2F4VM

30s ribosome + designer antibiotic
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 22
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2f4vM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2f4vM02
1L2CA 3SAUA 2UXDM 1MX0A 3A46A 4DR2M 4K0KM 4JI5M 3GO8A 3SATA 4LF5M 4JI2M 4X65M 3GQ3A 4DUZM 1Z5BA 3A42A 2OQ4A 4LF8M 3SAWA 2F5QA 1PJJA 1HR0M 3U6EA 4AQYM 4CISA 4LF6M 4JI0M 3U6CA 3J7AS 3W0FA 4X66M 4OX9M 4LFAM 4PD2A 4JI1M 3U6PA 1N33M 3SAVA 1N34M 2UUAM 4B3MM 1KFVA 1N32M 4DR6M 3U6MA 3VK7A 4DV2M 1TDZA 4GKKM 1K82A 4YY3M 4DV0M 5ITYA 1IBKM 2F5NA 1IBLM 3GPYA 1Z5AA 3J80S 5ITQA 1K3XA 4MB7A 1L1ZA 1IBMM 3GPUA 2F5OA 1HNWM 4ITQA 4NRWA 4DV4M 3U6SA 2VQEM 3VK8A 2UXBM 3JR5A 4DV1M 2F5PA 5FLXS 3SARA 5ITTA 5IWAM 2VQFM 1PJIA 4JI7M 1Z5CA 1EE8A 3JAMS 1FJGM 4LF7M 2UUBM 1XMOM 4PDGA 2OPFA 1XMQM 4G4NA 4B3TM 2Q2EB 4DR7M 2HKJA 3T1HM 3DOAA 1PM5A 4B3SM 1Q3CA 1TDHA 4KHPM 3OTOM 5A2QS 1R2YA 1L1TA 3A45A 2UUCM 4JYAM 2UXCM 4YHHM 1HNZM 3TWMA 4DV7M 3J81S 3T1YM 3TWKA 4JI8M 1Q3BA 1J5EM 4NRVA 1L2BA 4LFCM 1Z59A 4B3RM 3U6OA 4DR4M 3SBJA 4JV5M 5ITXE 5ITXA 3GP1A 4GKJM 1XNQM 4X64M 2ZM6M 2XZUA 4PCZA 1L2DA 4LFBM 1NNJA 3TWLA 4G4RA 1MU5A 4NXMM 3GQ4A 1XC8A 1HNXM 2UU9M 4PDIA 2F4VM 1R2ZA 5IT9S 2ZBKB 4JI3M 5ITUA 4NXNM 4DR1M 2HHHM 2E5LM 2XZFA 3U6LA 4G4OA 1K3WA 1I94M 3GPXA 4DUYM 4G4QA 3C58A 4LF9M 1N36M 3SASA 5LMNM 4DV3M 4X62M 2F5SA 3GPPA 4DR3M 5LMUM 4DV6M 5BR8M 3U6QA 4DV5M 4JI4M 4LF4M 1XNRM 4JI6M 1Q39A 3JR4A 3GQ5A 5ITRA 2EA0A 3U6DA 4DR5M
chains in the Genus database with same CATH superfamily
1QAMA 3SAUA 2UXDM 1WIVA 4NSOB 4DR2M 2KRUA 4AI6A 2LBCA 3LQRA 4K0KM 1P3QQ 4JI5M 2H5XA 4I8OA 4JI2M 1C1KA 3KXEC 4DUZM 1KSFX 3FRIA 3D8LA 2I7PA 3GLFA 1G41A 3M0EA 3A42A 3KOYE 3C3EA 5IZ7D 4REZA 2DZNB 1MJGM 3U6EA 4LF6M 4CISA 3U6CA 2K6BA 4IBJA 4X66M 2C5RA 2DWMA 4KT0F 1JR3E 3NWLA 4KLNA 4OVZB 1QYRA 1QZMA 4UN2B 3WHKA 1N33M 3T15A 1LV7A 3SAVA 1N32M 1KFVA 5KO3A 3LVWA 2OOAA 3AOEA 3KFUG 3V76A 4LJ5A 1XXHE 4LJ4A 3I4YA 3AL0C 2Z8YM 5EXXA 1GJTA 1WGLA 1ZQ9A 4FCTA 2JA2A 1AUAA 1E32A 2QBYB 3EIEA 3E46A 4DBGB 1ZMUA 3KSJA 4P17A 4OW0A 1GL6A 3HJSA 2ZANA 3HU2A 4M9XA 1WJ7A 1XXHA 2CWBA 1QDTA 1IBMM 4ITQA 1W5TA 4NRWA 2YQZA 2WZJA 2VDBB 3ZC7B 4QHSA 4FWDA 5JI3E 3U6SA 1QVRA 2OOBA 2XEPA 1NHWC 3Q8GA 4CJ6A 3HU1A 3K9OA 4IBEA 7CATA 2C98A 2CHGA 3HWSA 3D8BA 2KHHA 3ILKA 1SXJA 2KRKA 3SHFA 4GC5A 3GLIA 1ZAEA 4R71A 3NBXX 4WURA 2BNKA 2UUBM 4LGMA 2BJWA 2D7EA 4D81A 1XMQM 4B7HA 3FKEA 2LVPC 3FTFA 4DR7M 4AW4A 1GO5A 1NV9A 4A3VB 1OFHA 2QCUA 2KW0A 2DNAA 2D7GA 3WHLA 4KO8A 2APLA 3GLFE 2JXNA 5L8RF 1R2YA 2K0BX 3H4MA 4MGZE 1L1TA 3FUWA 4KODA 3A98B 2ZTCA 1DO0A 2UXCM 1HNZM 4FWGA 2K47A 3K1JA 3J81S 4DV7M 2XLJA 4IBKA 2I7NA 2XFSA 1I4WA 3FUUA 3GRVA 4I4LA 2DWZB 2KZSA 3CF0A 4XGIA 5F3WA 2WSEF 1UFZA 2FFJA 3SBJA 1IY0A 4GKJM 2RGOA 1QAOA 3ZQJA 4LFBM 3FE3A 5GKNA 3ZH9B 4G4RA 2CHVA 4LGYA 1NNJA 1WHCA 1TH3A 4GC9A 4CGYB 4GHLA 4HLQA 2X4AA 3I01M 3FTEA 4Z8XA 5EP2A 3KP0E 2XF3A 2OO9A 2CUZA 2XZFA 3QYBA 4G4OA 1I94M 4AZFA 4RKUF 3GPXA 2O5RA 4G4QA 4P16A 4AKIA 1TF0B 1VDLA 4IBBA 3HZJA 3J27B 3HHWA 1QUTA 4WP2A 3GLIE 4X62M 2QP9X 3FRHA 2F5SA 3T6PA 3GPPA 4CIZA 2DAEA 4F2LA 2R45A 2L7IA 5LMUM 1ZMVA 1OJLA 2KXEA 3RE8A 1TH4A 4B7GA 3JR4A 3CF6E 5ITRA 3SC3A 1OQYA 4L8RC 1HQCA 3F92A 2CV2A 1OTRA 5FTLA 4WW0A 1ZV1A 1OIPA 3SATA 2EKKA 4MGYE 2X8AA 4G6ZA 5FTMA 3RGSA 4JXJA 3TPZA 1XB2B 3QWLA 2LVAA 1D2NA 1CUKA 3T38A 3HHZA 3L27A 4LF8M 2XSZA 3C3DA 1XWIA 1PJJA 3GLGE 2EKFA 4GHAA 3J7AS 3B7QA 3LW5F 2JY6B 1YE9A 2C99A 3MHVC 4OX9M 1NY6A 1PRBA 4PD2A 5IREB 2M5ZA 3HKPA 2BWBA 3U6MA 3LVVA 3VK7A 4IBIA 2JY8A 1BVSA 2JY5A 2BWEA 4S12A 2DWNA 4RF0A 1G71A 1K82A 2LHCA 4LJ9A 1IBKM 3VKHA 2P5TA 1QQWA 2R6FA 3GPYA 4LY6A 1Z5AA 1G8PA 2LWXA 5EXPA 1K3XA 1L1ZA 4IBDA 5EP1A 1E9SA 3SFZA 4LZZA 2Y0QA 1IQPA 3GLHE 3L28A 4MGHA 2JNHA 3VLFB 4DV4M 2QBYA 1OFIA 2WSFF 1DGGA 2UXBM 1XXHB 4D80A 2DHYA 3DA1A 2F5PA 3AOGA 1HNWM 1HT1E 3SARA 3GLHA 2CP8A 2EUCA 3M7GA 5DNYA 2LHGA 3L26A 5DYIA 1JR3D 1Y8GA 4G4NA 2D7HA 2Z4RA 5DYGA 3TE6A 2L7HA 2JZ1A 1SXJE 1YLAA 2L2DA 3VKGA 4MH0E 4RF1A 3UJNA 1IN6A 3ZCBB 1YUBA 2J7NA 1QAQA 3OTOM 1VDDA 3AKZA 4R3DA 1LTMA 1IN7A 1C7YA 3A45A 1PGYA 2CRUA 1IFYA 3W68A 5E6JA 4YHHM 2QQ8A 2H1RA 3R9XB 4AG6A 2DZOB 1PJSA 4Z6YA 1N77A 1IXSA 1VEKA 3AV0A 3FUTA 5KPZA 3FD9A 4GEWA 1E94E 4M0WA 4PT5A 3PVSA 1J5EM 1TR8A 2DENA 3J2PB 1Z59A 1WGNA 3HJQA 2C9CA 3U6OA 3RFWA 2LVQD 5ITXA 1FNNA 4FWHA 2EO2A 3LCUA 3THGA 2G5GX 3W67A 2ZM6M 1G4AE 1ORYB 4L4UA 5EXTA 4NXMM 3KDSE 4MM3B 2N35A 2F4VM 4I81A 4DR1M 1N75A 1T3TA 1S3SA 1DO2A 1VEJA 2LXEA 2JY7A 2XSZD 3E21A 4F1IA 5KQ8A 2Z3XA 3U6LA 1KYIA 2L4FA 2DAKA 3AOEC 4M9SA 2CEAA 3C58A 3SMPA 1DGFA 1X37A 3SASA 4LF9M 3CF2A 3PFIA 1NJGA 4DR3M 5EJCA 4LJ7A 2Z4SA 5BR8M 3U6QA 1XNRM 2XGNA 1DV0A 4AG5A 4XK8F 1Q39A 3UZUA 4AKHA 2DKLA 5FTJA 3UK6A 4LRSA 3GQ5A 4DR5M 2MROB 3U6DA 3B74A 1L2CA 3L25A 3L29A 2XFTA 1GABA 1EIJA 4B7FA 2DVWB 3BXWA 2V1UA 3GO8A 4LF5M 3HU3A 3PXGA 1J7KA 2DWLA 4X65M 2LVNC 3FTDA 1GL7A 1WR1B 2KNAA 1SXJC 2A5YB 4BBAA 4D82A 3GRYA 1IXSB 2OQ4A 1T6OA 4AKGA 3GLGA 2F5QA 2VF7A 1HR0M 1D0KA 3HJ8A 4GRIA 5EP4A 4L78A 4JI0M 3J7BA 3W0FA 4LFAM 1H6UA 2RRUA 4L16A 3PNVA 2R46A 1VG5A 1N34M 2UUAM 4LJAA 4QNMA 4DR6M 3UMMA 2LVOC 1A5TA 3KVWA 4DV2M 5KQDA 4GKKM 1HT2E 3AFHA 2BJVA 1R4GA 4YY3M 4DV0M 3IG5A 3B7NA 4ANRA 2F5NA 2JP7A 3J80S 5ITQA 3KOWE 3VFDA 3GPUA 5DFLA 2F5OA 2LNHC 4NOOB 3HHXA 1EFUB 3E9SA 2R62A 3AJIB 2M60A 3U61A 3SYLA 4GMQA 2DAGA 5FSWA 4QOZC 1D0MA 4DV1M 3HGIA 3I51A 5FLXS 3M6AA 2MR9A 5IWAM 2JUJA 4QOSA 1PJIA 3HY5A 2B3TA 1EE8A 3JAMS 4BLCA 2AHMA 2ZTDA 4PDGA 2OPFA 3I04M 4IBGA 2HKJA 3GLHB 4Q7JA 2L4EA 4QNRA 5JI2E 1PM5A 1Q3CA 1TGUA 1TDHA 2L09A 2XH9A 4M0DA 4OU7A 2ERCA 2KZUA 3IHPA 3L2AA 4HL4A 4IBFA 1V33A 2NQ8C 1YSYA 3QAUA 4M9ZA 4JYAM 3TWMA 2QPAA 1ZMWA 3TWKA 3K92A 1Q3BA 5KPRA 3VDUA 1R5LA 2YFQA 4L6V6 1L2BA 4JV5M 4GIPA 2K9DA 1L8QA 3GP1A 1XNQM 4FCVA 3SYKA 3W0LB 4PCZA 3TWLA 1MU5A 1NO1A 2G3QA 3B9PA 3KSXA 3GQ4A 3B7ZA 3U60A 2UU9M 4IJEA 1R2ZA 5IT9S 2ZBKB 2QZ4A 3DFZA 3FYDA 4JI3M 4NXNM 1NVMA 4HEOA 4RNAA 3U61B 1DGHA 1IY1A 3SHGB 2X49A 1IY2A 3HHYA 2HCBA 1W5SA 1PJTA 4DUYM 2CV1A 4NL4H 3FUVA 4BB9A 1MN3A 4LZJA 3KOZE 3I4VA 1N36M 5C1BA 2DAMA 2FH0A 4DV3M 1QANA 1T43A 1V92A 2QSFX 4FVMA 4MGIE 1IN8A 4W5WA 4DV6M 4JI4M 4LF4M 4DV5M 2VF8A 2DZLA 4JI6M 2CFOA 1JB0F 2C9OA 2O01F 3E4RA 2EA0A 2QHOB 3C9PA 2Y0TA 1MX0A 2YNMD 3A46A 3GLFB 2YR0A 1QZEA 2CHQA 4II7A 1VEGA 3BBZA 5KPTA 1IXZA 1V34A 2KDLA 2KEBA 3KS4A 3GQ3A 2W82A 1NV8A 2C96A 4OVZA 5EXSA 1Z5BA 5H37D 2KA6B 3SAWA 2R18A 1QUSA 3HX3A 1NY5A 4AQYM 4B08A 1GJSA 2Y20A 4JI1M 4B3RM 2FNAA 3U6PA 4B3MM 1JQJC 1D0LA 2LH0A 2VIIA 3GLGB 1NJFA 3B89A 3K2LA 2R65A 1TDZA 1NSFA 2MH8A 2ZAMA 3NBIA 3GRUA 2QENA 2O25A 5ITYA 2QNJA 2J7OA 1IBLM 4LJ8A 1N78A 2DI0A 2R4JA 1Z6TA 4IIWA 4ZPXA 4MB7A 1DGHB 3KP1E 5FTKA 3KS8A 3MMPA 2V1CA 4FCWA 1E9RA 1XHBA 3CTWB 1G59A 3H4JA 3GLIB 3UGJA 2VQEM 3VK8A 3CGWA 4CHTB 1HJPA 1DGBA 1OKSA 2KNVA 5EP3A 3JR5A 4GH9A 3LQQA 2HWJA 1OIZA 3R8FA 4FW9A 3FTCA 3U5ZB 2MJ5B 5ITTA 1QDRA 2VQFM 4LG2A 1RU3A 4JI7M 1OAOC 4QHTA 1Z5CA 1FJGM 3LMMA 4LF7M 4IJFA 2DXIA 3TQSA 3QYEA 2HAKA 1XMOM 4L15A 4B3TM 2Q2EB 2G8LA 1R6BX 3DOAA 4R7GA 3T1HM 3EIHA 1IN4A 4B3SM 2L6OA 1VQ1A 1WXQA 3PNYA 2CE7A 1IXRC 4KHPM 4NSRA 3FUXA 3RGPA 5A2QS 1F4IA 4XBOA 4TUWA 2Y21A 4I5SA 2UUCM 3KW6A 5E26A 1G3IA 3LCVB 1GKIA 2DHRA 4FD2A 3T1YM 4JN6A 2RGHA 4IBCA 4JI8M 2CV0A 1GVNA 1OAIA 3KOXE 1Q02A 4LCBA 4NRVA 4EIWA 4LFCM 4DR4M 2LTUA 4LRTA 5ITXE 1IM2A 1SG9A 1JR3A 1TTEA 1PJQA 1SXJD 4X64M 2EJSA 3DZDA 4G3OA 2ZAOA 1AIPC 2R4EA 2XZUA 1L2DA 2GNOA 1GLNA 1J09A 2FOIC 2WSCF 2FS1A 3K8ZA 1XC8A 2J5YA 3Q8XA 1HNXM 4PDIA 3IECA 3BOSA 1UM8A 5ITUA 2R0IA 2HHHM 5C18A 1NHGC 1IN5A 1HQYE 4Y28F 5FTNA 2FE8A 2E5LM 3MK6A 4MGKE 2DAIA 4GITA 1K3WA 2R44A 3SMSA 2KNZA 3U60B 1TH2A 3MJ5A 2MGWA 3U5ZA 1R7RA 4LJ6A 5LMNM 8CATA 3IG8A 1NNUC 2HL7A 5BPVA 2RKOA 3GRRA 5EQTA 2GQFA 4NC6A 2JZ0A 1SXJB 3FYCA 3TL4X 3K9PA 3VDPA 2V6ZM 2JWSA 2Z7JA
chains in the Genus database with same CATH topology
1QAMA 3SAUA 2UXDM 4NSOB 4DR2M 2KRUA 4AI6A 3LQRA 4K0KM 4JI5M 4I8OA 4JI2M 1C1KA 3KXEC 4DUZM 1KSFX 3D8LA 2I7PA 3GLFA 1G41A 3M0EA 3A42A 3KOYE 5IZ7D 4REZA 2DZNB 3U6EA 4LF6M 4CISA 3U6CA 2C5RA 4IBJA 4X66M 2DWMA 3NWLA 4KLNA 4OVZB 1QYRA 1QZMA 3WHKA 1N33M 3T15A 1LV7A 3SAVA 1N32M 1KFVA 5KO3A 3LVWA 3AOEA 3KFUG 4LJ5A 4LJ4A 3I4YA 3AL0C 5EXXA 1ZQ9A 4FCTA 2JA2A 2QBYB 1E32A 3EIEA 3KSJA 4OW0A 1GL6A 3HJSA 2ZANA 3HU2A 4M9XA 1XXHA 1IBMM 1HNWM 4ITQA 1W5TA 4NRWA 2YQZA 3ZC7B 4QHSA 4FWDA 5JI3E 3U6SA 1QVRA 2XEPA 1NHWC 3HU1A 7CATA 4IBEA 2C98A 2CHGA 3HWSA 3D8BA 3ILKA 1SXJA 2KRKA 3SHFA 4GC5A 3GLIA 1ZAEA 4WURA 2BNKA 2UUBM 4LGMA 2BJWA 2D7EA 4D81A 1XMQM 4B7HA 3FKEA 3FTFA 4DR7M 4AW4A 4A3VB 1OFHA 2QCUA 2KW0A 2D7GA 3WHLA 4KO8A 1R2YA 3H4MA 4MGZE 1L1TA 3FUWA 4KODA 3A98B 1DO0A 2UXCM 1HNZM 4FWGA 2K47A 3K1JA 3J81S 4DV7M 2XLJA 4IBKA 2I7NA 2XFSA 1I4WA 3FUUA 3GRVA 4I4LA 2DWZB 2KZSA 3CF0A 4XGIA 5F3WA 3SBJA 2FFJA 1IY0A 4GKJM 2RGOA 1QAOA 4LFBM 5GKNA 3ZH9B 4G4RA 2CHVA 4LGYA 1NNJA 1TH3A 4GC9A 4CGYB 4GHLA 4HLQA 2X4AA 3FTEA 4Z8XA 5EP2A 3KP0E 2XF3A 2CUZA 2XZFA 4G4OA 1I94M 4AZFA 3GPXA 2O5RA 4G4QA 4P16A 4AKIA 4IBBA 3J27B 3HHWA 4X62M 2QP9X 2F5SA 3GPPA 5LMUM 2R45A 2L7IA 1OJLA 2KXEA 3RE8A 1TH4A 4B7GA 3JR4A 3CF6E 5ITRA 3SC3A 4L8RC 1HQCA 2CV2A 5FTLA 4WW0A 3SATA 4MGYE 2X8AA 4G6ZA 5FTMA 3RGSA 4JXJA 3TPZA 3QWLA 1D2NA 3T38A 3HHZA 3L27A 4LF8M 2XSZA 1XWIA 1PJJA 4GHAA 3J7AS 3MHVC 1YE9A 2C99A 4OX9M 1NY6A 4PD2A 5IREB 2M5ZA 3HKPA 3U6MA 3LVVA 3VK7A 4IBIA 2DWNA 4S12A 4RF0A 1K82A 3VKHA 4LJ9A 1IBKM 2P5TA 1QQWA 3GPYA 4LY6A 1Z5AA 1G8PA 2LWXA 5EXPA 1K3XA 1L1ZA 4IBDA 5EP1A 1E9SA 3SFZA 4LZZA 2Y0QA 1IQPA 3L28A 4MGHA 4DV4M 3VLFB 2QBYA 1OFIA 1DGGA 2UXBM 1XXHB 4D80A 3DA1A 2F5PA 3AOGA 1HT1E 3SARA 3GLHA 2EUCA 3M7GA 5DNYA 3L26A 5DYIA 1JR3D 4G4NA 2D7HA 2Z4RA 5DYGA 3TE6A 2L7HA 1SXJE 3VKGA 4MH0E 4RF1A 3UJNA 1IN6A 3ZCBB 1YUBA 2J7NA 1QAQA 3OTOM 1VDDA 3AKZA 4R3DA 1IN7A 3A45A 5E6JA 4YHHM 2H1RA 3R9XB 4AG6A 2DZOB 4Z6YA 1N77A 3AV0A 3FUTA 5KPZA 3FD9A 1E94E 4M0WA 4PT5A 3PVSA 1J5EM 3J2PB 4B3RM 1Z59A 3HJQA 3U6OA 2C9CA 3RFWA 5ITXA 1FNNA 4FWHA 2EO2A 3THGA 2G5GX 2ZM6M 1G4AE 1ORYB 4L4UA 5EXTA 4NXMM 3KDSE 4MM3B 2F4VM 4I81A 4DR1M 1N75A 1T3TA 1S3SA 1DO2A 2LXEA 2XSZD 2Z3XA 5KQ8A 3U6LA 1KYIA 3AOEC 4M9SA 2CEAA 3C58A 3SMPA 1DGFA 1X37A 3SASA 4LF9M 3CF2A 3PFIA 1NJGA 4DR3M 5EJCA 4LJ7A 2Z4SA 5BR8M 3U6QA 1XNRM 2XGNA 4AG5A 1Q39A 3UZUA 4AKHA 5FTJA 3GQ5A 3UK6A 4LRSA 4DR5M 3U6DA 1L2CA 3L25A 3L29A 2XFTA 4B7FA 2DVWB 2V1UA 3GO8A 4LF5M 3HU3A 3PXGA 1J7KA 2DWLA 4X65M 3FTDA 1GL7A 1SXJC 2A5YB 4BBAA 4D82A 3GRYA 1IXSB 2OQ4A 4AKGA 3GLGA 2F5QA 1HR0M 3HJ8A 4GRIA 5EP4A 4L78A 4JI0M 3J7BA 3W0FA 4LFAM 1H6UA 4L16A 3PNVA 2R46A 1N34M 2UUAM 4LJAA 4QNMA 4DR6M 3UMMA 3KVWA 4DV2M 5KQDA 4GKKM 1HT2E 3AFHA 2BJVA 4YY3M 4DV0M 3IG5A 2F5NA 3J80S 5ITQA 3KOWE 3VFDA 3GPUA 2F5OA 2LNHC 4NOOB 3HHXA 3E9SA 2R62A 3AJIB 2M60A 3U61A 3SYLA 4GMQA 5FSWA 4QOZC 4DV1M 3HGIA 3I51A 5FLXS 3M6AA 5IWAM 4QOSA 1PJIA 1EE8A 3JAMS 4BLCA 2AHMA 4PDGA 2OPFA 4IBGA 2HKJA 3GLHB 4QNRA 5JI2E 1PM5A 1Q3CA 1TGUA 1TDHA 2L09A 2XH9A 4M0DA 4OU7A 2ERCA 2KZUA 3L2AA 4HL4A 4IBFA 2NQ8C 1YSYA 3QAUA 4M9ZA 4JYAM 3TWMA 2QPAA 3TWKA 3K92A 1Q3BA 5KPRA 3VDUA 2YFQA 1L2BA 4JV5M 4GIPA 1L8QA 3GP1A 1XNQM 4FCVA 3SYKA 3W0LB 4PCZA 3TWLA 1MU5A 3KSXA 3B9PA 3GQ4A 3U60A 2UU9M 4IJEA 1R2ZA 5IT9S 2ZBKB 2QZ4A 3DFZA 3FYDA 4JI3M 4NXNM 1NVMA 4RNAA 3U61B 1DGHA 1IY1A 3SHGB 2X49A 1IY2A 3HHYA 2HCBA 1W5SA 4DUYM 2CV1A 4NL4H 3FUVA 4BB9A 4LZJA 3KOZE 3I4VA 1N36M 5C1BA 4DV3M 1QANA 4FVMA 4MGIE 1IN8A 4W5WA 4DV6M 4JI4M 4LF4M 4DV5M 4JI6M 2CFOA 2C9OA 3E4RA 2EA0A 2Y0TA 1MX0A 2YNMD 3A46A 3GLFB 2YR0A 2CHQA 4II7A 5KPTA 1IXZA 2KEBA 3KS4A 3GQ3A 2W82A 2C96A 4OVZA 5EXSA 1Z5BA 5H37D 2KA6B 3SAWA 2R18A 4AQYM 1NY5A 4B08A 2Y20A 4JI1M 2FNAA 3U6PA 4B3MM 1JQJC 2LH0A 2VIIA 3GLGB 1NJFA 3K2LA 2R65A 1TDZA 1NSFA 2ZAMA 3NBIA 3GRUA 2QENA 5ITYA 2J7OA 1IBLM 4LJ8A 1N78A 2R4JA 1Z6TA 4IIWA 4ZPXA 4MB7A 1DGHB 3KP1E 3KS8A 2V1CA 4FCWA 1E9RA 1XHBA 3CTWB 1G59A 3GLIB 3UGJA 2VQEM 3VK8A 4CHTB 1DGBA 5EP3A 3JR5A 4GH9A 3LQQA 3R8FA 4FW9A 3FTCA 3U5ZB 5ITTA 2VQFM 4LG2A 4JI7M 4QHTA 1Z5CA 1FJGM 3LMMA 4LF7M 4IJFA 2DXIA 3TQSA 1XMOM 4L15A 4B3TM 2Q2EB 2G8LA 1R6BX 3DOAA 4R7GA 3T1HM 3EIHA 1IN4A 4B3SM 2L6OA 3PNYA 1WXQA 2CE7A 1IXRC 4KHPM 4NSRA 3FUXA 3RGPA 5A2QS 4XBOA 4TUWA 2Y21A 4I5SA 2UUCM 3KW6A 5E26A 1G3IA 1GKIA 2DHRA 4FD2A 3T1YM 4JN6A 2RGHA 4IBCA 4JI8M 2CV0A 1GVNA 3KOXE 4LCBA 4NRVA 4LFCM 4EIWA 4DR4M 4LRTA 5ITXE 1IM2A 1JR3A 1SXJD 4X64M 3DZDA 2ZAOA 2XZUA 2R4EA 1L2DA 1GLNA 1J09A 2FOIC 3K8ZA 1XC8A 3Q8XA 1HNXM 4PDIA 3BOSA 1UM8A 5ITUA 2HHHM 5C18A 1NHGC 1IN5A 1HQYE 5FTNA 2FE8A 2E5LM 3MK6A 4MGKE 4GITA 1K3WA 3SMSA 3U60B 1TH2A 3MJ5A 3U5ZA 1R7RA 4LJ6A 5LMNM 8CATA 3IG8A 1NNUC 2HL7A 5BPVA 2RKOA 3GRRA 5EQTA 1SXJB 3FYCA 3TL4X 3VDPA 2V6ZM 5FTKA 2Z7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2C A;  3SAU A;  2UXD M;  1MX0 A;  3A46 A;  4DR2 M;  4K0K M;  4JI5 M;  3GO8 A;  3SAT A;  4LF5 M;  4JI2 M;  4X65 M;  3GQ3 A;  4DUZ M;  1Z5B A;  3A42 A;  2OQ4 A;  4LF8 M;  3SAW A;  2F5Q A;  1PJJ A;  1HR0 M;  3U6E A;  4AQY M;  4CIS A;  4LF6 M;  4JI0 M;  3U6C A;  3J7A S;  3W0F A;  4X66 M;  4OX9 M;  4LFA M;  4PD2 A;  4JI1 M;  3U6P A;  1N33 M;  3SAV A;  1N34 M;  2UUA M;  4B3M M;  1KFV A;  1N32 M;  4DR6 M;  3U6M A;  3VK7 A;  4DV2 M;  1TDZ A;  4GKK M;  1K82 A;  4YY3 M;  4DV0 M;  5ITY A;  1IBK M;  2F5N A;  1IBL M;  3GPY A;  1Z5A A;  3J80 S;  5ITQ A;  1K3X A;  4MB7 A;  1L1Z A;  1IBM M;  3GPU A;  2F5O A;  1HNW M;  4ITQ A;  4NRW A;  4DV4 M;  3U6S A;  2VQE M;  3VK8 A;  2UXB M;  3JR5 A;  4DV1 M;  2F5P A;  5FLX S;  3SAR A;  5ITT A;  5IWA M;  2VQF M;  1PJI A;  4JI7 M;  1Z5C A;  1EE8 A;  3JAM S;  1FJG M;  4LF7 M;  2UUB M;  1XMO M;  4PDG A;  2OPF A;  1XMQ M;  4G4N A;  4B3T M;  2Q2E B;  4DR7 M;  2HKJ A;  3T1H M;  3DOA A;  1PM5 A;  4B3S M;  1Q3C A;  1TDH A;  4KHP M;  3OTO M;  5A2Q S;  1R2Y A;  1L1T A;  3A45 A;  2UUC M;  4JYA M;  2UXC M;  4YHH M;  1HNZ M;  3TWM A;  4DV7 M;  3J81 S;  3T1Y M;  3TWK A;  4JI8 M;  1Q3B A;  1J5E M;  4NRV A;  1L2B A;  4LFC M;  1Z59 A;  4B3R M;  3U6O A;  4DR4 M;  3SBJ A;  4JV5 M;  5ITX E;  5ITX A;  3GP1 A;  4GKJ M;  1XNQ M;  4X64 M;  2ZM6 M;  2XZU A;  4PCZ A;  1L2D A;  4LFB M;  1NNJ A;  3TWL A;  4G4R A;  1MU5 A;  4NXM M;  3GQ4 A;  1XC8 A;  1HNX M;  2UU9 M;  4PDI A;  2F4V M;  1R2Z A;  5IT9 S;  2ZBK B;  4JI3 M;  5ITU A;  4NXN M;  4DR1 M;  2HHH M;  2E5L M;  2XZF A;  3U6L A;  4G4O A;  1K3W A;  1I94 M;  3GPX A;  4DUY M;  4G4Q A;  3C58 A;  4LF9 M;  1N36 M;  3SAS A;  5LMN M;  4DV3 M;  4X62 M;  2F5S A;  3GPP A;  4DR3 M;  5LMU M;  4DV6 M;  5BR8 M;  3U6Q A;  4DV5 M;  4JI4 M;  4LF4 M;  1XNR M;  4JI6 M;  1Q39 A;  3JR4 A;  3GQ5 A;  5ITR A;  2EA0 A;  3U6D A;  4DR5 M; 
#chains in the Genus database with same CATH topology
 1QAM A;  3SAU A;  2UXD M;  1WIV A;  4NSO B;  4DR2 M;  2KRU A;  4AI6 A;  2LBC A;  3LQR A;  4K0K M;  1P3Q Q;  4JI5 M;  2H5X A;  4I8O A;  4JI2 M;  1C1K A;  3KXE C;  4DUZ M;  1KSF X;  3FRI A;  3D8L A;  2I7P A;  3GLF A;  1G41 A;  3M0E A;  3A42 A;  3KOY E;  3C3E A;  5IZ7 D;  4REZ A;  2DZN B;  1MJG M;  3U6E A;  4LF6 M;  4CIS A;  3U6C A;  2K6B A;  4IBJ A;  4X66 M;  2C5R A;  2DWM A;  4KT0 F;  1JR3 E;  3NWL A;  4KLN A;  4OVZ B;  1QYR A;  1QZM A;  4UN2 B;  3WHK A;  1N33 M;  3T15 A;  1LV7 A;  3SAV A;  1N32 M;  1KFV A;  5KO3 A;  3LVW A;  2OOA A;  3AOE A;  3KFU G;  3V76 A;  4LJ5 A;  1XXH E;  4LJ4 A;  3I4Y A;  3AL0 C;  2Z8Y M;  5EXX A;  1GJT A;  1WGL A;  1ZQ9 A;  4FCT A;  2JA2 A;  1AUA A;  1E32 A;  2QBY B;  3EIE A;  3E46 A;  4DBG B;  1ZMU A;  3KSJ A;  4P17 A;  4OW0 A;  1GL6 A;  3HJS A;  2ZAN A;  3HU2 A;  4M9X A;  1WJ7 A;  1XXH A;  2CWB A;  1QDT A;  1IBM M;  4ITQ A;  1W5T A;  4NRW A;  2YQZ A;  2WZJ A;  2VDB B;  3ZC7 B;  4QHS A;  4FWD A;  5JI3 E;  3U6S A;  1QVR A;  2OOB A;  2XEP A;  1NHW C;  3Q8G A;  4CJ6 A;  3HU1 A;  3K9O A;  4IBE A;  7CAT A;  2C98 A;  2CHG A;  3HWS A;  3D8B A;  2KHH A;  3ILK A;  1SXJ A;  2KRK A;  3SHF A;  4GC5 A;  3GLI A;  1ZAE A;  4R71 A;  3NBX X;  4WUR A;  2BNK A;  2UUB M;  4LGM A;  2BJW A;  2D7E A;  4D81 A;  1XMQ M;  4B7H A;  3FKE A;  2LVP C;  3FTF A;  4DR7 M;  4AW4 A;  1GO5 A;  1NV9 A;  4A3V B;  1OFH A;  2QCU A;  2KW0 A;  2DNA A;  2D7G A;  3WHL A;  4KO8 A;  2APL A;  3GLF E;  2JXN A;  5L8R F;  1R2Y A;  2K0B X;  3H4M A;  4MGZ E;  1L1T A;  3FUW A;  4KOD A;  3A98 B;  2ZTC A;  1DO0 A;  2UXC M;  1HNZ M;  4FWG A;  2K47 A;  3K1J A;  3J81 S;  4DV7 M;  2XLJ A;  4IBK A;  2I7N A;  2XFS A;  1I4W A;  3FUU A;  3GRV A;  4I4L A;  2DWZ B;  2KZS A;  3CF0 A;  4XGI A;  5F3W A;  2WSE F;  1UFZ A;  2FFJ A;  3SBJ A;  1IY0 A;  4GKJ M;  2RGO A;  1QAO A;  3ZQJ A;  4LFB M;  3FE3 A;  5GKN A;  3ZH9 B;  4G4R A;  2CHV A;  4LGY A;  1NNJ A;  1WHC A;  1TH3 A;  4GC9 A;  4CGY B;  4GHL A;  4HLQ A;  2X4A A;  3I01 M;  3FTE A;  4Z8X A;  5EP2 A;  3KP0 E;  2XF3 A;  2OO9 A;  2CUZ A;  2XZF A;  3QYB A;  4G4O A;  1I94 M;  4AZF A;  4RKU F;  3GPX A;  2O5R A;  4G4Q A;  4P16 A;  4AKI A;  1TF0 B;  1VDL A;  4IBB A;  3HZJ A;  3J27 B;  3HHW A;  1QUT A;  4WP2 A;  3GLI E;  4X62 M;  2QP9 X;  3FRH A;  2F5S A;  3T6P A;  3GPP A;  4CIZ A;  2DAE A;  4F2L A;  2R45 A;  2L7I A;  5LMU M;  1ZMV A;  1OJL A;  2KXE A;  3RE8 A;  1TH4 A;  4B7G A;  3JR4 A;  3CF6 E;  5ITR A;  3SC3 A;  1OQY A;  4L8R C;  1HQC A;  3F92 A;  2CV2 A;  1OTR A;  5FTL A;  4WW0 A;  1ZV1 A;  1OIP A;  3SAT A;  2EKK A;  4MGY E;  2X8A A;  4G6Z A;  5FTM A;  3RGS A;  4JXJ A;  3TPZ A;  1XB2 B;  3QWL A;  2LVA A;  1D2N A;  1CUK A;  3T38 A;  3HHZ A;  3L27 A;  4LF8 M;  2XSZ A;  3C3D A;  1XWI A;  1PJJ A;  3GLG E;  2EKF A;  4GHA A;  3J7A S;  3B7Q A;  3LW5 F;  2JY6 B;  1YE9 A;  2C99 A;  3MHV C;  4OX9 M;  1NY6 A;  1PRB A;  4PD2 A;  5IRE B;  2M5Z A;  3HKP A;  2BWB A;  3U6M A;  3LVV A;  3VK7 A;  4IBI A;  2JY8 A;  1BVS A;  2JY5 A;  2BWE A;  4S12 A;  2DWN A;  4RF0 A;  1G71 A;  1K82 A;  2LHC A;  4LJ9 A;  1IBK M;  3VKH A;  2P5T A;  1QQW A;  2R6F A;  3GPY A;  4LY6 A;  1Z5A A;  1G8P A;  2LWX A;  5EXP A;  1K3X A;  1L1Z A;  4IBD A;  5EP1 A;  1E9S A;  3SFZ A;  4LZZ A;  2Y0Q A;  1IQP A;  3GLH E;  3L28 A;  4MGH A;  2JNH A;  3VLF B;  4DV4 M;  2QBY A;  1OFI A;  2WSF F;  1DGG A;  2UXB M;  1XXH B;  4D80 A;  2DHY A;  3DA1 A;  2F5P A;  3AOG A;  1HNW M;  1HT1 E;  3SAR A;  3GLH A;  2CP8 A;  2EUC A;  3M7G A;  5DNY A;  2LHG A;  3L26 A;  5DYI A;  1JR3 D;  1Y8G A;  4G4N A;  2D7H A;  2Z4R A;  5DYG A;  3TE6 A;  2L7H A;  2JZ1 A;  1SXJ E;  1YLA A;  2L2D A;  3VKG A;  4MH0 E;  4RF1 A;  3UJN A;  1IN6 A;  3ZCB B;  1YUB A;  2J7N A;  1QAQ A;  3OTO M;  1VDD A;  3AKZ A;  4R3D A;  1LTM A;  1IN7 A;  1C7Y A;  3A45 A;  1PGY A;  2CRU A;  1IFY A;  3W68 A;  5E6J A;  4YHH M;  2QQ8 A;  2H1R A;  3R9X B;  4AG6 A;  2DZO B;  1PJS A;  4Z6Y A;  1N77 A;  1IXS A;  1VEK A;  3AV0 A;  3FUT A;  5KPZ A;  3FD9 A;  4GEW A;  1E94 E;  4M0W A;  4PT5 A;  3PVS A;  1J5E M;  1TR8 A;  2DEN A;  3J2P B;  1Z59 A;  1WGN A;  3HJQ A;  2C9C A;  3U6O A;  3RFW A;  2LVQ D;  5ITX A;  1FNN A;  4FWH A;  2EO2 A;  3LCU A;  3THG A;  2G5G X;  3W67 A;  2ZM6 M;  1G4A E;  1ORY B;  4L4U A;  5EXT A;  4NXM M;  3KDS E;  4MM3 B;  2N35 A;  2F4V M;  4I81 A;  4DR1 M;  1N75 A;  1T3T A;  1S3S A;  1DO2 A;  1VEJ A;  2LXE A;  2JY7 A;  2XSZ D;  3E21 A;  4F1I A;  5KQ8 A;  2Z3X A;  3U6L A;  1KYI A;  2L4F A;  2DAK A;  3AOE C;  4M9S A;  2CEA A;  3C58 A;  3SMP A;  1DGF A;  1X37 A;  3SAS A;  4LF9 M;  3CF2 A;  3PFI A;  1NJG A;  4DR3 M;  5EJC A;  4LJ7 A;  2Z4S A;  5BR8 M;  3U6Q A;  1XNR M;  2XGN A;  1DV0 A;  4AG5 A;  4XK8 F;  1Q39 A;  3UZU A;  4AKH A;  2DKL A;  5FTJ A;  3UK6 A;  4LRS A;  3GQ5 A;  4DR5 M;  2MRO B;  3U6D A;  3B74 A;  1L2C A;  3L25 A;  3L29 A;  2XFT A;  1GAB A;  1EIJ A;  4B7F A;  2DVW B;  3BXW A;  2V1U A;  3GO8 A;  4LF5 M;  3HU3 A;  3PXG A;  1J7K A;  2DWL A;  4X65 M;  2LVN C;  3FTD A;  1GL7 A;  1WR1 B;  2KNA A;  1SXJ C;  2A5Y B;  4BBA A;  4D82 A;  3GRY A;  1IXS B;  2OQ4 A;  1T6O A;  4AKG A;  3GLG A;  2F5Q A;  2VF7 A;  1HR0 M;  1D0K A;  3HJ8 A;  4GRI A;  5EP4 A;  4L78 A;  4JI0 M;  3J7B A;  3W0F A;  4LFA M;  1H6U A;  2RRU A;  4L16 A;  3PNV A;  2R46 A;  1VG5 A;  1N34 M;  2UUA M;  4LJA A;  4QNM A;  4DR6 M;  3UMM A;  2LVO C;  1A5T A;  3KVW A;  4DV2 M;  5KQD A;  4GKK M;  1HT2 E;  3AFH A;  2BJV A;  1R4G A;  4YY3 M;  4DV0 M;  3IG5 A;  3B7N A;  4ANR A;  2F5N A;  2JP7 A;  3J80 S;  5ITQ A;  3KOW E;  3VFD A;  3GPU A;  5DFL A;  2F5O A;  2LNH C;  4NOO B;  3HHX A;  1EFU B;  3E9S A;  2R62 A;  3AJI B;  2M60 A;  3U61 A;  3SYL A;  4GMQ A;  2DAG A;  5FSW A;  4QOZ C;  1D0M A;  4DV1 M;  3HGI A;  3I51 A;  5FLX S;  3M6A A;  2MR9 A;  5IWA M;  2JUJ A;  4QOS A;  1PJI A;  3HY5 A;  2B3T A;  1EE8 A;  3JAM S;  4BLC A;  2AHM A;  2ZTD A;  4PDG A;  2OPF A;  3I04 M;  4IBG A;  2HKJ A;  3GLH B;  4Q7J A;  2L4E A;  4QNR A;  5JI2 E;  1PM5 A;  1Q3C A;  1TGU A;  1TDH A;  2L09 A;  2XH9 A;  4M0D A;  4OU7 A;  2ERC A;  2KZU A;  3IHP A;  3L2A A;  4HL4 A;  4IBF A;  1V33 A;  2NQ8 C;  1YSY A;  3QAU A;  4M9Z A;  4JYA M;  3TWM A;  2QPA A;  1ZMW A;  3TWK A;  3K92 A;  1Q3B A;  5KPR A;  3VDU A;  1R5L A;  2YFQ A;  4L6V 6;  1L2B A;  4JV5 M;  4GIP A;  2K9D A;  1L8Q A;  3GP1 A;  1XNQ M;  4FCV A;  3SYK A;  3W0L B;  4PCZ A;  3TWL A;  1MU5 A;  1NO1 A;  2G3Q A;  3B9P A;  3KSX A;  3GQ4 A;  3B7Z A;  3U60 A;  2UU9 M;  4IJE A;  1R2Z A;  5IT9 S;  2ZBK B;  2QZ4 A;  3DFZ A;  3FYD A;  4JI3 M;  4NXN M;  1NVM A;  4HEO A;  4RNA A;  3U61 B;  1DGH A;  1IY1 A;  3SHG B;  2X49 A;  1IY2 A;  3HHY A;  2HCB A;  1W5S A;  1PJT A;  4DUY M;  2CV1 A;  4NL4 H;  3FUV A;  4BB9 A;  1MN3 A;  4LZJ A;  3KOZ E;  3I4V A;  1N36 M;  5C1B A;  2DAM A;  2FH0 A;  4DV3 M;  1QAN A;  1T43 A;  1V92 A;  2QSF X;  4FVM A;  4MGI E;  1IN8 A;  4W5W A;  4DV6 M;  4JI4 M;  4LF4 M;  4DV5 M;  2VF8 A;  2DZL A;  4JI6 M;  2CFO A;  1JB0 F;  2C9O A;  2O01 F;  3E4R A;  2EA0 A;  2QHO B;  3C9P A;  2Y0T A;  1MX0 A;  2YNM D;  3A46 A;  3GLF B;  2YR0 A;  1QZE A;  2CHQ A;  4II7 A;  1VEG A;  3BBZ A;  5KPT A;  1IXZ A;  1V34 A;  2KDL A;  2KEB A;  3KS4 A;  3GQ3 A;  2W82 A;  1NV8 A;  2C96 A;  4OVZ A;  5EXS A;  1Z5B A;  5H37 D;  2KA6 B;  3SAW A;  2R18 A;  1QUS A;  3HX3 A;  1NY5 A;  4AQY M;  4B08 A;  1GJS A;  2Y20 A;  4JI1 M;  4B3R M;  2FNA A;  3U6P A;  4B3M M;  1JQJ C;  1D0L A;  2LH0 A;  2VII A;  3GLG B;  1NJF A;  3B89 A;  3K2L A;  2R65 A;  1TDZ A;  1NSF A;  2MH8 A;  2ZAM A;  3NBI A;  3GRU A;  2QEN A;  2O25 A;  5ITY A;  2QNJ A;  2J7O A;  1IBL M;  4LJ8 A;  1N78 A;  2DI0 A;  2R4J A;  1Z6T A;  4IIW A;  4ZPX A;  4MB7 A;  1DGH B;  3KP1 E;  5FTK A;  3KS8 A;  3MMP A;  2V1C A;  4FCW A;  1E9R A;  1XHB A;  3CTW B;  1G59 A;  3H4J A;  3GLI B;  3UGJ A;  2VQE M;  3VK8 A;  3CGW A;  4CHT B;  1HJP A;  1DGB A;  1OKS A;  2KNV A;  5EP3 A;  3JR5 A;  4GH9 A;  3LQQ A;  2HWJ A;  1OIZ A;  3R8F A;  4FW9 A;  3FTC A;  3U5Z B;  2MJ5 B;  5ITT A;  1QDR A;  2VQF M;  4LG2 A;  1RU3 A;  4JI7 M;  1OAO C;  4QHT A;  1Z5C A;  1FJG M;  3LMM A;  4LF7 M;  4IJF A;  2DXI A;  3TQS A;  3QYE A;  2HAK A;  1XMO M;  4L15 A;  4B3T M;  2Q2E B;  2G8L A;  1R6B X;  3DOA A;  4R7G A;  3T1H M;  3EIH A;  1IN4 A;  4B3S M;  2L6O A;  1VQ1 A;  1WXQ A;  3PNY A;  2CE7 A;  1IXR C;  4KHP M;  4NSR A;  3FUX A;  3RGP A;  5A2Q S;  1F4I A;  4XBO A;  4TUW A;  2Y21 A;  4I5S A;  2UUC M;  3KW6 A;  5E26 A;  1G3I A;  3LCV B;  1GKI A;  2DHR A;  4FD2 A;  3T1Y M;  4JN6 A;  2RGH A;  4IBC A;  4JI8 M;  2CV0 A;  1GVN A;  1OAI A;  3KOX E;  1Q02 A;  4LCB A;  4NRV A;  4EIW A;  4LFC M;  4DR4 M;  2LTU A;  4LRT A;  5ITX E;  1IM2 A;  1SG9 A;  1JR3 A;  1TTE A;  1PJQ A;  1SXJ D;  4X64 M;  2EJS A;  3DZD A;  4G3O A;  2ZAO A;  1AIP C;  2R4E A;  2XZU A;  1L2D A;  2GNO A;  1GLN A;  1J09 A;  2FOI C;  2WSC F;  2FS1 A;  3K8Z A;  1XC8 A;  2J5Y A;  3Q8X A;  1HNX M;  4PDI A;  3IEC A;  3BOS A;  1UM8 A;  5ITU A;  2R0I A;  2HHH M;  5C18 A;  1NHG C;  1IN5 A;  1HQY E;  4Y28 F;  5FTN A;  2FE8 A;  2E5L M;  3MK6 A;  4MGK E;  2DAI A;  4GIT A;  1K3W A;  2R44 A;  3SMS A;  2KNZ A;  3U60 B;  1TH2 A;  3MJ5 A;  2MGW A;  3U5Z A;  1R7R A;  4LJ6 A;  5LMN M;  8CAT A;  3IG8 A;  1NNU C;  2HL7 A;  5BPV A;  2RKO A;  3GRR A;  5EQT A;  2GQF A;  4NC6 A;  2JZ0 A;  1SXJ B;  3FYC A;  3TL4 X;  3K9P A;  3VDP A;  2V6Z M;  2JWS A;  2Z7J A; 
#chains in the Genus database with same CATH homology
 1QAM A;  3SAU A;  2UXD M;  4NSO B;  4DR2 M;  2KRU A;  4AI6 A;  3LQR A;  4K0K M;  4JI5 M;  4I8O A;  4JI2 M;  1C1K A;  3KXE C;  4DUZ M;  1KSF X;  3D8L A;  2I7P A;  3GLF A;  1G41 A;  3M0E A;  3A42 A;  3KOY E;  5IZ7 D;  4REZ A;  2DZN B;  3U6E A;  4LF6 M;  4CIS A;  3U6C A;  2C5R A;  4IBJ A;  4X66 M;  2DWM A;  3NWL A;  4KLN A;  4OVZ B;  1QYR A;  1QZM A;  3WHK A;  1N33 M;  3T15 A;  1LV7 A;  3SAV A;  1N32 M;  1KFV A;  5KO3 A;  3LVW A;  3AOE A;  3KFU G;  4LJ5 A;  4LJ4 A;  3I4Y A;  3AL0 C;  5EXX A;  1ZQ9 A;  4FCT A;  2JA2 A;  2QBY B;  1E32 A;  3EIE A;  3KSJ A;  4OW0 A;  1GL6 A;  3HJS A;  2ZAN A;  3HU2 A;  4M9X A;  1XXH A;  1IBM M;  1HNW M;  4ITQ A;  1W5T A;  4NRW A;  2YQZ A;  3ZC7 B;  4QHS A;  4FWD A;  5JI3 E;  3U6S A;  1QVR A;  2XEP A;  1NHW C;  3HU1 A;  7CAT A;  4IBE A;  2C98 A;  2CHG A;  3HWS A;  3D8B A;  3ILK A;  1SXJ A;  2KRK A;  3SHF A;  4GC5 A;  3GLI A;  1ZAE A;  4WUR A;  2BNK A;  2UUB M;  4LGM A;  2BJW A;  2D7E A;  4D81 A;  1XMQ M;  4B7H A;  3FKE A;  3FTF A;  4DR7 M;  4AW4 A;  4A3V B;  1OFH A;  2QCU A;  2KW0 A;  2D7G A;  3WHL A;  4KO8 A;  1R2Y A;  3H4M A;  4MGZ E;  1L1T A;  3FUW A;  4KOD A;  3A98 B;  1DO0 A;  2UXC M;  1HNZ M;  4FWG A;  2K47 A;  3K1J A;  3J81 S;  4DV7 M;  2XLJ A;  4IBK A;  2I7N A;  2XFS A;  1I4W A;  3FUU A;  3GRV A;  4I4L A;  2DWZ B;  2KZS A;  3CF0 A;  4XGI A;  5F3W A;  3SBJ A;  2FFJ A;  1IY0 A;  4GKJ M;  2RGO A;  1QAO A;  4LFB M;  5GKN A;  3ZH9 B;  4G4R A;  2CHV A;  4LGY A;  1NNJ A;  1TH3 A;  4GC9 A;  4CGY B;  4GHL A;  4HLQ A;  2X4A A;  3FTE A;  4Z8X A;  5EP2 A;  3KP0 E;  2XF3 A;  2CUZ A;  2XZF A;  4G4O A;  1I94 M;  4AZF A;  3GPX A;  2O5R A;  4G4Q A;  4P16 A;  4AKI A;  4IBB A;  3J27 B;  3HHW A;  4X62 M;  2QP9 X;  2F5S A;  3GPP A;  5LMU M;  2R45 A;  2L7I A;  1OJL A;  2KXE A;  3RE8 A;  1TH4 A;  4B7G A;  3JR4 A;  3CF6 E;  5ITR A;  3SC3 A;  4L8R C;  1HQC A;  2CV2 A;  5FTL A;  4WW0 A;  3SAT A;  4MGY E;  2X8A A;  4G6Z A;  5FTM A;  3RGS A;  4JXJ A;  3TPZ A;  3QWL A;  1D2N A;  3T38 A;  3HHZ A;  3L27 A;  4LF8 M;  2XSZ A;  1XWI A;  1PJJ A;  4GHA A;  3J7A S;  3MHV C;  1YE9 A;  2C99 A;  4OX9 M;  1NY6 A;  4PD2 A;  5IRE B;  2M5Z A;  3HKP A;  3U6M A;  3LVV A;  3VK7 A;  4IBI A;  2DWN A;  4S12 A;  4RF0 A;  1K82 A;  3VKH A;  4LJ9 A;  1IBK M;  2P5T A;  1QQW A;  3GPY A;  4LY6 A;  1Z5A A;  1G8P A;  2LWX A;  5EXP A;  1K3X A;  1L1Z A;  4IBD A;  5EP1 A;  1E9S A;  3SFZ A;  4LZZ A;  2Y0Q A;  1IQP A;  3L28 A;  4MGH A;  4DV4 M;  3VLF B;  2QBY A;  1OFI A;  1DGG A;  2UXB M;  1XXH B;  4D80 A;  3DA1 A;  2F5P A;  3AOG A;  1HT1 E;  3SAR A;  3GLH A;  2EUC A;  3M7G A;  5DNY A;  3L26 A;  5DYI A;  1JR3 D;  4G4N A;  2D7H A;  2Z4R A;  5DYG A;  3TE6 A;  2L7H A;  1SXJ E;  3VKG A;  4MH0 E;  4RF1 A;  3UJN A;  1IN6 A;  3ZCB B;  1YUB A;  2J7N A;  1QAQ A;  3OTO M;  1VDD A;  3AKZ A;  4R3D A;  1IN7 A;  3A45 A;  5E6J A;  4YHH M;  2H1R A;  3R9X B;  4AG6 A;  2DZO B;  4Z6Y A;  1N77 A;  3AV0 A;  3FUT A;  5KPZ A;  3FD9 A;  1E94 E;  4M0W A;  4PT5 A;  3PVS A;  1J5E M;  3J2P B;  4B3R M;  1Z59 A;  3HJQ A;  3U6O A;  2C9C A;  3RFW A;  5ITX A;  1FNN A;  4FWH A;  2EO2 A;  3THG A;  2G5G X;  2ZM6 M;  1G4A E;  1ORY B;  4L4U A;  5EXT A;  4NXM M;  3KDS E;  4MM3 B;  2F4V M;  4I81 A;  4DR1 M;  1N75 A;  1T3T A;  1S3S A;  1DO2 A;  2LXE A;  2XSZ D;  2Z3X A;  5KQ8 A;  3U6L A;  1KYI A;  3AOE C;  4M9S A;  2CEA A;  3C58 A;  3SMP A;  1DGF A;  1X37 A;  3SAS A;  4LF9 M;  3CF2 A;  3PFI A;  1NJG A;  4DR3 M;  5EJC A;  4LJ7 A;  2Z4S A;  5BR8 M;  3U6Q A;  1XNR M;  2XGN A;  4AG5 A;  1Q39 A;  3UZU A;  4AKH A;  5FTJ A;  3GQ5 A;  3UK6 A;  4LRS A;  4DR5 M;  3U6D A;  1L2C A;  3L25 A;  3L29 A;  2XFT A;  4B7F A;  2DVW B;  2V1U A;  3GO8 A;  4LF5 M;  3HU3 A;  3PXG A;  1J7K A;  2DWL A;  4X65 M;  3FTD A;  1GL7 A;  1SXJ C;  2A5Y B;  4BBA A;  4D82 A;  3GRY A;  1IXS B;  2OQ4 A;  4AKG A;  3GLG A;  2F5Q A;  1HR0 M;  3HJ8 A;  4GRI A;  5EP4 A;  4L78 A;  4JI0 M;  3J7B A;  3W0F A;  4LFA M;  1H6U A;  4L16 A;  3PNV A;  2R46 A;  1N34 M;  2UUA M;  4LJA A;  4QNM A;  4DR6 M;  3UMM A;  3KVW A;  4DV2 M;  5KQD A;  4GKK M;  1HT2 E;  3AFH A;  2BJV A;  4YY3 M;  4DV0 M;  3IG5 A;  2F5N A;  3J80 S;  5ITQ A;  3KOW E;  3VFD A;  3GPU A;  2F5O A;  2LNH C;  4NOO B;  3HHX A;  3E9S A;  2R62 A;  3AJI B;  2M60 A;  3U61 A;  3SYL A;  4GMQ A;  5FSW A;  4QOZ C;  4DV1 M;  3HGI A;  3I51 A;  5FLX S;  3M6A A;  5IWA M;  4QOS A;  1PJI A;  1EE8 A;  3JAM S;  4BLC A;  2AHM A;  4PDG A;  2OPF A;  4IBG A;  2HKJ A;  3GLH B;  4QNR A;  5JI2 E;  1PM5 A;  1Q3C A;  1TGU A;  1TDH A;  2L09 A;  2XH9 A;  4M0D A;  4OU7 A;  2ERC A;  2KZU A;  3L2A A;  4HL4 A;  4IBF A;  2NQ8 C;  1YSY A;  3QAU A;  4M9Z A;  4JYA M;  3TWM A;  2QPA A;  3TWK A;  3K92 A;  1Q3B A;  5KPR A;  3VDU A;  2YFQ A;  1L2B A;  4JV5 M;  4GIP A;  1L8Q A;  3GP1 A;  1XNQ M;  4FCV A;  3SYK A;  3W0L B;  4PCZ A;  3TWL A;  1MU5 A;  3KSX A;  3B9P A;  3GQ4 A;  3U60 A;  2UU9 M;  4IJE A;  1R2Z A;  5IT9 S;  2ZBK B;  2QZ4 A;  3DFZ A;  3FYD A;  4JI3 M;  4NXN M;  1NVM A;  4RNA A;  3U61 B;  1DGH A;  1IY1 A;  3SHG B;  2X49 A;  1IY2 A;  3HHY A;  2HCB A;  1W5S A;  4DUY M;  2CV1 A;  4NL4 H;  3FUV A;  4BB9 A;  4LZJ A;  3KOZ E;  3I4V A;  1N36 M;  5C1B A;  4DV3 M;  1QAN A;  4FVM A;  4MGI E;  1IN8 A;  4W5W A;  4DV6 M;  4JI4 M;  4LF4 M;  4DV5 M;  4JI6 M;  2CFO A;  2C9O A;  3E4R A;  2EA0 A;  2Y0T A;  1MX0 A;  2YNM D;  3A46 A;  3GLF B;  2YR0 A;  2CHQ A;  4II7 A;  5KPT A;  1IXZ A;  2KEB A;  3KS4 A;  3GQ3 A;  2W82 A;  2C96 A;  4OVZ A;  5EXS A;  1Z5B A;  5H37 D;  2KA6 B;  3SAW A;  2R18 A;  4AQY M;  1NY5 A;  4B08 A;  2Y20 A;  4JI1 M;  2FNA A;  3U6P A;  4B3M M;  1JQJ C;  2LH0 A;  2VII A;  3GLG B;  1NJF A;  3K2L A;  2R65 A;  1TDZ A;  1NSF A;  2ZAM A;  3NBI A;  3GRU A;  2QEN A;  5ITY A;  2J7O A;  1IBL M;  4LJ8 A;  1N78 A;  2R4J A;  1Z6T A;  4IIW A;  4ZPX A;  4MB7 A;  1DGH B;  3KP1 E;  3KS8 A;  2V1C A;  4FCW A;  1E9R A;  1XHB A;  3CTW B;  1G59 A;  3GLI B;  3UGJ A;  2VQE M;  3VK8 A;  4CHT B;  1DGB A;  5EP3 A;  3JR5 A;  4GH9 A;  3LQQ A;  3R8F A;  4FW9 A;  3FTC A;  3U5Z B;  5ITT A;  2VQF M;  4LG2 A;  4JI7 M;  4QHT A;  1Z5C A;  1FJG M;  3LMM A;  4LF7 M;  4IJF A;  2DXI A;  3TQS A;  1XMO M;  4L15 A;  4B3T M;  2Q2E B;  2G8L A;  1R6B X;  3DOA A;  4R7G A;  3T1H M;  3EIH A;  1IN4 A;  4B3S M;  2L6O A;  3PNY A;  1WXQ A;  2CE7 A;  1IXR C;  4KHP M;  4NSR A;  3FUX A;  3RGP A;  5A2Q S;  4XBO A;  4TUW A;  2Y21 A;  4I5S A;  2UUC M;  3KW6 A;  5E26 A;  1G3I A;  1GKI A;  2DHR A;  4FD2 A;  3T1Y M;  4JN6 A;  2RGH A;  4IBC A;  4JI8 M;  2CV0 A;  1GVN A;  3KOX E;  4LCB A;  4NRV A;  4LFC M;  4EIW A;  4DR4 M;  4LRT A;  5ITX E;  1IM2 A;  1JR3 A;  1SXJ D;  4X64 M;  3DZD A;  2ZAO A;  2XZU A;  2R4E A;  1L2D A;  1GLN A;  1J09 A;  2FOI C;  3K8Z A;  1XC8 A;  3Q8X A;  1HNX M;  4PDI A;  3BOS A;  1UM8 A;  5ITU A;  2HHH M;  5C18 A;  1NHG C;  1IN5 A;  1HQY E;  5FTN A;  2FE8 A;  2E5L M;  3MK6 A;  4MGK E;  4GIT A;  1K3W A;  3SMS A;  3U60 B;  1TH2 A;  3MJ5 A;  3U5Z A;  1R7R A;  4LJ6 A;  5LMN M;  8CAT A;  3IG8 A;  1NNU C;  2HL7 A;  5BPV A;  2RKO A;  3GRR A;  5EQT A;  1SXJ B;  3FYC A;  3TL4 X;  3VDP A;  2V6Z M;  5FTK A;  2Z7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...