2F4VM

30s ribosome + designer antibiotic
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2f4vM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2f4vM02
3JR5A 1NNJA 1K3XA 4DR7M 3VK7A 1TDHA 1Z59A 4DV6M 3VK8A 4G4OA 1L1ZA 2F5OA 1K82A 2F5SA 4NXNM 2UUCM 4B3SM 4LF6M 3U6QA 1N33M 3TWKA 4MB7A 3U6DA 1KFVA 1IBKM 3SATA 4X65M 4DV3M 5ITQA 4DV7M 1Z5CA 4DR5M 4B3RM 4LF8M 4GKKM 4PD2A 1L2DA 3TWMA 4KHPM 2HHHM 5ITYA 3U6LA 1FJGM 2UU9M 5LMUM 4NRVA 1N36M 4G4NA 3SARA 3J80S 1Z5BA 3GPPA 1L2CA 5ITXA 3OTOM 1Q39A 1MX0A 4DV2M 4JV5M 3U6MA 4G4QA 4DV4M 1R2ZA 3JAMS 4JI2M 3JR4A 4PDGA 2F5QA 4LF7M 3J81S 2Q2EB 3W0FA 1XNQM 3GP1A 1N32M 4DUZM 2UXCM 4GKJM 3T1YM 3U6PA 4NRWA 4ITQA 5ITTA 2UXBM 4JI5M 3A46A 5IT9S 3GPXA 1XC8A 4PDIA 4JYAM 3A45A 2F4VM 3U6SA 3GPUA 4X62M 3T1HM 1XNRM 1HNXM 2OPFA 4LFBM 2F5NA 3DOAA 4DR6M 3GQ5A 1PJIA 2UUAM 4JI6M 4JI7M 1HNWM 3U6CA 3U6EA 5IWAM 4X66M 3U6OA 4LF5M 5FLXS 2VQEM 4JI8M 2XZUA 2ZBKB 3SAUA 2E5LM 3SBJA 1IBMM 3SAWA 1IBLM 1R2YA 5ITUA 1K3WA 3GQ3A 4G4RA 1L2BA 2VQFM 3A42A 5ITRA 2HKJA 2F5PA 3SASA 4LFCM 4DR2M 1J5EM 1L1TA 4OX9M 1Z5AA 4CISA 4B3TM 1Q3BA 4PCZA 4DUYM 4X64M 1XMOM 4JI0M 4DV5M 4JI3M 5LMNM 3TWLA 3GO8A 1PM5A 4DR4M 4LF9M 1TDZA 1Q3CA 1HR0M 5ITXE 4LF4M 3J7AS 3GQ4A 2UUBM 4NXMM 4LFAM 2UXDM 4AQYM 4DR3M 4YY3M 1XMQM 4B3MM 2XZFA 2EA0A 4JI1M 5A2QS 4DR1M 3SAVA 1PJJA 1N34M 2OQ4A 1I94M 4DV0M 1EE8A 4K0KM 2ZM6M 3GPYA 3C58A 1HNZM 1MU5A 5BR8M 4DV1M 4YHHM 4JI4M
chains in the Genus database with same CATH superfamily
3FD9A 3FYDA 2Z8YM 1NNJA 2Y21A 4DR7M 4GIPA 4NXNM 2J7OA 4IBBA 3U6QA 4LJ4A 1CUKA 1NY6A 1R7RA 2O01F 3B7QA 4PT5A 2K47A 4MB7A 3GLGE 1SXJB 3KXEC 1IBKM 5BPVA 1IN8A 2BJWA 2I7NA 4KO8A 4FVMA 1QYRA 4FCVA 4OW0A 1IXZA 1IXRC 1Z5CA 1G8PA 2DWMA 5IREB 4DR5M 4B3RM 2LH0A 2YR0A 2HHHM 4AG5A 5ITYA 1NO1A 3NBIA 3HU3A 1D2NA 2Y20A 3HU2A 1VEGA 1ZAEA 4QHTA 3HJ8A 1L2CA 3VKGA 5EXSA 1G71A 1G59A 1KSFX 2R6FA 2CRUA 1DGHB 2BWEA 2OOAA 3AOEA 2EO2A 1QUTA 2JY6B 2LVNC 1R2ZA 4D81A 3MHVC 4JI2M 3BBZA 3IG8A 4RF1A 3JR4A 4PDGA 2M5ZA 1L8QA 2MROB 3U60A 2CHVA 1XNQM 3D8BA 3I51A 2A5YB 3H4JA 1N32M 1D0KA 2KXEA 4GKJM 2UXCM 1TH2A 2I7PA 3LW5F 2XSZA 5ITTA 2UXBM 3FTDA 4MGKE 2GNOA 4JI5M 5IT9S 2CEAA 3GPXA 3KS4A 3HHXA 3KFUG 4LJ5A 5E6JA 4I4LA 5KQ8A 1XNRM 1ORYB 1XXHA 2R62A 4LFBM 3A98B 3RGPA 2HL7A 3GRYA 2UUAM 3KSJA 1SXJE 4JI6M 2MJ5B 3F92A 1RU3A 2JNHA 2R0IA 3C9PA 5FSWA 1KYIA 2L2DA 2XEPA 2ZAOA 3HHYA 3L2AA 3LQQA 2P5TA 2QPAA 5H37D 2R65A 1NJFA 2LXEA 1E94E 5FLXS 4R7GA 2VQEM 4TUWA 1HT1E 3J2PB 2R18A 4CHTB 2LBCA 2XH9A 3FTFA 4BB9A 2JZ1A 3SBJA 1UM8A 2L6OA 4NC6A 2KZSA 3FRHA 3SAWA 1ZQ9A 2G3QA 4GITA 4L16A 2KEBA 4LCBA 4LJ9A 1L2BA 1VEKA 2LNHC 3FE3A 3L27A 2CV2A 3T38A 3HHZA 1BVSA 3LMMA 2QZ4A 4F2LA 1Z5AA 1WIVA 3RGSA 4DUYM 2L7HA 2QQ8A 1V34A 3TWLA 2LVPC 3GO8A 4LF9M 1TDZA 1Q3CA 3TQSA 1JB0F 2ZANA 4LY6A 3WHLA 3FUWA 4QNMA 2DVWB 4P17A 2ZTCA 3BOSA 1I4WA 4DR3M 2R46A 2WSFF 2VF7A 3GLHA 4YY3M 1EFUB 1XB2B 1QUSA 3NWLA 4B3MM 4L8RC 2JZ0A 2VF8A 3SAVA 4W5WA 3E4RA 2QBYA 3R8FA 2VDBB 4K0KM 1EE8A 2QP9X 3QAUA 1IN5A 1HNZM 1MU5A 1VDDA 4HL4A 4YHHM 3SATA 4QHSA 3W67A 1K3XA 2LVAA 3MK6A 3FUVA 4LJ8A 4B08A 3VK7A 2EKFA 4KT0F 4DV6M 3VK8A 1L1ZA 2UUCM 3GLHB 1G41A 3SHGB 1T3TA 1K82A 4GHLA 3K9PA 1EIJA 3LCVB 2KRKA 3PFIA 3U6DA 1J7KA 2QBYB 5ITQA 1YSYA 3CF6E 1FNNA 2LWXA 2KNZA 4B7HA 4GKKM 2KRUA 5KO3A 3GLFB 4AKGA 4WURA 4NSOB 2DWLA 3AJIB 3B9PA 2C96A 5FTLA 2JWSA 4A3VB 4QOSA 4NRVA 3FTCA 1N36M 1Z5BA 2EUCA 1HT2E 3GRRA 2FOIC 4OU7A 1D0MA 3SMPA 4LGMA 2NQ8C 1WXQA 1OIZA 1MX0A 1QAMA 2XF3A 2BJVA 4LJAA 2ERCA 2LTUA 7CATA 4DV4M 2DKLA 4OVZA 3I04M 3AL0C 1GL6A 1OJLA 4D80A 2F5QA 4REZA 1TF0B 2CHGA 5KPZA 1E9RA 1SXJC 1F4IA 5GKNA 1IY2A 2FFJA 1DV0A 1DGHA 2Y0QA 1JR3A 2LHGA 2V1CA 2JY5A 3Q8GA 5DFLA 1TR8A 3U6PA 4NRWA 4IBGA 2YNMD 4L6V6 1IY1A 4PDIA 3UMMA 4FCTA 3SC3A 3SHFA 1V33A 4OVZB 3M6AA 4IIWA 4X62M 3T1HM 3GLHE 5FTNA 1OQYA 3DOAA 3UGJA 3B74A 3GQ5A 4DR6M 1WR1B 2K0BX 3VKHA 1XWIA 3D8LA 5EQTA 1Y8GA 1A5TA 3SYLA 2QSFX 1OFIA 2R44A 5IZ7D 1VDLA 3PVSA 4X66M 1NHWC 3HJQA 3K9OA 4Z8XA 4QNRA 3TPZA 1R5LA 2LVOC 3KP0E 2RGHA 3GLFE 1T43A 3VDPA 3DZDA 4AW4A 3VFDA 4JI8M 4AKHA 4IJEA 4B7FA 2X4AA 3L29A 1C7YA 2KZUA 3PNYA 3AKZA 4NSRA 1IBLM 2HAKA 3K2LA 3GRVA 3GQ3A 2HKJA 3AFHA 3AOEC 1SXJD 2G8LA 1J09A 4Q7JA 1L1TA 2FE8A 3TE6A 2B3TA 4B3TM 1V92A 1VEJA 2Z4SA 2MGWA 2DAMA 3LVWA 1GKIA 1TGUA 1QANA 1PRBA 1PM5A 4DR4M 3Q8XA 5DNYA 4L15A 1HR0M 1ZMVA 1W5TA 2J7NA 4FW9A 4LF4M 2OO9A 2FS1A 4WP2A 2QHOB 3FUUA 4G6ZA 4L78A 4LFAM 2UXDM 4CIZA 4Z6YA 1DGGA 3KOYE 4UN2B 4IBDA 4IJFA 5KQDA 5JI3E 2EKKA 1XMQM 3L28A 4IBKA 4M9ZA 2XZFA 2EA0A 4JI1M 1VQ1A 3KW6A 5A2QS 4G3OA 1AUAA 1I94M 4DV0M 1PJSA 4DBGB 2ZM6M 3C58A 5KPTA 1IXSB 1JR3E 5BR8M 2HWJA 3BXWA 4JI4M 1GO5A 2CUZA 3IHPA 3JR5A 4NOOB 2XLJA 1PJQA 3KSXA 3KDSE 5FTKA 4AG6A 1NY5A 3KOWE 2RRUA 4G4OA 1DO0A 2F5OA 2F5SA 3FRIA 3HY5A 4MH0E 4AKIA 1KFVA 3RE8A 1DGBA 1TTEA 1ZMUA 3MJ5A 4DV3M 2YQZA 2BNKA 4P16A 4XK8F 3FUXA 5EXTA 1PJTA 3QWLA 4BLCA 2H5XA 1YE9A 3TWMA 3SYKA 1N75A 5C1BA 4KHPM 1NVMA 2XSZD 3U6LA 3K92A 2JXNA 2UU9M 4G4NA 1T6OA 3B89A 4HEOA 2JP7A 3GPPA 4EIWA 2JUJA 1TH3A 5L8RF 5ITXA 1HQYE 1Q39A 1L2DA 1OKSA 5E26A 2VIIA 4IBJA 4DV2M 3GLFA 2DXIA 4JV5M 3ZCBB 3U6MA 1GLNA 4G4QA 3ZH9B 4KLNA 1WHCA 2JY7A 2N35A 3E9SA 4LF7M 1IFYA 1UFZA 2Q2EB 1WJ7A 2FNAA 1ZV1A 3FTEA 3RFWA 2L4EA 4AI6A 1YUBA 3T1YM 4LG2A 2XFSA 3I01M 3QYBA 4M0WA 3M0EA 3A46A 1WGNA 4D82A 3THGA 3V76A 3HZJA 3VDUA 2OPFA 2F5NA 2ZAMA 2CE7A 1PJIA 1XHBA 3UJNA 2QCUA 4JI7M 1P3QQ 3U6CA 1N78A 2D7GA 4QOZC 2DWZB 4IBEA 4I8OA 4M9XA 2GQFA 1GL7A 3W68A 2RGOA 5DYGA 2DENA 2HCBA 3E21A 2V6ZM 4GRIA 4XGIA 2DAKA 1ZMWA 5FTMA 3R9XB 2H1RA 1NSFA 3T15A 2XZUA 1GJSA 3ZQJA 3SAUA 2E5LM 3ZC7B 2C5RA 4JN6A 2DWNA 2BWBA 5ITUA 1Z6TA 1K3WA 2DI0A 2VQFM 3A42A 2DHYA 4LJ6A 3SASA 1G4AE 4LFCM 1OFHA 3PNVA 4MGZE 4WW0A 3M7GA 3PXGA 3L26A 3GLIB 1HQCA 1YLAA 4KODA 5C18A 1GABA 4X64M 4BBAA 2AHMA 2C99A 1XMOM 2L09A 3U5ZB 4JI3M 2KW0A 4LRTA 3DA1A 1NV9A 1MN3A 5ITXE 2MR9A 3UZUA 1NNUC 4AQYM 3KOXE 4GC5A 3NBXX 3I4YA 1QAOA 2C9CA 3CF2A 4IBFA 5EXXA 1IN4A 3UK6A 3HHWA 3KVWA 3MMPA 4GEWA 2DZLA 4DR1M 1PJJA 1N34M 2X8AA 2OQ4A 4MGHA 3FYCA 2L4FA 1DO2A 1HJPA 2CWBA 2KHHA 4DV1M 2M60A 1NHGC 4FWGA 3EIEA 2LHCA 3FUTA 2W82A 5FTJA 1TDHA 1Z59A 3T6PA 1N33M 4B3SM 4LF6M 1WGLA 3TWKA 2D7HA 5EJCA 5EP4A 4R3DA 1IXSA 4RF0A 2DZNB 2JA2A 4X65M 2C9OA 4DV7M 4GC9A 2Z7JA 2CV1A 2CHQA 1IN7A 2KA6B 5EP3A 4FWHA 3SMSA 5EP1A 1C1KA 2DNAA 5JI2E 4LF8M 4II7A 4PD2A 3DFZA 1LTMA 2QENA 1G3IA 2K6BA 3FKEA 1DGFA 1JR3D 2DZOB 2XFTA 3W0LB 2FH0A 2R45A 4S12A 3GLIE 1FJGM 4FWDA 1QDRA 5LMUM 3TL4X 2CFOA 3SARA 3J80S 3CGWA 2WSEF 3KP1E 3B7NA 3LQRA 3U60B 3KS8A 3CF0A 3I4VA 1IM2A 3AOGA 3EIHA 3K8ZA 3OTOM 4LJ7A 2O5RA 3VLFB 3HU1A 5F3WA 4IBCA 2LVQD 4AZFA 3JAMS 3J7BA 1AIPC 1QZMA 3B7ZA 2Y0TA 4ZPXA 2OOBA 2XGNA 3HKPA 5EP2A 4CGYB 3J81S 3W0FA 1XXHB 2WZJA 2DAEA 4IBIA 1QQWA 3GP1A 4DUZM 2L7IA 1W5SA 4MM3B 4ITQA 1TH4A 4LZZA 3GRUA 1VG5A 1OAIA 1JQJC 2APLA 3HGIA 3AV0A 4CJ6A 1XC8A 4JYAM 2JY8A 1GVNA 3A45A 4M9SA 1QVRA 3U6SA 2R4JA 1IN6A 1IY0A 4GH9A 3GPUA 2F4VM 1HNXM 1NJGA 1H6UA 3GLGA 3H4MA 2J5YA 2EJSA 4FD2A 3WHKA 1HNWM 3CTWB 1Q02A 1D0LA 1E9SA 3U6EA 4MGYE 5IWAM 4GHAA 1OTRA 2X49A 2K9DA 4I5SA 4LZJA 3U6OA 3C3DA 4LF5M 3IG5A 3HX3A 4FCWA 8CATA 3GLGB 3U61A 1PGYA 2D7EA 2ZBKB 3KOZE 4I81A 4XBOA 1IBMM 4R71A 2DAGA 2Z4RA 4RKUF 1R2YA 4F1IA 4G4RA 4MGIE 2DHRA 3HJSA 4L4UA 4LRSA 5ITRA 2F5PA 1QAQA 3IECA 1SG9A 2YFQA 1OIPA 4HLQA 3K1JA 2QNJA 2RKOA 4DR2M 2R4EA 1J5EM 4OX9M 4CISA 2CV0A 2WSCF 1Q3BA 2DAIA 4Y28F 4PCZA 1N77A 1MJGM 4JI0M 4NL4H 1QZEA 3U61B 3HWSA 1XXHE 2KDLA 2O25A 5LMNM 4DV5M 2CP8A 2G5GX 4B7GA 4LGYA 3J7AS 3GQ4A 2UUBM 4ANRA 2ZTDA 3L25A 3ILKA 4NXMM 3E46A 4GMQA 3GLIA 3J27B 1X37A 1GJTA 5DYIA 4RNAA 4M0DA 1R4GA 3U5ZA 1R6BX 2Z3XA 1SXJA 5KPRA 1IQPA 1E32A 3QYEA 3SFZA 1NV8A 2V1UA 1QDTA 3LVVA 1OAOC 3C3EA 3GPYA 2KNVA 2MH8A 3LCUA 4JXJA 5EXPA 1LV7A 2C98A 2KNAA 1S3SA
chains in the Genus database with same CATH topology
3FD9A 3FYDA 1NNJA 2Y21A 4DR7M 4GIPA 4NXNM 2J7OA 4IBBA 3U6QA 4LJ4A 1NY6A 1R7RA 4PT5A 2K47A 4MB7A 1SXJB 3KXEC 1IBKM 5BPVA 1IN8A 2BJWA 2I7NA 4KO8A 4FVMA 1QYRA 4FCVA 4OW0A 1IXZA 1IXRC 1Z5CA 1G8PA 2DWMA 5IREB 4DR5M 4B3RM 2LH0A 2YR0A 2HHHM 4AG5A 5ITYA 3NBIA 3HU3A 1D2NA 2Y20A 3HU2A 1ZAEA 4QHTA 3HJ8A 1L2CA 3VKGA 5EXSA 1G59A 1KSFX 1DGHB 3AOEA 2EO2A 1R2ZA 4D81A 3MHVC 4JI2M 4RF1A 3IG8A 3JR4A 4PDGA 2M5ZA 1L8QA 3U60A 2CHVA 1XNQM 3I51A 3D8BA 2A5YB 1N32M 2KXEA 4GKJM 2UXCM 1TH2A 2I7PA 2XSZA 5ITTA 2UXBM 3FTDA 4MGKE 4JI5M 5IT9S 2CEAA 3GPXA 3KS4A 3HHXA 3KFUG 4LJ5A 5E6JA 4I4LA 5KQ8A 1XNRM 1ORYB 1XXHA 2R62A 4LFBM 3A98B 3RGPA 2HL7A 3GRYA 2UUAM 3KSJA 1SXJE 4JI6M 5FSWA 1KYIA 2XEPA 2ZAOA 3HHYA 3L2AA 3LQQA 2P5TA 2QPAA 5H37D 2R65A 1NJFA 2LXEA 1E94E 5FLXS 4R7GA 2VQEM 4TUWA 1HT1E 3J2PB 2R18A 4CHTB 2XH9A 3FTFA 4BB9A 3SBJA 1UM8A 2L6OA 3SAWA 2KZSA 1ZQ9A 4GITA 4L16A 2KEBA 4LCBA 4LJ9A 1L2BA 2LNHC 3L27A 2CV2A 3T38A 3HHZA 3LMMA 2QZ4A 1Z5AA 3RGSA 4DUYM 2L7HA 3TWLA 3GO8A 4LF9M 1TDZA 1Q3CA 3TQSA 2ZANA 4LY6A 3WHLA 3FUWA 4QNMA 2DVWB 3BOSA 1I4WA 4DR3M 2R46A 4YY3M 3GLHA 3NWLA 4B3MM 4L8RC 3SAVA 4W5WA 3E4RA 2QBYA 3R8FA 4K0KM 1EE8A 2QP9X 3QAUA 1IN5A 1HNZM 1MU5A 1VDDA 4HL4A 4YHHM 3SATA 4QHSA 1K3XA 3MK6A 3FUVA 4LJ8A 4B08A 3VK7A 4DV6M 3VK8A 1L1ZA 2UUCM 4GHLA 3GLHB 1G41A 3SHGB 1T3TA 1K82A 2KRKA 3PFIA 3U6DA 1J7KA 2QBYB 5ITQA 1YSYA 3CF6E 1FNNA 2LWXA 4B7HA 4GKKM 2KRUA 5KO3A 3GLFB 4AKGA 4WURA 4NSOB 2DWLA 3AJIB 3B9PA 2C96A 5FTLA 4A3VB 4QOSA 4NRVA 3FTCA 1N36M 1Z5BA 2EUCA 1HT2E 3GRRA 2FOIC 4OU7A 3SMPA 4LGMA 2NQ8C 1WXQA 1MX0A 1QAMA 2XF3A 2BJVA 4LJAA 2ERCA 7CATA 4DV4M 4OVZA 3AL0C 1GL6A 1OJLA 4D80A 2F5QA 4REZA 2CHGA 5KPZA 1E9RA 1SXJC 5GKNA 1IY2A 2FFJA 1DGHA 2Y0QA 1JR3A 3U6PA 2V1CA 4NRWA 4IBGA 2YNMD 1IY1A 4PDIA 3UMMA 4FCTA 3SC3A 3SHFA 4OVZB 3M6AA 4IIWA 4X62M 3T1HM 5FTNA 3DOAA 3UGJA 4DR6M 3GQ5A 3VKHA 1XWIA 3D8LA 5EQTA 3SYLA 1OFIA 5IZ7D 3PVSA 4X66M 1NHWC 3HJQA 4Z8XA 4QNRA 3TPZA 3KP0E 2RGHA 3VDPA 3DZDA 4AW4A 3VFDA 4JI8M 4AKHA 4IJEA 4B7FA 2X4AA 3L29A 2KZUA 3PNYA 3AKZA 4NSRA 1IBLM 3K2LA 3GRVA 3GQ3A 2HKJA 3AFHA 3AOEC 1SXJD 2G8LA 1J09A 1L1TA 2FE8A 3TE6A 4B3TM 2Z4SA 3LVWA 1GKIA 1TGUA 1QANA 1PM5A 4DR4M 3Q8XA 5DNYA 4L15A 1HR0M 2J7NA 1W5TA 4FW9A 4LF4M 3FUUA 4G6ZA 4L78A 4LFAM 2UXDM 4Z6YA 1DGGA 3KOYE 5KQDA 4IBDA 4IJFA 5JI3E 1XMQM 3L28A 4IBKA 4M9ZA 2XZFA 2EA0A 4JI1M 3KW6A 5A2QS 1I94M 4DV0M 2ZM6M 3C58A 5KPTA 1IXSB 5BR8M 4JI4M 2CUZA 3JR5A 4NOOB 2XLJA 3KSXA 5FTKA 3KDSE 4AG6A 1NY5A 3KOWE 4G4OA 2F5OA 1DO0A 2F5SA 4MH0E 4AKIA 1KFVA 3RE8A 1DGBA 3MJ5A 4DV3M 2YQZA 2BNKA 4P16A 3FUXA 5EXTA 3QWLA 4BLCA 1YE9A 3TWMA 3SYKA 1N75A 5C1BA 4KHPM 1NVMA 2XSZD 3U6LA 3K92A 2UU9M 4G4NA 3GPPA 4EIWA 1TH3A 5ITXA 1HQYE 1Q39A 5E26A 2VIIA 4IBJA 4DV2M 3GLFA 2DXIA 4JV5M 3ZCBB 3U6MA 1GLNA 4G4QA 3ZH9B 4KLNA 3E9SA 4LF7M 2Q2EB 2FNAA 3FTEA 3RFWA 4AI6A 1YUBA 3T1YM 4LG2A 2XFSA 4M0WA 3M0EA 3A46A 4D82A 3THGA 3VDUA 2OPFA 2F5NA 2ZAMA 2CE7A 1PJIA 1XHBA 3UJNA 2QCUA 4JI7M 3U6CA 1N78A 2D7GA 4QOZC 2DWZB 4IBEA 4I8OA 4M9XA 1GL7A 2RGOA 5DYGA 2HCBA 2V6ZM 4GRIA 4XGIA 5FTMA 3R9XB 2H1RA 1NSFA 3T15A 2XZUA 3SAUA 2E5LM 3ZC7B 2C5RA 4JN6A 2DWNA 5ITUA 1Z6TA 1K3WA 2VQFM 3A42A 4LJ6A 3SASA 1G4AE 4LFCM 1OFHA 3PNVA 4MGZE 4WW0A 3M7GA 3PXGA 3L26A 3GLIB 1HQCA 4KODA 5C18A 4X64M 4BBAA 2AHMA 2C99A 1XMOM 2L09A 3U5ZB 4JI3M 2KW0A 4LRTA 3DA1A 5ITXE 3UZUA 1NNUC 4AQYM 3KOXE 4GC5A 3I4YA 1QAOA 2C9CA 3CF2A 4IBFA 5EXXA 1IN4A 3UK6A 3HHWA 3KVWA 4DR1M 1PJJA 1N34M 2X8AA 2OQ4A 4MGHA 3FYCA 1DO2A 4DV1M 2M60A 1NHGC 4FWGA 3EIEA 3FUTA 2W82A 5FTJA 1TDHA 1Z59A 1N33M 4B3SM 4LF6M 3TWKA 2D7HA 5EJCA 5EP4A 4R3DA 4RF0A 2DZNB 2JA2A 4X65M 2C9OA 4DV7M 4GC9A 2Z7JA 2CV1A 2CHQA 1IN7A 2KA6B 5EP3A 4FWHA 3SMSA 5EP1A 1C1KA 5JI2E 4LF8M 4II7A 4PD2A 3DFZA 2QENA 3W0LB 1G3IA 3FKEA 1L2DA 1DGFA 1JR3D 2DZOB 2XFTA 2R45A 4S12A 1FJGM 4FWDA 5LMUM 3TL4X 2CFOA 3SARA 3J80S 3KP1E 3LQRA 3U60B 3KS8A 3CF0A 3I4VA 1IM2A 3AOGA 3EIHA 3K8ZA 3OTOM 4LJ7A 2O5RA 3VLFB 3HU1A 5F3WA 4IBCA 4AZFA 3JAMS 3J7BA 1QZMA 2Y0TA 4ZPXA 2XGNA 3HKPA 5EP2A 4CGYB 3J81S 3W0FA 1XXHB 4IBIA 3GP1A 1QQWA 4DUZM 2L7IA 1W5SA 4MM3B 4ITQA 1TH4A 4LZZA 3GRUA 1JQJC 3HGIA 3AV0A 1XC8A 4JYAM 1GVNA 3A45A 4M9SA 1QVRA 3U6SA 2R4JA 1IN6A 1IY0A 4GH9A 3GPUA 2F4VM 1HNXM 1NJGA 1H6UA 3GLGA 3H4MA 4FD2A 3WHKA 1HNWM 3CTWB 1E9SA 3U6EA 4MGYE 5IWAM 4GHAA 2X49A 4I5SA 4LZJA 3U6OA 4LF5M 3IG5A 4FCWA 8CATA 3GLGB 3U61A 2D7EA 2ZBKB 3KOZE 4I81A 4XBOA 1IBMM 2Z4RA 1R2YA 4G4RA 4MGIE 2DHRA 3HJSA 4L4UA 4LRSA 5ITRA 2F5PA 1QAQA 2YFQA 4HLQA 3K1JA 2RKOA 4DR2M 2R4EA 1J5EM 4OX9M 4CISA 2CV0A 1Q3BA 4PCZA 1N77A 4JI0M 4NL4H 3U61B 3HWSA 4DV5M 5LMNM 2G5GX 4B7GA 4LGYA 3J7AS 3GQ4A 2UUBM 3L25A 3ILKA 4NXMM 4GMQA 3GLIA 3J27B 1X37A 5DYIA 4RNAA 4M0DA 3U5ZA 1R6BX 2Z3XA 1SXJA 5KPRA 1IQPA 1E32A 3SFZA 2V1UA 3LVVA 3GPYA 4JXJA 5EXPA 1LV7A 2C98A 1S3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JR5 A;  1NNJ A;  1K3X A;  4DR7 M;  3VK7 A;  1TDH A;  1Z59 A;  4DV6 M;  3VK8 A;  4G4O A;  1L1Z A;  2F5O A;  1K82 A;  2F5S A;  4NXN M;  2UUC M;  4B3S M;  4LF6 M;  3U6Q A;  1N33 M;  3TWK A;  4MB7 A;  3U6D A;  1KFV A;  1IBK M;  3SAT A;  4X65 M;  4DV3 M;  5ITQ A;  4DV7 M;  1Z5C A;  4DR5 M;  4B3R M;  4LF8 M;  4GKK M;  4PD2 A;  1L2D A;  3TWM A;  4KHP M;  2HHH M;  5ITY A;  3U6L A;  1FJG M;  2UU9 M;  5LMU M;  4NRV A;  1N36 M;  4G4N A;  3SAR A;  3J80 S;  1Z5B A;  3GPP A;  1L2C A;  5ITX A;  3OTO M;  1Q39 A;  1MX0 A;  4DV2 M;  4JV5 M;  3U6M A;  4G4Q A;  4DV4 M;  1R2Z A;  3JAM S;  4JI2 M;  3JR4 A;  4PDG A;  2F5Q A;  4LF7 M;  3J81 S;  2Q2E B;  3W0F A;  1XNQ M;  3GP1 A;  1N32 M;  4DUZ M;  2UXC M;  4GKJ M;  3T1Y M;  3U6P A;  4NRW A;  4ITQ A;  5ITT A;  2UXB M;  4JI5 M;  3A46 A;  5IT9 S;  3GPX A;  1XC8 A;  4PDI A;  4JYA M;  3A45 A;  2F4V M;  3U6S A;  3GPU A;  4X62 M;  3T1H M;  1XNR M;  1HNX M;  2OPF A;  4LFB M;  2F5N A;  3DOA A;  4DR6 M;  3GQ5 A;  1PJI A;  2UUA M;  4JI6 M;  4JI7 M;  1HNW M;  3U6C A;  3U6E A;  5IWA M;  4X66 M;  3U6O A;  4LF5 M;  5FLX S;  2VQE M;  4JI8 M;  2XZU A;  2ZBK B;  3SAU A;  2E5L M;  3SBJ A;  1IBM M;  3SAW A;  1IBL M;  1R2Y A;  5ITU A;  1K3W A;  3GQ3 A;  4G4R A;  1L2B A;  2VQF M;  3A42 A;  5ITR A;  2HKJ A;  2F5P A;  3SAS A;  4LFC M;  4DR2 M;  1J5E M;  1L1T A;  4OX9 M;  1Z5A A;  4CIS A;  4B3T M;  1Q3B A;  4PCZ A;  4DUY M;  4X64 M;  1XMO M;  4JI0 M;  4DV5 M;  4JI3 M;  5LMN M;  3TWL A;  3GO8 A;  1PM5 A;  4DR4 M;  4LF9 M;  1TDZ A;  1Q3C A;  1HR0 M;  5ITX E;  4LF4 M;  3J7A S;  3GQ4 A;  2UUB M;  4NXM M;  4LFA M;  2UXD M;  4AQY M;  4DR3 M;  4YY3 M;  1XMQ M;  4B3M M;  2XZF A;  2EA0 A;  4JI1 M;  5A2Q S;  4DR1 M;  3SAV A;  1PJJ A;  1N34 M;  2OQ4 A;  1I94 M;  4DV0 M;  1EE8 A;  4K0K M;  2ZM6 M;  3GPY A;  3C58 A;  1HNZ M;  1MU5 A;  5BR8 M;  4DV1 M;  4YHH M;  4JI4 M; 
#chains in the Genus database with same CATH topology
 3FD9 A;  3FYD A;  2Z8Y M;  1NNJ A;  2Y21 A;  4DR7 M;  4GIP A;  4NXN M;  2J7O A;  4IBB A;  3U6Q A;  4LJ4 A;  1CUK A;  1NY6 A;  1R7R A;  2O01 F;  3B7Q A;  4PT5 A;  2K47 A;  4MB7 A;  3GLG E;  1SXJ B;  3KXE C;  1IBK M;  5BPV A;  1IN8 A;  2BJW A;  2I7N A;  4KO8 A;  4FVM A;  1QYR A;  4FCV A;  4OW0 A;  1IXZ A;  1IXR C;  1Z5C A;  1G8P A;  2DWM A;  5IRE B;  4DR5 M;  4B3R M;  2LH0 A;  2YR0 A;  2HHH M;  4AG5 A;  5ITY A;  1NO1 A;  3NBI A;  3HU3 A;  1D2N A;  2Y20 A;  3HU2 A;  1VEG A;  1ZAE A;  4QHT A;  3HJ8 A;  1L2C A;  3VKG A;  5EXS A;  1G71 A;  1G59 A;  1KSF X;  2R6F A;  2CRU A;  1DGH B;  2BWE A;  2OOA A;  3AOE A;  2EO2 A;  1QUT A;  2JY6 B;  2LVN C;  1R2Z A;  4D81 A;  3MHV C;  4JI2 M;  3BBZ A;  3IG8 A;  4RF1 A;  3JR4 A;  4PDG A;  2M5Z A;  1L8Q A;  2MRO B;  3U60 A;  2CHV A;  1XNQ M;  3D8B A;  3I51 A;  2A5Y B;  3H4J A;  1N32 M;  1D0K A;  2KXE A;  4GKJ M;  2UXC M;  1TH2 A;  2I7P A;  3LW5 F;  2XSZ A;  5ITT A;  2UXB M;  3FTD A;  4MGK E;  2GNO A;  4JI5 M;  5IT9 S;  2CEA A;  3GPX A;  3KS4 A;  3HHX A;  3KFU G;  4LJ5 A;  5E6J A;  4I4L A;  5KQ8 A;  1XNR M;  1ORY B;  1XXH A;  2R62 A;  4LFB M;  3A98 B;  3RGP A;  2HL7 A;  3GRY A;  2UUA M;  3KSJ A;  1SXJ E;  4JI6 M;  2MJ5 B;  3F92 A;  1RU3 A;  2JNH A;  2R0I A;  3C9P A;  5FSW A;  1KYI A;  2L2D A;  2XEP A;  2ZAO A;  3HHY A;  3L2A A;  3LQQ A;  2P5T A;  2QPA A;  5H37 D;  2R65 A;  1NJF A;  2LXE A;  1E94 E;  5FLX S;  4R7G A;  2VQE M;  4TUW A;  1HT1 E;  3J2P B;  2R18 A;  4CHT B;  2LBC A;  2XH9 A;  3FTF A;  4BB9 A;  2JZ1 A;  3SBJ A;  1UM8 A;  2L6O A;  4NC6 A;  2KZS A;  3FRH A;  3SAW A;  1ZQ9 A;  2G3Q A;  4GIT A;  4L16 A;  2KEB A;  4LCB A;  4LJ9 A;  1L2B A;  1VEK A;  2LNH C;  3FE3 A;  3L27 A;  2CV2 A;  3T38 A;  3HHZ A;  1BVS A;  3LMM A;  2QZ4 A;  4F2L A;  1Z5A A;  1WIV A;  3RGS A;  4DUY M;  2L7H A;  2QQ8 A;  1V34 A;  3TWL A;  2LVP C;  3GO8 A;  4LF9 M;  1TDZ A;  1Q3C A;  3TQS A;  1JB0 F;  2ZAN A;  4LY6 A;  3WHL A;  3FUW A;  4QNM A;  2DVW B;  4P17 A;  2ZTC A;  3BOS A;  1I4W A;  4DR3 M;  2R46 A;  2WSF F;  2VF7 A;  3GLH A;  4YY3 M;  1EFU B;  1XB2 B;  1QUS A;  3NWL A;  4B3M M;  4L8R C;  2JZ0 A;  2VF8 A;  3SAV A;  4W5W A;  3E4R A;  2QBY A;  3R8F A;  2VDB B;  4K0K M;  1EE8 A;  2QP9 X;  3QAU A;  1IN5 A;  1HNZ M;  1MU5 A;  1VDD A;  4HL4 A;  4YHH M;  3SAT A;  4QHS A;  3W67 A;  1K3X A;  2LVA A;  3MK6 A;  3FUV A;  4LJ8 A;  4B08 A;  3VK7 A;  2EKF A;  4KT0 F;  4DV6 M;  3VK8 A;  1L1Z A;  2UUC M;  3GLH B;  1G41 A;  3SHG B;  1T3T A;  1K82 A;  4GHL A;  3K9P A;  1EIJ A;  3LCV B;  2KRK A;  3PFI A;  3U6D A;  1J7K A;  2QBY B;  5ITQ A;  1YSY A;  3CF6 E;  1FNN A;  2LWX A;  2KNZ A;  4B7H A;  4GKK M;  2KRU A;  5KO3 A;  3GLF B;  4AKG A;  4WUR A;  4NSO B;  2DWL A;  3AJI B;  3B9P A;  2C96 A;  5FTL A;  2JWS A;  4A3V B;  4QOS A;  4NRV A;  3FTC A;  1N36 M;  1Z5B A;  2EUC A;  1HT2 E;  3GRR A;  2FOI C;  4OU7 A;  1D0M A;  3SMP A;  4LGM A;  2NQ8 C;  1WXQ A;  1OIZ A;  1MX0 A;  1QAM A;  2XF3 A;  2BJV A;  4LJA A;  2ERC A;  2LTU A;  7CAT A;  4DV4 M;  2DKL A;  4OVZ A;  3I04 M;  3AL0 C;  1GL6 A;  1OJL A;  4D80 A;  2F5Q A;  4REZ A;  1TF0 B;  2CHG A;  5KPZ A;  1E9R A;  1SXJ C;  1F4I A;  5GKN A;  1IY2 A;  2FFJ A;  1DV0 A;  1DGH A;  2Y0Q A;  1JR3 A;  2LHG A;  2V1C A;  2JY5 A;  3Q8G A;  5DFL A;  1TR8 A;  3U6P A;  4NRW A;  4IBG A;  2YNM D;  4L6V 6;  1IY1 A;  4PDI A;  3UMM A;  4FCT A;  3SC3 A;  3SHF A;  1V33 A;  4OVZ B;  3M6A A;  4IIW A;  4X62 M;  3T1H M;  3GLH E;  5FTN A;  1OQY A;  3DOA A;  3UGJ A;  3B74 A;  3GQ5 A;  4DR6 M;  1WR1 B;  2K0B X;  3VKH A;  1XWI A;  3D8L A;  5EQT A;  1Y8G A;  1A5T A;  3SYL A;  2QSF X;  1OFI A;  2R44 A;  5IZ7 D;  1VDL A;  3PVS A;  4X66 M;  1NHW C;  3HJQ A;  3K9O A;  4Z8X A;  4QNR A;  3TPZ A;  1R5L A;  2LVO C;  3KP0 E;  2RGH A;  3GLF E;  1T43 A;  3VDP A;  3DZD A;  4AW4 A;  3VFD A;  4JI8 M;  4AKH A;  4IJE A;  4B7F A;  2X4A A;  3L29 A;  1C7Y A;  2KZU A;  3PNY A;  3AKZ A;  4NSR A;  1IBL M;  2HAK A;  3K2L A;  3GRV A;  3GQ3 A;  2HKJ A;  3AFH A;  3AOE C;  1SXJ D;  2G8L A;  1J09 A;  4Q7J A;  1L1T A;  2FE8 A;  3TE6 A;  2B3T A;  4B3T M;  1V92 A;  1VEJ A;  2Z4S A;  2MGW A;  2DAM A;  3LVW A;  1GKI A;  1TGU A;  1QAN A;  1PRB A;  1PM5 A;  4DR4 M;  3Q8X A;  5DNY A;  4L15 A;  1HR0 M;  1ZMV A;  1W5T A;  2J7N A;  4FW9 A;  4LF4 M;  2OO9 A;  2FS1 A;  4WP2 A;  2QHO B;  3FUU A;  4G6Z A;  4L78 A;  4LFA M;  2UXD M;  4CIZ A;  4Z6Y A;  1DGG A;  3KOY E;  4UN2 B;  4IBD A;  4IJF A;  5KQD A;  5JI3 E;  2EKK A;  1XMQ M;  3L28 A;  4IBK A;  4M9Z A;  2XZF A;  2EA0 A;  4JI1 M;  1VQ1 A;  3KW6 A;  5A2Q S;  4G3O A;  1AUA A;  1I94 M;  4DV0 M;  1PJS A;  4DBG B;  2ZM6 M;  3C58 A;  5KPT A;  1IXS B;  1JR3 E;  5BR8 M;  2HWJ A;  3BXW A;  4JI4 M;  1GO5 A;  2CUZ A;  3IHP A;  3JR5 A;  4NOO B;  2XLJ A;  1PJQ A;  3KSX A;  3KDS E;  5FTK A;  4AG6 A;  1NY5 A;  3KOW E;  2RRU A;  4G4O A;  1DO0 A;  2F5O A;  2F5S A;  3FRI A;  3HY5 A;  4MH0 E;  4AKI A;  1KFV A;  3RE8 A;  1DGB A;  1TTE A;  1ZMU A;  3MJ5 A;  4DV3 M;  2YQZ A;  2BNK A;  4P16 A;  4XK8 F;  3FUX A;  5EXT A;  1PJT A;  3QWL A;  4BLC A;  2H5X A;  1YE9 A;  3TWM A;  3SYK A;  1N75 A;  5C1B A;  4KHP M;  1NVM A;  2XSZ D;  3U6L A;  3K92 A;  2JXN A;  2UU9 M;  4G4N A;  1T6O A;  3B89 A;  4HEO A;  2JP7 A;  3GPP A;  4EIW A;  2JUJ A;  1TH3 A;  5L8R F;  5ITX A;  1HQY E;  1Q39 A;  1L2D A;  1OKS A;  5E26 A;  2VII A;  4IBJ A;  4DV2 M;  3GLF A;  2DXI A;  4JV5 M;  3ZCB B;  3U6M A;  1GLN A;  4G4Q A;  3ZH9 B;  4KLN A;  1WHC A;  2JY7 A;  2N35 A;  3E9S A;  4LF7 M;  1IFY A;  1UFZ A;  2Q2E B;  1WJ7 A;  2FNA A;  1ZV1 A;  3FTE A;  3RFW A;  2L4E A;  4AI6 A;  1YUB A;  3T1Y M;  4LG2 A;  2XFS A;  3I01 M;  3QYB A;  4M0W A;  3M0E A;  3A46 A;  1WGN A;  4D82 A;  3THG A;  3V76 A;  3HZJ A;  3VDU A;  2OPF A;  2F5N A;  2ZAM A;  2CE7 A;  1PJI A;  1XHB A;  3UJN A;  2QCU A;  4JI7 M;  1P3Q Q;  3U6C A;  1N78 A;  2D7G A;  4QOZ C;  2DWZ B;  4IBE A;  4I8O A;  4M9X A;  2GQF A;  1GL7 A;  3W68 A;  2RGO A;  5DYG A;  2DEN A;  2HCB A;  3E21 A;  2V6Z M;  4GRI A;  4XGI A;  2DAK A;  1ZMW A;  5FTM A;  3R9X B;  2H1R A;  1NSF A;  3T15 A;  2XZU A;  1GJS A;  3ZQJ A;  3SAU A;  2E5L M;  3ZC7 B;  2C5R A;  4JN6 A;  2DWN A;  2BWB A;  5ITU A;  1Z6T A;  1K3W A;  2DI0 A;  2VQF M;  3A42 A;  2DHY A;  4LJ6 A;  3SAS A;  1G4A E;  4LFC M;  1OFH A;  3PNV A;  4MGZ E;  4WW0 A;  3M7G A;  3PXG A;  3L26 A;  3GLI B;  1HQC A;  1YLA A;  4KOD A;  5C18 A;  1GAB A;  4X64 M;  4BBA A;  2AHM A;  2C99 A;  1XMO M;  2L09 A;  3U5Z B;  4JI3 M;  2KW0 A;  4LRT A;  3DA1 A;  1NV9 A;  1MN3 A;  5ITX E;  2MR9 A;  3UZU A;  1NNU C;  4AQY M;  3KOX E;  4GC5 A;  3NBX X;  3I4Y A;  1QAO A;  2C9C A;  3CF2 A;  4IBF A;  5EXX A;  1IN4 A;  3UK6 A;  3HHW A;  3KVW A;  3MMP A;  4GEW A;  2DZL A;  4DR1 M;  1PJJ A;  1N34 M;  2X8A A;  2OQ4 A;  4MGH A;  3FYC A;  2L4F A;  1DO2 A;  1HJP A;  2CWB A;  2KHH A;  4DV1 M;  2M60 A;  1NHG C;  4FWG A;  3EIE A;  2LHC A;  3FUT A;  2W82 A;  5FTJ A;  1TDH A;  1Z59 A;  3T6P A;  1N33 M;  4B3S M;  4LF6 M;  1WGL A;  3TWK A;  2D7H A;  5EJC A;  5EP4 A;  4R3D A;  1IXS A;  4RF0 A;  2DZN B;  2JA2 A;  4X65 M;  2C9O A;  4DV7 M;  4GC9 A;  2Z7J A;  2CV1 A;  2CHQ A;  1IN7 A;  2KA6 B;  5EP3 A;  4FWH A;  3SMS A;  5EP1 A;  1C1K A;  2DNA A;  5JI2 E;  4LF8 M;  4II7 A;  4PD2 A;  3DFZ A;  1LTM A;  2QEN A;  1G3I A;  2K6B A;  3FKE A;  1DGF A;  1JR3 D;  2DZO B;  2XFT A;  3W0L B;  2FH0 A;  2R45 A;  4S12 A;  3GLI E;  1FJG M;  4FWD A;  1QDR A;  5LMU M;  3TL4 X;  2CFO A;  3SAR A;  3J80 S;  3CGW A;  2WSE F;  3KP1 E;  3B7N A;  3LQR A;  3U60 B;  3KS8 A;  3CF0 A;  3I4V A;  1IM2 A;  3AOG A;  3EIH A;  3K8Z A;  3OTO M;  4LJ7 A;  2O5R A;  3VLF B;  3HU1 A;  5F3W A;  4IBC A;  2LVQ D;  4AZF A;  3JAM S;  3J7B A;  1AIP C;  1QZM A;  3B7Z A;  2Y0T A;  4ZPX A;  2OOB A;  2XGN A;  3HKP A;  5EP2 A;  4CGY B;  3J81 S;  3W0F A;  1XXH B;  2WZJ A;  2DAE A;  4IBI A;  1QQW A;  3GP1 A;  4DUZ M;  2L7I A;  1W5S A;  4MM3 B;  4ITQ A;  1TH4 A;  4LZZ A;  3GRU A;  1VG5 A;  1OAI A;  1JQJ C;  2APL A;  3HGI A;  3AV0 A;  4CJ6 A;  1XC8 A;  4JYA M;  2JY8 A;  1GVN A;  3A45 A;  4M9S A;  1QVR A;  3U6S A;  2R4J A;  1IN6 A;  1IY0 A;  4GH9 A;  3GPU A;  2F4V M;  1HNX M;  1NJG A;  1H6U A;  3GLG A;  3H4M A;  2J5Y A;  2EJS A;  4FD2 A;  3WHK A;  1HNW M;  3CTW B;  1Q02 A;  1D0L A;  1E9S A;  3U6E A;  4MGY E;  5IWA M;  4GHA A;  1OTR A;  2X49 A;  2K9D A;  4I5S A;  4LZJ A;  3U6O A;  3C3D A;  4LF5 M;  3IG5 A;  3HX3 A;  4FCW A;  8CAT A;  3GLG B;  3U61 A;  1PGY A;  2D7E A;  2ZBK B;  3KOZ E;  4I81 A;  4XBO A;  1IBM M;  4R71 A;  2DAG A;  2Z4R A;  4RKU F;  1R2Y A;  4F1I A;  4G4R A;  4MGI E;  2DHR A;  3HJS A;  4L4U A;  4LRS A;  5ITR A;  2F5P A;  1QAQ A;  3IEC A;  1SG9 A;  2YFQ A;  1OIP A;  4HLQ A;  3K1J A;  2QNJ A;  2RKO A;  4DR2 M;  2R4E A;  1J5E M;  4OX9 M;  4CIS A;  2CV0 A;  2WSC F;  1Q3B A;  2DAI A;  4Y28 F;  4PCZ A;  1N77 A;  1MJG M;  4JI0 M;  4NL4 H;  1QZE A;  3U61 B;  3HWS A;  1XXH E;  2KDL A;  2O25 A;  5LMN M;  4DV5 M;  2CP8 A;  2G5G X;  4B7G A;  4LGY A;  3J7A S;  3GQ4 A;  2UUB M;  4ANR A;  2ZTD A;  3L25 A;  3ILK A;  4NXM M;  3E46 A;  4GMQ A;  3GLI A;  3J27 B;  1X37 A;  1GJT A;  5DYI A;  4RNA A;  4M0D A;  1R4G A;  3U5Z A;  1R6B X;  2Z3X A;  1SXJ A;  5KPR A;  1IQP A;  1E32 A;  3QYE A;  3SFZ A;  1NV8 A;  2V1U A;  1QDT A;  3LVV A;  1OAO C;  3C3E A;  3GPY A;  2KNV A;  2MH8 A;  3LCU A;  4JXJ A;  5EXP A;  1LV7 A;  2C98 A;  2KNA A;  1S3S A; 
#chains in the Genus database with same CATH homology
 3FD9 A;  3FYD A;  1NNJ A;  2Y21 A;  4DR7 M;  4GIP A;  4NXN M;  2J7O A;  4IBB A;  3U6Q A;  4LJ4 A;  1NY6 A;  1R7R A;  4PT5 A;  2K47 A;  4MB7 A;  1SXJ B;  3KXE C;  1IBK M;  5BPV A;  1IN8 A;  2BJW A;  2I7N A;  4KO8 A;  4FVM A;  1QYR A;  4FCV A;  4OW0 A;  1IXZ A;  1IXR C;  1Z5C A;  1G8P A;  2DWM A;  5IRE B;  4DR5 M;  4B3R M;  2LH0 A;  2YR0 A;  2HHH M;  4AG5 A;  5ITY A;  3NBI A;  3HU3 A;  1D2N A;  2Y20 A;  3HU2 A;  1ZAE A;  4QHT A;  3HJ8 A;  1L2C A;  3VKG A;  5EXS A;  1G59 A;  1KSF X;  1DGH B;  3AOE A;  2EO2 A;  1R2Z A;  4D81 A;  3MHV C;  4JI2 M;  4RF1 A;  3IG8 A;  3JR4 A;  4PDG A;  2M5Z A;  1L8Q A;  3U60 A;  2CHV A;  1XNQ M;  3I51 A;  3D8B A;  2A5Y B;  1N32 M;  2KXE A;  4GKJ M;  2UXC M;  1TH2 A;  2I7P A;  2XSZ A;  5ITT A;  2UXB M;  3FTD A;  4MGK E;  4JI5 M;  5IT9 S;  2CEA A;  3GPX A;  3KS4 A;  3HHX A;  3KFU G;  4LJ5 A;  5E6J A;  4I4L A;  5KQ8 A;  1XNR M;  1ORY B;  1XXH A;  2R62 A;  4LFB M;  3A98 B;  3RGP A;  2HL7 A;  3GRY A;  2UUA M;  3KSJ A;  1SXJ E;  4JI6 M;  5FSW A;  1KYI A;  2XEP A;  2ZAO A;  3HHY A;  3L2A A;  3LQQ A;  2P5T A;  2QPA A;  5H37 D;  2R65 A;  1NJF A;  2LXE A;  1E94 E;  5FLX S;  4R7G A;  2VQE M;  4TUW A;  1HT1 E;  3J2P B;  2R18 A;  4CHT B;  2XH9 A;  3FTF A;  4BB9 A;  3SBJ A;  1UM8 A;  2L6O A;  3SAW A;  2KZS A;  1ZQ9 A;  4GIT A;  4L16 A;  2KEB A;  4LCB A;  4LJ9 A;  1L2B A;  2LNH C;  3L27 A;  2CV2 A;  3T38 A;  3HHZ A;  3LMM A;  2QZ4 A;  1Z5A A;  3RGS A;  4DUY M;  2L7H A;  3TWL A;  3GO8 A;  4LF9 M;  1TDZ A;  1Q3C A;  3TQS A;  2ZAN A;  4LY6 A;  3WHL A;  3FUW A;  4QNM A;  2DVW B;  3BOS A;  1I4W A;  4DR3 M;  2R46 A;  4YY3 M;  3GLH A;  3NWL A;  4B3M M;  4L8R C;  3SAV A;  4W5W A;  3E4R A;  2QBY A;  3R8F A;  4K0K M;  1EE8 A;  2QP9 X;  3QAU A;  1IN5 A;  1HNZ M;  1MU5 A;  1VDD A;  4HL4 A;  4YHH M;  3SAT A;  4QHS A;  1K3X A;  3MK6 A;  3FUV A;  4LJ8 A;  4B08 A;  3VK7 A;  4DV6 M;  3VK8 A;  1L1Z A;  2UUC M;  4GHL A;  3GLH B;  1G41 A;  3SHG B;  1T3T A;  1K82 A;  2KRK A;  3PFI A;  3U6D A;  1J7K A;  2QBY B;  5ITQ A;  1YSY A;  3CF6 E;  1FNN A;  2LWX A;  4B7H A;  4GKK M;  2KRU A;  5KO3 A;  3GLF B;  4AKG A;  4WUR A;  4NSO B;  2DWL A;  3AJI B;  3B9P A;  2C96 A;  5FTL A;  4A3V B;  4QOS A;  4NRV A;  3FTC A;  1N36 M;  1Z5B A;  2EUC A;  1HT2 E;  3GRR A;  2FOI C;  4OU7 A;  3SMP A;  4LGM A;  2NQ8 C;  1WXQ A;  1MX0 A;  1QAM A;  2XF3 A;  2BJV A;  4LJA A;  2ERC A;  7CAT A;  4DV4 M;  4OVZ A;  3AL0 C;  1GL6 A;  1OJL A;  4D80 A;  2F5Q A;  4REZ A;  2CHG A;  5KPZ A;  1E9R A;  1SXJ C;  5GKN A;  1IY2 A;  2FFJ A;  1DGH A;  2Y0Q A;  1JR3 A;  3U6P A;  2V1C A;  4NRW A;  4IBG A;  2YNM D;  1IY1 A;  4PDI A;  3UMM A;  4FCT A;  3SC3 A;  3SHF A;  4OVZ B;  3M6A A;  4IIW A;  4X62 M;  3T1H M;  5FTN A;  3DOA A;  3UGJ A;  4DR6 M;  3GQ5 A;  3VKH A;  1XWI A;  3D8L A;  5EQT A;  3SYL A;  1OFI A;  5IZ7 D;  3PVS A;  4X66 M;  1NHW C;  3HJQ A;  4Z8X A;  4QNR A;  3TPZ A;  3KP0 E;  2RGH A;  3VDP A;  3DZD A;  4AW4 A;  3VFD A;  4JI8 M;  4AKH A;  4IJE A;  4B7F A;  2X4A A;  3L29 A;  2KZU A;  3PNY A;  3AKZ A;  4NSR A;  1IBL M;  3K2L A;  3GRV A;  3GQ3 A;  2HKJ A;  3AFH A;  3AOE C;  1SXJ D;  2G8L A;  1J09 A;  1L1T A;  2FE8 A;  3TE6 A;  4B3T M;  2Z4S A;  3LVW A;  1GKI A;  1TGU A;  1QAN A;  1PM5 A;  4DR4 M;  3Q8X A;  5DNY A;  4L15 A;  1HR0 M;  2J7N A;  1W5T A;  4FW9 A;  4LF4 M;  3FUU A;  4G6Z A;  4L78 A;  4LFA M;  2UXD M;  4Z6Y A;  1DGG A;  3KOY E;  5KQD A;  4IBD A;  4IJF A;  5JI3 E;  1XMQ M;  3L28 A;  4IBK A;  4M9Z A;  2XZF A;  2EA0 A;  4JI1 M;  3KW6 A;  5A2Q S;  1I94 M;  4DV0 M;  2ZM6 M;  3C58 A;  5KPT A;  1IXS B;  5BR8 M;  4JI4 M;  2CUZ A;  3JR5 A;  4NOO B;  2XLJ A;  3KSX A;  5FTK A;  3KDS E;  4AG6 A;  1NY5 A;  3KOW E;  4G4O A;  2F5O A;  1DO0 A;  2F5S A;  4MH0 E;  4AKI A;  1KFV A;  3RE8 A;  1DGB A;  3MJ5 A;  4DV3 M;  2YQZ A;  2BNK A;  4P16 A;  3FUX A;  5EXT A;  3QWL A;  4BLC A;  1YE9 A;  3TWM A;  3SYK A;  1N75 A;  5C1B A;  4KHP M;  1NVM A;  2XSZ D;  3U6L A;  3K92 A;  2UU9 M;  4G4N A;  3GPP A;  4EIW A;  1TH3 A;  5ITX A;  1HQY E;  1Q39 A;  5E26 A;  2VII A;  4IBJ A;  4DV2 M;  3GLF A;  2DXI A;  4JV5 M;  3ZCB B;  3U6M A;  1GLN A;  4G4Q A;  3ZH9 B;  4KLN A;  3E9S A;  4LF7 M;  2Q2E B;  2FNA A;  3FTE A;  3RFW A;  4AI6 A;  1YUB A;  3T1Y M;  4LG2 A;  2XFS A;  4M0W A;  3M0E A;  3A46 A;  4D82 A;  3THG A;  3VDU A;  2OPF A;  2F5N A;  2ZAM A;  2CE7 A;  1PJI A;  1XHB A;  3UJN A;  2QCU A;  4JI7 M;  3U6C A;  1N78 A;  2D7G A;  4QOZ C;  2DWZ B;  4IBE A;  4I8O A;  4M9X A;  1GL7 A;  2RGO A;  5DYG A;  2HCB A;  2V6Z M;  4GRI A;  4XGI A;  5FTM A;  3R9X B;  2H1R A;  1NSF A;  3T15 A;  2XZU A;  3SAU A;  2E5L M;  3ZC7 B;  2C5R A;  4JN6 A;  2DWN A;  5ITU A;  1Z6T A;  1K3W A;  2VQF M;  3A42 A;  4LJ6 A;  3SAS A;  1G4A E;  4LFC M;  1OFH A;  3PNV A;  4MGZ E;  4WW0 A;  3M7G A;  3PXG A;  3L26 A;  3GLI B;  1HQC A;  4KOD A;  5C18 A;  4X64 M;  4BBA A;  2AHM A;  2C99 A;  1XMO M;  2L09 A;  3U5Z B;  4JI3 M;  2KW0 A;  4LRT A;  3DA1 A;  5ITX E;  3UZU A;  1NNU C;  4AQY M;  3KOX E;  4GC5 A;  3I4Y A;  1QAO A;  2C9C A;  3CF2 A;  4IBF A;  5EXX A;  1IN4 A;  3UK6 A;  3HHW A;  3KVW A;  4DR1 M;  1PJJ A;  1N34 M;  2X8A A;  2OQ4 A;  4MGH A;  3FYC A;  1DO2 A;  4DV1 M;  2M60 A;  1NHG C;  4FWG A;  3EIE A;  3FUT A;  2W82 A;  5FTJ A;  1TDH A;  1Z59 A;  1N33 M;  4B3S M;  4LF6 M;  3TWK A;  2D7H A;  5EJC A;  5EP4 A;  4R3D A;  4RF0 A;  2DZN B;  2JA2 A;  4X65 M;  2C9O A;  4DV7 M;  4GC9 A;  2Z7J A;  2CV1 A;  2CHQ A;  1IN7 A;  2KA6 B;  5EP3 A;  4FWH A;  3SMS A;  5EP1 A;  1C1K A;  5JI2 E;  4LF8 M;  4II7 A;  4PD2 A;  3DFZ A;  2QEN A;  3W0L B;  1G3I A;  3FKE A;  1L2D A;  1DGF A;  1JR3 D;  2DZO B;  2XFT A;  2R45 A;  4S12 A;  1FJG M;  4FWD A;  5LMU M;  3TL4 X;  2CFO A;  3SAR A;  3J80 S;  3KP1 E;  3LQR A;  3U60 B;  3KS8 A;  3CF0 A;  3I4V A;  1IM2 A;  3AOG A;  3EIH A;  3K8Z A;  3OTO M;  4LJ7 A;  2O5R A;  3VLF B;  3HU1 A;  5F3W A;  4IBC A;  4AZF A;  3JAM S;  3J7B A;  1QZM A;  2Y0T A;  4ZPX A;  2XGN A;  3HKP A;  5EP2 A;  4CGY B;  3J81 S;  3W0F A;  1XXH B;  4IBI A;  3GP1 A;  1QQW A;  4DUZ M;  2L7I A;  1W5S A;  4MM3 B;  4ITQ A;  1TH4 A;  4LZZ A;  3GRU A;  1JQJ C;  3HGI A;  3AV0 A;  1XC8 A;  4JYA M;  1GVN A;  3A45 A;  4M9S A;  1QVR A;  3U6S A;  2R4J A;  1IN6 A;  1IY0 A;  4GH9 A;  3GPU A;  2F4V M;  1HNX M;  1NJG A;  1H6U A;  3GLG A;  3H4M A;  4FD2 A;  3WHK A;  1HNW M;  3CTW B;  1E9S A;  3U6E A;  4MGY E;  5IWA M;  4GHA A;  2X49 A;  4I5S A;  4LZJ A;  3U6O A;  4LF5 M;  3IG5 A;  4FCW A;  8CAT A;  3GLG B;  3U61 A;  2D7E A;  2ZBK B;  3KOZ E;  4I81 A;  4XBO A;  1IBM M;  2Z4R A;  1R2Y A;  4G4R A;  4MGI E;  2DHR A;  3HJS A;  4L4U A;  4LRS A;  5ITR A;  2F5P A;  1QAQ A;  2YFQ A;  4HLQ A;  3K1J A;  2RKO A;  4DR2 M;  2R4E A;  1J5E M;  4OX9 M;  4CIS A;  2CV0 A;  1Q3B A;  4PCZ A;  1N77 A;  4JI0 M;  4NL4 H;  3U61 B;  3HWS A;  4DV5 M;  5LMN M;  2G5G X;  4B7G A;  4LGY A;  3J7A S;  3GQ4 A;  2UUB M;  3L25 A;  3ILK A;  4NXM M;  4GMQ A;  3GLI A;  3J27 B;  1X37 A;  5DYI A;  4RNA A;  4M0D A;  3U5Z A;  1R6B X;  2Z3X A;  1SXJ A;  5KPR A;  1IQP A;  1E32 A;  3SFZ A;  2V1U A;  3LVV A;  3GPY A;  4JXJ A;  5EXP A;  1LV7 A;  2C98 A;  1S3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...