2F4VM

30s ribosome + designer antibiotic
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 22
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2f4vM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2f4vM02
2VQFM 4JV5M 5FLXS 5ITUA 4DV7M 3GQ4A 3A42A 3U6MA 2UXCM 3GPYA 3SAVA 4JI6M 4PDGA 5LMUM 1L1ZA 3SBJA 1L2CA 4LF7M 4MB7A 1HNWM 4B3SM 4LF9M 4GKJM 5IWAM 4CISA 1XC8A 2F5SA 4B3MM 3C58A 1XMQM 1EE8A 2OQ4A 1Q3CA 4DV5M 3T1YM 2F5NA 4JYAM 1Z5AA 4PCZA 5A2QS 5ITXE 4X64M 4YHHM 3U6QA 4YY3M 3U6OA 2F5PA 5LMNM 4DR1M 4G4NA 1TDZA 3TWKA 2UUBM 4LFCM 3W0FA 4PDIA 2XZUA 4DR7M 2XZFA 4OX9M 4G4OA 1XNRM 5ITTA 2VQEM 1PJJA 3GO8A 4NRWA 3VK8A 4DR2M 3SASA 2UUAM 2ZBKB 4PD2A 2F5OA 1TDHA 3TWLA 4JI4M 3VK7A 3A46A 3U6DA 2HKJA 4DV1M 1K3XA 4JI8M 4DR5M 4LF4M 1HNXM 4DR3M 3U6PA 4JI3M 1L1TA 2HHHM 4JI0M 1NNJA 1IBMM 3TWMA 3GPUA 5ITXA 1IBKM 2ZM6M 4DR6M 1XMOM 3T1HM 4DV0M 3U6SA 3J7AS 2Q2EB 1N33M 4X66M 3U6LA 1KFVA 4NXMM 4DUYM 1Z5CA 1L2DA 4DV4M 1MU5A 1N34M 1IBLM 4JI2M 4ITQA 4LF5M 3A45A 2EA0A 4B3TM 4DV2M 1I94M 3GQ3A 4X62M 4LFBM 4JI5M 2E5LM 3J81S 1Z5BA 1HR0M 4DV6M 3GQ5A 4K0KM 3GP1A 5ITRA 3DOAA 2UXBM 3JAMS 3SARA 1Q3BA 4NXNM 4KHPM 3OTOM 1N36M 1L2BA 1N32M 1HNZM 4GKKM 4DV3M 2UXDM 2F4VM 3GPXA 1J5EM 4LF8M 5ITQA 2OPFA 1Q39A 1XNQM 2UU9M 3SAWA 3JR4A 3U6CA 4LFAM 3GPPA 5BR8M 4DUZM 1K3WA 4G4QA 1R2ZA 2F5QA 3SAUA 1MX0A 4G4RA 1K82A 4AQYM 1PM5A 3J80S 4B3RM 4NRVA 4JI1M 3U6EA 4LF6M 3SATA 4JI7M 2UUCM 1PJIA 5IT9S 4DR4M 5ITYA 3JR5A 1R2YA 1FJGM 1Z59A 4X65M
chains in the Genus database with same CATH superfamily
1CUKA 1QAQA 2LBCA 3K9PA 5FLXS 1WR1B 2P5TA 2HWJA 3GQ4A 3LCUA 2LVNC 1TH4A 2JNHA 5EXXA 2FNAA 2V1CA 1NJGA 3Q8XA 3D8BA 1V33A 5FTMA 4LF9M 2JZ0A 3NBIA 4KODA 4GKJM 3B74A 4GEWA 1GVNA 1R5LA 1EFUB 1IXRC 1SXJA 2WSCF 1QZEA 2MROB 3H4JA 3LVVA 1Q3CA 4A3VB 4WP2A 3HHYA 3GLIE 1GL6A 3NWLA 2Z4SA 4PCZA 5A2QS 4PT5A 5ITXE 3U6QA 4YHHM 4FCTA 1VDDA 2EUCA 2R65A 3U5ZA 1YE9A 4GRIA 2F5PA 4EIWA 1QAMA 4IBIA 4AI6A 3J2PB 3PNYA 4CIZA 4DR1M 4FD2A 2UUBM 3TWKA 2DHYA 2K6BA 4ZPXA 4PDIA 2HAKA 4MGKE 2XZUA 2K47A 1NV8A 4OX9M 4G4OA 1E94E 3HGIA 4AZFA 2BJVA 3FE3A 3SC3A 3K1JA 4NRWA 4DR2M 3D8LA 4LRSA 3B89A 2ZBKB 4UN2B 3FUXA 4JI4M 3A46A 5EXTA 2HKJA 1QDTA 5IREB 2CFOA 4DV1M 3L25A 1GABA 4GMQA 2DWMA 3FTCA 3KOWE 4OVZB 2DZNB 2DVWB 3SYLA 1OAOC 4AW4A 2CHGA 2LVPC 3H4MA 4IBCA 4XGIA 1AUAA 4JI0M 2CE7A 2VF7A 2L7HA 1IBMM 3TWMA 1OTRA 3GRVA 4QNRA 1WHCA 1YUBA 2Z4RA 3U6SA 3QWLA 2K0BX 2QSFX 2Q2EB 3J7AS 3KS4A 1LV7A 3LQRA 3HJQA 5KO3A 2QPAA 4G6ZA 3TQSA 2WSEF 2EO2A 1HT2E 1DO2A 3I4YA 1HQYE 1VEGA 1MU5A 3SMPA 4MGYE 4F2LA 1UM8A 4DV4M 3U5ZB 4LF5M 1GKIA 2LHCA 3AL0C 4QOZC 2EA0A 4B3TM 1G59A 3GQ3A 2J7NA 3CF2A 1NY5A 4IBBA 4RKUF 3GLFA 3GLFE 2E5LM 2JWSA 2QZ4A 2LWXA 1NVMA 3GP1A 3SFZA 4RF1A 4S12A 1R6BX 3KSJA 3SARA 1Q3BA 1L8QA 2HL7A 1OAIA 3FYDA 4LJ6A 1GJTA 3OTOM 1L2BA 3E4RA 2DZLA 1PJIA 4GKKM 2UXDM 1JR3A 4LF8M 4FWDA 5BPVA 1R7RA 1Q39A 3DFZA 1XNQM 1NNUC 3RE8A 2BJWA 4CGYB 1T6OA 3L2AA 4B08A 1JB0F 4GC9A 2DAMA 2MJ5B 3GLHB 1I4WA 2LNHC 5FTNA 4BLCA 2VDBB 5H37D 5KPRA 1EIJA 3J80S 1PJTA 4XBOA 3U6EA 1V92A 2CV0A 4JI1M 1H6UA 2LH0A 2UUCM 5FTLA 2LTUA 1IN6A 1NO1A 5IT9S 1NY6A 5JI2E 2ZAOA 5DNYA 2KNVA 1OQYA 1FJGM 1Z59A 2CRUA 3LCVB 2O01F 3W0LB 2VQFM 3IHPA 3RFWA 1QUTA 2CHQA 2X4AA 5ITUA 2XLJA 4DV7M 5DYGA 3A42A 3U6MA 3KW6A 4QHTA 3F92A 1OFHA 3LW5F 4PDGA 3GLIB 4JI6M 2XEPA 2KA6B 4LJ9A 2R45A 5LMUM 2DKLA 3SMSA 4LF7M 3BXWA 3I4VA 4B3SM 1T43A 3M6AA 2R44A 2RGOA 5C1BA 3HHZA 2OOBA 4R7GA 1TF0B 4CISA 2FH0A 4B7HA 1TGUA 1XC8A 1DGGA 2WZJA 4L78A 3IECA 1XMQM 1EE8A 3GLGE 4NSRA 4DV5M 1TR8A 5F3WA 3LQQA 2LVOC 1SXJB 4KT0F 1MN3A 1DGFA 1PJQA 4NOOB 4BBAA 4YY3M 2KXEA 1SXJC 4B7FA 2B3TA 2CUZA 3KVWA 1AIPC 1R4GA 3THGA 5KQDA 2I7PA 4G4NA 4LFCM 2Z7JA 2M60A 1E9RA 4QOSA 1NJFA 3J7BA 4D82A 2DWLA 1XNRM 3AJIB 2CV2A 1PJJA 5EP4A 4AKHA 3T15A 2O5RA 1G4AE 5KPTA 5L8RF 2FFJA 2C9OA 4IBEA 3FUVA 4M9ZA 3SYKA 3VKHA 1TDHA 2DHRA 3VK7A 2L7IA 3C3EA 3SHGB 3HHXA 1IQPA 3VFDA 4IJFA 1K3XA 3HKPA 4JI8M 3AOGA 4LF4M 4IBJA 2KRUA 3VDUA 3U6PA 2L6OA 4JI3M 3ZCBB 3HWSA 4ANRA 2HHHM 4MGIE 5EP2A 2C98A 1WGNA 3GPUA 3CF6E 4L16A 4NC6A 3KOXE 2CHVA 4QNMA 2ZM6M 3GLFB 3T1HM 1WXQA 1IN4A 4MGZE 2KHHA 1VEKA 5E26A 4FWHA 3U6LA 3C3DA 1Z6TA 2GQFA 1ORYB 2R46A 2EJSA 2KNZA 2DWNA 1L2DA 4D81A 2L4EA 2AHMA 2YR0A 4R71A 1N34M 1VQ1A 4L6V6 4ITQA 3A45A 2JY7A 1X37A 2JY8A 3BOSA 1ZV1A 1G8PA 1KSFX 2JZ1A 4GH9A 4DV2M 2V1UA 2O25A 3T6PA 2KW0A 2MH8A 4DV6M 4RF0A 1N75A 1E32A 3CF0A 1IN8A 3FTEA 1DGHB 3GLHE 4KHPM 2QHOB 1N32M 4HEOA 4M0WA 5IZ7D 1HQCA 1S3SA 2XSZD 3RGPA 1ZMWA 1JR3E 1XHBA 2RKOA 4IIWA 2JXNA 2KZSA 2UU9M 3SAWA 1FNNA 3U6CA 4D80A 1GLNA 3PNVA 4LZJA 2KNAA 5BR8M 1N77A 4I4LA 2XSZA 1R2ZA 3SAUA 4LJ5A 1J09A 1E9SA 3FRHA 1K82A 1PM5A 3K2LA 3KOYE 2JY5A 4B3RM 3V76A 4JI7M 2VIIA 3FKEA 2N35A 4OVZA 2G3QA 2CP8A 2ZANA 3QYEA 4IBGA 2MR9A 4W5WA 1HJPA 5ITYA 3JR5A 3K9OA 1R2YA 4KLNA 4LG2A 3U6OA 4X65M 3AKZA 3WHKA 5DFLA 2F5OA 1DO0A 3UGJA 4AKGA 3L26A 1VEJA 1YSYA 2H5XA 5FTKA 2JUJA 1D0LA 3GPYA 1D0KA 4LRTA 1QAOA 4IBKA 3R8FA 1L1ZA 1BVSA 3SBJA 1L2CA 3C9PA 1GJSA 2DZOB 2J5YA 1G3IA 5IWAM 2Y20A 8CATA 1ZAEA 2L4FA 2QP9X 4LCBA 1HT1E 3ZC7B 2OQ4A 3VKGA 4L15A 3K92A 3T1YM 3GLIA 4JYAM 2XF3A 4KO8A 3GLHA 4X64M 1JQJC 2Y0QA 3MJ5A 4IBDA 1TH2A 1D0MA 4LGMA 5LMNM 2FE8A 2BNKA 4WW0A 3W0FA 2BWBA 2XZFA 1QZMA 4IJEA 3M0EA 3I04M 3UK6A 3B7NA 4OW0A 2OOAA 2CWBA 3B7ZA 4DBGB 4OU7A 2G8LA 4I81A 2R4JA 5EJCA 1D2NA 4LJ4A 2UUAM 3WHLA 3TWLA 3U60B 1NV9A 3U6DA 3MK6A 4F1IA 4TUWA 1PRBA 1XXHE 4FVMA 3GLGA 1TH3A 1SXJE 3HX3A 4GHLA 3TPZA 2YFQA 4M9XA 4BB9A 3VLFB 2R18A 1IFYA 5FSWA 3FUUA 1QUSA 2DWZB 1GL7A 4NSOB 3UMMA 5ITXA 1IBKM 1ZQ9A 3AV0A 3CTWB 3HZJA 5EP1A 4HLQA 1XMOM 2NQ8C 5KQ8A 3AOEA 3K8ZA 1N78A 1N33M 1KFVA 1IXSA 3FUWA 2EKKA 3HU3A 4DUYM 3HY5A 1F4IA 4JXJA 1QVRA 2DI0A 4JI2M 4GHAA 4IBFA 2CV1A 1I94M 1SG9A 2XFSA 2X49A 4DR4M 3E9SA 1DGHA 2DXIA 4K0KM 3AFHA 4LGYA 3GQ5A 3KP0E 3L28A 5ITRA 3DOAA 3DZDA 1OIPA 1MJGM 1QDRA 4AG5A 2DAGA 3JAMS 4P16A 4II7A 4CHTB 1N36M 1C7YA 2KDLA 1HNZM 3PFIA 4DV3M 4I5SA 3HHWA 3I01M 2F4VM 3J27B 3FRIA 2R6FA 3QYBA 2KEBA 2OO9A 2QBYA 1IM2A 1IY0A 2D7EA 1JR3D 3ZQJA 1K3WA 4QHSA 2F5QA 4G4RA 2J7OA 3HU2A 2I7NA 5EQTA 5EXSA 5KPZA 1XXHB 2QNJA 1RU3A 3LVWA 2W82A 4I8OA 2VF8A 3SATA 3EIHA 1GO5A 3FTDA 5FTJA 1PGYA 4NL4H 1Y8GA 1OIZA 1W5TA 4REZA 4R3DA 1WIVA 2RRUA 3KDSE 4JV5M 3M7GA 3HJSA 2FOIC 1IN7A 2UXCM 3SAVA 1LTMA 2BWEA 2C96A 3E21A 1OFIA 4AG6A 4B7GA 1NHGC 3IG8A 1IY1A 2Z8YM 4MB7A 1HNWM 3KXEC 3KSXA 2K9DA 1NHWC 1IY2A 3GRUA 2WSFF 4AKIA 1W5SA 2Y21A 4RNAA 3FTFA 4LJAA 2F5SA 2FS1A 1UFZA 3L27A 3C58A 4B3MM 2C9CA 2C99A 1OJLA 2Y0TA 3EIEA 3HU1A 2Z3XA 3A98B 4LJ8A 3MMPA 2F5NA 1Z5AA 1IN5A 2R4EA 1YLAA 4G3OA 1IXZA 4LZZA 2KZUA 3KOZE 1PJSA 2EKFA 2ZAMA 2QBYB 1A5TA 1TDZA 4MM3B 1VDLA 3W68A 2JY6B 2G5GX 1QQWA 4XK8F 3VDPA 4DR7M 4FWGA 1KYIA 1XXHA 5ITTA 2VQEM 2APLA 4JN6A 4Z6YA 4M0DA 1P3QQ 3GO8A 2GNOA 3VK8A 4MH0E 2LHGA 3DA1A 2QQ8A 3BBZA 4FCVA 3PXGA 2A5YB 3SASA 4PD2A 3CGWA 2DNAA 3AOEC 5EP3A 3U61A 1DV0A 2LVAA 3PVSA 2MGWA 4L4UA 2JP7A 1DGBA 3UZUA 3UJNA 1J7KA 2CEAA 2X8AA 2HCBA 4P17A 4DR5M 1HNXM 1QYRA 2V6ZM 4DR3M 3NBXX 4CJ6A 3FUTA 3W67A 3I51A 1L1TA 2YQZA 2XH9A 4M9SA 3TE6A 1NNJA 2R62A 1SXJD 4HL4A 5GKNA 4Q7JA 7CATA 4DR6M 2C5RA 2L09A 3IG5A 4DV0M 2RGHA 2YNMD 3LMMA 3ILKA 4X66M 3ZH9B 4NXMM 4GC5A 3RGSA 2L2DA 2JA2A 3U61B 3R9XB 1Z5CA 4MGHA 4FCWA 3B7QA 4Z8XA 1XWIA 1G41A 1ZMVA 1IBLM 1IXSB 2LVQD 3T38A 2XFTA 5C18A 4X62M 4L8RC 3TL4X 1ZMUA 4JI5M 4LFBM 2ERCA 4GIPA 3J81S 1Z5BA 2ZTDA 3B9PA 3U60A 1HR0M 4FW9A 1OKSA 2DENA 2UXBM 1V34A 1XB2B 2H1RA 2QENA 3Q8GA 4NXNM 4LY6A 5DYIA 2R0IA 3FD9A 3GPXA 1J5EM 5ITQA 2OPFA 3KS8A 2D7HA 3JR4A 5E6JA 1WGLA 3GRRA 4GITA 3KP1E 4LFAM 3GPPA 2ZTCA 4DUZM 2QCUA 3L29A 4G4QA 1MX0A 3QAUA 5EXPA 3SHFA 3GRYA 2DAKA 1WJ7A 4AQYM 4WURA 1T3TA 2D7GA 4LJ7A 4NRVA 3GLGB 2LXEA 4LF6M 2M5ZA 2KRKA 3E46A 1NSFA 1QANA 4Y28F 5JI3E 1Q02A 1G71A 2XGNA 3FYCA 1C1KA 2DAEA 2DAIA 3KFUG 1VG5A 3MHVC 3HJ8A 1TTEA
chains in the Genus database with same CATH topology
1QAQA 5FLXS 2P5TA 3GQ4A 1TH4A 5EXXA 2FNAA 2V1CA 1NJGA 3Q8XA 3D8BA 5FTMA 4LF9M 3NBIA 4KODA 4GKJM 1GVNA 1IXRC 1SXJA 3LVVA 1Q3CA 4A3VB 3HHYA 1GL6A 3NWLA 2Z4SA 4PCZA 5A2QS 4PT5A 5ITXE 3U6QA 4YHHM 4FCTA 1VDDA 2EUCA 2R65A 3U5ZA 1YE9A 4GRIA 2F5PA 4EIWA 1QAMA 4IBIA 4AI6A 3J2PB 3PNYA 4DR1M 4FD2A 2UUBM 3TWKA 4ZPXA 4PDIA 4MGKE 2XZUA 2K47A 4OX9M 4G4OA 1E94E 3HGIA 4AZFA 2BJVA 3SC3A 3K1JA 4NRWA 4DR2M 3D8LA 4LRSA 2ZBKB 3FUXA 4JI4M 3A46A 5EXTA 2HKJA 3L25A 5IREB 2CFOA 4DV1M 4GMQA 2DWMA 3KOWE 3FTCA 4OVZB 2DZNB 2DVWB 3SYLA 4AW4A 2CHGA 3H4MA 4IBCA 4XGIA 4JI0M 2CE7A 2L7HA 1IBMM 3TWMA 3GRVA 4QNRA 1YUBA 2Z4RA 3U6SA 3QWLA 3J7AS 2Q2EB 3KS4A 1LV7A 3LQRA 3HJQA 5KO3A 2QPAA 4G6ZA 3TQSA 2EO2A 1HT2E 1DO2A 3I4YA 1HQYE 3SMPA 1MU5A 4DV4M 4MGYE 1UM8A 3U5ZB 4LF5M 4QOZC 1GKIA 2EA0A 4B3TM 1G59A 3GQ3A 2J7NA 3CF2A 1NY5A 4IBBA 3GLFA 2E5LM 2QZ4A 2LWXA 1NVMA 3GP1A 3SFZA 4RF1A 4S12A 1R6BX 3KSJA 3SARA 1Q3BA 1L8QA 2HL7A 3FYDA 4LJ6A 3OTOM 1L2BA 3E4RA 4GKKM 2UXDM 1JR3A 4LF8M 4FWDA 5BPVA 1R7RA 1Q39A 3DFZA 1XNQM 1NNUC 3RE8A 2BJWA 4CGYB 3L2AA 4B08A 4GC9A 3GLHB 5FTNA 4BLCA 1I4WA 2LNHC 5H37D 5KPRA 3J80S 4XBOA 3U6EA 4JI1M 2CV0A 1H6UA 2LH0A 2UUCM 5FTLA 1IN6A 5IT9S 1NY6A 5JI2E 2ZAOA 5DNYA 1FJGM 1Z59A 3W0LB 2VQFM 3RFWA 2CHQA 2X4AA 5ITUA 2XLJA 4DV7M 5DYGA 3A42A 3U6MA 3KW6A 4QHTA 1OFHA 4PDGA 3GLIB 4JI6M 2XEPA 2KA6B 4LJ9A 2R45A 5LMUM 3SMSA 4LF7M 3I4VA 4B3SM 3M6AA 2RGOA 5C1BA 3HHZA 4R7GA 4CISA 4B7HA 1XC8A 1TGUA 1DGGA 4L78A 1XMQM 1EE8A 4NSRA 4DV5M 5F3WA 3LQQA 1SXJB 1DGFA 4NOOB 4BBAA 4YY3M 2KXEA 1SXJC 4B7FA 2CUZA 3KVWA 3THGA 5KQDA 2I7PA 4G4NA 4LFCM 2Z7JA 2M60A 1E9RA 4QOSA 1NJFA 3J7BA 4D82A 2DWLA 1XNRM 3AJIB 2CV2A 1PJJA 5EP4A 4AKHA 3T15A 2O5RA 1G4AE 5KPTA 2FFJA 2C9OA 4IBEA 3FUVA 4M9ZA 3SYKA 3VKHA 1TDHA 2DHRA 3VK7A 2L7IA 3SHGB 3HHXA 1IQPA 3VFDA 4IJFA 1K3XA 3HKPA 4JI8M 3AOGA 4LF4M 4IBJA 2KRUA 3VDUA 3U6PA 2L6OA 4JI3M 3ZCBB 3HWSA 2HHHM 4MGIE 5EP2A 2C98A 3GPUA 3CF6E 4L16A 4QNMA 3KOXE 2CHVA 2ZM6M 3GLFB 3T1HM 1WXQA 1IN4A 4MGZE 5E26A 4FWHA 3U6LA 1Z6TA 1ORYB 2R46A 2DWNA 1L2DA 4D81A 2AHMA 2YR0A 1N34M 4ITQA 3A45A 4GH9A 1X37A 3BOSA 4DV2M 1G8PA 1KSFX 2V1UA 2KW0A 4DV6M 4RF0A 1N75A 1E32A 3CF0A 1IN8A 3FTEA 1DGHB 4KHPM 1N32M 4M0WA 5IZ7D 1HQCA 1S3SA 2XSZD 3RGPA 1XHBA 2RKOA 4IIWA 2KZSA 2UU9M 3SAWA 1FNNA 3U6CA 4D80A 1GLNA 3PNVA 4LZJA 5BR8M 1N77A 4I4LA 2XSZA 1R2ZA 3SAUA 4LJ5A 1J09A 1E9SA 1K82A 1PM5A 3K2LA 3KOYE 4B3RM 4JI7M 2VIIA 3FKEA 4OVZA 1PJIA 2ZANA 4W5WA 4IBGA 3AL0C 4DR4M 5ITYA 3JR5A 1R2YA 4KLNA 4LG2A 3U6OA 4X65M 3AKZA 3WHKA 2F5OA 1DO0A 3UGJA 4AKGA 3L26A 1YSYA 5FTKA 3GPYA 4LRTA 1QAOA 4IBKA 3R8FA 1L1ZA 3SBJA 1L2CA 2DZOB 1G3IA 5IWAM 2Y20A 8CATA 1ZAEA 2QP9X 4LCBA 1HT1E 3ZC7B 2OQ4A 3VKGA 4L15A 3K92A 3T1YM 3GLIA 4JYAM 2XF3A 4KO8A 3GLHA 4X64M 1JQJC 2Y0QA 3MJ5A 4IBDA 1TH2A 4LGMA 5LMNM 2FE8A 2BNKA 4WW0A 3W0FA 2XZFA 1QZMA 4IJEA 3M0EA 3UK6A 4OW0A 4OU7A 2G8LA 4I81A 2R4JA 5EJCA 1D2NA 4LJ4A 2UUAM 3WHLA 3TWLA 3U60B 3U6DA 3MK6A 4TUWA 4FVMA 3GLGA 1TH3A 1SXJE 4GHLA 3TPZA 2YFQA 4M9XA 4BB9A 3VLFB 2R18A 5FSWA 3FUUA 2DWZB 1GL7A 4NSOB 3UMMA 5ITXA 1IBKM 1ZQ9A 3AV0A 3CTWB 5EP1A 4HLQA 1XMOM 2NQ8C 5KQ8A 3AOEA 3K8ZA 1N78A 1N33M 1KFVA 3FUWA 3HU3A 4DUYM 4JXJA 1QVRA 4JI2M 4GHAA 4IBFA 2CV1A 1I94M 2XFSA 3E9SA 1DGHA 2DXIA 4K0KM 3AFHA 4LGYA 3GQ5A 3KP0E 3L28A 5ITRA 3DOAA 3DZDA 4AG5A 3JAMS 4P16A 4II7A 4CHTB 1N36M 1HNZM 3PFIA 4DV3M 4I5SA 3HHWA 2F4VM 3J27B 2KEBA 2QBYA 1IM2A 1IY0A 2D7EA 1JR3D 1K3WA 4QHSA 2F5QA 4G4RA 2J7OA 3HU2A 2I7NA 5EQTA 5EXSA 5KPZA 1XXHB 3LVWA 2W82A 4I8OA 3SATA 3EIHA 3FTDA 5FTJA 4NL4H 1W5TA 4REZA 4R3DA 3KDSE 4JV5M 3M7GA 3HJSA 2FOIC 1IN7A 2UXCM 3SAVA 2C96A 1OFIA 4AG6A 4B7GA 1NHGC 3IG8A 1IY1A 4MB7A 1HNWM 3KXEC 3KSXA 1NHWC 1IY2A 3GRUA 4AKIA 1W5SA 2Y21A 4RNAA 3FTFA 4LJAA 2F5SA 3L27A 3C58A 4B3MM 2C9CA 2C99A 1OJLA 2Y0TA 3EIEA 3HU1A 2Z3XA 3A98B 4LJ8A 2F5NA 1Z5AA 1IN5A 2R4EA 1IXZA 4LZZA 2KZUA 3KOZE 2ZAMA 2QBYB 1TDZA 4MM3B 2G5GX 1QQWA 3VDPA 4DR7M 4FWGA 1KYIA 1XXHA 5ITTA 2VQEM 4JN6A 4Z6YA 4M0DA 3GO8A 3VK8A 4MH0E 3DA1A 3SASA 4FCVA 3PXGA 2A5YB 4PD2A 3U61A 3AOEC 5EP3A 3PVSA 4L4UA 3UZUA 1DGBA 3UJNA 1J7KA 2CEAA 2X8AA 2HCBA 4DR5M 1HNXM 1QYRA 2V6ZM 4DR3M 3FUTA 3I51A 1L1TA 2YQZA 2XH9A 4M9SA 3TE6A 1NNJA 2R62A 1SXJD 4HL4A 5GKNA 7CATA 4DR6M 2C5RA 2L09A 3IG5A 4DV0M 2RGHA 2YNMD 3LMMA 3ILKA 4X66M 3ZH9B 4NXMM 4GC5A 3RGSA 2JA2A 3U61B 3R9XB 1Z5CA 4MGHA 4FCWA 4Z8XA 1XWIA 1G41A 1IBLM 1IXSB 3T38A 2XFTA 5C18A 4X62M 4L8RC 3TL4X 4JI5M 4LFBM 2ERCA 4GIPA 3J81S 1Z5BA 3B9PA 3U60A 1HR0M 4FW9A 2UXBM 2H1RA 2QENA 4NXNM 4LY6A 5DYIA 3FD9A 3GPXA 1J5EM 5ITQA 2OPFA 3KS8A 2D7HA 3JR4A 5E6JA 3GRRA 4GITA 3KP1E 4LFAM 3GPPA 4DUZM 2QCUA 3L29A 4G4QA 1MX0A 3QAUA 5EXPA 3SHFA 3GRYA 4AQYM 4WURA 1T3TA 2D7GA 4LJ7A 4NRVA 3GLGB 2LXEA 4LF6M 2M5ZA 2KRKA 1NSFA 1QANA 5JI3E 2XGNA 3FYCA 1C1KA 3KFUG 2X49A 3MHVC 3HJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQF M;  4JV5 M;  5FLX S;  5ITU A;  4DV7 M;  3GQ4 A;  3A42 A;  3U6M A;  2UXC M;  3GPY A;  3SAV A;  4JI6 M;  4PDG A;  5LMU M;  1L1Z A;  3SBJ A;  1L2C A;  4LF7 M;  4MB7 A;  1HNW M;  4B3S M;  4LF9 M;  4GKJ M;  5IWA M;  4CIS A;  1XC8 A;  2F5S A;  4B3M M;  3C58 A;  1XMQ M;  1EE8 A;  2OQ4 A;  1Q3C A;  4DV5 M;  3T1Y M;  2F5N A;  4JYA M;  1Z5A A;  4PCZ A;  5A2Q S;  5ITX E;  4X64 M;  4YHH M;  3U6Q A;  4YY3 M;  3U6O A;  2F5P A;  5LMN M;  4DR1 M;  4G4N A;  1TDZ A;  3TWK A;  2UUB M;  4LFC M;  3W0F A;  4PDI A;  2XZU A;  4DR7 M;  2XZF A;  4OX9 M;  4G4O A;  1XNR M;  5ITT A;  2VQE M;  1PJJ A;  3GO8 A;  4NRW A;  3VK8 A;  4DR2 M;  3SAS A;  2UUA M;  2ZBK B;  4PD2 A;  2F5O A;  1TDH A;  3TWL A;  4JI4 M;  3VK7 A;  3A46 A;  3U6D A;  2HKJ A;  4DV1 M;  1K3X A;  4JI8 M;  4DR5 M;  4LF4 M;  1HNX M;  4DR3 M;  3U6P A;  4JI3 M;  1L1T A;  2HHH M;  4JI0 M;  1NNJ A;  1IBM M;  3TWM A;  3GPU A;  5ITX A;  1IBK M;  2ZM6 M;  4DR6 M;  1XMO M;  3T1H M;  4DV0 M;  3U6S A;  3J7A S;  2Q2E B;  1N33 M;  4X66 M;  3U6L A;  1KFV A;  4NXM M;  4DUY M;  1Z5C A;  1L2D A;  4DV4 M;  1MU5 A;  1N34 M;  1IBL M;  4JI2 M;  4ITQ A;  4LF5 M;  3A45 A;  2EA0 A;  4B3T M;  4DV2 M;  1I94 M;  3GQ3 A;  4X62 M;  4LFB M;  4JI5 M;  2E5L M;  3J81 S;  1Z5B A;  1HR0 M;  4DV6 M;  3GQ5 A;  4K0K M;  3GP1 A;  5ITR A;  3DOA A;  2UXB M;  3JAM S;  3SAR A;  1Q3B A;  4NXN M;  4KHP M;  3OTO M;  1N36 M;  1L2B A;  1N32 M;  1HNZ M;  4GKK M;  4DV3 M;  2UXD M;  2F4V M;  3GPX A;  1J5E M;  4LF8 M;  5ITQ A;  2OPF A;  1Q39 A;  1XNQ M;  2UU9 M;  3SAW A;  3JR4 A;  3U6C A;  4LFA M;  3GPP A;  5BR8 M;  4DUZ M;  1K3W A;  4G4Q A;  1R2Z A;  2F5Q A;  3SAU A;  1MX0 A;  4G4R A;  1K82 A;  4AQY M;  1PM5 A;  3J80 S;  4B3R M;  4NRV A;  4JI1 M;  3U6E A;  4LF6 M;  3SAT A;  4JI7 M;  2UUC M;  1PJI A;  5IT9 S;  4DR4 M;  5ITY A;  3JR5 A;  1R2Y A;  1FJG M;  1Z59 A;  4X65 M; 
#chains in the Genus database with same CATH topology
 1CUK A;  1QAQ A;  2LBC A;  3K9P A;  5FLX S;  1WR1 B;  2P5T A;  2HWJ A;  3GQ4 A;  3LCU A;  2LVN C;  1TH4 A;  2JNH A;  5EXX A;  2FNA A;  2V1C A;  1NJG A;  3Q8X A;  3D8B A;  1V33 A;  5FTM A;  4LF9 M;  2JZ0 A;  3NBI A;  4KOD A;  4GKJ M;  3B74 A;  4GEW A;  1GVN A;  1R5L A;  1EFU B;  1IXR C;  1SXJ A;  2WSC F;  1QZE A;  2MRO B;  3H4J A;  3LVV A;  1Q3C A;  4A3V B;  4WP2 A;  3HHY A;  3GLI E;  1GL6 A;  3NWL A;  2Z4S A;  4PCZ A;  5A2Q S;  4PT5 A;  5ITX E;  3U6Q A;  4YHH M;  4FCT A;  1VDD A;  2EUC A;  2R65 A;  3U5Z A;  1YE9 A;  4GRI A;  2F5P A;  4EIW A;  1QAM A;  4IBI A;  4AI6 A;  3J2P B;  3PNY A;  4CIZ A;  4DR1 M;  4FD2 A;  2UUB M;  3TWK A;  2DHY A;  2K6B A;  4ZPX A;  4PDI A;  2HAK A;  4MGK E;  2XZU A;  2K47 A;  1NV8 A;  4OX9 M;  4G4O A;  1E94 E;  3HGI A;  4AZF A;  2BJV A;  3FE3 A;  3SC3 A;  3K1J A;  4NRW A;  4DR2 M;  3D8L A;  4LRS A;  3B89 A;  2ZBK B;  4UN2 B;  3FUX A;  4JI4 M;  3A46 A;  5EXT A;  2HKJ A;  1QDT A;  5IRE B;  2CFO A;  4DV1 M;  3L25 A;  1GAB A;  4GMQ A;  2DWM A;  3FTC A;  3KOW E;  4OVZ B;  2DZN B;  2DVW B;  3SYL A;  1OAO C;  4AW4 A;  2CHG A;  2LVP C;  3H4M A;  4IBC A;  4XGI A;  1AUA A;  4JI0 M;  2CE7 A;  2VF7 A;  2L7H A;  1IBM M;  3TWM A;  1OTR A;  3GRV A;  4QNR A;  1WHC A;  1YUB A;  2Z4R A;  3U6S A;  3QWL A;  2K0B X;  2QSF X;  2Q2E B;  3J7A S;  3KS4 A;  1LV7 A;  3LQR A;  3HJQ A;  5KO3 A;  2QPA A;  4G6Z A;  3TQS A;  2WSE F;  2EO2 A;  1HT2 E;  1DO2 A;  3I4Y A;  1HQY E;  1VEG A;  1MU5 A;  3SMP A;  4MGY E;  4F2L A;  1UM8 A;  4DV4 M;  3U5Z B;  4LF5 M;  1GKI A;  2LHC A;  3AL0 C;  4QOZ C;  2EA0 A;  4B3T M;  1G59 A;  3GQ3 A;  2J7N A;  3CF2 A;  1NY5 A;  4IBB A;  4RKU F;  3GLF A;  3GLF E;  2E5L M;  2JWS A;  2QZ4 A;  2LWX A;  1NVM A;  3GP1 A;  3SFZ A;  4RF1 A;  4S12 A;  1R6B X;  3KSJ A;  3SAR A;  1Q3B A;  1L8Q A;  2HL7 A;  1OAI A;  3FYD A;  4LJ6 A;  1GJT A;  3OTO M;  1L2B A;  3E4R A;  2DZL A;  1PJI A;  4GKK M;  2UXD M;  1JR3 A;  4LF8 M;  4FWD A;  5BPV A;  1R7R A;  1Q39 A;  3DFZ A;  1XNQ M;  1NNU C;  3RE8 A;  2BJW A;  4CGY B;  1T6O A;  3L2A A;  4B08 A;  1JB0 F;  4GC9 A;  2DAM A;  2MJ5 B;  3GLH B;  1I4W A;  2LNH C;  5FTN A;  4BLC A;  2VDB B;  5H37 D;  5KPR A;  1EIJ A;  3J80 S;  1PJT A;  4XBO A;  3U6E A;  1V92 A;  2CV0 A;  4JI1 M;  1H6U A;  2LH0 A;  2UUC M;  5FTL A;  2LTU A;  1IN6 A;  1NO1 A;  5IT9 S;  1NY6 A;  5JI2 E;  2ZAO A;  5DNY A;  2KNV A;  1OQY A;  1FJG M;  1Z59 A;  2CRU A;  3LCV B;  2O01 F;  3W0L B;  2VQF M;  3IHP A;  3RFW A;  1QUT A;  2CHQ A;  2X4A A;  5ITU A;  2XLJ A;  4DV7 M;  5DYG A;  3A42 A;  3U6M A;  3KW6 A;  4QHT A;  3F92 A;  1OFH A;  3LW5 F;  4PDG A;  3GLI B;  4JI6 M;  2XEP A;  2KA6 B;  4LJ9 A;  2R45 A;  5LMU M;  2DKL A;  3SMS A;  4LF7 M;  3BXW A;  3I4V A;  4B3S M;  1T43 A;  3M6A A;  2R44 A;  2RGO A;  5C1B A;  3HHZ A;  2OOB A;  4R7G A;  1TF0 B;  4CIS A;  2FH0 A;  4B7H A;  1TGU A;  1XC8 A;  1DGG A;  2WZJ A;  4L78 A;  3IEC A;  1XMQ M;  1EE8 A;  3GLG E;  4NSR A;  4DV5 M;  1TR8 A;  5F3W A;  3LQQ A;  2LVO C;  1SXJ B;  4KT0 F;  1MN3 A;  1DGF A;  1PJQ A;  4NOO B;  4BBA A;  4YY3 M;  2KXE A;  1SXJ C;  4B7F A;  2B3T A;  2CUZ A;  3KVW A;  1AIP C;  1R4G A;  3THG A;  5KQD A;  2I7P A;  4G4N A;  4LFC M;  2Z7J A;  2M60 A;  1E9R A;  4QOS A;  1NJF A;  3J7B A;  4D82 A;  2DWL A;  1XNR M;  3AJI B;  2CV2 A;  1PJJ A;  5EP4 A;  4AKH A;  3T15 A;  2O5R A;  1G4A E;  5KPT A;  5L8R F;  2FFJ A;  2C9O A;  4IBE A;  3FUV A;  4M9Z A;  3SYK A;  3VKH A;  1TDH A;  2DHR A;  3VK7 A;  2L7I A;  3C3E A;  3SHG B;  3HHX A;  1IQP A;  3VFD A;  4IJF A;  1K3X A;  3HKP A;  4JI8 M;  3AOG A;  4LF4 M;  4IBJ A;  2KRU A;  3VDU A;  3U6P A;  2L6O A;  4JI3 M;  3ZCB B;  3HWS A;  4ANR A;  2HHH M;  4MGI E;  5EP2 A;  2C98 A;  1WGN A;  3GPU A;  3CF6 E;  4L16 A;  4NC6 A;  3KOX E;  2CHV A;  4QNM A;  2ZM6 M;  3GLF B;  3T1H M;  1WXQ A;  1IN4 A;  4MGZ E;  2KHH A;  1VEK A;  5E26 A;  4FWH A;  3U6L A;  3C3D A;  1Z6T A;  2GQF A;  1ORY B;  2R46 A;  2EJS A;  2KNZ A;  2DWN A;  1L2D A;  4D81 A;  2L4E A;  2AHM A;  2YR0 A;  4R71 A;  1N34 M;  1VQ1 A;  4L6V 6;  4ITQ A;  3A45 A;  2JY7 A;  1X37 A;  2JY8 A;  3BOS A;  1ZV1 A;  1G8P A;  1KSF X;  2JZ1 A;  4GH9 A;  4DV2 M;  2V1U A;  2O25 A;  3T6P A;  2KW0 A;  2MH8 A;  4DV6 M;  4RF0 A;  1N75 A;  1E32 A;  3CF0 A;  1IN8 A;  3FTE A;  1DGH B;  3GLH E;  4KHP M;  2QHO B;  1N32 M;  4HEO A;  4M0W A;  5IZ7 D;  1HQC A;  1S3S A;  2XSZ D;  3RGP A;  1ZMW A;  1JR3 E;  1XHB A;  2RKO A;  4IIW A;  2JXN A;  2KZS A;  2UU9 M;  3SAW A;  1FNN A;  3U6C A;  4D80 A;  1GLN A;  3PNV A;  4LZJ A;  2KNA A;  5BR8 M;  1N77 A;  4I4L A;  2XSZ A;  1R2Z A;  3SAU A;  4LJ5 A;  1J09 A;  1E9S A;  3FRH A;  1K82 A;  1PM5 A;  3K2L A;  3KOY E;  2JY5 A;  4B3R M;  3V76 A;  4JI7 M;  2VII A;  3FKE A;  2N35 A;  4OVZ A;  2G3Q A;  2CP8 A;  2ZAN A;  3QYE A;  4IBG A;  2MR9 A;  4W5W A;  1HJP A;  5ITY A;  3JR5 A;  3K9O A;  1R2Y A;  4KLN A;  4LG2 A;  3U6O A;  4X65 M;  3AKZ A;  3WHK A;  5DFL A;  2F5O A;  1DO0 A;  3UGJ A;  4AKG A;  3L26 A;  1VEJ A;  1YSY A;  2H5X A;  5FTK A;  2JUJ A;  1D0L A;  3GPY A;  1D0K A;  4LRT A;  1QAO A;  4IBK A;  3R8F A;  1L1Z A;  1BVS A;  3SBJ A;  1L2C A;  3C9P A;  1GJS A;  2DZO B;  2J5Y A;  1G3I A;  5IWA M;  2Y20 A;  8CAT A;  1ZAE A;  2L4F A;  2QP9 X;  4LCB A;  1HT1 E;  3ZC7 B;  2OQ4 A;  3VKG A;  4L15 A;  3K92 A;  3T1Y M;  3GLI A;  4JYA M;  2XF3 A;  4KO8 A;  3GLH A;  4X64 M;  1JQJ C;  2Y0Q A;  3MJ5 A;  4IBD A;  1TH2 A;  1D0M A;  4LGM A;  5LMN M;  2FE8 A;  2BNK A;  4WW0 A;  3W0F A;  2BWB A;  2XZF A;  1QZM A;  4IJE A;  3M0E A;  3I04 M;  3UK6 A;  3B7N A;  4OW0 A;  2OOA A;  2CWB A;  3B7Z A;  4DBG B;  4OU7 A;  2G8L A;  4I81 A;  2R4J A;  5EJC A;  1D2N A;  4LJ4 A;  2UUA M;  3WHL A;  3TWL A;  3U60 B;  1NV9 A;  3U6D A;  3MK6 A;  4F1I A;  4TUW A;  1PRB A;  1XXH E;  4FVM A;  3GLG A;  1TH3 A;  1SXJ E;  3HX3 A;  4GHL A;  3TPZ A;  2YFQ A;  4M9X A;  4BB9 A;  3VLF B;  2R18 A;  1IFY A;  5FSW A;  3FUU A;  1QUS A;  2DWZ B;  1GL7 A;  4NSO B;  3UMM A;  5ITX A;  1IBK M;  1ZQ9 A;  3AV0 A;  3CTW B;  3HZJ A;  5EP1 A;  4HLQ A;  1XMO M;  2NQ8 C;  5KQ8 A;  3AOE A;  3K8Z A;  1N78 A;  1N33 M;  1KFV A;  1IXS A;  3FUW A;  2EKK A;  3HU3 A;  4DUY M;  3HY5 A;  1F4I A;  4JXJ A;  1QVR A;  2DI0 A;  4JI2 M;  4GHA A;  4IBF A;  2CV1 A;  1I94 M;  1SG9 A;  2XFS A;  2X49 A;  4DR4 M;  3E9S A;  1DGH A;  2DXI A;  4K0K M;  3AFH A;  4LGY A;  3GQ5 A;  3KP0 E;  3L28 A;  5ITR A;  3DOA A;  3DZD A;  1OIP A;  1MJG M;  1QDR A;  4AG5 A;  2DAG A;  3JAM S;  4P16 A;  4II7 A;  4CHT B;  1N36 M;  1C7Y A;  2KDL A;  1HNZ M;  3PFI A;  4DV3 M;  4I5S A;  3HHW A;  3I01 M;  2F4V M;  3J27 B;  3FRI A;  2R6F A;  3QYB A;  2KEB A;  2OO9 A;  2QBY A;  1IM2 A;  1IY0 A;  2D7E A;  1JR3 D;  3ZQJ A;  1K3W A;  4QHS A;  2F5Q A;  4G4R A;  2J7O A;  3HU2 A;  2I7N A;  5EQT A;  5EXS A;  5KPZ A;  1XXH B;  2QNJ A;  1RU3 A;  3LVW A;  2W82 A;  4I8O A;  2VF8 A;  3SAT A;  3EIH A;  1GO5 A;  3FTD A;  5FTJ A;  1PGY A;  4NL4 H;  1Y8G A;  1OIZ A;  1W5T A;  4REZ A;  4R3D A;  1WIV A;  2RRU A;  3KDS E;  4JV5 M;  3M7G A;  3HJS A;  2FOI C;  1IN7 A;  2UXC M;  3SAV A;  1LTM A;  2BWE A;  2C96 A;  3E21 A;  1OFI A;  4AG6 A;  4B7G A;  1NHG C;  3IG8 A;  1IY1 A;  2Z8Y M;  4MB7 A;  1HNW M;  3KXE C;  3KSX A;  2K9D A;  1NHW C;  1IY2 A;  3GRU A;  2WSF F;  4AKI A;  1W5S A;  2Y21 A;  4RNA A;  3FTF A;  4LJA A;  2F5S A;  2FS1 A;  1UFZ A;  3L27 A;  3C58 A;  4B3M M;  2C9C A;  2C99 A;  1OJL A;  2Y0T A;  3EIE A;  3HU1 A;  2Z3X A;  3A98 B;  4LJ8 A;  3MMP A;  2F5N A;  1Z5A A;  1IN5 A;  2R4E A;  1YLA A;  4G3O A;  1IXZ A;  4LZZ A;  2KZU A;  3KOZ E;  1PJS A;  2EKF A;  2ZAM A;  2QBY B;  1A5T A;  1TDZ A;  4MM3 B;  1VDL A;  3W68 A;  2JY6 B;  2G5G X;  1QQW A;  4XK8 F;  3VDP A;  4DR7 M;  4FWG A;  1KYI A;  1XXH A;  5ITT A;  2VQE M;  2APL A;  4JN6 A;  4Z6Y A;  4M0D A;  1P3Q Q;  3GO8 A;  2GNO A;  3VK8 A;  4MH0 E;  2LHG A;  3DA1 A;  2QQ8 A;  3BBZ A;  4FCV A;  3PXG A;  2A5Y B;  3SAS A;  4PD2 A;  3CGW A;  2DNA A;  3AOE C;  5EP3 A;  3U61 A;  1DV0 A;  2LVA A;  3PVS A;  2MGW A;  4L4U A;  2JP7 A;  1DGB A;  3UZU A;  3UJN A;  1J7K A;  2CEA A;  2X8A A;  2HCB A;  4P17 A;  4DR5 M;  1HNX M;  1QYR A;  2V6Z M;  4DR3 M;  3NBX X;  4CJ6 A;  3FUT A;  3W67 A;  3I51 A;  1L1T A;  2YQZ A;  2XH9 A;  4M9S A;  3TE6 A;  1NNJ A;  2R62 A;  1SXJ D;  4HL4 A;  5GKN A;  4Q7J A;  7CAT A;  4DR6 M;  2C5R A;  2L09 A;  3IG5 A;  4DV0 M;  2RGH A;  2YNM D;  3LMM A;  3ILK A;  4X66 M;  3ZH9 B;  4NXM M;  4GC5 A;  3RGS A;  2L2D A;  2JA2 A;  3U61 B;  3R9X B;  1Z5C A;  4MGH A;  4FCW A;  3B7Q A;  4Z8X A;  1XWI A;  1G41 A;  1ZMV A;  1IBL M;  1IXS B;  2LVQ D;  3T38 A;  2XFT A;  5C18 A;  4X62 M;  4L8R C;  3TL4 X;  1ZMU A;  4JI5 M;  4LFB M;  2ERC A;  4GIP A;  3J81 S;  1Z5B A;  2ZTD A;  3B9P A;  3U60 A;  1HR0 M;  4FW9 A;  1OKS A;  2DEN A;  2UXB M;  1V34 A;  1XB2 B;  2H1R A;  2QEN A;  3Q8G A;  4NXN M;  4LY6 A;  5DYI A;  2R0I A;  3FD9 A;  3GPX A;  1J5E M;  5ITQ A;  2OPF A;  3KS8 A;  2D7H A;  3JR4 A;  5E6J A;  1WGL A;  3GRR A;  4GIT A;  3KP1 E;  4LFA M;  3GPP A;  2ZTC A;  4DUZ M;  2QCU A;  3L29 A;  4G4Q A;  1MX0 A;  3QAU A;  5EXP A;  3SHF A;  3GRY A;  2DAK A;  1WJ7 A;  4AQY M;  4WUR A;  1T3T A;  2D7G A;  4LJ7 A;  4NRV A;  3GLG B;  2LXE A;  4LF6 M;  2M5Z A;  2KRK A;  3E46 A;  1NSF A;  1QAN A;  4Y28 F;  5JI3 E;  1Q02 A;  1G71 A;  2XGN A;  3FYC A;  1C1K A;  2DAE A;  2DAI A;  3KFU G;  1VG5 A;  3MHV C;  3HJ8 A;  1TTE A; 
#chains in the Genus database with same CATH homology
 1QAQ A;  5FLX S;  2P5T A;  3GQ4 A;  1TH4 A;  5EXX A;  2FNA A;  2V1C A;  1NJG A;  3Q8X A;  3D8B A;  5FTM A;  4LF9 M;  3NBI A;  4KOD A;  4GKJ M;  1GVN A;  1IXR C;  1SXJ A;  3LVV A;  1Q3C A;  4A3V B;  3HHY A;  1GL6 A;  3NWL A;  2Z4S A;  4PCZ A;  5A2Q S;  4PT5 A;  5ITX E;  3U6Q A;  4YHH M;  4FCT A;  1VDD A;  2EUC A;  2R65 A;  3U5Z A;  1YE9 A;  4GRI A;  2F5P A;  4EIW A;  1QAM A;  4IBI A;  4AI6 A;  3J2P B;  3PNY A;  4DR1 M;  4FD2 A;  2UUB M;  3TWK A;  4ZPX A;  4PDI A;  4MGK E;  2XZU A;  2K47 A;  4OX9 M;  4G4O A;  1E94 E;  3HGI A;  4AZF A;  2BJV A;  3SC3 A;  3K1J A;  4NRW A;  4DR2 M;  3D8L A;  4LRS A;  2ZBK B;  3FUX A;  4JI4 M;  3A46 A;  5EXT A;  2HKJ A;  3L25 A;  5IRE B;  2CFO A;  4DV1 M;  4GMQ A;  2DWM A;  3KOW E;  3FTC A;  4OVZ B;  2DZN B;  2DVW B;  3SYL A;  4AW4 A;  2CHG A;  3H4M A;  4IBC A;  4XGI A;  4JI0 M;  2CE7 A;  2L7H A;  1IBM M;  3TWM A;  3GRV A;  4QNR A;  1YUB A;  2Z4R A;  3U6S A;  3QWL A;  3J7A S;  2Q2E B;  3KS4 A;  1LV7 A;  3LQR A;  3HJQ A;  5KO3 A;  2QPA A;  4G6Z A;  3TQS A;  2EO2 A;  1HT2 E;  1DO2 A;  3I4Y A;  1HQY E;  3SMP A;  1MU5 A;  4DV4 M;  4MGY E;  1UM8 A;  3U5Z B;  4LF5 M;  4QOZ C;  1GKI A;  2EA0 A;  4B3T M;  1G59 A;  3GQ3 A;  2J7N A;  3CF2 A;  1NY5 A;  4IBB A;  3GLF A;  2E5L M;  2QZ4 A;  2LWX A;  1NVM A;  3GP1 A;  3SFZ A;  4RF1 A;  4S12 A;  1R6B X;  3KSJ A;  3SAR A;  1Q3B A;  1L8Q A;  2HL7 A;  3FYD A;  4LJ6 A;  3OTO M;  1L2B A;  3E4R A;  4GKK M;  2UXD M;  1JR3 A;  4LF8 M;  4FWD A;  5BPV A;  1R7R A;  1Q39 A;  3DFZ A;  1XNQ M;  1NNU C;  3RE8 A;  2BJW A;  4CGY B;  3L2A A;  4B08 A;  4GC9 A;  3GLH B;  5FTN A;  4BLC A;  1I4W A;  2LNH C;  5H37 D;  5KPR A;  3J80 S;  4XBO A;  3U6E A;  4JI1 M;  2CV0 A;  1H6U A;  2LH0 A;  2UUC M;  5FTL A;  1IN6 A;  5IT9 S;  1NY6 A;  5JI2 E;  2ZAO A;  5DNY A;  1FJG M;  1Z59 A;  3W0L B;  2VQF M;  3RFW A;  2CHQ A;  2X4A A;  5ITU A;  2XLJ A;  4DV7 M;  5DYG A;  3A42 A;  3U6M A;  3KW6 A;  4QHT A;  1OFH A;  4PDG A;  3GLI B;  4JI6 M;  2XEP A;  2KA6 B;  4LJ9 A;  2R45 A;  5LMU M;  3SMS A;  4LF7 M;  3I4V A;  4B3S M;  3M6A A;  2RGO A;  5C1B A;  3HHZ A;  4R7G A;  4CIS A;  4B7H A;  1XC8 A;  1TGU A;  1DGG A;  4L78 A;  1XMQ M;  1EE8 A;  4NSR A;  4DV5 M;  5F3W A;  3LQQ A;  1SXJ B;  1DGF A;  4NOO B;  4BBA A;  4YY3 M;  2KXE A;  1SXJ C;  4B7F A;  2CUZ A;  3KVW A;  3THG A;  5KQD A;  2I7P A;  4G4N A;  4LFC M;  2Z7J A;  2M60 A;  1E9R A;  4QOS A;  1NJF A;  3J7B A;  4D82 A;  2DWL A;  1XNR M;  3AJI B;  2CV2 A;  1PJJ A;  5EP4 A;  4AKH A;  3T15 A;  2O5R A;  1G4A E;  5KPT A;  2FFJ A;  2C9O A;  4IBE A;  3FUV A;  4M9Z A;  3SYK A;  3VKH A;  1TDH A;  2DHR A;  3VK7 A;  2L7I A;  3SHG B;  3HHX A;  1IQP A;  3VFD A;  4IJF A;  1K3X A;  3HKP A;  4JI8 M;  3AOG A;  4LF4 M;  4IBJ A;  2KRU A;  3VDU A;  3U6P A;  2L6O A;  4JI3 M;  3ZCB B;  3HWS A;  2HHH M;  4MGI E;  5EP2 A;  2C98 A;  3GPU A;  3CF6 E;  4L16 A;  4QNM A;  3KOX E;  2CHV A;  2ZM6 M;  3GLF B;  3T1H M;  1WXQ A;  1IN4 A;  4MGZ E;  5E26 A;  4FWH A;  3U6L A;  1Z6T A;  1ORY B;  2R46 A;  2DWN A;  1L2D A;  4D81 A;  2AHM A;  2YR0 A;  1N34 M;  4ITQ A;  3A45 A;  4GH9 A;  1X37 A;  3BOS A;  4DV2 M;  1G8P A;  1KSF X;  2V1U A;  2KW0 A;  4DV6 M;  4RF0 A;  1N75 A;  1E32 A;  3CF0 A;  1IN8 A;  3FTE A;  1DGH B;  4KHP M;  1N32 M;  4M0W A;  5IZ7 D;  1HQC A;  1S3S A;  2XSZ D;  3RGP A;  1XHB A;  2RKO A;  4IIW A;  2KZS A;  2UU9 M;  3SAW A;  1FNN A;  3U6C A;  4D80 A;  1GLN A;  3PNV A;  4LZJ A;  5BR8 M;  1N77 A;  4I4L A;  2XSZ A;  1R2Z A;  3SAU A;  4LJ5 A;  1J09 A;  1E9S A;  1K82 A;  1PM5 A;  3K2L A;  3KOY E;  4B3R M;  4JI7 M;  2VII A;  3FKE A;  4OVZ A;  1PJI A;  2ZAN A;  4W5W A;  4IBG A;  3AL0 C;  4DR4 M;  5ITY A;  3JR5 A;  1R2Y A;  4KLN A;  4LG2 A;  3U6O A;  4X65 M;  3AKZ A;  3WHK A;  2F5O A;  1DO0 A;  3UGJ A;  4AKG A;  3L26 A;  1YSY A;  5FTK A;  3GPY A;  4LRT A;  1QAO A;  4IBK A;  3R8F A;  1L1Z A;  3SBJ A;  1L2C A;  2DZO B;  1G3I A;  5IWA M;  2Y20 A;  8CAT A;  1ZAE A;  2QP9 X;  4LCB A;  1HT1 E;  3ZC7 B;  2OQ4 A;  3VKG A;  4L15 A;  3K92 A;  3T1Y M;  3GLI A;  4JYA M;  2XF3 A;  4KO8 A;  3GLH A;  4X64 M;  1JQJ C;  2Y0Q A;  3MJ5 A;  4IBD A;  1TH2 A;  4LGM A;  5LMN M;  2FE8 A;  2BNK A;  4WW0 A;  3W0F A;  2XZF A;  1QZM A;  4IJE A;  3M0E A;  3UK6 A;  4OW0 A;  4OU7 A;  2G8L A;  4I81 A;  2R4J A;  5EJC A;  1D2N A;  4LJ4 A;  2UUA M;  3WHL A;  3TWL A;  3U60 B;  3U6D A;  3MK6 A;  4TUW A;  4FVM A;  3GLG A;  1TH3 A;  1SXJ E;  4GHL A;  3TPZ A;  2YFQ A;  4M9X A;  4BB9 A;  3VLF B;  2R18 A;  5FSW A;  3FUU A;  2DWZ B;  1GL7 A;  4NSO B;  3UMM A;  5ITX A;  1IBK M;  1ZQ9 A;  3AV0 A;  3CTW B;  5EP1 A;  4HLQ A;  1XMO M;  2NQ8 C;  5KQ8 A;  3AOE A;  3K8Z A;  1N78 A;  1N33 M;  1KFV A;  3FUW A;  3HU3 A;  4DUY M;  4JXJ A;  1QVR A;  4JI2 M;  4GHA A;  4IBF A;  2CV1 A;  1I94 M;  2XFS A;  3E9S A;  1DGH A;  2DXI A;  4K0K M;  3AFH A;  4LGY A;  3GQ5 A;  3KP0 E;  3L28 A;  5ITR A;  3DOA A;  3DZD A;  4AG5 A;  3JAM S;  4P16 A;  4II7 A;  4CHT B;  1N36 M;  1HNZ M;  3PFI A;  4DV3 M;  4I5S A;  3HHW A;  2F4V M;  3J27 B;  2KEB A;  2QBY A;  1IM2 A;  1IY0 A;  2D7E A;  1JR3 D;  1K3W A;  4QHS A;  2F5Q A;  4G4R A;  2J7O A;  3HU2 A;  2I7N A;  5EQT A;  5EXS A;  5KPZ A;  1XXH B;  3LVW A;  2W82 A;  4I8O A;  3SAT A;  3EIH A;  3FTD A;  5FTJ A;  4NL4 H;  1W5T A;  4REZ A;  4R3D A;  3KDS E;  4JV5 M;  3M7G A;  3HJS A;  2FOI C;  1IN7 A;  2UXC M;  3SAV A;  2C96 A;  1OFI A;  4AG6 A;  4B7G A;  1NHG C;  3IG8 A;  1IY1 A;  4MB7 A;  1HNW M;  3KXE C;  3KSX A;  1NHW C;  1IY2 A;  3GRU A;  4AKI A;  1W5S A;  2Y21 A;  4RNA A;  3FTF A;  4LJA A;  2F5S A;  3L27 A;  3C58 A;  4B3M M;  2C9C A;  2C99 A;  1OJL A;  2Y0T A;  3EIE A;  3HU1 A;  2Z3X A;  3A98 B;  4LJ8 A;  2F5N A;  1Z5A A;  1IN5 A;  2R4E A;  1IXZ A;  4LZZ A;  2KZU A;  3KOZ E;  2ZAM A;  2QBY B;  1TDZ A;  4MM3 B;  2G5G X;  1QQW A;  3VDP A;  4DR7 M;  4FWG A;  1KYI A;  1XXH A;  5ITT A;  2VQE M;  4JN6 A;  4Z6Y A;  4M0D A;  3GO8 A;  3VK8 A;  4MH0 E;  3DA1 A;  3SAS A;  4FCV A;  3PXG A;  2A5Y B;  4PD2 A;  3U61 A;  3AOE C;  5EP3 A;  3PVS A;  4L4U A;  3UZU A;  1DGB A;  3UJN A;  1J7K A;  2CEA A;  2X8A A;  2HCB A;  4DR5 M;  1HNX M;  1QYR A;  2V6Z M;  4DR3 M;  3FUT A;  3I51 A;  1L1T A;  2YQZ A;  2XH9 A;  4M9S A;  3TE6 A;  1NNJ A;  2R62 A;  1SXJ D;  4HL4 A;  5GKN A;  7CAT A;  4DR6 M;  2C5R A;  2L09 A;  3IG5 A;  4DV0 M;  2RGH A;  2YNM D;  3LMM A;  3ILK A;  4X66 M;  3ZH9 B;  4NXM M;  4GC5 A;  3RGS A;  2JA2 A;  3U61 B;  3R9X B;  1Z5C A;  4MGH A;  4FCW A;  4Z8X A;  1XWI A;  1G41 A;  1IBL M;  1IXS B;  3T38 A;  2XFT A;  5C18 A;  4X62 M;  4L8R C;  3TL4 X;  4JI5 M;  4LFB M;  2ERC A;  4GIP A;  3J81 S;  1Z5B A;  3B9P A;  3U60 A;  1HR0 M;  4FW9 A;  2UXB M;  2H1R A;  2QEN A;  4NXN M;  4LY6 A;  5DYI A;  3FD9 A;  3GPX A;  1J5E M;  5ITQ A;  2OPF A;  3KS8 A;  2D7H A;  3JR4 A;  5E6J A;  3GRR A;  4GIT A;  3KP1 E;  4LFA M;  3GPP A;  4DUZ M;  2QCU A;  3L29 A;  4G4Q A;  1MX0 A;  3QAU A;  5EXP A;  3SHF A;  3GRY A;  4AQY M;  4WUR A;  1T3T A;  2D7G A;  4LJ7 A;  4NRV A;  3GLG B;  2LXE A;  4LF6 M;  2M5Z A;  2KRK A;  1NSF A;  1QAN A;  5JI3 E;  2XGN A;  3FYC A;  1C1K A;  3KFU G;  2X49 A;  3MHV C;  3HJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...