2F4VM

30s ribosome + designer antibiotic
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2f4vM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2f4vM02
2UXBM 4LF7M 3J7AS 3GPPA 1Z5BA 4PD2A 3U6LA 5ITRA 3SASA 3GQ3A 4YHHM 2UUAM 4DV2M 3VK7A 4NXNM 4X62M 4JV5M 3OTOM 1I94M 4JI5M 1N34M 4JI4M 3U6MA 4PDGA 1Q39A 3J80S 4DV0M 1L1TA 4DR6M 3SARA 3SBJA 2OPFA 3T1HM 4LFBM 3GO8A 4X64M 3JR5A 4JI6M 1IBKM 2VQEM 4DV4M 2UUCM 4JI2M 4LF8M 2VQFM 4JI3M 3T1YM 1XC8A 1EE8A 4LF6M 3C58A 4G4QA 4KHPM 3TWMA 5ITUA 1Z59A 3W0FA 4NXMM 4G4NA 1MU5A 4LFAM 4JI8M 2F5OA 5ITTA 3GPYA 1HR0M 4JI7M 1J5EM 4JI1M 4DUYM 1K3WA 2UU9M 3U6QA 4DV6M 4PDIA 4G4OA 5IT9S 1R2YA 4X65M 3GPUA 4PCZA 4DR7M 1Z5AA 3U6PA 1Q3BA 4OX9M 4LF9M 2HKJA 3GQ5A 1HNXM 3J81S 1L1ZA 2UUBM 1Z5CA 2ZBKB 1K82A 4DR1M 4X66M 4YY3M 3SATA 4B3TM 5BR8M 1N36M 4B3RM 1MX0A 2OQ4A 3U6CA 4DV5M 2F5NA 4AQYM 2F5PA 4B3MM 1L2DA 1XMOM 5A2QS 4GKKM 1XNQM 3VK8A 1KFVA 4K0KM 4DV7M 2F5QA 2ZM6M 3SAWA 3JAMS 4LFCM 4CISA 4JYAM 4DUZM 5ITQA 1IBLM 3TWKA 3U6DA 4DR3M 5ITYA 1TDHA 3SAVA 5LMUM 3GP1A 2XZFA 3A45A 1N32M 2F5SA 3U6OA 1IBMM 4DR2M 4MB7A 2Q2EB 1HNWM 3DOAA 1L2CA 2XZUA 3U6SA 4LF5M 4DV3M 3A46A 1NNJA 5ITXA 2UXCM 4GKJM 2E5LM 1XMQM 2EA0A 3SAUA 5LMNM 1TDZA 1XNRM 4G4RA 5ITXE 4LF4M 1R2ZA 3GQ4A 4NRVA 1PJJA 4DV1M 1PM5A 1K3XA 3TWLA 5FLXS 4NRWA 4DR5M 3U6EA 1FJGM 1Q3CA 1HNZM 4ITQA 1L2BA 2UXDM 2F4VM 2HHHM 1N33M 4DR4M 3GPXA 5IWAM 3A42A 1PJIA 4B3SM 3JR4A 4JI0M
chains in the Genus database with same CATH superfamily
3J7AS 3NBIA 2DNAA 4PT5A 2CWBA 3U6LA 2V1CA 4WP2A 3SASA 3AOEA 3GLHE 1UFZA 4JV5M 1G3IA 2CV0A 5EXPA 2KDLA 3B7QA 2DAMA 3FUUA 3LW5F 3T15A 2KNAA 2FFJA 4W5WA 3MJ5A 2R0IA 2DAGA 2FOIC 5DFLA 3QWLA 4IIWA 3CF2A 4CJ6A 1D0LA 3WHKA 2HAKA 4L6V6 3ZC7B 2J7OA 5BPVA 5EP4A 1SXJA 2M60A 2W82A 4X64M 4AZFA 1DGGA 3JR5A 1IBKM 1WXQA 1G4AE 3T1YM 3VFDA 3K9PA 4WW0A 4LF6M 2OO9A 3C58A 2YQZA 3LCVB 4KHPM 3U60A 3TWMA 5ITUA 3W0FA 2X49A 3FRHA 4FCVA 4LY6A 2F5OA 1XHBA 3RFWA 4B08A 3MHVC 2JZ1A 1HR0M 4G3OA 1J5EM 1LTMA 2DWLA 2L2DA 3LMMA 4DUYM 1K3WA 2UU9M 1VDLA 1ZQ9A 2CUZA 3DA1A 4XBOA 3U6PA 1Q3BA 1SXJD 2QCUA 1YSYA 4LF9M 3KXEC 1EFUB 3I4VA 4GMQA 3UZUA 3GLGE 1VEJA 4X66M 4B3TM 2EO2A 5BR8M 5KO3A 2DENA 1NHWC 3AV0A 4DV5M 1MN3A 1TH2A 4B3MM 3E46A 1OTRA 1P3QQ 1XMOM 2XGNA 2YNMD 3FE3A 3KVWA 4IBCA 1R6BX 2CRUA 3SMPA 1W5SA 4K0KM 2KA6B 1HJPA 2MROB 3QAUA 4IBKA 5KPTA 5L8RF 3SAWA 2D7HA 2MR9A 4I81A 4JYAM 3GRVA 3HWSA 2C98A 5ITQA 3SHFA 4LZZA 2J5YA 3LQQA 3SC3A 3GLFB 5ITYA 1TDHA 1J7KA 1YLAA 3ZH9B 3TE6A 5LMUM 3GP1A 3C9PA 4P16A 5DYGA 4I5SA 3Q8XA 3D8BA 3U6OA 4DR2M 4D82A 1MJGM 4WURA 2BWBA 2R44A 4P17A 3LCUA 1WIVA 2FH0A 3W0LB 3B9PA 3LQRA 1R7RA 3M6AA 4LRTA 2XZUA 3HU1A 1HQYE 1NNJA 3PXGA 5ITXA 1NO1A 4M9SA 1IXZA 2EA0A 3U61B 1XMQM 2L4EA 2MH8A 3J2PB 1DO0A 2Y21A 4NRVA 2N35A 2ZANA 2LVQD 2C96A 3L27A 1DO2A 5FTLA 4NRWA 2I7NA 1OIPA 1Q3CA 2EKKA 2EKFA 4MGIE 2KNVA 1RU3A 2DZLA 1QVRA 2DAIA 4DR4M 4MGKE 4NSRA 1SXJC 2L6OA 2L7HA 3B7NA 1T3TA 3GRRA 4BBAA 3KS8A 2DAEA 1E9SA 3L25A 4JI0M 3UK6A 5H37D 4LF7M 1PJSA 2H5XA 3KSXA 2UXBM 1PRBA 1VEKA 3HY5A 5IZ7D 4PD2A 5ITRA 1GJSA 3VLFB 4DV2M 1IXSB 4X62M 2XSZA 3TQSA 3FYDA 5FTKA 3OTOM 2AHMA 3HX3A 2JWSA 2DZNB 4AG5A 4D81A 1I94M 3BXWA 4JI5M 4NSOB 2Z7JA 1GO5A 2K0BX 3U6MA 4PDGA 4KO8A 4DR6M 3GRYA 1WGLA 2C9CA 2K9DA 3LVWA 3AOGA 1V33A 3C3DA 3KOWE 2OPFA 1OIZA 3T1HM 4S12A 4LF8M 2V6ZM 2R4EA 2KXEA 2RGOA 4II7A 4NC6A 4F2LA 2DWMA 3CF6E 4QNRA 4R7GA 1IN4A 2L09A 4FW9A 4NXMM 2RKOA 4LZJA 4UN2B 5C1BA 2XSZD 3GPYA 3GLFA 2QP9X 3GLIB 4L78A 2CV1A 1NSFA 4REZA 1TH3A 7CATA 1KYIA 4D80A 4R71A 4FCTA 1L8QA 2Z4SA 3DFZA 3HZJA 1Q02A 3GLHB 8CATA 2KZSA 3HHXA 1HT1E 4DV6M 1QYRA 3U6QA 5FTMA 4JXJA 4FWGA 5JI3E 1OQYA 4PCZA 3FUXA 2G8LA 4OX9M 5EP1A 1N78A 2HKJA 1PJTA 4CGYB 4Z6YA 1HNXM 1L1ZA 1QANA 1ZAEA 3L2AA 1VG5A 2ZBKB 3U61A 2XEPA 2XH9A 4LRSA 1TH4A 1IN6A 4DR1M 3SATA 3GLIE 1JR3A 2KRUA 2OQ4A 2J7NA 3KP1E 3NWLA 3U6CA 2F5NA 1N77A 1L2DA 4F1IA 1H6UA 1X37A 3FD9A 1JB0F 2LVAA 1GABA 3MMPA 3KFUG 4NL4H 2F5QA 4L16A 2ZM6M 4CISA 2LH0A 1G71A 4A3VB 3WHLA 3I01M 2LTUA 3FUTA 4OW0A 3TWKA 2JY8A 1IBLM 2C99A 3E9SA 3H4MA 1J09A 3EIHA 1ZMWA 4KODA 4LCBA 3W67A 3ZCBB 3VKHA 3W68A 4GC9A 3HKPA 1N32M 1DV0A 1TGUA 2VF7A 4RF1A 1IXSA 1QAOA 1SG9A 2KNZA 1GLNA 1JR3D 3HJSA 2XF3A 3BOSA 3LVVA 3FTEA 4TUWA 3DOAA 2DHRA 3GLGB 4BLCA 3U5ZB 2Y0QA 3FUVA 4DV3M 2R65A 2YR0A 2DWZB 3AL0C 2K47A 4M0WA 1IY2A 4QOZC 4MM3B 1TDZA 2ZTCA 4LJ7A 2ERCA 4AI6A 4LF4M 2FE8A 2KEBA 2KZUA 1EIJA 1T6OA 1PJJA 1K3XA 3TWLA 3CGWA 2Z4RA 1AIPC 1WGNA 3L26A 4QNMA 3U6EA 1NY5A 1FJGM 4ITQA 1L2BA 2HL7A 2UXDM 3SYLA 4GRIA 2G5GX 3GLIA 4AKGA 4FVMA 5IWAM 4B3SM 2O25A 1GVNA 2DAKA 2EUCA 3F92A 2CV2A 2MGWA 3PNYA 2CEAA 1CUKA 1GJTA 4LGMA 4Q7JA 1C1KA 1HNZM 1QUTA 3GLHA 3GPPA 1IN7A 1OJLA 2CFOA 2GNOA 3GQ3A 2UUAM 3RGSA 3VK7A 2VDBB 1NHGC 1LV7A 4FWHA 4AW4A 1R5LA 2JY6B 2LHCA 1E9RA 3AOEC 2R62A 2JY7A 5KQDA 3L28A 1N75A 1VEGA 2LXEA 1G8PA 1W5TA 1ZMUA 2JUJA 2O01F 3J80S 3FUWA 4CIZA 2D7EA 1L1TA 3M7GA 1XXHB 2C9OA 5EP2A 3SBJA 2LNHC 1V92A 3PNVA 4HL4A 4AKHA 1PGYA 4LFBM 2LVNC 4IBEA 4QHSA 4GEWA 4DV4M 4JI2M 2LVOC 2VQFM 2XFTA 1ORYB 4CHTB 5FSWA 1EE8A 1XC8A 3E21A 4KLNA 4G4QA 1SXJE 3FYCA 3FKEA 4GIPA 1OAIA 3C3EA 1MU5A 4LFAM 4JI8M 5ITTA 1BVSA 1A5TA 2RRUA 4I4LA 1OAOC 2KHHA 4I8OA 4LJ8A 2FNAA 4B7FA 4M0DA 4JI7M 1V34A 3PFIA 5DNYA 2M5ZA 4AG6A 1TTEA 2O5RA 1NJFA 2BWEA 1GKIA 3IECA 4JI1M 2Y20A 3FTDA 4PDIA 2QBYB 4G4OA 5IT9S 3GPUA 4DR7M 1Z5AA 3I4YA 3B7ZA 3I04M 3HHZA 3GLGA 3FTFA 2CHGA 5KPZA 3U5ZA 5IREB 2X8AA 3R9XB 3T6PA 3HHYA 4M9ZA 2UUBM 2XFSA 5FTNA 2ZTDA 3THGA 1K82A 3RE8A 3BBZA 1MX0A 4MGYE 1XB2B 3ILKA 2CHQA 3SFZA 4AKIA 1QZEA 4L4UA 2F5PA 1XWIA 2OOAA 2RGHA 4OVZB 4LJ9A 1XNQM 1ZV1A 3VK8A 1QAMA 2VF8A 1E94E 2DI0A 5KPRA 4LFCM 2WSFF 3KOXE 4IBBA 1HQCA 2V1UA 2DKLA 2JNHA 1QDTA 3KOYE 3U6DA 1IY0A 2JY5A 3SAVA 2WSCF 2XZFA 1Y8GA 2BNKA 4Y28F 2WZJA 4IBFA 1NY6A 1D2NA 3IG8A 1IBMM 3B74A 3EIEA 5DYIA 2Q2EB 2R6FA 2JA2A 1T43A 3R8FA 1HNWM 1I4WA 4LF5M 3H4JA 3A46A 3K9OA 2DXIA 1GL6A 4GHLA 4GKJM 2UXCM 4LJAA 3KW6A 1XXHA 3AKZA 3DZDA 2DHYA 2KW0A 4HLQA 2E5LM 2JZ0A 4JI4M 2GQFA 3K2LA 4OU7A 2DZOB 5ITXE 2MJ5B 2CP8A 4IJFA 2XLJA 3GQ4A 2DWNA 4LJ5A 1OKSA 5FLXS 4HEOA 1YE9A 1PJQA 4DR5M 1C7YA 3UGJA 1IQPA 1UM8A 1OFHA 2QPAA 3GPXA 3AJIB 4QHTA 5E6JA 2R45A 3K92A 3HU3A 1VQ1A 2R46A 4B7GA 3JR4A 1Z5BA 4LG2A 3FRIA 5F3WA 3B89A 2QBYA 4DBGB 3HGIA 2Z8YM 1KSFX 4YHHM 4NXNM 3E4RA 1YUBA 1NV9A 4LJ4A 4ZPXA 5EXTA 3HJ8A 2EJSA 4MH0E 2LWXA 3ZQJA 3L29A 1N34M 2LHGA 1D0KA 2D7GA 1Q39A 4M9XA 4DV0M 1AUAA 1G41A 4RKUF 4BB9A 4MGHA 3SARA 4IBJA 4GH9A 3QYBA 1DGHB 4JN6A 4JI6M 3D8LA 3K8ZA 2DVWB 4OVZA 2VQEM 2UUCM 4JI3M 4ANRA 2L7IA 4RF0A 2R4JA 1NJGA 2B3TA 3AFHA 3RGPA 3FTCA 2KRKA 4IBGA 1Z59A 2QZ4A 4MGZE 3T38A 4G4NA 3J27B 4Z8XA 4LJ6A 4FD2A 2JXNA 5GKNA 1TF0B 1HT2E 1OFIA 3GLFE 3KSJA 4FCWA 5EXSA 2QQ8A 2X4AA 2QHOB 1R2YA 4X65M 2LBCA 2QNJA 3IG5A 3CTWB 5KQ8A 4EIWA 5JI2E 1VDDA 1FNNA 2ZAOA 1TR8A 4FWDA 2BJWA 3GQ5A 3HHWA 3J81S 1S3SA 4NOOB 1D0MA 1Z5CA 2QENA 1IM2A 1QDRA 1QQWA 2QSFX 4GITA 4YY3M 1N36M 4IJEA 4B3RM 5EQTA 3CF0A 2H1RA 4AQYM 2OOBA 1JR3E 1SXJB 5A2QS 4GKKM 1R4GA 1QAQA 1KFVA 3V76A 1GL7A 2A5YB 4L8RC 4DV7M 3MK6A 2P5TA 1XXHE 1IN5A 3JAMS 3U60B 2I7PA 3K1JA 3KDSE 4DUZM 3HJQA 1G59A 2VIIA 4GHAA 5EXXA 4DR3M 1IN8A 3VDUA 1DGBA 4XGIA 5C18A 1NV8A 4KT0F 2ZAMA 5EJCA 1IY1A 3A45A 3PVSA 3SMSA 2K6BA 2F5SA 1IXRC 2C5RA 1WR1B 5EP3A 1QZMA 4MB7A 3HU2A 4IBIA 5FTJA 3KP0E 3UJNA 1L2CA 1Z6TA 5E26A 3U6SA 3QYEA 3TL4X 3KS4A 2Z3XA 3IHPA 2G3QA 3J7BA 3VDPA 1WHCA 2CE7A 1NNUC 3GRUA 3SAUA 4R3DA 4XK8F 5LMNM 2HCBA 3KOZE 2NQ8C 4G4RA 1XNRM 1DGHA 2BJVA 3M0EA 3NBXX 4IBDA 4QOSA 1R2ZA 2LVPC 3Q8GA 2WSEF 4DV1M 1ZMVA 3UMMA 1PM5A 1F4IA 2YFQA 4B7HA 2APLA 2FS1A 2Y0TA 3SHGB 3SYKA 4RNAA 3VKGA 4GC5A 3TPZA 1QUSA 4LGYA 2F4VM 4L15A 2R18A 1WJ7A 4G6ZA 2HHHM 1DGFA 1N33M 1E32A 2L4FA 3A42A 3A98B 1PJIA 3I51A 1JQJC 2JP7A 1NVMA 3GO8A 1IFYA 2HWJA 2CHVA
chains in the Genus database with same CATH topology
3J7AS 3NBIA 4PT5A 3U6LA 2V1CA 3SASA 3AOEA 4JV5M 1G3IA 2CV0A 5EXPA 3FUUA 3T15A 2FFJA 4W5WA 3MJ5A 4JI4M 2FOIC 3QWLA 4IIWA 3CF2A 3WHKA 3ZC7B 2J7OA 5BPVA 5EP4A 1SXJA 2M60A 2W82A 4X64M 4AZFA 1DGGA 3JR5A 1IBKM 1WXQA 1G4AE 3T1YM 3VFDA 4WW0A 4LF6M 3C58A 2YQZA 4KHPM 3U60A 3TWMA 5ITUA 3W0FA 2X49A 4FCVA 4LY6A 2F5OA 1XHBA 3RFWA 4B08A 3MHVC 1HR0M 1J5EM 2DWLA 3LMMA 4DUYM 1K3WA 2UU9M 1ZQ9A 2CUZA 3DA1A 4XBOA 3U6PA 1Q3BA 1SXJD 2QCUA 1YSYA 4LF9M 3KXEC 3I4VA 4GMQA 3UZUA 4X66M 4B3TM 2EO2A 5BR8M 5KO3A 1NHWC 3AV0A 4DV5M 1TH2A 4B3MM 1XMOM 2XGNA 2YNMD 3KVWA 4IBCA 1R6BX 3SMPA 1W5SA 4K0KM 2KA6B 3QAUA 4IBKA 5KPTA 3SAWA 2D7HA 4I81A 4JYAM 3GRVA 3HWSA 2C98A 5ITQA 3SHFA 4LZZA 3LQQA 3SC3A 3GLFB 5ITYA 1TDHA 1J7KA 3ZH9B 3TE6A 5LMUM 3GP1A 4P16A 5DYGA 4I5SA 3Q8XA 3D8BA 3U6OA 4DR2M 4D82A 4WURA 3W0LB 3B9PA 3LQRA 1R7RA 3M6AA 4LRTA 2XZUA 3HU1A 1HQYE 1NNJA 3PXGA 5ITXA 4M9SA 1IXZA 2EA0A 3U61B 1XMQM 3J2PB 1DO0A 2Y21A 4NRVA 2ZANA 2C96A 3L27A 1DO2A 5FTLA 4NRWA 2I7NA 1Q3CA 4MGIE 1QVRA 4DR4M 4MGKE 4NSRA 1SXJC 2L6OA 2L7HA 4BBAA 1T3TA 3GRRA 3KS8A 3L25A 1E9SA 4JI0M 3UK6A 5H37D 4LF7M 2UXBM 3KSXA 5IZ7D 4PD2A 5ITRA 3VLFB 4DV2M 1IXSB 4X62M 2XSZA 3TQSA 3FYDA 5FTKA 3OTOM 2AHMA 4AG5A 2DZNB 4D81A 1I94M 4JI5M 4NSOB 2Z7JA 3U6MA 4PDGA 4KO8A 4DR6M 3GRYA 2C9CA 3LVWA 3AOGA 3KOWE 2OPFA 3T1HM 4S12A 4LF8M 2V6ZM 2R4EA 2KXEA 2RGOA 4II7A 2DWMA 3CF6E 4QNRA 4R7GA 1IN4A 2L09A 4FW9A 4NXMM 2RKOA 4LZJA 5C1BA 2XSZD 3GPYA 3GLFA 2QP9X 3GLIB 4L78A 2CV1A 1NSFA 4REZA 1TH3A 7CATA 1KYIA 4D80A 4FCTA 1L8QA 2Z4SA 3DFZA 3GLHB 8CATA 2KZSA 3HHXA 1HT1E 4DV6M 1QYRA 3U6QA 5FTMA 4JXJA 4FWGA 5JI3E 4PCZA 3FUXA 2G8LA 4OX9M 5EP1A 1N78A 2HKJA 4CGYB 1HNXM 4Z6YA 1L1ZA 1QANA 1ZAEA 3L2AA 2ZBKB 3U61A 2XEPA 2XH9A 4LRSA 1TH4A 1IN6A 4DR1M 3SATA 1JR3A 2KRUA 2OQ4A 2J7NA 3KP1E 3NWLA 3U6CA 2F5NA 1N77A 1L2DA 1H6UA 1X37A 3FD9A 3KFUG 4NL4H 2F5QA 4L16A 2ZM6M 4CISA 2LH0A 4A3VB 3WHLA 3FUTA 4OW0A 3TWKA 1IBLM 2C99A 3E9SA 3H4MA 1J09A 3EIHA 4LCBA 4KODA 3ZCBB 3VKHA 4GC9A 3HKPA 1N32M 1TGUA 4RF1A 1QAOA 1GLNA 1JR3D 3HJSA 2XF3A 3BOSA 3LVVA 3FTEA 4TUWA 3DOAA 2DHRA 3GLGB 4BLCA 3U5ZB 2Y0QA 3FUVA 4DV3M 2R65A 2YR0A 2DWZB 3AL0C 2K47A 4M0WA 1IY2A 4QOZC 4MM3B 1TDZA 4LJ7A 2ERCA 4AI6A 4LF4M 2FE8A 2KEBA 2KZUA 1PJJA 1K3XA 3TWLA 2Z4RA 3L26A 4QNMA 3U6EA 1NY5A 1FJGM 4ITQA 1L2BA 2HL7A 2UXDM 3SYLA 4GRIA 2G5GX 3GLIA 4AKGA 4FVMA 5IWAM 4B3SM 1GVNA 2EUCA 2CV2A 3PNYA 4LGMA 2CEAA 1HNWM 1HNZM 1C1KA 3GLHA 3GPPA 1IN7A 1OJLA 2CFOA 3GQ3A 2UUAM 3RGSA 3VK7A 1NHGC 1LV7A 4FWHA 4AW4A 1E9RA 3AOEC 2R62A 5KQDA 3L28A 1N75A 2LXEA 1G8PA 1W5TA 3J80S 1L1TA 3FUWA 2D7EA 3M7GA 1XXHB 2C9OA 5EP2A 3SBJA 2LNHC 3PNVA 4HL4A 4AKHA 4LFBM 4IBEA 4QHSA 4DV4M 4JI2M 2VQFM 2XFTA 1ORYB 4CHTB 5FSWA 1EE8A 1XC8A 4KLNA 4G4QA 1SXJE 3FYCA 3FKEA 4GIPA 1MU5A 4LFAM 4JI8M 5ITTA 4B7FA 4I4LA 4LJ8A 4I8OA 2FNAA 4M0DA 4JI7M 3PFIA 5DNYA 2M5ZA 4AG6A 2O5RA 1NJFA 4JI1M 1GKIA 2Y20A 3FTDA 4PDIA 2QBYB 4G4OA 5IT9S 3GPUA 4DR7M 1Z5AA 3I4YA 3HHZA 3GLGA 3FTFA 2CHGA 5KPZA 3U5ZA 5IREB 2X8AA 3R9XB 3HHYA 4M9ZA 2UUBM 2XFSA 5FTNA 3THGA 1K82A 3RE8A 1MX0A 4MGYE 3ILKA 2CHQA 3SFZA 4AKIA 4L4UA 2F5PA 1XWIA 2RGHA 4OVZB 4LJ9A 1XNQM 3VK8A 1QAMA 1E94E 5KPRA 4LFCM 3KOXE 4IBBA 1HQCA 2V1UA 3KOYE 3U6DA 1IY0A 3SAVA 2XZFA 2BNKA 4IBFA 1NY6A 1D2NA 3IG8A 1IBMM 3EIEA 5DYIA 2Q2EB 2JA2A 3R8FA 1I4WA 4LF5M 3A46A 2DXIA 1GL6A 4GHLA 4GKJM 2UXCM 4LJAA 3KW6A 1XXHA 3AKZA 3DZDA 2KW0A 2E5LM 4HLQA 3K2LA 4OU7A 2DZOB 5ITXE 2XLJA 4IJFA 3GQ4A 2DWNA 4LJ5A 5FLXS 1YE9A 4DR5M 3UGJA 1IQPA 1UM8A 1OFHA 2QPAA 3GPXA 3AJIB 4QHTA 5E6JA 3K92A 2R45A 3HU3A 3JR4A 2R46A 4B7GA 1Z5BA 4LG2A 5F3WA 2QBYA 3HGIA 1KSFX 4YHHM 4NXNM 3E4RA 1YUBA 4LJ4A 4ZPXA 5EXTA 3HJ8A 4MH0E 2LWXA 3L29A 1N34M 2D7GA 1Q39A 4M9XA 4DV0M 1G41A 4BB9A 4MGHA 3SARA 4IBJA 4GH9A 1DGHB 4JN6A 4JI6M 3D8LA 3K8ZA 2DVWB 4OVZA 2VQEM 2UUCM 4JI3M 2L7IA 4RF0A 2R4JA 1NJGA 3AFHA 3RGPA 3FTCA 2KRKA 4IBGA 1Z59A 2QZ4A 4MGZE 3T38A 4G4NA 3J27B 4Z8XA 4LJ6A 4FD2A 5GKNA 1HT2E 1OFIA 3KSJA 4FCWA 5EXSA 2X4AA 1R2YA 4X65M 3IG5A 3CTWB 5KQ8A 4EIWA 5JI2E 1VDDA 1FNNA 2ZAOA 4FWDA 2BJWA 3GQ5A 3HHWA 3J81S 1S3SA 4NOOB 1Z5CA 2QENA 1IM2A 1QQWA 4GITA 4YY3M 1N36M 4IJEA 4B3RM 5EQTA 3CF0A 2H1RA 4AQYM 1SXJB 5A2QS 4GKKM 1QAQA 1KFVA 1GL7A 2A5YB 4L8RC 4DV7M 3MK6A 2P5TA 1IN5A 3JAMS 3U60B 2I7PA 3K1JA 3KDSE 4DUZM 3HJQA 1G59A 2VIIA 4GHAA 5EXXA 4DR3M 1IN8A 3VDUA 1DGBA 4XGIA 5C18A 5EJCA 2ZAMA 1IY1A 3A45A 3PVSA 3SMSA 2F5SA 1IXRC 2C5RA 5EP3A 1QZMA 4MB7A 3HU2A 4IBIA 5FTJA 3KP0E 3UJNA 1L2CA 1Z6TA 5E26A 3U6SA 3TL4X 3KS4A 2Z3XA 3J7BA 3VDPA 2CE7A 1NNUC 3GRUA 3SAUA 4R3DA 5LMNM 2HCBA 3KOZE 2NQ8C 4G4RA 1XNRM 1DGHA 3M0EA 4IBDA 1R2ZA 4QOSA 4DV1M 3UMMA 1PM5A 2YFQA 4B7HA 2Y0TA 3SHGB 3SYKA 4RNAA 3VKGA 4GC5A 3TPZA 4LGYA 2F4VM 4L15A 2R18A 4G6ZA 2HHHM 1N33M 1DGFA 1E32A 3A42A 3A98B 1PJIA 3I51A 1JQJC 1NVMA 3GO8A 2BJVA 2CHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB M;  4LF7 M;  3J7A S;  3GPP A;  1Z5B A;  4PD2 A;  3U6L A;  5ITR A;  3SAS A;  3GQ3 A;  4YHH M;  2UUA M;  4DV2 M;  3VK7 A;  4NXN M;  4X62 M;  4JV5 M;  3OTO M;  1I94 M;  4JI5 M;  1N34 M;  4JI4 M;  3U6M A;  4PDG A;  1Q39 A;  3J80 S;  4DV0 M;  1L1T A;  4DR6 M;  3SAR A;  3SBJ A;  2OPF A;  3T1H M;  4LFB M;  3GO8 A;  4X64 M;  3JR5 A;  4JI6 M;  1IBK M;  2VQE M;  4DV4 M;  2UUC M;  4JI2 M;  4LF8 M;  2VQF M;  4JI3 M;  3T1Y M;  1XC8 A;  1EE8 A;  4LF6 M;  3C58 A;  4G4Q A;  4KHP M;  3TWM A;  5ITU A;  1Z59 A;  3W0F A;  4NXM M;  4G4N A;  1MU5 A;  4LFA M;  4JI8 M;  2F5O A;  5ITT A;  3GPY A;  1HR0 M;  4JI7 M;  1J5E M;  4JI1 M;  4DUY M;  1K3W A;  2UU9 M;  3U6Q A;  4DV6 M;  4PDI A;  4G4O A;  5IT9 S;  1R2Y A;  4X65 M;  3GPU A;  4PCZ A;  4DR7 M;  1Z5A A;  3U6P A;  1Q3B A;  4OX9 M;  4LF9 M;  2HKJ A;  3GQ5 A;  1HNX M;  3J81 S;  1L1Z A;  2UUB M;  1Z5C A;  2ZBK B;  1K82 A;  4DR1 M;  4X66 M;  4YY3 M;  3SAT A;  4B3T M;  5BR8 M;  1N36 M;  4B3R M;  1MX0 A;  2OQ4 A;  3U6C A;  4DV5 M;  2F5N A;  4AQY M;  2F5P A;  4B3M M;  1L2D A;  1XMO M;  5A2Q S;  4GKK M;  1XNQ M;  3VK8 A;  1KFV A;  4K0K M;  4DV7 M;  2F5Q A;  2ZM6 M;  3SAW A;  3JAM S;  4LFC M;  4CIS A;  4JYA M;  4DUZ M;  5ITQ A;  1IBL M;  3TWK A;  3U6D A;  4DR3 M;  5ITY A;  1TDH A;  3SAV A;  5LMU M;  3GP1 A;  2XZF A;  3A45 A;  1N32 M;  2F5S A;  3U6O A;  1IBM M;  4DR2 M;  4MB7 A;  2Q2E B;  1HNW M;  3DOA A;  1L2C A;  2XZU A;  3U6S A;  4LF5 M;  4DV3 M;  3A46 A;  1NNJ A;  5ITX A;  2UXC M;  4GKJ M;  2E5L M;  1XMQ M;  2EA0 A;  3SAU A;  5LMN M;  1TDZ A;  1XNR M;  4G4R A;  5ITX E;  4LF4 M;  1R2Z A;  3GQ4 A;  4NRV A;  1PJJ A;  4DV1 M;  1PM5 A;  1K3X A;  3TWL A;  5FLX S;  4NRW A;  4DR5 M;  3U6E A;  1FJG M;  1Q3C A;  1HNZ M;  4ITQ A;  1L2B A;  2UXD M;  2F4V M;  2HHH M;  1N33 M;  4DR4 M;  3GPX A;  5IWA M;  3A42 A;  1PJI A;  4B3S M;  3JR4 A;  4JI0 M; 
#chains in the Genus database with same CATH topology
 3J7A S;  3NBI A;  2DNA A;  4PT5 A;  2CWB A;  3U6L A;  2V1C A;  4WP2 A;  3SAS A;  3AOE A;  3GLH E;  1UFZ A;  4JV5 M;  1G3I A;  2CV0 A;  5EXP A;  2KDL A;  3B7Q A;  2DAM A;  3FUU A;  3LW5 F;  3T15 A;  2KNA A;  2FFJ A;  4W5W A;  3MJ5 A;  2R0I A;  2DAG A;  2FOI C;  5DFL A;  3QWL A;  4IIW A;  3CF2 A;  4CJ6 A;  1D0L A;  3WHK A;  2HAK A;  4L6V 6;  3ZC7 B;  2J7O A;  5BPV A;  5EP4 A;  1SXJ A;  2M60 A;  2W82 A;  4X64 M;  4AZF A;  1DGG A;  3JR5 A;  1IBK M;  1WXQ A;  1G4A E;  3T1Y M;  3VFD A;  3K9P A;  4WW0 A;  4LF6 M;  2OO9 A;  3C58 A;  2YQZ A;  3LCV B;  4KHP M;  3U60 A;  3TWM A;  5ITU A;  3W0F A;  2X49 A;  3FRH A;  4FCV A;  4LY6 A;  2F5O A;  1XHB A;  3RFW A;  4B08 A;  3MHV C;  2JZ1 A;  1HR0 M;  4G3O A;  1J5E M;  1LTM A;  2DWL A;  2L2D A;  3LMM A;  4DUY M;  1K3W A;  2UU9 M;  1VDL A;  1ZQ9 A;  2CUZ A;  3DA1 A;  4XBO A;  3U6P A;  1Q3B A;  1SXJ D;  2QCU A;  1YSY A;  4LF9 M;  3KXE C;  1EFU B;  3I4V A;  4GMQ A;  3UZU A;  3GLG E;  1VEJ A;  4X66 M;  4B3T M;  2EO2 A;  5BR8 M;  5KO3 A;  2DEN A;  1NHW C;  3AV0 A;  4DV5 M;  1MN3 A;  1TH2 A;  4B3M M;  3E46 A;  1OTR A;  1P3Q Q;  1XMO M;  2XGN A;  2YNM D;  3FE3 A;  3KVW A;  4IBC A;  1R6B X;  2CRU A;  3SMP A;  1W5S A;  4K0K M;  2KA6 B;  1HJP A;  2MRO B;  3QAU A;  4IBK A;  5KPT A;  5L8R F;  3SAW A;  2D7H A;  2MR9 A;  4I81 A;  4JYA M;  3GRV A;  3HWS A;  2C98 A;  5ITQ A;  3SHF A;  4LZZ A;  2J5Y A;  3LQQ A;  3SC3 A;  3GLF B;  5ITY A;  1TDH A;  1J7K A;  1YLA A;  3ZH9 B;  3TE6 A;  5LMU M;  3GP1 A;  3C9P A;  4P16 A;  5DYG A;  4I5S A;  3Q8X A;  3D8B A;  3U6O A;  4DR2 M;  4D82 A;  1MJG M;  4WUR A;  2BWB A;  2R44 A;  4P17 A;  3LCU A;  1WIV A;  2FH0 A;  3W0L B;  3B9P A;  3LQR A;  1R7R A;  3M6A A;  4LRT A;  2XZU A;  3HU1 A;  1HQY E;  1NNJ A;  3PXG A;  5ITX A;  1NO1 A;  4M9S A;  1IXZ A;  2EA0 A;  3U61 B;  1XMQ M;  2L4E A;  2MH8 A;  3J2P B;  1DO0 A;  2Y21 A;  4NRV A;  2N35 A;  2ZAN A;  2LVQ D;  2C96 A;  3L27 A;  1DO2 A;  5FTL A;  4NRW A;  2I7N A;  1OIP A;  1Q3C A;  2EKK A;  2EKF A;  4MGI E;  2KNV A;  1RU3 A;  2DZL A;  1QVR A;  2DAI A;  4DR4 M;  4MGK E;  4NSR A;  1SXJ C;  2L6O A;  2L7H A;  3B7N A;  1T3T A;  3GRR A;  4BBA A;  3KS8 A;  2DAE A;  1E9S A;  3L25 A;  4JI0 M;  3UK6 A;  5H37 D;  4LF7 M;  1PJS A;  2H5X A;  3KSX A;  2UXB M;  1PRB A;  1VEK A;  3HY5 A;  5IZ7 D;  4PD2 A;  5ITR A;  1GJS A;  3VLF B;  4DV2 M;  1IXS B;  4X62 M;  2XSZ A;  3TQS A;  3FYD A;  5FTK A;  3OTO M;  2AHM A;  3HX3 A;  2JWS A;  2DZN B;  4AG5 A;  4D81 A;  1I94 M;  3BXW A;  4JI5 M;  4NSO B;  2Z7J A;  1GO5 A;  2K0B X;  3U6M A;  4PDG A;  4KO8 A;  4DR6 M;  3GRY A;  1WGL A;  2C9C A;  2K9D A;  3LVW A;  3AOG A;  1V33 A;  3C3D A;  3KOW E;  2OPF A;  1OIZ A;  3T1H M;  4S12 A;  4LF8 M;  2V6Z M;  2R4E A;  2KXE A;  2RGO A;  4II7 A;  4NC6 A;  4F2L A;  2DWM A;  3CF6 E;  4QNR A;  4R7G A;  1IN4 A;  2L09 A;  4FW9 A;  4NXM M;  2RKO A;  4LZJ A;  4UN2 B;  5C1B A;  2XSZ D;  3GPY A;  3GLF A;  2QP9 X;  3GLI B;  4L78 A;  2CV1 A;  1NSF A;  4REZ A;  1TH3 A;  7CAT A;  1KYI A;  4D80 A;  4R71 A;  4FCT A;  1L8Q A;  2Z4S A;  3DFZ A;  3HZJ A;  1Q02 A;  3GLH B;  8CAT A;  2KZS A;  3HHX A;  1HT1 E;  4DV6 M;  1QYR A;  3U6Q A;  5FTM A;  4JXJ A;  4FWG A;  5JI3 E;  1OQY A;  4PCZ A;  3FUX A;  2G8L A;  4OX9 M;  5EP1 A;  1N78 A;  2HKJ A;  1PJT A;  4CGY B;  4Z6Y A;  1HNX M;  1L1Z A;  1QAN A;  1ZAE A;  3L2A A;  1VG5 A;  2ZBK B;  3U61 A;  2XEP A;  2XH9 A;  4LRS A;  1TH4 A;  1IN6 A;  4DR1 M;  3SAT A;  3GLI E;  1JR3 A;  2KRU A;  2OQ4 A;  2J7N A;  3KP1 E;  3NWL A;  3U6C A;  2F5N A;  1N77 A;  1L2D A;  4F1I A;  1H6U A;  1X37 A;  3FD9 A;  1JB0 F;  2LVA A;  1GAB A;  3MMP A;  3KFU G;  4NL4 H;  2F5Q A;  4L16 A;  2ZM6 M;  4CIS A;  2LH0 A;  1G71 A;  4A3V B;  3WHL A;  3I01 M;  2LTU A;  3FUT A;  4OW0 A;  3TWK A;  2JY8 A;  1IBL M;  2C99 A;  3E9S A;  3H4M A;  1J09 A;  3EIH A;  1ZMW A;  4KOD A;  4LCB A;  3W67 A;  3ZCB B;  3VKH A;  3W68 A;  4GC9 A;  3HKP A;  1N32 M;  1DV0 A;  1TGU A;  2VF7 A;  4RF1 A;  1IXS A;  1QAO A;  1SG9 A;  2KNZ A;  1GLN A;  1JR3 D;  3HJS A;  2XF3 A;  3BOS A;  3LVV A;  3FTE A;  4TUW A;  3DOA A;  2DHR A;  3GLG B;  4BLC A;  3U5Z B;  2Y0Q A;  3FUV A;  4DV3 M;  2R65 A;  2YR0 A;  2DWZ B;  3AL0 C;  2K47 A;  4M0W A;  1IY2 A;  4QOZ C;  4MM3 B;  1TDZ A;  2ZTC A;  4LJ7 A;  2ERC A;  4AI6 A;  4LF4 M;  2FE8 A;  2KEB A;  2KZU A;  1EIJ A;  1T6O A;  1PJJ A;  1K3X A;  3TWL A;  3CGW A;  2Z4R A;  1AIP C;  1WGN A;  3L26 A;  4QNM A;  3U6E A;  1NY5 A;  1FJG M;  4ITQ A;  1L2B A;  2HL7 A;  2UXD M;  3SYL A;  4GRI A;  2G5G X;  3GLI A;  4AKG A;  4FVM A;  5IWA M;  4B3S M;  2O25 A;  1GVN A;  2DAK A;  2EUC A;  3F92 A;  2CV2 A;  2MGW A;  3PNY A;  2CEA A;  1CUK A;  1GJT A;  4LGM A;  4Q7J A;  1C1K A;  1HNZ M;  1QUT A;  3GLH A;  3GPP A;  1IN7 A;  1OJL A;  2CFO A;  2GNO A;  3GQ3 A;  2UUA M;  3RGS A;  3VK7 A;  2VDB B;  1NHG C;  1LV7 A;  4FWH A;  4AW4 A;  1R5L A;  2JY6 B;  2LHC A;  1E9R A;  3AOE C;  2R62 A;  2JY7 A;  5KQD A;  3L28 A;  1N75 A;  1VEG A;  2LXE A;  1G8P A;  1W5T A;  1ZMU A;  2JUJ A;  2O01 F;  3J80 S;  3FUW A;  4CIZ A;  2D7E A;  1L1T A;  3M7G A;  1XXH B;  2C9O A;  5EP2 A;  3SBJ A;  2LNH C;  1V92 A;  3PNV A;  4HL4 A;  4AKH A;  1PGY A;  4LFB M;  2LVN C;  4IBE A;  4QHS A;  4GEW A;  4DV4 M;  4JI2 M;  2LVO C;  2VQF M;  2XFT A;  1ORY B;  4CHT B;  5FSW A;  1EE8 A;  1XC8 A;  3E21 A;  4KLN A;  4G4Q A;  1SXJ E;  3FYC A;  3FKE A;  4GIP A;  1OAI A;  3C3E A;  1MU5 A;  4LFA M;  4JI8 M;  5ITT A;  1BVS A;  1A5T A;  2RRU A;  4I4L A;  1OAO C;  2KHH A;  4I8O A;  4LJ8 A;  2FNA A;  4B7F A;  4M0D A;  4JI7 M;  1V34 A;  3PFI A;  5DNY A;  2M5Z A;  4AG6 A;  1TTE A;  2O5R A;  1NJF A;  2BWE A;  1GKI A;  3IEC A;  4JI1 M;  2Y20 A;  3FTD A;  4PDI A;  2QBY B;  4G4O A;  5IT9 S;  3GPU A;  4DR7 M;  1Z5A A;  3I4Y A;  3B7Z A;  3I04 M;  3HHZ A;  3GLG A;  3FTF A;  2CHG A;  5KPZ A;  3U5Z A;  5IRE B;  2X8A A;  3R9X B;  3T6P A;  3HHY A;  4M9Z A;  2UUB M;  2XFS A;  5FTN A;  2ZTD A;  3THG A;  1K82 A;  3RE8 A;  3BBZ A;  1MX0 A;  4MGY E;  1XB2 B;  3ILK A;  2CHQ A;  3SFZ A;  4AKI A;  1QZE A;  4L4U A;  2F5P A;  1XWI A;  2OOA A;  2RGH A;  4OVZ B;  4LJ9 A;  1XNQ M;  1ZV1 A;  3VK8 A;  1QAM A;  2VF8 A;  1E94 E;  2DI0 A;  5KPR A;  4LFC M;  2WSF F;  3KOX E;  4IBB A;  1HQC A;  2V1U A;  2DKL A;  2JNH A;  1QDT A;  3KOY E;  3U6D A;  1IY0 A;  2JY5 A;  3SAV A;  2WSC F;  2XZF A;  1Y8G A;  2BNK A;  4Y28 F;  2WZJ A;  4IBF A;  1NY6 A;  1D2N A;  3IG8 A;  1IBM M;  3B74 A;  3EIE A;  5DYI A;  2Q2E B;  2R6F A;  2JA2 A;  1T43 A;  3R8F A;  1HNW M;  1I4W A;  4LF5 M;  3H4J A;  3A46 A;  3K9O A;  2DXI A;  1GL6 A;  4GHL A;  4GKJ M;  2UXC M;  4LJA A;  3KW6 A;  1XXH A;  3AKZ A;  3DZD A;  2DHY A;  2KW0 A;  4HLQ A;  2E5L M;  2JZ0 A;  4JI4 M;  2GQF A;  3K2L A;  4OU7 A;  2DZO B;  5ITX E;  2MJ5 B;  2CP8 A;  4IJF A;  2XLJ A;  3GQ4 A;  2DWN A;  4LJ5 A;  1OKS A;  5FLX S;  4HEO A;  1YE9 A;  1PJQ A;  4DR5 M;  1C7Y A;  3UGJ A;  1IQP A;  1UM8 A;  1OFH A;  2QPA A;  3GPX A;  3AJI B;  4QHT A;  5E6J A;  2R45 A;  3K92 A;  3HU3 A;  1VQ1 A;  2R46 A;  4B7G A;  3JR4 A;  1Z5B A;  4LG2 A;  3FRI A;  5F3W A;  3B89 A;  2QBY A;  4DBG B;  3HGI A;  2Z8Y M;  1KSF X;  4YHH M;  4NXN M;  3E4R A;  1YUB A;  1NV9 A;  4LJ4 A;  4ZPX A;  5EXT A;  3HJ8 A;  2EJS A;  4MH0 E;  2LWX A;  3ZQJ A;  3L29 A;  1N34 M;  2LHG A;  1D0K A;  2D7G A;  1Q39 A;  4M9X A;  4DV0 M;  1AUA A;  1G41 A;  4RKU F;  4BB9 A;  4MGH A;  3SAR A;  4IBJ A;  4GH9 A;  3QYB A;  1DGH B;  4JN6 A;  4JI6 M;  3D8L A;  3K8Z A;  2DVW B;  4OVZ A;  2VQE M;  2UUC M;  4JI3 M;  4ANR A;  2L7I A;  4RF0 A;  2R4J A;  1NJG A;  2B3T A;  3AFH A;  3RGP A;  3FTC A;  2KRK A;  4IBG A;  1Z59 A;  2QZ4 A;  4MGZ E;  3T38 A;  4G4N A;  3J27 B;  4Z8X A;  4LJ6 A;  4FD2 A;  2JXN A;  5GKN A;  1TF0 B;  1HT2 E;  1OFI A;  3GLF E;  3KSJ A;  4FCW A;  5EXS A;  2QQ8 A;  2X4A A;  2QHO B;  1R2Y A;  4X65 M;  2LBC A;  2QNJ A;  3IG5 A;  3CTW B;  5KQ8 A;  4EIW A;  5JI2 E;  1VDD A;  1FNN A;  2ZAO A;  1TR8 A;  4FWD A;  2BJW A;  3GQ5 A;  3HHW A;  3J81 S;  1S3S A;  4NOO B;  1D0M A;  1Z5C A;  2QEN A;  1IM2 A;  1QDR A;  1QQW A;  2QSF X;  4GIT A;  4YY3 M;  1N36 M;  4IJE A;  4B3R M;  5EQT A;  3CF0 A;  2H1R A;  4AQY M;  2OOB A;  1JR3 E;  1SXJ B;  5A2Q S;  4GKK M;  1R4G A;  1QAQ A;  1KFV A;  3V76 A;  1GL7 A;  2A5Y B;  4L8R C;  4DV7 M;  3MK6 A;  2P5T A;  1XXH E;  1IN5 A;  3JAM S;  3U60 B;  2I7P A;  3K1J A;  3KDS E;  4DUZ M;  3HJQ A;  1G59 A;  2VII A;  4GHA A;  5EXX A;  4DR3 M;  1IN8 A;  3VDU A;  1DGB A;  4XGI A;  5C18 A;  1NV8 A;  4KT0 F;  2ZAM A;  5EJC A;  1IY1 A;  3A45 A;  3PVS A;  3SMS A;  2K6B A;  2F5S A;  1IXR C;  2C5R A;  1WR1 B;  5EP3 A;  1QZM A;  4MB7 A;  3HU2 A;  4IBI A;  5FTJ A;  3KP0 E;  3UJN A;  1L2C A;  1Z6T A;  5E26 A;  3U6S A;  3QYE A;  3TL4 X;  3KS4 A;  2Z3X A;  3IHP A;  2G3Q A;  3J7B A;  3VDP A;  1WHC A;  2CE7 A;  1NNU C;  3GRU A;  3SAU A;  4R3D A;  4XK8 F;  5LMN M;  2HCB A;  3KOZ E;  2NQ8 C;  4G4R A;  1XNR M;  1DGH A;  2BJV A;  3M0E A;  3NBX X;  4IBD A;  4QOS A;  1R2Z A;  2LVP C;  3Q8G A;  2WSE F;  4DV1 M;  1ZMV A;  3UMM A;  1PM5 A;  1F4I A;  2YFQ A;  4B7H A;  2APL A;  2FS1 A;  2Y0T A;  3SHG B;  3SYK A;  4RNA A;  3VKG A;  4GC5 A;  3TPZ A;  1QUS A;  4LGY A;  2F4V M;  4L15 A;  2R18 A;  1WJ7 A;  4G6Z A;  2HHH M;  1DGF A;  1N33 M;  1E32 A;  2L4F A;  3A42 A;  3A98 B;  1PJI A;  3I51 A;  1JQJ C;  2JP7 A;  1NVM A;  3GO8 A;  1IFY A;  2HWJ A;  2CHV A; 
#chains in the Genus database with same CATH homology
 3J7A S;  3NBI A;  4PT5 A;  3U6L A;  2V1C A;  3SAS A;  3AOE A;  4JV5 M;  1G3I A;  2CV0 A;  5EXP A;  3FUU A;  3T15 A;  2FFJ A;  4W5W A;  3MJ5 A;  4JI4 M;  2FOI C;  3QWL A;  4IIW A;  3CF2 A;  3WHK A;  3ZC7 B;  2J7O A;  5BPV A;  5EP4 A;  1SXJ A;  2M60 A;  2W82 A;  4X64 M;  4AZF A;  1DGG A;  3JR5 A;  1IBK M;  1WXQ A;  1G4A E;  3T1Y M;  3VFD A;  4WW0 A;  4LF6 M;  3C58 A;  2YQZ A;  4KHP M;  3U60 A;  3TWM A;  5ITU A;  3W0F A;  2X49 A;  4FCV A;  4LY6 A;  2F5O A;  1XHB A;  3RFW A;  4B08 A;  3MHV C;  1HR0 M;  1J5E M;  2DWL A;  3LMM A;  4DUY M;  1K3W A;  2UU9 M;  1ZQ9 A;  2CUZ A;  3DA1 A;  4XBO A;  3U6P A;  1Q3B A;  1SXJ D;  2QCU A;  1YSY A;  4LF9 M;  3KXE C;  3I4V A;  4GMQ A;  3UZU A;  4X66 M;  4B3T M;  2EO2 A;  5BR8 M;  5KO3 A;  1NHW C;  3AV0 A;  4DV5 M;  1TH2 A;  4B3M M;  1XMO M;  2XGN A;  2YNM D;  3KVW A;  4IBC A;  1R6B X;  3SMP A;  1W5S A;  4K0K M;  2KA6 B;  3QAU A;  4IBK A;  5KPT A;  3SAW A;  2D7H A;  4I81 A;  4JYA M;  3GRV A;  3HWS A;  2C98 A;  5ITQ A;  3SHF A;  4LZZ A;  3LQQ A;  3SC3 A;  3GLF B;  5ITY A;  1TDH A;  1J7K A;  3ZH9 B;  3TE6 A;  5LMU M;  3GP1 A;  4P16 A;  5DYG A;  4I5S A;  3Q8X A;  3D8B A;  3U6O A;  4DR2 M;  4D82 A;  4WUR A;  3W0L B;  3B9P A;  3LQR A;  1R7R A;  3M6A A;  4LRT A;  2XZU A;  3HU1 A;  1HQY E;  1NNJ A;  3PXG A;  5ITX A;  4M9S A;  1IXZ A;  2EA0 A;  3U61 B;  1XMQ M;  3J2P B;  1DO0 A;  2Y21 A;  4NRV A;  2ZAN A;  2C96 A;  3L27 A;  1DO2 A;  5FTL A;  4NRW A;  2I7N A;  1Q3C A;  4MGI E;  1QVR A;  4DR4 M;  4MGK E;  4NSR A;  1SXJ C;  2L6O A;  2L7H A;  4BBA A;  1T3T A;  3GRR A;  3KS8 A;  3L25 A;  1E9S A;  4JI0 M;  3UK6 A;  5H37 D;  4LF7 M;  2UXB M;  3KSX A;  5IZ7 D;  4PD2 A;  5ITR A;  3VLF B;  4DV2 M;  1IXS B;  4X62 M;  2XSZ A;  3TQS A;  3FYD A;  5FTK A;  3OTO M;  2AHM A;  4AG5 A;  2DZN B;  4D81 A;  1I94 M;  4JI5 M;  4NSO B;  2Z7J A;  3U6M A;  4PDG A;  4KO8 A;  4DR6 M;  3GRY A;  2C9C A;  3LVW A;  3AOG A;  3KOW E;  2OPF A;  3T1H M;  4S12 A;  4LF8 M;  2V6Z M;  2R4E A;  2KXE A;  2RGO A;  4II7 A;  2DWM A;  3CF6 E;  4QNR A;  4R7G A;  1IN4 A;  2L09 A;  4FW9 A;  4NXM M;  2RKO A;  4LZJ A;  5C1B A;  2XSZ D;  3GPY A;  3GLF A;  2QP9 X;  3GLI B;  4L78 A;  2CV1 A;  1NSF A;  4REZ A;  1TH3 A;  7CAT A;  1KYI A;  4D80 A;  4FCT A;  1L8Q A;  2Z4S A;  3DFZ A;  3GLH B;  8CAT A;  2KZS A;  3HHX A;  1HT1 E;  4DV6 M;  1QYR A;  3U6Q A;  5FTM A;  4JXJ A;  4FWG A;  5JI3 E;  4PCZ A;  3FUX A;  2G8L A;  4OX9 M;  5EP1 A;  1N78 A;  2HKJ A;  4CGY B;  1HNX M;  4Z6Y A;  1L1Z A;  1QAN A;  1ZAE A;  3L2A A;  2ZBK B;  3U61 A;  2XEP A;  2XH9 A;  4LRS A;  1TH4 A;  1IN6 A;  4DR1 M;  3SAT A;  1JR3 A;  2KRU A;  2OQ4 A;  2J7N A;  3KP1 E;  3NWL A;  3U6C A;  2F5N A;  1N77 A;  1L2D A;  1H6U A;  1X37 A;  3FD9 A;  3KFU G;  4NL4 H;  2F5Q A;  4L16 A;  2ZM6 M;  4CIS A;  2LH0 A;  4A3V B;  3WHL A;  3FUT A;  4OW0 A;  3TWK A;  1IBL M;  2C99 A;  3E9S A;  3H4M A;  1J09 A;  3EIH A;  4LCB A;  4KOD A;  3ZCB B;  3VKH A;  4GC9 A;  3HKP A;  1N32 M;  1TGU A;  4RF1 A;  1QAO A;  1GLN A;  1JR3 D;  3HJS A;  2XF3 A;  3BOS A;  3LVV A;  3FTE A;  4TUW A;  3DOA A;  2DHR A;  3GLG B;  4BLC A;  3U5Z B;  2Y0Q A;  3FUV A;  4DV3 M;  2R65 A;  2YR0 A;  2DWZ B;  3AL0 C;  2K47 A;  4M0W A;  1IY2 A;  4QOZ C;  4MM3 B;  1TDZ A;  4LJ7 A;  2ERC A;  4AI6 A;  4LF4 M;  2FE8 A;  2KEB A;  2KZU A;  1PJJ A;  1K3X A;  3TWL A;  2Z4R A;  3L26 A;  4QNM A;  3U6E A;  1NY5 A;  1FJG M;  4ITQ A;  1L2B A;  2HL7 A;  2UXD M;  3SYL A;  4GRI A;  2G5G X;  3GLI A;  4AKG A;  4FVM A;  5IWA M;  4B3S M;  1GVN A;  2EUC A;  2CV2 A;  3PNY A;  4LGM A;  2CEA A;  1HNW M;  1HNZ M;  1C1K A;  3GLH A;  3GPP A;  1IN7 A;  1OJL A;  2CFO A;  3GQ3 A;  2UUA M;  3RGS A;  3VK7 A;  1NHG C;  1LV7 A;  4FWH A;  4AW4 A;  1E9R A;  3AOE C;  2R62 A;  5KQD A;  3L28 A;  1N75 A;  2LXE A;  1G8P A;  1W5T A;  3J80 S;  1L1T A;  3FUW A;  2D7E A;  3M7G A;  1XXH B;  2C9O A;  5EP2 A;  3SBJ A;  2LNH C;  3PNV A;  4HL4 A;  4AKH A;  4LFB M;  4IBE A;  4QHS A;  4DV4 M;  4JI2 M;  2VQF M;  2XFT A;  1ORY B;  4CHT B;  5FSW A;  1EE8 A;  1XC8 A;  4KLN A;  4G4Q A;  1SXJ E;  3FYC A;  3FKE A;  4GIP A;  1MU5 A;  4LFA M;  4JI8 M;  5ITT A;  4B7F A;  4I4L A;  4LJ8 A;  4I8O A;  2FNA A;  4M0D A;  4JI7 M;  3PFI A;  5DNY A;  2M5Z A;  4AG6 A;  2O5R A;  1NJF A;  4JI1 M;  1GKI A;  2Y20 A;  3FTD A;  4PDI A;  2QBY B;  4G4O A;  5IT9 S;  3GPU A;  4DR7 M;  1Z5A A;  3I4Y A;  3HHZ A;  3GLG A;  3FTF A;  2CHG A;  5KPZ A;  3U5Z A;  5IRE B;  2X8A A;  3R9X B;  3HHY A;  4M9Z A;  2UUB M;  2XFS A;  5FTN A;  3THG A;  1K82 A;  3RE8 A;  1MX0 A;  4MGY E;  3ILK A;  2CHQ A;  3SFZ A;  4AKI A;  4L4U A;  2F5P A;  1XWI A;  2RGH A;  4OVZ B;  4LJ9 A;  1XNQ M;  3VK8 A;  1QAM A;  1E94 E;  5KPR A;  4LFC M;  3KOX E;  4IBB A;  1HQC A;  2V1U A;  3KOY E;  3U6D A;  1IY0 A;  3SAV A;  2XZF A;  2BNK A;  4IBF A;  1NY6 A;  1D2N A;  3IG8 A;  1IBM M;  3EIE A;  5DYI A;  2Q2E B;  2JA2 A;  3R8F A;  1I4W A;  4LF5 M;  3A46 A;  2DXI A;  1GL6 A;  4GHL A;  4GKJ M;  2UXC M;  4LJA A;  3KW6 A;  1XXH A;  3AKZ A;  3DZD A;  2KW0 A;  2E5L M;  4HLQ A;  3K2L A;  4OU7 A;  2DZO B;  5ITX E;  2XLJ A;  4IJF A;  3GQ4 A;  2DWN A;  4LJ5 A;  5FLX S;  1YE9 A;  4DR5 M;  3UGJ A;  1IQP A;  1UM8 A;  1OFH A;  2QPA A;  3GPX A;  3AJI B;  4QHT A;  5E6J A;  3K92 A;  2R45 A;  3HU3 A;  3JR4 A;  2R46 A;  4B7G A;  1Z5B A;  4LG2 A;  5F3W A;  2QBY A;  3HGI A;  1KSF X;  4YHH M;  4NXN M;  3E4R A;  1YUB A;  4LJ4 A;  4ZPX A;  5EXT A;  3HJ8 A;  4MH0 E;  2LWX A;  3L29 A;  1N34 M;  2D7G A;  1Q39 A;  4M9X A;  4DV0 M;  1G41 A;  4BB9 A;  4MGH A;  3SAR A;  4IBJ A;  4GH9 A;  1DGH B;  4JN6 A;  4JI6 M;  3D8L A;  3K8Z A;  2DVW B;  4OVZ A;  2VQE M;  2UUC M;  4JI3 M;  2L7I A;  4RF0 A;  2R4J A;  1NJG A;  3AFH A;  3RGP A;  3FTC A;  2KRK A;  4IBG A;  1Z59 A;  2QZ4 A;  4MGZ E;  3T38 A;  4G4N A;  3J27 B;  4Z8X A;  4LJ6 A;  4FD2 A;  5GKN A;  1HT2 E;  1OFI A;  3KSJ A;  4FCW A;  5EXS A;  2X4A A;  1R2Y A;  4X65 M;  3IG5 A;  3CTW B;  5KQ8 A;  4EIW A;  5JI2 E;  1VDD A;  1FNN A;  2ZAO A;  4FWD A;  2BJW A;  3GQ5 A;  3HHW A;  3J81 S;  1S3S A;  4NOO B;  1Z5C A;  2QEN A;  1IM2 A;  1QQW A;  4GIT A;  4YY3 M;  1N36 M;  4IJE A;  4B3R M;  5EQT A;  3CF0 A;  2H1R A;  4AQY M;  1SXJ B;  5A2Q S;  4GKK M;  1QAQ A;  1KFV A;  1GL7 A;  2A5Y B;  4L8R C;  4DV7 M;  3MK6 A;  2P5T A;  1IN5 A;  3JAM S;  3U60 B;  2I7P A;  3K1J A;  3KDS E;  4DUZ M;  3HJQ A;  1G59 A;  2VII A;  4GHA A;  5EXX A;  4DR3 M;  1IN8 A;  3VDU A;  1DGB A;  4XGI A;  5C18 A;  5EJC A;  2ZAM A;  1IY1 A;  3A45 A;  3PVS A;  3SMS A;  2F5S A;  1IXR C;  2C5R A;  5EP3 A;  1QZM A;  4MB7 A;  3HU2 A;  4IBI A;  5FTJ A;  3KP0 E;  3UJN A;  1L2C A;  1Z6T A;  5E26 A;  3U6S A;  3TL4 X;  3KS4 A;  2Z3X A;  3J7B A;  3VDP A;  2CE7 A;  1NNU C;  3GRU A;  3SAU A;  4R3D A;  5LMN M;  2HCB A;  3KOZ E;  2NQ8 C;  4G4R A;  1XNR M;  1DGH A;  3M0E A;  4IBD A;  1R2Z A;  4QOS A;  4DV1 M;  3UMM A;  1PM5 A;  2YFQ A;  4B7H A;  2Y0T A;  3SHG B;  3SYK A;  4RNA A;  3VKG A;  4GC5 A;  3TPZ A;  4LGY A;  2F4V M;  4L15 A;  2R18 A;  4G6Z A;  2HHH M;  1N33 M;  1DGF A;  1E32 A;  3A42 A;  3A98 B;  1PJI A;  3I51 A;  1JQJ C;  1NVM A;  3GO8 A;  2BJV A;  2CHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...