2F4VM

30s ribosome + designer antibiotic
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2f4vM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2f4vM02
2F5OA 4JI2M 5LMNM 5ITTA 3GP1A 4G4QA 1R2ZA 4DV3M 4OX9M 3U6OA 4LF9M 3T1HM 3DOAA 2HKJA 4LF7M 4DV5M 3J80S 1R2YA 4DUZM 2UXDM 3U6DA 4LF8M 4GKKM 1L1TA 3SAWA 3U6EA 2F5NA 5ITXE 3SASA 1HR0M 3VK7A 2UXCM 1J5EM 2VQFM 4LFAM 4DV1M 3GPUA 2VQEM 4DR5M 1IBKM 5BR8M 3GQ3A 4DV6M 3A42A 3C58A 1NNJA 4JI5M 1MU5A 4G4RA 3SAUA 2UU9M 4PCZA 5ITYA 1Z5CA 4NRVA 5ITRA 3SATA 5IT9S 4K0KM 3U6QA 3A46A 2F5SA 4CISA 4DR4M 4KHPM 1TDHA 3TWKA 1HNZM 2ZM6M 4LF5M 3U6LA 2OQ4A 4DR6M 3GQ5A 3GQ4A 1PJJA 4YY3M 4YHHM 3JR4A 4LFCM 4PDGA 4B3SM 1K82A 4JV5M 2F4VM 3T1YM 4DR1M 1XC8A 4LFBM 1PM5A 4GKJM 1Q3CA 1HNWM 1L2BA 4ITQA 1XMQM 4DV0M 4JI1M 2OPFA 4JI3M 2XZUA 3JAMS 1MX0A 1KFVA 5A2QS 2EA0A 1L2DA 3U6SA 4X62M 2XZFA 4AQYM 2UUBM 1EE8A 1PJIA 3GPPA 4X65M 4DUYM 1K3XA 1XNQM 5ITQA 5ITXA 3J81S 4G4OA 2Q2EB 2ZBKB 1N33M 1L1ZA 1N36M 4LF6M 3J7AS 1Z5BA 4JI6M 2F5QA 4MB7A 3U6PA 2UUCM 4JI0M 3JR5A 4JYAM 1Z59A 1K3WA 1FJGM 5FLXS 4NXMM 4JI8M 4NRWA 1Z5AA 1XMOM 1L2CA 2HHHM 1XNRM 3W0FA 3VK8A 4JI7M 3SBJA 3GPXA 3OTOM 4PD2A 4B3RM 4X66M 4PDIA 3TWMA 5IWAM 1IBLM 1Q39A 4DV4M 1IBMM 3GPYA 5ITUA 3U6CA 1Q3BA 4JI4M 1N34M 2E5LM 1N32M 3GO8A 4DV7M 3U6MA 3TWLA 2F5PA 4B3MM 1TDZA 4DR2M 5LMUM 4G4NA 4DR7M 1I94M 4B3TM 4X64M 3A45A 3SAVA 1HNXM 4DR3M 3SARA 2UXBM 4NXNM 4DV2M 4LF4M 2UUAM
chains in the Genus database with same CATH superfamily
2APLA 2KZUA 2F5OA 5LMNM 5ITTA 3VDUA 4NL4H 4OVZB 3GP1A 2FS1A 3FD9A 2J5YA 2KRKA 2Y0TA 4G4QA 2XFSA 5EQTA 4LF9M 1JB0F 1NVMA 3DOAA 3HHZA 1W5SA 3NWLA 1LV7A 2D7HA 4LF7M 2MJ5B 2D7EA 2R0IA 1R2YA 3FRHA 1A5TA 2FNAA 2OPFA 4A3VB 1HT2E 3VKHA 2F5NA 2I7PA 2O01F 3CF2A 3KP0E 4IBKA 4IJFA 3SASA 3L27A 2DAIA 2V6ZM 5EXPA 1J5EM 2VQFM 1WJ7A 2DZOB 3HU3A 4LFAM 3K9OA 2C5RA 4L6V6 2QBYA 3GQ3A 1VDDA 4AG5A 4M9ZA 4DV6M 1EFUB 2Z7JA 2C96A 1ZMWA 2DVWB 2L6OA 3GRUA 3U6MA 2QP9X 4MH0E 3T38A 4G4RA 3U5ZB 2FE8A 3DFZA 3WHLA 3UMMA 3KFUG 4M9SA 1OIPA 5IT9S 2O25A 3U61A 3SC3A 3A46A 1XXHA 4CISA 4LZZA 3AL0C 2VDBB 4KHPM 3TWKA 1TH3A 4FCTA 2ZM6M 2OQ4A 3GQ5A 3HJQA 4OU7A 3GLIB 1GL7A 1PJJA 1XB2B 2DHYA 1H6UA 3HKPA 2QZ4A 2L7HA 1K82A 4S12A 1KYIA 1J7KA 3DA1A 4DR1M 1XC8A 1PRBA 2QHOB 4LFBM 4GKJM 3KW6A 2L09A 4BLCA 1QUTA 3IECA 3D8BA 3GRRA 1SXJB 3VFDA 2LH0A 1N78A 4RF0A 4IBJA 2R45A 2ZAMA 3B9PA 1XMQM 1QDTA 2HL7A 1NV8A 4L16A 4JI3M 2C9OA 3M7GA 3BBZA 4QHTA 1R4GA 2XZUA 1KFVA 1OIZA 1L2DA 1IXZA 3PXGA 2RRUA 2I7NA 1AUAA 3AOGA 2CE7A 3FKEA 5DFLA 3FUWA 4X65M 2J7OA 4WP2A 4FWGA 5ITXA 2EKKA 4DBGB 5EXSA 4II7A 1L1ZA 3KSXA 5IREB 3LW5F 4MB7A 1OJLA 3U6PA 2F5QA 2UUCM 2JWSA 3LVWA 4JYAM 2JA2A 3K8ZA 1VG5A 2M5ZA 3QWLA 1K3WA 1E94E 2Z8YM 1IXRC 2KNVA 4FWHA 1NSFA 4KLNA 2K9DA 1L2CA 1ZV1A 4LG2A 4XK8F 1XNRM 1DGGA 1R5LA 4D80A 2BNKA 5DNYA 1DGHB 2M60A 2R46A 7CATA 4Z8XA 3GPXA 1ZMUA 3BXWA 2KRUA 3MJ5A 2KNAA 3FUXA 4EIWA 3ZCBB 4DV4M 4FW9A 1IBMM 3FTCA 4MGIE 3J27B 2LHCA 5FTMA 5ITUA 1XXHE 1JR3D 2JY5A 1Q3BA 3L28A 4GMQA 2L2DA 3LVVA 4JI4M 1OKSA 1QDRA 3KS4A 3EIEA 3VDPA 2ZTCA 2E5LM 2DNAA 1YSYA 1GL6A 3SFZA 3TWLA 1VEKA 2QSFX 2RGOA 3QYBA 4B3MM 1G4AE 4F2LA 2KEBA 2R44A 4I4LA 4IBDA 1TGUA 3C9PA 3RE8A 4DR7M 4MGHA 4X64M 3VLFB 1TH4A 2VIIA 3HZJA 3FTEA 4P17A 3SMSA 2UXBM 2CUZA 2LWXA 1DO2A 5IZ7D 1QVRA 2DHRA 2R4JA 4NSRA 2DAEA 4KT0F 4NSOB 2XFTA 1HQYE 4I8OA 5EXXA 2UUAM 1R2ZA 4IIWA 1VEJA 2C99A 3B7NA 4IBCA 3U60B 1DO0A 1QAOA 3T1HM 4FCVA 4REZA 2HKJA 1E9SA 2N35A 4NC6A 4DV5M 3D8LA 1D0KA 4IBGA 3L25A 4AKIA 1NJGA 2UXDM 3U6DA 4AKHA 3H4MA 4G3OA 1R7RA 1L1TA 3PNYA 5EP4A 3U6EA 4AG6A 5ITXE 3HX3A 4MGZE 3J2PB 4UN2B 2DKLA 1D0LA 4DV1M 3GPUA 2KA6B 2DZLA 1OFIA 4M0WA 3J7BA 3C58A 2QQ8A 4LJ8A 3SAUA 1ZMVA 1CUKA 5ITYA 1Y8GA 4B08A 5ITRA 3AJIB 3SYLA 2R65A 3SHGB 3SMPA 1TDHA 5FTLA 1HNZM 2X8AA 1GO5A 4QHSA 5FTNA 5EP1A 3UJNA 1NY5A 3GQ4A 3GLGA 1YE9A 5C18A 2QBYB 3JR4A 3GLFA 1IM2A 5EP2A 3KSJA 5DYIA 2HAKA 1DV0A 2C98A 4QOZC 1JR3A 2DXIA 5KO3A 3R8FA 1IXSA 3E9SA 3AV0A 1PM5A 1DGFA 5BPVA 2L7IA 3H4JA 1OQYA 1Q3CA 1XXHB 1I4WA 2BJWA 2MGWA 3LQQA 1OAOC 4IBIA 1V34A 4ITQA 4B7GA 3FYDA 1MJGM 4LJ9A 1NNUC 1MX0A 2EA0A 2KHHA 3I4YA 2R18A 3HGIA 1L8QA 3GLHA 4HL4A 5JI3E 3FE3A 3K9PA 3LCVB 4AQYM 1WGLA 3HU1A 1C7YA 1EE8A 4I81A 4DUYM 1D0MA 3HWSA 1XNQM 1GLNA 5L8RF 2YQZA 2Q2EB 4IBEA 1S3SA 2DAKA 5KQ8A 2X4AA 2ZBKB 2CV1A 3HJ8A 2LBCA 1N36M 1N33M 3UZUA 4JI6M 2QCUA 4JI0M 2LVPC 1GKIA 1G8PA 4CGYB 4B7HA 1FJGM 3E4RA 2CFOA 1T43A 2R4EA 3FUTA 4NXMM 4NOOB 1Z5AA 2WSCF 1XMOM 2HHHM 4D82A 2LVQD 1HJPA 1X37A 2P5TA 2B3TA 2XEPA 3MHVC 3T6PA 4B3RM 1XHBA 3LCUA 5IWAM 1DGBA 1QUSA 2J7NA 3GPYA 2Y21A 3Q8XA 3U5ZA 4LJ5A 2G3QA 1P3QQ 2QENA 4QOSA 1VDLA 3FUUA 3I4VA 4LRSA 1N34M 2LVAA 2OO9A 2MR9A 4KODA 2EUCA 1HT1E 1VQ1A 1XWIA 1N32M 4RNAA 1KSFX 1N77A 4P16A 3UK6A 1OTRA 1YUBA 1E9RA 2CHVA 2KZSA 5GKNA 4L8RC 2QPAA 4DR2M 3GLIA 5LMUM 1IN6A 1G59A 1F4IA 1JR3E 4FWDA 1I94M 2FOIC 2L4EA 1HNXM 2O5RA 1QAMA 1TR8A 1OFHA 2X49A 4LF4M 2VF7A 1C1KA 1N75A 2WZJA 2D7GA 1GJSA 1QZEA 3L26A 4IBFA 4OX9M 3U6OA 1D2NA 3B7QA 2OOBA 1SG9A 2CRUA 5F3WA 5E6JA 1NHWC 3EIHA 2DAGA 5FSWA 2HWJA 2OOAA 2JXNA 4DUZM 1QAQA 1TTEA 3SAWA 3GRYA 3LQRA 4MGKE 2EKFA 1HR0M 3VK7A 2CWBA 2UXCM 4W5WA 4AZFA 4QNRA 2VQEM 1BVSA 1AIPC 3RGPA 1IBKM 5BR8M 3HHXA 2H5XA 2NQ8C 3HHWA 2AHMA 3A42A 2W82A 2K0BX 1MU5A 1Z5CA 4GIPA 4NRVA 3SATA 3ZQJA 3DZDA 4K0KM 4DR4M 2CHQA 4AW4A 3B7ZA 3I51A 1Q02A 3I04M 1ZQ9A 3SHFA 4LF5M 1DGHA 1FNNA 2KNZA 1YLAA 3AKZA 3SYKA 4YHHM 4AI6A 4PDGA 1G41A 3IHPA 2Z4RA 4IBBA 1IY1A 1GABA 1IY2A 4JV5M 4OW0A 4XGIA 3FYCA 3KVWA 2G8LA 3T1YM 3B74A 2ZAOA 4LJ4A 2LVNC 2LXEA 1NO1A 3UGJA 1HNWM 3QYEA 3PFIA 1L2BA 3ILKA 4LJ6A 1ORYB 1R6BX 4WW0A 4JXJA 4JI1M 4L4UA 3JAMS 5FTJA 3M0EA 3PVSA 4X62M 3R9XB 4LJAA 3F92A 1K3XA 2BJVA 3TPZA 3KS8A 4TUWA 1IN4A 2Y20A 2R6FA 3J81S 3U60A 4LF6M 1Z5BA 2BWBA 2YR0A 3HJSA 4R3DA 4CJ6A 1GJTA 3JR5A 2JUJA 2V1UA 1T6OA 1Z59A 1WXQA 5KPZA 4B7FA 3U61B 2XGNA 3ZC7B 4D81A 1SXJD 4GITA 3RFWA 4NRWA 3W0FA 3VK8A 1WHCA 2DWLA 2JP7A 4IJEA 3TL4X 3OTOM 3KP1E 4PD2A 2LVOC 1PJQA 1IN7A 1Q39A 1WR1B 2LHGA 3LMMA 5KQDA 5EXTA 3QAUA 4AKGA 1WGNA 3B89A 4RF1A 3U6CA 3AFHA 1V92A 1WIVA 2H1RA 4OVZA 3GRVA 3RGSA 2HCBA 3FUVA 3GO8A 4DV7M 2Z4SA 3TE6A 2F5PA 2K6BA 4F1IA 4GHLA 2V1CA 1TDZA 3VKGA 3E21A 3KOZE 3V76A 3K1JA 4BB9A 2ZANA 4B3TM 2FH0A 4JN6A 1PJSA 4DR3M 4DV2M 3A98B 3CF6E 2WSFF 3HHYA 3Q8GA 5C1BA 4JI2M 2JZ0A 4BBAA 4DV3M 2JY8A 2L4FA 2XSZA 3HY5A 1NY6A 4Q7JA 2XLJA 3MMPA 3CGWA 3M6AA 2C9CA 4M0DA 1RU3A 4LGYA 4GH9A 2JY6B 3J80S 3KOWE 1UFZA 4MGYE 1IFYA 1EIJA 4LF8M 4GKKM 2GQFA 4LGMA 3GLGE 3W0LB 2R62A 3THGA 3W68A 3GLFE 1QQWA 2DWNA 4DR5M 1G71A 1V33A 1T3TA 1NNJA 3HU2A 1GVNA 4JI5M 2UU9M 4PCZA 2A5YB 5DYGA 2CP8A 3U6QA 2F5SA 1Z6TA 4Y28F 3IG8A 1SXJA 2K47A 2DI0A 4LY6A 2XH9A 1VEGA 3AOEA 1IN5A 3I01M 3WHKA 3KOYE 3U6LA 4DR6M 1IN8A 3BOSA 3GLHE 1OAIA 4YY3M 4LFCM 2JNHA 1NV9A 2DWZB 4PT5A 8CATA 2JZ1A 4B3SM 2Z3XA 2F4VM 2ERCA 4GC9A 3C3DA 4CHTB 2RGHA 2MH8A 3TQSA 5H37D 5KPTA 4Z6YA 3PNVA 2CV2A 3L2AA 2MROB 4L15A 3ZH9B 2G5GX 4DV0M 4R7GA 3NBIA 2YNMD 1LTMA 1QANA 4HEOA 5A2QS 5EP3A 1G3IA 4I5SA 3U6SA 2LTUA 2DZNB 2XZFA 5KPRA 1IQPA 4KO8A 4LCBA 3K2LA 3L29A 2UUBM 1QZMA 3FTFA 3KXEC 2JY7A 3FTDA 1PJIA 3CTWB 3GPPA 2QNJA 5ITQA 4G4OA 2RKOA 1HQCA 3J7AS 4ZPXA 4CIZA 3CF0A 1PJTA 4MM3B 4LJ7A 2XF3A 4LRTA 3T15A 1MN3A 3NBXX 4GRIA 4HLQA 4FD2A 4LZJA 4GHAA 5FLXS 1E32A 3GLIE 4JI8M 2WSEF 2XSZD 1J09A 4FVMA 4JI7M 3SBJA 1QYRA 3GLGB 5E26A 2ZTDA 4GC5A 1UM8A 4M9XA 4R71A 4X66M 4ANRA 4PDIA 3TWMA 3IG5A 2DENA 3GLFB 1IBLM 2VF8A 3KOXE 3FRIA 1IY0A 4G6ZA 4QNMA 5FTKA 4FCWA 3KDSE 1SXJE 1SXJC 1IXSB 4RKUF 5JI2E 2DWMA 2CV0A 2GNOA 3AOEC 1W5TA 2Y0QA 2KW0A 3MK6A 1JQJC 3C3EA 1TH2A 1NHGC 1TF0B 2YFQA 2LNHC 1PGYA 3E46A 3K92A 4L78A 4WURA 3W67A 2DAMA 4XBOA 2FFJA 4G4NA 2EJSA 1ZAEA 3A45A 2CEAA 2KDLA 2KXEA 2EO2A 3SAVA 2CHGA 3SARA 2BWEA 3GLHB 4NXNM 5EJCA 4GEWA 1NJFA
chains in the Genus database with same CATH topology
2KZUA 2F5OA 5LMNM 5ITTA 3VDUA 4NL4H 4OVZB 3GP1A 3FD9A 4G4QA 2KRKA 2Y0TA 2XFSA 5EQTA 4LF9M 1NVMA 3DOAA 3HHZA 1W5SA 3NWLA 1LV7A 2D7HA 4LF7M 2D7EA 1R2YA 2FNAA 4A3VB 1HT2E 2F5NA 2I7PA 3KP0E 3CF2A 4IBKA 4IJFA 3SASA 3L27A 2V6ZM 5EXPA 1J5EM 2VQFM 2DZOB 3HU3A 4LFAM 2C5RA 2QBYA 3GQ3A 1VDDA 4AG5A 4M9ZA 4DV6M 2Z7JA 2C96A 3GRUA 2DVWB 2L6OA 2QP9X 4MH0E 3T38A 4G4RA 3U5ZB 2FE8A 3DFZA 3WHLA 3UMMA 3KFUG 4M9SA 5IT9S 3U61A 3SC3A 3A46A 1XXHA 4CISA 4LZZA 3AL0C 4KHPM 3TWKA 1TH3A 4FCTA 2ZM6M 2OQ4A 3GQ5A 3HJQA 4OU7A 3GLIB 1GL7A 1PJJA 1H6UA 3HKPA 2QZ4A 2L7HA 1K82A 4S12A 1KYIA 1J7KA 3DA1A 4DR1M 1XC8A 4LFBM 4GKJM 3KW6A 2L09A 4BLCA 3D8BA 3GRRA 1SXJB 3VFDA 2LH0A 1N78A 4RF0A 4IBJA 2R45A 2ZAMA 3B9PA 1XMQM 4L16A 2HL7A 4JI3M 2OPFA 2XZUA 2C9OA 3M7GA 4QHTA 1KFVA 1L2DA 1IXZA 3PXGA 2I7NA 3AOGA 2CE7A 3FKEA 3FUWA 4X65M 2J7OA 4FWGA 5ITXA 5EXSA 4II7A 1L1ZA 3KSXA 5IREB 2F5QA 4MB7A 1OJLA 3U6PA 2UUCM 3LVWA 4JYAM 2JA2A 3K8ZA 2M5ZA 1K3WA 3QWLA 1E94E 4FWHA 1IXRC 1NSFA 4KLNA 1L2CA 1XNRM 4LG2A 1DGGA 4D80A 2BNKA 5DNYA 1DGHB 2M60A 2R46A 7CATA 4Z8XA 3GPXA 2KRUA 3MJ5A 3FUXA 4EIWA 3ZCBB 4DV4M 4FW9A 1IBMM 3FTCA 4MGIE 3J27B 5FTMA 5ITUA 1JR3D 3L28A 1Q3BA 4GMQA 4JI4M 3LVVA 3KS4A 3VDPA 3EIEA 2E5LM 1YSYA 1GL6A 3SFZA 3TWLA 2RGOA 4B3MM 1G4AE 2KEBA 4I4LA 4IBDA 1TGUA 3RE8A 4DR7M 4MGHA 4X64M 3VLFB 1TH4A 2VIIA 3FTEA 3SMSA 2UXBM 2CUZA 2LWXA 1DO2A 5IZ7D 1QVRA 2R4JA 2DHRA 4NSRA 4NSOB 2UUAM 5EXXA 2XFTA 1HQYE 4I8OA 1R2ZA 4IIWA 2C99A 4IBCA 3U60B 1DO0A 1QAOA 3T1HM 4FCVA 4REZA 2HKJA 1E9SA 4DV5M 3D8LA 4IBGA 3L25A 4AKIA 1NJGA 2UXDM 3U6DA 4AKHA 3H4MA 1R7RA 1L1TA 3PNYA 5EP4A 3U6EA 4AG6A 5ITXE 4MGZE 3J2PB 4DV1M 3GPUA 2KA6B 1OFIA 4M0WA 3J7BA 3C58A 4LJ8A 3SAUA 5ITYA 4B08A 5ITRA 3AJIB 3SYLA 2R65A 3SHGB 3SMPA 1TDHA 5FTLA 1HNZM 2X8AA 4QHSA 5FTNA 5EP1A 3UJNA 1NY5A 3GQ4A 3GLGA 1YE9A 5C18A 2QBYB 3JR4A 3GLFA 1IM2A 5EP2A 3KSJA 5DYIA 2C98A 4QOZC 1JR3A 2DXIA 5KO3A 3R8FA 3E9SA 3AV0A 1PM5A 1DGFA 5BPVA 2L7IA 1Q3CA 1XXHB 2BJWA 1I4WA 3LQQA 4IBIA 4ITQA 4B7GA 3FYDA 4LJ9A 1NNUC 1MX0A 2EA0A 3I4YA 2R18A 3HGIA 1L8QA 3GLHA 4HL4A 5JI3E 4AQYM 3HU1A 1EE8A 4I81A 4DUYM 1XNQM 3HWSA 1GLNA 2YQZA 2Q2EB 4IBEA 1S3SA 5KQ8A 2X4AA 2ZBKB 2CV1A 3HJ8A 1N36M 1N33M 3UZUA 4JI6M 2QCUA 4JI0M 1GKIA 1G8PA 4CGYB 4B7HA 1FJGM 3E4RA 2CFOA 3FUTA 2R4EA 4NXMM 4NOOB 1Z5AA 1XMOM 2HHHM 4D82A 1X37A 2P5TA 2XEPA 3MHVC 4B3RM 1XHBA 5IWAM 1DGBA 2J7NA 3GPYA 2Y21A 3Q8XA 3U5ZA 4LJ5A 2QENA 4QOSA 1N34M 3FUUA 3I4VA 4LRSA 4KODA 2EUCA 1HT1E 1XWIA 1N32M 4RNAA 1KSFX 1N77A 4P16A 3UK6A 1YUBA 1E9RA 2CHVA 2KZSA 5GKNA 4L8RC 2QPAA 4DR2M 3GLIA 5LMUM 1IN6A 1G59A 4FWDA 1I94M 2FOIC 1HNXM 2O5RA 1QAMA 1OFHA 2X49A 4LF4M 1C1KA 1N75A 2D7GA 3L26A 4IBFA 4OX9M 3U6OA 1D2NA 5F3WA 5E6JA 1NHWC 3EIHA 5FSWA 4DUZM 1QAQA 3SAWA 3GRYA 3LQRA 4MGKE 1HR0M 3VK7A 2UXCM 4W5WA 4AZFA 4QNRA 2VQEM 3RGPA 1IBKM 5BR8M 3HHXA 2NQ8C 3HHWA 2AHMA 3A42A 2W82A 1MU5A 1Z5CA 4GIPA 4NRVA 3SATA 3DZDA 4K0KM 4DR4M 2CHQA 4AW4A 3I51A 1ZQ9A 3SHFA 4LF5M 1DGHA 1FNNA 3AKZA 3SYKA 4YHHM 4AI6A 4PDGA 1G41A 2Z4RA 4IBBA 1IY1A 1IY2A 4JV5M 4OW0A 4XGIA 3FYCA 3KVWA 2G8LA 3T1YM 2ZAOA 4LJ4A 2LXEA 3UGJA 1HNWM 3PFIA 1L2BA 3ILKA 4LJ6A 1ORYB 1R6BX 4WW0A 4JXJA 4JI1M 4L4UA 3JAMS 5FTJA 3M0EA 3PVSA 4X62M 3R9XB 4LJAA 1K3XA 2BJVA 3TPZA 3KS8A 4TUWA 1IN4A 2Y20A 3J81S 3U60A 4LF6M 1Z5BA 3HJSA 2YR0A 4R3DA 3JR5A 2V1UA 5KPZA 1Z59A 1WXQA 4B7FA 3U61B 2XGNA 3ZC7B 4D81A 1SXJD 4GITA 3RFWA 4NRWA 3W0FA 3VK8A 2DWLA 4IJEA 3TL4X 3OTOM 3KP1E 4PD2A 1IN7A 1Q39A 3LMMA 5KQDA 5EXTA 3QAUA 4AKGA 4RF1A 3U6CA 3AFHA 2H1RA 4OVZA 3GRVA 3RGSA 3FUVA 2HCBA 3GO8A 4DV7M 2Z4SA 3TE6A 2F5PA 4GHLA 2V1CA 1TDZA 3VKGA 4BB9A 3KOZE 2ZANA 4B3TM 4JN6A 4DR3M 4DV2M 3A98B 3CF6E 3HHYA 5C1BA 4JI2M 4BBAA 4DV3M 2XSZA 1NY6A 2XLJA 3M6AA 4LGYA 2C9CA 4M0DA 4GH9A 3J80S 3KOWE 4MGYE 4LF8M 4GKKM 4LGMA 3W0LB 2R62A 3THGA 1QQWA 2DWNA 4DR5M 1T3TA 1NNJA 3HU2A 1GVNA 4JI5M 2UU9M 4PCZA 2A5YB 5DYGA 3U6QA 2F5SA 1Z6TA 3IG8A 1SXJA 2K47A 4LY6A 2XH9A 3AOEA 1IN5A 3WHKA 3KOYE 3U6LA 4DR6M 1IN8A 3BOSA 4YY3M 4LFCM 2DWZB 4PT5A 8CATA 4B3SM 2Z3XA 2F4VM 2ERCA 4GC9A 4CHTB 2RGHA 5H37D 3TQSA 5KPTA 4Z6YA 3PNVA 2CV2A 3L2AA 3ZH9B 4L15A 2G5GX 4DV0M 4R7GA 3NBIA 2YNMD 1QANA 5A2QS 5EP3A 1G3IA 4I5SA 3U6SA 1NJFA 2DZNB 2XZFA 5KPRA 1IQPA 4KO8A 4LCBA 3K2LA 3L29A 2UUBM 1QZMA 3FTFA 3KXEC 3FTDA 1PJIA 3CTWB 3GPPA 5ITQA 4G4OA 2RKOA 1HQCA 3J7AS 4ZPXA 3CF0A 4MM3B 4LJ7A 2XF3A 4LRTA 3T15A 4GRIA 4HLQA 4FD2A 4LZJA 4GHAA 5FLXS 1E32A 4JI8M 2XSZD 1J09A 4FVMA 4JI7M 3SBJA 1QYRA 3GLGB 5E26A 4GC5A 4M9XA 1UM8A 4X66M 4PDIA 3TWMA 3IG5A 3GLFB 1IBLM 3KOXE 4QNMA 1IY0A 4G6ZA 5FTKA 4FCWA 3KDSE 1SXJE 1SXJC 1IXSB 5JI2E 2DWMA 2CV0A 3AOEC 1W5TA 2Y0QA 2KW0A 3MK6A 1JQJC 3U6MA 1TH2A 1NHGC 2YFQA 4L78A 2LNHC 3K92A 3VKHA 4WURA 4XBOA 2FFJA 4G4NA 1ZAEA 3A45A 2CEAA 2KXEA 3SAVA 2EO2A 2CHGA 3SARA 3GLHB 4NXNM 5EJCA 3K1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5O A;  4JI2 M;  5LMN M;  5ITT A;  3GP1 A;  4G4Q A;  1R2Z A;  4DV3 M;  4OX9 M;  3U6O A;  4LF9 M;  3T1H M;  3DOA A;  2HKJ A;  4LF7 M;  4DV5 M;  3J80 S;  1R2Y A;  4DUZ M;  2UXD M;  3U6D A;  4LF8 M;  4GKK M;  1L1T A;  3SAW A;  3U6E A;  2F5N A;  5ITX E;  3SAS A;  1HR0 M;  3VK7 A;  2UXC M;  1J5E M;  2VQF M;  4LFA M;  4DV1 M;  3GPU A;  2VQE M;  4DR5 M;  1IBK M;  5BR8 M;  3GQ3 A;  4DV6 M;  3A42 A;  3C58 A;  1NNJ A;  4JI5 M;  1MU5 A;  4G4R A;  3SAU A;  2UU9 M;  4PCZ A;  5ITY A;  1Z5C A;  4NRV A;  5ITR A;  3SAT A;  5IT9 S;  4K0K M;  3U6Q A;  3A46 A;  2F5S A;  4CIS A;  4DR4 M;  4KHP M;  1TDH A;  3TWK A;  1HNZ M;  2ZM6 M;  4LF5 M;  3U6L A;  2OQ4 A;  4DR6 M;  3GQ5 A;  3GQ4 A;  1PJJ A;  4YY3 M;  4YHH M;  3JR4 A;  4LFC M;  4PDG A;  4B3S M;  1K82 A;  4JV5 M;  2F4V M;  3T1Y M;  4DR1 M;  1XC8 A;  4LFB M;  1PM5 A;  4GKJ M;  1Q3C A;  1HNW M;  1L2B A;  4ITQ A;  1XMQ M;  4DV0 M;  4JI1 M;  2OPF A;  4JI3 M;  2XZU A;  3JAM S;  1MX0 A;  1KFV A;  5A2Q S;  2EA0 A;  1L2D A;  3U6S A;  4X62 M;  2XZF A;  4AQY M;  2UUB M;  1EE8 A;  1PJI A;  3GPP A;  4X65 M;  4DUY M;  1K3X A;  1XNQ M;  5ITQ A;  5ITX A;  3J81 S;  4G4O A;  2Q2E B;  2ZBK B;  1N33 M;  1L1Z A;  1N36 M;  4LF6 M;  3J7A S;  1Z5B A;  4JI6 M;  2F5Q A;  4MB7 A;  3U6P A;  2UUC M;  4JI0 M;  3JR5 A;  4JYA M;  1Z59 A;  1K3W A;  1FJG M;  5FLX S;  4NXM M;  4JI8 M;  4NRW A;  1Z5A A;  1XMO M;  1L2C A;  2HHH M;  1XNR M;  3W0F A;  3VK8 A;  4JI7 M;  3SBJ A;  3GPX A;  3OTO M;  4PD2 A;  4B3R M;  4X66 M;  4PDI A;  3TWM A;  5IWA M;  1IBL M;  1Q39 A;  4DV4 M;  1IBM M;  3GPY A;  5ITU A;  3U6C A;  1Q3B A;  4JI4 M;  1N34 M;  2E5L M;  1N32 M;  3GO8 A;  4DV7 M;  3U6M A;  3TWL A;  2F5P A;  4B3M M;  1TDZ A;  4DR2 M;  5LMU M;  4G4N A;  4DR7 M;  1I94 M;  4B3T M;  4X64 M;  3A45 A;  3SAV A;  1HNX M;  4DR3 M;  3SAR A;  2UXB M;  4NXN M;  4DV2 M;  4LF4 M;  2UUA M; 
#chains in the Genus database with same CATH topology
 2APL A;  2KZU A;  2F5O A;  5LMN M;  5ITT A;  3VDU A;  4NL4 H;  4OVZ B;  3GP1 A;  2FS1 A;  3FD9 A;  2J5Y A;  2KRK A;  2Y0T A;  4G4Q A;  2XFS A;  5EQT A;  4LF9 M;  1JB0 F;  1NVM A;  3DOA A;  3HHZ A;  1W5S A;  3NWL A;  1LV7 A;  2D7H A;  4LF7 M;  2MJ5 B;  2D7E A;  2R0I A;  1R2Y A;  3FRH A;  1A5T A;  2FNA A;  2OPF A;  4A3V B;  1HT2 E;  3VKH A;  2F5N A;  2I7P A;  2O01 F;  3CF2 A;  3KP0 E;  4IBK A;  4IJF A;  3SAS A;  3L27 A;  2DAI A;  2V6Z M;  5EXP A;  1J5E M;  2VQF M;  1WJ7 A;  2DZO B;  3HU3 A;  4LFA M;  3K9O A;  2C5R A;  4L6V 6;  2QBY A;  3GQ3 A;  1VDD A;  4AG5 A;  4M9Z A;  4DV6 M;  1EFU B;  2Z7J A;  2C96 A;  1ZMW A;  2DVW B;  2L6O A;  3GRU A;  3U6M A;  2QP9 X;  4MH0 E;  3T38 A;  4G4R A;  3U5Z B;  2FE8 A;  3DFZ A;  3WHL A;  3UMM A;  3KFU G;  4M9S A;  1OIP A;  5IT9 S;  2O25 A;  3U61 A;  3SC3 A;  3A46 A;  1XXH A;  4CIS A;  4LZZ A;  3AL0 C;  2VDB B;  4KHP M;  3TWK A;  1TH3 A;  4FCT A;  2ZM6 M;  2OQ4 A;  3GQ5 A;  3HJQ A;  4OU7 A;  3GLI B;  1GL7 A;  1PJJ A;  1XB2 B;  2DHY A;  1H6U A;  3HKP A;  2QZ4 A;  2L7H A;  1K82 A;  4S12 A;  1KYI A;  1J7K A;  3DA1 A;  4DR1 M;  1XC8 A;  1PRB A;  2QHO B;  4LFB M;  4GKJ M;  3KW6 A;  2L09 A;  4BLC A;  1QUT A;  3IEC A;  3D8B A;  3GRR A;  1SXJ B;  3VFD A;  2LH0 A;  1N78 A;  4RF0 A;  4IBJ A;  2R45 A;  2ZAM A;  3B9P A;  1XMQ M;  1QDT A;  2HL7 A;  1NV8 A;  4L16 A;  4JI3 M;  2C9O A;  3M7G A;  3BBZ A;  4QHT A;  1R4G A;  2XZU A;  1KFV A;  1OIZ A;  1L2D A;  1IXZ A;  3PXG A;  2RRU A;  2I7N A;  1AUA A;  3AOG A;  2CE7 A;  3FKE A;  5DFL A;  3FUW A;  4X65 M;  2J7O A;  4WP2 A;  4FWG A;  5ITX A;  2EKK A;  4DBG B;  5EXS A;  4II7 A;  1L1Z A;  3KSX A;  5IRE B;  3LW5 F;  4MB7 A;  1OJL A;  3U6P A;  2F5Q A;  2UUC M;  2JWS A;  3LVW A;  4JYA M;  2JA2 A;  3K8Z A;  1VG5 A;  2M5Z A;  3QWL A;  1K3W A;  1E94 E;  2Z8Y M;  1IXR C;  2KNV A;  4FWH A;  1NSF A;  4KLN A;  2K9D A;  1L2C A;  1ZV1 A;  4LG2 A;  4XK8 F;  1XNR M;  1DGG A;  1R5L A;  4D80 A;  2BNK A;  5DNY A;  1DGH B;  2M60 A;  2R46 A;  7CAT A;  4Z8X A;  3GPX A;  1ZMU A;  3BXW A;  2KRU A;  3MJ5 A;  2KNA A;  3FUX A;  4EIW A;  3ZCB B;  4DV4 M;  4FW9 A;  1IBM M;  3FTC A;  4MGI E;  3J27 B;  2LHC A;  5FTM A;  5ITU A;  1XXH E;  1JR3 D;  2JY5 A;  1Q3B A;  3L28 A;  4GMQ A;  2L2D A;  3LVV A;  4JI4 M;  1OKS A;  1QDR A;  3KS4 A;  3EIE A;  3VDP A;  2ZTC A;  2E5L M;  2DNA A;  1YSY A;  1GL6 A;  3SFZ A;  3TWL A;  1VEK A;  2QSF X;  2RGO A;  3QYB A;  4B3M M;  1G4A E;  4F2L A;  2KEB A;  2R44 A;  4I4L A;  4IBD A;  1TGU A;  3C9P A;  3RE8 A;  4DR7 M;  4MGH A;  4X64 M;  3VLF B;  1TH4 A;  2VII A;  3HZJ A;  3FTE A;  4P17 A;  3SMS A;  2UXB M;  2CUZ A;  2LWX A;  1DO2 A;  5IZ7 D;  1QVR A;  2DHR A;  2R4J A;  4NSR A;  2DAE A;  4KT0 F;  4NSO B;  2XFT A;  1HQY E;  4I8O A;  5EXX A;  2UUA M;  1R2Z A;  4IIW A;  1VEJ A;  2C99 A;  3B7N A;  4IBC A;  3U60 B;  1DO0 A;  1QAO A;  3T1H M;  4FCV A;  4REZ A;  2HKJ A;  1E9S A;  2N35 A;  4NC6 A;  4DV5 M;  3D8L A;  1D0K A;  4IBG A;  3L25 A;  4AKI A;  1NJG A;  2UXD M;  3U6D A;  4AKH A;  3H4M A;  4G3O A;  1R7R A;  1L1T A;  3PNY A;  5EP4 A;  3U6E A;  4AG6 A;  5ITX E;  3HX3 A;  4MGZ E;  3J2P B;  4UN2 B;  2DKL A;  1D0L A;  4DV1 M;  3GPU A;  2KA6 B;  2DZL A;  1OFI A;  4M0W A;  3J7B A;  3C58 A;  2QQ8 A;  4LJ8 A;  3SAU A;  1ZMV A;  1CUK A;  5ITY A;  1Y8G A;  4B08 A;  5ITR A;  3AJI B;  3SYL A;  2R65 A;  3SHG B;  3SMP A;  1TDH A;  5FTL A;  1HNZ M;  2X8A A;  1GO5 A;  4QHS A;  5FTN A;  5EP1 A;  3UJN A;  1NY5 A;  3GQ4 A;  3GLG A;  1YE9 A;  5C18 A;  2QBY B;  3JR4 A;  3GLF A;  1IM2 A;  5EP2 A;  3KSJ A;  5DYI A;  2HAK A;  1DV0 A;  2C98 A;  4QOZ C;  1JR3 A;  2DXI A;  5KO3 A;  3R8F A;  1IXS A;  3E9S A;  3AV0 A;  1PM5 A;  1DGF A;  5BPV A;  2L7I A;  3H4J A;  1OQY A;  1Q3C A;  1XXH B;  1I4W A;  2BJW A;  2MGW A;  3LQQ A;  1OAO C;  4IBI A;  1V34 A;  4ITQ A;  4B7G A;  3FYD A;  1MJG M;  4LJ9 A;  1NNU C;  1MX0 A;  2EA0 A;  2KHH A;  3I4Y A;  2R18 A;  3HGI A;  1L8Q A;  3GLH A;  4HL4 A;  5JI3 E;  3FE3 A;  3K9P A;  3LCV B;  4AQY M;  1WGL A;  3HU1 A;  1C7Y A;  1EE8 A;  4I81 A;  4DUY M;  1D0M A;  3HWS A;  1XNQ M;  1GLN A;  5L8R F;  2YQZ A;  2Q2E B;  4IBE A;  1S3S A;  2DAK A;  5KQ8 A;  2X4A A;  2ZBK B;  2CV1 A;  3HJ8 A;  2LBC A;  1N36 M;  1N33 M;  3UZU A;  4JI6 M;  2QCU A;  4JI0 M;  2LVP C;  1GKI A;  1G8P A;  4CGY B;  4B7H A;  1FJG M;  3E4R A;  2CFO A;  1T43 A;  2R4E A;  3FUT A;  4NXM M;  4NOO B;  1Z5A A;  2WSC F;  1XMO M;  2HHH M;  4D82 A;  2LVQ D;  1HJP A;  1X37 A;  2P5T A;  2B3T A;  2XEP A;  3MHV C;  3T6P A;  4B3R M;  1XHB A;  3LCU A;  5IWA M;  1DGB A;  1QUS A;  2J7N A;  3GPY A;  2Y21 A;  3Q8X A;  3U5Z A;  4LJ5 A;  2G3Q A;  1P3Q Q;  2QEN A;  4QOS A;  1VDL A;  3FUU A;  3I4V A;  4LRS A;  1N34 M;  2LVA A;  2OO9 A;  2MR9 A;  4KOD A;  2EUC A;  1HT1 E;  1VQ1 A;  1XWI A;  1N32 M;  4RNA A;  1KSF X;  1N77 A;  4P16 A;  3UK6 A;  1OTR A;  1YUB A;  1E9R A;  2CHV A;  2KZS A;  5GKN A;  4L8R C;  2QPA A;  4DR2 M;  3GLI A;  5LMU M;  1IN6 A;  1G59 A;  1F4I A;  1JR3 E;  4FWD A;  1I94 M;  2FOI C;  2L4E A;  1HNX M;  2O5R A;  1QAM A;  1TR8 A;  1OFH A;  2X49 A;  4LF4 M;  2VF7 A;  1C1K A;  1N75 A;  2WZJ A;  2D7G A;  1GJS A;  1QZE A;  3L26 A;  4IBF A;  4OX9 M;  3U6O A;  1D2N A;  3B7Q A;  2OOB A;  1SG9 A;  2CRU A;  5F3W A;  5E6J A;  1NHW C;  3EIH A;  2DAG A;  5FSW A;  2HWJ A;  2OOA A;  2JXN A;  4DUZ M;  1QAQ A;  1TTE A;  3SAW A;  3GRY A;  3LQR A;  4MGK E;  2EKF A;  1HR0 M;  3VK7 A;  2CWB A;  2UXC M;  4W5W A;  4AZF A;  4QNR A;  2VQE M;  1BVS A;  1AIP C;  3RGP A;  1IBK M;  5BR8 M;  3HHX A;  2H5X A;  2NQ8 C;  3HHW A;  2AHM A;  3A42 A;  2W82 A;  2K0B X;  1MU5 A;  1Z5C A;  4GIP A;  4NRV A;  3SAT A;  3ZQJ A;  3DZD A;  4K0K M;  4DR4 M;  2CHQ A;  4AW4 A;  3B7Z A;  3I51 A;  1Q02 A;  3I04 M;  1ZQ9 A;  3SHF A;  4LF5 M;  1DGH A;  1FNN A;  2KNZ A;  1YLA A;  3AKZ A;  3SYK A;  4YHH M;  4AI6 A;  4PDG A;  1G41 A;  3IHP A;  2Z4R A;  4IBB A;  1IY1 A;  1GAB A;  1IY2 A;  4JV5 M;  4OW0 A;  4XGI A;  3FYC A;  3KVW A;  2G8L A;  3T1Y M;  3B74 A;  2ZAO A;  4LJ4 A;  2LVN C;  2LXE A;  1NO1 A;  3UGJ A;  1HNW M;  3QYE A;  3PFI A;  1L2B A;  3ILK A;  4LJ6 A;  1ORY B;  1R6B X;  4WW0 A;  4JXJ A;  4JI1 M;  4L4U A;  3JAM S;  5FTJ A;  3M0E A;  3PVS A;  4X62 M;  3R9X B;  4LJA A;  3F92 A;  1K3X A;  2BJV A;  3TPZ A;  3KS8 A;  4TUW A;  1IN4 A;  2Y20 A;  2R6F A;  3J81 S;  3U60 A;  4LF6 M;  1Z5B A;  2BWB A;  2YR0 A;  3HJS A;  4R3D A;  4CJ6 A;  1GJT A;  3JR5 A;  2JUJ A;  2V1U A;  1T6O A;  1Z59 A;  1WXQ A;  5KPZ A;  4B7F A;  3U61 B;  2XGN A;  3ZC7 B;  4D81 A;  1SXJ D;  4GIT A;  3RFW A;  4NRW A;  3W0F A;  3VK8 A;  1WHC A;  2DWL A;  2JP7 A;  4IJE A;  3TL4 X;  3OTO M;  3KP1 E;  4PD2 A;  2LVO C;  1PJQ A;  1IN7 A;  1Q39 A;  1WR1 B;  2LHG A;  3LMM A;  5KQD A;  5EXT A;  3QAU A;  4AKG A;  1WGN A;  3B89 A;  4RF1 A;  3U6C A;  3AFH A;  1V92 A;  1WIV A;  2H1R A;  4OVZ A;  3GRV A;  3RGS A;  2HCB A;  3FUV A;  3GO8 A;  4DV7 M;  2Z4S A;  3TE6 A;  2F5P A;  2K6B A;  4F1I A;  4GHL A;  2V1C A;  1TDZ A;  3VKG A;  3E21 A;  3KOZ E;  3V76 A;  3K1J A;  4BB9 A;  2ZAN A;  4B3T M;  2FH0 A;  4JN6 A;  1PJS A;  4DR3 M;  4DV2 M;  3A98 B;  3CF6 E;  2WSF F;  3HHY A;  3Q8G A;  5C1B A;  4JI2 M;  2JZ0 A;  4BBA A;  4DV3 M;  2JY8 A;  2L4F A;  2XSZ A;  3HY5 A;  1NY6 A;  4Q7J A;  2XLJ A;  3MMP A;  3CGW A;  3M6A A;  2C9C A;  4M0D A;  1RU3 A;  4LGY A;  4GH9 A;  2JY6 B;  3J80 S;  3KOW E;  1UFZ A;  4MGY E;  1IFY A;  1EIJ A;  4LF8 M;  4GKK M;  2GQF A;  4LGM A;  3GLG E;  3W0L B;  2R62 A;  3THG A;  3W68 A;  3GLF E;  1QQW A;  2DWN A;  4DR5 M;  1G71 A;  1V33 A;  1T3T A;  1NNJ A;  3HU2 A;  1GVN A;  4JI5 M;  2UU9 M;  4PCZ A;  2A5Y B;  5DYG A;  2CP8 A;  3U6Q A;  2F5S A;  1Z6T A;  4Y28 F;  3IG8 A;  1SXJ A;  2K47 A;  2DI0 A;  4LY6 A;  2XH9 A;  1VEG A;  3AOE A;  1IN5 A;  3I01 M;  3WHK A;  3KOY E;  3U6L A;  4DR6 M;  1IN8 A;  3BOS A;  3GLH E;  1OAI A;  4YY3 M;  4LFC M;  2JNH A;  1NV9 A;  2DWZ B;  4PT5 A;  8CAT A;  2JZ1 A;  4B3S M;  2Z3X A;  2F4V M;  2ERC A;  4GC9 A;  3C3D A;  4CHT B;  2RGH A;  2MH8 A;  3TQS A;  5H37 D;  5KPT A;  4Z6Y A;  3PNV A;  2CV2 A;  3L2A A;  2MRO B;  4L15 A;  3ZH9 B;  2G5G X;  4DV0 M;  4R7G A;  3NBI A;  2YNM D;  1LTM A;  1QAN A;  4HEO A;  5A2Q S;  5EP3 A;  1G3I A;  4I5S A;  3U6S A;  2LTU A;  2DZN B;  2XZF A;  5KPR A;  1IQP A;  4KO8 A;  4LCB A;  3K2L A;  3L29 A;  2UUB M;  1QZM A;  3FTF A;  3KXE C;  2JY7 A;  3FTD A;  1PJI A;  3CTW B;  3GPP A;  2QNJ A;  5ITQ A;  4G4O A;  2RKO A;  1HQC A;  3J7A S;  4ZPX A;  4CIZ A;  3CF0 A;  1PJT A;  4MM3 B;  4LJ7 A;  2XF3 A;  4LRT A;  3T15 A;  1MN3 A;  3NBX X;  4GRI A;  4HLQ A;  4FD2 A;  4LZJ A;  4GHA A;  5FLX S;  1E32 A;  3GLI E;  4JI8 M;  2WSE F;  2XSZ D;  1J09 A;  4FVM A;  4JI7 M;  3SBJ A;  1QYR A;  3GLG B;  5E26 A;  2ZTD A;  4GC5 A;  1UM8 A;  4M9X A;  4R71 A;  4X66 M;  4ANR A;  4PDI A;  3TWM A;  3IG5 A;  2DEN A;  3GLF B;  1IBL M;  2VF8 A;  3KOX E;  3FRI A;  1IY0 A;  4G6Z A;  4QNM A;  5FTK A;  4FCW A;  3KDS E;  1SXJ E;  1SXJ C;  1IXS B;  4RKU F;  5JI2 E;  2DWM A;  2CV0 A;  2GNO A;  3AOE C;  1W5T A;  2Y0Q A;  2KW0 A;  3MK6 A;  1JQJ C;  3C3E A;  1TH2 A;  1NHG C;  1TF0 B;  2YFQ A;  2LNH C;  1PGY A;  3E46 A;  3K92 A;  4L78 A;  4WUR A;  3W67 A;  2DAM A;  4XBO A;  2FFJ A;  4G4N A;  2EJS A;  1ZAE A;  3A45 A;  2CEA A;  2KDL A;  2KXE A;  2EO2 A;  3SAV A;  2CHG A;  3SAR A;  2BWE A;  3GLH B;  4NXN M;  5EJC A;  4GEW A;  1NJF A; 
#chains in the Genus database with same CATH homology
 2KZU A;  2F5O A;  5LMN M;  5ITT A;  3VDU A;  4NL4 H;  4OVZ B;  3GP1 A;  3FD9 A;  4G4Q A;  2KRK A;  2Y0T A;  2XFS A;  5EQT A;  4LF9 M;  1NVM A;  3DOA A;  3HHZ A;  1W5S A;  3NWL A;  1LV7 A;  2D7H A;  4LF7 M;  2D7E A;  1R2Y A;  2FNA A;  4A3V B;  1HT2 E;  2F5N A;  2I7P A;  3KP0 E;  3CF2 A;  4IBK A;  4IJF A;  3SAS A;  3L27 A;  2V6Z M;  5EXP A;  1J5E M;  2VQF M;  2DZO B;  3HU3 A;  4LFA M;  2C5R A;  2QBY A;  3GQ3 A;  1VDD A;  4AG5 A;  4M9Z A;  4DV6 M;  2Z7J A;  2C96 A;  3GRU A;  2DVW B;  2L6O A;  2QP9 X;  4MH0 E;  3T38 A;  4G4R A;  3U5Z B;  2FE8 A;  3DFZ A;  3WHL A;  3UMM A;  3KFU G;  4M9S A;  5IT9 S;  3U61 A;  3SC3 A;  3A46 A;  1XXH A;  4CIS A;  4LZZ A;  3AL0 C;  4KHP M;  3TWK A;  1TH3 A;  4FCT A;  2ZM6 M;  2OQ4 A;  3GQ5 A;  3HJQ A;  4OU7 A;  3GLI B;  1GL7 A;  1PJJ A;  1H6U A;  3HKP A;  2QZ4 A;  2L7H A;  1K82 A;  4S12 A;  1KYI A;  1J7K A;  3DA1 A;  4DR1 M;  1XC8 A;  4LFB M;  4GKJ M;  3KW6 A;  2L09 A;  4BLC A;  3D8B A;  3GRR A;  1SXJ B;  3VFD A;  2LH0 A;  1N78 A;  4RF0 A;  4IBJ A;  2R45 A;  2ZAM A;  3B9P A;  1XMQ M;  4L16 A;  2HL7 A;  4JI3 M;  2OPF A;  2XZU A;  2C9O A;  3M7G A;  4QHT A;  1KFV A;  1L2D A;  1IXZ A;  3PXG A;  2I7N A;  3AOG A;  2CE7 A;  3FKE A;  3FUW A;  4X65 M;  2J7O A;  4FWG A;  5ITX A;  5EXS A;  4II7 A;  1L1Z A;  3KSX A;  5IRE B;  2F5Q A;  4MB7 A;  1OJL A;  3U6P A;  2UUC M;  3LVW A;  4JYA M;  2JA2 A;  3K8Z A;  2M5Z A;  1K3W A;  3QWL A;  1E94 E;  4FWH A;  1IXR C;  1NSF A;  4KLN A;  1L2C A;  1XNR M;  4LG2 A;  1DGG A;  4D80 A;  2BNK A;  5DNY A;  1DGH B;  2M60 A;  2R46 A;  7CAT A;  4Z8X A;  3GPX A;  2KRU A;  3MJ5 A;  3FUX A;  4EIW A;  3ZCB B;  4DV4 M;  4FW9 A;  1IBM M;  3FTC A;  4MGI E;  3J27 B;  5FTM A;  5ITU A;  1JR3 D;  3L28 A;  1Q3B A;  4GMQ A;  4JI4 M;  3LVV A;  3KS4 A;  3VDP A;  3EIE A;  2E5L M;  1YSY A;  1GL6 A;  3SFZ A;  3TWL A;  2RGO A;  4B3M M;  1G4A E;  2KEB A;  4I4L A;  4IBD A;  1TGU A;  3RE8 A;  4DR7 M;  4MGH A;  4X64 M;  3VLF B;  1TH4 A;  2VII A;  3FTE A;  3SMS A;  2UXB M;  2CUZ A;  2LWX A;  1DO2 A;  5IZ7 D;  1QVR A;  2R4J A;  2DHR A;  4NSR A;  4NSO B;  2UUA M;  5EXX A;  2XFT A;  1HQY E;  4I8O A;  1R2Z A;  4IIW A;  2C99 A;  4IBC A;  3U60 B;  1DO0 A;  1QAO A;  3T1H M;  4FCV A;  4REZ A;  2HKJ A;  1E9S A;  4DV5 M;  3D8L A;  4IBG A;  3L25 A;  4AKI A;  1NJG A;  2UXD M;  3U6D A;  4AKH A;  3H4M A;  1R7R A;  1L1T A;  3PNY A;  5EP4 A;  3U6E A;  4AG6 A;  5ITX E;  4MGZ E;  3J2P B;  4DV1 M;  3GPU A;  2KA6 B;  1OFI A;  4M0W A;  3J7B A;  3C58 A;  4LJ8 A;  3SAU A;  5ITY A;  4B08 A;  5ITR A;  3AJI B;  3SYL A;  2R65 A;  3SHG B;  3SMP A;  1TDH A;  5FTL A;  1HNZ M;  2X8A A;  4QHS A;  5FTN A;  5EP1 A;  3UJN A;  1NY5 A;  3GQ4 A;  3GLG A;  1YE9 A;  5C18 A;  2QBY B;  3JR4 A;  3GLF A;  1IM2 A;  5EP2 A;  3KSJ A;  5DYI A;  2C98 A;  4QOZ C;  1JR3 A;  2DXI A;  5KO3 A;  3R8F A;  3E9S A;  3AV0 A;  1PM5 A;  1DGF A;  5BPV A;  2L7I A;  1Q3C A;  1XXH B;  2BJW A;  1I4W A;  3LQQ A;  4IBI A;  4ITQ A;  4B7G A;  3FYD A;  4LJ9 A;  1NNU C;  1MX0 A;  2EA0 A;  3I4Y A;  2R18 A;  3HGI A;  1L8Q A;  3GLH A;  4HL4 A;  5JI3 E;  4AQY M;  3HU1 A;  1EE8 A;  4I81 A;  4DUY M;  1XNQ M;  3HWS A;  1GLN A;  2YQZ A;  2Q2E B;  4IBE A;  1S3S A;  5KQ8 A;  2X4A A;  2ZBK B;  2CV1 A;  3HJ8 A;  1N36 M;  1N33 M;  3UZU A;  4JI6 M;  2QCU A;  4JI0 M;  1GKI A;  1G8P A;  4CGY B;  4B7H A;  1FJG M;  3E4R A;  2CFO A;  3FUT A;  2R4E A;  4NXM M;  4NOO B;  1Z5A A;  1XMO M;  2HHH M;  4D82 A;  1X37 A;  2P5T A;  2XEP A;  3MHV C;  4B3R M;  1XHB A;  5IWA M;  1DGB A;  2J7N A;  3GPY A;  2Y21 A;  3Q8X A;  3U5Z A;  4LJ5 A;  2QEN A;  4QOS A;  1N34 M;  3FUU A;  3I4V A;  4LRS A;  4KOD A;  2EUC A;  1HT1 E;  1XWI A;  1N32 M;  4RNA A;  1KSF X;  1N77 A;  4P16 A;  3UK6 A;  1YUB A;  1E9R A;  2CHV A;  2KZS A;  5GKN A;  4L8R C;  2QPA A;  4DR2 M;  3GLI A;  5LMU M;  1IN6 A;  1G59 A;  4FWD A;  1I94 M;  2FOI C;  1HNX M;  2O5R A;  1QAM A;  1OFH A;  2X49 A;  4LF4 M;  1C1K A;  1N75 A;  2D7G A;  3L26 A;  4IBF A;  4OX9 M;  3U6O A;  1D2N A;  5F3W A;  5E6J A;  1NHW C;  3EIH A;  5FSW A;  4DUZ M;  1QAQ A;  3SAW A;  3GRY A;  3LQR A;  4MGK E;  1HR0 M;  3VK7 A;  2UXC M;  4W5W A;  4AZF A;  4QNR A;  2VQE M;  3RGP A;  1IBK M;  5BR8 M;  3HHX A;  2NQ8 C;  3HHW A;  2AHM A;  3A42 A;  2W82 A;  1MU5 A;  1Z5C A;  4GIP A;  4NRV A;  3SAT A;  3DZD A;  4K0K M;  4DR4 M;  2CHQ A;  4AW4 A;  3I51 A;  1ZQ9 A;  3SHF A;  4LF5 M;  1DGH A;  1FNN A;  3AKZ A;  3SYK A;  4YHH M;  4AI6 A;  4PDG A;  1G41 A;  2Z4R A;  4IBB A;  1IY1 A;  1IY2 A;  4JV5 M;  4OW0 A;  4XGI A;  3FYC A;  3KVW A;  2G8L A;  3T1Y M;  2ZAO A;  4LJ4 A;  2LXE A;  3UGJ A;  1HNW M;  3PFI A;  1L2B A;  3ILK A;  4LJ6 A;  1ORY B;  1R6B X;  4WW0 A;  4JXJ A;  4JI1 M;  4L4U A;  3JAM S;  5FTJ A;  3M0E A;  3PVS A;  4X62 M;  3R9X B;  4LJA A;  1K3X A;  2BJV A;  3TPZ A;  3KS8 A;  4TUW A;  1IN4 A;  2Y20 A;  3J81 S;  3U60 A;  4LF6 M;  1Z5B A;  3HJS A;  2YR0 A;  4R3D A;  3JR5 A;  2V1U A;  5KPZ A;  1Z59 A;  1WXQ A;  4B7F A;  3U61 B;  2XGN A;  3ZC7 B;  4D81 A;  1SXJ D;  4GIT A;  3RFW A;  4NRW A;  3W0F A;  3VK8 A;  2DWL A;  4IJE A;  3TL4 X;  3OTO M;  3KP1 E;  4PD2 A;  1IN7 A;  1Q39 A;  3LMM A;  5KQD A;  5EXT A;  3QAU A;  4AKG A;  4RF1 A;  3U6C A;  3AFH A;  2H1R A;  4OVZ A;  3GRV A;  3RGS A;  3FUV A;  2HCB A;  3GO8 A;  4DV7 M;  2Z4S A;  3TE6 A;  2F5P A;  4GHL A;  2V1C A;  1TDZ A;  3VKG A;  4BB9 A;  3KOZ E;  2ZAN A;  4B3T M;  4JN6 A;  4DR3 M;  4DV2 M;  3A98 B;  3CF6 E;  3HHY A;  5C1B A;  4JI2 M;  4BBA A;  4DV3 M;  2XSZ A;  1NY6 A;  2XLJ A;  3M6A A;  4LGY A;  2C9C A;  4M0D A;  4GH9 A;  3J80 S;  3KOW E;  4MGY E;  4LF8 M;  4GKK M;  4LGM A;  3W0L B;  2R62 A;  3THG A;  1QQW A;  2DWN A;  4DR5 M;  1T3T A;  1NNJ A;  3HU2 A;  1GVN A;  4JI5 M;  2UU9 M;  4PCZ A;  2A5Y B;  5DYG A;  3U6Q A;  2F5S A;  1Z6T A;  3IG8 A;  1SXJ A;  2K47 A;  4LY6 A;  2XH9 A;  3AOE A;  1IN5 A;  3WHK A;  3KOY E;  3U6L A;  4DR6 M;  1IN8 A;  3BOS A;  4YY3 M;  4LFC M;  2DWZ B;  4PT5 A;  8CAT A;  4B3S M;  2Z3X A;  2F4V M;  2ERC A;  4GC9 A;  4CHT B;  2RGH A;  5H37 D;  3TQS A;  5KPT A;  4Z6Y A;  3PNV A;  2CV2 A;  3L2A A;  3ZH9 B;  4L15 A;  2G5G X;  4DV0 M;  4R7G A;  3NBI A;  2YNM D;  1QAN A;  5A2Q S;  5EP3 A;  1G3I A;  4I5S A;  3U6S A;  1NJF A;  2DZN B;  2XZF A;  5KPR A;  1IQP A;  4KO8 A;  4LCB A;  3K2L A;  3L29 A;  2UUB M;  1QZM A;  3FTF A;  3KXE C;  3FTD A;  1PJI A;  3CTW B;  3GPP A;  5ITQ A;  4G4O A;  2RKO A;  1HQC A;  3J7A S;  4ZPX A;  3CF0 A;  4MM3 B;  4LJ7 A;  2XF3 A;  4LRT A;  3T15 A;  4GRI A;  4HLQ A;  4FD2 A;  4LZJ A;  4GHA A;  5FLX S;  1E32 A;  4JI8 M;  2XSZ D;  1J09 A;  4FVM A;  4JI7 M;  3SBJ A;  1QYR A;  3GLG B;  5E26 A;  4GC5 A;  4M9X A;  1UM8 A;  4X66 M;  4PDI A;  3TWM A;  3IG5 A;  3GLF B;  1IBL M;  3KOX E;  4QNM A;  1IY0 A;  4G6Z A;  5FTK A;  4FCW A;  3KDS E;  1SXJ E;  1SXJ C;  1IXS B;  5JI2 E;  2DWM A;  2CV0 A;  3AOE C;  1W5T A;  2Y0Q A;  2KW0 A;  3MK6 A;  1JQJ C;  3U6M A;  1TH2 A;  1NHG C;  2YFQ A;  4L78 A;  2LNH C;  3K92 A;  3VKH A;  4WUR A;  4XBO A;  2FFJ A;  4G4N A;  1ZAE A;  3A45 A;  2CEA A;  2KXE A;  3SAV A;  2EO2 A;  2CHG A;  3SAR A;  3GLH B;  4NXN M;  5EJC A;  3K1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...