2F4VQ

30s ribosome + designer antibiotic
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 15
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2f4vQ00
3F1ZA 1BBUA 1SLJA 3GD7A 2N78A 4JI8Q 4YCWA 2KCTA 5M3MG 3H3VI 2WB1G 2AHOB 5LMNW 4PZ8A 1KXLA 4A3GG 1I50H 1MKHA 3PO3H 4IFDJ 2R92G 4A4IA 4QJFA 4LFCQ 3S1QH 2B29A 4BA1I 5JEAJ 4A93G 3T1YQ 2EQSA 1SMXA 3RLNA 3K7UC 3S17H 4POFA 4A3FH 2KENA 2VY3A 4P72A 1I5FA 3CCQA 4DV1L 1SFOH 1PH1A 4A3KG 1VQOA 5C0XG 3CC2A 4DK6C 4BBSH 2ZJPA 4A3EH 3S24A 4A76A 1X3GA 4BBRH 3S1RH 4UP7A 4DV0L 4A3IH 2MQHA 2RCNA 3NEMA 4R4IA 2JA8G 4JI5Q 4L5TA 5IYDG 4JV5L 1EIFA 1GD7A 2F3IA 1VQHA 2Q2HA 2ALYB 3PGZA 4MTNA 1S40A 1VQ7A 3M7NA 1O7IA 3IRBA 2VZAA 2F52A 4NPSA 4DKAC 1AE3A 4A3GH 1V9PA 4JOIA 2R7DA 1XTDA 2BH2A 1Q1EA 4YWLA 3CAMA 4DV3Q 1YITA 1NY4A 1UE6A 3ICEA 4JG2A 2K4KA 1VQIA 1CKMA 1Q1BA 5FLXc 4YWMA 3CD6A 1PH2A 4IO9A 4GOPC 4LF8L 3UDGA 4FDBA 2F4VL 4DUZQ 1KL9A 1HH2P 1K3RA 1PYBA 3AQQA 4A3LH 4J15A 2KHIA 3BJUA 4A3MH 1LTLA 2ZJQA 1XNRL 2IY5B 1IBLQ 3FKIG 1OXTA 2A1AA 4BXXH 4A3IG 1PH8A 5IP7H 1CSPA 2Q2IA 1Y14B 4DR7Q 4OWXB 4KHPQ 3GDEA 2FXQA 3HKSA 2JA6G 4YHHL 1Q12A 3S2DH 2MNAA 3PUZA 1B7YB 1CKOA 1U0LA 4GNXA 1PH5A 1C9OA 3U4VA 1JMCA 4OWWB 3CCLA 3GO5A 1IXRA 2V1CC 1HNWQ 1G51A 4NXMQ 4DR1L 4UP8A 2R93G 5ELOA 2UUBQ 3U58A 3HOXH 3J81j 4P73A 1X9NA 2Z0SA 4LW1A 3BZKA 3G4SA 1OXUA 2HIVA 2JA7G 2UXCL 1HR0W 5FLMG 4O0AA 4LF5L 3BZCA 1HZBA 4DNIA 1X6OA 3TREA 3HOZG 3CC4A 2MO1A 4YY3Q 3EIVA 2E5LL 1GM5A 4JI0L 3I55A 1VQJA 1PH3A 2CQOA 3W5OA 4A3JH 4LF7Q 1X55A 4RG1A 1IBML 3FP9A 2OWOA 4WJ3M 4NXNL 1L1OC 1YI2A 4LFAL 3I4MG 4DR7L 4PZ6A 1I94L 1FGUA 3UE0A 4GLAC 3RZOH 1E3PA 3FHWA 1HZCA 5GAEC 1TWFH 2HIXA 4DV7Q 1N34L 2XTIA 1HR0L 1VQ5A 1QUQB 4JI3Q 4JI4Q 3GTQH 1MJCA 4ME3A 3TRZA 1L2FA 2VS1A 2DGYA 1BBWA 3J80c 4JYAL 2IX0A 3E9IA 3W1BA 1VCIA 2YYZA 4AQYL 1YJ9A 1K8AC 4R4OA 2D62A 2CKZB 4K0KQ 2AMCB 3U4ZA 3F2BA 3S16H 1VQ9A 1JJ2A 1L1OB 2JK8A 1A8VA 1Q86C 2PI2A 4DV4L 3AEVA 3HOWH 2VQEQ 2Q2TA 3GTOH 3JAMc 2UUCQ 1N36L 5C44H 4DK3C 4IFDG 1WCMG 4HJ9A 1WYDA 2E2HH 5HGQA 3STBC 2BA1A 3MEFA 1HJPA 4IFDI 5JJLA 1YVCA 3I4OA 2LXKA 1Y1VG 1NMFA 5H1SE 2VQEL 1XMQQ 1W2BA 4AYBE 2IHFA 2A19A 4HIOA 1HNZL 1V1QA 2Q2UA 4JI2L 2UXCQ 1XMOL 4C3JH 4LUVA 1HNXL 2JQOA 3CQZH 1ASZA 2YU9H 4UP9A 3RLOA 4DPGA 5IYDH 4DV5L 3T1HQ 3PCOB 3HKZE 3TQYA 1AH9A 3DM3A 1TWCH 2R7FA 1PH6A 5HY6A 3CCJA 3CCMA 4HIKA 4BY1H 4X65Q 3GTKH 4DV4Q 4JYAQ 2K5NA 1S3OA 3K81C 4A75A 4JI2Q 1HNZQ 2PQAB 1CKNB 1VQLA 3PO3G 1PV4A 4KHPL 1P16A 4A3FG 4QQBX 4EQ5A 2VUMG 4ALPA 5JJKA 3UE1A 4X66L 4GNXC 2QGQA 2K52A 5FJ8H 3KF6A 4YWKA 1SR3A 4HJ5A 4B3RL 5IP7G 2E8GA 4GLVB 4X64Q 3TS0A 1QVFA 3HOUG 3RN2A 4GN3B 2ZJRA 4DV6L 2HHHQ 4DUZL 2LXJA 4A3MG 5IP9H 4X62Q 1QZGA 3HFZB 4TQUS 2XGTA 4OONA 3VDYA 4LFBL 4GKKL 1N33Q 5C44G 3J81i 3CCUA 2A8VA 3PO2H 2RF4A 4AH6A 2YTVA 4DV0Q 3CP0A 1G291 1VQPA 2ZM6L 4GOPA 1SE8A 1JE5A 3F2DA 2Y0SG 1VQGA 1Q81C 3AFPA 3KJPA 2OQKA 1GO3E 1RL2A 1VQ8A 1S72A 4BY1G 3ZJYC 4GKJQ 3KOJA 5M5YH 2R92H 1HZ9A 3HOYH 4JI0Q 4A93H 1WFQA 1C0AA 1PVOA 2BA0A 2DUDA 5M3MH 3GTGH 2WAQE 5J3BA 1D7QA 1CUKA 3M9BA 3A0JA 3KDFB 1PHJA 1N32Q 4B3SQ 2D0PA 3FKIH 4YHHQ 5LMNQ 3KYHC 2EXDA 2IT1A 1XJVA 3JAMi 2LSSA 2ID0A 1EUJA 2EIFA 3STBD 3PF5A 4BA2I 5JJIA 2AWNA 4LFCL 3K7AH 3I4NG 4A3CH 4OO1I 3E9HA 1PYSB 3I7FA 5BR8L 1YHAA 4DV6Q 2HHHL 1X54A 2VNUD 1T9HA 4IPGA 4XIGS 3CF5A 4YCVA 2K50A 1VQFA 3AFQA 3PUWA 3W1GA 3NELA 1Q7YC 3A74A 1X3EA 1VQ6A 1HZAA 3HOVH 4IPHA 4GNXB 4DR6Q 2ZM6Q 1E7ZA 2JEAI 4X64L 1NTGA 1PFSA 1YZ6A 3PV0A 4JBWA 5ELNA 5C3EG 4JBKA 3H3VH 3OYYA 4A3DG 1N36Q 2PMZE 3OW2A 3NENA 5GQOA 2ES2A 3HOXG 3CC7A 1VQNA 2NVXH 4DV5Q 4AYBG 3T1HL 2VQFQ 4LF9L 2Y0SE 3KLWA 1Y1VH 2KBNA 1CSQA 2I5HA 1Y1WH 5BR8Q 1KC8C 4XTCS 1RIPA 3I4MH 4A3BG 3KJOA 4C3IH 1YNXA 5C0XI 1YJNA 2E5LQ 3KFUA 4PZ7A 2JJQA 4A3LG 3L7ZC 1IYJB 1FJGQ 4BXXG 3M4QA 4JBJA 3ERSX 3I4NH 2YTYA 4DV3L 3J80i 2Z6KC 2UXBL 4B3TQ 4IPCA 3D0FA 2UUAL 4L5SA 4LWCA 3S1NH 2UUBL 3J7ZC 3SGIA 4P75A 3UDXA 1VQBA 1QZHA 1BVSA 2UXDQ 2RHSB 1K8GA 4B3SL 1GVPA 3CMEA 1I6HH 4JV5Q 5IWAQ 3JC66 1JJCB 2VQFL 2I5MX 4O2DA 2OCEA 3GTLH 3PSIA 3K0XA 4R4CA 3M85A 1V43A 5AJ3L 1IL2A 1TWGH 1W3SA 4R1JA 2CCZA 3RR5A 3S2HH 1E22A 2AKWB 2PI2E 2IHEA 2VL6A 4TVAB 3J81c 3ULPA 2YV5A 3CPFA 3EN2A 1PH9A 1M1KC 3HOVG 4LF6Q 1A63A 1YJWA 1BKBA 3PO2G 4JI6Q 3D31A 3U50C 4GKKQ 1SRUA 1VQMA 1EIYB 1MIUA 1YEZA 2E2IH 3WWVA 2QA4A 4LF4L 4LF8Q 2F4VQ 2AWOA 3H0GH 4AIMA 4B3TL 4P74A 4HJ7A 3G6EA 4GN4B 3HOZH 3J7A5 3UDFA 1LUZA 5JEAG 1EQQA 2WB1E 2GVBA 4OX9Q 4A3BH 1OXXK 1E1TA 4OO1G 4LUZA 3CXCA 2OTJA 3UDIA 1I3QH 2R7ZG 1WI5A 1X56A 2GVAA 5IWAL 4NXNQ 4DR4L 4DV2Q 2VUMH 2RHQB 1EOVA 1NBWA 1KIXA 5C4JH 1QVCA 5GROA 1X3FA 1LM0A 4EX5A 2BH8A 1A62A 2NZOA 2NVTH 5C4XG 4POGA 1JJGA 5M5XH 3ULJA 4DR1Q 2JA6H 1JB7A 2VW9A 5E7NA 1XPRA 4LF6L 3M4OH 4QL5A 2JA9A 4HIDA 4R4QA 4JI4L 3S1MH 3T1YL 2CWAA 3KF6B 1JT8A 1PH4A 2OTLA 1K0RA 1UEBA 4OWTB 4YCUA 4DV1Q 4HIMA 1VQ4A 5DLQE 3HKZG 3GTPH 4LF7L 1MJEA 3OTOQ 1UE5A 4LF9Q 3CCEA 1PH7A 2KCMA 1FVIA 1WCMH 2KHJA 1Y1WG 1TXYA 4A3JG 2JA5G 3G71A 1XNQL 2R6GA 2K14A 4GOPB 4LFBQ 2I5LX 2NVYH 5IE8A 1EQRA 4GLXA 1U5KA 3GTJH 1FJGL 1YHBA 5C3EH 2B63H 1PA6A 3K8AA 4HJAA 4DV7L 1N34Q 2I0QA 4A3DH 3HOYG 1P8LA 1X65A 1UE1A 4KI0A 3DLLA 3CCRA 4AQYQ 1YHQA 5IYCH 1L1OA 1QVGA 1IBKQ 4DUYL 1J5EQ 4B3ML 2Z6KA 3PUXA 2R7ZH 1NE3A 4GKJL 2ZTDA 1IBMQ 3G48A 3PUYA 2MFIA 2WP8J 4JI7L 3KDFA 4GS3A 4PMWA 4X65L 1R9TH 2ATWA 1IBLL 4APVA 1J6QA 2N8NA 3M3YH 3CPWA 4IJLA 2B3GA 2K5VA 2K75A 1EYGA 3AYHB 3PUVA 4IJHA 3F8TA 4LF5Q 4NB3A 3I56A 4JI8L 1KRSA 1QUQA 1VS0A 1OTCA 3ULLA 1XPOA 1AE2A 4JCVE 4LUOA 4MZ9A 5FLMH 4A3CG 4JI6L 4DR3Q 2GN5A 3HOUH 1XPUA 4C2MH 1M90C 1NJIC 4BY7H 4BBSG 4KLKA 4OXPA 3TEHB 4JI1L 3MXNB 3RN5A 5C0XJ 3L2PA 1E24A 4DUYQ 1J5EL 2MO0A 1XMQL 1VQKA 4B3MQ 2NVQH 1K83H 1VQEA 5IYBH 2UUCL 4NXML 4LFAQ 1KHIA 1CKNA 4QIWE 1XNRQ 1H95A 2OQ0A 4C3HH 1VQDA 3OTOL 1Z9FA 4L5QA 2JA5H 4UY8C 4DV2L 1D8LA 2K5HA 1Q82C 4KHZA 3PF4A 2UU9L 1G6PA 5IT9c 2HQLA 1KQSA 4JI5L 4QY7A 2L15A 4UPAA 4DR2Q 1IZ6A 4BBRG 5LMNL 1XMOQ 1DGSA 1KAWA 4DAYB 2JA8H 4A3KH 4HJ8A 4JC0A 2PNHA 4DAMA 5IY0A 1N8RC 2JEBI 2CWPA 3BU2A 1IBKL 4IOCA 4DR5Q 3CCVA 1OXVA 4A3EG 5FJ8G 3PIPA 4K0KL 1HNWL 2H5XA 1VQAA 4DR3L 4H02A 2E2JH 1KD1C 1FL0A 3HOWG 1UE7A 4LF4Q 2PQAA 4YY3L 2HT1A 1XNQQ 1B8AA 5IYBG 2ASBA 4P71A 1HNXQ 2R93H 3S15H 1N33L 2D0OA 1HR0Q 2UXDL 3CMAA 1YIJA 4LNQA 5K36G 3RNUA 4PG3A 1UWVA 3KF8B 1L0WA 3L0OA 1WJJA 4WJ4A 1SROA 3H0GG 4IPDA 4X6AH 1NMGA 4JOIC 1B70B 3LGJA 4JI1Q 2YTXA 5M3FH 1EFWA 4DR5L 1LYLA 4DR2L 1K73C 3CW2C 2ZTCA 2C35B 3M4PA 4QGUA 1GKHA 5LMUQ 4L5RC 1SN8A 4IOAA 2N3SA 5GAGC 2IX1A 3E0EA 3A5ZB 1Q8KA 5C4XH 1EWIA 1VQCA 1K9MC 1WOCA 5GAHC 2ZTEA 2WFWA 2UU9Q 1OXSC 3F2CA 2B63G 1ASYA 3ER0A 5LMUL 4RMFA 3CCSA 1C7YA 3EBEA 4BY7G 5IYCG 3PIOA 4OX9L 1Z47A 2JA7H 3GTMH 2UXBQ 1N32L 4GN5A 3B6YA 1YBYA 2JE6I 3S14H 2QEXA 3I2ZA 5EAYA 4DR4Q 4MNOA 3TS2A 4DR6L 4Y7NH 3Q8DA 3A5UA 2UUAQ 2WAQG 4X66Q 1KRTA 1TWHH 3K80C 1I94Q 2NN6I 2NN6G 4JI7Q 3H15A 2N49A 5GADC 3NBHB 5IP9G 1Q46A 2NZHA 1N9WA 4R4TA 4JI3L 2CFMA 4JBMA 1A0IA 4B3RQ 1E1OA 5AJ3Q 5M3FG 4Y52H 3RZDH 5M5WH 4X62L 1TWAH 3RLFA
chains in the Genus database with same CATH superfamily
3F1ZA 3HEJA 1SLJA 3D6WA 1KNEA 4YCWA 5LMNW 4IFDJ 2JA6B 4ZRZA 4Q0FA 2EQSA 3K7UC 4A3FH 4P72A 1TWFB 1SFOH 1ICWA 3CC2A 4X3TA 3BVGA 3QIAA 5KYIA 3PMFA 2EYLA 4DV0L 3NPPA 4R4IA 3BYTB 4JI5Q 2KEEA 3T4AC 2SDFA 4JV5L 1EIFA 2QW7A 5JPMC 2OT2A 1KTKA 2LKVA 3PGZA 5AFWA 1VQ7A 1FNUA 4CJ0B 2IX3A 2QF7A 5JOBA 1L0YB 1RD9D 1BO0A 1XTDA 2K5QA 1J9OA 1ILPA 1YITA 1NY4A 1UE6A 1HUMA 4BWGB 3ICEA 2K4KA 1VQIA 4FF2A 3HOXB 2B8FA 3K5OA 3N52A 4IO9A 2F4VL 3UDGA 1EIGA 4H13C 4BS9A 1KL9A 3CQZB 5KGUA 2EYJA 2KECA 4A3MH 1DOKA 1LTLA 3P75A 2ZJQA 3C3LA 2Z9HA 1OXTA 3S1QB 1PH8A 5IP7H 1Y14B 1KABA 3G7LA 5EKLA 2QDLA 2FXQA 2JA6G 2G5DA 3S2DH 1ESRA 1U0LA 3HGBA 3CCLA 2XWJB 4IFDH 1ET6A 5ELOA 4WFN3 1TY0A 2Z0SA 4G4KA 4CDCC 1HR0W 2K32A 5CV7A 4O0AA 1HZBA 4C3JG 4HMIA 4JI0L 3PO3B 1SYBA 1VQJA 4G7OC 2KVMA 3W5OA 2GA4B 4RG1A 3I8ZA 2I46A 4WJ3M 4FXKC 1L1OC 1YI2A 4PZ6A 1I94L 1FGUA 3UE0A 2M00A 1N34L 3I90A 4JI4Q 2SOBA 4RA8A 1CQVA 5ELDA 2DGYA 2F0KA 2IX0A 3E9IA 2KQ3A 1TWAH 1VCIA 4AQYL 1KLGD 4R4OA 5G3LF 2CKZB 1EWCA 3U4ZA 1RCVD 3AEVA 1Q86C 3K7AB 3HOWH 4QCLA 1RKNA 5C44H 2CW0C 3STBC 3NTIA 2RSOA 1HJPA 5JJLA 3I4OA 3HG9A 1A2TA 4EVOA 3P7JA 2VQEL 4JK1C 2Q2UA 1V1QA 3D4DA 1K0SA 3U9SA 3CQZH 5KNCA 3TP8A 3RLOA 1JCKB 3HKZE 4F88A 5F2DA 1RTOA 5HY6A 1PH6A 3GTMB 4KY5A 3HRZC 3GTJB 2Q8RE 4KHPL 4QIWB 4ALPA 1F2MA 1ET9A 1BOSA 4GNXC 2QGQA 1WTWA 3I4NB 5NUCA 3A55A 3VR4A 5IP7G 4X64Q 1ENFA 1F9PA 3TS0A 3DUZA 1IYUA 2HHHQ 1VF7A 4G7HC 3HFZB 1D2BA 1AFPA 2XGTA 3VDYA 4LFBL 4C3JB 5C44G 2L12A 2WACA 3OSOA 1QILA 2X69A 1ZEQX 2YTVA 2A6HC 4RHRA 4MTKA 4FF1A 5D3DA 3I4MB 2NN6H 4R9WA 2EOTA 4QUFA 2FINB 4K5VA 3MFGA 2EXZA 3HOVB 3SDZA 4BY1G 3ZJYC 2PPBC 5E1FA 3NTHA 3HOYH 1C0AA 1O7ZA 2BA0A 2DUDA 2MPMA 4KV6A 5J3BA 5M3MH 3GTGH 1CUKA 1GUNA 2D0PA 4YHHQ 1HHVA 3KYHC 2EXDA 1PTOB 2PW5A 1NAPA 2EIFA 3PF5A 2AWNA 2PZWA 3K7AH 5BR8L 1PYSB 1AEXA 1YHAA 5C44B 1HTLD 1X54A 3CHBD 4IPGA 1T9HA 4RFBA 4XIGS 1VQFA 3AFQA 4U673 1VQ6A 3HOVH 1HZAA 1SJED 2DY7A 3QOJA 5EQ0A 2B2VA 2A6EC 2F0LA 1CI3M 4X64L 1NTGA 4K2LA 4JBWA 3H3VH 2HCCA 1N36Q 3LNNA 3TP6A 1GHJA 3NENA 3U9OA 3VR6A 3AB9A 5J1ZA 2TMPA 3T1HL 2VQFQ 2Y0SE 2KBNA 2B2TC 5JVG3 3BVZA 4RKLA 2I5HA 3Q23A 1FD7D 1TIID 1GUOA 2CVRA 4PZ7A 2FMCA 4N8FA 2O4XA 4BXXG 3ERSX 2RVLA 2YTYA 4A3DB 4DV3L 2A69C 1NNXA 3J7ZC 3SGIA 3UDXA 1MI2A 5KIXA 2LMCB 2UXDQ 2F0MA 1SYDA 2O5IC 1ICFB 3K5MA 3WOEA 1HTPA 1AN8A 4JV5Q 2A69D 4O2DA 3PSIA 3OPOA 2EDGA 2ICIA 5AJ3L 2NVTB 2KCNA 1XTCD 2KUMA 2NVYB 1E22A 2PI2E 4TVAB 1TY2A 1M1KC 5IYDH 3CPFA 2C9OA 2F3VA 4JI6Q 1SRUA 1VQMA 1EIYB 2QA4A 4CDEC 3ZYYX 1X32A 1SMYD 5IGDA 5M3MB 3GTGB 3S1NB 1TT2A 3UDFA 1LUZA 4J8QA 1S4ZA 2OTJA 4OO1G 1X56A 5I4DA 4DV2Q 2RHQB 4NP5A 1EOVA 1TS3A 1QVCA 5C4JH 1SE4A 4ZQ3A 2BH8A 3GTOB 3ULJA 1JB7A 2DY8A 3Q24A 1O7LA 1JOOA 4HSVA 3T1YL 1JT8A 1XWEA 1DONA 1K0RA 4YCUA 4F7XA 2ZXRA 3A54A 2BE5D 4DV1Q 3JAME 1SNQA 3M3YB 4LF7L 1MJEA 5DAUA 3OTOQ 2ICEC 5EGTA 1U4PA 1WD1A 1Y69U 2KCMA 1WCMH 2NZ1D 1KAAA 1YNJD 2K14A 1L0XB 1VDZA 5IE8A 5I6YA 1FJGL 5C3EH 1GXDC 4HJAA 1N34Q 4C1NI 4MHEA 1QVGA 4L6TB 5IYCH 1L1OA 4DUYL 1J5EQ 2Z6KA 4GKJL 1R4QB 3PUYA 2MFIA 1FNVA 3NTKA 1R9TH 1AZPA 1CTMA 1IBLL 3M3YH 2D9UA 2B3GA 3KBXA 4LF5Q 4TRDA 4JI8L 1TR5A 2F0QA 1VS0A 2RDHA 2XN9C 2PQEA 4LUOA 5FLMH 4MZ9A 5IODA 1I6VC 2GN5A 3HOUH 2OEOA 4BBSG 3V05A 4JI1L 5J22A 4F8MA 4C3HG 5D14A 4QIWE 1JOQA 5DEHA 2HD3A 2OQ0A 1NUCA 1H95A 3I73A 4X3KA 3OTOL 4L5QA 1R9TB 3RZDB 3PF4A 1G6PA 1SMYC 1IZ6A 4OO1H 2Q8TA 4CGYB 3QWNA 4WJWA 3H94A 4A3KH 2PO4A 4L63B 5IY0A 4DNTB 2JEBI 2K6AA 2CWPA 3BU2A 4DR5Q 3GTQB 3V96A 5FJ8G 4N9TA 3VR2A 1X3PA 2RCFA 1UE7A 4NDXA 1A3VA 1TWAB 3MVVA 5IYBG 1HNXQ 3IKJA 2D0OA 1QE6A 2F0IA 3DHQA 4C3IB 1C4QA 1PMRA 1UWVA 2FMMA 1GUSA 3L0OA 4RH6A 5IGGA 4ZCKA 4KY6A 4C3IG 1NMGA 4JI1Q 5M3FH 2E2HB 2L1BA 1K73C 4DR2L 4L5RC 2MGSA 3E3XA 2ZXPA 1H9KA 2F0FA 3A5ZB 1Q8KA 3L9AX 1K9MC 2ZTEA 5CORA 2B63G 3F2CA 1S5BD 4RMFA 1HQMC 4BY7G 2PMZB 2JA7H 4KKUA 1Y8NB 3L3OC 1QOHA 1TU2B 2QEXA 5EAYA 1GUTA 5G3LD 4MNOA 4Y7NH 3Q8DA 5CR3A 5FO7B 4DU9A 4LJZC 2UUAQ 1B1ZA 2WAQG 4X66Q 1II3A 2JSOA 2NN6G 1HFGA 2WB1B 4B3RQ 4R4TA 3D6CA 2CFMA 1A0IA 2MJ8A 5AJ3Q 3RZDH 1IW7C 3RLFA 3GD7A 1DD2A 1Q8IA 4JI8Q 2KCTA 2R93B 3W2DA 2WB1G 2JYOA 2AHOB 4PZ8A 1FR3A 4KHVA 3PO3H 4S3SA 4A3MB 3AU7A 1MD2D 2R92G 4QJFA 3S1QH 2B29A 4BA1I 5JEAJ 3T1YQ 4PV1C 4POFA 5IT9E 3S2DB 1X3QA 5BN5A 2K5DA 4DV1L 1HQRD 1PH1A 1VQOA 5C0XG 4FO2A 4DK6C 4A3EH 1U9RA 4A76A 1DOMA 4UP7A 4A3IH 2RCNA 1QNUA 3NEMA 2JA8G 2RDGA 1EY7A 1RHPA 1CA5A 4EQNA 4RGTA 1GD7A 1D5ZC 2ALYB 2PZTA 2D5DA 3M7NA 3QO2A 4O42A 2Q8IB 2VZAA 4FYDA 1AE3A 4A3GH 1V9PA 1VMCA 2R7DA 4K6DA 1Q1EA 1EY6A 4XYQA 3KBGA 4EQOA 4YWMA 1U4MA 3MTSA 4FDBA 4ZK9B 3AQQA 1GOZA 4J15A 2KHIA 1EOTA 1DJRD 3GQBA 1BNZA 3UI2A 5IGCA 5ELBA 1FGBD 1H9JA 4A3IG 3R8BA 1CSPA 1KLUD 3X3MA 4Q5VA 1TKWB 3GDEA 1ML0D 2MNAA 3PUZA 1PH5A 1HNWQ 4A3GB 5T1IA 2K01A 5EBDA 4DR1L 4UP8A 3BZKA 1OXUA 2E76C 2HIVA 2F0PA 1GUWA 3BZCA 1F2YA 2XSCA 5FLXE 3KLRA 2CQOA 4A3JH 3CRKC 1IBML 1GHKA 4NXNL 4DR7L 1IW7D 3K59A 4GLAC 1F77A 3FHWA 1HZCA 1VQ5A 2XTIA 1QUQB 3HOYB 1RODA 1O80A 1L2FA 5C6AA 1BBWA 2PCFB 3W1BA 3I3CA 5KNDA 2B8GA 1EY5A 3TSSA 1YJ9A 2Z4HA 4K0KQ 2IJ0A 2AMCB 1TS4A 3S16H 1JJ2A 2JK8A 2R61A 4DV4L 2B2WA 1PLFA 1CT1D 1PRTD 4CJ1B 3JAMc 1N36L 1WCMG 2O2LD 1EL0A 5HGQA 4FVMA 3V2TA 3EJIA 2R92B 3NBHA 1F9QA 1YVCA 2LXKA 4NKLA 1Y1VG 1DYQA 1PFBA 1UNSA 1JWMD 2A19A 4HIOA 4JI2L 1XMOL 4C3JH 4UP9A 1B44D 4NW2A 4DV5L 3TQYA 1AH9A 3DM3A 1PYWD 3ND9A 4X65Q 3EFXD 3OOCA 4A75A 2ZXOA 2WAQB 4A3FG 4FXDA 2B39A 3T13A 3UE1A 4X66L 1S5ED 1AW7A 2F0TA 2R3ZA 3KF6A 4HJ5A 4B3RL 2E8GA 4GLVB 1QVFA 3HOUG 4GN3B 3SK8A 2ZJRA 4A3MG 4RGMA 2L0CA 4OONA 4TKOB 4DV0Q 4HMJA 3CP0A 1IL8A 1JE5A 1Q3LA 1STEA 3F2DA 3GTKB 3R2IA 1EY4A 4H44C 3KJPA 4FNFA 4DA2A 4HEDA 2AQ2B 2RDFA 1PVOA 2N88A 2WAQE 5IIFA 3NXWA 3KDFB 1PHJA 1N32Q 1BQQT 4A3BB 5CYUA 1XJVA 2CW0D 3CU7A 4TSSA 1EUJA 5JJIA 4LFCL 3I4NG 4A3CH 3E9HA 4KTAA 2WINB 4DV6Q 3CKIB 3C1FA 4K2KA 3J80L 2E2DC 3D8GA 4PQXA 4U68A 5EKIA 3A74A 3I91A 2HUGA 1LACA 1E7ZA 4CDFC 5C3EG 1QNKA 4ZKCB 3Q6SA 4YIJA 1Q90A 2NWGA 3CC7A 3X3NA 1EQVA 3KLWA 1Y1VH 3TP5A 4OEMB 2OF1A 1CSQA 4A3BG 1RIPA 3FEWX 3KJOA 1JORA 2V4DA 2JJQA 4KMUC 1WTVA 1IYJB 2Z6KC 4B9XA 4IPCA 3S1NH 1I4RA 3I72A 3LX0A 5DM73 1BVSA 5L37A 3MFYA 4UHVA 3E5SA 1CZGA 1GVPA 3CMEA 1EYCA 4HR7B 3RUZA 3Q22A 2OCEA 2J4XA 2L11A 1Y8OB 2CCZA 1H9SB 2AKWB 2Z8LA 2IHEA 2VL6A 3ULPA 3LWUA 3HOVG 1A63A 2NTSA 4LF6Q 3S14B 3D31A 3KLSA 4LF4L 3BYYB 2E2IH 4LF8Q 1SJHD 4DAPA 4DK0A 2EVBA 3H0GH 4I65A 4B3TL 1BR9A 2HDMA 5C5MA 4HJ7A 3G6EA 5JEAG 1EQQA 4OHJA 2K04A 4A3BH 1OXXK 3VYSA 2JN4A 3UDIA 2WV6D 1I3QH 4LAAA 3I70A 1WI5A 5IWAL 4NXNQ 2M2LA 2VUMH 3BDLA 5DM63 1LTAD 3Q0AA 3NWTA 2NZOA 1BCPC 1QG7A 2NUCA 4POGA 2JA6H 2VW9A 3J7AV 4QL5A 5FKAC 1HCZA 3KF6B 3HS0C 2C5CA 1B9MA 2KOLA 3H0GB 2KEDA 1BUVT 3H91A 1NR4A 3T53B 5KYLA 1PRTC 5IGEA 3CRLC 5K5PA 4J1MA 2X6LA 4LF9Q 1PH7A 1GUGA 2JA5G 4LFBQ 4WRDA 1EQRA 4GLXA 1U5KA 3GTJH 2LFNA 1EEID 2B63H 3K8AA 4A3KB 2F0WA 1P8LA 3HOYG 1TVXA 1SBBB 1W6JA 1RJTA 4OL7A 3PUXA 1PXUA 4DNRB 3D3RA 1D1IA 2F1MA 2RQXA 4L8JA 3HZXA 4DGZA 4GS3A 4DF7A 4X65L 2E2JB 1V1OA 1J6QA 3CPWA 2K5VA 1EYGA 3PUVA 3F8TA 5LHY1 4NB3A 3I56A 2X6GA 2XIWA 1TWGB 4QUCA 1QUQA 1OTCA 1BCPB 4XQJA 2A68C 3M4OB 1M90C 1NJIC 4KLKA 1ILQA 5M5YB 4FF3A 3KUPA 4B3MQ 3GV6A 1VQEA 2ENBA 2F0SA 1STYA 4NXML 1KHIA 2VXWA 4XT1B 4C3HH 1VQDA 1Z9FA 4B08A 1D8LA 2QCPX 1BBXC 2VUMB 4KHZA 2UU9L 5IT9c 2J0TD 2B2YC 4QY7A 2L15A 3NQIA 4DR2Q 1TQOA 1HPCA 1ZKOA 1I4HA 1CZWA 4V190 3MXPA 1F2LA 4C2MB 5M3FB 1N8RC 3FPPA 1F9SA 2Z4IA 3DXJC 1FYCA 2H5XA 4DR3L 1M8AA 5KRUA 4A3EB 3HOWG 5J39A 1NR2A 4YY3L 2QEJC 5LL6X 2WKCA 2RSNA 1XNQQ 4FF4A 3R3OA 4G7ZC 1MSHA 1YIJA 5FO8B 3RNUA 4PG3A 1WJJA 4WJ4A 1SROA 1LV9A 4IUPA 3NQTA 1B70B 4KD3A 4KJOA 1GJXA 2ZTCA 3CW2C 1LTRD 1LT3D 4IOAA 5CV6A 3AMUA 1VQCA 2EE1A 2H4OA 2UU9Q 4RKBA 1TWCB 3EBEA 5IYCG 3S15B 4OX9L 1Z47A 3GTMH 1EYDA 3ND8A 3N6RA 3I2ZA 4DR4Q 3I4LA 3SVMA 2DJGC 2DNEA 3K80C 2NN6I 3H15A 2N49A 3P1HA 4JI3L 1E1OA 4Y52H 1BBUA 1DOLA 2O5JC 2N78A 2KCCA 1LT4D 2E75C 4ZAIA 2F3WA 3S1MB 3S17H 2KENA 1AP0A 1I5FA 3CCQA 2ZJPA 3S24A 1CFMA 1B4OA 1EEFD 4DK1A 4L5TA 5JAVA 5A35A 5IYDG 3WDNA 2F3IA 1VQHA 2A73B 1QCBD 2B2YA 2F0GA 1HFNA 5EPLA 4DKAC 2BH2A 2R7ZB 1LTTD 4DV3Q 1Q1BA 3CD6A 5C4XB 1PYBA 1K3RA 5EJWA 3S16B 3PQIA 1SNMA 4A3JB 1XNRL 2DJFC 3E6ZX 1IBLQ 3FKIG 4H0LC 4XYOA 2B2WC 2Q2IA 1A3UA 4FP5D 4LMQD 4KHPQ 2F03A 3HKSA 1B7YB 1CKOA 1CHQD 1S5CD 1SNOA 2EYHA 2NTTA 3U4VA 4GNXA 3C2PA 3GO5A 5K36H 5BN4A 1E2WA 4NXMQ 3T56B 2UUBQ 3U58A 3W3AA 4P73A 1X9NA 1ESFA 1YNND 3FVQA 2JA7G 2D2CC 5FLMG 1CK1A 3TREA 3HOZG 3TZDA 2MO1A 3EIVA 2E5LL 1I50B 3I55A 4LF7Q 4RCOA 5I9OA 1X55A 3FP9A 1STGA 3OIQA 1WTXA 2KJXA 2PW7A 3RD4A 2DN8A 3RZOH 5GAEC 3KK7A 3GTQH 4DV7Q 4JI3Q 2DNCA 2K28A 4JVZA 4ME3A 3A8KE 1BCPD 3SEBA 2K03A 1K8AC 4IUNA 1SE2A 1VQ9A 3VR5A 2G9HD 5KNBA 1H9MA 2Q2TA 3GTOH 4ILWA 2UUCQ 1KDBA 2KA7A 4IFDG 1KNAA 1WYDA 2E2HH 1UUPA 2BA1A 4IFDI 4AYBB 5H1SE 1EWHA 3J81E 1OO9B 1XMQQ 2F4IA 4AYBE 1R4PB 1HNZL 3GTPB 2YU9H 3T1HQ 2AUKA 3PCOB 4EGVA 4BY1H 3CCMA 1EY9A 3A8JE 3GTKH 4JYAQ 1S3OA 1EQTA 4JI2Q 1PV4A 3TDQA 4EQ5A 1SSOA 1WTPA 5JJKA 1E0BA 4MIUA 5FJ8H 4YWKA 5I9PA 3RN2A 3MXGA 1S5FD 4CKEA 4DV6L 2LXJA 1QZGA 4DAYA 4TQUS 1STAA 3J81i 4RWSC 3PO2H 2RF4A 5D65A 4KJNA 4AH6A 4KKTA 4IUVA 4UAIA 1G291 1PTOF 1ZYRD 2MP1A 2MHVA 2F0DA 4XT3B 1VQGA 1Q81C 3AFPA 4X3SA 1GO3E 1RL2A 1VQ8A 3RZOB 1A6XA 1S72A 1B53A 1SYFA 3HP3A 2QILA 1HZ9A 2A6HD 1WTHA 4XDXA 4A93H 1A3TA 5EPKA 3VYTA 3A0JA 3DWPA 5LMNQ 3FKIH 2F0OA 1SE3A 3JAMi 2LSSA 4E6IA 3ITPA 4OO1I 3I7FA 1WTQA 1PTOD 1SNDA 3DWQA 4FXGC 4G57A 4YCVA 3CF5A 2K50A 1HXYD 3W1GA 3NELA 1X3EA 1SYCA 4GNXB 2ZM6Q 2JEAI 1MGSA 1M4VA 1PFSA 3PV0A 4JBKA 1NSNS 3NHHA 1B3AA 4A3DG 2PMZE 3OW2A 1V8QA 1JWSD 5GQOA 2JP1A 1VQNA 5JVH3 1F2ZA 1WVLA 2Z6BA 3OMCA 4JPBW 1Y1WH 5BR8Q 4XTCS 1F9RA 4HTHA 3I4MH 2WIIB 1YNXA 3KFUA 3L7ZC 1FJGQ 3TMEA 3DMUA 4OIKA 4IUQA 3C1EA 4GZYC 2UXBL 1LLRD 2UUAL 4L5SA 3SK5A 2UUBL 2RA4A 2J7ZA 2NB0A 4KN7C 4P75A 2AQ3B 1SDFA 1QZHA 2EYOA 4WORA 4K6LA 3TN2A 4CBVA 5JPNC 3JC66 3EVQA 2VQFL 3G6JB 2I5MX 3PO2B 3K0XA 3M85A 1V43A 1IL2A 1D5XC 1TWGH 1W3SA 5FK9C 2JA7B 2LY7A 3J81c 1PH9A 1B50A 3EN2A 3PO2G 2Y0SB 3U50C 2B63B 4GKKQ 1YEZA 2G9DA 3WWVA 2F4VQ 2AWOA 2PNRC 2XRSD 3DEOA 4P74A 1ENAA 4F87A 3ERQA 4EQPA 4GN4B 3J7A5 4OX9Q 3FKIB 1E1TA 1JOKA 1KDCA 4LUZA 1O7YA 3QR8A 4DR4L 1G2SA 4K8IA 3TBIB 1KIXA 1LM0A 3MWYW 4EX5A 1STHA 5C4XG 5M5XH 4C1NK 3MEHA 1SNPA 2ZT9C 4M8AA 1XPRA 2EJFC 2JA9A 4JI4L 4RGOS 3VA5A 1JQYD 2OTLA 1G6ZA 2B2VC 4OWTB 1VQ4A 5DLQE 3NWSA 4XQNA 3WOFA 5EPJA 1UE5A 3J7YW 3GTLB 2KHJA 1FVIA 5FOBB 4MN3A 4A3JG 3G71A 1G91A 2EJMA 3J7AF 1UAPA 5A2QE 1YHBA 1PA6A 1EU3A 4OIJA 4DV7L 2I0QA 4KI0A 1UE1A 4AQYQ 1IBKQ 1IBMQ 5COYA 2K7VA 2WP8J 4JI7L 2IL8A 3KDFA 4C3HB 1JICA 4P2CB 5HURA 4APVA 2K75A 1KRSA 1AE2A 4JCVE 2Z1CA 4JI6L 4DR3Q 4C2MH 1CHPD 2EY1A 3TEHB 4OXPA 3MXNB 5C0XJ 1E24A 4DUYQ 1J5EL 1XMQL 3C46A 1DZ1A 5CBEE 5IYBH 4LFAQ 4ZYSA 1CKNA 2MUYA 4JW0A 1G8ZD 2HQEA 1XNRQ 3MC0B 3H3VC 2JA5H 5JEAH 4UY8C 4DV2L 4CDDC 1Q82C 1MSGA 4B9WA 2F0VA 1B9NA 1KQSA 1SYEA 1XMOQ 3K0YA 4DAYB 2L9HA 4HJ8A 3NSWA 4JC0A 4DAMA 2F0JA 5E4XA 1PRTF 1IBKL 1IKLA 4IOCA 1XYIA 4OELB 3CCVA 1OXVA 3QG1A 3NUCA 3DM1A 1KD1C 1FL0A 4K5WA 3SXHA 4LF4Q 2NYZD 2PQAA 2HT1A 3S1RB 2JA5B 1B8AA 1Y1VB 4IUUA 2RKSA 1ONLA 2ASBA 2R93H 3TZUA 3S15H 1N33L 2PZUA 1S5DD 3HOWB 1NCVA 2L4NA 1EZ8A 3H0GG 5JJZA 3EQLC 3LGJA 1TWHB 2YTXA 2CHBD 3SR1A 1UEAB 3S17B 4DR5L 1LYLA 3SE0A 4N9PA 3M4PA 2N55A 5LMUQ 1LT5D 5C3XA 1PFMA 4NMZA 2N3SA 1XX8A 1AZQA 2IX1A 3MXUA 5D3IB 5C4XH 1SAPA 1D5MC 1EZ6A 2WFWA 2FHTA 4IUTA 3ER0A 1A2UA 1C7YA 4ZUIA 2UXBQ 1VF5C 1LTSD 1N32L 4GN5A 1YBYA 2JXMB 2XVSA 1TWHH 1EY0A 1K8MA 4JI7Q 5GADC 5I2XA 2NZHA 1N9WA 4JBMA 5IOCA 5M3FG 1I3QB 1E2ZA 5M5WH 2EYPA 4X62L 1Z6HA 3H3VI 5M3MG 3TP7A 5I2YA 1KXLA 4A3GG 1I50H 1MKHA 4A4IA 4LFCQ 4KK7A 3BDOA 1PRTB 4A93G 3RLNA 1SMXA 4DN4M 3K5LA 3R93A 2VY3A 4IALA 3URYA 4O1NA 1JB3A 4A3KG 3SK6A 4BBSH 2CQAA 4OGQC 1X3GA 4BBRH 2EY6A 5C3WA 3S1RH 2MQHA 5E4WC 1PTOH 1IYVA 5CV5A 3M4YA 2Q2HA 5FLXL 5CC4A 4MTNA 1TS5A 5C3EB 1S40A 3OIPA 2K1BA 1O7IA 3P20A 3A7AB 3IRBA 2F52A 4NPSA 2XRQD 4JOIA 4YWLA 3CAMA 1BCPF 4JG2A 1CKMA 5FLXc 2OXPA 1PH2A 1SEBD 4I7ZC 2SEBD 4GOPC 4LF8L 1DCZA 4BBRB 4DUZQ 1HH2P 2F0NA 4A3LH 2B2UA 1C8CA 3NE5B 3BJUA 1B3QA 3OWEB 2IY5B 3NK9A 3GP7A 3A7LA 2A1AA 4HN7A 4BXXH 1HRJA 1YNNC 1LTID 3SHLA 1WTOA 4DR7Q 4OWXB 3ONAB 3IAYA 4YHHL 1Q12A 2QKIC 2CH4A 4A3FB 4BY7H 2K05A 1JMCA 1C9OA 3F2UA 4OWWB 1IXRA 2V1CC 1G51A 3NBIA 3FMCA 2R93G 3RMHA 3HOXH 3J81j 1MHWC 4LW1A 3G4SA 3BS1A 5M5WB 3T51B 2UXCL 5C5LA 4LF5L 4DAVA 4DNIA 1X6OA 2YU9B 2IPKD 4R8IA 3CC4A 4YY3Q 1GM5A 4BY1B 1XXGA 1PH3A 5CMDA 2SNMA 4V0BA 3KF8A 4RGNA 4QMGA 5EBCA 2VB2X 2OWOA 3FDTA 3IFDA 3I4MG 4LFAL 1JR0D 1E3PA 2E2IB 4BY7B 1TWFH 2HIXA 1HR0L 1HNWL 1SFOB 5DNFA 1MJCA 2KHSA 3TRZA 1DM0B 2VS1A 3J80c 4JYAL 2YYZA 3O13A 3KLSX 1K8OA 2D62A 3F2BA 1L1OB 2A74C 1A8VA 2PI2A 4IURA 2VQEQ 1PDQA 1H9SA 3SK4A 4DK3C 4HJ9A 4RCNA 1Z7TA 2IW3A 1PFNA 2BDOA 3MEFA 1EU4A 1LT6D 2E74C 5ELCA 1K3BC 1NMFA 1W2BA 2IHFA 2UXCQ 1EFID 4LUVA 1HNXL 2JQOA 1ASZA 4RAUC 4DPGA 2LS01 1TWCH 2R7FA 3MXNA 3CCJA 4HIKA 4XQQA 1BXTA 2BOSA 4DV4Q 2K5NA 1Y1WB 3K81C 1HNZQ 1SYGA 1CKNB 2PQAB 1VQLA 3PO3G 4QQBX 1P16A 4Y7NB 2VUMG 1ZXTA 2H1EA 1D1KA 2K52A 4IQZA 4A93B 3IL8A 4LK1C 1SR3A 4K14A 4CKCA 1I4XA 3FPUB 5CV9A 4ULLA 1QJOA 4DUZL 5IP9H 4X62Q 1A15A 1BDOA 3EA6A 3M7GA 2HDLA 4GKKL 2EJGC 3K6OA 1N33Q 4ABNA 3CCUA 2A8VA 4KN4C 1EYAA 2WKDA 1V1PA 1VQPA 1SNCA 3A56A 2ZM6L 4GOPA 1SE8A 3R2TA 2Y0SG 4PMBA 2B2UC 2TSSA 1WD0A 3HOUB 2OQKA 4GKJQ 3KOJA 1JWUD 5M5YH 1RTNA 2FJ2A 4IN3A 2R92H 4JI0Q 1WFQA 1QB5D 3IFTA 1D7QA 4RHSA 1IHZA 3M9BA 4B3SQ 4HCEA 2IT1A 2NBFA 5ELFA 2ID0A 3STBD 4BA2I 5FO9B 1T5EA 1CQFA 2A5HA 4K8JA 2HHHL 3J80E 1PZKD 2VNUD 2SNSA 4UDUC 3OWFA 3PUWA 1Q7YC 1SXTA 5CV8A 3MAQA 2P5ZX 4IPHA 1JC7A 1LTBD 1YNJC 4DR6Q 3OMGA 1YZ6A 5ELNA 1EIHA 3OYYA 3VYRA 3QB3A 1I6HB 1PZJD 3PIP3 2ES2A 3HOXG 2NVXH 4DV5Q 4AYBG 4LF9L 5LL6S 2CH4W 4ZUJA 1KC8C 5EKKA 5ISRA 3GV3A 4C3IH 5C0XI 1YJNA 2E5LQ 4A3LG 2I07B 3MA2B 1LTGD 3M4QA 3VR3A 4JBJA 3I4NH 1CM9A 3J80i 3EROA 4B3TQ 3BG3A 3D0FA 4LWCA 4C56C 1VQBA 4HSPA 1U4LA 2A68D 2RHSB 1K8GA 4B3SL 1I6HH 1FNWA 3BDCA 4Z9CB 5IWAQ 2EZVA 1JJCB 1Y8PB 3MHBA 3GTLH 5TSSA 4KY7A 4R4CA 3BVMA 4R1JA 5M5XB 3RR5A 3S2HH 2YV5A 2AQ1B 1YJWA 1BKBA 1J8IA 3PIO3 3QJYA 1JE4A 1MIUA 3OHXC 4ID6A 5E3FA 4AIMA 1BF4A 2QDBA 5BN3A 3BZDB 3DWAA 3H6MA 3HOZH 1H9RA 3J81L 2WB1E 2GVBA 4PMCA 1I4QA 5IT9L 2R7ZG 1G2TA 2GVAA 2L55A 1NBWA 1HA6A 5GROA 1X3FA 1JJGA 2M9VA 1A62A 2NVTH 4DXFA 4DR1Q 1LO5D 5E7NA 4LF6L 3M4OH 2EYMA 1ENCA 4QB4A 5C4ZA 5KEEA 2HCIA 1DXMA 3LWEA 4DXGA 4R4QA 3K58A 4HIDA 3S1MH 2CWAA 1PH4A 4X3UA 4I7AA 1UEBA 2EY5A 4HIMA 2EY2A 3H09A 3HKZG 1T5XD 3GTPH 2NVXB 3CCEA 4A3IB 3VYUA 1Y1WG 1XNQL 1TXYA 2A6ED 2R6GA 4GOPB 5C4JB 2I5LX 2NVYH 3A8IE 3E0JA 5M9OA 4A3DH 3DLLA 1X65A 3CCRA 1YHQA 3MZ5A 4B3ML 4XXEA 2R7ZH 1NE3A 1I4PA 2ZTDA 3K5NA 3G48A 2K33A 1WTRA 4PMWA 2ATWA 2N8NA 4ME5A 4IJLA 1RF2D 1QWYA 3AYHB 4IJHA 4CKBA 2BDNA 5CBAE 1PZID 1IKMA 1W6KA 4N8X1 1STNA 3S2HB 3OW7A 3FRPB 3QOLA 3ULLA 1XPOA 1KDAA 2JA8B 4A3CG 1VMPA 1XPUA 4IZ8A 4QF4A 3T16A 2XNAC 3RN5A 3L2PA 1VQKA 2MO0A 2NVQH 1K83H 3HOZB 2BCOA 1ZYRC 5T1GA 2L5TA 2UUCL 1C48A 2XWBB 1MBYA 3K57A 4HCSA 4J6HA 2K5HA 5ELEA 1EY8A 4ZLTF 2HQLA 3NP8A 4JI5L 4UPAA 4BBRG 3VA7A 5LMNL 3DEPA 1DGSA 1KAWA 2JA8H 1D6EC 5CGKA 4CHTB 2PNHA 2B2TA 4CJ2C 1O78A 5IGFA 5C0XH 4A3EG 1STBA 2NVQB 3HKZB 3PIPA 1PTOC 4K0KL 3D4RA 1VQAA 4H02A 4K5XA 2E2JH 1CA6A 1WCMB 4P71A 2RBMA 3S9WA 1HR0Q 2UXDL 3CMAA 5K36G 2BE5C 4LNQA 2EPBA 3KF8B 1L0WA 4ZKBB 4IPDA 4X6AH 4JOIC 5CV4A 1EFWA 1U4RA 4QGUA 2C35B 1GKHA 2F0EA 1SN8A 1V1PB 1RDPD 2F0UA 2EYFA 2K5WA 5GAGC 3E0EA 1B2TA 1HA5A 5C4HA 1EWIA 4M1UB 1TS2A 1HUNA 1WOCA 5GAHC 5HGTA 1OXSC 1ASYA 5LMUL 3CCSA 1K28A 5A2QL 3PIOA 2PYKA 4KD4A 3B6YA 2JE6I 2FFKB 3S14H 2AUJD 4KKSA 3TS2A 4DR6L 3A5UA 1E2VA 1KRTA 1I94Q 1K83B 5IGBA 3JAML 4H7BA 2IWHA 3NBHB 5I6WA 1LABA 5IP9G 1Q46A 4BBSB 4ODGA 3D4WA 4PNYA 4DFAA 4HAEA 2F0HA 1I4GA 4R8NA 2VB3X 3CXCA
chains in the Genus database with same CATH topology
3F1ZA 1BBUA 1SLJA 3GD7A 2N78A 4JI8Q 4YCWA 2KCTA 5M3MG 3H3VI 2WB1G 2AHOB 5LMNW 4PZ8A 1KXLA 4A3GG 1I50H 1MKHA 3PO3H 4IFDJ 2R92G 4A4IA 4QJFA 4LFCQ 3S1QH 2B29A 4BA1I 5JEAJ 4A93G 3T1YQ 2EQSA 1SMXA 3RLNA 3K7UC 3S17H 4POFA 4A3FH 2KENA 2VY3A 4P72A 1I5FA 3CCQA 4DV1L 1SFOH 1PH1A 4A3KG 1VQOA 5C0XG 3CC2A 4DK6C 4BBSH 2ZJPA 4A3EH 3S24A 4A76A 1X3GA 4BBRH 3S1RH 4UP7A 4DV0L 4A3IH 2MQHA 2RCNA 3NEMA 4R4IA 2JA8G 4JI5Q 4L5TA 5IYDG 4JV5L 1EIFA 1GD7A 2F3IA 1VQHA 2Q2HA 2ALYB 3PGZA 4MTNA 1S40A 1VQ7A 3M7NA 1O7IA 3IRBA 2VZAA 2F52A 4NPSA 4DKAC 1AE3A 4A3GH 1V9PA 4JOIA 2R7DA 1XTDA 2BH2A 1Q1EA 4YWLA 3CAMA 4DV3Q 1YITA 1NY4A 1UE6A 3ICEA 4JG2A 2K4KA 1VQIA 1CKMA 1Q1BA 5FLXc 4YWMA 3CD6A 1PH2A 4IO9A 4GOPC 4LF8L 3UDGA 4FDBA 2F4VL 4DUZQ 1KL9A 1HH2P 1K3RA 1PYBA 3AQQA 4A3LH 4J15A 2KHIA 3BJUA 4A3MH 1LTLA 2ZJQA 1XNRL 2IY5B 1IBLQ 3FKIG 1OXTA 2A1AA 4BXXH 4A3IG 1PH8A 5IP7H 1CSPA 2Q2IA 1Y14B 4DR7Q 4OWXB 4KHPQ 3GDEA 2FXQA 3HKSA 2JA6G 4YHHL 1Q12A 3S2DH 2MNAA 3PUZA 1B7YB 1CKOA 1U0LA 4GNXA 1PH5A 1C9OA 3U4VA 1JMCA 4OWWB 3CCLA 3GO5A 1IXRA 2V1CC 1HNWQ 1G51A 4NXMQ 4DR1L 4UP8A 2R93G 5ELOA 2UUBQ 3U58A 3HOXH 3J81j 4P73A 1X9NA 2Z0SA 4LW1A 3BZKA 3G4SA 1OXUA 2HIVA 2JA7G 2UXCL 1HR0W 5FLMG 4O0AA 4LF5L 3BZCA 1HZBA 4DNIA 1X6OA 3TREA 3HOZG 3CC4A 2MO1A 4YY3Q 3EIVA 2E5LL 1GM5A 4JI0L 3I55A 1VQJA 1PH3A 2CQOA 3W5OA 4A3JH 4LF7Q 1X55A 4RG1A 1IBML 3FP9A 2OWOA 4WJ3M 4NXNL 1L1OC 1YI2A 4LFAL 3I4MG 4DR7L 4PZ6A 1I94L 1FGUA 3UE0A 4GLAC 3RZOH 1E3PA 3FHWA 1HZCA 5GAEC 1TWFH 2HIXA 4DV7Q 1N34L 2XTIA 1HR0L 1VQ5A 1QUQB 4JI3Q 4JI4Q 3GTQH 1MJCA 4ME3A 3TRZA 1L2FA 2VS1A 2DGYA 1BBWA 3J80c 4JYAL 2IX0A 3E9IA 3W1BA 1VCIA 2YYZA 4AQYL 1YJ9A 1K8AC 4R4OA 2D62A 2CKZB 4K0KQ 2AMCB 3U4ZA 3F2BA 3S16H 1VQ9A 1JJ2A 1L1OB 2JK8A 1A8VA 1Q86C 2PI2A 4DV4L 3AEVA 3HOWH 2VQEQ 2Q2TA 3GTOH 3JAMc 2UUCQ 1N36L 5C44H 4DK3C 4IFDG 1WCMG 4HJ9A 1WYDA 2E2HH 5HGQA 3STBC 2BA1A 3MEFA 1HJPA 4IFDI 5JJLA 1YVCA 3I4OA 2LXKA 1Y1VG 1NMFA 5H1SE 2VQEL 1XMQQ 1W2BA 4AYBE 2IHFA 2A19A 4HIOA 1HNZL 1V1QA 2Q2UA 4JI2L 2UXCQ 1XMOL 4C3JH 4LUVA 1HNXL 2JQOA 3CQZH 1ASZA 2YU9H 4UP9A 3RLOA 4DPGA 5IYDH 4DV5L 3T1HQ 3PCOB 3HKZE 3TQYA 1AH9A 3DM3A 1TWCH 2R7FA 1PH6A 5HY6A 3CCJA 3CCMA 4HIKA 4BY1H 4X65Q 3GTKH 4DV4Q 4JYAQ 2K5NA 1S3OA 3K81C 4A75A 4JI2Q 1HNZQ 2PQAB 1CKNB 1VQLA 3PO3G 1PV4A 4KHPL 1P16A 4A3FG 4QQBX 4EQ5A 2VUMG 4ALPA 5JJKA 3UE1A 4X66L 4GNXC 2QGQA 2K52A 5FJ8H 3KF6A 4YWKA 1SR3A 4HJ5A 4B3RL 5IP7G 2E8GA 4GLVB 4X64Q 3TS0A 1QVFA 3HOUG 3RN2A 4GN3B 2ZJRA 4DV6L 2HHHQ 4DUZL 2LXJA 4A3MG 5IP9H 4X62Q 1QZGA 3HFZB 4TQUS 2XGTA 4OONA 3VDYA 4LFBL 4GKKL 1N33Q 5C44G 3J81i 3CCUA 2A8VA 3PO2H 2RF4A 4AH6A 2YTVA 4DV0Q 3CP0A 1G291 1VQPA 2ZM6L 4GOPA 1SE8A 1JE5A 3F2DA 2Y0SG 1VQGA 1Q81C 3AFPA 3KJPA 2OQKA 1GO3E 1RL2A 1VQ8A 1S72A 4BY1G 3ZJYC 4GKJQ 3KOJA 5M5YH 2R92H 1HZ9A 3HOYH 4JI0Q 4A93H 1WFQA 1C0AA 1PVOA 2BA0A 2DUDA 5M3MH 3GTGH 2WAQE 5J3BA 1D7QA 1CUKA 3M9BA 3A0JA 3KDFB 1PHJA 1N32Q 4B3SQ 2D0PA 3FKIH 4YHHQ 5LMNQ 3KYHC 2EXDA 2IT1A 1XJVA 3JAMi 2LSSA 2ID0A 1EUJA 2EIFA 3STBD 3PF5A 4BA2I 5JJIA 2AWNA 4LFCL 3K7AH 3I4NG 4A3CH 4OO1I 3E9HA 1PYSB 3I7FA 5BR8L 1YHAA 4DV6Q 2HHHL 1X54A 2VNUD 1T9HA 4IPGA 4XIGS 3CF5A 4YCVA 2K50A 1VQFA 3AFQA 3PUWA 3W1GA 3NELA 1Q7YC 3A74A 1X3EA 1VQ6A 1HZAA 3HOVH 4IPHA 4GNXB 4DR6Q 2ZM6Q 1E7ZA 2JEAI 4X64L 1NTGA 1PFSA 1YZ6A 3PV0A 4JBWA 5ELNA 5C3EG 4JBKA 3H3VH 3OYYA 4A3DG 1N36Q 2PMZE 3OW2A 3NENA 5GQOA 2ES2A 3HOXG 3CC7A 1VQNA 2NVXH 4DV5Q 4AYBG 3T1HL 2VQFQ 4LF9L 2Y0SE 3KLWA 1Y1VH 2KBNA 1CSQA 2I5HA 1Y1WH 5BR8Q 1KC8C 4XTCS 1RIPA 3I4MH 4A3BG 3KJOA 4C3IH 1YNXA 5C0XI 1YJNA 2E5LQ 3KFUA 4PZ7A 2JJQA 4A3LG 3L7ZC 1IYJB 1FJGQ 4BXXG 3M4QA 4JBJA 3ERSX 3I4NH 2YTYA 4DV3L 3J80i 2Z6KC 2UXBL 4B3TQ 4IPCA 3D0FA 2UUAL 4L5SA 4LWCA 3S1NH 2UUBL 3J7ZC 3SGIA 4P75A 3UDXA 1VQBA 1QZHA 1BVSA 2UXDQ 2RHSB 1K8GA 4B3SL 1GVPA 3CMEA 1I6HH 4JV5Q 5IWAQ 3JC66 1JJCB 2VQFL 2I5MX 4O2DA 2OCEA 3GTLH 3PSIA 3K0XA 4R4CA 3M85A 1V43A 5AJ3L 1IL2A 1TWGH 1W3SA 4R1JA 2CCZA 3RR5A 3S2HH 1E22A 2AKWB 2PI2E 2IHEA 2VL6A 4TVAB 3J81c 3ULPA 2YV5A 3CPFA 3EN2A 1PH9A 1M1KC 3HOVG 4LF6Q 1A63A 1YJWA 1BKBA 3PO2G 4JI6Q 3D31A 3U50C 4GKKQ 1SRUA 1VQMA 1EIYB 1MIUA 1YEZA 2E2IH 3WWVA 2QA4A 4LF4L 4LF8Q 2F4VQ 2AWOA 3H0GH 4AIMA 4B3TL 4P74A 4HJ7A 3G6EA 4GN4B 3HOZH 3J7A5 3UDFA 1LUZA 5JEAG 1EQQA 2WB1E 2GVBA 4OX9Q 4A3BH 1OXXK 1E1TA 4OO1G 4LUZA 3CXCA 2OTJA 3UDIA 1I3QH 2R7ZG 1WI5A 1X56A 2GVAA 5IWAL 4NXNQ 4DR4L 4DV2Q 2VUMH 2RHQB 1EOVA 1NBWA 1KIXA 5C4JH 1QVCA 5GROA 1X3FA 1LM0A 4EX5A 2BH8A 1A62A 2NZOA 2NVTH 5C4XG 4POGA 1JJGA 5M5XH 3ULJA 4DR1Q 2JA6H 1JB7A 2VW9A 5E7NA 1XPRA 4LF6L 3M4OH 4QL5A 2JA9A 4HIDA 4R4QA 4JI4L 3S1MH 3T1YL 2CWAA 3KF6B 1JT8A 1PH4A 2OTLA 1K0RA 1UEBA 4OWTB 4YCUA 4DV1Q 4HIMA 1VQ4A 5DLQE 3HKZG 3GTPH 4LF7L 1MJEA 3OTOQ 1UE5A 4LF9Q 3CCEA 1PH7A 2KCMA 1FVIA 1WCMH 2KHJA 1Y1WG 1TXYA 4A3JG 2JA5G 3G71A 1XNQL 2R6GA 2K14A 4GOPB 4LFBQ 2I5LX 2NVYH 5IE8A 1EQRA 4GLXA 1U5KA 3GTJH 1FJGL 1YHBA 5C3EH 2B63H 1PA6A 3K8AA 4HJAA 4DV7L 1N34Q 2I0QA 4A3DH 3HOYG 1P8LA 1X65A 1UE1A 4KI0A 3DLLA 3CCRA 4AQYQ 1YHQA 5IYCH 1L1OA 1QVGA 1IBKQ 4DUYL 1J5EQ 4B3ML 2Z6KA 3PUXA 2R7ZH 1NE3A 4GKJL 2ZTDA 1IBMQ 3G48A 3PUYA 2MFIA 2WP8J 4JI7L 3KDFA 4GS3A 4PMWA 4X65L 1R9TH 2ATWA 1IBLL 4APVA 1J6QA 2N8NA 3M3YH 3CPWA 4IJLA 2B3GA 2K5VA 2K75A 1EYGA 3AYHB 3PUVA 4IJHA 3F8TA 4LF5Q 4NB3A 3I56A 4JI8L 1KRSA 1QUQA 1VS0A 1OTCA 3ULLA 1XPOA 1AE2A 4JCVE 4LUOA 4MZ9A 5FLMH 4A3CG 4JI6L 4DR3Q 2GN5A 3HOUH 1XPUA 4C2MH 1M90C 1NJIC 4BY7H 4BBSG 4KLKA 4OXPA 3TEHB 4JI1L 3MXNB 3RN5A 5C0XJ 3L2PA 1E24A 4DUYQ 1J5EL 2MO0A 1XMQL 1VQKA 4B3MQ 2NVQH 1K83H 1VQEA 5IYBH 2UUCL 4NXML 4LFAQ 1KHIA 1CKNA 4QIWE 1XNRQ 1H95A 2OQ0A 4C3HH 1VQDA 3OTOL 1Z9FA 4L5QA 2JA5H 4UY8C 4DV2L 1D8LA 2K5HA 1Q82C 4KHZA 3PF4A 2UU9L 1G6PA 5IT9c 2HQLA 1KQSA 4JI5L 4QY7A 2L15A 4UPAA 4DR2Q 1IZ6A 4BBRG 5LMNL 1XMOQ 1DGSA 1KAWA 4DAYB 2JA8H 4A3KH 4HJ8A 4JC0A 2PNHA 4DAMA 5IY0A 1N8RC 2JEBI 2CWPA 3BU2A 1IBKL 4IOCA 4DR5Q 3CCVA 1OXVA 4A3EG 5FJ8G 3PIPA 4K0KL 1HNWL 2H5XA 1VQAA 4DR3L 4H02A 2E2JH 1KD1C 1FL0A 3HOWG 1UE7A 4LF4Q 2PQAA 4YY3L 2HT1A 1XNQQ 1B8AA 5IYBG 2ASBA 4P71A 1HNXQ 2R93H 3S15H 1N33L 2D0OA 1HR0Q 2UXDL 3CMAA 1YIJA 4LNQA 5K36G 3RNUA 4PG3A 1UWVA 3KF8B 1L0WA 3L0OA 1WJJA 4WJ4A 1SROA 3H0GG 4IPDA 4X6AH 1NMGA 4JOIC 1B70B 3LGJA 4JI1Q 2YTXA 5M3FH 1EFWA 4DR5L 1LYLA 4DR2L 1K73C 3CW2C 2ZTCA 2C35B 3M4PA 4QGUA 1GKHA 5LMUQ 4L5RC 1SN8A 4IOAA 2N3SA 5GAGC 2IX1A 3E0EA 3A5ZB 1Q8KA 5C4XH 1EWIA 1VQCA 1K9MC 1WOCA 5GAHC 2ZTEA 2WFWA 2UU9Q 1OXSC 3F2CA 2B63G 1ASYA 3ER0A 5LMUL 4RMFA 3CCSA 1C7YA 3EBEA 4BY7G 5IYCG 3PIOA 4OX9L 1Z47A 2JA7H 3GTMH 2UXBQ 1N32L 4GN5A 3B6YA 1YBYA 2JE6I 3S14H 2QEXA 3I2ZA 5EAYA 4DR4Q 4MNOA 3TS2A 4DR6L 4Y7NH 3Q8DA 3A5UA 2UUAQ 2WAQG 4X66Q 1KRTA 1TWHH 3K80C 1I94Q 2NN6I 2NN6G 4JI7Q 3H15A 2N49A 5GADC 3NBHB 5IP9G 1Q46A 2NZHA 1N9WA 4R4TA 4JI3L 2CFMA 4JBMA 1A0IA 4B3RQ 1E1OA 5AJ3Q 5M3FG 4Y52H 3RZDH 5M5WH 4X62L 1TWAH 3RLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F1Z A;  1BBU A;  1SLJ A;  3GD7 A;  2N78 A;  4JI8 Q;  4YCW A;  2KCT A;  5M3M G;  3H3V I;  2WB1 G;  2AHO B;  5LMN W;  4PZ8 A;  1KXL A;  4A3G G;  1I50 H;  1MKH A;  3PO3 H;  4IFD J;  2R92 G;  4A4I A;  4QJF A;  4LFC Q;  3S1Q H;  2B29 A;  4BA1 I;  5JEA J;  4A93 G;  3T1Y Q;  2EQS A;  1SMX A;  3RLN A;  3K7U C;  3S17 H;  4POF A;  4A3F H;  2KEN A;  2VY3 A;  4P72 A;  1I5F A;  3CCQ A;  4DV1 L;  1SFO H;  1PH1 A;  4A3K G;  1VQO A;  5C0X G;  3CC2 A;  4DK6 C;  4BBS H;  2ZJP A;  4A3E H;  3S24 A;  4A76 A;  1X3G A;  4BBR H;  3S1R H;  4UP7 A;  4DV0 L;  4A3I H;  2MQH A;  2RCN A;  3NEM A;  4R4I A;  2JA8 G;  4JI5 Q;  4L5T A;  5IYD G;  4JV5 L;  1EIF A;  1GD7 A;  2F3I A;  1VQH A;  2Q2H A;  2ALY B;  3PGZ A;  4MTN A;  1S40 A;  1VQ7 A;  3M7N A;  1O7I A;  3IRB A;  2VZA A;  2F52 A;  4NPS A;  4DKA C;  1AE3 A;  4A3G H;  1V9P A;  4JOI A;  2R7D A;  1XTD A;  2BH2 A;  1Q1E A;  4YWL A;  3CAM A;  4DV3 Q;  1YIT A;  1NY4 A;  1UE6 A;  3ICE A;  4JG2 A;  2K4K A;  1VQI A;  1CKM A;  1Q1B A;  5FLX c;  4YWM A;  3CD6 A;  1PH2 A;  4IO9 A;  4GOP C;  4LF8 L;  3UDG A;  4FDB A;  2F4V L;  4DUZ Q;  1KL9 A;  1HH2 P;  1K3R A;  1PYB A;  3AQQ A;  4A3L H;  4J15 A;  2KHI A;  3BJU A;  4A3M H;  1LTL A;  2ZJQ A;  1XNR L;  2IY5 B;  1IBL Q;  3FKI G;  1OXT A;  2A1A A;  4BXX H;  4A3I G;  1PH8 A;  5IP7 H;  1CSP A;  2Q2I A;  1Y14 B;  4DR7 Q;  4OWX B;  4KHP Q;  3GDE A;  2FXQ A;  3HKS A;  2JA6 G;  4YHH L;  1Q12 A;  3S2D H;  2MNA A;  3PUZ A;  1B7Y B;  1CKO A;  1U0L A;  4GNX A;  1PH5 A;  1C9O A;  3U4V A;  1JMC A;  4OWW B;  3CCL A;  3GO5 A;  1IXR A;  2V1C C;  1HNW Q;  1G51 A;  4NXM Q;  4DR1 L;  4UP8 A;  2R93 G;  5ELO A;  2UUB Q;  3U58 A;  3HOX H;  3J81 j;  4P73 A;  1X9N A;  2Z0S A;  4LW1 A;  3BZK A;  3G4S A;  1OXU A;  2HIV A;  2JA7 G;  2UXC L;  1HR0 W;  5FLM G;  4O0A A;  4LF5 L;  3BZC A;  1HZB A;  4DNI A;  1X6O A;  3TRE A;  3HOZ G;  3CC4 A;  2MO1 A;  4YY3 Q;  3EIV A;  2E5L L;  1GM5 A;  4JI0 L;  3I55 A;  1VQJ A;  1PH3 A;  2CQO A;  3W5O A;  4A3J H;  4LF7 Q;  1X55 A;  4RG1 A;  1IBM L;  3FP9 A;  2OWO A;  4WJ3 M;  4NXN L;  1L1O C;  1YI2 A;  4LFA L;  3I4M G;  4DR7 L;  4PZ6 A;  1I94 L;  1FGU A;  3UE0 A;  4GLA C;  3RZO H;  1E3P A;  3FHW A;  1HZC A;  5GAE C;  1TWF H;  2HIX A;  4DV7 Q;  1N34 L;  2XTI A;  1HR0 L;  1VQ5 A;  1QUQ B;  4JI3 Q;  4JI4 Q;  3GTQ H;  1MJC A;  4ME3 A;  3TRZ A;  1L2F A;  2VS1 A;  2DGY A;  1BBW A;  3J80 c;  4JYA L;  2IX0 A;  3E9I A;  3W1B A;  1VCI A;  2YYZ A;  4AQY L;  1YJ9 A;  1K8A C;  4R4O A;  2D62 A;  2CKZ B;  4K0K Q;  2AMC B;  3U4Z A;  3F2B A;  3S16 H;  1VQ9 A;  1JJ2 A;  1L1O B;  2JK8 A;  1A8V A;  1Q86 C;  2PI2 A;  4DV4 L;  3AEV A;  3HOW H;  2VQE Q;  2Q2T A;  3GTO H;  3JAM c;  2UUC Q;  1N36 L;  5C44 H;  4DK3 C;  4IFD G;  1WCM G;  4HJ9 A;  1WYD A;  2E2H H;  5HGQ A;  3STB C;  2BA1 A;  3MEF A;  1HJP A;  4IFD I;  5JJL A;  1YVC A;  3I4O A;  2LXK A;  1Y1V G;  1NMF A;  5H1S E;  2VQE L;  1XMQ Q;  1W2B A;  4AYB E;  2IHF A;  2A19 A;  4HIO A;  1HNZ L;  1V1Q A;  2Q2U A;  4JI2 L;  2UXC Q;  1XMO L;  4C3J H;  4LUV A;  1HNX L;  2JQO A;  3CQZ H;  1ASZ A;  2YU9 H;  4UP9 A;  3RLO A;  4DPG A;  5IYD H;  4DV5 L;  3T1H Q;  3PCO B;  3HKZ E;  3TQY A;  1AH9 A;  3DM3 A;  1TWC H;  2R7F A;  1PH6 A;  5HY6 A;  3CCJ A;  3CCM A;  4HIK A;  4BY1 H;  4X65 Q;  3GTK H;  4DV4 Q;  4JYA Q;  2K5N A;  1S3O A;  3K81 C;  4A75 A;  4JI2 Q;  1HNZ Q;  2PQA B;  1CKN B;  1VQL A;  3PO3 G;  1PV4 A;  4KHP L;  1P16 A;  4A3F G;  4QQB X;  4EQ5 A;  2VUM G;  4ALP A;  5JJK A;  3UE1 A;  4X66 L;  4GNX C;  2QGQ A;  2K52 A;  5FJ8 H;  3KF6 A;  4YWK A;  1SR3 A;  4HJ5 A;  4B3R L;  5IP7 G;  2E8G A;  4GLV B;  4X64 Q;  3TS0 A;  1QVF A;  3HOU G;  3RN2 A;  4GN3 B;  2ZJR A;  4DV6 L;  2HHH Q;  4DUZ L;  2LXJ A;  4A3M G;  5IP9 H;  4X62 Q;  1QZG A;  3HFZ B;  4TQU S;  2XGT A;  4OON A;  3VDY A;  4LFB L;  4GKK L;  1N33 Q;  5C44 G;  3J81 i;  3CCU A;  2A8V A;  3PO2 H;  2RF4 A;  4AH6 A;  2YTV A;  4DV0 Q;  3CP0 A;  1G29 1;  1VQP A;  2ZM6 L;  4GOP A;  1SE8 A;  1JE5 A;  3F2D A;  2Y0S G;  1VQG A;  1Q81 C;  3AFP A;  3KJP A;  2OQK A;  1GO3 E;  1RL2 A;  1VQ8 A;  1S72 A;  4BY1 G;  3ZJY C;  4GKJ Q;  3KOJ A;  5M5Y H;  2R92 H;  1HZ9 A;  3HOY H;  4JI0 Q;  4A93 H;  1WFQ A;  1C0A A;  1PVO A;  2BA0 A;  2DUD A;  5M3M H;  3GTG H;  2WAQ E;  5J3B A;  1D7Q A;  1CUK A;  3M9B A;  3A0J A;  3KDF B;  1PHJ A;  1N32 Q;  4B3S Q;  2D0P A;  3FKI H;  4YHH Q;  5LMN Q;  3KYH C;  2EXD A;  2IT1 A;  1XJV A;  3JAM i;  2LSS A;  2ID0 A;  1EUJ A;  2EIF A;  3STB D;  3PF5 A;  4BA2 I;  5JJI A;  2AWN A;  4LFC L;  3K7A H;  3I4N G;  4A3C H;  4OO1 I;  3E9H A;  1PYS B;  3I7F A;  5BR8 L;  1YHA A;  4DV6 Q;  2HHH L;  1X54 A;  2VNU D;  1T9H A;  4IPG A;  4XIG S;  3CF5 A;  4YCV A;  2K50 A;  1VQF A;  3AFQ A;  3PUW A;  3W1G A;  3NEL A;  1Q7Y C;  3A74 A;  1X3E A;  1VQ6 A;  1HZA A;  3HOV H;  4IPH A;  4GNX B;  4DR6 Q;  2ZM6 Q;  1E7Z A;  2JEA I;  4X64 L;  1NTG A;  1PFS A;  1YZ6 A;  3PV0 A;  4JBW A;  5ELN A;  5C3E G;  4JBK A;  3H3V H;  3OYY A;  4A3D G;  1N36 Q;  2PMZ E;  3OW2 A;  3NEN A;  5GQO A;  2ES2 A;  3HOX G;  3CC7 A;  1VQN A;  2NVX H;  4DV5 Q;  4AYB G;  3T1H L;  2VQF Q;  4LF9 L;  2Y0S E;  3KLW A;  1Y1V H;  2KBN A;  1CSQ A;  2I5H A;  1Y1W H;  5BR8 Q;  1KC8 C;  4XTC S;  1RIP A;  3I4M H;  4A3B G;  3KJO A;  4C3I H;  1YNX A;  5C0X I;  1YJN A;  2E5L Q;  3KFU A;  4PZ7 A;  2JJQ A;  4A3L G;  3L7Z C;  1IYJ B;  1FJG Q;  4BXX G;  3M4Q A;  4JBJ A;  3ERS X;  3I4N H;  2YTY A;  4DV3 L;  3J80 i;  2Z6K C;  2UXB L;  4B3T Q;  4IPC A;  3D0F A;  2UUA L;  4L5S A;  4LWC A;  3S1N H;  2UUB L;  3J7Z C;  3SGI A;  4P75 A;  3UDX A;  1VQB A;  1QZH A;  1BVS A;  2UXD Q;  2RHS B;  1K8G A;  4B3S L;  1GVP A;  3CME A;  1I6H H;  4JV5 Q;  5IWA Q;  3JC6 6;  1JJC B;  2VQF L;  2I5M X;  4O2D A;  2OCE A;  3GTL H;  3PSI A;  3K0X A;  4R4C A;  3M85 A;  1V43 A;  5AJ3 L;  1IL2 A;  1TWG H;  1W3S A;  4R1J A;  2CCZ A;  3RR5 A;  3S2H H;  1E22 A;  2AKW B;  2PI2 E;  2IHE A;  2VL6 A;  4TVA B;  3J81 c;  3ULP A;  2YV5 A;  3CPF A;  3EN2 A;  1PH9 A;  1M1K C;  3HOV G;  4LF6 Q;  1A63 A;  1YJW A;  1BKB A;  3PO2 G;  4JI6 Q;  3D31 A;  3U50 C;  4GKK Q;  1SRU A;  1VQM A;  1EIY B;  1MIU A;  1YEZ A;  2E2I H;  3WWV A;  2QA4 A;  4LF4 L;  4LF8 Q;  2F4V Q;  2AWO A;  3H0G H;  4AIM A;  4B3T L;  4P74 A;  4HJ7 A;  3G6E A;  4GN4 B;  3HOZ H;  3J7A 5;  3UDF A;  1LUZ A;  5JEA G;  1EQQ A;  2WB1 E;  2GVB A;  4OX9 Q;  4A3B H;  1OXX K;  1E1T A;  4OO1 G;  4LUZ A;  3CXC A;  2OTJ A;  3UDI A;  1I3Q H;  2R7Z G;  1WI5 A;  1X56 A;  2GVA A;  5IWA L;  4NXN Q;  4DR4 L;  4DV2 Q;  2VUM H;  2RHQ B;  1EOV A;  1NBW A;  1KIX A;  5C4J H;  1QVC A;  5GRO A;  1X3F A;  1LM0 A;  4EX5 A;  2BH8 A;  1A62 A;  2NZO A;  2NVT H;  5C4X G;  4POG A;  1JJG A;  5M5X H;  3ULJ A;  4DR1 Q;  2JA6 H;  1JB7 A;  2VW9 A;  5E7N A;  1XPR A;  4LF6 L;  3M4O H;  4QL5 A;  2JA9 A;  4HID A;  4R4Q A;  4JI4 L;  3S1M H;  3T1Y L;  2CWA A;  3KF6 B;  1JT8 A;  1PH4 A;  2OTL A;  1K0R A;  1UEB A;  4OWT B;  4YCU A;  4DV1 Q;  4HIM A;  1VQ4 A;  5DLQ E;  3HKZ G;  3GTP H;  4LF7 L;  1MJE A;  3OTO Q;  1UE5 A;  4LF9 Q;  3CCE A;  1PH7 A;  2KCM A;  1FVI A;  1WCM H;  2KHJ A;  1Y1W G;  1TXY A;  4A3J G;  2JA5 G;  3G71 A;  1XNQ L;  2R6G A;  2K14 A;  4GOP B;  4LFB Q;  2I5L X;  2NVY H;  5IE8 A;  1EQR A;  4GLX A;  1U5K A;  3GTJ H;  1FJG L;  1YHB A;  5C3E H;  2B63 H;  1PA6 A;  3K8A A;  4HJA A;  4DV7 L;  1N34 Q;  2I0Q A;  4A3D H;  3HOY G;  1P8L A;  1X65 A;  1UE1 A;  4KI0 A;  3DLL A;  3CCR A;  4AQY Q;  1YHQ A;  5IYC H;  1L1O A;  1QVG A;  1IBK Q;  4DUY L;  1J5E Q;  4B3M L;  2Z6K A;  3PUX A;  2R7Z H;  1NE3 A;  4GKJ L;  2ZTD A;  1IBM Q;  3G48 A;  3PUY A;  2MFI A;  2WP8 J;  4JI7 L;  3KDF A;  4GS3 A;  4PMW A;  4X65 L;  1R9T H;  2ATW A;  1IBL L;  4APV A;  1J6Q A;  2N8N A;  3M3Y H;  3CPW A;  4IJL A;  2B3G A;  2K5V A;  2K75 A;  1EYG A;  3AYH B;  3PUV A;  4IJH A;  3F8T A;  4LF5 Q;  4NB3 A;  3I56 A;  4JI8 L;  1KRS A;  1QUQ A;  1VS0 A;  1OTC A;  3ULL A;  1XPO A;  1AE2 A;  4JCV E;  4LUO A;  4MZ9 A;  5FLM H;  4A3C G;  4JI6 L;  4DR3 Q;  2GN5 A;  3HOU H;  1XPU A;  4C2M H;  1M90 C;  1NJI C;  4BY7 H;  4BBS G;  4KLK A;  4OXP A;  3TEH B;  4JI1 L;  3MXN B;  3RN5 A;  5C0X J;  3L2P A;  1E24 A;  4DUY Q;  1J5E L;  2MO0 A;  1XMQ L;  1VQK A;  4B3M Q;  2NVQ H;  1K83 H;  1VQE A;  5IYB H;  2UUC L;  4NXM L;  4LFA Q;  1KHI A;  1CKN A;  4QIW E;  1XNR Q;  1H95 A;  2OQ0 A;  4C3H H;  1VQD A;  3OTO L;  1Z9F A;  4L5Q A;  2JA5 H;  4UY8 C;  4DV2 L;  1D8L A;  2K5H A;  1Q82 C;  4KHZ A;  3PF4 A;  2UU9 L;  1G6P A;  5IT9 c;  2HQL A;  1KQS A;  4JI5 L;  4QY7 A;  2L15 A;  4UPA A;  4DR2 Q;  1IZ6 A;  4BBR G;  5LMN L;  1XMO Q;  1DGS A;  1KAW A;  4DAY B;  2JA8 H;  4A3K H;  4HJ8 A;  4JC0 A;  2PNH A;  4DAM A;  5IY0 A;  1N8R C;  2JEB I;  2CWP A;  3BU2 A;  1IBK L;  4IOC A;  4DR5 Q;  3CCV A;  1OXV A;  4A3E G;  5FJ8 G;  3PIP A;  4K0K L;  1HNW L;  2H5X A;  1VQA A;  4DR3 L;  4H02 A;  2E2J H;  1KD1 C;  1FL0 A;  3HOW G;  1UE7 A;  4LF4 Q;  2PQA A;  4YY3 L;  2HT1 A;  1XNQ Q;  1B8A A;  5IYB G;  2ASB A;  4P71 A;  1HNX Q;  2R93 H;  3S15 H;  1N33 L;  2D0O A;  1HR0 Q;  2UXD L;  3CMA A;  1YIJ A;  4LNQ A;  5K36 G;  3RNU A;  4PG3 A;  1UWV A;  3KF8 B;  1L0W A;  3L0O A;  1WJJ A;  4WJ4 A;  1SRO A;  3H0G G;  4IPD A;  4X6A H;  1NMG A;  4JOI C;  1B70 B;  3LGJ A;  4JI1 Q;  2YTX A;  5M3F H;  1EFW A;  4DR5 L;  1LYL A;  4DR2 L;  1K73 C;  3CW2 C;  2ZTC A;  2C35 B;  3M4P A;  4QGU A;  1GKH A;  5LMU Q;  4L5R C;  1SN8 A;  4IOA A;  2N3S A;  5GAG C;  2IX1 A;  3E0E A;  3A5Z B;  1Q8K A;  5C4X H;  1EWI A;  1VQC A;  1K9M C;  1WOC A;  5GAH C;  2ZTE A;  2WFW A;  2UU9 Q;  1OXS C;  3F2C A;  2B63 G;  1ASY A;  3ER0 A;  5LMU L;  4RMF A;  3CCS A;  1C7Y A;  3EBE A;  4BY7 G;  5IYC G;  3PIO A;  4OX9 L;  1Z47 A;  2JA7 H;  3GTM H;  2UXB Q;  1N32 L;  4GN5 A;  3B6Y A;  1YBY A;  2JE6 I;  3S14 H;  2QEX A;  3I2Z A;  5EAY A;  4DR4 Q;  4MNO A;  3TS2 A;  4DR6 L;  4Y7N H;  3Q8D A;  3A5U A;  2UUA Q;  2WAQ G;  4X66 Q;  1KRT A;  1TWH H;  3K80 C;  1I94 Q;  2NN6 I;  2NN6 G;  4JI7 Q;  3H15 A;  2N49 A;  5GAD C;  3NBH B;  5IP9 G;  1Q46 A;  2NZH A;  1N9W A;  4R4T A;  4JI3 L;  2CFM A;  4JBM A;  1A0I A;  4B3R Q;  1E1O A;  5AJ3 Q;  5M3F G;  4Y52 H;  3RZD H;  5M5W H;  4X62 L;  1TWA H;  3RLF A; 
#chains in the Genus database with same CATH topology
 3F1Z A;  3HEJ A;  1SLJ A;  3D6W A;  1KNE A;  4YCW A;  5LMN W;  4IFD J;  2JA6 B;  4ZRZ A;  4Q0F A;  2EQS A;  3K7U C;  4A3F H;  4P72 A;  1TWF B;  1SFO H;  1ICW A;  3CC2 A;  4X3T A;  3BVG A;  3QIA A;  5KYI A;  3PMF A;  2EYL A;  4DV0 L;  3NPP A;  4R4I A;  3BYT B;  4JI5 Q;  2KEE A;  3T4A C;  2SDF A;  4JV5 L;  1EIF A;  2QW7 A;  5JPM C;  2OT2 A;  1KTK A;  2LKV A;  3PGZ A;  5AFW A;  1VQ7 A;  1FNU A;  4CJ0 B;  2IX3 A;  2QF7 A;  5JOB A;  1L0Y B;  1RD9 D;  1BO0 A;  1XTD A;  2K5Q A;  1J9O A;  1ILP A;  1YIT A;  1NY4 A;  1UE6 A;  1HUM A;  4BWG B;  3ICE A;  2K4K A;  1VQI A;  4FF2 A;  3HOX B;  2B8F A;  3K5O A;  3N52 A;  4IO9 A;  2F4V L;  3UDG A;  1EIG A;  4H13 C;  4BS9 A;  1KL9 A;  3CQZ B;  5KGU A;  2EYJ A;  2KEC A;  4A3M H;  1DOK A;  1LTL A;  3P75 A;  2ZJQ A;  3C3L A;  2Z9H A;  1OXT A;  3S1Q B;  1PH8 A;  5IP7 H;  1Y14 B;  1KAB A;  3G7L A;  5EKL A;  2QDL A;  2FXQ A;  2JA6 G;  2G5D A;  3S2D H;  1ESR A;  1U0L A;  3HGB A;  3CCL A;  2XWJ B;  4IFD H;  1ET6 A;  5ELO A;  4WFN 3;  1TY0 A;  2Z0S A;  4G4K A;  4CDC C;  1HR0 W;  2K32 A;  5CV7 A;  4O0A A;  1HZB A;  4C3J G;  4HMI A;  4JI0 L;  3PO3 B;  1SYB A;  1VQJ A;  4G7O C;  2KVM A;  3W5O A;  2GA4 B;  4RG1 A;  3I8Z A;  2I46 A;  4WJ3 M;  4FXK C;  1L1O C;  1YI2 A;  4PZ6 A;  1I94 L;  1FGU A;  3UE0 A;  2M00 A;  1N34 L;  3I90 A;  4JI4 Q;  2SOB A;  4RA8 A;  1CQV A;  5ELD A;  2DGY A;  2F0K A;  2IX0 A;  3E9I A;  2KQ3 A;  1TWA H;  1VCI A;  4AQY L;  1KLG D;  4R4O A;  5G3L F;  2CKZ B;  1EWC A;  3U4Z A;  1RCV D;  3AEV A;  1Q86 C;  3K7A B;  3HOW H;  4QCL A;  1RKN A;  5C44 H;  2CW0 C;  3STB C;  3NTI A;  2RSO A;  1HJP A;  5JJL A;  3I4O A;  3HG9 A;  1A2T A;  4EVO A;  3P7J A;  2VQE L;  4JK1 C;  2Q2U A;  1V1Q A;  3D4D A;  1K0S A;  3U9S A;  3CQZ H;  5KNC A;  3TP8 A;  3RLO A;  1JCK B;  3HKZ E;  4F88 A;  5F2D A;  1RTO A;  5HY6 A;  1PH6 A;  3GTM B;  4KY5 A;  3HRZ C;  3GTJ B;  2Q8R E;  4KHP L;  4QIW B;  4ALP A;  1F2M A;  1ET9 A;  1BOS A;  4GNX C;  2QGQ A;  1WTW A;  3I4N B;  5NUC A;  3A55 A;  3VR4 A;  5IP7 G;  4X64 Q;  1ENF A;  1F9P A;  3TS0 A;  3DUZ A;  1IYU A;  2HHH Q;  1VF7 A;  4G7H C;  3HFZ B;  1D2B A;  1AFP A;  2XGT A;  3VDY A;  4LFB L;  4C3J B;  5C44 G;  2L12 A;  2WAC A;  3OSO A;  1QIL A;  2X69 A;  1ZEQ X;  2YTV A;  2A6H C;  4RHR A;  4MTK A;  4FF1 A;  5D3D A;  3I4M B;  2NN6 H;  4R9W A;  2EOT A;  4QUF A;  2FIN B;  4K5V A;  3MFG A;  2EXZ A;  3HOV B;  3SDZ A;  4BY1 G;  3ZJY C;  2PPB C;  5E1F A;  3NTH A;  3HOY H;  1C0A A;  1O7Z A;  2BA0 A;  2DUD A;  2MPM A;  4KV6 A;  5J3B A;  5M3M H;  3GTG H;  1CUK A;  1GUN A;  2D0P A;  4YHH Q;  1HHV A;  3KYH C;  2EXD A;  1PTO B;  2PW5 A;  1NAP A;  2EIF A;  3PF5 A;  2AWN A;  2PZW A;  3K7A H;  5BR8 L;  1PYS B;  1AEX A;  1YHA A;  5C44 B;  1HTL D;  1X54 A;  3CHB D;  4IPG A;  1T9H A;  4RFB A;  4XIG S;  1VQF A;  3AFQ A;  4U67 3;  1VQ6 A;  3HOV H;  1HZA A;  1SJE D;  2DY7 A;  3QOJ A;  5EQ0 A;  2B2V A;  2A6E C;  2F0L A;  1CI3 M;  4X64 L;  1NTG A;  4K2L A;  4JBW A;  3H3V H;  2HCC A;  1N36 Q;  3LNN A;  3TP6 A;  1GHJ A;  3NEN A;  3U9O A;  3VR6 A;  3AB9 A;  5J1Z A;  2TMP A;  3T1H L;  2VQF Q;  2Y0S E;  2KBN A;  2B2T C;  5JVG 3;  3BVZ A;  4RKL A;  2I5H A;  3Q23 A;  1FD7 D;  1TII D;  1GUO A;  2CVR A;  4PZ7 A;  2FMC A;  4N8F A;  2O4X A;  4BXX G;  3ERS X;  2RVL A;  2YTY A;  4A3D B;  4DV3 L;  2A69 C;  1NNX A;  3J7Z C;  3SGI A;  3UDX A;  1MI2 A;  5KIX A;  2LMC B;  2UXD Q;  2F0M A;  1SYD A;  2O5I C;  1ICF B;  3K5M A;  3WOE A;  1HTP A;  1AN8 A;  4JV5 Q;  2A69 D;  4O2D A;  3PSI A;  3OPO A;  2EDG A;  2ICI A;  5AJ3 L;  2NVT B;  2KCN A;  1XTC D;  2KUM A;  2NVY B;  1E22 A;  2PI2 E;  4TVA B;  1TY2 A;  1M1K C;  5IYD H;  3CPF A;  2C9O A;  2F3V A;  4JI6 Q;  1SRU A;  1VQM A;  1EIY B;  2QA4 A;  4CDE C;  3ZYY X;  1X32 A;  1SMY D;  5IGD A;  5M3M B;  3GTG B;  3S1N B;  1TT2 A;  3UDF A;  1LUZ A;  4J8Q A;  1S4Z A;  2OTJ A;  4OO1 G;  1X56 A;  5I4D A;  4DV2 Q;  2RHQ B;  4NP5 A;  1EOV A;  1TS3 A;  1QVC A;  5C4J H;  1SE4 A;  4ZQ3 A;  2BH8 A;  3GTO B;  3ULJ A;  1JB7 A;  2DY8 A;  3Q24 A;  1O7L A;  1JOO A;  4HSV A;  3T1Y L;  1JT8 A;  1XWE A;  1DON A;  1K0R A;  4YCU A;  4F7X A;  2ZXR A;  3A54 A;  2BE5 D;  4DV1 Q;  3JAM E;  1SNQ A;  3M3Y B;  4LF7 L;  1MJE A;  5DAU A;  3OTO Q;  2ICE C;  5EGT A;  1U4P A;  1WD1 A;  1Y69 U;  2KCM A;  1WCM H;  2NZ1 D;  1KAA A;  1YNJ D;  2K14 A;  1L0X B;  1VDZ A;  5IE8 A;  5I6Y A;  1FJG L;  5C3E H;  1GXD C;  4HJA A;  1N34 Q;  4C1N I;  4MHE A;  1QVG A;  4L6T B;  5IYC H;  1L1O A;  4DUY L;  1J5E Q;  2Z6K A;  4GKJ L;  1R4Q B;  3PUY A;  2MFI A;  1FNV A;  3NTK A;  1R9T H;  1AZP A;  1CTM A;  1IBL L;  3M3Y H;  2D9U A;  2B3G A;  3KBX A;  4LF5 Q;  4TRD A;  4JI8 L;  1TR5 A;  2F0Q A;  1VS0 A;  2RDH A;  2XN9 C;  2PQE A;  4LUO A;  5FLM H;  4MZ9 A;  5IOD A;  1I6V C;  2GN5 A;  3HOU H;  2OEO A;  4BBS G;  3V05 A;  4JI1 L;  5J22 A;  4F8M A;  4C3H G;  5D14 A;  4QIW E;  1JOQ A;  5DEH A;  2HD3 A;  2OQ0 A;  1NUC A;  1H95 A;  3I73 A;  4X3K A;  3OTO L;  4L5Q A;  1R9T B;  3RZD B;  3PF4 A;  1G6P A;  1SMY C;  1IZ6 A;  4OO1 H;  2Q8T A;  4CGY B;  3QWN A;  4WJW A;  3H94 A;  4A3K H;  2PO4 A;  4L63 B;  5IY0 A;  4DNT B;  2JEB I;  2K6A A;  2CWP A;  3BU2 A;  4DR5 Q;  3GTQ B;  3V96 A;  5FJ8 G;  4N9T A;  3VR2 A;  1X3P A;  2RCF A;  1UE7 A;  4NDX A;  1A3V A;  1TWA B;  3MVV A;  5IYB G;  1HNX Q;  3IKJ A;  2D0O A;  1QE6 A;  2F0I A;  3DHQ A;  4C3I B;  1C4Q A;  1PMR A;  1UWV A;  2FMM A;  1GUS A;  3L0O A;  4RH6 A;  5IGG A;  4ZCK A;  4KY6 A;  4C3I G;  1NMG A;  4JI1 Q;  5M3F H;  2E2H B;  2L1B A;  1K73 C;  4DR2 L;  4L5R C;  2MGS A;  3E3X A;  2ZXP A;  1H9K A;  2F0F A;  3A5Z B;  1Q8K A;  3L9A X;  1K9M C;  2ZTE A;  5COR A;  2B63 G;  3F2C A;  1S5B D;  4RMF A;  1HQM C;  4BY7 G;  2PMZ B;  2JA7 H;  4KKU A;  1Y8N B;  3L3O C;  1QOH A;  1TU2 B;  2QEX A;  5EAY A;  1GUT A;  5G3L D;  4MNO A;  4Y7N H;  3Q8D A;  5CR3 A;  5FO7 B;  4DU9 A;  4LJZ C;  2UUA Q;  1B1Z A;  2WAQ G;  4X66 Q;  1II3 A;  2JSO A;  2NN6 G;  1HFG A;  2WB1 B;  4B3R Q;  4R4T A;  3D6C A;  2CFM A;  1A0I A;  2MJ8 A;  5AJ3 Q;  3RZD H;  1IW7 C;  3RLF A;  3GD7 A;  1DD2 A;  1Q8I A;  4JI8 Q;  2KCT A;  2R93 B;  3W2D A;  2WB1 G;  2JYO A;  2AHO B;  4PZ8 A;  1FR3 A;  4KHV A;  3PO3 H;  4S3S A;  4A3M B;  3AU7 A;  1MD2 D;  2R92 G;  4QJF A;  3S1Q H;  2B29 A;  4BA1 I;  5JEA J;  3T1Y Q;  4PV1 C;  4POF A;  5IT9 E;  3S2D B;  1X3Q A;  5BN5 A;  2K5D A;  4DV1 L;  1HQR D;  1PH1 A;  1VQO A;  5C0X G;  4FO2 A;  4DK6 C;  4A3E H;  1U9R A;  4A76 A;  1DOM A;  4UP7 A;  4A3I H;  2RCN A;  1QNU A;  3NEM A;  2JA8 G;  2RDG A;  1EY7 A;  1RHP A;  1CA5 A;  4EQN A;  4RGT A;  1GD7 A;  1D5Z C;  2ALY B;  2PZT A;  2D5D A;  3M7N A;  3QO2 A;  4O42 A;  2Q8I B;  2VZA A;  4FYD A;  1AE3 A;  4A3G H;  1V9P A;  1VMC A;  2R7D A;  4K6D A;  1Q1E A;  1EY6 A;  4XYQ A;  3KBG A;  4EQO A;  4YWM A;  1U4M A;  3MTS A;  4FDB A;  4ZK9 B;  3AQQ A;  1GOZ A;  4J15 A;  2KHI A;  1EOT A;  1DJR D;  3GQB A;  1BNZ A;  3UI2 A;  5IGC A;  5ELB A;  1FGB D;  1H9J A;  4A3I G;  3R8B A;  1CSP A;  1KLU D;  3X3M A;  4Q5V A;  1TKW B;  3GDE A;  1ML0 D;  2MNA A;  3PUZ A;  1PH5 A;  1HNW Q;  4A3G B;  5T1I A;  2K01 A;  5EBD A;  4DR1 L;  4UP8 A;  3BZK A;  1OXU A;  2E76 C;  2HIV A;  2F0P A;  1GUW A;  3BZC A;  1F2Y A;  2XSC A;  5FLX E;  3KLR A;  2CQO A;  4A3J H;  3CRK C;  1IBM L;  1GHK A;  4NXN L;  4DR7 L;  1IW7 D;  3K59 A;  4GLA C;  1F77 A;  3FHW A;  1HZC A;  1VQ5 A;  2XTI A;  1QUQ B;  3HOY B;  1ROD A;  1O80 A;  1L2F A;  5C6A A;  1BBW A;  2PCF B;  3W1B A;  3I3C A;  5KND A;  2B8G A;  1EY5 A;  3TSS A;  1YJ9 A;  2Z4H A;  4K0K Q;  2IJ0 A;  2AMC B;  1TS4 A;  3S16 H;  1JJ2 A;  2JK8 A;  2R61 A;  4DV4 L;  2B2W A;  1PLF A;  1CT1 D;  1PRT D;  4CJ1 B;  3JAM c;  1N36 L;  1WCM G;  2O2L D;  1EL0 A;  5HGQ A;  4FVM A;  3V2T A;  3EJI A;  2R92 B;  3NBH A;  1F9Q A;  1YVC A;  2LXK A;  4NKL A;  1Y1V G;  1DYQ A;  1PFB A;  1UNS A;  1JWM D;  2A19 A;  4HIO A;  4JI2 L;  1XMO L;  4C3J H;  4UP9 A;  1B44 D;  4NW2 A;  4DV5 L;  3TQY A;  1AH9 A;  3DM3 A;  1PYW D;  3ND9 A;  4X65 Q;  3EFX D;  3OOC A;  4A75 A;  2ZXO A;  2WAQ B;  4A3F G;  4FXD A;  2B39 A;  3T13 A;  3UE1 A;  4X66 L;  1S5E D;  1AW7 A;  2F0T A;  2R3Z A;  3KF6 A;  4HJ5 A;  4B3R L;  2E8G A;  4GLV B;  1QVF A;  3HOU G;  4GN3 B;  3SK8 A;  2ZJR A;  4A3M G;  4RGM A;  2L0C A;  4OON A;  4TKO B;  4DV0 Q;  4HMJ A;  3CP0 A;  1IL8 A;  1JE5 A;  1Q3L A;  1STE A;  3F2D A;  3GTK B;  3R2I A;  1EY4 A;  4H44 C;  3KJP A;  4FNF A;  4DA2 A;  4HED A;  2AQ2 B;  2RDF A;  1PVO A;  2N88 A;  2WAQ E;  5IIF A;  3NXW A;  3KDF B;  1PHJ A;  1N32 Q;  1BQQ T;  4A3B B;  5CYU A;  1XJV A;  2CW0 D;  3CU7 A;  4TSS A;  1EUJ A;  5JJI A;  4LFC L;  3I4N G;  4A3C H;  3E9H A;  4KTA A;  2WIN B;  4DV6 Q;  3CKI B;  3C1F A;  4K2K A;  3J80 L;  2E2D C;  3D8G A;  4PQX A;  4U68 A;  5EKI A;  3A74 A;  3I91 A;  2HUG A;  1LAC A;  1E7Z A;  4CDF C;  5C3E G;  1QNK A;  4ZKC B;  3Q6S A;  4YIJ A;  1Q90 A;  2NWG A;  3CC7 A;  3X3N A;  1EQV A;  3KLW A;  1Y1V H;  3TP5 A;  4OEM B;  2OF1 A;  1CSQ A;  4A3B G;  1RIP A;  3FEW X;  3KJO A;  1JOR A;  2V4D A;  2JJQ A;  4KMU C;  1WTV A;  1IYJ B;  2Z6K C;  4B9X A;  4IPC A;  3S1N H;  1I4R A;  3I72 A;  3LX0 A;  5DM7 3;  1BVS A;  5L37 A;  3MFY A;  4UHV A;  3E5S A;  1CZG A;  1GVP A;  3CME A;  1EYC A;  4HR7 B;  3RUZ A;  3Q22 A;  2OCE A;  2J4X A;  2L11 A;  1Y8O B;  2CCZ A;  1H9S B;  2AKW B;  2Z8L A;  2IHE A;  2VL6 A;  3ULP A;  3LWU A;  3HOV G;  1A63 A;  2NTS A;  4LF6 Q;  3S14 B;  3D31 A;  3KLS A;  4LF4 L;  3BYY B;  2E2I H;  4LF8 Q;  1SJH D;  4DAP A;  4DK0 A;  2EVB A;  3H0G H;  4I65 A;  4B3T L;  1BR9 A;  2HDM A;  5C5M A;  4HJ7 A;  3G6E A;  5JEA G;  1EQQ A;  4OHJ A;  2K04 A;  4A3B H;  1OXX K;  3VYS A;  2JN4 A;  3UDI A;  2WV6 D;  1I3Q H;  4LAA A;  3I70 A;  1WI5 A;  5IWA L;  4NXN Q;  2M2L A;  2VUM H;  3BDL A;  5DM6 3;  1LTA D;  3Q0A A;  3NWT A;  2NZO A;  1BCP C;  1QG7 A;  2NUC A;  4POG A;  2JA6 H;  2VW9 A;  3J7A V;  4QL5 A;  5FKA C;  1HCZ A;  3KF6 B;  3HS0 C;  2C5C A;  1B9M A;  2KOL A;  3H0G B;  2KED A;  1BUV T;  3H91 A;  1NR4 A;  3T53 B;  5KYL A;  1PRT C;  5IGE A;  3CRL C;  5K5P A;  4J1M A;  2X6L A;  4LF9 Q;  1PH7 A;  1GUG A;  2JA5 G;  4LFB Q;  4WRD A;  1EQR A;  4GLX A;  1U5K A;  3GTJ H;  2LFN A;  1EEI D;  2B63 H;  3K8A A;  4A3K B;  2F0W A;  1P8L A;  3HOY G;  1TVX A;  1SBB B;  1W6J A;  1RJT A;  4OL7 A;  3PUX A;  1PXU A;  4DNR B;  3D3R A;  1D1I A;  2F1M A;  2RQX A;  4L8J A;  3HZX A;  4DGZ A;  4GS3 A;  4DF7 A;  4X65 L;  2E2J B;  1V1O A;  1J6Q A;  3CPW A;  2K5V A;  1EYG A;  3PUV A;  3F8T A;  5LHY 1;  4NB3 A;  3I56 A;  2X6G A;  2XIW A;  1TWG B;  4QUC A;  1QUQ A;  1OTC A;  1BCP B;  4XQJ A;  2A68 C;  3M4O B;  1M90 C;  1NJI C;  4KLK A;  1ILQ A;  5M5Y B;  4FF3 A;  3KUP A;  4B3M Q;  3GV6 A;  1VQE A;  2ENB A;  2F0S A;  1STY A;  4NXM L;  1KHI A;  2VXW A;  4XT1 B;  4C3H H;  1VQD A;  1Z9F A;  4B08 A;  1D8L A;  2QCP X;  1BBX C;  2VUM B;  4KHZ A;  2UU9 L;  5IT9 c;  2J0T D;  2B2Y C;  4QY7 A;  2L15 A;  3NQI A;  4DR2 Q;  1TQO A;  1HPC A;  1ZKO A;  1I4H A;  1CZW A;  4V19 0;  3MXP A;  1F2L A;  4C2M B;  5M3F B;  1N8R C;  3FPP A;  1F9S A;  2Z4I A;  3DXJ C;  1FYC A;  2H5X A;  4DR3 L;  1M8A A;  5KRU A;  4A3E B;  3HOW G;  5J39 A;  1NR2 A;  4YY3 L;  2QEJ C;  5LL6 X;  2WKC A;  2RSN A;  1XNQ Q;  4FF4 A;  3R3O A;  4G7Z C;  1MSH A;  1YIJ A;  5FO8 B;  3RNU A;  4PG3 A;  1WJJ A;  4WJ4 A;  1SRO A;  1LV9 A;  4IUP A;  3NQT A;  1B70 B;  4KD3 A;  4KJO A;  1GJX A;  2ZTC A;  3CW2 C;  1LTR D;  1LT3 D;  4IOA A;  5CV6 A;  3AMU A;  1VQC A;  2EE1 A;  2H4O A;  2UU9 Q;  4RKB A;  1TWC B;  3EBE A;  5IYC G;  3S15 B;  4OX9 L;  1Z47 A;  3GTM H;  1EYD A;  3ND8 A;  3N6R A;  3I2Z A;  4DR4 Q;  3I4L A;  3SVM A;  2DJG C;  2DNE A;  3K80 C;  2NN6 I;  3H15 A;  2N49 A;  3P1H A;  4JI3 L;  1E1O A;  4Y52 H;  1BBU A;  1DOL A;  2O5J C;  2N78 A;  2KCC A;  1LT4 D;  2E75 C;  4ZAI A;  2F3W A;  3S1M B;  3S17 H;  2KEN A;  1AP0 A;  1I5F A;  3CCQ A;  2ZJP A;  3S24 A;  1CFM A;  1B4O A;  1EEF D;  4DK1 A;  4L5T A;  5JAV A;  5A35 A;  5IYD G;  3WDN A;  2F3I A;  1VQH A;  2A73 B;  1QCB D;  2B2Y A;  2F0G A;  1HFN A;  5EPL A;  4DKA C;  2BH2 A;  2R7Z B;  1LTT D;  4DV3 Q;  1Q1B A;  3CD6 A;  5C4X B;  1PYB A;  1K3R A;  5EJW A;  3S16 B;  3PQI A;  1SNM A;  4A3J B;  1XNR L;  2DJF C;  3E6Z X;  1IBL Q;  3FKI G;  4H0L C;  4XYO A;  2B2W C;  2Q2I A;  1A3U A;  4FP5 D;  4LMQ D;  4KHP Q;  2F03 A;  3HKS A;  1B7Y B;  1CKO A;  1CHQ D;  1S5C D;  1SNO A;  2EYH A;  2NTT A;  3U4V A;  4GNX A;  3C2P A;  3GO5 A;  5K36 H;  5BN4 A;  1E2W A;  4NXM Q;  3T56 B;  2UUB Q;  3U58 A;  3W3A A;  4P73 A;  1X9N A;  1ESF A;  1YNN D;  3FVQ A;  2JA7 G;  2D2C C;  5FLM G;  1CK1 A;  3TRE A;  3HOZ G;  3TZD A;  2MO1 A;  3EIV A;  2E5L L;  1I50 B;  3I55 A;  4LF7 Q;  4RCO A;  5I9O A;  1X55 A;  3FP9 A;  1STG A;  3OIQ A;  1WTX A;  2KJX A;  2PW7 A;  3RD4 A;  2DN8 A;  3RZO H;  5GAE C;  3KK7 A;  3GTQ H;  4DV7 Q;  4JI3 Q;  2DNC A;  2K28 A;  4JVZ A;  4ME3 A;  3A8K E;  1BCP D;  3SEB A;  2K03 A;  1K8A C;  4IUN A;  1SE2 A;  1VQ9 A;  3VR5 A;  2G9H D;  5KNB A;  1H9M A;  2Q2T A;  3GTO H;  4ILW A;  2UUC Q;  1KDB A;  2KA7 A;  4IFD G;  1KNA A;  1WYD A;  2E2H H;  1UUP A;  2BA1 A;  4IFD I;  4AYB B;  5H1S E;  1EWH A;  3J81 E;  1OO9 B;  1XMQ Q;  2F4I A;  4AYB E;  1R4P B;  1HNZ L;  3GTP B;  2YU9 H;  3T1H Q;  2AUK A;  3PCO B;  4EGV A;  4BY1 H;  3CCM A;  1EY9 A;  3A8J E;  3GTK H;  4JYA Q;  1S3O A;  1EQT A;  4JI2 Q;  1PV4 A;  3TDQ A;  4EQ5 A;  1SSO A;  1WTP A;  5JJK A;  1E0B A;  4MIU A;  5FJ8 H;  4YWK A;  5I9P A;  3RN2 A;  3MXG A;  1S5F D;  4CKE A;  4DV6 L;  2LXJ A;  1QZG A;  4DAY A;  4TQU S;  1STA A;  3J81 i;  4RWS C;  3PO2 H;  2RF4 A;  5D65 A;  4KJN A;  4AH6 A;  4KKT A;  4IUV A;  4UAI A;  1G29 1;  1PTO F;  1ZYR D;  2MP1 A;  2MHV A;  2F0D A;  4XT3 B;  1VQG A;  1Q81 C;  3AFP A;  4X3S A;  1GO3 E;  1RL2 A;  1VQ8 A;  3RZO B;  1A6X A;  1S72 A;  1B53 A;  1SYF A;  3HP3 A;  2QIL A;  1HZ9 A;  2A6H D;  1WTH A;  4XDX A;  4A93 H;  1A3T A;  5EPK A;  3VYT A;  3A0J A;  3DWP A;  5LMN Q;  3FKI H;  2F0O A;  1SE3 A;  3JAM i;  2LSS A;  4E6I A;  3ITP A;  4OO1 I;  3I7F A;  1WTQ A;  1PTO D;  1SND A;  3DWQ A;  4FXG C;  4G57 A;  4YCV A;  3CF5 A;  2K50 A;  1HXY D;  3W1G A;  3NEL A;  1X3E A;  1SYC A;  4GNX B;  2ZM6 Q;  2JEA I;  1MGS A;  1M4V A;  1PFS A;  3PV0 A;  4JBK A;  1NSN S;  3NHH A;  1B3A A;  4A3D G;  2PMZ E;  3OW2 A;  1V8Q A;  1JWS D;  5GQO A;  2JP1 A;  1VQN A;  5JVH 3;  1F2Z A;  1WVL A;  2Z6B A;  3OMC A;  4JPB W;  1Y1W H;  5BR8 Q;  4XTC S;  1F9R A;  4HTH A;  3I4M H;  2WII B;  1YNX A;  3KFU A;  3L7Z C;  1FJG Q;  3TME A;  3DMU A;  4OIK A;  4IUQ A;  3C1E A;  4GZY C;  2UXB L;  1LLR D;  2UUA L;  4L5S A;  3SK5 A;  2UUB L;  2RA4 A;  2J7Z A;  2NB0 A;  4KN7 C;  4P75 A;  2AQ3 B;  1SDF A;  1QZH A;  2EYO A;  4WOR A;  4K6L A;  3TN2 A;  4CBV A;  5JPN C;  3JC6 6;  3EVQ A;  2VQF L;  3G6J B;  2I5M X;  3PO2 B;  3K0X A;  3M85 A;  1V43 A;  1IL2 A;  1D5X C;  1TWG H;  1W3S A;  5FK9 C;  2JA7 B;  2LY7 A;  3J81 c;  1PH9 A;  1B50 A;  3EN2 A;  3PO2 G;  2Y0S B;  3U50 C;  2B63 B;  4GKK Q;  1YEZ A;  2G9D A;  3WWV A;  2F4V Q;  2AWO A;  2PNR C;  2XRS D;  3DEO A;  4P74 A;  1ENA A;  4F87 A;  3ERQ A;  4EQP A;  4GN4 B;  3J7A 5;  4OX9 Q;  3FKI B;  1E1T A;  1JOK A;  1KDC A;  4LUZ A;  1O7Y A;  3QR8 A;  4DR4 L;  1G2S A;  4K8I A;  3TBI B;  1KIX A;  1LM0 A;  3MWY W;  4EX5 A;  1STH A;  5C4X G;  5M5X H;  4C1N K;  3MEH A;  1SNP A;  2ZT9 C;  4M8A A;  1XPR A;  2EJF C;  2JA9 A;  4JI4 L;  4RGO S;  3VA5 A;  1JQY D;  2OTL A;  1G6Z A;  2B2V C;  4OWT B;  1VQ4 A;  5DLQ E;  3NWS A;  4XQN A;  3WOF A;  5EPJ A;  1UE5 A;  3J7Y W;  3GTL B;  2KHJ A;  1FVI A;  5FOB B;  4MN3 A;  4A3J G;  3G71 A;  1G91 A;  2EJM A;  3J7A F;  1UAP A;  5A2Q E;  1YHB A;  1PA6 A;  1EU3 A;  4OIJ A;  4DV7 L;  2I0Q A;  4KI0 A;  1UE1 A;  4AQY Q;  1IBK Q;  1IBM Q;  5COY A;  2K7V A;  2WP8 J;  4JI7 L;  2IL8 A;  3KDF A;  4C3H B;  1JIC A;  4P2C B;  5HUR A;  4APV A;  2K75 A;  1KRS A;  1AE2 A;  4JCV E;  2Z1C A;  4JI6 L;  4DR3 Q;  4C2M H;  1CHP D;  2EY1 A;  3TEH B;  4OXP A;  3MXN B;  5C0X J;  1E24 A;  4DUY Q;  1J5E L;  1XMQ L;  3C46 A;  1DZ1 A;  5CBE E;  5IYB H;  4LFA Q;  4ZYS A;  1CKN A;  2MUY A;  4JW0 A;  1G8Z D;  2HQE A;  1XNR Q;  3MC0 B;  3H3V C;  2JA5 H;  5JEA H;  4UY8 C;  4DV2 L;  4CDD C;  1Q82 C;  1MSG A;  4B9W A;  2F0V A;  1B9N A;  1KQS A;  1SYE A;  1XMO Q;  3K0Y A;  4DAY B;  2L9H A;  4HJ8 A;  3NSW A;  4JC0 A;  4DAM A;  2F0J A;  5E4X A;  1PRT F;  1IBK L;  1IKL A;  4IOC A;  1XYI A;  4OEL B;  3CCV A;  1OXV A;  3QG1 A;  3NUC A;  3DM1 A;  1KD1 C;  1FL0 A;  4K5W A;  3SXH A;  4LF4 Q;  2NYZ D;  2PQA A;  2HT1 A;  3S1R B;  2JA5 B;  1B8A A;  1Y1V B;  4IUU A;  2RKS A;  1ONL A;  2ASB A;  2R93 H;  3TZU A;  3S15 H;  1N33 L;  2PZU A;  1S5D D;  3HOW B;  1NCV A;  2L4N A;  1EZ8 A;  3H0G G;  5JJZ A;  3EQL C;  3LGJ A;  1TWH B;  2YTX A;  2CHB D;  3SR1 A;  1UEA B;  3S17 B;  4DR5 L;  1LYL A;  3SE0 A;  4N9P A;  3M4P A;  2N55 A;  5LMU Q;  1LT5 D;  5C3X A;  1PFM A;  4NMZ A;  2N3S A;  1XX8 A;  1AZQ A;  2IX1 A;  3MXU A;  5D3I B;  5C4X H;  1SAP A;  1D5M C;  1EZ6 A;  2WFW A;  2FHT A;  4IUT A;  3ER0 A;  1A2U A;  1C7Y A;  4ZUI A;  2UXB Q;  1VF5 C;  1LTS D;  1N32 L;  4GN5 A;  1YBY A;  2JXM B;  2XVS A;  1TWH H;  1EY0 A;  1K8M A;  4JI7 Q;  5GAD C;  5I2X A;  2NZH A;  1N9W A;  4JBM A;  5IOC A;  5M3F G;  1I3Q B;  1E2Z A;  5M5W H;  2EYP A;  4X62 L;  1Z6H A;  3H3V I;  5M3M G;  3TP7 A;  5I2Y A;  1KXL A;  4A3G G;  1I50 H;  1MKH A;  4A4I A;  4LFC Q;  4KK7 A;  3BDO A;  1PRT B;  4A93 G;  3RLN A;  1SMX A;  4DN4 M;  3K5L A;  3R93 A;  2VY3 A;  4IAL A;  3URY A;  4O1N A;  1JB3 A;  4A3K G;  3SK6 A;  4BBS H;  2CQA A;  4OGQ C;  1X3G A;  4BBR H;  2EY6 A;  5C3W A;  3S1R H;  2MQH A;  5E4W C;  1PTO H;  1IYV A;  5CV5 A;  3M4Y A;  2Q2H A;  5FLX L;  5CC4 A;  4MTN A;  1TS5 A;  5C3E B;  1S40 A;  3OIP A;  2K1B A;  1O7I A;  3P20 A;  3A7A B;  3IRB A;  2F52 A;  4NPS A;  2XRQ D;  4JOI A;  4YWL A;  3CAM A;  1BCP F;  4JG2 A;  1CKM A;  5FLX c;  2OXP A;  1PH2 A;  1SEB D;  4I7Z C;  2SEB D;  4GOP C;  4LF8 L;  1DCZ A;  4BBR B;  4DUZ Q;  1HH2 P;  2F0N A;  4A3L H;  2B2U A;  1C8C A;  3NE5 B;  3BJU A;  1B3Q A;  3OWE B;  2IY5 B;  3NK9 A;  3GP7 A;  3A7L A;  2A1A A;  4HN7 A;  4BXX H;  1HRJ A;  1YNN C;  1LTI D;  3SHL A;  1WTO A;  4DR7 Q;  4OWX B;  3ONA B;  3IAY A;  4YHH L;  1Q12 A;  2QKI C;  2CH4 A;  4A3F B;  4BY7 H;  2K05 A;  1JMC A;  1C9O A;  3F2U A;  4OWW B;  1IXR A;  2V1C C;  1G51 A;  3NBI A;  3FMC A;  2R93 G;  3RMH A;  3HOX H;  3J81 j;  1MHW C;  4LW1 A;  3G4S A;  3BS1 A;  5M5W B;  3T51 B;  2UXC L;  5C5L A;  4LF5 L;  4DAV A;  4DNI A;  1X6O A;  2YU9 B;  2IPK D;  4R8I A;  3CC4 A;  4YY3 Q;  1GM5 A;  4BY1 B;  1XXG A;  1PH3 A;  5CMD A;  2SNM A;  4V0B A;  3KF8 A;  4RGN A;  4QMG A;  5EBC A;  2VB2 X;  2OWO A;  3FDT A;  3IFD A;  3I4M G;  4LFA L;  1JR0 D;  1E3P A;  2E2I B;  4BY7 B;  1TWF H;  2HIX A;  1HR0 L;  1HNW L;  1SFO B;  5DNF A;  1MJC A;  2KHS A;  3TRZ A;  1DM0 B;  2VS1 A;  3J80 c;  4JYA L;  2YYZ A;  3O13 A;  3KLS X;  1K8O A;  2D62 A;  3F2B A;  1L1O B;  2A74 C;  1A8V A;  2PI2 A;  4IUR A;  2VQE Q;  1PDQ A;  1H9S A;  3SK4 A;  4DK3 C;  4HJ9 A;  4RCN A;  1Z7T A;  2IW3 A;  1PFN A;  2BDO A;  3MEF A;  1EU4 A;  1LT6 D;  2E74 C;  5ELC A;  1K3B C;  1NMF A;  1W2B A;  2IHF A;  2UXC Q;  1EFI D;  4LUV A;  1HNX L;  2JQO A;  1ASZ A;  4RAU C;  4DPG A;  2LS0 1;  1TWC H;  2R7F A;  3MXN A;  3CCJ A;  4HIK A;  4XQQ A;  1BXT A;  2BOS A;  4DV4 Q;  2K5N A;  1Y1W B;  3K81 C;  1HNZ Q;  1SYG A;  1CKN B;  2PQA B;  1VQL A;  3PO3 G;  4QQB X;  1P16 A;  4Y7N B;  2VUM G;  1ZXT A;  2H1E A;  1D1K A;  2K52 A;  4IQZ A;  4A93 B;  3IL8 A;  4LK1 C;  1SR3 A;  4K14 A;  4CKC A;  1I4X A;  3FPU B;  5CV9 A;  4ULL A;  1QJO A;  4DUZ L;  5IP9 H;  4X62 Q;  1A15 A;  1BDO A;  3EA6 A;  3M7G A;  2HDL A;  4GKK L;  2EJG C;  3K6O A;  1N33 Q;  4ABN A;  3CCU A;  2A8V A;  4KN4 C;  1EYA A;  2WKD A;  1V1P A;  1VQP A;  1SNC A;  3A56 A;  2ZM6 L;  4GOP A;  1SE8 A;  3R2T A;  2Y0S G;  4PMB A;  2B2U C;  2TSS A;  1WD0 A;  3HOU B;  2OQK A;  4GKJ Q;  3KOJ A;  1JWU D;  5M5Y H;  1RTN A;  2FJ2 A;  4IN3 A;  2R92 H;  4JI0 Q;  1WFQ A;  1QB5 D;  3IFT A;  1D7Q A;  4RHS A;  1IHZ A;  3M9B A;  4B3S Q;  4HCE A;  2IT1 A;  2NBF A;  5ELF A;  2ID0 A;  3STB D;  4BA2 I;  5FO9 B;  1T5E A;  1CQF A;  2A5H A;  4K8J A;  2HHH L;  3J80 E;  1PZK D;  2VNU D;  2SNS A;  4UDU C;  3OWF A;  3PUW A;  1Q7Y C;  1SXT A;  5CV8 A;  3MAQ A;  2P5Z X;  4IPH A;  1JC7 A;  1LTB D;  1YNJ C;  4DR6 Q;  3OMG A;  1YZ6 A;  5ELN A;  1EIH A;  3OYY A;  3VYR A;  3QB3 A;  1I6H B;  1PZJ D;  3PIP 3;  2ES2 A;  3HOX G;  2NVX H;  4DV5 Q;  4AYB G;  4LF9 L;  5LL6 S;  2CH4 W;  4ZUJ A;  1KC8 C;  5EKK A;  5ISR A;  3GV3 A;  4C3I H;  5C0X I;  1YJN A;  2E5L Q;  4A3L G;  2I07 B;  3MA2 B;  1LTG D;  3M4Q A;  3VR3 A;  4JBJ A;  3I4N H;  1CM9 A;  3J80 i;  3ERO A;  4B3T Q;  3BG3 A;  3D0F A;  4LWC A;  4C56 C;  1VQB A;  4HSP A;  1U4L A;  2A68 D;  2RHS B;  1K8G A;  4B3S L;  1I6H H;  1FNW A;  3BDC A;  4Z9C B;  5IWA Q;  2EZV A;  1JJC B;  1Y8P B;  3MHB A;  3GTL H;  5TSS A;  4KY7 A;  4R4C A;  3BVM A;  4R1J A;  5M5X B;  3RR5 A;  3S2H H;  2YV5 A;  2AQ1 B;  1YJW A;  1BKB A;  1J8I A;  3PIO 3;  3QJY A;  1JE4 A;  1MIU A;  3OHX C;  4ID6 A;  5E3F A;  4AIM A;  1BF4 A;  2QDB A;  5BN3 A;  3BZD B;  3DWA A;  3H6M A;  3HOZ H;  1H9R A;  3J81 L;  2WB1 E;  2GVB A;  4PMC A;  1I4Q A;  5IT9 L;  2R7Z G;  1G2T A;  2GVA A;  2L55 A;  1NBW A;  1HA6 A;  5GRO A;  1X3F A;  1JJG A;  2M9V A;  1A62 A;  2NVT H;  4DXF A;  4DR1 Q;  1LO5 D;  5E7N A;  4LF6 L;  3M4O H;  2EYM A;  1ENC A;  4QB4 A;  5C4Z A;  5KEE A;  2HCI A;  1DXM A;  3LWE A;  4DXG A;  4R4Q A;  3K58 A;  4HID A;  3S1M H;  2CWA A;  1PH4 A;  4X3U A;  4I7A A;  1UEB A;  2EY5 A;  4HIM A;  2EY2 A;  3H09 A;  3HKZ G;  1T5X D;  3GTP H;  2NVX B;  3CCE A;  4A3I B;  3VYU A;  1Y1W G;  1XNQ L;  1TXY A;  2A6E D;  2R6G A;  4GOP B;  5C4J B;  2I5L X;  2NVY H;  3A8I E;  3E0J A;  5M9O A;  4A3D H;  3DLL A;  1X65 A;  3CCR A;  1YHQ A;  3MZ5 A;  4B3M L;  4XXE A;  2R7Z H;  1NE3 A;  1I4P A;  2ZTD A;  3K5N A;  3G48 A;  2K33 A;  1WTR A;  4PMW A;  2ATW A;  2N8N A;  4ME5 A;  4IJL A;  1RF2 D;  1QWY A;  3AYH B;  4IJH A;  4CKB A;  2BDN A;  5CBA E;  1PZI D;  1IKM A;  1W6K A;  4N8X 1;  1STN A;  3S2H B;  3OW7 A;  3FRP B;  3QOL A;  3ULL A;  1XPO A;  1KDA A;  2JA8 B;  4A3C G;  1VMP A;  1XPU A;  4IZ8 A;  4QF4 A;  3T16 A;  2XNA C;  3RN5 A;  3L2P A;  1VQK A;  2MO0 A;  2NVQ H;  1K83 H;  3HOZ B;  2BCO A;  1ZYR C;  5T1G A;  2L5T A;  2UUC L;  1C48 A;  2XWB B;  1MBY A;  3K57 A;  4HCS A;  4J6H A;  2K5H A;  5ELE A;  1EY8 A;  4ZLT F;  2HQL A;  3NP8 A;  4JI5 L;  4UPA A;  4BBR G;  3VA7 A;  5LMN L;  3DEP A;  1DGS A;  1KAW A;  2JA8 H;  1D6E C;  5CGK A;  4CHT B;  2PNH A;  2B2T A;  4CJ2 C;  1O78 A;  5IGF A;  5C0X H;  4A3E G;  1STB A;  2NVQ B;  3HKZ B;  3PIP A;  1PTO C;  4K0K L;  3D4R A;  1VQA A;  4H02 A;  4K5X A;  2E2J H;  1CA6 A;  1WCM B;  4P71 A;  2RBM A;  3S9W A;  1HR0 Q;  2UXD L;  3CMA A;  5K36 G;  2BE5 C;  4LNQ A;  2EPB A;  3KF8 B;  1L0W A;  4ZKB B;  4IPD A;  4X6A H;  4JOI C;  5CV4 A;  1EFW A;  1U4R A;  4QGU A;  2C35 B;  1GKH A;  2F0E A;  1SN8 A;  1V1P B;  1RDP D;  2F0U A;  2EYF A;  2K5W A;  5GAG C;  3E0E A;  1B2T A;  1HA5 A;  5C4H A;  1EWI A;  4M1U B;  1TS2 A;  1HUN A;  1WOC A;  5GAH C;  5HGT A;  1OXS C;  1ASY A;  5LMU L;  3CCS A;  1K28 A;  5A2Q L;  3PIO A;  2PYK A;  4KD4 A;  3B6Y A;  2JE6 I;  2FFK B;  3S14 H;  2AUJ D;  4KKS A;  3TS2 A;  4DR6 L;  3A5U A;  1E2V A;  1KRT A;  1I94 Q;  1K83 B;  5IGB A;  3JAM L;  4H7B A;  2IWH A;  3NBH B;  5I6W A;  1LAB A;  5IP9 G;  1Q46 A;  4BBS B;  4ODG A;  3D4W A;  4PNY A;  4DFA A;  4HAE A;  2F0H A;  1I4G A;  4R8N A;  2VB3 X;  3CXC A; 
#chains in the Genus database with same CATH homology
 3F1Z A;  1BBU A;  1SLJ A;  3GD7 A;  2N78 A;  4JI8 Q;  4YCW A;  2KCT A;  5M3M G;  3H3V I;  2WB1 G;  2AHO B;  5LMN W;  4PZ8 A;  1KXL A;  4A3G G;  1I50 H;  1MKH A;  3PO3 H;  4IFD J;  2R92 G;  4A4I A;  4QJF A;  4LFC Q;  3S1Q H;  2B29 A;  4BA1 I;  5JEA J;  4A93 G;  3T1Y Q;  2EQS A;  1SMX A;  3RLN A;  3K7U C;  3S17 H;  4POF A;  4A3F H;  2KEN A;  2VY3 A;  4P72 A;  1I5F A;  3CCQ A;  4DV1 L;  1SFO H;  1PH1 A;  4A3K G;  1VQO A;  5C0X G;  3CC2 A;  4DK6 C;  4BBS H;  2ZJP A;  4A3E H;  3S24 A;  4A76 A;  1X3G A;  4BBR H;  3S1R H;  4UP7 A;  4DV0 L;  4A3I H;  2MQH A;  2RCN A;  3NEM A;  4R4I A;  2JA8 G;  4JI5 Q;  4L5T A;  5IYD G;  4JV5 L;  1EIF A;  1GD7 A;  2F3I A;  1VQH A;  2Q2H A;  2ALY B;  3PGZ A;  4MTN A;  1S40 A;  1VQ7 A;  3M7N A;  1O7I A;  3IRB A;  2VZA A;  2F52 A;  4NPS A;  4DKA C;  1AE3 A;  4A3G H;  1V9P A;  4JOI A;  2R7D A;  1XTD A;  2BH2 A;  1Q1E A;  4YWL A;  3CAM A;  4DV3 Q;  1YIT A;  1NY4 A;  1UE6 A;  3ICE A;  4JG2 A;  2K4K A;  1VQI A;  1CKM A;  1Q1B A;  5FLX c;  4YWM A;  3CD6 A;  1PH2 A;  4IO9 A;  4GOP C;  4LF8 L;  3UDG A;  4FDB A;  2F4V L;  4DUZ Q;  1KL9 A;  1HH2 P;  1K3R A;  1PYB A;  3AQQ A;  4A3L H;  4J15 A;  2KHI A;  3BJU A;  4A3M H;  1LTL A;  2ZJQ A;  1XNR L;  2IY5 B;  1IBL Q;  3FKI G;  1OXT A;  2A1A A;  4BXX H;  4A3I G;  1PH8 A;  5IP7 H;  1CSP A;  2Q2I A;  1Y14 B;  4DR7 Q;  4OWX B;  4KHP Q;  3GDE A;  2FXQ A;  3HKS A;  2JA6 G;  4YHH L;  1Q12 A;  3S2D H;  2MNA A;  3PUZ A;  1B7Y B;  1CKO A;  1U0L A;  4GNX A;  1PH5 A;  1C9O A;  3U4V A;  1JMC A;  4OWW B;  3CCL A;  3GO5 A;  1IXR A;  2V1C C;  1HNW Q;  1G51 A;  4NXM Q;  4DR1 L;  4UP8 A;  2R93 G;  5ELO A;  2UUB Q;  3U58 A;  3HOX H;  3J81 j;  4P73 A;  1X9N A;  2Z0S A;  4LW1 A;  3BZK A;  3G4S A;  1OXU A;  2HIV A;  2JA7 G;  2UXC L;  1HR0 W;  5FLM G;  4O0A A;  4LF5 L;  3BZC A;  1HZB A;  4DNI A;  1X6O A;  3TRE A;  3HOZ G;  3CC4 A;  2MO1 A;  4YY3 Q;  3EIV A;  2E5L L;  1GM5 A;  4JI0 L;  3I55 A;  1VQJ A;  1PH3 A;  2CQO A;  3W5O A;  4A3J H;  4LF7 Q;  1X55 A;  4RG1 A;  1IBM L;  3FP9 A;  2OWO A;  4WJ3 M;  4NXN L;  1L1O C;  1YI2 A;  4LFA L;  3I4M G;  4DR7 L;  4PZ6 A;  1I94 L;  1FGU A;  3UE0 A;  4GLA C;  3RZO H;  1E3P A;  3FHW A;  1HZC A;  5GAE C;  1TWF H;  2HIX A;  4DV7 Q;  1N34 L;  2XTI A;  1HR0 L;  1VQ5 A;  1QUQ B;  4JI3 Q;  4JI4 Q;  3GTQ H;  1MJC A;  4ME3 A;  3TRZ A;  1L2F A;  2VS1 A;  2DGY A;  1BBW A;  3J80 c;  4JYA L;  2IX0 A;  3E9I A;  3W1B A;  1VCI A;  2YYZ A;  4AQY L;  1YJ9 A;  1K8A C;  4R4O A;  2D62 A;  2CKZ B;  4K0K Q;  2AMC B;  3U4Z A;  3F2B A;  3S16 H;  1VQ9 A;  1JJ2 A;  1L1O B;  2JK8 A;  1A8V A;  1Q86 C;  2PI2 A;  4DV4 L;  3AEV A;  3HOW H;  2VQE Q;  2Q2T A;  3GTO H;  3JAM c;  2UUC Q;  1N36 L;  5C44 H;  4DK3 C;  4IFD G;  1WCM G;  4HJ9 A;  1WYD A;  2E2H H;  5HGQ A;  3STB C;  2BA1 A;  3MEF A;  1HJP A;  4IFD I;  5JJL A;  1YVC A;  3I4O A;  2LXK A;  1Y1V G;  1NMF A;  5H1S E;  2VQE L;  1XMQ Q;  1W2B A;  4AYB E;  2IHF A;  2A19 A;  4HIO A;  1HNZ L;  1V1Q A;  2Q2U A;  4JI2 L;  2UXC Q;  1XMO L;  4C3J H;  4LUV A;  1HNX L;  2JQO A;  3CQZ H;  1ASZ A;  2YU9 H;  4UP9 A;  3RLO A;  4DPG A;  5IYD H;  4DV5 L;  3T1H Q;  3PCO B;  3HKZ E;  3TQY A;  1AH9 A;  3DM3 A;  1TWC H;  2R7F A;  1PH6 A;  5HY6 A;  3CCJ A;  3CCM A;  4HIK A;  4BY1 H;  4X65 Q;  3GTK H;  4DV4 Q;  4JYA Q;  2K5N A;  1S3O A;  3K81 C;  4A75 A;  4JI2 Q;  1HNZ Q;  2PQA B;  1CKN B;  1VQL A;  3PO3 G;  1PV4 A;  4KHP L;  1P16 A;  4A3F G;  4QQB X;  4EQ5 A;  2VUM G;  4ALP A;  5JJK A;  3UE1 A;  4X66 L;  4GNX C;  2QGQ A;  2K52 A;  5FJ8 H;  3KF6 A;  4YWK A;  1SR3 A;  4HJ5 A;  4B3R L;  5IP7 G;  2E8G A;  4GLV B;  4X64 Q;  3TS0 A;  1QVF A;  3HOU G;  3RN2 A;  4GN3 B;  2ZJR A;  4DV6 L;  2HHH Q;  4DUZ L;  2LXJ A;  4A3M G;  5IP9 H;  4X62 Q;  1QZG A;  3HFZ B;  4TQU S;  2XGT A;  4OON A;  3VDY A;  4LFB L;  4GKK L;  1N33 Q;  5C44 G;  3J81 i;  3CCU A;  2A8V A;  3PO2 H;  2RF4 A;  4AH6 A;  2YTV A;  4DV0 Q;  3CP0 A;  1G29 1;  1VQP A;  2ZM6 L;  4GOP A;  1SE8 A;  1JE5 A;  3F2D A;  2Y0S G;  1VQG A;  1Q81 C;  3AFP A;  3KJP A;  2OQK A;  1GO3 E;  1RL2 A;  1VQ8 A;  1S72 A;  4BY1 G;  3ZJY C;  4GKJ Q;  3KOJ A;  5M5Y H;  2R92 H;  1HZ9 A;  3HOY H;  4JI0 Q;  4A93 H;  1WFQ A;  1C0A A;  1PVO A;  2BA0 A;  2DUD A;  5M3M H;  3GTG H;  2WAQ E;  5J3B A;  1D7Q A;  1CUK A;  3M9B A;  3A0J A;  3KDF B;  1PHJ A;  1N32 Q;  4B3S Q;  2D0P A;  3FKI H;  4YHH Q;  5LMN Q;  3KYH C;  2EXD A;  2IT1 A;  1XJV A;  3JAM i;  2LSS A;  2ID0 A;  1EUJ A;  2EIF A;  3STB D;  3PF5 A;  4BA2 I;  5JJI A;  2AWN A;  4LFC L;  3K7A H;  3I4N G;  4A3C H;  4OO1 I;  3E9H A;  1PYS B;  3I7F A;  5BR8 L;  1YHA A;  4DV6 Q;  2HHH L;  1X54 A;  2VNU D;  1T9H A;  4IPG A;  4XIG S;  3CF5 A;  4YCV A;  2K50 A;  1VQF A;  3AFQ A;  3PUW A;  3W1G A;  3NEL A;  1Q7Y C;  3A74 A;  1X3E A;  1VQ6 A;  1HZA A;  3HOV H;  4IPH A;  4GNX B;  4DR6 Q;  2ZM6 Q;  1E7Z A;  2JEA I;  4X64 L;  1NTG A;  1PFS A;  1YZ6 A;  3PV0 A;  4JBW A;  5ELN A;  5C3E G;  4JBK A;  3H3V H;  3OYY A;  4A3D G;  1N36 Q;  2PMZ E;  3OW2 A;  3NEN A;  5GQO A;  2ES2 A;  3HOX G;  3CC7 A;  1VQN A;  2NVX H;  4DV5 Q;  4AYB G;  3T1H L;  2VQF Q;  4LF9 L;  2Y0S E;  3KLW A;  1Y1V H;  2KBN A;  1CSQ A;  2I5H A;  1Y1W H;  5BR8 Q;  1KC8 C;  4XTC S;  1RIP A;  3I4M H;  4A3B G;  3KJO A;  4C3I H;  1YNX A;  5C0X I;  1YJN A;  2E5L Q;  3KFU A;  4PZ7 A;  2JJQ A;  4A3L G;  3L7Z C;  1IYJ B;  1FJG Q;  4BXX G;  3M4Q A;  4JBJ A;  3ERS X;  3I4N H;  2YTY A;  4DV3 L;  3J80 i;  2Z6K C;  2UXB L;  4B3T Q;  4IPC A;  3D0F A;  2UUA L;  4L5S A;  4LWC A;  3S1N H;  2UUB L;  3J7Z C;  3SGI A;  4P75 A;  3UDX A;  1VQB A;  1QZH A;  1BVS A;  2UXD Q;  2RHS B;  1K8G A;  4B3S L;  1GVP A;  3CME A;  1I6H H;  4JV5 Q;  5IWA Q;  3JC6 6;  1JJC B;  2VQF L;  2I5M X;  4O2D A;  2OCE A;  3GTL H;  3PSI A;  3K0X A;  4R4C A;  3M85 A;  1V43 A;  5AJ3 L;  1IL2 A;  1TWG H;  1W3S A;  4R1J A;  2CCZ A;  3RR5 A;  3S2H H;  1E22 A;  2AKW B;  2PI2 E;  2IHE A;  2VL6 A;  4TVA B;  3J81 c;  3ULP A;  2YV5 A;  3CPF A;  3EN2 A;  1PH9 A;  1M1K C;  3HOV G;  4LF6 Q;  1A63 A;  1YJW A;  1BKB A;  3PO2 G;  4JI6 Q;  3D31 A;  3U50 C;  4GKK Q;  1SRU A;  1VQM A;  1EIY B;  1MIU A;  1YEZ A;  2E2I H;  3WWV A;  2QA4 A;  4LF4 L;  4LF8 Q;  2F4V Q;  2AWO A;  3H0G H;  4AIM A;  4B3T L;  4P74 A;  4HJ7 A;  3G6E A;  4GN4 B;  3HOZ H;  3J7A 5;  3UDF A;  1LUZ A;  5JEA G;  1EQQ A;  2WB1 E;  2GVB A;  4OX9 Q;  4A3B H;  1OXX K;  1E1T A;  4OO1 G;  4LUZ A;  3CXC A;  2OTJ A;  3UDI A;  1I3Q H;  2R7Z G;  1WI5 A;  1X56 A;  2GVA A;  5IWA L;  4NXN Q;  4DR4 L;  4DV2 Q;  2VUM H;  2RHQ B;  1EOV A;  1NBW A;  1KIX A;  5C4J H;  1QVC A;  5GRO A;  1X3F A;  1LM0 A;  4EX5 A;  2BH8 A;  1A62 A;  2NZO A;  2NVT H;  5C4X G;  4POG A;  1JJG A;  5M5X H;  3ULJ A;  4DR1 Q;  2JA6 H;  1JB7 A;  2VW9 A;  5E7N A;  1XPR A;  4LF6 L;  3M4O H;  4QL5 A;  2JA9 A;  4HID A;  4R4Q A;  4JI4 L;  3S1M H;  3T1Y L;  2CWA A;  3KF6 B;  1JT8 A;  1PH4 A;  2OTL A;  1K0R A;  1UEB A;  4OWT B;  4YCU A;  4DV1 Q;  4HIM A;  1VQ4 A;  5DLQ E;  3HKZ G;  3GTP H;  4LF7 L;  1MJE A;  3OTO Q;  1UE5 A;  4LF9 Q;  3CCE A;  1PH7 A;  2KCM A;  1FVI A;  1WCM H;  2KHJ A;  1Y1W G;  1TXY A;  4A3J G;  2JA5 G;  3G71 A;  1XNQ L;  2R6G A;  2K14 A;  4GOP B;  4LFB Q;  2I5L X;  2NVY H;  5IE8 A;  1EQR A;  4GLX A;  1U5K A;  3GTJ H;  1FJG L;  1YHB A;  5C3E H;  2B63 H;  1PA6 A;  3K8A A;  4HJA A;  4DV7 L;  1N34 Q;  2I0Q A;  4A3D H;  3HOY G;  1P8L A;  1X65 A;  1UE1 A;  4KI0 A;  3DLL A;  3CCR A;  4AQY Q;  1YHQ A;  5IYC H;  1L1O A;  1QVG A;  1IBK Q;  4DUY L;  1J5E Q;  4B3M L;  2Z6K A;  3PUX A;  2R7Z H;  1NE3 A;  4GKJ L;  2ZTD A;  1IBM Q;  3G48 A;  3PUY A;  2MFI A;  2WP8 J;  4JI7 L;  3KDF A;  4GS3 A;  4PMW A;  4X65 L;  1R9T H;  2ATW A;  1IBL L;  4APV A;  1J6Q A;  2N8N A;  3M3Y H;  3CPW A;  4IJL A;  2B3G A;  2K5V A;  2K75 A;  1EYG A;  3AYH B;  3PUV A;  4IJH A;  3F8T A;  4LF5 Q;  4NB3 A;  3I56 A;  4JI8 L;  1KRS A;  1QUQ A;  1VS0 A;  1OTC A;  3ULL A;  1XPO A;  1AE2 A;  4JCV E;  4LUO A;  4MZ9 A;  5FLM H;  4A3C G;  4JI6 L;  4DR3 Q;  2GN5 A;  3HOU H;  1XPU A;  4C2M H;  1M90 C;  1NJI C;  4BY7 H;  4BBS G;  4KLK A;  4OXP A;  3TEH B;  4JI1 L;  3MXN B;  3RN5 A;  5C0X J;  3L2P A;  1E24 A;  4DUY Q;  1J5E L;  2MO0 A;  1XMQ L;  1VQK A;  4B3M Q;  2NVQ H;  1K83 H;  1VQE A;  5IYB H;  2UUC L;  4NXM L;  4LFA Q;  1KHI A;  1CKN A;  4QIW E;  1XNR Q;  1H95 A;  2OQ0 A;  4C3H H;  1VQD A;  3OTO L;  1Z9F A;  4L5Q A;  2JA5 H;  4UY8 C;  4DV2 L;  1D8L A;  2K5H A;  1Q82 C;  4KHZ A;  3PF4 A;  2UU9 L;  1G6P A;  5IT9 c;  2HQL A;  1KQS A;  4JI5 L;  4QY7 A;  2L15 A;  4UPA A;  4DR2 Q;  1IZ6 A;  4BBR G;  5LMN L;  1XMO Q;  1DGS A;  1KAW A;  4DAY B;  2JA8 H;  4A3K H;  4HJ8 A;  4JC0 A;  2PNH A;  4DAM A;  5IY0 A;  1N8R C;  2JEB I;  2CWP A;  3BU2 A;  1IBK L;  4IOC A;  4DR5 Q;  3CCV A;  1OXV A;  4A3E G;  5FJ8 G;  3PIP A;  4K0K L;  1HNW L;  2H5X A;  1VQA A;  4DR3 L;  4H02 A;  2E2J H;  1KD1 C;  1FL0 A;  3HOW G;  1UE7 A;  4LF4 Q;  2PQA A;  4YY3 L;  2HT1 A;  1XNQ Q;  1B8A A;  5IYB G;  2ASB A;  4P71 A;  1HNX Q;  2R93 H;  3S15 H;  1N33 L;  2D0O A;  1HR0 Q;  2UXD L;  3CMA A;  1YIJ A;  4LNQ A;  5K36 G;  3RNU A;  4PG3 A;  1UWV A;  3KF8 B;  1L0W A;  3L0O A;  1WJJ A;  4WJ4 A;  1SRO A;  3H0G G;  4IPD A;  4X6A H;  1NMG A;  4JOI C;  1B70 B;  3LGJ A;  4JI1 Q;  2YTX A;  5M3F H;  1EFW A;  4DR5 L;  1LYL A;  4DR2 L;  1K73 C;  3CW2 C;  2ZTC A;  2C35 B;  3M4P A;  4QGU A;  1GKH A;  5LMU Q;  4L5R C;  1SN8 A;  4IOA A;  2N3S A;  5GAG C;  2IX1 A;  3E0E A;  3A5Z B;  1Q8K A;  5C4X H;  1EWI A;  1VQC A;  1K9M C;  1WOC A;  5GAH C;  2ZTE A;  2WFW A;  2UU9 Q;  1OXS C;  3F2C A;  2B63 G;  1ASY A;  3ER0 A;  5LMU L;  4RMF A;  3CCS A;  1C7Y A;  3EBE A;  4BY7 G;  5IYC G;  3PIO A;  4OX9 L;  1Z47 A;  2JA7 H;  3GTM H;  2UXB Q;  1N32 L;  4GN5 A;  3B6Y A;  1YBY A;  2JE6 I;  3S14 H;  2QEX A;  3I2Z A;  5EAY A;  4DR4 Q;  4MNO A;  3TS2 A;  4DR6 L;  4Y7N H;  3Q8D A;  3A5U A;  2UUA Q;  2WAQ G;  4X66 Q;  1KRT A;  1TWH H;  3K80 C;  1I94 Q;  2NN6 I;  2NN6 G;  4JI7 Q;  3H15 A;  2N49 A;  5GAD C;  3NBH B;  5IP9 G;  1Q46 A;  2NZH A;  1N9W A;  4R4T A;  4JI3 L;  2CFM A;  4JBM A;  1A0I A;  4B3R Q;  1E1O A;  5AJ3 Q;  5M3F G;  4Y52 H;  3RZD H;  5M5W H;  4X62 L;  1TWA H;  3RLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...