2F4VF

30s ribosome + designer antibiotic
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2f4vF00
1N34F 4DV6F 1XNRF 2BXJA 4B3TF 4DR6F 1G1XA 4X65F 4OX9F 4DV1F 1B64A 1N32F 4DR7F 2ZM6F 2HHHF 4B3MF 4JI1F 4DV2F 2UU9F 2UXBF 4B3RF 2J5AA 2RJZA 4DV7F 4DR2F 4DR1F 2UXDF 4K0KF 2VQEF 4KHPF 4JI2F 5IWAF 1HNWF 2B7CB 3ZZPA 3OTOF 3T1HF 4LF9F 4JI7F 4DV5F 4GKKF 4B3SF 4GKJF 4LFCF 5AJ3F 1N33F 4YY3F 4LF7F 2UUBF 1HNXF 1QJHA 4LF6F 1IBMF 1J5EF 1VMBA 4DV4F 4X64F 1G7CB 1IBLF 1HR0F 4JI8F 4DUZF 4LF5F 2UUAF 1N36F 4LFAF 2KJWA 4AQYF 1FKAF 3T1YF 1CQNA 4JV5F 1GH8A 1XNQF 4JI3F 4DUYF 4DR3F 4YHHF 2B7BB 1IJEB 2F4VF 1CQMA 4JI0F 4NXMF 4JI4F 4JI6F 4LF4F 1F60B 1HNZF 5LMNF 4DV3F 4JI5F 3R3TA 1I94F 2UUCF 5LMUF 1XMOF 2YY3A 2VQFF 4DR4F 5BR8F 1IJFB 2BVZA 2E5LF 4NXNF 2UXCF 4X66F 4LF8F 4LFBF 2KJVA 1XMQF 4DR5F 1RISA 1IBKF 1FJGF 4X62F 4DV0F 1LOUA 4JYAF
chains in the Genus database with same CATH superfamily
4FBTA 2HNZB 4TQRA 3RRKA 6AT1B 1WC4A 2A2CA 1ACMB 3DXBA 3PRBA 3R5CA 4O3QA 1X9SA 2GNKA 4C7QA 4DQRA 1N5YA 1IR1A 1HQEB 2ALYB 5IQ6A 2EBGA 3VZHA 4AL7A 3NP5A 5M2PA 1DQAA 1U47A 4WK1A 2JEJA 4DI6A 2FZGB 2XZDB 2HGNA 1Y11A 1QAXA 2X3DA 2DNYA 2RKIB 7AT1B 1VBZA 2C2EA 2CPXA 1SKRA 4J9OA 1YBTA 4LF5F 4DV3J 5DLFA 4MKAA 5KFCA 3PY8A 3M2VA 2J7KA 2CZVC 4UW2A 5H9EJ 1NSPA 4M5NA 4NE9C 4JI0F 3SCIE 1LFPA 1Q8KA 2VDIA 3MFIA 4KPCA 2OFGX 1VQ7S 2MLXA 4IFYA 3PKMA 2R2SA 4KO0B 2YXLA 3C15B 1H2TZ 1R8HA 4ZVEA 1PIEA 1XQIA 1X4CA 4L3KA 4IG0A 2CQGA 4LF8F 3T6JA 2X3GA 2LLZA 2HBQB 4DPOA 4NI2A 1FKPB 2FJVA 1HNXJ 3KNAA 2KM8B 1YSJA 4OMFG 1EETA 5AE2A 4CCHA 3QGGA 2KKHA 1HNVB 1N5QA 3HK2A 2HQCA 4XDCA 4QOTA 1I51B 5IQQA 1RWUA 3FBCA 3RBEA 4F0KA 3KDNA 2G0CA 3DOKA 3HULA 3MD1A 1K9MT 1YQHA 2GIFA 2CZ4A 1EX8A 2N3LA 4ZPTR 2O5DA 2FJXA 2HQDA 1H98A 4C8MA 3SIPB 5B0DA 3K59A 1UMJA 4ECUA 3I96A 3HKWA 4ID5B 5M2RA 4DR3J 5HMXA 2IFXA 4J9PA 3DNCA 3S7RA 1J5OB 5GMEA 3RB0A 4LRBA 2IBOA 1JKHB 3CJSA 2PI5A 1AFJA 4IRKA 3UO0A 4CO0A 5J1PA 3LOUA 2XBPA 2W01A 3V4IA 1OY6A 5LXYA 4IFVA 3EICA 2MHEA 2RRBA 4K4UA 1LXJA 4CP5A 4C8LA 5BR8F 1Q79A 4NYOA 1DZ5A 1JLQA 1WOSA 1FDNA 1U1MA 4B17A 2Z4PA 2YVSA 2YWGA 3CGIA 4M8LA 2KRBA 2X1GA 3V6JA 2IAJA 1E6VB 3T1HJ 4Y2IA 4M5JA 4B3MF 4WFZA 1UVKA 3EUNA 4DSIA 5A6WA 2V6AA 4A8MP 2MGZA 5IWAF 1P1TA 4X4PA 1T03B 4F3OA 3E01B 1RADB 3HLUA 3NLCA 3C66A 3ZXWA 3WZ0A 5JVHQ 1X4GA 1HWIA 3MECA 2DH8A 1UW4A 2VKRA 4OX8A 4IH7A 2HLTA 1HBMB 1SL0A 1QSYA 4GVLA 3ISNC 1EARA 1X5TA 2OD6A 2XQCA 3MM5B 2ZDPA 5LMNF 3BSCA 1QUPA 5L39A 4TU8A 3MMBA 3TEGA 2B9EA 3QT5A 2HWHA 3ENVA 4X66F 1YLXA 4ZVGA 4PABA 4N7TA 2MZTA 2HHTA 4FXWA 2NPFA 2M70A 4BC9A 4ECXA 4PZVA 5I3UB 3CCMS 1NKBA 1LKZA 5B0FA 1Q81T 1N34F 2YNIA 5B7WA 3F0NA 2B8PA 1HA1A 2FD2A 1N32F 2KFYA 2M8DB 4IG3B 5KFJA 1Q78A 2DKOB 4NA2A 1X5SA 4C3LA 1QAIA 2AGOA 1VK8A 1PC5A 1Y7PA 2R8KA 3BGLA 2ZUGA 3R7BB 1ZETA 2DNPA 2KXFA 4CYUA 1JLEB 5T7LA 1IKWA 1S9GA 1NKEA 1DHMA 4I2QB 3VAHA 4H4MA 2H4WB 3OV7A 4LF4J 3V6HA 1AROP 2IM1A 4ZVRB 3W3SA 1KP6A 4AQYF 2XGPA 1WOPA 4DCJB 2UV8A 5LSOA 2J8SA 2C1EB 4ZJLA 1C2PA 2ZM6J 3QWUA 4ILLA 4DL7A 2XO6A 2Z0GA 4LSNB 4RWWA 4JV2A 5AXMA 1FRIA 3NGUA 2QMWA 1KD1T 5DG9A 4L72B 2FLLA 3VQSA 1QY7A 4QW8A 1N48A 4X65J 2OPRA 1YBUA 2HHHJ 4K2JA 3DHWC 1JLAB 2EWHA 3BO2A 1T05A 1BQMA 3GQCA 4IYQA 1HYSA 3L7OA 3OR1B 1WTFA 1TK0A 3MOJB 2ZH1A 2GJIA 2BM0A 4ELVA 1FNXH 3ETOA 2WAQD 4L73A 3RB3A 4WP8A 2N82B 1A7GE 3R6GB 2I0XA 4M5DB 2I8EA 1OPZA 4NLOA 3HHEA 2UUBF 4F4KA 4YOEA 3C46A 2K3KA 3D0HE 4PUOB 3CJ2A 4ED6A 3CW2C 3RBDA 1RCXB 4LFAF 4D3HA 5GAGI 2AHOB 4XPEA 2YX4A 5DQGA 4QPTA 4LJMA 2K3IA 5LSRA 4PPDA 2JX2A 2R7OA 4UOCA 2L41A 1WHWA 1HQ2A 4ZKAA 4DV0J 3PFOA 3B8HA 3GIKA 1S0NA 1MMDA 5HN0A 3GJQB 1SJ4P 1UFKA 2HNYA 5C2GA 1U0HA 2CQHA 3NS6A 5KFYA 1QE1B 5CYJA 4YR3A 3DDNA 2VA2A 2DR5A 4DR7F 2H65B 1U1KA 4DZDA 5SZTA 2DGSA 3O3LA 5HQ8A 4P6QA 2Q43A 3CNQP 2JVRA 1IVZA 2UVVA 3HJFA 2HQGA 3W8PA 4DV4J 4ZCIA 4DUZJ 3T9NA 3H5SA 1HKAA 3VR1A 2H5IB 2PC6A 1RHRB 2EBEA 3MEDA 2QO3A 3G8QA 2GHPA 4MKBA 3LA0A 4PCQA 1XNQF 2MQNA 1JLGA 3EPIA 2BV3A 4WU2A 4PXBA 1S4EA 5DDRC 4P2SA 2KG1A 3T5LA 1JNRB 1Q5YA 2QL5B 4NLUA 4CZCA 5F8LA 2DNRA 1TL7A 4ED3A 3R5AA 4C11B 4CLYA 4H4OB 3CCLS 3GJSB 2N4CA 3TZXA 3SYZA 4J9UE 1XTZA 4M94A 5E41A 1K44A 2AJ2A 4L76A 4LF5J 4J9MA 1C0UB 5D3GB 3MAAB 4KH1B 3NCPA 1B70B 4OQJA 4LBIA 3V2UC 5KFEA 3W60A 3G2XA 2MSTA 4G1IA 1BLUA 4RJVA 4LF8J 1RUSA 1FRHA 4NLPA 2V2VA 3CD6S 1V3RA 3CCES 2IM2A 3D6FB 4JI5J 2UUAF 2XZTB 2E1PA 1UCNA 1YZ7A 3M30A 2LU2A 1N0UA 4M5LA 5ETRA 5E3QA 5L1JA 3IWXA 4BC7A 2UVWA 3J81U 1MLAA 5H9EK 2J6UA 2XMTA 3PEHA 4ZVQB 3V6DA 3LUYA 2ZHOA 4ECRA 2AX1A 3P8BB 4OZ2A 4FF1A 2HZCA 1IBKF 1RKIA 4HDHA 5DDQC 5GAHU 4I1TA 3R2CJ 1NJZA 2JLEA 2CQ3A 4DU7A 3DGPA 3EJMA 1FJ7A 4NI2B 4P7VA 1FFSB 2PMHA 3MM7B 2KZZA 4JB8B 1UFLA 2FJEB 3ZZUA 1EETB 4CNYA 1B0PA 3AOAA 2R8IA 2B6AB 1VC0A 3EVOA 1WTBA 4NXMJ 3UE2A 1KR4A 4OI1A 4Y6IA 3DOMA 3E51A 4MH8A 2W9CB 2CQDA 2D3OR 2W25A 3C16A 1UWAA 1VIOA 5KOWA 4NLVA 3V4IB 1S0MA 4LSLA 1GMWD 3PJWA 4IFVB 2DNMA 4AT1B 2UZAA 3FQKA 2DPIA 2KYXA 2B5JB 2KHCA 1AFIA 1N0VC 3BH6B 1R3NA 1N56A 1XNRF 3I31A 3BSOA 1RP5A 4LBHA 2OIHA 1BC6A 5HBMA 4YFUA 4A8YA 1T3OA 5L1IA 3B54A 2OSQA 1BUXA 5DG7A 1VQLS 1UFWA 3BDEA 2QN6B 4NEZA 3QIDA 4KFBA 4RPFA 5D4LA 2MGZB 3AQPA 3SSSA 5HROB 1VFJA 1RHKB 2R4FA 5E2QA 4JI8F 2CRLA 1GXLA 1TAQA 5KAKA 2ZH2A 3C14B 2XSJB 1N34J 3CD0A 3RB6A 2FLNA 1SL1A 1IWGA 3L95X 4NXNJ 3A8EA 3AT1B 4XTTA 1L3TA 1TVRA 2QYGA 2ZWOA 3FSYA 4CTAA 2Z2MA 4CLKA 1QVFR 2LXUA 2Y1JA 3JTOA 1PKUA 1UTAA 4HH0A 2EFQA 2FC9A 1TZ0A 4DX7A 4N5SA 3M8QB 3EGZA 4RW9B 1U2CA 3P49B 3DFEA 1E6YB 1VYAA 2MZ1A 4FKYA 4PYAA 4ED5A 1HNWJ 4ZP8A 3MR5A 3BPDA 3R5DA 2X51A 4KPYA 2HHSA 3QGHA 2IHR1 1YJ7A 3ZTQA 1S0OA 1PAEX 3MTJA 2YKOA 4YY3J 5F9NA 1D3WA 3HDSA 2C3OA 2WHOA 4EK2A 2QZ8A 4DCPB 3OTOF 4DPUA 2MEWA 2AGPA 1WI8A 4G1PA 3LAKA 2QYCA 5F8HA 4L6V3 2W2OP 5HMWA 4PG8A 2L3MA 4P71A 1BY9A 3AA8A 1RBLA 1KQSR 4DPWA 2ADBA 4Y2MA 3SMZA 2ZZTA 2F5GA 4TN2A 5K14B 1RHQB 4ZIVA 2AD9A 3CC4S 1RWOB 5HQMA 1UVMA 4DZ6A 3A8JA 2GMJA 2W7AA 3DYAA 2PIIA 2L9WA 5IFMA 1RI7A 3R2DJ 3I56S 3M8WA 1O5JA 2GQCA 2LEPA 3L4BC 1NU4A 4DV1F 2CDRB 1NK6A 1HNIA 3EMTA 3PYFA 1W7WA 4HH1A 4C98A 1W25A 3DOLA 2HHQA 3ITHA 2W24A 2XGQA 3I5BA 4R0EA 2BJ7A 1TL3A 4CO5A 5E3CA 5B0CA 2KT3A 3UCZP 1K0TA 3H4DA 1K1QA 2EFPA 4GMKA 1SH0A 5DM6Q 4QR1A 2YKNB 2IIHA 3D7SB 2V8VA 4C97A 5C25B 3UFCX 1M0SA 4TNOA 1JLBB 2E5GA 3GIMA 4JI3F 2B8QA 1S1XB 2CPFA 3RUBL 5HVFA 3PTWA 2XNRA 6FDRA 2BA9A 4OX7A 1S72S 3BQ1A 4J7CA 5FDLB 2KH9A 1NJXA 4X62J 4ZP7A 2YKAA 1HBOA 3RTVA 4JYAJ 2ZBPA 3PKYA 2PO4A 4A46A 1FKOB 1N8RT 3EGWB 3QRQA 1PSDA 3DM2B 4M1KA 3KLIB 3ILIA 2ZC3A 4FVMA 3J81j 3CCQS 1Y0HA 1U0HB 4F4XA 2EI5A 1AUDA 1RWWB 1U2RA 3M4XA 4OI4A 5B08A 1FWLA 4ZHRB 1FEEA 2HFOA 2VKZG 4DSLA 4K8RA 1H3DA 4LREA 1S9FA 5B0AA 3CJ5A 5BXIA 2KYZA 1X0PA 2WONB 4KKOB 3N5FA 2BJEA 2WBRA 3TYTA 5KFXA 4M5MA 1TR0A 3BV8A 2OPPB 4IO1A 3MEDB 2WCXA 4ECQA 2JH3A 2G1DA 3H2UB 4ZCKA 2VQFF 2B0GA 5J2MA 1TKTA 2G1HA 3MM9B 4OFZA 2L48A 4ZVUB 1N88A 1M5PC 2F7VA 4KTQA 3GFYA 2VPWB 2HRUA 2JLFA 1RXOB 4B9MA 2E7WA 4ANDA 2ZD1A 1TL7B 5E0OA 1AZSA 4USHA 3KK2A 4ZVFA 3OXLA 3SCKE 2NREA 4FVCA 2IC3A 2MYFA 4U8YA 5J2QA 5D0RA 1KTVA 3RYLA 3MMAA 1ZYQA 2CJBA 2YPZA 2UU9F 3CWJA 4I6AA 1U6BA 3FZBA 3I0RA 4OYIA 1Q1KA 4OYBA 3PJ9A 4ZPVR 1KLMA 3QJJA 4F25A 4X4OA 1DTTB 2X7IA 4HTJA 1LFWA 1KVIA 3NAHA 1CVJA 1FJCA 2FHJD 1REGX 5GVQA 1TL1A 1WKJA 2KJWA 4F2SA 4Y3CA 2AV5A 3DKDA 1NPRA 4Q2MA 3TNVA 2OD4A 4RWXA 4P7TA 5EHHA 2G4BA 4U67Q 2ZOFA 3RRHA 3M9MB 2WVFA 3AXKA 3OUYB 3J81Y 3BF4A 4DLEA 1PYOB 1LK7A 1F9HA 4MK9A 1RTHA 2E5LF 4Y0FA 3KLGA 2QX0A 1IKXA 2EVZA 3V6KA 1NLKL 2W2PP 1DLOB 1NDCA 2EXUA 5RUBA 1MWYA 1PYTA 1T7PA 1R8CA 4Q0BA 1RT1B 2C3UA 2A10A 4TVAB 2ZC4A 2C2ZB 5AE3A 2AMCB 3W63A 2J8AA 4RNNA 3DGPB 1S1TB 1UEVA 3D28A 4J91A 3UNGC 5HP1A 2E5IA 4X84A 1SBRA 5L46A 2EPIA 4NZ7A 2HFVA 1N33F 3TQ1A 3IG1B 4LF7F 3W5YA 3ZNJ1 2ZE2B 3EM1A 3TVYA 1IBLF 2PT0A 2QA4G 1YJNS 1N36F 1EQ0A 3AFGA 4HL9A 3BN4A 2NXJA 2KO1A 1VHIA 2B7BB 3KUEA 3N79A 5F0UA 3ZFVA 1JLFB 1JJ4A 3KLEB 3ELHA 3F56A 1K73T 1FDBA 2BVZA 1D8YA 1FE0A 3PR4A 4EO8A 1R0CB 2XO7A 3N0VA 1W2IA 4HACB 3G82B 5IC4B 2D69A 2UUWA 5KFRA 4ECSA 3UNYA 3D9BA 3MR3A 2Y1RI 2CFXA 4IQMA 2DCLA 4OLPA 5G4DA 4DV7F 2CG8A 4DR1F 4ECWA 1WORA 4FN5A 1VQMS 4HVZA 2WW4A 2XS5A 3NY0A 1KTQA 2DGQA 4KE5A 2DNGA 1XWLA 1H2VZ 1RWXB 2AW0A 2LDYA 4M95A 4LF6F 4YB7A 2WSEC 4EBEA 3BSAA 3MCOA 3IN5A 4RUAA 2QC3A 2VH7A 4HHJA 3IWLA 4R8UA 1HPZA 3MZIA 2IVYA 1H7XA 1YRUA 5U47A 4HHUA 2E1CA 2R7VA 2P5VA 2HRYA 3RBZA 4O3SA 3VAJA 2NLWA 4MJKA 5M2UA 3HHLA 3IMQJ 1P1LA 4YR2A 2JNJA 2Y0BB 2OMLA 2KL8A 2ZFHA 4O3RA 1H0HB 1TK8A 4WFXA 3MWBA 3MUTP 3EE3A 3HVAA 3OTCA 3EXCX 1VQOS 3I32A 3ZNUA 4B9VA 2K7KA 5D0GA 2VD3A 2MB0B 2CQCA 5F8MA 4DFMA 4JI1F 1NB2A 5IZHA 2B4VA 2DO4A 4YS2A 1V9OA 3UDCA 3LGMA 1S9EA 4X64J 2XI2A 4LF9F 3A8KA 1KONA 2AJ1A 1S99A 1RWMB 3LTOA 1A0OB 4JV5J 2PI4A 3MM8A 2RF2A 1H74A 3MCSA 2F4VJ 1VMBA 3B78A 3OJUA 2VOPA 5T14A 2KDOA 5D77A 4O3PA 3TAQA 2N7CA 1H73A 4DPTA 2AJ0A 1HW8A 2DNHA 4XAKA 4FYYB 3HXMA 3MUMP 2ZKUA 1KRPA 1OSDA 1R89A 4N8NA 3DLHA 4MFBA 4YEAA 2CXEA 1VRTA 5D6GA 3LGHA 2FZCB 4KY3A 4NMLA 1LWCA 1RTJA 3D0GE 1CJUB 2DGWA 3NS5A 2M0GB 4TU9A 4KYZA 2YNFB 3GYNA 5KFSA 4X4NA 2Y1LB 4NRTA 3DYAB 3PW0A 3FSIA 1RDRA 3A4TA 3RRGA 3R5GA 4KH0B 2BANA 4O4GA 2XMAA 2CA9A 2Q3PA 2VB6A 3IR7B 1O51A 2RHSB 3GJRB 2Q1LA 4OYMA 3CDEA 3C3LA 3ENWA 2CNLB 2POKA 4LFCF 2V69A 3GONA 4OYAA 5CA5A 3KUHA 2DHXA 2BBEA 2FIUA 2W8KA 1IBMF 4DSEA 4GVBA 2LFVA 5EX3A 2VJVA 2YQ0A 4UOFA 2H5EA 1XEZA 3M9NB 3HD2A 5A2QU 2D9OA 3KG4A 3AAWB 4ANEA 1SUQA 1T11A 5IV3A 2P9CA 2MQPA 5SUHA 1FFGB 5DDPC 4DQIA 2GQQA 2XSFA 3VGVA 1CJTB 2MZQA 4KBIA 4PWWA 3CO0P 4ZMMA 3KFWX 2ZWPA 5E3AA 1RISA 1CSJA 3DU5A 4YB1P 4WZQA 4F67A 1R0AA 2CAJA 5KG3A 1K0VA 1LOUA 3BN7A 4NZ6A 2DGTA 3KLHA 1ZOTA 1FVQA 1FRKA 1RT5A 1FXDA 4E2FB 5GADU 3ISZA 4DV2F 4UQGA 4DSKA 5K5MA 1NUEA 1ULRA 4NWBA 2CJYB 5CYMB 4B9TA 4DR2F 4HTIA 3FC9A 3N9UC 2VQFJ 3CD7A 2BJ1A 5CXTA 3PFEA 5IOLA 3M2RB 1M5KC 3HVTB 2LVWA 2ZKTA 3WBZA 3KTQA 3ZZRA 1S1WA 1R7IA 3R9LA 1I94J 3W62A 3HZEA 1F9FA 3KNGA 3IAM9 4YHHF 4ES2A 4IH5A 4NPOA 1NHVA 2ZHAA 2AEFA 3UR0A 1TUVA 1XMQJ 1YJTA 3W1YC 2JEFA 2UU9J 3O5TB 1XMOF 2HMIB 3JSYA 3DRSA 4ID8A 2DGXA 1HWUA 4RBUA 1IR2A 1VQ6S 2RRAA 2VPZB 4HI1A 4PWDA 4HLBA 2XS7A 3H2LA 5KFUA 2ZUAA 3T41A 2Y0SD 4UY8T 4NCBA 1HWJA 2VICA 4RNMA 4B3RJ 4CLPA 1UJ6A 1ELOA 3DLEA 1VLOA 3VHQA 3CCJS 4OJGA 1GMWA 2KFZA 4DV5J 1VRUA 2ATLA 1OSCA 3GTYX 5A76A 2JZ5A 1Z4UA 3I0RB 1RT4A 1TMJA 1AXQA 4MMOA 1IR0A 5ETLA 1KLMB 4ZLLA 4I0WA 2VC0A 1HBNB 1L3SA 2LU1A 3TAMA 2EFNA 5FJ4A 2H3EB 2KB2A 4DU8A 1UVIA 3QO9A 4O3NA 2W9BA 5HSPA 2DNNA 1T94A 4FYXB 3RR8A 1V3SA 1JLCB 4ED4A 3POTB 4UUXA 2W7PA 1IKYA 1SH3A 2Y8YA 2FY8A 2C2RA 5ETSA 4IH6A 2Z2YB 2JC1A 4A8QA 3CMAS 2E7VA 1KDNA 2YKMB 4OI6A 2DNZA 4C0HA 4ER8A 1EKRA 1FXLA 1IBLJ 5A8KA 2UXDJ 4X4TA 2J7WA 5KG1A 1DQ8A 1HBUB 3TJAA 2Y1IA 2WSCC 4RUBA 1I6JA 4ECYA 3VAFA 4P75A 3KDOA 2CVIA 1Q8IA 2CIMA 4PAAA 3UN2A 4FS2A 4EZ9A 5HP1B 2EK1A 3LP0A 3GYGA 1QLNA 3MEGA 3T1YF 2DIVA 2N4DA 1HMVA 2ZDOA 4PQUA 3Q23A 5FD1A 3LH2S 1CPZA 4G6VB 4QIEA 4JI6F 4H4KA 4B9UA 3RG6A 4JOUA 4NX9A 4ZCLA 2P8IA 4FNIA 4MAKA 3BGUA 3GP9A 4TYBA 3IC1A 4USMA 4WFBQ 1WG5A 3J80U 2NSBA 2DRBA 9RUBA 2AF6A 3EZUA 3TO8A 4ICLA 1ZH5A 3LF0A 3NOCA 1R0BG 4LF6J 2GVZB 3G86A 4EMDA 5KFMA 1RSCA 1B7FA 1VS3A 3QFHA 3W2WB 4CDIA 1WEYA 2B4OA 3KJFB 1VQPS 1WC5A 2GS8A 3LW5C 3MEKA 1KHVA 1PYSB 3JAMU 3H2VE 1HHQA 3LPEA 3WC2A 3BBFA 4ETXA 3M8RA 3CCZA 2HHUA 2OEKA 3DRXA 1FVSA 2A1BA 1LWEA 4QJVA 4O0IA 2M9KA 2ILZA 4FYWB 3RR7A 3MFHA 1RT7B 3I6PA 5F3ZA 4GC6A 2VONA 2O67A 2HAFA 2EG1A 3D1HA 4AXIA 4R8UB 3SCJE 2FVPA 3ZTPA 2HWIA 4OJ3A 4O4RA 2ZJPQ 1IJFB 3LALA 5K8NA 4L75A 5CH7B 2NZCA 4WE1A 4DR6J 3MXHP 2XCPA 1YDLA 1Q82T 4AE5A 5J2PA 5K9FA 1NNDA 4J5OA 1N5TA 3O8WA 2K7JA 2MQOA 2QFJA 2Z2LA 3D66A 5KT4A 3H98A 2MY7A 5K8MA 4OIXA 4RW6A 3VAKA 4F4ZA 1RZMA 4OV1A 5KFLA 3T3FA 1TQLA 3DXSX 4NYPA 1WNEA 3L9ZA 4GRSA 1KWMA 1S9EB 2IMWP 4LF2A 3C6UB 2COLA 4KQZA 1FI4A 4PKDB 4KAIA 3MM8B 2RF2B 4KRWA 4FP9A 4KGKA 2YH1A 1LWFA 4U6PA 4KC5A 3N28A 2ROGA 1BGXT 4DV3F 4G1QB 2BOAA 3SDEB 1DY3A 2QMXA 2J9DE 4Q45A 1UETA 4J37A 3CTRA 3GIJA 5C7PA 4R5PB 4MT1A 4OHWA 4ED7A 1XK8A 1KQGB 1RK8A 1SJQA 1IBMJ 1P8GA 3VCDA 3AJ2A 1WF0A 1Q7LB 1TL5A 2WW8A 2ZVSA 5D15A 1RTJB 1Y5IB 1EHWA 3IS9A 4P2XA 4USIA 1X5PA 1U7LA 2PMZD 3CIMA 4NA1A 3SSQA 5ETVA 3MD3A 4HT5A 3W9JA 3R1LA 3NXZA 5CD4A 2BANB 1TV6B 5E3PA 2RQCA 5GAEI 4A8FA 4CH0S 3CO9A 2XMKA 3Q89A 4W90B 2DNKA 3HSJA 4MIAA 3TJ9A 2H5JB 2D9PA 2BW2A 1AW0A 1GH8A 4DR3F 1S1VA 1IJEB 3AHPA 1YI2S 4HR2A 2E7XA 4RO0A 2ZEJA 1C1BB 4XK8C 4V1Ak 4DFJA 2VPXB 3BKTA 1H6KX 1FJGJ 2MZRA 4ZPAA 2GJFA 2DJWA 2RE1A 1T9UA 2MQQA 4W98A 3T1AA 4O44B 1SQEA 2UXBJ 2R2TA 3FZ2A 3BQ0A 3D1OA 2UVRA 4M5KA 1XIQA 5D0HA 4Y2AA 3PVXA 4WYLA 3M8PB 4WIIA 2J6SA 3UD5A 3RZAA 3MMCA 4QPXA 1XMOJ 3T1HF 3NMAA 2PA8D 3J7A1 4FNHA 5GAGU 2FLPA 1D9AA 5HVGA 4GO5X 2CJXB 3GU0A 2OGUA 4F0MA 1KOOA 1FT8A 1URNA 2IDLA 1PJ6A 4LQ3A 3LP1A 3QLHA 4C8YA 3HFVA 3OT9A 2IMOA 3PX4A 1RAOA 3CJ0A 1SJFA 2MJUA 3PO5A 5F8IA 2J76E 1BQNA 2C2NA 4B3OA 1F5CA 2DHGA 4CLLA 1U1OA 2YY3A 2HK3A 1O8BA 2I9SA 3V81A 2WB4A 3HSDA 3VAGA 3DRSB 2R2RA 2XLIA 3K57A 2R7UA 5F8NA 2CJKA 2AEMA 2FDNA 3QJPA 2NQPA 3PDNA 3FNNA 2BE2A 3IA0A 4Q7AA 1JQGA 3KJNB 1BE4A 4EGLA 5JUMA 1RLCL 3J7ZT 5KFGA 2BJ3A 3N5BA 1VRUB 2C2DA 4ELTA 4BBYA 1QJHA 3NBPA 1GTHA 3LP2B 3NMRA 3BKFA 4WYWA 1RT4B 4WP3A 2FC8A 5DRKA 1ZPVA 3C19A 1EP4A 3CDUA 4EEYA 3ZTOA 4LF4F 2HNDA 2Y8WA 3TRGA 4DLGA 2RS2A 3TX8A 5C2CA 2AZ1A 2XMVA 2WOMB 4U9RA 1CJKA 4LIRA 3Q24A 1XR7A 2R7WA 1XERA 2OUGA 3GCXP 1S12A 3MEEA 3VQTA 5DG8A 2BW7A 4ZP9A 4X65F 2MXYA 4JUZA 2HHHF 2BEFA 2U1AA 3AB2B 1V6HA 5F9LA 1CBKA 2O66A 4HT7A 4ZPWR 1NSKL 5GAHI 1RB0A 4C8KA 4C3MA 3CDWA 3KK1A 3HT3A 4GKJF 1OO0B 3THTA 4CO4A 4CLSA 3M1VA 5KFWA 2JHEA 4JI4J 1X4BA 4K2XA 1AA1B 2VJUA 5KFHA 3QAUA 2OPSA 4F26A 4EUVA 2FVCA 2FYXA 1YJVA 1S48A 3CMQA 1X5OA 2AJFE 4PQUB 5HI7A 3OXFA 2AEJA 4RLEA 3J80Y 2DNLA 1HQUB 1HARA 3DU6A 4EBCA 2UVUA 2VFVA 4DV0F 3R5JB 4DV6F 4CH7A 2YNHA 1B64A 1WKKA 3MAQA 2DEJA 2P6TA 1PG5B 2RQMA 4ELUA 2M4MA 2DR7A 4KJIA 2HVHA 2ROPA 4ZN1A 4U96A 1DAXA 3GLJA 4DV4F 1TKXB 2PSZA 3Q8YA 1FNOA 3NKYA 2Y3YA 2MHNA 4DUZF 4TU7A 3BZQA 1CQNA 3L7PA 4M5GA 3FGVA 4ZVSB 2W8LA 2G0JA 2R9LA 4LFBJ 5J2NB 4D3GA 1NB7A 2AJ4A 3NEKA 3VGSA 4EYHB 3AH6A 4OJHA 2CDQA 4FYDA 1NDKA 4LVNP 1CS4A 1X31C 1RTIB 5AXNA 3Q0AA 2JC0A 3GV8B 1R8AA 3GR0A 1UPMB 3US5A 2HHWA 3FCVA 1WF1A 2LQ8A 3PYGA 2W4CA 4C0OC 3CCVS 1RAEB 2VIHA 2GGPA 2MQMA 1WDDA 4NASA 2F65A 5C24B 1VIXA 4RW7A 2XYGB 1X0FA 2ZITA 3IGNA 2GMLA 3KLFA 3CJ4A 2B7CB 5D4OA 5KFVA 4B08A 3BO4A 3VV2B 4NLDA 4DDFA 2EKNA 4DUYJ 3NCQA 1YTYA 3PACA 2V4RA 1VQNS 3C6TB 3D2WA 5HANA 3NL0A 3WX4A 1HHSA 3CJQA 2R7QA 2VFTA 4IDKA 5A8RB 3TUJC 1U09A 1KHWA 3PR5B 2JEIA 3GJTB 4DG1A 2HSEB 4JI5F 3AOCA 3CJ3A 1VQ5S 3OL9A 2VZ9A 5A8WA 2CPDA 3TP2A 3N6NA 4NCAA 1VBYA 2DPJA 1RAIB 2CZ9A 1RT3B 5LM7E 3PM9A 1VQ4S 4FXVA 2CJ9A 2AX0A 2PFFB 3MR6A 1SQGA 3PEJA 3KLVA 1NEEA 4JV0A 5IC6B 4C2MA 1ITPA 2GA7A 5C42A 3RW6A 2QL7B 4TYAA 3OFFA 3W2VA 3CC2S 3QZ7A 1FESA 2L9DA 1RABB 4PXCA 1PAUB 5KTQA 1K47A 3GIIA 3IS9B 2ACMA 3HVRA 5D4PA 3P6YC 3ET6A 2MKCA 2E29A 2HKEA 4P72A 4TKTA 2XY5A 4EFAC 4IUFA 2QFIA 2BKPA 1NK0A 1XJWB 1VQ9S 1N52B 3CULA 2V2QA 2R8JA 2IJNA 2GV1A 2EFOA 5K20B 4NXMF 4WP9A 5JMNA 2ZH9A 4DFPA 2WBMA 2DHSA 4F4YA 3J7YI 2OJ3A 4Y28C 2QEXS 2ZVIA 4NLXA 2D3O1 4RW8A 4QQBA 4ZOSA 2HRTA 1TMMA 3VALA 1MROA 1ZAXA 5CQGA 2DISA 1M5VC 4DPYA 1P27B 5BYRA 3SXLA 2ZH5A 3BGRA 4QWEA 1L5UA 3MGJA 1YKWA 5D0EA 3NCRA 1FK9A 2F1FA 3MF5A 3BEGB 2RHQB 1U02A 4J9LA 4I7FB 1IBCB 4QBUA 1NDLA 2XYPB 3OPKA 1F6TA 3W5XA 4FS1A 1KFDA 2ASJA 2H54B 2LCWA 4RUCA 1V3ZA 2VPYB 2F4FA 3WIVA 2HBZB 3T5KA 3PCOB 5I4MA 1NSAA 3D1QA 1S1UA 3ZO7A 1J2VA 3CCUS 3OHAA 2IM0A 2B4PA 1BMQB 2RU3A 3KK3A 4UTGA 1OYEA 2MLZA 4USWA 4DN0A 1RBOB 2W9AA 1VBKA 5GMDA 3CCRS 1CJVA 1HIYA 2DD8S 3QLHB 1S10A 3QIPA 1FO1A 3I0SA 2F8HA 4I56A 3FK4A 1FDDA 4FBUA 3UI3A 1A6LA 4NXNF 4TLQA 3ZZTA 2XLJA 3PRDA 3UD4P 1BQNB 4ILMA 4A47A 2V4JA 3GE9A 1B7YB 3BS9A 3V81B 5HVHA 4BHQA 4CI0B 1H72C 1GT8A 1M1KT 3QFWA 4U7UD 4KHPJ 2GC8A 4QIGA 5DGBA 5KT2A 3VVTA 4NA3A 3CJKA 3M6VA 2QGFB 1RTDA 1S6PB 2MSSA 1HNWF 1ZTWA 3L09A 1WDTA 3VVUA 4Z7YA 4ZJQA 2E1MC 2B51A 5KFZA 5DZ7A 4YY3F 2WTFA 1SV5A 1X4HA 3I5CA 3SI8A 5J1EB 1VJQA 1D1UA 5KFBA 4IR9A 3ENQA 2YWEA 1U1LA 1VHFA 5LJ5Y 3Q8UA 4RW4A 3O1LA 4B9LA 3QGPA 3DI6B 1V5IB 1RAAB 1KSPA 2RSQA 2M8HA 1GAOA 2RUGA 3RBXA 3QPIA 1D9DA 2RILA 5T41A 5H1SV 2J9DA 3M2UA 2EEYA 4RZRA 3VAMA 4DWIA 3N4WA 3WDOA 3OFHA 1RTZA 4GKJJ 3TA1A 4IOBA 5DLGA 1NSQA 2QA4S 2B3TB 4ES3A 1RGVA 1CJKB 2R8HA 4I6YA 1R31A 3GWCA 6FD1A 2D3ZA 2QIFA 2ADCA 4ZN3A 5J1NA 2HNZA 4CLFA 4ENOA 4DFKA 2WZ1A 3P5BP 1YRXA 3M8ZA 3KJQB 4NLGA 2WB1D 3HHLD 3UWTA 1T9XA 1HQEA 2CNNB 3CF5Q 2C2KB 2YPYA 3O6QA 1ZA2B 2HIYA 3RAMA 1SXLA 3CSKA 2R8GA 1UP1A 4E0DA 1URRA 4KGXB 1APSA 1LW0A 2QV6A 3DRPB 2LXIA 4NCGB 1GXUA 1M5SA 2YWFA 2RKIA 2V8GA 1ZA1B 3VGTA 2YX7A 2D1CA 4DV6J 2VG6B 8RUCA 1KNZA 3TA0A 2HZAA 1VOMA 4EYIB 1FTRA 3A8IA 3U1LA 3IBFB 3NNCA 4WFAQ 2JLGA 3EDQB 3OW2R 4B02A 2DH7A 4I2PB 4KO0A 1RT2B 3C15A 5KG5A 1QTMA 5LJ3Y 2HWTA 4X62F 1FX2A 2VG7B 3D67A 4JYAF 3LO3A 3Q86A 3MI7X 4YR0A 3QRRA 2YNGB 1FKPA 1SKWA 3BGFA 2C2OB 4PEOA 5ETTA 2YBVA 4TLRA 1CULA 2XCAA 1HNVA 2NXEA 3SQGB 4FPRA 1FF2A 5F41A 4DN9A 3PV8A 3PW7A 1F3VA 1NRKA 3G6YA 5F8JA 4RNOA 1JXVA 2WVEA 2F8EX 4ED0A 2OAUA 3NRBA 3IBWA 1HNZJ 1AUSL 5JXSA 2NXCA 2V2ZA 3PX6A 1T95A 1J5OA 2VC1A 2ASDA 1UZHA 1JKHA 1YJWS 2DTJA 3BJYA 1ZAWA 4K4SA 3S8SA 2UP1A 1C1CB 3AD8C 1PCAA 4CWBA 3UCGA 5AXKA 3B82A 1JIHA 4N47A 4LRAA 2SXLA 2CPIA 1WD6A 2MQ8A 2DO0A 2VL1A 4USKA 2NCKL 2ROEA 2HURA 1NH8A 1ZPWX 3EGVA 4C3KA 3BDPA 3ETMA 1Z2ZA 1CS4B 1N5YB 5EDWA 5EX0A 3JSMA 1B0TA 2BM1A 2YWWA 4DQQA 4HKQA 2CG4A 5L9XA 2RIJA 4U95A 1E6VA 3IM9A 3SFGA 3NAIA 1HD0A 2OLWA 5CYQA 2EFVA 5ETMA 4RW7B 4DF8A 3DLBA 2QLJB 5ETKA 2LECA 1T03A 2P2CB 3E01A 3M2VB 4ZP6A 3CXCR 3BH7B 2OPQA 3DC2A 3HM9A 4EWTA 3R6LB 3JQKA 3M7VA 3GPAA 3AODA 3OVBA 4N77A 4OZJA 4ZLNA 2FZKB 3DLLQ 1C4AA 5BJRA 4IFYB 3PX0A 1HL6A 3AB4B 5MAOA 3G4SS 1HBMA 3CE8A 4ZPDA 1RKJA 3UR3C 3OHBA 4IG0B 4KR0B 4NLSA 3MM5A 2Q79A 3NOGA 2E9ZA 2A6OA 1RAGB 1YRTA 1Q8BA 3G8TA 3BYRA 2G13A 3SFUA 1J27A 4PG4A 1WI6A 3DOKB 5I3UA 4X4SA 2HFZA 1UJ5A 1WHXA 4IRCA 1X4DA 2FJBB 1MMNA 5AJ3J 2RJZA 4LT6A 5LL6d 3NGKA 4Q43A 1WELA 4QIVA 1S77D 4OHXA 1IN0A 5KFAA 4ITSA 3W2VB 3ONQA 2IDEA 4LQ9A 2DR6A 4NOHA 2DVIA 2M7SA 2HS3A 5THWA 5IT4A 3FEZA 2HLUA 3H8YA 1KVKA 4EU0A 1S76D 3DMJA 5DGAA 2FUG9 2GHVC 4I2QA 4DMZA 2H48B 3TJ8A 4OHZA 4EO6A 4DQPA 1EIYB 2D74B 3TUZC 2KM8C 3HPOA 2LXFA 4HHHA 5HQLA 3KXDA 3OLBA 5FIIA 4P10A 1CEZA 2BRKA 1JLQB 3KHGA 4F0HA 2FLOA 5F0WA 1M1GA 2Q66A 4M63A 3K5MA 4XIUA 4OI2A 4XPCA 4P74A 2HIQA 3OVAA 2ASLA 2PEBA 2IAJB 1MN7A 3HSZA 1UW9A 1HW9A 2HFNA 1FRMA 3PZPA 2ILYA 4ZDNA 4OYWA 2QE5A 3OR1A 2QT7A 2FJWA 1T9TA 3H5UA 1CLFA 1ZM9A 2RAQA 1F2HA 4YB5A 2EKYA 3MECB 2CQ0A 3CB4A 4M5DA 4IKAA 2IBKA 2DY9A 4NZ0A 1U6ZA 2N3OA 1RYSA 2H9ZA 2W7OA 4KSEB 5KG7A 2G2OA 3MMBB 4AL6A 3MMJA 8AT1B 5HJYA 3AD7C 3OL7A 1N6QA 3U1NA 5CD4H 1G3OA 3I0SB 3OTEA 4MTPA 3E8OA 2YNIB 3HHNB 4NRUA 4KGMA 1IKVA 4CT9A 2V4JB 2BXJA 1F9EB 1XC9A 2DXDA 1QE1A 2NR0A 4CYUB 4BCAA 5EWGA 1T9YA 3NGTA 1XMBA 5T7LB 1IKWB 1S9GB 1PILA 3OL8A 2AYEA 4H4MB 1MNEA 3CJKB 3GG0A 4X64F 1G4CA 1UA1A 3VZIA 4O0NA 4JV5F 3PW4A 2AQ4A 2F4VF 2BACA 2N7YA 2H4YB 1EAYC 3PG9A 1Y3KA 3PJXA 1TTHB 3A12A 2ZBRA 3SCLE 3LWLA 2BE7D 5KG2A 3BBCA 4BWMA 2WVBA 2FGOA 2OPRB 3L3CA 2FVQA 1WF2A 2W4DA 3FEXB 1T05B 1BQMB 3VWSA 4DL6A 2BX6A 2W4PA 5KFOA 2E9TA 3M2UB 3Q8SB 2QA1A 4C11A 1HYSB 2FB0A 1YX2A 4Y34A 4AUKA 4M5HA 2HFUA 1FWPA 3UCUP 2HPUA 4F4AA 4Z7CA 2JFKA 4J9RA 2RDDA 3JXOA 2APOA 4LRFA 3T19A 1S0VA 3B6BA 1GFWB 5KT3A 4UZBA 2LA6A 5D3GA 3MURP 3RGIA 5E33A 3MAAA 1HWKA 1KLNA 1ROFA 3IWNC 4GC7A 5KFKA 3FBFA 2QSWA 5IXUA 4CRJA 1R6YA 2ZNYA 2VOOA 2LQJA 4R0JA 2JL9A 1IXKA 2XYHB 1F0XA 3WC0A 2UUCJ 3I5AA 2AP6A 3I82A 1LW0B 4ERDA 2XMWA 3MHYA 3W8GA 3QT8A 4OYXA 3JSRA 3OSPA 1LNQA 2KZMA 1WC1A 3G6XA 2HNYB 2DB1A 4Z2XA 1P6TA 4WU3A 2VASA 4OX9J 2IM3A 2DRDA 4IOCQ 4YQWA 1Z2LA 1KFSA 4B3TF 1Q5VA 5BYSA 4B3SJ 2A2DA 1D8ZA 2ZZNA 1RWPB 3MM7A 2NS1B 5DO2A 2V0NA 3NNHA 3OFEA 1JJHA 1CULB 2FTRA 1WJ9A 2CJQA 4LRDA 3C2PA 4CM2A 4DX8H 3MUVP 4YDXA 2B6AA 2KXHA 1DBDA 1JLGB 4K5RA 3EXYA 3GILA 2MDAA 5LMUJ 4KV8A 3QGIA 4RX6A 2CWXA 2DCUB 4LRCA 4RL1A 2W2NP 1NZ8A 5L1LA 4QIFA 4BS2A 1QAYA 2W9CA 2P9EA 2IRYA 2IPOB 4K50A 1I94F 2OMOA 4N41A 2ZJRQ 3IRWP 4JP8A 2DGVA 5IT9Y 5EGYA 3BB5A 2UXCJ 1XMQF 4E8UA 5DZ6A 2WVCA 3BGOP 4V19X 4PR6A 2V8HA 4PXDA 2WSFC 1RWVB 2PD1A 5ETPA 4NMXA 4QR0A 4K0KJ 2B5JA 3PYDA 2J7UA 1WC3A 4URQU 1HI0P 2OI2A 4B3RF 1OY9A 3BYPA 3JSMB 3TARA 2E5HA 3I4PA 2BQUA 1R27B 3LWMA 4DV5F 1TFYA 1GMUA 5HAOA 4DUTA 3JS9A 3EDRB 1PBUA 5CYQB 3M30B 5LOQA 4XO0A 1N5VA 3ILOA 4ALZA 2AJQA 4UOGA 5HROA 2BJ9A 2OH2A 2GIQA 2CQ2A 3FEYB 3EGNA 2UV8G 2OPQB 3F41A 1YZ6A 4DEZA 3QRPA 3C14A 2XSJA 4P73A 3V6DB 3GIRA 3PW2A 9ATCB 1MN9A 2BUNA 3PYEA 3HFZB 2VODA 2HFSA 1JWWA 5JVGQ 3S01A 3NS7B 1RA6A 4K4ZA 4N8OA 3M8QA 1HD1A 5KFPA 1SIZA 4RW9A 4NYZA 1E6YA 1RAJA 4ZIWA 3FBEA 2UXDF 4CLTA 1WSVA 2G0IA 4FXDA 1L3UA 4GKKF 2E66A 5CHCB 1U0SA 2ASYA 2H51B 2BOPA 2DBBA 3F44A 1X7VA 4K4YA 3DOMB 1M90T 5KFFA 2BQ3A 2EC0A 1Y5NB 4AXJA 3IR5B 2BKNA 4MK8A 2F63A 3C16B 1OIAA 1RHMB 1WC6A 4A8WA 4QWBA 3DMJB 4WFYA 2LEBA 2HW3A 4KGZB 3D0IE 4OLOA 4UF4A 3QBCA 1SKSA 4LSLB 4LSZB 3OD2A 4DJBA 3UDVA 5HK4A 1K1SA 2F3JA 3CJRA 1NHKL 1JMTA 2RS8A 5HMZA 2U2FA 3TUIC 1UVLA 3RB4A 2K06A 2V68A 2GCFA 3X1LB 5K14A 3S1TA 4M5IA 1RU1A 4DL4A 2J0XA 4MK7A 3QSYB 3UDLA 5HBMB 1O6XA 5DS7A 5D8HB 4AD6A 3I55S 2RRNA 3U02A 5I42A 1QVGR 4O3OA 2Z56B 4X4RA 3H90A 3QSIA 1Q53A 4KFBB 4Y65A 5GAEU 3BR8A 1D9FA 3VGUA 4UZCA 3PXGa 2PDAA 4WBFA 1GEHA 3R7SB 5LT5A 1RHJB 4ATNA 3C8YA 4P52A 2Y9HA 2B9WA 4DR4J 3T5HA 4J9KA 2YKNA 1TVRB 3FJ2A 2HQIA 1IUJA 4F36A 2GO9A 2K8GA 4CTAB 1GTEA 5C25A 2XZWA 3ICLA 1YK9A 1JLBA 2C22A 1NXIA 3JYTA 1S1XA 3RAXA 2G9OA 3OL6A 2M52A 2Z2ZA 2CQBA 4P2FA 4L3NA 4G65A 3EWGA 3G9CA 2V50A 5FDLA 2C28A 2XB2D 2HEKA 3EYZA 1N6QB 4LBPA 2E44A 3UPFA 5A6PA 2A18A 3H5XA 3KOAA 2FJAB 1FKOA 2C2MB 4DR6F 4JI2J 2B9XA 2XMUA 3NGSA 3DM2A 4JI7J 3KLIA 2BABA 1IKVB 1FEHA 4C48A 1TL4A 3FRZA 1U25A 1X4AA 1QSSA 2YKQA 3G8SA 2C3MA 4ZHRA 1VCTA 4A8SA 1IM6A 2F8MA 1TKZA 1GK8A 1TP7A 2CKWA 2FY1A 1T0TV 2KG0A 2WONA 1MU2A 2WVDA 1UEKA 2O1PA 4KKOA 5AXLA 3TW0A 3GB0A 1SI9A 2GX8A 1GQEA 3EZOA 2ZH3A 1EB0A 2ZJQQ 4IO9Q 2MJNA 3MR7A 1SVDA 4IOAQ 4DR5J 3LPYA 3RW7A 2OPPA 1H7WA 2GAGC 1MWQA 1I1GA 2YH0A 3VTIA 1VJWA 5L38A 4I69A 3MPVA 1Y3JA 2BJ8A 3MM9A 2HGLA 4RNHA 3QMQA 4Y2CA 1Q86T 1X60A 3HVWA 3KJVA 1HNIB 1VBXA 1YG0A 4RNFA 3IFEA 1XBWA 2MKSA 2ZHBA 3DOLB 3ITHB 1H38A 2JDJA 3K5NA 1TL3B 1S7HA 3ISND 3FMBA 2MZJA 1SJ3P 1UVNA 3MPWA 2HHPA 2GAHC 3TA2A 3H20A 4I6WA 4WFNQ 4JI0J 3QT7A 1JJCB 1DTTA 3IM8A 4F8RA 1RT6A 4WZMA 1KKHA 4B3TJ 1EJ7L 1HBOB 4U8VA 2M88A 1S6UA 1SJRA 2GQ2A 3H40A 1NM2A 1PO6A 3PW5A 4USVA 3OUYA 3PO4A 2EC2A 5I3PA 4OI0A 4FYVB 1FJGF 1DFDA 2CVEA 1TELA 2JWNA 1DLOA 3GFHA 5G0RA 3P96A 3G6VA 1BHNA 1QUVA 3ZTRA 1RT1A 3CDAA 4ZK7M 4CH1A 2UXBF 3ZZYA 4MIBA 2KHDA 5HO4A 5CCLA 5DJBA 1B99A 3ZZPA 5ETNA 1S1TA 1KVJA 3OVSA 1QTNB 3GSIA 4UQTA 4URSA 2ZH8A 1Y00A 2BDPA 1L3KA 4V19J 3HX9A 5C5JA 2VHGA 3IG1A 1ZZFA 3U7JA 5KG0A 2J9EA 3CDBA 1PGZA 2ZE2A 3K58A 1TK5A 2DT9A 5BR8J 5J2MB 4FKXA 1TKTB 3QQCD 3H42A 2QLBB 4P9SA 3IGVA 4KV8B 4OZLA 1CC8A 3CMES 4N76A 2ZBQA 1JLFA 5CZXA 4RUHA 3KLEA 2ZD1B 4QYRA 2X1FA 1RU2A 1RWKB 4HDGA 4OZ1A 1AZSB 5F8GA 3KK2B 2CPHA 4X4QA 3KHLA 5KFIA 2IC3B 4MYUA 4B3MJ 5J2QB 2CQPA 3EZ5A 3QNWB 4QWDA 2DXEA 4HACA 3G82A 3MMAB 3UW1A 1O0PA 4Q8FA 1QAJA 4OYOA 5IWAJ 2DEIA 2PGCA 4ILRA 4J9NA 4LMZA 1FHTA 3JTPA 4IQXA 2DGUA 1NJWA 4ED1A 1M1HA 1WG4A 2CADA 1TL1B 1KS2A 1NK4A 1NMEB 2IA6A 5LXRA 1U6FA 5LMNJ 2IYIA 1YITS 2YQ1A 3QATA 2E5JA 5I3QA 2YKPA 1EQMA 1CQMA 2AT1B 2XMMA 3OSNA 1ZS6A 1LXNA 1NAQA 4X66J 3IP0A 1RTHB 2AYMA 3GYXB 3KLGB 1U8WA 1IKXB 3H25A 3T6BA 3D3BJ 3I4HX 2ACYA 2MPUA 3NWGA 4C8OA 1T9WA 3EPGA 5IM0A 4Q0BB 3UN3A 2ZOMA 3GFXA 4GKKJ 2GMHA 2AZ3A 3CD5A 1N32J 2PEHA 2O3DA 2RMLA 1YHQS 1OPIA 4YB6A 3KHRA 2JSXA 1TAUA 5B0EA 4YMEA 1NO8A 2ZBIA 1VK3A 2NUUG 3FSXA 2QJ3A 4WTOB 4ZPCA 3TQEA 3D5MA 3W5ZA 4AQYJ 1G6BA 2HHXA 1R6VA 4RBTA 1LV5A 2HYIB 1KQKA 3D6TB 3PHTA 2IRUA 2XMJA 2AYGA 4DCOB 1Y4ZB 5CZVA 3MCNA 2JEGA 4JI4F 1F60B 1UA0A 2FGCA 1OYDA 5DDOC 2MKHA 2NYHA 3D54A 2I6WA 1Y5LB 3K0JA 2ATCB 2OHDA 3UDEA 2OKQA 3PNIA 3VAIA 4F7VA 2Z58B 1T02A 2HS0A 1NPPA 5HL7Q 4RBVA 3CVKA 2BQRA 4ECVA 1U1RA 1ZBTA 3R5BA 2QLFB 4TY8A 1CJUA 4PXEA 3P45B 2FPHX 4NLWA 2YNFA 2VBXA 3K5LA 3D68A 1Q16B 3DHXA 2UUBJ 4TQSA 3TANA 3AJ1A 1D0EA 3KHHA 5I42B 1KEKA 5FLXU 3H7HB 3SZ2A 4LFAJ 3MR2A 3J7AN 2GJ2A 1S57A 7FDRA 2MKJA 1NK5A 4X4VA 1M5HA 4WWSA 4BLGA 3ZTSA 1HPZB 2VG5A 3ILJA 2X1AA 1VRQC 2R7XA 3M05A 2DHAA 4ZS6A 3TZYA 4U7CA 1Q8LA 2JJ4D 1WKLA 4DL2A 3J7YU 4X2BA 3HHLB 2XTJP 2JVOA 4WTYA 4MKYA 2ABYA 2KXNB 4I67A 4DX5A 3FCWA 1JXLA 4LFBF 3JYTB 4J9SA 3FKBA 2VU5A 2JOQA 4OZNA 2F9DA 3THPA 1CJTA 1S6OA 4DR7J 3HZGA 4EZ6A 2HZVA 2CQ4A 1LQ9A 2RD5C 1RWNB 4DSJA 4NLRA 2ZZMA 3DCAA 3M9OB 2VQEF 2YWKA 3OTDA 1FD8A 4Q44A 3RJMB 5AT1B 1NDPA 5CYMA 1U2FA 2IA0A 1D09B 1A9NB 4AL5A 2LQ9A 1XNQJ 1B3TA 2VBYA 2KFNA 4KB7A 4DHVA 3QZ8A 4CLWA 3M2RA 2HHVA 4ZVTB 3ENAA 2VDHA 1FKAF 2V4QA 3HVTA 3HT0A 4YDDB 4I64A 4DUYF 1TKZB 1FRJA 4ZVPB 2ZNZA 5KFQA 2R7SA 3R3TA 2IY5B 1MU2B 4MFBB 2AKWB 2WRMA 3UVJA 3P3DA 1HLWA 1VRTB 3Q8QB 1RAFB 4QZVB 2MY8A 1FXRA 5K8OA 1U1NA 4OX6A 1GNKA 1LWCB 4ZITA 1DJ0A 2HMIA 2KJVA 1JXEA 4FPIA 1UKUA 2HQFA 4CT8A 4ZVOB 4KHMA 4O4GB 2XC9A 3QWPA 3DN9A 2UUTA 2FHMA 3KJVB 4CQ1A 1ICEB 3KMQA 2NUHA 2CJAA 2GVDA 2XNQA 4Y00A 2HS4A 1ZZNA 1Q0NA 2DHHA 2NXNA 1U8SA 3CT9A 2OP5A 4ZLJA 1NK8A 1RE1B 4GVBB 2UUAJ 3BSNA 1NPKA 2L9NA 3Q2SC 3VF0B 2HVDA 4N56A 1XR6A 5DM7Q 1SUQB 2M2BA 2QMUB 2R7TA 1HBNA 4A8KA 1U24A 2KT2A 2DH9A 3AXMA 3MDFA 2RU9A 1RT6B 1IBKJ 1CC7A 4J9QA 2KI2A 2MZSA 2ZH4A 3H4BA 1R0AB 2YX1A 2QG9B 1QM9A 1JLCA 1RA7A 3POTA 2CYYA 3D3CJ 5H9FJ 2VA3A 3ZZOA 3KLHB 4PG7A 1RT5B 2I1RA 3WIUA 3W64A 4K5SA 3OJSA 3MPDA 3QYYA 2YKMA 3WHIA 4IR1A 2MKYA 2NPIA 4F04B 2BR0A 5G0RB 1AB8A 3SEOA 4LUBA 4WPAA 3TVKA 1HBUA 3IAS9 3K7RA 1TUWA 4ECZA 2LP4A 1XN9A 4K4TA 4BWJA 3TVZA 3FFIA 1S1WB 3DRRA 3CJ8A 2QLXA 5IS2A 3TWZA 3PIPQ 1G7CB 2D3UA 3BO3A 2VF3A 3FQLA 1N5SA 2LEAA 4NL5A 1RLDA 4TXSA 1FFWB 1I5OB 4UT4A 5HLFA 4OI3A 1U45A 1N54B 2EFGA 4UOHA 4Z37A 4OYZA 4PWDB 2GZOA 2DXFA 1OQ3A 3G87A 3GV7B 3A3NB 4Q8EA 3ILLA 3W61A 5KG6A 2KVQE 2RQ4A 1XNRJ 3H59A 2KN4A 3DLEB 1P9QC 3KMSA 4DPXA 1X4EA 1RBAA 5D78A 2V63A 2JFDA 2B4UA 1MMLA 2BYCA 3R27A 3OFGA 3D6HB 3W66A 2GVZA 2PE8A 4ZCMA 3HP6A 1YJRA 4DS5A 3T5JA 4ZVHA 2FQQB 3A3OB 4KT0C 1LW2A 3UQSA 4RKUC 2J5AA 4PG5A 1WHYA 2IVFB 3M8SA 3FBBA 3W2WA 1W2BR 4KHPF 2VFRA 3JSBA 5L9NA 1ZM4A 4JI8J 2J6TA 1UWBA 2GFFA 4FF4A 1H2UX 3OR2A 3TAMB 3M32A 1PC4A 2HG4A 2DITA 1X9MA 1X9WA 2I5JA 3QO9B 3OBIA 2AGQA 1KOHA 2XG8A 4FDFA 2W9BB 2GW8A 4ZA1A 1WG1A 5CAAA 1BWEA 1FNMA 2HVIA 3AOBA 1RT7A 1JJ2R 1FX4A 2R7RA 2G2YA 2DRAA 1IKYB 1T3NA 3TZZA 2W2MP 4K4VA 1LEOA 5K8PA 4LR8A 1YJUA 3R97A 2QSFA 3BQ2A 1NCLA 1U48A 5E3RA 5A8KB 4F3QA 4TY9A 2DIUA 5IM0B 1UAWA 5KT5A 5ITHA 1V5VA 2IRXA 1SC3B 3SQOP 1VQYA 5EWEA 2E1AA 4ECTA 3OTOJ 2I2YA 2LKZA 2OSRA 2RQKA 3LAMA 1NKCA 3GV5B 3V4MA 1GXTA 4ED2A 3HD1A 3HO1A 1MG7A 3R1HA 1WACA 4OL8A 3CIZA 3LP0B 1T8EA 5KT7A 3MEGB 4CLZA 1J5EF 1S4FA 2V67A 4G3IA 1HMVB 4DSFA 1VDHA 2P6SA 3DLKA 3C6UA 5IV4A 4OHVA 4CLUA 3L7UA 1P9YA 3ZC4A 1EKSA 4LF1A 4PQAA 4I4BA 4ES1A 3M6XA 4CO2A 3HSGA 2EK6A 4OYPA 4YP3A 4ICLB 4G1QA 2I38A 4QWAA 1S59A 5E5NA 3SDEA 4MYTA 2H1YA 1RACB 2V34A 1REVA 4DV1J 4UY85 2XS2A 2MKIA 1SB6A 4R5PA 3Q2TC 3DLGA 3AD9C 1UJ4A 2RDJA 2IJFA 3AQOA 4TY8B 5CABA 5FLXY 3M6UA 3NGRA 3DRYA 4F02A 1LWEB 2DYAA 3HF5A 4OJ1A 4JI3J 3KG0A 1TV6A 1VR6A 4RR5A 4HYKA 5HATA 2B9YA 5ETOA 3OLAA 3FMWA 2DGOA 3TOQA 3CCWA 4C4WA 2VG5B 3U27A 1I3OB 3BKUA 4WXOA 1HNZF 2OELA 3UN5A 2QL9B 4WE1B 1C1BA 1SKUB 2VQEJ 2ZH6A 5J2PB 4E98A 1ZM3A 3SBMA 1PJ7A 1SCJB 1WHVA 1WEZA 1ZTTA 3THVA 1HI8A 2XY7A 1AYEA 4QYZJ 4O44A 1OY8A 4RW6B 3R8YA 1FDAA 2FVRA 3GZ7A 3LANA 2MTLA 5B0GA 3K8WA 1VQ8S 2MQLA 3PRVA 1Q95G 2DR9A 3O44A 1F2GA 3JTNA 2QLWA 1F5AA 3M8PA 3AY0A 4EI2A 2HQ3A 3BBBA 3JQJA 3K5PA 3GSDA 4HEA9 1HR0F 1LWFB 2XI3A 1S49A 2A0FB 2DR8A 2FJDB 3HHLC 2CUYA 3QAEA 1F3FA 3Q8PB 2LMIA 1RCOB 3CUNA 4KHRA 1DQ9A 1FD2A 3K8VA 2X1BA 1RQ0A 2OTJS 1L3VA 3BREA 5KFDA 2IJRA 4B9SA 2XLKA 1OJ4A 3NNAA 2LYVA 2V9WA 1Z1ZA 3UD3P 4RU9A 2OO4A 2VBZA 3RU0A 2E1RA 3MTKA 2R2UA 3UVJB 2KU7A 1S79A 1B4SA 1VLYA 1JX4A 1DTQA 2OEMA 3SV4A 1TUGB 2NZ4A 4HI2A 4J9VA 2QA2A 3P4UB 4CNZA 4H54A 2Q6CA 1NBEB 3IRXA 2VV5A 3R7NB 5IT0A 1CG2A 2HGMA 3TEHB 4MIWA 4Q2LA 2RH3A 2KT5A 2GVDB 1FE4A 5AJ3F 4OHYA 2V5HG 1M5OC 2AWZA 1FWKA 1S1VB 1IWAA 5ADZA 2O01C 2VUGA 1BXNA 2BRLA 2B43A 3LP2A 3IO1A 2E5LJ 2K1RA 3IBCB 4F2RA 3NGDA 3JQMA 3K5OA 3FVYA 2J0WA 1GX5A 4OZ5A 3EVWA 1RAHB 1PBAA 2DY1A 1AT1B 2V2KA 2VFUA 1OQ6A 1QD1A 1SQFA 3Q8RB 4CM0A 2WOMA 1NH7A 5ETQA 4K4WA 2IYGA 2CWKA 5H9FK 4W4MA 3MMCB 4IRDA 1N33J 4LF7J 3N6LA 3BM7A 3ULHA 3K89A 4R25A 1NJYA 2V8PA 4C8ZA 1N36J 2VFSA 3EVMA 3MM6A 3LP1B 4PWUA 3FFIB 4JBCA 3EX7B 3DRRB 1KN6A 4B3OB 3OXGA 4B9NA 4L74A 4GO7X 5HLFB 1FRLA 1HFEL 4KIAA 3Q83A 3LGNA 1BQXA 1DURA 3QJLA 2FHOB 1UL3A 2HVZA 1T9VA 3B4MA 3BR9A 4BDPA 4A4JA 4A8XA 1IQTA 2YQ3A 2KRRA 1HQUA 4ZPBA 2WK4A 4Y2KA 1S6QA 1JNZB 4DV7J 4S0MA 4DR1J 4DL3A 2BE2B 1G1XA 1TFWA 2NSCA 5HMYA 3FCHA 4FZVA 1C0TA 4USTA 2MMYA 1VI7A 4DXLA 5DETA 1HI1A 2RDIA 4NLTA 3PIOQ 4WXWA 1BWVA 2ERRA 2BKOA 1FA0A 3NBPB 1LW2B 5A0YA 3A1YG 2BZ2A 2CPJA 1BD6A 3DDIA 1EP4B 3NWRA 5CCMA 4DF4A 3H5YA 2E9RX 1TKDA 1NJIT 1UWBB 1F5BA 2HNDB 3OR2B 1TKXA 4NLYA 4ED8A 3M32B 5L8RC 2G2ZA 2VBWA 2FVSA 2I5JB 1YJ9S 2J0SD 1R8PA 4OZ0A 1K8AT 2RVJA 1LK5A 3KKFA 3SSRA 2DNQA 1PJ5A 3GMGA 4CO3A 2B56A 4WKRA 5J2NA 1MW7A 4K7QA 3MCMA 3K2YA 1U1PA 1S97A 3MEEB 1R8BA 4JI1J 1J5EJ 2P9GA 4J90A 2NXUA 3MPYA 5GMKa 3G96A 1RTIA 3M8YA 3TR5A 2XM3A 1SC1B 3RAQA 4LF9J 2W2QP 3S6EA 2CPEA 1B0VA 5L1KA 3KK1B 1R43A 2IVMA 2CQ1A 2XWXA 4JV1A 3M1VB 1SC4B 1VISA 2XY6A 5C24A 3P5TL 1NK9A 4WCEQ 1U1QA 3SV3A 5D4NA 2CPYA 4F50A 1UZDA 1WUUA 4NEYA 3D4JA 2OPSB 2ZOGA 4UUWA 5DQHA 5EWFA 1TU0B 2YTCA 1KBRA 3CEDA 1U4BA 3MAHA 2KVIA 4QWCA 1RHUB 3C6TA 1SL2A 5KFNA 3OQ2A 1WSRA 2A6MA 3DLKB 2UUCF 5BYQA 2FHKA 4DX6A 5A8RA 2LQ5A 4EBDA 4X4UA 3WX8A 4PPZA 3TZWA 2PN6A 1N4LA 2YNHB 2Z30B 1RT3A 2EG2A 1REVB 3IR6B 3CCSS 2LDIA 3GCWP 4OX9F 2OFHX 3OTBA 1VGYA 2EW9A 3FDSA 4LFCJ 1LWXA 3DLGB 1SH2A 1DARA 2C3YA 2V8DA 1U26A 4ID5A 2RNEA 3J7Z5 4OV6A 1SIWB 4B3SF 2D41A 1IQZA 1MSWD 5EUHA 3B4DA 4WKYA 3I9ZA 5B09A 1HNXF 5AE1A 4CIOA 4C9DA 2OEJA 4H4KC 5EN1A 1WWHA 3AJDA 2HVEA 5MLCV 4URGA 1YIJS 4XDDA 3Q22A 3KYLA 5IT9U 1Y10A 1QDUB 3IXQA 1Q4RA 2ZBCA 3V5RA 2R42A 4WK3A 1EZZB 5LMUF 1MWZA 1RYRA 5HJXA 5A2QY 1OS5A 3KUGA 4K59A 1OMSA 7FD1A 3W9IA 3CCTA 3FRYA 1KQFB 4DOZA 1FTCA 1WEXA 2FHJA 4QU6A 4DV2J 3TI0A 2W1BA 2UXCF 2GGPB 2KTQA 4DR2J 1HR0J 3H0PA 4ZLPA 1NZAA 2C42A 4LR7A 2CQIA 3CJTA 3KLFB 3BPSP 4K0KF 4QYZK 1YVFA 5E7OB 3LQVA 3M6WA 2GO8A 4NLQA 2BJDA 1FJEB 3MOZA 4I7FA 2NYIA 1YGYA 2DK2A 3W9HA 4MKVA 4QW9A 2C3PA 3JB9k 4YHHJ 3G71S 1GX6A 1NK7A 2XHWA 4IDKB 2ZH7A 2LQBA 1C4CA 4DG1B 2Z57B 3D6MB 1U49A 4AYBD 4PRFA 5A8WB 4DQSA 1F1BB 5B0BA 3KG1A 5DQIA 3I87A 3HHKA 2JRSA 1KC8T 1UEUA 3N01A 4PYDA 4USJC 1GMVA 1FCAA 3HI9A 2L08A 2RT3A 4P2MA 4FF3A 2AYBA 1JB0C 2F9JA 2HAIA 1Y9OA 4PG6A 5C42B 1X8DA 3TX0A 4IG3A 4O23A 2YWHA 5JJBA 2D7SA 4QCLA 3HKZD 1DTQB 3DGVA 3HJVA 4LVOP 3GR1A 4WF9Q 3ET6B 1JLEA 1YWXA 4ANCA 4C6AA 3IRXB 5KT6A 4K4XA 1QSLA 2MLYA 3TAPA 3HHDA 1VQKS 4ETZA 1S6PA 3TUPA 4FF2A 2BE9B 2AIRB 2HK2A 3K17A 2ALZA 2CNKB 3HFKA 3NG8A 5J1EA 3A13A 4LSNA 2XULA 2PMWA 2M3DA 4DBQA 3ADAC 4DS4A 3CPWR 3HCXA 2PA3A 5KFTA 3WQPA 4Q5VA 3DI6A 1ZM2A 1SPBP 2K1RB 4RW8B 2AU0A 1MROB 3A3PB 1JLAA 3W7BA 4A48A 4KGVB 1S5ZA 2Z8QA 3N6MA 1IM4A 3BGRB 3G6ES 1G2EA 1XR5A 1FK9B 3ZZ0A 1HHTP 2LA4A 4F4WA 3PHEA 3AA9A 3MPUB 8ATCB 4F3MA 4LR9A 2ZM6F 2MKKA 4C8NA 3DLJA 2XHCA 4QIWD 3T9ZA 5GADI 2RB7A 3I9V9 1DRZA 4PUOA 4AFFA 1HWLA 1SC6A 1S1UB 1WC0A 3T1YJ 1VC5A 3HMJG 1YBAA 2R3VA 2PFDA 3KK3B 4JI6J 1VC6A 2GIRA 4QU7A 3ZZZA 3Q8VA 1CJVB 1NHUA 3MM6B 4DL0C 2QRRA 3QIPB 1RJJA 3DRPA 4NCGA 4I68A 4W92B 1VQSA 4DR4F 2VG6A 3GFZA 4USUA 5F3TA 1OWXA 3E3XA 4YUDA 3E2EA 4DL5A 2F40A 3KWMA 2A3JA 5KOXA 5LSLA 1FRXA 4WIQA 4I2PA 1RT2A 4A8OA 1X4FA 2V94A 4ZJOA 1UVJA 3W65A 2QTWA 1W26A 1ZAVA 2RUSA 3O2IA 2VG7A 1S6QB 1RTDB 2V9KA 1UPPA 2GHWA 2YNGA 2HBRB 4OZ3A 4JI2F 1SV5B 1C0TB 1S7IA 4JI7F 4YN3B 4WJBA 3CC7S 3SQGA 3JAMY 2HBYB 4CO1A 4RW4B 5A0YB 1FERA 3X3UA 1JK9B 5KG4A 4C0BA 1Q7YT 2DNOA 2CPZA 4LIWA 1WOOA 2J0QD 2XWYA 2CNOB 3DDKA 4U7UK 3U1MA 4H4OA 4RU2A 3QT6A 2J9CA 1SJ1A 2OTLS 1C1CA 4DR5F 3GG1A 3F73A 2Q6BA 1C0UA 2BMBA 2M5YA 4QR2A 2K2PA 3FUYA 2XEXA
chains in the Genus database with same CATH topology
3LO3A 4FBTA 2HNZB 2YNFB 3GYNA 5KFSA 4X4NA 3MI7X 4TQRA 3RRKA 4NRTA 3DYAB 4YR0A 2YNGB 1FKPA 1SKWA 4EZ6A 3BGFA 2A2CA 3PW0A 3DXBA 3PRBA 3R5CA 4O3QA 3FSIA 1RDRA 2CQ4A 3RRGA 1X9SA 1LQ9A 2GNKA 4C7QA 4TLRA 2BANA 2RD5C 4O4GA 4DQRA 1N5YA 2XCAA 2Q3PA 1HNVA 1HQEB 2VB6A 3IR7B 5IQ6A 4DSJA 2EBGA 4NLRA 3VZHA 4AL7A 1O51A 3NP5A 2ZZMA 5M2PA 1DQAA 1U47A 4WK1A 3SQGB 4FPRA 3DCAA 2Q1LA 3M9OB 2VQEF 2JEJA 1FF2A 5F41A 4DN9A 2YWKA 3OTDA 3CDEA 3C3LA 1FD8A 4Q44A 2HGNA 3ENWA 5CYMA 1U2FA 2IA0A 2POKA 4LFCF 3PV8A 1QAXA 1A9NB 3PW7A 4AL5A 5CA5A 2DHXA 2DNYA 1NRKA 2BBEA 2LQ9A 2RKIB 2FIUA 3G6YA 2W8KA 5F8JA 1IBMF 2VBYA 4RNOA 4DSEA 1VBZA 2KFNA 2C2EA 2F8EX 2CPXA 4KB7A 4DHVA 4ED0A 2OAUA 1SKRA 3NRBA 5EX3A 3QZ8A 4J9OA 3IBWA 3M2RA 2HHVA 4LF5F 5DLFA 1FKAF 4MKAA 5JXSA 5KFCA 2V4QA 3HVTA 2H5EA 3PY8A 1XEZA 3M9NB 3M2VA 4YDDB 3PX6A 4I64A 4DUYF 1T95A 1J5OA 1TKZB 2J7KA 2CZVC 2VC1A 4UW2A 5H9EJ 1FRJA 2ASDA 4JI0F 2ZNZA 2D9OA 3SCIE 1JKHA 3KG4A 3AAWB 5KFQA 1LFPA 1SUQA 2P9CA 3MFIA 1YJWS 2DTJA 2OFGX 3BJYA 2R7SA 1ZAWA 3R3TA 2MQPA 4K4SA 5SUHA 3S8SA 1MU2B 5DDPC 2UP1A 1VQ7S 4MFBB 4IFYA 3PKMA 2WRMA 4DQIA 2R2SA 1C1CB 1VRTB 2GQQA 2XSFA 3P3DA 4KO0B 3Q8QB 4QZVB 2MY8A 1H2TZ 1FXRA 2MZQA 5K8OA 4KBIA 1U1NA 4OX6A 1GNKA 1LWCB 1R8HA 3UCGA 1DJ0A 4ZVEA 1X4CA 5AXKA 4IG0A 2CQGA 4ZMMA 4LF8F 2HMIA 2KJVA 3KFWX 3T6JA 2X3GA 5E3AA 1RISA 1JXEA 1JIHA 3B82A 4N47A 2SXLA 1CSJA 2CPIA 2LLZA 3DU5A 4DPOA 1WD6A 2DO0A 1UKUA 2VL1A 4YB1P 1FKPB 4WZQA 2FJVA 2ROEA 3KNAA 1NH8A 1ZPWX 4F67A 1R0AA 2KM8B 5KG3A 1K0VA 4C3KA 1YSJA 3BDPA 4OMFG 1LOUA 3BN7A 4NZ6A 1EETA 1Z2ZA 4CT8A 5AE2A 4CCHA 3QGGA 4KHMA 4O4GB 2DGTA 2XC9A 1N5YB 2KKHA 3KLHA 1HNVB 5EX0A 5EDWA 3JSMA 1ZOTA 1N5QA 1FVQA 3QWPA 1B0TA 1FRKA 2BM1A 3HK2A 1RT5A 3DN9A 4XDCA 4QOTA 1FXDA 2UUTA 5GADU 2FHMA 5IQQA 1RWUA 3KJVB 3ISZA 4CQ1A 3RBEA 4DV2F 4UQGA 2G0CA 4DSKA 5K5MA 3DOKA 1ULRA 4NWBA 3MD1A 2NUHA 2CJAA 1K9MT 3KMQA 2XNQA 4DQQA 4HKQA 4Y00A 2CG4A 2HS4A 5CYMB 1ZZNA 4B9TA 4DR2F 5L9XA 1YQHA 2RIJA 2CZ4A 1E6VA 3SFGA 1U8SA 3CT9A 3NAIA 4HTIA 2OP5A 2N3LA 4ZPTR 3N9UC 2O5DA 2FJXA 1NK8A 1HD0A 1H98A 2OLWA 4C8MA 3CD7A 5CYQA 5B0DA 2EFVA 3K59A 5CXTA 1UMJA 3PFEA 4RW7B 4ECUA 4DF8A 3M2RB 3I96A 3BSNA 1M5KC 3DLBA 2LECA 3HKWA 4ID5B 5M2RA 5HMXA 2IFXA 3HVTB 2LVWA 4J9PA 1T03A 2L9NA 3DNCA 3S7RA 3E01A 3M2VB 3Q2SC 2ZKTA 4ZP6A 3WBZA 3VF0B 3CXCR 1J5OB 2OPQA 4N56A 3DC2A 3HM9A 3KTQA 4EWTA 3RB0A 1XR6A 3ZZRA 1S1WA 2IBOA 1JKHB 1R7IA 5DM7Q 2PI5A 1AFJA 1SUQB 3HZEA 4IRKA 3OVBA 2M2BA 4N77A 4CO0A 1F9FA 4OZJA 3KNGA 5J1PA 3LOUA 3IAM9 4YHHF 2XBPA 3DLLQ 4ES2A 1C4AA 2R7TA 1HBNA 5BJRA 4IFYB 4IH5A 4NPOA 4A8KA 3V4IA 3PX0A 1U24A 1NHVA 2KT2A 1HL6A 2ZHAA 3AB4B 5MAOA 5LXYA 3G4SS 2DH9A 3UR0A 1HBMA 1TUVA 3CE8A 4ZPDA 3MDFA 4IFVA 1RKJA 3UR3C 2MHEA 1YJTA 2RRBA 3OHBA 2JEFA 4K4UA 3O5TB 4IG0B 2RU9A 1XMOF 1RT6B 4KR0B 3JSYA 2HMIB 1LXJA 3DRSA 1CC7A 4ID8A 4C8LA 4NLSA 2DGXA 1HWUA 3MM5A 5BR8F 4J9QA 4RBUA 2KI2A 1Q79A 2Q79A 1VQ6S 2MZSA 4NYOA 2VPZB 2RRAA 2ZH4A 1DZ5A 4HI1A 3H4BA 4PWDA 1R0AB 1JLQA 2E9ZA 2YX1A 4HLBA 3H2LA 5KFUA 2XS7A 1QM9A 1FDNA 1JLCA 1RA7A 2Y0SD 1YRTA 3POTA 2CYYA 4B17A 1U1MA 5H9FJ 4UY8T 2VA3A 1Q8BA 2Z4PA 2YVSA 3G8TA 3ZZOA 4NCBA 3KLHB 1HWJA 2G13A 4PG7A 3SFUA 4RNMA 2YWGA 1RT5B 3CGIA 2I1RA 4M8LA 4PG4A 4K5SA 1UJ6A 1ELOA 3DLEA 3OJSA 1WI6A 3DOKB 2KRBA 3QYYA 4X4SA 3CCJS 5I3UA 2X1GA 2HFZA 2YKMA 4OJGA 3V6JA 1UJ5A 2IAJA 1WHXA 4IR1A 2KFZA 4IRCA 1E6VB 2NPIA 1X4DA 4Y2IA 2BR0A 4B3MF 4WFZA 5G0RB 1UVKA 3SEOA 3EUNA 4DSIA 2FJBB 1MMNA 4LUBA 2RJZA 5A6WA 4LT6A 5LL6d 3NGKA 3TVKA 1VRUA 4Q43A 4A8MP 2ATLA 1WELA 4QIVA 1S77D 1OSCA 2MGZA 4OHXA 1IN0A 5KFAA 4ITSA 1HBUA 3IAS9 5IWAF 3W2VB 3ONQA 3K7RA 1P1TA 4ECZA 4X4PA 1T03B 4F3OA 3E01B 2JZ5A 1Z4UA 3HLUA 1XN9A 3I0RB 4LQ9A 4NOHA 4K4TA 2DVIA 1RT4A 2M7SA 4BWJA 3NLCA 3TVZA 1AXQA 3FFIA 1S1WB 2HS3A 5THWA 5IT4A 3FEZA 4MMOA 2HLUA 1IR0A 3H8YA 3DRRA 3C66A 4EU0A 2QLXA 5IS2A 1S76D 3WZ0A 3PIPQ 5JVHQ 3DMJA 5DGAA 1KLMB 1G7CB 2D3UA 1X4GA 3BO3A 1HWIA 3MECA 3FQLA 1N5SA 4I0WA 2VC0A 1HBNB 2FUG9 2DH8A 2GHVC 1UW4A 1L3SA 4I2QA 2VKRA 2LU1A 4OX8A 3TAMA 2EFNA 2LEAA 4NL5A 4IH7A 4DMZA 2HLTA 1HBMB 4TXSA 1SL0A 5HLFA 1QSYA 5FJ4A 3ISNC 4OI3A 4OHZA 4EO6A 1U45A 4DQPA 1N54B 2KB2A 1UVIA 2EFGA 2D74B 3TUZC 4Z37A 2KM8C 3HPOA 2LXFA 1X5TA 2OD6A 3QO9A 4O3NA 3MM5B 2W9BA 3OLBA 2ZDPA 5FIIA 5LMNF 3BSCA 1QUPA 1CEZA 4PWDB 2DNNA 5L39A 2BRKA 1JLQB 1T94A 3KHGA 3RR8A 4TU8A 3MMBA 1V3SA 1JLCB 1OQ3A 3GV7B 3POTB 4UUXA 2W7PA 2HWHA 4Q8EA 1IKYA 3ENVA 4X66F 4ZVGA 1SH3A 2FLOA 5F0WA 2C2RA 2MZTA 2HHTA 5KG6A 2Q66A 4FXWA 4M63A 3K5MA 4XIUA 4IH6A 4OI2A 4XPCA 2RQ4A 2NPFA 2HIQA 2JC1A 2M70A 3H59A 4BC9A 4A8QA 4ECXA 2KN4A 3CMAS 3DLEB 3OVAA 5I3UB 1P9QC 2ASLA 3KMSA 2YKMB 3CCMS 1NKBA 4OI6A 1X4EA 2DNZA 1LKZA 2IAJB 5B0FA 4C0HA 1Q81T 5D78A 1FXLA 2JFDA 2B4UA 1N34F 2YNIA 5A8KA 5B7WA 1HW9A 1MMLA 1HA1A 2BYCA 4X4TA 3R27A 3OFGA 2HFNA 1FRMA 2PE8A 4ZCMA 2FD2A 1N32F 3HP6A 1YJRA 2J7WA 2KFYA 4DS5A 3T5JA 5KG1A 2M8DB 4ZVHA 4IG3B 5KFJA 3PZPA 1DQ8A 1HBUB 1Q78A 2Y1IA 4NA2A 4KT0C 1LW2A 2WSCC 3UQSA 4RKUC 2ILYA 4ZDNA 2J5AA 1X5SA 4PG5A 1WHYA 4C3LA 1QAIA 2QE5A 1I6JA 2IVFB 2AGOA 1VK8A 3M8SA 1PC5A 3OR1A 1Y7PA 2R8KA 3W2WA 2QT7A 1W2BR 3BGLA 4ECYA 2FJWA 4KHPF 2VFRA 3H5UA 2ZUGA 1CLFA 3JSBA 5L9NA 1ZM9A 3VAFA 1ZM4A 1ZETA 2DNPA 2CVIA 2KXFA 1Q8IA 4YB5A 2J6TA 2CIMA 2EKYA 3MECB 1JLEB 5T7LA 1IKWA 1UWBA 1S9GA 4FS2A 2CQ0A 2GFFA 1NKEA 1DHMA 4I2QB 4EZ9A 4FF4A 3CB4A 1H2UX 3OR2A 3TAMB 4M5DA 5HP1B 4IKAA 2EK1A 3VAHA 4H4MA 3M32A 2IBKA 1PC4A 2HG4A 2DITA 3OV7A 1X9WA 1X9MA 3V6HA 1AROP 3LP0A 2I5JA 2IM1A 4NZ0A 1QLNA 3QO9B 3W3SA 1U6ZA 4AQYF 3OBIA 3MEGA 2XGPA 1KOHA 2XG8A 3T1YF 2W9BB 2AGQA 2DIVA 2GW8A 2N4DA 4ZA1A 1WG1A 2N3OA 2UV8A 5LSOA 1HMVA 2ZDOA 1RYSA 2H9ZA 2W7OA 4PQUA 4KSEB 5KG7A 3Q23A 1BWEA 5FD1A 1FNMA 3LH2S 1CPZA 4G6VB 3MMBB 2HVIA 4QIEA 4JI6F 4H4KA 1C2PA 1RT7A 4AL6A 1JJ2R 3MMJA 4B9UA 2R7RA 4JOUA 2DRAA 1IKYB 1T3NA 3QWUA 4ILLA 4NX9A 4DL7A 4K4VA 2Z0GA 4ZCLA 4LSNB 5K8PA 4RWWA 4JV2A 5AXMA 4FNIA 1FRIA 4MAKA 3BGUA 4TYBA 3IC1A 2QMWA 1KD1T 3OL7A 1N6QA 1YJUA 4WFBQ 1WG5A 2QSFA 2NSBA 3BQ2A 5DG9A 4L72B 3U1NA 2FLLA 3VQSA 5CD4H 1G3OA 1QY7A 2DRBA 4QW8A 1U48A 3I0SB 3OTEA 1N48A 5E3RA 4MTPA 3E8OA 2AF6A 2YNIB 3EZUA 5A8KB 3HHNB 3TO8A 4ICLA 4F3QA 1ZH5A 4TY9A 4NRUA 3LF0A 4KGMA 2OPRA 2DIUA 5IM0B 1UAWA 5KT5A 3DHWC 1IKVA 5ITHA 1JLAB 2EWHA 3BO2A 3G86A 1T05A 1BQMA 4CT9A 2IRXA 5KFMA 3GQCA 2V4JB 4IYQA 2BXJA 1VQYA 1HYSA 5EWEA 2E1AA 3L7OA 3OR1B 4ECTA 1WTFA 1VS3A 1B7FA 1TK0A 3W2WB 1WEYA 2B4OA 1VQPS 2I2YA 1XC9A 1QE1A 3MOJB 2ZH1A 2LKZA 2OSRA 2GJIA 2RQKA 3LW5C 3LAMA 1NKCA 2NR0A 2BM0A 3GV5B 4ELVA 3V4MA 3MEKA 4BCAA 3ETOA 1FNXH 2WAQD 1GXTA 1KHVA 5EWGA 4ED2A 3H2VE 1XMBA 3RB3A 5T7LB 1IKWB 1S9GB 4ETXA 2N82B 1PILA 1A7GE 3WC2A 3HO1A 3M8RA 2I0XA 3OL8A 3CCZA 4M5DB 3R1HA 2AYEA 2HHUA 2I8EA 4H4MB 1WACA 4OL8A 1OPZA 4NLOA 1MNEA 3CIZA 3LP0B 3CJKB 1T8EA 3HHEA 2UUBF 5KT7A 3DRXA 3MEGB 1FVSA 3GG0A 2A1BA 1J5EF 1LWEA 1S4FA 4F4KA 4QJVA 3C46A 2K3KA 3D0HE 4G3IA 4YOEA 4PUOB 4X64F 1HMVB 3CJ2A 4O0IA 4DSFA 4ED6A 2M9KA 1UA1A 2ILZA 3RBDA 3RR7A 4LFAF 3VZIA 3MFHA 4D3HA 5GAGI 2P6SA 1RT7B 4XPEA 3DLKA 3I6PA 5F3ZA 4JV5F 2YX4A 3C6UA 5DQGA 3PW4A 2AQ4A 4OHVA 4GC6A 2F4VF 2VONA 2O67A 4QPTA 2BACA 2N7YA 4LJMA 2K3IA 5LSRA 4PPDA 2EG1A 2JX2A 3PJXA 1Y3KA 3ZC4A 3D1HA 4AXIA 3SCLE 3SCJE 2R7OA 4R8UB 2FVPA 3LWLA 4UOCA 2HWIA 2L41A 1WHWA 4OJ3A 4PQAA 4O4RA 4I4BA 5KG2A 4ES1A 2ZJPQ 3M6XA 4CO2A 4BWMA 2EK6A 1IJFB 3LALA 5K8NA 4ICLB 4G1QA 2I38A 4YP3A 2FGOA 5E5NA 4ZKAA 4QWAA 3PFOA 2OPRB 3SDEA 3L3CA 2FVQA 4MYTA 5CH7B 3B8HA 1WF2A 2W4DA 3FEXB 3GIKA 4WE1A 1T05B 1S0NA 3MXHP 1MMDA 1BQMB 1REVA 3VWSA 4UY85 5HN0A 4DL6A 2XS2A 2W4PA 2XCPA 2MKIA 5KFOA 2E9TA 1SJ4P 2HNYA 3M2UB 4AE5A 3Q8SB 5J2PA 1SB6A 2QA1A 4C11A 1Q82T 1HYSB 5K9FA 2FB0A 4JYAF 4Y34A 1NNDA 4AUKA 4R5PA 2CQHA 3NS6A 5KFYA 4J5OA 1QE1B 3UCUP 1N5TA 5CYJA 3Q2TC 2HPUA 3DLGA 3O8WA 1UJ4A 2K7JA 4YR3A 3DDNA 2JFKA 4J9RA 2VA2A 2RDJA 2MQOA 2APOA 2QFJA 2Z2LA 2DR5A 4DR7F 3T19A 2IJFA 5KT4A 1S0VA 3H98A 1U1KA 2MY7A 5SZTA 5K8MA 2DGSA 3AQOA 5KT3A 4OIXA 2LA6A 3O3LA 4RW6A 4P6QA 2Q43A 5HQ8A 4TY8B 2JVRA <