS7A 4DL3A 1KRPA 1G7CB 2POKA 5AE1A 3OXGA 4LVOP 4QWBA 1NJWA 2OPQA 4PG5A 3PXGa 4Q43A 1NB7A 1LOUA 1LW2B 3E8OA 3VAHA 1HNVA 1K0TA 2EC0A 4I1TA 3J80Y 2NPIA 2Q43A 2IM2A 3DHWC 4DR3F 2B4OA 3RAMA 2AWZA 2HHWA 1C1CB 4JI0F 4ID5B 3ULHA 2ZHAA 5DRKA 3T3FA 4I6WA 1KR4A 3NGKA 4HDHA 1LFPA 1VC5A 3V4IB 4OX8A 3V6DB 1SJRA 4M1KA 1JLAB 3DCAA 4DR2F 2F8EX 4N47A 3GFXA 4NMLA 3CJ5A 5HLFA 5IT9Y 1YBAA 2W9CB 1YGYA 4ZPTR 4FF3A 4ZP7A 2CRLA 4QWAA 4OHVA 3T5KA 2LU2A 2KJVA 1MSWD 2RS8A 5THWA 3B8HA 4F26A 4ZP8A 1HBMA 2HLUA 3T5JA 1KD1T 1OSDA 4M95A 4KO0B 3CVKA 3F44A 4A8KA 4G6VB 4BCAA 4Y00A 1UKUA 1URNA 4PKDB 5KFGA 1X9WA 4AXIA 3O44A 1MNEA 2DCLA 3M9OB 1YG0A 2DO4A 2FC9A 2ADCA 5KT6A 3KK2B 3KMQA 4C7QA 4YMEA 1TK0A 3DLGA 4HDGA 2YNGA 3BN4A 1C1CA 1JJHA 1T8EA 3HK2A 1P1LA 4ED6A 1PSDA 4N5SA 1LWFB 2GHWA 5K8PA 1LWEB 1HR0F 1RJJA 1NKEA 2WRMA 1C4CA 3V4IA 4I2PA 3V81B 2B43A 2BJDA 4RW6A 4ZPWR 1DBDA 3ITHA 3PW7A 3QZ8A 1R7IA 5A2QY 4RNNA 4B3SF 1CG2A 3KK1A 3KLEA 1HHTP 4ILMA 4AFFA 3OV7A 3LGNA 2MQMA 5L1LA 3I96A 3CCLS 3HO1A 1MMDA 2HG4A 3MAQA 2CPEA 3VAGA 5EWFA 2OD4A 5KFSA 2MKIA 1U1NA 2DHSA 1SXLA 2MJNA 1R8BA 3QLHB 5HMYA 1MMNA 2CQPA 2LDYA 1BD6A 1RP5A 4NYZA 2YNHA 2XCPA 2FHJD 3MMAB 1X4BA 2FIUA 1KEKA 1IR0A 5DLGA 1LK5A 1VLYA 1U1QA 4A8FA 3J7A1 4CTAB 1JB0C 2A2CA 3UR0A 1WEZA 4LF4F 1N6QA 2K3KA 4YR2A 5EX0A 1IKVA 4TY8A 4XPEA 4DSEA 1GTEA 1Q7LB 2ZD1B 3IS9A 1CPZA 3R5CA 1D8YA 4RZRA 1KQGB 2YNFB 4NLRA 4CO3A 2KYXA 1JKHA 4ZPAA 5GAGI 2DNLA 2IMWP 1CC8A 4HKQA 1RT6A 4LQ3A 4FF2A 2J5AA 3IWNC 1U2FA 1X4AA 2MZTA 4KFBB 5C25B 3N6MA 2CPJA 2KT3A 1GX6A 3ENQA 3EPGA 2VA2A 1H98A 1KOHA 2W8KA 4KBIA 2L48A 2AYMA 5BYRA 3UE2A 3UDLA 2KYZA 3BO2A 3Q8SB 2KXHA 2VPWB 3FMWA 2XB2D 1GXTA 4CO2A 3T1YF 5F9NA 4O3NA 3GG1A 1YJVA 3PEJA 3D1QA 5LSOA 1TQLA 3SCJE 3K5NA 4RNFA 3LO3A 2Q1LA 3M1VA 2M8DB 1FJ7A 3N01A 1HARA 3ONQA 1DAXA 1R31A 5B0DA 1V6HA 1VS3A 3MEEB 4U7UK 5M2UA 4ICLB 3PW2A 2I2YA 4DQIA 4WF9Q 2R7OA 3AB4B 3DU6A 5DQIA 2HWTA 3F56A 2H5EA 1HNWF 2ZKUA 2EK1A 3DLLQ 2PDAA 2JFDA 2JRSA 2E9RX 1AFJA 4QJVA 5LMNF 3D1OA 3MR5A 2VONA 2YH0A 4ZVHA 1S9EA 4O44B 4DV5F 3WC2A 1RAJA 2CPFA 2M7SA 2DB1A 1AXQA 4QU6A 1S1VB 3KLIB 3MEGB 1RK8A 2C3MA 1SV5B 2MZJA 2RIJA 1RTHB 5DLFA 4YB7A 4CI0B 2B7BB 2NZ4A 1H38A 5AE3A 3M8PA 3LOUA 1WWHA 3PY8A 4OLPA 3G71S 1S0OA 1FD2A 5G4DA 3RB0A 5F9LA 4NA2A 2BW2A 3TUJC 2CIMA 1S1UB 1DLOA 2ZBCA 2HAIA 4OZ0A 4I67A 3CJ4A 4MIAA 2XGQA 5I3QA 1LXNA 1IQZA 2DPJA 4NLYA 4CO4A 1TUVA 2R2TA 5AJ3F 5DGBA 1EETA 2CQCA 4NWBA 1UA0A 4K4WA 1YSJA 3TUZC 2V4QA 4TU7A 3LGMA 4WIIA 1DTQB 1X4HA 1YVFA 4N41A 1KVIA 5CD4H 3S1TA 4YR0A 2OFHX 3QJPA 1XR7A 2MQLA 5J1EA 5HN0A 2RRNA 1GXLA 1CVJA 2ZOFA 2EWHA 3CC2S 2AV5A 1IJFB 2WONA 1S9FA 1FNMA 1HBMB 3M2VB 1REVA 3BR8A 2MMYA 2ROEA 4C2MA 4B3MF 4B9MA 1H3DA 4IOBA 2B6AA 4ID8A 3SFUA 3NNCA 4WYLA 1F9FA 3DU5A 2N7YA 4MJKA 3O6QA 2VG5B 2M8HA 2QEXS 2QO3A 4J9LA 4NXMF 2ZBIA 3VF0B 1IBLF 3FRYA 5KT5A 4JOUA 1D3WA 4J9KA 4C97A 4ES3A 1OSCA 3M2VA 5IQQA 1BC6A 4USIA 1J2VA 4Q0BA 1NJZA 2UVRA 5K14A 4HLBA 5GADI 1XTZA 5AXKA 1UMJA 5J2MB 3OL8A 1SKWA 2HFOA 1CQMA 4HTIA 1R0AB 3NCPA 3KLEB 1SJ1A 4IFYA 1S7HA 4Y2MA 2WW8A 1S1TA 2YKMA 1SB6A 3K5LA 1DTTA 1WTBA 2DTJA 2L9WA 4QIVA 3G9CA 1HD0A 3B82A 3TW0A 2IM0A 4IOAQ 2VFRA 2EFOA 3Q8RB 1SL1A 1NHUA 2M70A 1B0PA 4DDFA 5M2RA 2RRAA 5IS2A 4RNMA 3LF0A 1KHWA 4PR6A 3K8WA 3MM5B 1QSSA 4C8LA 4I2PB 3V81A 2Y1IA 1BQMA 4Z37A 3RYLA 2FB0A 4GO7X 4MIBA 5KAKA 3I5CA 3KK3A 1EP4B 2YKOA 4DUYF 2ZD1A 3IS9B 4HHJA 3QAUA 2GHPA 4EYHB 1CLFA 4DR6F 4ID5A 3L7PA 4P2SA 1WEXA 3H2LA 3B78A 5D8HB 1TK8A 1F0XA 5JXSA 2DITA 3KG0A 5D4NA 4JI7F 2AJQA 3IGVA 2X51A 4XDCA 2LCWA 4EBEA 5HLFB 3NLCA 4KFBA 1TKZA 3PACA 3NAHA 2AJ1A 2OPRB 4EEYA 2M5YA 2BRKA 4XO0A 4B9SA 2KZMA 4KAIA 3I82A 1RISA 4JI4F 1T3OA 3O5TB 1UW4A 2YNFA 1VIOA 2YNIA 3PRBA 2GW8A 2W8LA 4KKOA 1YJWS 1UFLA 2DGUA 3NL0A 3OFFA 3M6UA 2C28A 4QR0A 2XLJA 1Y5IB 5B0FA 2VC1A 5CXTA 2FY1A 1ZM9A 1B0TA 3S7RA 3N9UC 4ZPVR 2I9SA 1PC5A 2DO0A 4IR1A 2IMOA 1U6ZA 5FJ4A 3MM7B 3VWSA 3MR6A 2ASDA 1U8SA 3D0IE 2JWNA 4UW2A 1UETA 4HI1A 4OHXA 1WNEA 4U6PA 4O0IA 3G86A 1C0TA 4FP9A 1IKXA 1ZPVA 4ED2A 4DOZA 2HW3A 3UNGC 2VFSA 5KFOA 5LJ5Y 2AGPA 2L9DA 4I7FA 2VG7A 3PFEA 5F0WA 4R5PB 2J0XA 2J9CA 2DGTA 3HM9A 3TI0A 4K59A 4CO5A 2XULA 4YY3F 1A7GE 1FKAF 5IQ6A 4N77A 1H2TZ 3A8EA 1S1XA 1RTHA 3J7Z5 2V0NA 3OLBA 3PX0A 4QW8A 1NAQA 4FF1A 3M30A 3ZZUA 2X1FA 2KH9A 2E9TA 3MTJA 4TN2A 4KKOB 1F5BA 5CYQA 5U47A 2MHEA 1S9EB 3C3LA 4TU8A 3GV8B 4E0DA 2JHEA 3C2PA 2XEXA 4O3PA 4YUDA 2XS2A 2BQUA 2ZM6F 5CQGA 3MM9B 4IG0A 5SUHA 3Q8PB 3E3XA 4KR0B 1JKHB 3VR1A 1SJQA 2M0GB 2UUAF 3Q22A 3SQGB 5GVQA 4R5PA 1YJTA 2QZ8A 4NLOA 2W25A 4F50A 4URQU 5A0YA 4OV1A 4LF9F 3OR1A 1OIAA 2HHSA 1FESA 2VC0A 1WHYA 2FHKA 2VBXA 2JOQA 4F2SA 4PG8A 4JI6F 2UZAA 4K0KF 4X4QA 1MWZA 3TP2A 3NP5A 2Z2MA 4OZNA 3G96A 3E51A 3G8QA 1TAUA 2B6AB 2JEGA 1P1TA 1NK7A 4F02A 5I4MA 1XNQF 2V8GA 3NS6A 3HHLD 3M4XA 4Y65A 3CD5A 5KFLA 1JNRB 4CZCA 1N5TA 2HNDA 4LIWA 3T1AA 3K2YA 4Q7AA 3KK1B 3BSOA 1X9MA 1TL1A 1QY7A 3DDNA 4DSJA 1NH7A 4H4KA 5KG2A 3NCRA 2MY7A 3ISNC 2VPYB 1OQ6A 1DURA 1D9AA 5K14B 2AGQA 1X5OA 4UUXA 2MZQA 4IO1A 1FEHA 2IYGA 4WTYA 1HWLA 1R27B 2ZDOA 5CH7B 3RAQA 4LF5F 2PFFB 5DGAA 3V5RA 5JVHQ 5A8WA 3HHLB 2K1RA 1SV5A 3BGFA 1U1PA 2VG5A 1MU2A 1N54B 3OR1B 1C0UA 5C42B 4P7TA 5J2PB 3E2EA 2LEAA 3BREA 4YB5A 3OFGA 4C8MA 3MPVA 3TA1A 1IN0A 3TRGA 4F4KA 4RU2A 2XHWA 2AQ4A 4LUBA 4ZCLA 4RX6A 2RSQA 1ZTWA 2RS2A 3LP2B 6FD1A 1P27B 4USJC 5AXNA 1FK9A 2ILZA 4X4SA 3GYNA 1ZAXA 2OKQA 3G6VA 3BQ0A 2DHAA 3FCHA 3DYAB 1Q8IA 3M8QB 3EZ5A 2ZH7A 2K2PA 4IFYB 1VBXA 1S99A 4OI1A 3RZAA 1WEYA 1HL6A 1RGVA 2BACA 2CQHA 3DN9A 4WFZA 3KHLA 2YNGB 4FNHA 3DOKA 4J5OA 2OPSA 2DNHA 2FLOA 1VHFA 3VQTA 4C9DA 4AE5A 4OX6A 5HMZA 5KFQA 1AUDA 2AX1A 1Y5NB 4DL5A 3M1VB 4RW6B 2QA4S 1TZ0A 1HW9A 2ZH5A 3HKZD 4EGLA 3HJFA 2OMOA 1Q4RA 2LXIA 5L9XA 3HHLA 3M6WA 3BGRB 3V2UC 4N56A 4K4XA 3CDBA 2ATLA 4B9VA 1Z1ZA 3B4MA 3KMSA 1UL3A 2CVIA 3DRPB 2PI5A 5D6GA 4PXBA 4O3QA 4Q5VA 5CYJA 2ALZA 1VQ7S 2EBGA 5LXYA 4B9LA 3TAMA 2PN6A 1VBYA 2YNHB 4WU3A 3PM9A 2KZZA 2J7UA 1FDDA 2J9EA 2UXBF 4ZCMA 3M8QA 3Q2TC 1RT2A 2XI2A 5CCLA 4A8OA 1N6QB 4H4MB 1SC6A 1N0VC 1SH2A 2FJEB 4TLRA 1VOMA 1BQNB 4TU9A 1FVSA 2GO9A 3DGPA 1IKWB 2F40A 1HBOB 3J81Y 2OP5A 3HVRA 3FMBA 3QAEA 2QFJA 1RT6B 3M2UA 5F3TA 3BO3A 4DF8A 3MFIA 2CQDA 2FD2A 3MWBA 4ZP9A 4NXNF 3DHXA 2CQGA 4PQAA 2HZCA 1U25A 2HHQA 5LL6d 2BM1A 3CDUA 1IKVB 4N8OA 3CMES 3BSNA 2FJXA 2VKRA 3RB4A 3BDEA 2IVMA 5E3QA 2KN4A 1RYRA 4LFBF 1CEZA 2C2RA 3FQLA 3IR6B 5CYQB 2JLGA 1T05A 5D4OA 5KFRA 1NK6A 1S72S 4X4TA 1Q86T 1S6UA 3KHHA 1DQ9A 1ZAVA 3LW5C 1IXKA 2EFPA 4KGKA 2MXYA 2B5JB 4LMZA 1G2EA 1O0PA 4H4MA 2C3PA 1JLFA 2RRBA 3MM8B 2KHDA 3BO4A 1XBWA 1FRXA 1FRIA 1PO6A 1O51A 5JJBA 5KFNA 2HLTA 2OO4A 4R8UB 3BSCA 2NLWA 2O1PA 5J1NA 3RB6A 2OTLS 5EWGA 5C24B 2HNYA 1FRLA 2OH2A 3IBWA 4NL5A 1N52B 3EX7B 2D9PA 3U1LA 3R1HA 2P9GA 2R8JA 4OHYA 2VASA 2P9CA 2CQ3A 3U02A 2XSJA 1P9QC 5GADU 3MEDB 3QZ7A 3PKYA 1VGYA 3JB9k 2VA3A 1TVRA 5D4LA 2LLZA 1D1UA 1DRZA 1T03A 3HHEA 3PJXA 4FS1A 3MR2A 1RKJA 2KM8B 2YKNA 2CFXA 3PR4A 3AB2B 3HKWA 3KYLA 2V5HG 5F3ZA 1DTTB 2MDAA 3H4BA 1VQMS 1ZYQA 2L3MA 5DM6Q 2BJEA 2MZRA 3NNAA 2WCXA 2ZH8A 2XMMA 2K7JA 3L09A 1FRJA 3UW1A 1XR6A 3ZZZA 2CQ1A 3ISND 2O66A 5H9EJ 3R5BA 4ED5A 2DGSA 3HFKA 2J6UA 4X4VA 4G1QB 1T03B 4X66F 2FPHX 5FLXY 3UD4P 2UXCF 5DO2A 4X4RA 2K3IA 4URSA 1A6LA