2F4VQ

30s ribosome + designer antibiotic
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
104
structure length
104
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2f4vQ00
4GOPC 2B63H 5DLQE 2I5MX 1VQIA 4FDBA 4R4OA 3K7AH 3ULLA 3HOVG 4B3RQ 1TWCH 4DV7Q 4DR2Q 1CKOA 4A3FH 1YEZA 3J7A5 3KJPA 1K8AC 3HOZG 3T1YQ 2JA6H 4JI1L 3VDYA 1IBKL 1WI5A 4IJLA 2UXBQ 1AE2A 4JBWA 1FJGL 3TS0A 4JI8Q 2DUDA 1XMQL 2JJQA 4DV5L 3OTOQ 4DV6L 1LYLA 4NXML 5IY0A 1WFQA 5C4XH 1SR3A 1S40A 5K36G 4A3CG 1X6OA 3PO3G 1MJEA 4OWTB 3S16H 4X64Q 1S72A 2B3GA 3U4ZA 2ZM6Q 4HJ8A 3K7UC 4MZ9A 3RZDH 3GD7A 3ER0A 4RMFA 1EQRA 4A3JG 5EAYA 4DR7Q 2ZJPA 4GKJL 2K75A 4PZ8A 5GQOA 5GAGC 1X54A 3HOWG 1EFWA 1MKHA 3KF6B 3LGJA 1UEBA 1Z47A 1N32L 3A5UA 1EUJA 4JI0L 3S15H 4NXNQ 1N33Q 1WOCA 1IZ6A 1NMGA 3K8AA 5ELNA 4DV0Q 4BXXG 3J81i 3EN2A 2N78A 4UPAA 3J80i 4EX5A 3KFUA 2R93G 1EQQA 1N36Q 2F4VL 4HJ5A 3HOVH 1E3PA 4OXPA 2HT1A 1Y14B 1X3EA 5M3MG 2HHHL 4HIKA 3ICEA 5JJKA 1QUQA 4QGUA 2IHFA 2UUAQ 2YTXA 4LF8Q 4R4IA 3HOZH 4DR6Q 4C3IH 2WAQE 1B7YB 1I3QH 4DUYQ 3HKSA 1W3SA 2JA5G 4JI6L 1JJGA 1Q1BA 3HOUG 2R7ZH 1E1TA 2YTVA 3PO3H 5C44G 2ZTCA 1KRTA 3I4MH 4GLXA 2Z6KC 4DKAC 4R1JA 3ZJYC 4B3TQ 4JI2Q 2MNAA 1E24A 4A3JH 3ULJA 2UXCL 2QGQA 3TEHB 2VY3A 2ZTDA 3EIVA 2MFIA 1UWVA 4QL5A 5C0XJ 1ASZA 3A74A 4PMWA 1X56A 1K83H 4BBSH 4HJAA 1YHAA 1QUQB 2Q2HA 4IFDJ 2RCNA 2Q2UA 1D8LA 4LF9L 1Q46A 2N8NA 5IT9c 3PUXA 3PUZA 3W5OA 2VQFQ 1PH5A 3GDEA 1K3RA 1HZ9A 1K0RA 1HR0L 1KIXA 3S17H 4IFDI 2NVQH 2WB1G 3AFQA 2UUBQ 4A3LH 3HFZB 3KDFA 5LMUQ 2OQKA 1CUKA 4DR1Q 3HOXG 3MXNB 2VQEQ 1YI2A 3M7NA 3STBC 3G4SA 4A3MG 1XPOA 1J6QA 3I55A 1OXTA 1QZGA 1B70B 2PI2E 2PNHA 3WWVA 5IYBG 1QVGA 4MNOA 3KYHC 4LW1A 1PYBA 5AJ3L 3PSIA 4A75A 4DUZL 3E9HA 3TREA 1G6PA 4AQYL 2C35B 4HIDA 3H0GG 2JA7G 2CKZB 2R93H 4JV5Q 4KLKA 1V43A 2YV5A 4DPGA 3Q8DA 4C3JH 5C44H 4LFAQ 3CCJA 1A62A 4LF5L 1OXXK 3GO5A 5JJLA 1YVCA 4QJFA 1NBWA 2Q2TA 4UY8C 2BA1A 2R7FA 3NBHB 2JA8H 3HOYH 3S1QH 1VQ4A 2PI2A 2CWPA 3KDFB 4JC0A 5ELOA 1N34L 5C3EG 4DAYB 1LUZA 2HQLA 1GVPA 4DV2L 5E7NA 1HNZL 1O7IA 1UE1A 4JBJA 1I94Q 3KF8B 3GTPH 3CAMA 1R9TH 4HJ9A 4L5TA 4BY7G 1PH2A 5C4JH 2E5LQ 4IOCA 2VL6A 1G291 1YIJA 3G71A 2VS1A 3D31A 2BH2A 2VUMG 1X3GA 2F52A 3CCSA 1FL0A 1WCMH 3FKIH 3S1MH 3H15A 4LF4Q 1BKBA 3HOXH 1YJ9A 1P16A 4AYBG 2A8VA 4P73A 4C2MH 4IPCA 1Y1WH 2UU9Q 5FLMG 2FXQA 3FHWA 1GM5A 1YJNA 1I50H 3I7FA 2IX0A 3PF5A 4LUVA 2AKWB 3RLNA 1YJWA 2UXDL 1PYSB 4GNXB 4GNXC 1KQSA 2JA7H 4ALPA 4K0KL 4X66L 4P71A 1XNRL 1A63A 1PH4A 5IP9G 3I56A 1EOVA 2IT1A 4OONA 3J81j 1IBML 3H3VH 3T1HL 2K50A 4EQ5A 4JI5Q 4JI3L 2GVBA 4A3BG 1TXYA 1K9MC 4ME3A 1Z9FA 4JOIA 1NY4A 1SLJA 3F2BA 2E2JH 1AE3A 2KHIA 2WB1E 4H02A 4BY1H 5IYDG 2RHSB 3F1ZA 4JI4Q 4B3RL 4B3MQ 4IPHA 4DV7L 5BR8Q 4DR2L 1JT8A 2BH8A 1HZBA 4DV4Q 2ZJRA 1VQCA 1JMCA 1VQHA 2JK8A 3T1YL 2UXBL 1U5KA 4WJ3M 4RG1A 1VQ9A 4A3KG 3A0JA 4JI8L 3L7ZC 5LMNW 4P74A 5FLMH 4QQBX 2GN5A 3SGIA 1CKNA 3OTOL 5LMNQ 1M1KC 4GKKQ 4LFBQ 4A3GG 1WYDA 2JE6I 4YY3Q 2JA9A 3A5ZB 4X62Q 5M3FH 1J5EQ 5JEAG 2ES2A 1NJIC 3BZCA 4A4IA 4BBRG 1EIFA 4JCVE 4X64L 1VQBA 4LNQA 4IPDA 2ZM6L 5IP7G 3M4PA 1XMOQ 3GTJH 2ALYB 3PV0A 4AH6A 5IP9H 2NN6G 2VW9A 4DR7L 4DR5L 4YWKA 2JEAI 1VQ6A 1MIUA 4A3IG 1W2BA 4KHPQ 3PUWA 2MO1A 3RZOH 3CCEA 4YWMA 4APVA 1Q81C 5GROA 2R92G 4LWCA 4NXNL 4X65Q 1N33L 4A3BH 2YYZA 5IYCG 4DV0L 1VQPA 4A3CH 4O0AA 4DV3Q 2KHJA 2Z0SA 2OTJA 2ID0A 4DK6C 3S2DH 2AHOB 3CQZH 5M5XH 2K4KA 1N36L 1HH2P 1VQ5A 4AYBE 4YCUA 3OYYA 2AMCB 1X65A 2NVYH 4A3DG 3G48A 4YHHQ 1PH3A 1ASYA 2UUAL 2ASBA 4LF8L 1NTGA 4A3EG 3HOWH 4OO1G 4LUZA 4DR6L 1VQKA 4LFCQ 4DUYL 1U0LA 4P72A 3RN2A 4POFA 3PIPA 4L5SA 1PH6A 4DV1Q 2KCTA 4POGA 1PHJA 2NVTH 4BXXH 1GO3E 1FVIA 4JG2A 3I2ZA 1N8RC 3GTLH 4MTNA 4BBRH 2Y0SG 1QVFA 3GTKH 1SFOH 1XNQQ 3BZKA 3H3VI 1XPRA 2QEXA 2H5XA 3UE1A 5M3MH 4B3TL 1VQMA 2D62A 4JI2L 3KOJA 1DGSA 3JAMc 4DR4Q 2GVAA 1HNWQ 4OX9Q 2KENA 1Q8KA 2UUCQ 2R7DA 3S2HH 4GLAC 3UDFA 2KBNA 1GKHA 2JA5H 3UDIA 2R92H 3HOUH 1VQFA 5HGQA 3F2DA 5IWAQ 2K52A 4DR3Q 1KC8C 2VQFL 2V1CC 3D0FA 1VQEA 1PH8A 1B8AA 4R4QA 3DM3A 2EIFA 2F3IA 1VS0A 5M5YH 2UUBL 3S14H 5LMUL 4DR1L 4JBMA 2PQAA 2VQEL 1XJVA 3I4NG 1BVSA 3CCUA 4UP7A 1TWHH 3PIOA 4LF6Q 2NZOA 4A3EH 2VNUD 3CCRA 2YTYA 4BBSG 3MEFA 3CCVA 3I4OA 1A8VA 3NELA 1YHBA 2E2HH 3M3YH 5JJIA 3S1NH 3UDGA 5C0XG 1EIYB 2B63G 1G51A 1L0WA 3J7ZC 2RF4A 4JV5L 1A0IA 1SN8A 1YZ6A 3G6EA 4BA1I 2EQSA 4LFAL 1HNXQ 3STBD 2MQHA 4JI7Q 3U50C 2JA6G 3K80C 3CPWA 4B3SQ 1RIPA 4A3MH 4HJ7A 4JYAQ 3DLLA 1N9WA 3CPFA 1E1OA 1KD1C 4TQUS 5IYBH 1IBLQ 4L5RC 2EXDA 3PO2G 4LUOA 1X3FA 1C0AA 3K0XA 3KJOA 4A93G 4X6AH 4AIMA 1I94L 4TVAB 4LF7L 2N49A 4GLVB 2XTIA 3H0GH 1LTLA 3E9IA 3W1BA 3CCMA 1FGUA 1VCIA 2E5LL 1Q86C 4IPGA 2LXKA 4XTCS 3NEMA 1T9HA 4PG3A 3RR5A 4Y7NH 3FP9A 4JI1Q 1IBKQ 1Q12A 4LF4L 1FJGQ 4YCWA 1GD7A 1M90C 1XMQQ 4DV5Q 3UDXA 4DV6Q 5C3EH 2NVXH 2UU9L 4NXMQ 3TS2A 4IOAA 4QIWE 1K73C 1MJCA 1V9PA 3AEVA 1VQ8A 3K81C 4C3HH 4PZ6A 1QZHA 1VQJA 1EYGA 4L5QA 4P75A 2Y0SE 3GTGH 4GOPB 3M4OH 4BY7H 3BU2A 2VUMH 2OCEA 2NN6I 1KL9A 4R4CA 3PGZA 4GKJQ 1KXLA 1PFSA 2D0OA 5IE8A 3KF6A 5GAEC 4YWLA 3S24A 4UP8A 3NENA 2CCZA 2E2IH 1N32Q 4KI0A 3EBEA 1VQAA 4JI0Q 1YBYA 1JJCB 2CQOA 4JI5L 2JQOA 3PO2H 1X55A 5HY6A 4HIMA 1Q82C 3AFPA 3CMEA 2R7ZG 4A93H 4GN4B 1H95A 5M5WH 4JOIC 2B29A 1K8GA 3CC4A 2I5HA 3I4MG 1CSQA 1BBWA 2F4VQ 3HKZG 4O2DA 1PH7A 1EWIA 4JI4L 2ZJQA 2HHHQ 1Q1EA 4B3ML 5BR8L 3CCQA 2ATWA 4DR5Q 4OO1I 4DV4L 1WJJA 1S3OA 2Q2IA 3RLFA 3U58A 2OWOA 1VQDA 2WP8J 3PUVA 1PH1A 1AH9A 2A19A 4JI6Q 2K14A 1XPUA 1VQ7A 5H1SE 3BJUA 5LMNL 3CP0A 3L0OA 4GKKL 4LFBL 3JC66 1CKNB 4YY3L 4X62L 4PZ7A 4HIOA 1SMXA 1J5EL 2Z6KA 3RN5A 3CF5A 1QVCA 5IYDH 1YNXA 2OQ0A 4JBKA 4UP9A 4A3LG 3J81c 1IL2A 4OWWB 1UE7A 4OWXB 3J80c 1XMOL 2UXCQ 4QY7A 4J15A 1L2FA 1BBUA 2QA4A 3RNUA 2MO0A 1IYJB 4A3KH 1I6HH 4KHPL 1TWAH 1HZAA 2I5LX 3UE0A 1Y1VG 4LF9Q 3PCOB 2AWOA 1JJ2A 1HR0W 4X65L 3TRZA 4A3GH 1TWGH 1HR0Q 2HIXA 4DV3L 1VQLA 1X9NA 3JAMi 2JEBI 5IP7H 2IX1A 2JA8G 3HOYG 2RHQB 3ULPA 2R6GA 4NB3A 1Q7YC 1PH9A 1VQNA 2WFWA 3GTOH 3PUYA 2CWAA 4YHHL 2VZAA 3M85A 1HJPA 2BA0A 5AJ3Q 4A3IH 1SE8A 1PVOA 3IRBA 5C0XI 4LFCL 4DUZQ 4AQYQ 1JE5A 3W1GA 5FJ8G 1OXVA 2CFMA 3CW2C 5IYCH 5FLXc 2E8GA 1E7ZA 4DV1L 3CD6A 1RL2A 3GTMH 3CCLA 2D0PA 4DNIA 1WCMG 1OXSC 3CMAA 3FKIG 4LF5Q 1NE3A 1NMFA 2LXJA 1XNQL 2LSSA 1VQOA 4BA2I 3GTQH 1N34Q 1KAWA 3PF4A 4XIGS 4A3DH 4GN3B 1Y1WG 4GS3A 4DAMA 4DV2Q 4DR4L 1HZCA 4WJ4A 3L2PA 4A76A 1HNZQ 4Y52H 1HNWL 1KRSA 1KHIA 3F8TA 1C9OA 4OX9L 2IHEA 2UUCL 3OW2A 1YITA 2PMZE 4YCVA 1Y1VH 3HKZE 1CSPA 3S1RH 3CC2A 5IWAL 5GAHC 4DR3L 2XGTA 3AQQA 4IJHA 1LM0A 3TQYA 1UE5A 4A3FG 4IFDG 1VQGA 1C7YA 2L15A 3M4QA 1I5FA 1OXUA 4GN5A 5J3BA 2OTLA 4R4TA 2PQAB 1YHQA 1L1OA 2AWNA 5C4XG 4GOPA 4LF6L 2K5HA 2K5VA 3ERSX 2ZTEA 1CKMA 2WAQG 2IY5B 2UXDQ 4GNXA 4LF7Q 1D7QA 1XTDA 1V1QA 3KLWA 4BY1G 1SROA 5FJ8H 1E22A 4K0KQ 2N3SA 3RLOA 4X66Q 1XNRQ 3CXCA 1JB7A 3E0EA 3CC7A 2HIVA 4KHZA 4DK3C 1PV4A 1HNXL 1P8LA 2I0QA 4JI7L 2A1AA 2NZHA 3I4NH 1IBMQ 1OTCA 4B3SL 5JEAJ 3T1HQ 4IO9A 2DGYA 4JYAL 4JI3Q 2KCMA 1TWFH 1UE6A 1SRUA 2K5NA 4NPSA 3U4VA 3F2CA 1PA6A 1IXRA 1IBLL 2YU9H 3B6YA 1L1OB 3M9BA 1L1OC 5GADC 5M3FG 3AYHB
chains in the Genus database with same CATH superfamily
3MC0B 4KY5A 5DLQE 2I5MX 4QF4A 4R4OA 3HOVG 1SNQA 1TWCH 4DR2Q 4A3FH 1K8AC 1NR2A 4A3IB 1IBKL 3S2HB 1EIGA 3TS0A 2DJFC 4DV6L 2JSOA 1SR3A 1S40A 1B1ZA 4M1UB 4OWTB 3S16H 4X64Q 3OMCA 4L6TB 4B08A 1SJHD 3ER0A 1EQRA 4A3JG 1TWHB 2WIIB 1ILQA 3A7LA 2ZJPA 4GKJL 4HSPA 3MA2B 3HOWG 3M3YB 1MKHA 3KF6B 3LGJA 3S1NB 1OO9B 4HMJA 4G7HC 2O5JC 1QNKA 1WOCA 1NMGA 1TVXA 3H09A 5ELNA 3J81i 1Y8PB 2TMPA 3BDOA 3EN2A 4EX5A 4IN3A 1SE4A 4HJ5A 4OXPA 2HT1A 1SYDA 1X3EA 5JJKA 1QUQA 2B8FA 1QE6A 3HOZH 4LF8Q 3MFYA 1QG7A 4C3IH 2WAQE 1B7YB 3OOCA 1HA6A 1I3QH 1JJGA 2KJXA 4EQPA 4DF7A 2EJFC 1HUNA 2DN8A 1H9JA 3PO3H 1KRTA 3I4MH 1EZ8A 2XNAC 2Z6KC 3MEHA 4R1JA 3UI2A 5I9PA 4B3TQ 2NVXB 2DY7A 2QGQA 5C5MA 1VQ8A 2K03A 1UWVA 4C3HB 4PMWA 1X56A 4WFN3 1QUQB 1T5XD 4LF9L 5AFWA 2N8NA 1PH5A 3PUXA 3GDEA 4IFDI 1HZ9A 3PIP3 1KIXA 3NBHA 2JA6B 1TIID 3I3CA 2NVQH 1H9SA 4RAUC 2R93H 1SE3A 3HFZB 3NTKA 1YI2A 2OQKA 1CUKA 2X6GA 3SDZA 3MXNB 2VQEQ 4FF2A 3PO2B 1XPOA 1OXTA 4KN7C 3DMUA 2L5TA 2PNHA 1QVGA 4CJ2C 2IX3A 2XVSA 1PYBA 4DUZL 3E9HA 1G6PA 4PQXA 3NWTA 1V43A 2F0EA 4KLKA 4DPGA 2K5QA 4C3JH 5C44H 1A62A 1O7YA 1ICWA 1HTLD 1NBWA 3N52A 5IOCA 3LWUA 1H9RA 2OEOA 3NBHB 3KBXA 3K57A 5J39A 1DD2A 5C3EG 2HQLA 1GVPA 1VMCA 5E7NA 5FK9C 2F0JA 4C3HG 3MVVA 1ILPA 4FYDA 4HJ9A 1PH2A 1S5FD 4IOCA 3BYYB 1YIJA 4NDXA 2VS1A 2BH2A 1KNEA 4IQZA 1SNCA 1XXGA 3H15A 1JOOA 2K6AA 2N55A 1DOMA 4S3SA 2F0PA 1DOLA 3R8BA 2F0IA 3U9SA 1EY4A 4P73A 4A3GB 1TWGB 5FLMG 1GM5A 1YJNA 3I7FA 1GUSA 3PF5A 3RLNA 1YJWA 3AMUA 1A63A 2KA7A 3P20A 1PFNA 4HTHA 1EOTA 2HQEA 4IZ8A 1IL8A 1TS3A 2PQEA 4JI5Q 1Q90A 1TS4A 1K9MC 4ME3A 1ET9A 3F2BA 1B3AA 2WB1E 2F0FA 4JI4Q 1B9MA 2QILA 5BR8Q 1JT8A 4ZKCB 2BH8A 2O4XA 5IIFA 1VQCA 1VQHA 2JK8A 3T1YL 1U5KA 1JWMD 1EU3A 4WJ3M 2K28A 3HS0C 1HPCA 1LV9A 3L7ZC 2IJ0A 1B2TA 4P74A 3OWFA 2WV6D 3SGIA 3OTOL 4QQBX 5DNFA 4A3GG 4YY3Q 4XDXA 3FEWX 3BZCA 3S1QB 4H44C 4NP5A 5IP7G 2C5CA 2ALYB 2NN6G 1IYUA 1VQ6A 4KJOA 1LTAD 2JEAI 5FO7B 1BCPD 3GTPB 3TP5A 2F0UA 2MO1A 1Q3LA 3CCEA 2F0OA 3GV6A 2R92G 1N33L 5IYCG 3J80E 1VQPA 2RQXA 2PZWA 2ID0A 4RWSC 2P5ZX 3S2DH 3CQZH 3TZDA 1EIHA 4KMUC 3OYYA 2AMCB 1X32A 2MP1A 2YU9B 4YHHQ 1XTCD 4DR6L 1DXMA 4DUYL 5JOBA 2J0TD 4P72A 4L5SA 1TWCB 1BO0A 1JB3A 3A8KE 4MIUA 4BWGB 4CKBA 4A3FB 2EY1A 1GO3E 4JVZA 2OF1A 4EQOA 1NSNS 1QVFA 1RCVD 4DAVA 1SFOH 1EWHA 3H3VI 5M3MH 1BBXC 4JI2L 1DGSA 3JAMc 1V1OA 5FLXE 4OX9Q 2KENA 3S16B 2UUCQ 3K0YA 4GLAC 3UDFA 2JA5H 1Y8OB 3F2DA 4DR3Q 1DCZA 1FR3A 4DNRB 5M5YH 5CORA 5LMUL 2PQAA 1XJVA 1V1PA 1EYAA 2PO4A 2KEDA 1BVSA 2LS01 4LF6Q 2NZOA 3VA7A 4A3EH 2K5DA 3EQLC 3PIO3 3CCVA 4O42A 1YHBA 1EIYB 1G51A 2NWGA 2RF4A 5C6AA 4WJWA 4KKSA 3HOZB 4ZUIA 1YZ6A 2EQSA 5ELFA 3STBD 4RGMA 1I3QB 3K80C 2B39A 1HRJA 2D9UA 4JYAQ 1DJRD 1EY6A 1N9WA 1GHJA 1XWEA 3CPFA 5IYBH 3FPPA 4L5RC 2EXDA 3PO3B 1O78A 3Q0AA 3V05A 1I94L 1CM9A 4KHVA 2KECA 1S5BD 4GLVB 2XTIA 4Z9CB 1LTLA 3W1BA 3CCMA 1VCIA 2KQ3A 1Q86C 1T9HA 1A3VA 1IBKQ 5G3LD 5DM63 1UAPA 3QR8A 2QEJC 4DV6Q 2UU9L 4IOAA 5FO8B 2PZUA 3TS2A 1MJCA 1V9PA 3K81C 2R93B 1LABA 3OIPA 5EKKA 3KUPA 2NN6I 3IKJA 4R4CA 1KXLA 4GKJQ 1PFSA 3H91A 4PNYA 4CBVA 1PRTF 4UP8A 3NENA 1EY7A 4C3IG 3IFDA 3HOUB 1VQAA 1YBYA 1JJCB 3D6WA 5HY6A 4HIMA 3AFPA 3NTIA 4C3JB 5IGDA 4C1NI 5C44B 1F9SA 2CVRA 5M5WH 2B29A 4IALA 3CC4A 1ESFA 3I4MG 2OXPA 1EWIA 3T53B 1YNNC 3QOLA 3VA5A 3V2TA 1S3OA 2Q2IA 2OWOA 2A69D 1AW7A 1VQDA 2WP8J 1PH1A 1AH9A 1J9OA 5BN4A 3RD4A 1XPUA 4XYOA 2D2CC 5CV9A 4J1MA 3BJUA 4LFBL 1B4OA 3E3XA 1EY8A 4N8X1 1CKNB 4RGNA 3OPOA 3RN5A 1I4RA 4H13C 5IYDH 1VF5C 2OQ0A 3J81c 3T51B 4N9TA 2QCPX 1ZYRD 2WKDA 2RSNA 1KLUD 4MTKA 3J7AV 2JP1A 1L0XB 1I6HH 4KHPL 1TWAH 4LF9Q 1RKNA 2HIXA 3J81L 5JEAH 1JOKA 1STYA 3ULPA 2R6GA 1Q7YC 2MUYA 2NB0A 3SK8A 3PUYA 1BQQT 1TQOA 1PVOA 4A3IH 3GTGB 1G8ZD 4DUZQ 5I6YA 3W1GA 5FJ8G 4ZKBB 3CD6A 2DJGC 4HCSA 3SR1A 3CMAA 1NE3A 1XNQL 2LSSA 1F2ZA 2F0TA 4GN3B 4DR4L 4Y52H 1HZCA 4WJ4A 2VXWA 1KRSA 1HNWL 2ZT9C 4C56C 3H94A 1DONA 4TSSA 4KY6A 2XGTA 3AQQA 4IJHA 1EQTA 2B2VA 2LKVA 3M4QA 5CC4A 5M9OA 1GUOA 4GN5A 2OTLA 3LWEA 3HZXA 5IGCA 4K6LA 5C4XG 4DK1A 2ZTEA 1CKMA 2WAQG 1D7QA 1XTDA 3KLWA 1KAAA 1PRTD 1E22A 3RLOA 4RH6A 2F0SA 1PV4A 1HNXL 2IWHA 2I0QA 4JI7L 2B2VC 2AQ1B 1UE6A 1SRUA 4NPSA 1PA6A 3B6YA 3M9BA 1SFOB 1I4QA 1SYGA 3BVGA 3FMCA 1ENAA 4L8JA 4JW0A 1YEZA 3T1YQ 2JA6H 3VDYA 4IJLA 2JA5B 2F0MA 3S9WA 4WORA 5CBEE 1XMQL 2JJQA 3C46A 1F2MA 3ONAB 3OTOQ 1PTOF 1LYLA 2KVMA 5IY0A 4B9WA 5K36G 4ZYSA 5M5YB 1B3QA 2B3GA 4MZ9A 3RZDH 4A3DB 3DXJC 4RMFA 5K5PA 1HXYD 4A3EB 2Z4HA 4PZ8A 1EY5A 2HCIA 2J4XA 1EFWA 1UEBA 3R2IA 1Z47A 1N32L 4QIWB 3A5UA 1EUJA 4JI0L 1N33Q 1IZ6A 2Y0SB 3NE5B 5EPJA 2N78A 3KFUA 1HQRD 1HHVA 1D6EC 1E3PA 5M3MG 2HHHL 4HIKA 5HGTA 4QGUA 2YTXA 4R4IA 4DR6Q 1IW7D 2K32A 2ZXOA 4DUYQ 3HKSA 2JA5G 4RGOS 1Q1BA 1TU2B 1LT5D 4K5XA 1AZQA 2Z9HA 2YTVA 2ZTCA 4JI2Q 1I4PA 2UXCL 4KN4C 2IX1A 2A73B 3ZYYX 1ASZA 2MFIA 1C4QA 4BBSB 1CFMA 1YHAA 2A68D 1SYBA 3TP7A 2Q2HA 1RF2D 2DNEA 3K7AB 1Q46A 4IUVA 4G7OC 3PUZA 4FXGC 3JAME 2I46A 2A6ED 2WB1G 3AFQA 4A3LH 5LMUQ 3HOXG 2QKIC 3GQBA 3STBC 3G4SA 2XN9C 4J6HA 1NAPA 1CA6A 5BN3A 3DHQA 5IYBG 2PI2E 2K7VA 3KBGA 5M5WB 3KYHC 4A75A 1EYDA 3TREA 2IW3A 4AQYL 2C35B 1LTSD 1GUWA 1LTBD 5JJLA 3GO5A 1YVCA 4QJFA 2Q2TA 4X3SA 2BA1A 3HOYH 2E2DC 3S1QH 5CV4A 4RFBA 2NZ1D 2QF7A 4TRDA 5I2YA 2F0WA 1SNDA 3K59A 5EPKA 4JBJA 1I94Q 3KK7A 3KF8B 3GTPH 2K01A 3CRKC 3D4DA 4L5TA 1R9TH 1E0BA 3O13A 2A5HA 2VL6A 3D31A 3A7AB 3M7GA 3EJIA 4FP5D 1PMRA 4KK7A 3T13A 4V0BA 1I6HB 2B8GA 2B2UA 2FJ2A 3NQTA 4RKLA 1HTPA 3MTSA 2Q8IB 2M00A 2UU9Q 2R7ZB 4IURA 1I50H 4K5WA 1SE2A 3SE0A 2PMZB 1X3PA 4LUVA 3HKZB 2EYFA 1PYSB 4GNXB 4GNXC 2JA7H 1SSOA 2QDBA 5IGBA 1XNRL 3VYSA 1EOVA 4OONA 5J1ZA 4ULLA 1AP0A 4UAIA 4EQ5A 4JI3L 1JQYD 2A69C 3QG1A 5NUCA 3NP8A 1TXYA 4JOIA 1A2UA 4KV6A 4XQJA 2QDLA 1AE3A 1CHPD 2KHIA 4H02A 5IYDG 2RHSB 3VYTA 3H6MA 4B3RL 4IPHA 4DV7L 2ZJRA 1ZYRC 3IL8A 5EQ0A 2K05A 3W2DA 1GHKA 2NYZD 1MGSA 4RG1A 1WTPA 1PTOH 1M1KC 4LFBQ 2EE1A 1WYDA 1PLFA 5JEAG 1W6KA 1NJIC 2JA8B 4BBRG 1EIFA 1VQBA 1FNWA 1SYCA 5CYUA 1KNAA 5IP9H 2EPBA 5EBDA 1G2SA 1MD2D 5ELCA 4A3IG 4KHPQ 3I70A 3PUWA 3RZOH 4LWCA 4A3BH 3J81E 2YYZA 2KOLA 4DV0L 2EOTA 4A3CH 1JWUD 1GXDC 2Z0SA 2BE5C 2RBMA 3D6CA 2JXMB 1YNJC 2FINB 4DK6C 1RODA 1N36L 4AYBE 1Y1WB 1TT2A 1CHQD 2RSOA 3BS1A 4R9WA 2ASBA 1ASYA 1NTGA 3X3MA 5IGGA 3BDCA 3RMHA 1B9NA 2B2TA 3NTHA 1BCPF 1GUTA 4HMIA 4POGA 2NVTH 2A74C 4JG2A 4C1NK 3DWPA 3R2TA 2KHSA 3GTKH 1XNQQ 2A6HC 4ZCKA 3QOJA 1VQMA 5CV7A 2F1MA 4DR4Q 4K5VA 2GVAA 1HNWQ 1Q8KA 4DXGA 4BY1B 3RZDB 2KBNA 3UDIA 3HOUH 1D1KA 5HGQA 5JVG3 1SBBB 3NSWA 3SK4A 2VQFL 2V1CC 1PRTB 1PZJD 1PRTC 1PH8A 4R4QA 4GZYC 2AQ2B 2EIFA 2X6LA 1K3BC 1H9SB 5DEHA 1LTTD 1O7ZA 1EEID 3PIOA 5D65A 2VNUD 3CCRA 2YTYA 2K33A 3UDGA 1A0IA 1PZID 1HCZA 1HNXQ 4JI7Q 3U50C 2EVBA 2JA6G 1EQVA 4OGQC 5KNDA 3EFXD 4N9PA 3DLLA 1E1OA 1KD1C 1MHWC 3PO2G 3HEJA 3K0XA 3SK6A 3KJOA 4KJNA 5JPMC 1WTQA 4TVAB 2N49A 4DN4M 4RCNA 4IUNA 4MHEA 4Y7NH 3BVMA 3K6OA 2WACA 1M90C 4DU9A 1XMQQ 1EY9A 3C1EA 4F7XA 1KDCA 4QIWE 3EVQA 1F9QA 3DEOA 2L9HA 4PZ6A 1S5CD 2DNCA 4IUUA 1EYGA 2LFNA 4P75A 2Y0SE 3GTGH 3M4OH 3BU2A 3ND9A 1D5MC 1F77A 2JYOA 1KL9A 3PGZA 2D0OA 4LK1C 4B9XA 4YWLA 3S24A 5A2QE 4LMQD 1L0YB 1SDFA 1N32Q 4JI0Q 2L11A 4YIJA 1SMYD 5G3LF 4DXFA 4A93H 4GN4B 3HOYB 1K8GA 3K5MA 2I5HA 3TBIB 1CSQA 1BBWA 2HHHQ 1I4HA 1U4LA 2K1BA 2CW0D 3CCQA 4QUCA 4DR5Q 5KYIA 4DV4L 1S5ED 4KD3A 5A35A 1R9TB 2EYOA 5HURA 1ENFA 2A68C 1VQ7A 5H1SE 3FDTA 4X3UA 5LMNL 4ABNA 3ND8A 5D3IB 2EYMA 3I73A 1GJXA 2B2WA 3R3OA 1QVCA 1YNXA 4JBKA 3BYTB 4A3LG 4A3MB 2PPBC 2QW7A 4OWWB 1UE7A 1XMOL 2UXCQ 1I50B 4J15A 1CZGA 3RNUA 2Z8LA 4H7BA 1R4PB 2HD3A 3H0GB 1HZAA 3UE0A 2JA7B 3PCOB 2AWOA 1JJ2A 1KDAA 3TN2A 3LX0A 5CV5A 2JEBI 3T16A 3HOYG 1RHPA 2N88A 2Q8RE 3M85A 2VZAA 2BA0A 4CJ0B 3Q23A 3QO2A 1Y8NB 2F0VA 3I4LA 4XT3B 4BY7B 4LFCL 1E2ZA 4AQYQ 1JE5A 4ID6A 2CFMA 3CW2C 4DV1L 3GTMH 3TDQA 3QIAA 4QB4A 5C3XA 1SNPA 2EY5A 1PTOB 1PTOC 4BA2I 4A3DH 4XIGS 5I9OA 4GS3A 4DAMA 1WTHA 3L2PA 4A76A 4OO1H 4PMBA 1NCVA 1YITA 2PMZE 4YCVA 1Y1VH 3HKZE 1NUCA 2FFKB 3AU7A 3CC2A 3T4AC 1LM0A 3TQYA 4A3FG 1LT3D 1C7YA 3RZOB 2MHVA 2K5WA 1OXUA 5J3BA 4A3BB 3NXWA 4R4TA 2PQAB 1W6JA 3TP6A 1V1PB 2CQAA 2AWNA 4GOPA 2K5VA 3ERSX 2IY5B 4LF7Q 5LL6S 1V1QA 1E2VA 1SROA 2E74C 1XNRQ 3CXCA 5C4ZA 1I4XA 2SNSA 1JB7A 1DYQA 1PYWD 4A3KB 3LNNA 4B3SL 1MI2A 5JEAJ 4XQNA 2BDNA 5T1IA 4JI3Q 2NVTB 3WDNA 1JC7A 1RD9D 4U68A 4BBSH 5GADC 3GTKB 1AN8A 4GOPB 1MSGA 4GOPC 2RVLA 5C0XH 1VQIA 4FDBA 1HFNA 1FNVA 3K7AH 1AZPA 4B3RQ 1BNZA 4DV7Q 1CKOA 3J7A5 4IFDH 3HOZG 4JI1L 1AE2A 4JBWA 2DUDA 3D3RA 5I6WA 4NXML 3G7LA 4A3CG 1X6OA 3PQIA 3PO3G 3FRPB 1S72A 3U4ZA 4HJ8A 3GD7A 1CQFA 1F9RA 1GUNA 2XRSD 2F0DA 2K75A 5GQOA 1SEBD 4BS9A 3M4YA 1O7LA 2KCCA 3K8AA 3W3AA 1UUPA 4DV0Q 2WKCA 4J8QA 4UPAA 4EQNA 2R93G 1EQQA 1N36Q 2IPKD 2F4VL 3HOVH 3I91A 5FO9B 1JWSD 2RKSA 1RTOA 3HP3A 3KLSX 3P75A 2EJGC 1W3SA 4JI6L 3HOUG 4QCLA 2R7ZH 4ILWA 4Y7NB 1E1TA 4C3JG 5C44G 3I4NB 4GLXA 4A3JH 3TEHB 2ZTDA 3DEPA 4KD4A 3NPPA 3IAYA 3A74A 1FD7D 4HJAA 3M4OB 2B63B 2RCNA 1D8LA 4KKUA 4XQQA 3OIQA 5IT9c 2VQFQ 2ZJQA 1K3RA 1K0RA 2LMCB 4AYBB 1MBYA 1JCKB 1TR5A 3OMGA 3MZ5A 1CA5A 2XSCA 2HUGA 1FNUA 2M2LA 1J6QA 5EKLA 4A93B 1B70B 4MNOA 5IT9L 4R8NA 3PSIA 1ICFB 4FXKC 2YV5A 2R3ZA 1KDBA 3Q8DA 3N6RA 1F2LA 2R7FA 2JA8H 3AB9A 1VQ4A 2F3WA 4JC0A 1SYFA 4ZQ3A 1N34L 5EJWA 1PXUA 1LUZA 1IYVA 1O7IA 1UE1A 4CJ1B 5E4XA 5E4WC 2FMMA 5C4JH 1G291 4XT1B 1X3GA 1ZXTA 1WCMH 3S1MH 1A3UA 2SDFA 1QILA 4NMZA 4UHVA 4MN3A 4AYBG 2A8VA 4DA2A 4IPCA 1Y1WH 2FXQA 3FHWA 1KLGD 4LJZC 1F2YA 5EBCA 4DGZA 5ELBA 1KQSA 4ALPA 4X66L 4P71A 2CH4W 4ZAIA 3I56A 3J81j 1B53A 2CW0C 3KLSA 2C9OA 1BCPB 5FKAC 1BCPC 1M8AA 3T1HL 1IBML 3K5OA 3H3VH 2K50A 4I7ZC 3A55A 3GTMB 2GVBA 3TMEA 2E76C 3S17B 1Z9FA 3MXGA 2E2JH 4BY1H 1AFPA 3F1ZA 3L9AX 5KNCA 1SXTA 1ONLA 1CZWA 4DV4Q 2UXBL 4H0LC 1Y1VB 2MJ8A 3A0JA 4JI8L 5LMNW 5FLMH 5LMNQ 1C8CA 1CTMA 2B2YA 2JE6I 3G6JB 3L3OC 2JA9A 5EGTA 5M3FH 2JN4A 2EXZA 2NTTA 4RKBA 1HFGA 5CV6A 4A4IA 2ZM6L 1A15A 1UEAB 3TSSA 3GTJH 1XMOQ 2VW9A 4DR7L 4DR5L 1MIUA 5T1GA 5KEEA 1W2BA 1DZ1A 4CDEC 4YWMA 4APVA 1Q81C 5GROA 4NXNL 4CDDC 2L1BA 1NNXA 3URYA 3CKIB 3TP8A 2OTJA 3KLRA 4HAEA 2AHOB 2K4KA 1WTXA 3DM1A 2EYHA 4A3DG 4ZRZA 1JOQA 2UUAL 3DUZA 4A3EG 3D8GA 4OO1G 4LUZA 4LFCQ 4TKOB 3RN2A 4POFA 3PIPA 1PH6A 1TKWB 4DV1Q 4BXXH 1TY2A 1FVIA 3I2ZA 3J80L 1N8RC 2Y0SG 2XWBB 5CBAE 2H5XA 2D62A 2KCNA 1R4QB 1LACA 1G2TA 3NQIA 5CV8A 4OIJA 2R7DA 4UDUC 2HDMA 2G9DA 3MAQA 1GKHA 2R92H 2ZXPA 3MFGA 1B8AA 3DM3A 1VS0A 2UUBL 1C48A 4DR1L 4JBMA 2H4OA 4UP7A 1B44D 4F88A 3ITPA 2J7ZA 1KTKA 5FLXL 4BBSG 2E2HH 3I4OA 1A8VA 3NELA 3HOVB 2PW5A 5C0XG 1D5ZC 3J7ZC 4JV5L 1SN8A 2ENBA 3G6EA 4LFAL 5L37A 2MQHA 3VR3A 3CPWA 4RCOA 4B3SQ 4A3MH 2F0QA 2CHBD 4TQUS 1S5DD 4LUOA 1X3FA 4EGVA 4X6AH 2RA4A 1QJOA 4LF7L 5M5XB 3MXUA 3H0GH 4A3JB 2E5LL 4IPGA 4XTCS 3NEMA 3HOWB 4PG3A 4FO2A 3FP9A 4JI1Q 1Q12A 4LF4L 5ELDA 2B2UC 3UDXA 3VR6A 4NXMQ 1K28A 4I65A 1K73C 1LTRD 4K6DA 1DM0B 1QZHA 1II3A 1EWCA 3BDLA 4BY7H 3SK5A 3BZDB 5DAUA 2VUMH 1V8QA 2O2LD 4DK0A 3J7AF 4L63B 1D5XC 3KF6A 1SYEA 1ZKOA 3WOEA 5GAEC 2CQOA 2JQOA 1Q82C 3FPUB 3CMEA 1WTVA 2R7ZG 4IUQA 1U4RA 1KABA 4JOIC 3S14B 3QJYA 2F4VQ 3HKZG 2I07B 1PH7A 1Z7TA 4CDFC 1X3QA 1Q1EA 5DM73 4B3ML 5LL6X 1E2WA 2ATWA 4OO1I 4X3TA 3PUVA 5C4JB 4JI6Q 4X3KA 2D5DA 3CP0A 1WCMB 3L0OA 4GKKL 3S1MB 3Q6SA 3QB3A 5ISRA 4X62L 4PZ7A 1SMXA 1J5EL 2Z6KA 1CT1D 1QOHA 1IL2A 4CKEA 1EL0A 1B50A 1EU4A 1L2FA 2XRQD 2MO0A 3VR4A 4QMGA 1M4VA 4A3KH 4X65L 4DV3L 3MXNA 1YNND 2HDLA 1X9NA 1LTID 3H3VC 2JA8G 5C3EB 4WRDA 4NB3A 1PH9A 1NR4A 2MGSA 2WFWA 5IT9E 2E2JB 1HJPA 5C0XI 1STNA 2E8GA 1E7ZA 1LLRD 1RL2A 2B2TC 3CCLA 4DNIA 2FMCA 1WCMG 1OXSC 1LT4D 4DNTB 2IL8A 5F2DA 2LXJA 2E2IB 3VR2A 1BUVT 2RDFA 1N34Q 1KAWA 3PF4A 2EY2A 5TSSA 3D4RA 1Y1WG 1I4GA 5M3FB 2Q8TA 1KHIA 3F8TA 4U673 4R8IA 3K5LA 2IHEA 3SXHA 3OW2A 1VMPA 3HG9A 4IUTA 3GTJB 2PCFB 2E75C 1CSPA 3S1RH 5IWAL 3F2UA 1K8MA 3P1HA 2VB3X 2Z1CA 3MXPA 1BF4A 1VQGA 5FOBB 2L15A 1Y69U 1SJED 2BOSA 1ESRA 1YHQA 1L1OA 4PMCA 4JK1C 4FF4A 1BDOA 1PDQA 2K5HA 1ZEQX 2DY8A 4BY1G 5FJ8H 4X66Q 2F0LA 1BXTA 4DK3C 3X3NA 2A1AA 4ZK9B 1IBMQ 3I4NH 3T1HQ 4IO9A 1SNOA 3MHBA 1TWFH 2L55A 1IXRA 5JPNC 1IBLL 1L1OB 1L1OC 4HR7B 5M3FG 3AYHB 3OSOA 2CH4A 3P7JA 2B63H 2AUJD 1ET6A 3ULLA 3GTOB 3OW7A 3RUZA 3KJPA 2UXBQ 1WI5A 2OT2A 1FJGL 1WVLA 2R92B 4JI8Q 1XYIA 4K2KA 1U4PA 4DV5L 1IW7C 1WFQA 5C4XH 1MJEA 1Z6HA 1PFMA 1O80A 2ZM6Q 3GTQB 3K7UC 1EYCA 5KNBA 3DWAA 5EAYA 4DR7Q 3T56B 5GAGC 1X54A 2E2HB 2V4DA 1RTNA 3S15H 4NXNQ 3C3LA 1EEFD 4BXXG 1SAPA 2Z4IA 3CRLC 3J80i 4N8FA 1QCBD 1EY0A 4V190 4BBRB 2A6EC 1Y14B 5CMDA 3ICEA 2UUAQ 2IHFA 1I6VC 1G91A 5K36H 2LY7A 4DAPA 1HA5A 1JR0D 2B2WC 4DKAC 3HRZC 3ZJYC 4F8MA 2MNAA 1E24A 3ULJA 2VY3A 4OELB 3EIVA 4QL5A 5C0XJ 5CR3A 1WTWA 1K83H 4FF1A 1IKLA 2VUMB 4IFDJ 2Q2UA 2XWJB 4E6IA 1HR0L 3W5OA 1PFBA 2EZVA 3S17H 4JPBW 4P2CB 2ICEC 2UUBQ 3SEBA 3KDFA 4DR1Q 3M7NA 4HCEA 4DAYA 3CHBD 4A3MG 2PNRC 1VF7A 4RA8A 3I55A 1WD0A 1QZGA 3E0JA 3WWVA 4LW1A 5AJ3L 2GA4B 3NWSA 2KEEA 2F0NA 5EPLA 4HIDA 4RGTA 3H0GG 2JA7G 2CKZB 4JV5Q 2XIWA 2HCCA 3NK9A 5ELEA 4LFAQ 3CCJA 4LF5L 1OXXK 3J7YW 1STGA 4UY8C 3GV3A 3JAML 1GUGA 2PI2A 2CWPA 3KDFB 5ELOA 4CGYB 2NBFA 4DAYB 1H9MA 4DV2L 1HNZL 4Q5VA 1LO5D 3CAMA 2F0HA 4BY7G 2E5LQ 3G71A 3ERQA 2VUMG 2F52A 3CCSA 3TZUA 1J8IA 1FL0A 3I72A 3FKIH 1RDPD 4LF4Q 4C3IB 1BKBA 4G57A 3HOXH 1YJ9A 1P16A 2RCFA 4C2MH 3MWYW 3BG3A 2FHTA 2IX0A 2RDHA 4CDCC 1ML0D 3I4MB 1CI3M 2AKWB 2EY6A 2UXDL 3Q24A 1LTGD 5JJZA 4XYQA 1MSHA 2F0KA 5J22A 1U4MA 4K0KL 4HEDA 1PH4A 1U9RA 2BCOA 5IP9G 2IT1A 4ZLTF 4OEMB 1DOKA 4M8AA 3EA6A 2F3VA 4A3BG 3IFTA 1NY4A 2NVQB 1SLJA 4LAAA 3OWEB 1QNUA 4G4KA 5JVH3 1K8OA 4EVOA 4B3MQ 3EROA 4DR2L 5I2XA 1HZBA 1JMCA 3E6ZX 3C2PA 1VQ9A 4A3KG 1G6ZA 2EYLA 3S1RB 2GN5A 1CKNA 4F87A 2ZXRA 4GKKQ 4X62Q 3A5ZB 1J5EQ 2ES2A 4JCVE 5C5LA 4X64L 5D3DA 4LNQA 4IPDA 3K58A 3M4PA 3PMFA 3PV0A 4AH6A 1STHA 4YWKA 5IODA 3VYRA 4ME5A 1RJTA 4HSVA 4OL7A 4X65Q 3CU7A 5BN5A 1WTRA 3HGBA 4O0AA 2KHJA 4DV3Q 5M5XH 1HH2P 1VQ5A 1TWFB 4YCUA 3NHHA 1QB5D 2NVYH 1X65A 1JICA 3QWNA 2AQ3B 3G48A 5C3WA 1PH3A 3HOWH 4LF8L 4OIKA 1T5EA 2F4IA 4K2LA 1U0LA 1K0SA 2KCTA 1PHJA 4PV1C 5JAVA 1S4ZA 2EDGA 3U9OA 3GTLH 4MTNA 4BBRH 2R61A 5EKIA 3BZKA 5KYLA 2QEXA 1SNMA 1XPRA 3UE1A 2PW7A 4B3TL 3WOFA 3KOJA 5C4XB 3NUCA 3FVQA 2H1EA 5I4DA 2WAQB 2KUMA 2X69A 3S2HH 4HN7A 1STAA 1VQFA 1FGBD 5IWAQ 2K52A 2BE5D 1KC8C 3D0FA 1YNJD 1VQEA 4ZUJA 1EZ6A 5IGFA 2EJMA 2F3IA 1UNSA 1D1IA 3S14H 4FVMA 3S15B 2VQEL 1HQMC 1JE4A 3I4NG 4NW2A 3CCUA 1TWHH 2ICIA 5IGEA 3SHLA 4NKLA 3MEFA 5JJIA 3M3YH 1EFID 3S1NH 2B63G 2AUKA 1L0WA 4RHRA 2A6HD 4BA1I 5LHY1 4O1NA 1RIPA 1FYCA 4HJ7A 2Z6BA 1C0AA 1IBLQ 1Q8IA 4A93G 2L12A 1SMYC 4AIMA 3S2DB 3CQZB 1CQVA 1ENCA 1WD1A 3E9IA 4ODGA 5KGUA 1FGUA 4FF3A 4RHSA 2LXKA 1K83B 4QUFA 3A8IE 3RR5A 4K14A 5E1FA 3Q22A 1FJGQ 4YCWA 1GD7A 1STEA 4I7AA 2K04A 2O5IC 4DV5Q 5C3EH 2NVXH 4G7ZC 3AEVA 2VB2X 4C3HH 1VQJA 4L5QA 2NUCA 2TSSA 2SEBD 5M3MB 1PZKD 2OCEA 2NTSA 2RDGA 1A2TA 5IE8A 3C1FA 1A3TA 5KIXA 1GOZA 2E2IH 2CCZA 4KI0A 3EBEA 3R93A 3E5SA 1D2BA 4JI5L 3PO2H 1X55A 4CKCA 3K5NA 1F9PA 1H95A 1AEXA 4DFAA 4O2DA 1IHZA 4JI4L 2G9HD 5KRUA 5BR8L 3DWQA 5CGKA 1WJJA 3RLFA 3U58A 4CHTB 2A19A 2L0CA 2SNMA 2K14A 5A2QL 1CK1A 3FKIB 3JC66 4YY3L 2WB1B 4HIOA 3VR5A 2B2YC 3CF5A 1WTOA 3HOXB 3A8JE 1BR9A 4UP9A 4C2MB 3J80c 4OWXB 2WINB 4QY7A 3SVMA 1BBUA 2QA4A 2BDOA 4KTAA 1IYJB 1VDZA 2L4NA 2I5LX 1Y1VG 1HR0W 3TRZA 4A3GH 1TWGH 2MPMA 1HR0Q 2SOBA 1VQLA 1QWYA 3JAMi 1STBA 5IP7H 1TY0A 2RHQB 2NN6H 1VQNA 3GTOH 2CWAA 4YHHL 5AJ3Q 1SE8A 2F0GA 3IRBA 1OXVA 3OHXC 5FLXc 5IYCH 2PYKA 3I90A 5E3FA 1H9KA 2D0PA 4FXDA 1TS5A 4LF5Q 3NBIA 3FKIG 1NMFA 4FNFA 3GP7A 1VQOA 3GTQH 1TS2A 2EYPA 4DV2Q 1HNZQ 3KF8A 3BVZA 4OX9L 1C9OA 1XX8A 3A54A 2UUCL 3A56A 5GAHC 4DR3L 1IKMA 4XXEA 3D4WA 1LT6D 1UE5A 4IFDG 2EYJA 2PZTA 3VYUA 4K8JA 4OHJA 1I5FA 2F03A 1JORA 4KKTA 1BOSA 4LF6L 2UXDQ 4GNXA 1A6XA 3V96A 4K0KQ 2N3SA 2NVYB 5C4HA 5COYA 3E0EA 3CC7A 4K8IA 2M9VA 2HIVA 4KHZA 1HUMA 1P8LA 1PTOD 4Q0FA 2NZHA 1TWAB 1OTCA 2DGYA 4JYAL 3I8ZA 2KCMA 4KY7A 2K5NA 3U4VA 4IUPA 3F2CA 2YU9H 3GTLB 5D14A 2G5DA 1VQKA
chains in the Genus database with same CATH topology
4GOPC 2B63H 5DLQE 2I5MX 1VQIA 4FDBA 4R4OA 3K7AH 3ULLA 3HOVG 4B3RQ 1TWCH 4DV7Q 4DR2Q 1CKOA 4A3FH 1YEZA 3J7A5 3KJPA 1K8AC 3HOZG 3T1YQ 2JA6H 4JI1L 3VDYA 1IBKL 1WI5A 4IJLA 2UXBQ 1AE2A 4JBWA 1FJGL 3TS0A 4JI8Q 2DUDA 1XMQL 2JJQA 4DV5L 3OTOQ 4DV6L 1LYLA 4NXML 5IY0A 1WFQA 5C4XH 1SR3A 1S40A 5K36G 4A3CG 1X6OA 3PO3G 1MJEA 4OWTB 3S16H 4X64Q 1S72A 2B3GA 3U4ZA 2ZM6Q 4HJ8A 3K7UC 4MZ9A 3RZDH 3GD7A 3ER0A 4RMFA 1EQRA 4A3JG 5EAYA 4DR7Q 2ZJPA 4GKJL 2K75A 4PZ8A 5GQOA 5GAGC 1X54A 3HOWG 1EFWA 1MKHA 3KF6B 3LGJA 1UEBA 1Z47A 1N32L 3A5UA 1EUJA 4JI0L 3S15H 4NXNQ 1N33Q 1WOCA 1IZ6A 1NMGA 3K8AA 5ELNA 4DV0Q 4BXXG 3J81i 3EN2A 2N78A 4UPAA 3J80i 4EX5A 3KFUA 2R93G 1EQQA 1N36Q 2F4VL 4HJ5A 3HOVH 1E3PA 4OXPA 2HT1A 1Y14B 1X3EA 5M3MG 2HHHL 4HIKA 3ICEA 5JJKA 1QUQA 4QGUA 2IHFA 2UUAQ 2YTXA 4LF8Q 4R4IA 3HOZH 4DR6Q 4C3IH 2WAQE 1B7YB 1I3QH 4DUYQ 3HKSA 1W3SA 2JA5G 4JI6L 1JJGA 1Q1BA 3HOUG 2R7ZH 1E1TA 2YTVA 3PO3H 5C44G 2ZTCA 1KRTA 3I4MH 4GLXA 2Z6KC 4DKAC 4R1JA 3ZJYC 4B3TQ 4JI2Q 2MNAA 1E24A 4A3JH 3ULJA 2UXCL 2QGQA 3TEHB 2VY3A 2ZTDA 3EIVA 2MFIA 1UWVA 4QL5A 5C0XJ 1ASZA 3A74A 4PMWA 1X56A 1K83H 4BBSH 4HJAA 1YHAA 1QUQB 2Q2HA 4IFDJ 2RCNA 2Q2UA 1D8LA 4LF9L 1Q46A 2N8NA 5IT9c 3PUXA 3PUZA 3W5OA 2VQFQ 1PH5A 3GDEA 1K3RA 1HZ9A 1K0RA 1HR0L 1KIXA 3S17H 4IFDI 2NVQH 2WB1G 3AFQA 2UUBQ 4A3LH 3HFZB 3KDFA 5LMUQ 2OQKA 1CUKA 4DR1Q 3HOXG 3MXNB 2VQEQ 1YI2A 3M7NA 3STBC 3G4SA 4A3MG 1XPOA 1J6QA 3I55A 1OXTA 1QZGA 1B70B 2PI2E 2PNHA 3WWVA 5IYBG 1QVGA 4MNOA 3KYHC 4LW1A 1PYBA 5AJ3L 3PSIA 4A75A 4DUZL 3E9HA 3TREA 1G6PA 4AQYL 2C35B 4HIDA 3H0GG 2JA7G 2CKZB 2R93H 4JV5Q 4KLKA 1V43A 2YV5A 4DPGA 3Q8DA 4C3JH 5C44H 4LFAQ 3CCJA 1A62A 4LF5L 1OXXK 3GO5A 5JJLA 1YVCA 4QJFA 1NBWA 2Q2TA 4UY8C 2BA1A 2R7FA 3NBHB 2JA8H 3HOYH 3S1QH 1VQ4A 2PI2A 2CWPA 3KDFB 4JC0A 5ELOA 1N34L 5C3EG 4DAYB 1LUZA 2HQLA 1GVPA 4DV2L 5E7NA 1HNZL 1O7IA 1UE1A 4JBJA 1I94Q 3KF8B 3GTPH 3CAMA 1R9TH 4HJ9A 4L5TA 4BY7G 1PH2A 5C4JH 2E5LQ 4IOCA 2VL6A 1G291 1YIJA 3G71A 2VS1A 3D31A 2BH2A 2VUMG 1X3GA 2F52A 3CCSA 1FL0A 1WCMH 3FKIH 3S1MH 3H15A 4LF4Q 1BKBA 3HOXH 1YJ9A 1P16A 4AYBG 2A8VA 4P73A 4C2MH 4IPCA 1Y1WH 2UU9Q 5FLMG 2FXQA 3FHWA 1GM5A 1YJNA 1I50H 3I7FA 2IX0A 3PF5A 4LUVA 2AKWB 3RLNA 1YJWA 2UXDL 1PYSB 4GNXB 4GNXC 1KQSA 2JA7H 4ALPA 4K0KL 4X66L 4P71A 1XNRL 1A63A 1PH4A 5IP9G 3I56A 1EOVA 2IT1A 4OONA 3J81j 1IBML 3H3VH 3T1HL 2K50A 4EQ5A 4JI5Q 4JI3L 2GVBA 4A3BG 1TXYA 1K9MC 4ME3A 1Z9FA 4JOIA 1NY4A 1SLJA 3F2BA 2E2JH 1AE3A 2KHIA 2WB1E 4H02A 4BY1H 5IYDG 2RHSB 3F1ZA 4JI4Q 4B3RL 4B3MQ 4IPHA 4DV7L 5BR8Q 4DR2L 1JT8A 2BH8A 1HZBA 4DV4Q 2ZJRA 1VQCA 1JMCA 1VQHA 2JK8A 3T1YL 2UXBL 1U5KA 4WJ3M 4RG1A 1VQ9A 4A3KG 3A0JA 4JI8L 3L7ZC 5LMNW 4P74A 5FLMH 4QQBX 2GN5A 3SGIA 1CKNA 3OTOL 5LMNQ 1M1KC 4GKKQ 4LFBQ 4A3GG 1WYDA 2JE6I 4YY3Q 2JA9A 3A5ZB 4X62Q 5M3FH 1J5EQ 5JEAG 2ES2A 1NJIC 3BZCA 4A4IA 4BBRG 1EIFA 4JCVE 4X64L 1VQBA 4LNQA 4IPDA 2ZM6L 5IP7G 3M4PA 1XMOQ 3GTJH 2ALYB 3PV0A 4AH6A 5IP9H 2NN6G 2VW9A 4DR7L 4DR5L 4YWKA 2JEAI 1VQ6A 1MIUA 4A3IG 1W2BA 4KHPQ 3PUWA 2MO1A 3RZOH 3CCEA 4YWMA 4APVA 1Q81C 5GROA 2R92G 4LWCA 4NXNL 4X65Q 1N33L 4A3BH 2YYZA 5IYCG 4DV0L 1VQPA 4A3CH 4O0AA 4DV3Q 2KHJA 2Z0SA 2OTJA 2ID0A 4DK6C 3S2DH 2AHOB 3CQZH 5M5XH 2K4KA 1N36L 1HH2P 1VQ5A 4AYBE 4YCUA 3OYYA 2AMCB 1X65A 2NVYH 4A3DG 3G48A 4YHHQ 1PH3A 1ASYA 2UUAL 2ASBA 4LF8L 1NTGA 4A3EG 3HOWH 4OO1G 4LUZA 4DR6L 1VQKA 4LFCQ 4DUYL 1U0LA 4P72A 3RN2A 4POFA 3PIPA 4L5SA 1PH6A 4DV1Q 2KCTA 4POGA 1PHJA 2NVTH 4BXXH 1GO3E 1FVIA 4JG2A 3I2ZA 1N8RC 3GTLH 4MTNA 4BBRH 2Y0SG 1QVFA 3GTKH 1SFOH 1XNQQ 3BZKA 3H3VI 1XPRA 2QEXA 2H5XA 3UE1A 5M3MH 4B3TL 1VQMA 2D62A 4JI2L 3KOJA 1DGSA 3JAMc 4DR4Q 2GVAA 1HNWQ 4OX9Q 2KENA 1Q8KA 2UUCQ 2R7DA 3S2HH 4GLAC 3UDFA 2KBNA 1GKHA 2JA5H 3UDIA 2R92H 3HOUH 1VQFA 5HGQA 3F2DA 5IWAQ 2K52A 4DR3Q 1KC8C 2VQFL 2V1CC 3D0FA 1VQEA 1PH8A 1B8AA 4R4QA 3DM3A 2EIFA 2F3IA 1VS0A 5M5YH 2UUBL 3S14H 5LMUL 4DR1L 4JBMA 2PQAA 2VQEL 1XJVA 3I4NG 1BVSA 3CCUA 4UP7A 1TWHH 3PIOA 4LF6Q 2NZOA 4A3EH 2VNUD 3CCRA 2YTYA 4BBSG 3MEFA 3CCVA 3I4OA 1A8VA 3NELA 1YHBA 2E2HH 3M3YH 5JJIA 3S1NH 3UDGA 5C0XG 1EIYB 2B63G 1G51A 1L0WA 3J7ZC 2RF4A 4JV5L 1A0IA 1SN8A 1YZ6A 3G6EA 4BA1I 2EQSA 4LFAL 1HNXQ 3STBD 2MQHA 4JI7Q 3U50C 2JA6G 3K80C 3CPWA 4B3SQ 1RIPA 4A3MH 4HJ7A 4JYAQ 3DLLA 1N9WA 3CPFA 1E1OA 1KD1C 4TQUS 5IYBH 1IBLQ 4L5RC 2EXDA 3PO2G 4LUOA 1X3FA 1C0AA 3K0XA 3KJOA 4A93G 4X6AH 4AIMA 1I94L 4TVAB 4LF7L 2N49A 4GLVB 2XTIA 3H0GH 1LTLA 3E9IA 3W1BA 3CCMA 1FGUA 1VCIA 2E5LL 1Q86C 4IPGA 2LXKA 4XTCS 3NEMA 1T9HA 4PG3A 3RR5A 4Y7NH 3FP9A 4JI1Q 1IBKQ 1Q12A 4LF4L 1FJGQ 4YCWA 1GD7A 1M90C 1XMQQ 4DV5Q 3UDXA 4DV6Q 5C3EH 2NVXH 2UU9L 4NXMQ 3TS2A 4IOAA 4QIWE 1K73C 1MJCA 1V9PA 3AEVA 1VQ8A 3K81C 4C3HH 4PZ6A 1QZHA 1VQJA 1EYGA 4L5QA 4P75A 2Y0SE 3GTGH 4GOPB 3M4OH 4BY7H 3BU2A 2VUMH 2OCEA 2NN6I 1KL9A 4R4CA 3PGZA 4GKJQ 1KXLA 1PFSA 2D0OA 5IE8A 3KF6A 5GAEC 4YWLA 3S24A 4UP8A 3NENA 2CCZA 2E2IH 1N32Q 4KI0A 3EBEA 1VQAA 4JI0Q 1YBYA 1JJCB 2CQOA 4JI5L 2JQOA 3PO2H 1X55A 5HY6A 4HIMA 1Q82C 3AFPA 3CMEA 2R7ZG 4A93H 4GN4B 1H95A 5M5WH 4JOIC 2B29A 1K8GA 3CC4A 2I5HA 3I4MG 1CSQA 1BBWA 2F4VQ 3HKZG 4O2DA 1PH7A 1EWIA 4JI4L 2ZJQA 2HHHQ 1Q1EA 4B3ML 5BR8L 3CCQA 2ATWA 4DR5Q 4OO1I 4DV4L 1WJJA 1S3OA 2Q2IA 3RLFA 3U58A 2OWOA 1VQDA 2WP8J 3PUVA 1PH1A 1AH9A 2A19A 4JI6Q 2K14A 1XPUA 1VQ7A 5H1SE 3BJUA 5LMNL 3CP0A 3L0OA 4GKKL 4LFBL 3JC66 1CKNB 4YY3L 4X62L 4PZ7A 4HIOA 1SMXA 1J5EL 2Z6KA 3RN5A 3CF5A 1QVCA 5IYDH 1YNXA 2OQ0A 4JBKA 4UP9A 4A3LG 3J81c 1IL2A 4OWWB 1UE7A 4OWXB 3J80c 1XMOL 2UXCQ 4QY7A 4J15A 1L2FA 1BBUA 2QA4A 3RNUA 2MO0A 1IYJB 4A3KH 1I6HH 4KHPL 1TWAH 1HZAA 2I5LX 3UE0A 1Y1VG 4LF9Q 3PCOB 2AWOA 1JJ2A 1HR0W 4X65L 3TRZA 4A3GH 1TWGH 1HR0Q 2HIXA 4DV3L 1VQLA 1X9NA 3JAMi 2JEBI 5IP7H 2IX1A 2JA8G 3HOYG 2RHQB 3ULPA 2R6GA 4NB3A 1Q7YC 1PH9A 1VQNA 2WFWA 3GTOH 3PUYA 2CWAA 4YHHL 2VZAA 3M85A 1HJPA 2BA0A 5AJ3Q 4A3IH 1SE8A 1PVOA 3IRBA 5C0XI 4LFCL 4DUZQ 4AQYQ 1JE5A 3W1GA 5FJ8G 1OXVA 2CFMA 3CW2C 5IYCH 5FLXc 2E8GA 1E7ZA 4DV1L 3CD6A 1RL2A 3GTMH 3CCLA 2D0PA 4DNIA 1WCMG 1OXSC 3CMAA 3FKIG 4LF5Q 1NE3A 1NMFA 2LXJA 1XNQL 2LSSA 1VQOA 4BA2I 3GTQH 1N34Q 1KAWA 3PF4A 4XIGS 4A3DH 4GN3B 1Y1WG 4GS3A 4DAMA 4DV2Q 4DR4L 1HZCA 4WJ4A 3L2PA 4A76A 1HNZQ 4Y52H 1HNWL 1KRSA 1KHIA 3F8TA 1C9OA 4OX9L 2IHEA 2UUCL 3OW2A 1YITA 2PMZE 4YCVA 1Y1VH 3HKZE 1CSPA 3S1RH 3CC2A 5IWAL 5GAHC 4DR3L 2XGTA 3AQQA 4IJHA 1LM0A 3TQYA 1UE5A 4A3FG 4IFDG 1VQGA 1C7YA 2L15A 3M4QA 1I5FA 1OXUA 4GN5A 5J3BA 2OTLA 4R4TA 2PQAB 1YHQA 1L1OA 2AWNA 5C4XG 4GOPA 4LF6L 2K5HA 2K5VA 3ERSX 2ZTEA 1CKMA 2WAQG 2IY5B 2UXDQ 4GNXA 4LF7Q 1D7QA 1XTDA 1V1QA 3KLWA 4BY1G 1SROA 5FJ8H 1E22A 4K0KQ 2N3SA 3RLOA 4X66Q 1XNRQ 3CXCA 1JB7A 3E0EA 3CC7A 2HIVA 4KHZA 4DK3C 1PV4A 1HNXL 1P8LA 2I0QA 4JI7L 2A1AA 2NZHA 3I4NH 1IBMQ 1OTCA 4B3SL 5JEAJ 3T1HQ 4IO9A 2DGYA 4JYAL 4JI3Q 2KCMA 1TWFH 1UE6A 1SRUA 2K5NA 4NPSA 3U4VA 3F2CA 1PA6A 1IXRA 1IBLL 2YU9H 3B6YA 1L1OB 3M9BA 1L1OC 5GADC 5M3FG 3AYHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GOP C;  2B63 H;  5DLQ E;  2I5M X;  1VQI A;  4FDB A;  4R4O A;  3K7A H;  3ULL A;  3HOV G;  4B3R Q;  1TWC H;  4DV7 Q;  4DR2 Q;  1CKO A;  4A3F H;  1YEZ A;  3J7A 5;  3KJP A;  1K8A C;  3HOZ G;  3T1Y Q;  2JA6 H;  4JI1 L;  3VDY A;  1IBK L;  1WI5 A;  4IJL A;  2UXB Q;  1AE2 A;  4JBW A;  1FJG L;  3TS0 A;  4JI8 Q;  2DUD A;  1XMQ L;  2JJQ A;  4DV5 L;  3OTO Q;  4DV6 L;  1LYL A;  4NXM L;  5IY0 A;  1WFQ A;  5C4X H;  1SR3 A;  1S40 A;  5K36 G;  4A3C G;  1X6O A;  3PO3 G;  1MJE A;  4OWT B;  3S16 H;  4X64 Q;  1S72 A;  2B3G A;  3U4Z A;  2ZM6 Q;  4HJ8 A;  3K7U C;  4MZ9 A;  3RZD H;  3GD7 A;  3ER0 A;  4RMF A;  1EQR A;  4A3J G;  5EAY A;  4DR7 Q;  2ZJP A;  4GKJ L;  2K75 A;  4PZ8 A;  5GQO A;  5GAG C;  1X54 A;  3HOW G;  1EFW A;  1MKH A;  3KF6 B;  3LGJ A;  1UEB A;  1Z47 A;  1N32 L;  3A5U A;  1EUJ A;  4JI0 L;  3S15 H;  4NXN Q;  1N33 Q;  1WOC A;  1IZ6 A;  1NMG A;  3K8A A;  5ELN A;  4DV0 Q;  4BXX G;  3J81 i;  3EN2 A;  2N78 A;  4UPA A;  3J80 i;  4EX5 A;  3KFU A;  2R93 G;  1EQQ A;  1N36 Q;  2F4V L;  4HJ5 A;  3HOV H;  1E3P A;  4OXP A;  2HT1 A;  1Y14 B;  1X3E A;  5M3M G;  2HHH L;  4HIK A;  3ICE A;  5JJK A;  1QUQ A;  4QGU A;  2IHF A;  2UUA Q;  2YTX A;  4LF8 Q;  4R4I A;  3HOZ H;  4DR6 Q;  4C3I H;  2WAQ E;  1B7Y B;  1I3Q H;  4DUY Q;  3HKS A;  1W3S A;  2JA5 G;  4JI6 L;  1JJG A;  1Q1B A;  3HOU G;  2R7Z H;  1E1T A;  2YTV A;  3PO3 H;  5C44 G;  2ZTC A;  1KRT A;  3I4M H;  4GLX A;  2Z6K C;  4DKA C;  4R1J A;  3ZJY C;  4B3T Q;  4JI2 Q;  2MNA A;  1E24 A;  4A3J H;  3ULJ A;  2UXC L;  2QGQ A;  3TEH B;  2VY3 A;  2ZTD A;  3EIV A;  2MFI A;  1UWV A;  4QL5 A;  5C0X J;  1ASZ A;  3A74 A;  4PMW A;  1X56 A;  1K83 H;  4BBS H;  4HJA A;  1YHA A;  1QUQ B;  2Q2H A;  4IFD J;  2RCN A;  2Q2U A;  1D8L A;  4LF9 L;  1Q46 A;  2N8N A;  5IT9 c;  3PUX A;  3PUZ A;  3W5O A;  2VQF Q;  1PH5 A;  3GDE A;  1K3R A;  1HZ9 A;  1K0R A;  1HR0 L;  1KIX A;  3S17 H;  4IFD I;  2NVQ H;  2WB1 G;  3AFQ A;  2UUB Q;  4A3L H;  3HFZ B;  3KDF A;  5LMU Q;  2OQK A;  1CUK A;  4DR1 Q;  3HOX G;  3MXN B;  2VQE Q;  1YI2 A;  3M7N A;  3STB C;  3G4S A;  4A3M G;  1XPO A;  1J6Q A;  3I55 A;  1OXT A;  1QZG A;  1B70 B;  2PI2 E;  2PNH A;  3WWV A;  5IYB G;  1QVG A;  4MNO A;  3KYH C;  4LW1 A;  1PYB A;  5AJ3 L;  3PSI A;  4A75 A;  4DUZ L;  3E9H A;  3TRE A;  1G6P A;  4AQY L;  2C35 B;  4HID A;  3H0G G;  2JA7 G;  2CKZ B;  2R93 H;  4JV5 Q;  4KLK A;  1V43 A;  2YV5 A;  4DPG A;  3Q8D A;  4C3J H;  5C44 H;  4LFA Q;  3CCJ A;  1A62 A;  4LF5 L;  1OXX K;  3GO5 A;  5JJL A;  1YVC A;  4QJF A;  1NBW A;  2Q2T A;  4UY8 C;  2BA1 A;  2R7F A;  3NBH B;  2JA8 H;  3HOY H;  3S1Q H;  1VQ4 A;  2PI2 A;  2CWP A;  3KDF B;  4JC0 A;  5ELO A;  1N34 L;  5C3E G;  4DAY B;  1LUZ A;  2HQL A;  1GVP A;  4DV2 L;  5E7N A;  1HNZ L;  1O7I A;  1UE1 A;  4JBJ A;  1I94 Q;  3KF8 B;  3GTP H;  3CAM A;  1R9T H;  4HJ9 A;  4L5T A;  4BY7 G;  1PH2 A;  5C4J H;  2E5L Q;  4IOC A;  2VL6 A;  1G29 1;  1YIJ A;  3G71 A;  2VS1 A;  3D31 A;  2BH2 A;  2VUM G;  1X3G A;  2F52 A;  3CCS A;  1FL0 A;  1WCM H;  3FKI H;  3S1M H;  3H15 A;  4LF4 Q;  1BKB A;  3HOX H;  1YJ9 A;  1P16 A;  4AYB G;  2A8V A;  4P73 A;  4C2M H;  4IPC A;  1Y1W H;  2UU9 Q;  5FLM G;  2FXQ A;  3FHW A;  1GM5 A;  1YJN A;  1I50 H;  3I7F A;  2IX0 A;  3PF5 A;  4LUV A;  2AKW B;  3RLN A;  1YJW A;  2UXD L;  1PYS B;  4GNX B;  4GNX C;  1KQS A;  2JA7 H;  4ALP A;  4K0K L;  4X66 L;  4P71 A;  1XNR L;  1A63 A;  1PH4 A;  5IP9 G;  3I56 A;  1EOV A;  2IT1 A;  4OON A;  3J81 j;  1IBM L;  3H3V H;  3T1H L;  2K50 A;  4EQ5 A;  4JI5 Q;  4JI3 L;  2GVB A;  4A3B G;  1TXY A;  1K9M C;  4ME3 A;  1Z9F A;  4JOI A;  1NY4 A;  1SLJ A;  3F2B A;  2E2J H;  1AE3 A;  2KHI A;  2WB1 E;  4H02 A;  4BY1 H;  5IYD G;  2RHS B;  3F1Z A;  4JI4 Q;  4B3R L;  4B3M Q;  4IPH A;  4DV7 L;  5BR8 Q;  4DR2 L;  1JT8 A;  2BH8 A;  1HZB A;  4DV4 Q;  2ZJR A;  1VQC A;  1JMC A;  1VQH A;  2JK8 A;  3T1Y L;  2UXB L;  1U5K A;  4WJ3 M;  4RG1 A;  1VQ9 A;  4A3K G;  3A0J A;  4JI8 L;  3L7Z C;  5LMN W;  4P74 A;  5FLM H;  4QQB X;  2GN5 A;  3SGI A;  1CKN A;  3OTO L;  5LMN Q;  1M1K C;  4GKK Q;  4LFB Q;  4A3G G;  1WYD A;  2JE6 I;  4YY3 Q;  2JA9 A;  3A5Z B;  4X62 Q;  5M3F H;  1J5E Q;  5JEA G;  2ES2 A;  1NJI C;  3BZC A;  4A4I A;  4BBR G;  1EIF A;  4JCV E;  4X64 L;  1VQB A;  4LNQ A;  4IPD A;  2ZM6 L;  5IP7 G;  3M4P A;  1XMO Q;  3GTJ H;  2ALY B;  3PV0 A;  4AH6 A;  5IP9 H;  2NN6 G;  2VW9 A;  4DR7 L;  4DR5 L;  4YWK A;  2JEA I;  1VQ6 A;  1MIU A;  4A3I G;  1W2B A;  4KHP Q;  3PUW A;  2MO1 A;  3RZO H;  3CCE A;  4YWM A;  4APV A;  1Q81 C;  5GRO A;  2R92 G;  4LWC A;  4NXN L;  4X65 Q;  1N33 L;  4A3B H;  2YYZ A;  5IYC G;  4DV0 L;  1VQP A;  4A3C H;  4O0A A;  4DV3 Q;  2KHJ A;  2Z0S A;  2OTJ A;  2ID0 A;  4DK6 C;  3S2D H;  2AHO B;  3CQZ H;  5M5X H;  2K4K A;  1N36 L;  1HH2 P;  1VQ5 A;  4AYB E;  4YCU A;  3OYY A;  2AMC B;  1X65 A;  2NVY H;  4A3D G;  3G48 A;  4YHH Q;  1PH3 A;  1ASY A;  2UUA L;  2ASB A;  4LF8 L;  1NTG A;  4A3E G;  3HOW H;  4OO1 G;  4LUZ A;  4DR6 L;  1VQK A;  4LFC Q;  4DUY L;  1U0L A;  4P72 A;  3RN2 A;  4POF A;  3PIP A;  4L5S A;  1PH6 A;  4DV1 Q;  2KCT A;  4POG A;  1PHJ A;  2NVT H;  4BXX H;  1GO3 E;  1FVI A;  4JG2 A;  3I2Z A;  1N8R C;  3GTL H;  4MTN A;  4BBR H;  2Y0S G;  1QVF A;  3GTK H;  1SFO H;  1XNQ Q;  3BZK A;  3H3V I;  1XPR A;  2QEX A;  2H5X A;  3UE1 A;  5M3M H;  4B3T L;  1VQM A;  2D62 A;  4JI2 L;  3KOJ A;  1DGS A;  3JAM c;  4DR4 Q;  2GVA A;  1HNW Q;  4OX9 Q;  2KEN A;  1Q8K A;  2UUC Q;  2R7D A;  3S2H H;  4GLA C;  3UDF A;  2KBN A;  1GKH A;  2JA5 H;  3UDI A;  2R92 H;  3HOU H;  1VQF A;  5HGQ A;  3F2D A;  5IWA Q;  2K52 A;  4DR3 Q;  1KC8 C;  2VQF L;  2V1C C;  3D0F A;  1VQE A;  1PH8 A;  1B8A A;  4R4Q A;  3DM3 A;  2EIF A;  2F3I A;  1VS0 A;  5M5Y H;  2UUB L;  3S14 H;  5LMU L;  4DR1 L;  4JBM A;  2PQA A;  2VQE L;  1XJV A;  3I4N G;  1BVS A;  3CCU A;  4UP7 A;  1TWH H;  3PIO A;  4LF6 Q;  2NZO A;  4A3E H;  2VNU D;  3CCR A;  2YTY A;  4BBS G;  3MEF A;  3CCV A;  3I4O A;  1A8V A;  3NEL A;  1YHB A;  2E2H H;  3M3Y H;  5JJI A;  3S1N H;  3UDG A;  5C0X G;  1EIY B;  2B63 G;  1G51 A;  1L0W A;  3J7Z C;  2RF4 A;  4JV5 L;  1A0I A;  1SN8 A;  1YZ6 A;  3G6E A;  4BA1 I;  2EQS A;  4LFA L;  1HNX Q;  3STB D;  2MQH A;  4JI7 Q;  3U50 C;  2JA6 G;  3K80 C;  3CPW A;  4B3S Q;  1RIP A;  4A3M H;  4HJ7 A;  4JYA Q;  3DLL A;  1N9W A;  3CPF A;  1E1O A;  1KD1 C;  4TQU S;  5IYB H;  1IBL Q;  4L5R C;  2EXD A;  3PO2 G;  4LUO A;  1X3F A;  1C0A A;  3K0X A;  3KJO A;  4A93 G;  4X6A H;  4AIM A;  1I94 L;  4TVA B;  4LF7 L;  2N49 A;  4GLV B;  2XTI A;  3H0G H;  1LTL A;  3E9I A;  3W1B A;  3CCM A;  1FGU A;  1VCI A;  2E5L L;  1Q86 C;  4IPG A;  2LXK A;  4XTC S;  3NEM A;  1T9H A;  4PG3 A;  3RR5 A;  4Y7N H;  3FP9 A;  4JI1 Q;  1IBK Q;  1Q12 A;  4LF4 L;  1FJG Q;  4YCW A;  1GD7 A;  1M90 C;  1XMQ Q;  4DV5 Q;  3UDX A;  4DV6 Q;  5C3E H;  2NVX H;  2UU9 L;  4NXM Q;  3TS2 A;  4IOA A;  4QIW E;  1K73 C;  1MJC A;  1V9P A;  3AEV A;  1VQ8 A;  3K81 C;  4C3H H;  4PZ6 A;  1QZH A;  1VQJ A;  1EYG A;  4L5Q A;  4P75 A;  2Y0S E;  3GTG H;  4GOP B;  3M4O H;  4BY7 H;  3BU2 A;  2VUM H;  2OCE A;  2NN6 I;  1KL9 A;  4R4C A;  3PGZ A;  4GKJ Q;  1KXL A;  1PFS A;  2D0O A;  5IE8 A;  3KF6 A;  5GAE C;  4YWL A;  3S24 A;  4UP8 A;  3NEN A;  2CCZ A;  2E2I H;  1N32 Q;  4KI0 A;  3EBE A;  1VQA A;  4JI0 Q;  1YBY A;  1JJC B;  2CQO A;  4JI5 L;  2JQO A;  3PO2 H;  1X55 A;  5HY6 A;  4HIM A;  1Q82 C;  3AFP A;  3CME A;  2R7Z G;  4A93 H;  4GN4 B;  1H95 A;  5M5W H;  4JOI C;  2B29 A;  1K8G A;  3CC4 A;  2I5H A;  3I4M G;  1CSQ A;  1BBW A;  2F4V Q;  3HKZ G;  4O2D A;  1PH7 A;  1EWI A;  4JI4 L;  2ZJQ A;  2HHH Q;  1Q1E A;  4B3M L;  5BR8 L;  3CCQ A;  2ATW A;  4DR5 Q;  4OO1 I;  4DV4 L;  1WJJ A;  1S3O A;  2Q2I A;  3RLF A;  3U58 A;  2OWO A;  1VQD A;  2WP8 J;  3PUV A;  1PH1 A;  1AH9 A;  2A19 A;  4JI6 Q;  2K14 A;  1XPU A;  1VQ7 A;  5H1S E;  3BJU A;  5LMN L;  3CP0 A;  3L0O A;  4GKK L;  4LFB L;  3JC6 6;  1CKN B;  4YY3 L;  4X62 L;  4PZ7 A;  4HIO A;  1SMX A;  1J5E L;  2Z6K A;  3RN5 A;  3CF5 A;  1QVC A;  5IYD H;  1YNX A;  2OQ0 A;  4JBK A;  4UP9 A;  4A3L G;  3J81 c;  1IL2 A;  4OWW B;  1UE7 A;  4OWX B;  3J80 c;  1XMO L;  2UXC Q;  4QY7 A;  4J15 A;  1L2F A;  1BBU A;  2QA4 A;  3RNU A;  2MO0 A;  1IYJ B;  4A3K H;  1I6H H;  4KHP L;  1TWA H;  1HZA A;  2I5L X;  3UE0 A;  1Y1V G;  4LF9 Q;  3PCO B;  2AWO A;  1JJ2 A;  1HR0 W;  4X65 L;  3TRZ A;  4A3G H;  1TWG H;  1HR0 Q;  2HIX A;  4DV3 L;  1VQL A;  1X9N A;  3JAM i;  2JEB I;  5IP7 H;  2IX1 A;  2JA8 G;  3HOY G;  2RHQ B;  3ULP A;  2R6G A;  4NB3 A;  1Q7Y C;  1PH9 A;  1VQN A;  2WFW A;  3GTO H;  3PUY A;  2CWA A;  4YHH L;  2VZA A;  3M85 A;  1HJP A;  2BA0 A;  5AJ3 Q;  4A3I H;  1SE8 A;  1PVO A;  3IRB A;  5C0X I;  4LFC L;  4DUZ Q;  4AQY Q;  1JE5 A;  3W1G A;  5FJ8 G;  1OXV A;  2CFM A;  3CW2 C;  5IYC H;  5FLX c;  2E8G A;  1E7Z A;  4DV1 L;  3CD6 A;  1RL2 A;  3GTM H;  3CCL A;  2D0P A;  4DNI A;  1WCM G;  1OXS C;  3CMA A;  3FKI G;  4LF5 Q;  1NE3 A;  1NMF A;  2LXJ A;  1XNQ L;  2LSS A;  1VQO A;  4BA2 I;  3GTQ H;  1N34 Q;  1KAW A;  3PF4 A;  4XIG S;  4A3D H;  4GN3 B;  1Y1W G;  4GS3 A;  4DAM A;  4DV2 Q;  4DR4 L;  1HZC A;  4WJ4 A;  3L2P A;  4A76 A;  1HNZ Q;  4Y52 H;  1HNW L;  1KRS A;  1KHI A;  3F8T A;  1C9O A;  4OX9 L;  2IHE A;  2UUC L;  3OW2 A;  1YIT A;  2PMZ E;  4YCV A;  1Y1V H;  3HKZ E;  1CSP A;  3S1R H;  3CC2 A;  5IWA L;  5GAH C;  4DR3 L;  2XGT A;  3AQQ A;  4IJH A;  1LM0 A;  3TQY A;  1UE5 A;  4A3F G;  4IFD G;  1VQG A;  1C7Y A;  2L15 A;  3M4Q A;  1I5F A;  1OXU A;  4GN5 A;  5J3B A;  2OTL A;  4R4T A;  2PQA B;  1YHQ A;  1L1O A;  2AWN A;  5C4X G;  4GOP A;  4LF6 L;  2K5H A;  2K5V A;  3ERS X;  2ZTE A;  1CKM A;  2WAQ G;  2IY5 B;  2UXD Q;  4GNX A;  4LF7 Q;  1D7Q A;  1XTD A;  1V1Q A;  3KLW A;  4BY1 G;  1SRO A;  5FJ8 H;  1E22 A;  4K0K Q;  2N3S A;  3RLO A;  4X66 Q;  1XNR Q;  3CXC A;  1JB7 A;  3E0E A;  3CC7 A;  2HIV A;  4KHZ A;  4DK3 C;  1PV4 A;  1HNX L;  1P8L A;  2I0Q A;  4JI7 L;  2A1A A;  2NZH A;  3I4N H;  1IBM Q;  1OTC A;  4B3S L;  5JEA J;  3T1H Q;  4IO9 A;  2DGY A;  4JYA L;  4JI3 Q;  2KCM A;  1TWF H;  1UE6 A;  1SRU A;  2K5N A;  4NPS A;  3U4V A;  3F2C A;  1PA6 A;  1IXR A;  1IBL L;  2YU9 H;  3B6Y A;  1L1O B;  3M9B A;  1L1O C;  5GAD C;  5M3F G;  3AYH B; 
#chains in the Genus database with same CATH topology
 3MC0 B;  4KY5 A;  5DLQ E;  2I5M X;  4QF4 A;  4R4O A;  3HOV G;  1SNQ A;  1TWC H;  4DR2 Q;  4A3F H;  1K8A C;  1NR2 A;  4A3I B;  1IBK L;  3S2H B;  1EIG A;  3TS0 A;  2DJF C;  4DV6 L;  2JSO A;  1SR3 A;  1S40 A;  1B1Z A;  4M1U B;  4OWT B;  3S16 H;  4X64 Q;  3OMC A;  4L6T B;  4B08 A;  1SJH D;  3ER0 A;  1EQR A;  4A3J G;  1TWH B;  2WII B;  1ILQ A;  3A7L A;  2ZJP A;  4GKJ L;  4HSP A;  3MA2 B;  3HOW G;  3M3Y B;  1MKH A;  3KF6 B;  3LGJ A;  3S1N B;  1OO9 B;  4HMJ A;  4G7H C;  2O5J C;  1QNK A;  1WOC A;  1NMG A;  1TVX A;  3H09 A;  5ELN A;  3J81 i;  1Y8P B;  2TMP A;  3BDO A;  3EN2 A;  4EX5 A;  4IN3 A;  1SE4 A;  4HJ5 A;  4OXP A;  2HT1 A;  1SYD A;  1X3E A;  5JJK A;  1QUQ A;  2B8F A;  1QE6 A;  3HOZ H;  4LF8 Q;  3MFY A;  1QG7 A;  4C3I H;  2WAQ E;  1B7Y B;  3OOC A;  1HA6 A;  1I3Q H;  1JJG A;  2KJX A;  4EQP A;  4DF7 A;  2EJF C;  1HUN A;  2DN8 A;  1H9J A;  3PO3 H;  1KRT A;  3I4M H;  1EZ8 A;  2XNA C;  2Z6K C;  3MEH A;  4R1J A;  3UI2 A;  5I9P A;  4B3T Q;  2NVX B;  2DY7 A;  2QGQ A;  5C5M A;  1VQ8 A;  2K03 A;  1UWV A;  4C3H B;  4PMW A;  1X56 A;  4WFN 3;  1QUQ B;  1T5X D;  4LF9 L;  5AFW A;  2N8N A;  1PH5 A;  3PUX A;  3GDE A;  4IFD I;  1HZ9 A;  3PIP 3;  1KIX A;  3NBH A;  2JA6 B;  1TII D;  3I3C A;  2NVQ H;  1H9S A;  4RAU C;  2R93 H;  1SE3 A;  3HFZ B;  3NTK A;  1YI2 A;  2OQK A;  1CUK A;  2X6G A;  3SDZ A;  3MXN B;  2VQE Q;  4FF2 A;  3PO2 B;  1XPO A;  1OXT A;  4KN7 C;  3DMU A;  2L5T A;  2PNH A;  1QVG A;  4CJ2 C;  2IX3 A;  2XVS A;  1PYB A;  4DUZ L;  3E9H A;  1G6P A;  4PQX A;  3NWT A;  1V43 A;  2F0E A;  4KLK A;  4DPG A;  2K5Q A;  4C3J H;  5C44 H;  1A62 A;  1O7Y A;  1ICW A;  1HTL D;  1NBW A;  3N52 A;  5IOC A;  3LWU A;  1H9R A;  2OEO A;  3NBH B;  3KBX A;  3K57 A;  5J39 A;  1DD2 A;  5C3E G;  2HQL A;  1GVP A;  1VMC A;  5E7N A;  5FK9 C;  2F0J A;  4C3H G;  3MVV A;  1ILP A;  4FYD A;  4HJ9 A;  1PH2 A;  1S5F D;  4IOC A;  3BYY B;  1YIJ A;  4NDX A;  2VS1 A;  2BH2 A;  1KNE A;  4IQZ A;  1SNC A;  1XXG A;  3H15 A;  1JOO A;  2K6A A;  2N55 A;  1DOM A;  4S3S A;  2F0P A;  1DOL A;  3R8B A;  2F0I A;  3U9S A;  1EY4 A;  4P73 A;  4A3G B;  1TWG B;  5FLM G;  1GM5 A;  1YJN A;  3I7F A;  1GUS A;  3PF5 A;  3RLN A;  1YJW A;  3AMU A;  1A63 A;  2KA7 A;  3P20 A;  1PFN A;  4HTH A;  1EOT A;  2HQE A;  4IZ8 A;  1IL8 A;  1TS3 A;  2PQE A;  4JI5 Q;  1Q90 A;  1TS4 A;  1K9M C;  4ME3 A;  1ET9 A;  3F2B A;  1B3A A;  2WB1 E;  2F0F A;  4JI4 Q;  1B9M A;  2QIL A;  5BR8 Q;  1JT8 A;  4ZKC B;  2BH8 A;  2O4X A;  5IIF A;  1VQC A;  1VQH A;  2JK8 A;  3T1Y L;  1U5K A;  1JWM D;  1EU3 A;  4WJ3 M;  2K28 A;  3HS0 C;  1HPC A;  1LV9 A;  3L7Z C;  2IJ0 A;  1B2T A;  4P74 A;  3OWF A;  2WV6 D;  3SGI A;  3OTO L;  4QQB X;  5DNF A;  4A3G G;  4YY3 Q;  4XDX A;  3FEW X;  3BZC A;  3S1Q B;  4H44 C;  4NP5 A;  5IP7 G;  2C5C A;  2ALY B;  2NN6 G;  1IYU A;  1VQ6 A;  4KJO A;  1LTA D;  2JEA I;  5FO7 B;  1BCP D;  3GTP B;  3TP5 A;  2F0U A;  2MO1 A;  1Q3L A;  3CCE A;  2F0O A;  3GV6 A;  2R92 G;  1N33 L;  5IYC G;  3J80 E;  1VQP A;  2RQX A;  2PZW A;  2ID0 A;  4RWS C;  2P5Z X;  3S2D H;  3CQZ H;  3TZD A;  1EIH A;  4KMU C;  3OYY A;  2AMC B;  1X32 A;  2MP1 A;  2YU9 B;  4YHH Q;  1XTC D;  4DR6 L;  1DXM A;  4DUY L;  5JOB A;  2J0T D;  4P72 A;  4L5S A;  1TWC B;  1BO0 A;  1JB3 A;  3A8K E;  4MIU A;  4BWG B;  4CKB A;  4A3F B;  2EY1 A;  1GO3 E;  4JVZ A;  2OF1 A;  4EQO A;  1NSN S;  1QVF A;  1RCV D;  4DAV A;  1SFO H;  1EWH A;  3H3V I;  5M3M H;  1BBX C;  4JI2 L;  1DGS A;  3JAM c;  1V1O A;  5FLX E;  4OX9 Q;  2KEN A;  3S16 B;  2UUC Q;  3K0Y A;  4GLA C;  3UDF A;  2JA5 H;  1Y8O B;  3F2D A;  4DR3 Q;  1DCZ A;  1FR3 A;  4DNR B;  5M5Y H;  5COR A;  5LMU L;  2PQA A;  1XJV A;  1V1P A;  1EYA A;  2PO4 A;  2KED A;  1BVS A;  2LS0 1;  4LF6 Q;  2NZO A;  3VA7 A;  4A3E H;  2K5D A;  3EQL C;  3PIO 3;  3CCV A;  4O42 A;  1YHB A;  1EIY B;  1G51 A;  2NWG A;  2RF4 A;  5C6A A;  4WJW A;  4KKS A;  3HOZ B;  4ZUI A;  1YZ6 A;  2EQS A;  5ELF A;  3STB D;  4RGM A;  1I3Q B;  3K80 C;  2B39 A;  1HRJ A;  2D9U A;  4JYA Q;  1DJR D;  1EY6 A;  1N9W A;  1GHJ A;  1XWE A;  3CPF A;  5IYB H;  3FPP A;  4L5R C;  2EXD A;  3PO3 B;  1O78 A;  3Q0A A;  3V05 A;  1I94 L;  1CM9 A;  4KHV A;  2KEC A;  1S5B D;  4GLV B;  2XTI A;  4Z9C B;  1LTL A;  3W1B A;  3CCM A;  1VCI A;  2KQ3 A;  1Q86 C;  1T9H A;  1A3V A;  1IBK Q;  5G3L D;  5DM6 3;  1UAP A;  3QR8 A;  2QEJ C;  4DV6 Q;  2UU9 L;  4IOA A;  5FO8 B;  2PZU A;  3TS2 A;  1MJC A;  1V9P A;  3K81 C;  2R93 B;  1LAB A;  3OIP A;  5EKK A;  3KUP A;  2NN6 I;  3IKJ A;  4R4C A;  1KXL A;  4GKJ Q;  1PFS A;  3H91 A;  4PNY A;  4CBV A;  1PRT F;  4UP8 A;  3NEN A;  1EY7 A;  4C3I G;  3IFD A;  3HOU B;  1VQA A;  1YBY A;  1JJC B;  3D6W A;  5HY6 A;  4HIM A;  3AFP A;  3NTI A;  4C3J B;  5IGD A;  4C1N I;  5C44 B;  1F9S A;  2CVR A;  5M5W H;  2B29 A;  4IAL A;  3CC4 A;  1ESF A;  3I4M G;  2OXP A;  1EWI A;  3T53 B;  1YNN C;  3QOL A;  3VA5 A;  3V2T A;  1S3O A;  2Q2I A;  2OWO A;  2A69 D;  1AW7 A;  1VQD A;  2WP8 J;  1PH1 A;  1AH9 A;  1J9O A;  5BN4 A;  3RD4 A;  1XPU A;  4XYO A;  2D2C C;  5CV9 A;  4J1M A;  3BJU A;  4LFB L;  1B4O A;  3E3X A;  1EY8 A;  4N8X 1;  1CKN B;  4RGN A;  3OPO A;  3RN5 A;  1I4R A;  4H13 C;  5IYD H;  1VF5 C;  2OQ0 A;  3J81 c;  3T51 B;  4N9T A;  2QCP X;  1ZYR D;  2WKD A;  2RSN A;  1KLU D;  4MTK A;  3J7A V;  2JP1 A;  1L0X B;  1I6H H;  4KHP L;  1TWA H;  4LF9 Q;  1RKN A;  2HIX A;  3J81 L;  5JEA H;  1JOK A;  1STY A;  3ULP A;  2R6G A;  1Q7Y C;  2MUY A;  2NB0 A;  3SK8 A;  3PUY A;  1BQQ T;  1TQO A;  1PVO A;  4A3I H;  3GTG B;  1G8Z D;  4DUZ Q;  5I6Y A;  3W1G A;  5FJ8 G;  4ZKB B;  3CD6 A;  2DJG C;  4HCS A;  3SR1 A;  3CMA A;  1NE3 A;  1XNQ L;  2LSS A;  1F2Z A;  2F0T A;  4GN3 B;  4DR4 L;  4Y52 H;  1HZC A;  4WJ4 A;  2VXW A;  1KRS A;  1HNW L;  2ZT9 C;  4C56 C;  3H94 A;  1DON A;  4TSS A;  4KY6 A;  2XGT A;  3AQQ A;  4IJH A;  1EQT A;  2B2V A;  2LKV A;  3M4Q A;  5CC4 A;  5M9O A;  1GUO A;  4GN5 A;  2OTL A;  3LWE A;  3HZX A;  5IGC A;  4K6L A;  5C4X G;  4DK1 A;  2ZTE A;  1CKM A;  2WAQ G;  1D7Q A;  1XTD A;  3KLW A;  1KAA A;  1PRT D;  1E22 A;  3RLO A;  4RH6 A;  2F0S A;  1PV4 A;  1HNX L;  2IWH A;  2I0Q A;  4JI7 L;  2B2V C;  2AQ1 B;  1UE6 A;  1SRU A;  4NPS A;  1PA6 A;  3B6Y A;  3M9B A;  1SFO B;  1I4Q A;  1SYG A;  3BVG A;  3FMC A;  1ENA A;  4L8J A;  4JW0 A;  1YEZ A;  3T1Y Q;  2JA6 H;  3VDY A;  4IJL A;  2JA5 B;  2F0M A;  3S9W A;  4WOR A;  5CBE E;  1XMQ L;  2JJQ A;  3C46 A;  1F2M A;  3ONA B;  3OTO Q;  1PTO F;  1LYL A;  2KVM A;  5IY0 A;  4B9W A;  5K36 G;  4ZYS A;  5M5Y B;  1B3Q A;  2B3G A;  4MZ9 A;  3RZD H;  4A3D B;  3DXJ C;  4RMF A;  5K5P A;  1HXY D;  4A3E B;  2Z4H A;  4PZ8 A;  1EY5 A;  2HCI A;  2J4X A;  1EFW A;  1UEB A;  3R2I A;  1Z47 A;  1N32 L;  4QIW B;  3A5U A;  1EUJ A;  4JI0 L;  1N33 Q;  1IZ6 A;  2Y0S B;  3NE5 B;  5EPJ A;  2N78 A;  3KFU A;  1HQR D;  1HHV A;  1D6E C;  1E3P A;  5M3M G;  2HHH L;  4HIK A;  5HGT A;  4QGU A;  2YTX A;  4R4I A;  4DR6 Q;  1IW7 D;  2K32 A;  2ZXO A;  4DUY Q;  3HKS A;  2JA5 G;  4RGO S;  1Q1B A;  1TU2 B;  1LT5 D;  4K5X A;  1AZQ A;  2Z9H A;  2YTV A;  2ZTC A;  4JI2 Q;  1I4P A;  2UXC L;  4KN4 C;  2IX1 A;  2A73 B;  3ZYY X;  1ASZ A;  2MFI A;  1C4Q A;  4BBS B;  1CFM A;  1YHA A;  2A68 D;  1SYB A;  3TP7 A;  2Q2H A;  1RF2 D;  2DNE A;  3K7A B;  1Q46 A;  4IUV A;  4G7O C;  3PUZ A;  4FXG C;  3JAM E;  2I46 A;  2A6E D;  2WB1 G;  3AFQ A;  4A3L H;  5LMU Q;  3HOX G;  2QKI C;  3GQB A;  3STB C;  3G4S A;  2XN9 C;  4J6H A;  1NAP A;  1CA6 A;  5BN3 A;  3DHQ A;  5IYB G;  2PI2 E;  2K7V A;  3KBG A;  5M5W B;  3KYH C;  4A75 A;  1EYD A;  3TRE A;  2IW3 A;  4AQY L;  2C35 B;  1LTS D;  1GUW A;  1LTB D;  5JJL A;  3GO5 A;  1YVC A;  4QJF A;  2Q2T A;  4X3S A;  2BA1 A;  3HOY H;  2E2D C;  3S1Q H;  5CV4 A;  4RFB A;  2NZ1 D;  2QF7 A;  4TRD A;  5I2Y A;  2F0W A;  1SND A;  3K59 A;  5EPK A;  4JBJ A;  1I94 Q;  3KK7 A;  3KF8 B;  3GTP H;  2K01 A;  3CRK C;  3D4D A;  4L5T A;  1R9T H;  1E0B A;  3O13 A;  2A5H A;  2VL6 A;  3D31 A;  3A7A B;  3M7G A;  3EJI A;  4FP5 D;  1PMR A;  4KK7 A;  3T13 A;  4V0B A;  1I6H B;  2B8G A;  2B2U A;  2FJ2 A;  3NQT A;  4RKL A;  1HTP A;  3MTS A;  2Q8I B;  2M00 A;  2UU9 Q;  2R7Z B;  4IUR A;  1I50 H;  4K5W A;  1SE2 A;  3SE0 A;  2PMZ B;  1X3P A;  4LUV A;  3HKZ B;  2EYF A;  1PYS B;  4GNX B;  4GNX C;  2JA7 H;  1SSO A;  2QDB A;  5IGB A;  1XNR L;  3VYS A;  1EOV A;  4OON A;  5J1Z A;  4ULL A;  1AP0 A;  4UAI A;  4EQ5 A;  4JI3 L;  1JQY D;  2A69 C;  3QG1 A;  5NUC A;  3NP8 A;  1TXY A;  4JOI A;  1A2U A;  4KV6 A;  4XQJ A;  2QDL A;  1AE3 A;  1CHP D;  2KHI A;  4H02 A;  5IYD G;  2RHS B;  3VYT A;  3H6M A;  4B3R L;  4IPH A;  4DV7 L;  2ZJR A;  1ZYR C;  3IL8 A;  5EQ0 A;  2K05 A;  3W2D A;  1GHK A;  2NYZ D;  1MGS A;  4RG1 A;  1WTP A;  1PTO H;  1M1K C;  4LFB Q;  2EE1 A;  1WYD A;  1PLF A;  5JEA G;  1W6K A;  1NJI C;  2JA8 B;  4BBR G;  1EIF A;  1VQB A;  1FNW A;  1SYC A;  5CYU A;  1KNA A;  5IP9 H;  2EPB A;  5EBD A;  1G2S A;  1MD2 D;  5ELC A;  4A3I G;  4KHP Q;  3I70 A;  3PUW A;  3RZO H;  4LWC A;  4A3B H;  3J81 E;  2YYZ A;  2KOL A;  4DV0 L;  2EOT A;  4A3C H;  1JWU D;  1GXD C;  2Z0S A;  2BE5 C;  2RBM A;  3D6C A;  2JXM B;  1YNJ C;  2FIN B;  4DK6 C;  1ROD A;  1N36 L;  4AYB E;  1Y1W B;  1TT2 A;  1CHQ D;  2RSO A;  3BS1 A;  4R9W A;  2ASB A;  1ASY A;  1NTG A;  3X3M A;  5IGG A;  3BDC A;  3RMH A;  1B9N A;  2B2T A;  3NTH A;  1BCP F;  1GUT A;  4HMI A;  4POG A;  2NVT H;  2A74 C;  4JG2 A;  4C1N K;  3DWP A;  3R2T A;  2KHS A;  3GTK H;  1XNQ Q;  2A6H C;  4ZCK A;  3QOJ A;  1VQM A;  5CV7 A;  2F1M A;  4DR4 Q;  4K5V A;  2GVA A;  1HNW Q;  1Q8K A;  4DXG A;  4BY1 B;  3RZD B;  2KBN A;  3UDI A;  3HOU H;  1D1K A;  5HGQ A;  5JVG 3;  1SBB B;  3NSW A;  3SK4 A;  2VQF L;  2V1C C;  1PRT B;  1PZJ D;  1PRT C;  1PH8 A;  4R4Q A;  4GZY C;  2AQ2 B;  2EIF A;  2X6L A;  1K3B C;  1H9S B;  5DEH A;  1LTT D;  1O7Z A;  1EEI D;  3PIO A;  5D65 A;  2VNU D;  3CCR A;  2YTY A;  2K33 A;  3UDG A;  1A0I A;  1PZI D;  1HCZ A;  1HNX Q;  4JI7 Q;  3U50 C;  2EVB A;  2JA6 G;  1EQV A;  4OGQ C;  5KND A;  3EFX D;  4N9P A;  3DLL A;  1E1O A;  1KD1 C;  1MHW C;  3PO2 G;  3HEJ A;  3K0X A;  3SK6 A;  3KJO A;  4KJN A;  5JPM C;  1WTQ A;  4TVA B;  2N49 A;  4DN4 M;  4RCN A;  4IUN A;  4MHE A;  4Y7N H;  3BVM A;  3K6O A;  2WAC A;  1M90 C;  4DU9 A;  1XMQ Q;  1EY9 A;  3C1E A;  4F7X A;  1KDC A;  4QIW E;  3EVQ A;  1F9Q A;  3DEO A;  2L9H A;  4PZ6 A;  1S5C D;  2DNC A;  4IUU A;  1EYG A;  2LFN A;  4P75 A;  2Y0S E;  3GTG H;  3M4O H;  3BU2 A;  3ND9 A;  1D5M C;  1F77 A;  2JYO A;  1KL9 A;  3PGZ A;  2D0O A;  4LK1 C;  4B9X A;  4YWL A;  3S24 A;  5A2Q E;  4LMQ D;  1L0Y B;  1SDF A;  1N32 Q;  4JI0 Q;  2L11 A;  4YIJ A;  1SMY D;  5G3L F;  4DXF A;  4A93 H;  4GN4 B;  3HOY B;  1K8G A;  3K5M A;  2I5H A;  3TBI B;  1CSQ A;  1BBW A;  2HHH Q;  1I4H A;  1U4L A;  2K1B A;  2CW0 D;  3CCQ A;  4QUC A;  4DR5 Q;  5KYI A;  4DV4 L;  1S5E D;  4KD3 A;  5A35 A;  1R9T B;  2EYO A;  5HUR A;  1ENF A;  2A68 C;  1VQ7 A;  5H1S E;  3FDT A;  4X3U A;  5LMN L;  4ABN A;  3ND8 A;  5D3I B;  2EYM A;  3I73 A;  1GJX A;  2B2W A;  3R3O A;  1QVC A;  1YNX A;  4JBK A;  3BYT B;  4A3L G;  4A3M B;  2PPB C;  2QW7 A;  4OWW B;  1UE7 A;  1XMO L;  2UXC Q;  1I50 B;  4J15 A;  1CZG A;  3RNU A;  2Z8L A;  4H7B A;  1R4P B;  2HD3 A;  3H0G B;  1HZA A;  3UE0 A;  2JA7 B;  3PCO B;  2AWO A;  1JJ2 A;  1KDA A;  3TN2 A;  3LX0 A;  5CV5 A;  2JEB I;  3T16 A;  3HOY G;  1RHP A;  2N88 A;  2Q8R E;  3M85 A;  2VZA A;  2BA0 A;  4CJ0 B;  3Q23 A;  3QO2 A;  1Y8N B;  2F0V A;  3I4L A;  4XT3 B;  4BY7 B;  4LFC L;  1E2Z A;  4AQY Q;  1JE5 A;  4ID6 A;  2CFM A;  3CW2 C;  4DV1 L;  3GTM H;  3TDQ A;  3QIA A;  4QB4 A;  5C3X A;  1SNP A;  2EY5 A;  1PTO B;  1PTO C;  4BA2 I;  4A3D H;  4XIG S;  5I9O A;  4GS3 A;  4DAM A;  1WTH A;  3L2P A;  4A76 A;  4OO1 H;  4PMB A;  1NCV A;  1YIT A;  2PMZ E;  4YCV A;  1Y1V H;  3HKZ E;  1NUC A;  2FFK B;  3AU7 A;  3CC2 A;  3T4A C;  1LM0 A;  3TQY A;  4A3F G;  1LT3 D;  1C7Y A;  3RZO B;  2MHV A;  2K5W A;  1OXU A;  5J3B A;  4A3B B;  3NXW A;  4R4T A;  2PQA B;  1W6J A;  3TP6 A;  1V1P B;  2CQA A;  2AWN A;  4GOP A;  2K5V A;  3ERS X;  2IY5 B;  4LF7 Q;  5LL6 S;  1V1Q A;  1E2V A;  1SRO A;  2E74 C;  1XNR Q;  3CXC A;  5C4Z A;  1I4X A;  2SNS A;  1JB7 A;  1DYQ A;  1PYW D;  4A3K B;  3LNN A;  4B3S L;  1MI2 A;  5JEA J;  4XQN A;  2BDN A;  5T1I A;  4JI3 Q;  2NVT B;  3WDN A;  1JC7 A;  1RD9 D;  4U68 A;  4BBS H;  5GAD C;  3GTK B;  1AN8 A;  4GOP B;  1MSG A;  4GOP C;  2RVL A;  5C0X H;  1VQI A;  4FDB A;  1HFN A;  1FNV A;  3K7A H;  1AZP A;  4B3R Q;  1BNZ A;  4DV7 Q;  1CKO A;  3J7A 5;  4IFD H;  3HOZ G;  4JI1 L;  1AE2 A;  4JBW A;  2DUD A;  3D3R A;  5I6W A;  4NXM L;  3G7L A;  4A3C G;  1X6O A;  3PQI A;  3PO3 G;  3FRP B;  1S72 A;  3U4Z A;  4HJ8 A;  3GD7 A;  1CQF A;  1F9R A;  1GUN A;  2XRS D;  2F0D A;  2K75 A;  5GQO A;  1SEB D;  4BS9 A;  3M4Y A;  1O7L A;  2KCC A;  3K8A A;  3W3A A;  1UUP A;  4DV0 Q;  2WKC A;  4J8Q A;  4UPA A;  4EQN A;  2R93 G;  1EQQ A;  1N36 Q;  2IPK D;  2F4V L;  3HOV H;  3I91 A;  5FO9 B;  1JWS D;  2RKS A;  1RTO A;  3HP3 A;  3KLS X;  3P75 A;  2EJG C;  1W3S A;  4JI6 L;  3HOU G;  4QCL A;  2R7Z H;  4ILW A;  4Y7N B;  1E1T A;  4C3J G;  5C44 G;  3I4N B;  4GLX A;  4A3J H;  3TEH B;  2ZTD A;  3DEP A;  4KD4 A;  3NPP A;  3IAY A;  3A74 A;  1FD7 D;  4HJA A;  3M4O B;  2B63 B;  2RCN A;  1D8L A;  4KKU A;  4XQQ A;  3OIQ A;  5IT9 c;  2VQF Q;  2ZJQ A;  1K3R A;  1K0R A;  2LMC B;  4AYB B;  1MBY A;  1JCK B;  1TR5 A;  3OMG A;  3MZ5 A;  1CA5 A;  2XSC A;  2HUG A;  1FNU A;  2M2L A;  1J6Q A;  5EKL A;  4A93 B;  1B70 B;  4MNO A;  5IT9 L;  4R8N A;  3PSI A;  1ICF B;  4FXK C;  2YV5 A;  2R3Z A;  1KDB A;  3Q8D A;  3N6R A;  1F2L A;  2R7F A;  2JA8 H;  3AB9 A;  1VQ4 A;  2F3W A;  4JC0 A;  1SYF A;  4ZQ3 A;  1N34 L;  5EJW A;  1PXU A;  1LUZ A;  1IYV A;  1O7I A;  1UE1 A;  4CJ1 B;  5E4X A;  5E4W C;  2FMM A;  5C4J H;  1G29 1;  4XT1 B;  1X3G A;  1ZXT A;  1WCM H;  3S1M H;  1A3U A;  2SDF A;  1QIL A;  4NMZ A;  4UHV A;  4MN3 A;  4AYB G;  2A8V A;  4DA2 A;  4IPC A;  1Y1W H;  2FXQ A;  3FHW A;  1KLG D;  4LJZ C;  1F2Y A;  5EBC A;  4DGZ A;  5ELB A;  1KQS A;  4ALP A;  4X66 L;  4P71 A;  2CH4 W;  4ZAI A;  3I56 A;  3J81 j;  1B53 A;  2CW0 C;  3KLS A;  2C9O A;  1BCP B;  5FKA C;  1BCP C;  1M8A A;  3T1H L;  1IBM L;  3K5O A;  3H3V H;  2K50 A;  4I7Z C;  3A55 A;  3GTM B;  2GVB A;  3TME A;  2E76 C;  3S17 B;  1Z9F A;  3MXG A;  2E2J H;  4BY1 H;  1AFP A;  3F1Z A;  3L9A X;  5KNC A;  1SXT A;  1ONL A;  1CZW A;  4DV4 Q;  2UXB L;  4H0L C;  1Y1V B;  2MJ8 A;  3A0J A;  4JI8 L;  5LMN W;  5FLM H;  5LMN Q;  1C8C A;  1CTM A;  2B2Y A;  2JE6 I;  3G6J B;  3L3O C;  2JA9 A;  5EGT A;  5M3F H;  2JN4 A;  2EXZ A;  2NTT A;  4RKB A;  1HFG A;  5CV6 A;  4A4I A;  2ZM6 L;  1A15 A;  1UEA B;  3TSS A;  3GTJ H;  1XMO Q;  2VW9 A;  4DR7 L;  4DR5 L;  1MIU A;  5T1G A;  5KEE A;  1W2B A;  1DZ1 A;  4CDE C;  4YWM A;  4APV A;  1Q81 C;  5GRO A;  4NXN L;  4CDD C;  2L1B A;  1NNX A;  3URY A;  3CKI B;  3TP8 A;  2OTJ A;  3KLR A;  4HAE A;  2AHO B;  2K4K A;  1WTX A;  3DM1 A;  2EYH A;  4A3D G;  4ZRZ A;  1JOQ A;  2UUA L;  3DUZ A;  4A3E G;  3D8G A;  4OO1 G;  4LUZ A;  4LFC Q;  4TKO B;  3RN2 A;  4POF A;  3PIP A;  1PH6 A;  1TKW B;  4DV1 Q;  4BXX H;  1TY2 A;  1FVI A;  3I2Z A;  3J80 L;  1N8R C;  2Y0S G;  2XWB B;  5CBA E;  2H5X A;  2D62 A;  2KCN A;  1R4Q B;  1LAC A;  1G2T A;  3NQI A;  5CV8 A;  4OIJ A;  2R7D A;  4UDU C;  2HDM A;  2G9D A;  3MAQ A;  1GKH A;  2R92 H;  2ZXP A;  3MFG A;  1B8A A;  3DM3 A;  1VS0 A;  2UUB L;  1C48 A;  4DR1 L;  4JBM A;  2H4O A;  4UP7 A;  1B44 D;  4F88 A;  3ITP A;  2J7Z A;  1KTK A;  5FLX L;  4BBS G;  2E2H H;  3I4O A;  1A8V A;  3NEL A;  3HOV B;  2PW5 A;  5C0X G;  1D5Z C;  3J7Z C;  4JV5 L;  1SN8 A;  2ENB A;  3G6E A;  4LFA L;  5L37 A;  2MQH A;  3VR3 A;  3CPW A;  4RCO A;  4B3S Q;  4A3M H;  2F0Q A;  2CHB D;  4TQU S;  1S5D D;  4LUO A;  1X3F A;  4EGV A;  4X6A H;  2RA4 A;  1QJO A;  4LF7 L;  5M5X B;  3MXU A;  3H0G H;  4A3J B;  2E5L L;  4IPG A;  4XTC S;  3NEM A;  3HOW B;  4PG3 A;  4FO2 A;  3FP9 A;  4JI1 Q;  1Q12 A;  4LF4 L;  5ELD A;  2B2U C;  3UDX A;  3VR6 A;  4NXM Q;  1K28 A;  4I65 A;  1K73 C;  1LTR D;  4K6D A;  1DM0 B;  1QZH A;  1II3 A;  1EWC A;  3BDL A;  4BY7 H;  3SK5 A;  3BZD B;  5DAU A;  2VUM H;  1V8Q A;  2O2L D;  4DK0 A;  3J7A F;  4L63 B;  1D5X C;  3KF6 A;  1SYE A;  1ZKO A;  3WOE A;  5GAE C;  2CQO A;  2JQO A;  1Q82 C;  3FPU B;  3CME A;  1WTV A;  2R7Z G;  4IUQ A;  1U4R A;  1KAB A;  4JOI C;  3S14 B;  3QJY A;  2F4V Q;  3HKZ G;  2I07 B;  1PH7 A;  1Z7T A;  4CDF C;  1X3Q A;  1Q1E A;  5DM7 3;  4B3M L;  5LL6 X;  1E2W A;  2ATW A;  4OO1 I;  4X3T A;  3PUV A;  5C4J B;  4JI6 Q;  4X3K A;  2D5D A;  3CP0 A;  1WCM B;  3L0O A;  4GKK L;  3S1M B;  3Q6S A;  3QB3 A;  5ISR A;  4X62 L;  4PZ7 A;  1SMX A;  1J5E L;  2Z6K A;  1CT1 D;  1QOH A;  1IL2 A;  4CKE A;  1EL0 A;  1B50 A;  1EU4 A;  1L2F A;  2XRQ D;  2MO0 A;  3VR4 A;  4QMG A;  1M4V A;  4A3K H;  4X65 L;  4DV3 L;  3MXN A;  1YNN D;  2HDL A;  1X9N A;  1LTI D;  3H3V C;  2JA8 G;  5C3E B;  4WRD A;  4NB3 A;  1PH9 A;  1NR4 A;  2MGS A;  2WFW A;  5IT9 E;  2E2J B;  1HJP A;  5C0X I;  1STN A;  2E8G A;  1E7Z A;  1LLR D;  1RL2 A;  2B2T C;  3CCL A;  4DNI A;  2FMC A;  1WCM G;  1OXS C;  1LT4 D;  4DNT B;  2IL8 A;  5F2D A;  2LXJ A;  2E2I B;  3VR2 A;  1BUV T;  2RDF A;  1N34 Q;  1KAW A;  3PF4 A;  2EY2 A;  5TSS A;  3D4R A;  1Y1W G;  1I4G A;  5M3F B;  2Q8T A;  1KHI A;  3F8T A;  4U67 3;  4R8I A;  3K5L A;  2IHE A;  3SXH A;  3OW2 A;  1VMP A;  3HG9 A;  4IUT A;  3GTJ B;  2PCF B;  2E75 C;  1CSP A;  3S1R H;  5IWA L;  3F2U A;  1K8M A;  3P1H A;  2VB3 X;  2Z1C A;  3MXP A;  1BF4 A;  1VQG A;  5FOB B;  2L15 A;  1Y69 U;  1SJE D;  2BOS A;  1ESR A;  1YHQ A;  1L1O A;  4PMC A;  4JK1 C;  4FF4 A;  1BDO A;  1PDQ A;  2K5H A;  1ZEQ X;  2DY8 A;  4BY1 G;  5FJ8 H;  4X66 Q;  2F0L A;  1BXT A;  4DK3 C;  3X3N A;  2A1A A;  4ZK9 B;  1IBM Q;  3I4N H;  3T1H Q;  4IO9 A;  1SNO A;  3MHB A;  1TWF H;  2L55 A;  1IXR A;  5JPN C;  1IBL L;  1L1O B;  1L1O C;  4HR7 B;  5M3F G;  3AYH B;  3OSO A;  2CH4 A;  3P7J A;  2B63 H;  2AUJ D;  1ET6 A;  3ULL A;  3GTO B;  3OW7 A;  3RUZ A;  3KJP A;  2UXB Q;  1WI5 A;  2OT2 A;  1FJG L;  1WVL A;  2R92 B;  4JI8 Q;  1XYI A;  4K2K A;  1U4P A;  4DV5 L;  1IW7 C;  1WFQ A;  5C4X H;  1MJE A;  1Z6H A;  1PFM A;  1O80 A;  2ZM6 Q;  3GTQ B;  3K7U C;  1EYC A;  5KNB A;  3DWA A;  5EAY A;  4DR7 Q;  3T56 B;  5GAG C;  1X54 A;  2E2H B;  2V4D A;  1RTN A;  3S15 H;  4NXN Q;  3C3L A;  1EEF D;  4BXX G;  1SAP A;  2Z4I A;  3CRL C;  3J80 i;  4N8F A;  1QCB D;  1EY0 A;  4V19 0;  4BBR B;  2A6E C;  1Y14 B;  5CMD A;  3ICE A;  2UUA Q;  2IHF A;  1I6V C;  1G91 A;  5K36 H;  2LY7 A;  4DAP A;  1HA5 A;  1JR0 D;  2B2W C;  4DKA C;  3HRZ C;  3ZJY C;  4F8M A;  2MNA A;  1E24 A;  3ULJ A;  2VY3 A;  4OEL B;  3EIV A;  4QL5 A;  5C0X J;  5CR3 A;  1WTW A;  1K83 H;  4FF1 A;  1IKL A;  2VUM B;  4IFD J;  2Q2U A;  2XWJ B;  4E6I A;  1HR0 L;  3W5O A;  1PFB A;  2EZV A;  3S17 H;  4JPB W;  4P2C B;  2ICE C;  2UUB Q;  3SEB A;  3KDF A;  4DR1 Q;  3M7N A;  4HCE A;  4DAY A;  3CHB D;  4A3M G;  2PNR C;  1VF7 A;  4RA8 A;  3I55 A;  1WD0 A;  1QZG A;  3E0J A;  3WWV A;  4LW1 A;  5AJ3 L;  2GA4 B;  3NWS A;  2KEE A;  2F0N A;  5EPL A;  4HID A;  4RGT A;  3H0G G;  2JA7 G;  2CKZ B;  4JV5 Q;  2XIW A;  2HCC A;  3NK9 A;  5ELE A;  4LFA Q;  3CCJ A;  4LF5 L;  1OXX K;  3J7Y W;  1STG A;  4UY8 C;  3GV3 A;  3JAM L;  1GUG A;  2PI2 A;  2CWP A;  3KDF B;  5ELO A;  4CGY B;  2NBF A;  4DAY B;  1H9M A;  4DV2 L;  1HNZ L;  4Q5V A;  1LO5 D;  3CAM A;  2F0H A;  4BY7 G;  2E5L Q;  3G71 A;  3ERQ A;  2VUM G;  2F52 A;  3CCS A;  3TZU A;  1J8I A;  1FL0 A;  3I72 A;  3FKI H;  1RDP D;  4LF4 Q;  4C3I B;  1BKB A;  4G57 A;  3HOX H;  1YJ9 A;  1P16 A;  2RCF A;  4C2M H;  3MWY W;  3BG3 A;  2FHT A;  2IX0 A;  2RDH A;  4CDC C;  1ML0 D;  3I4M B;  1CI3 M;  2AKW B;  2EY6 A;  2UXD L;  3Q24 A;  1LTG D;  5JJZ A;  4XYQ A;  1MSH A;  2F0K A;  5J22 A;  1U4M A;  4K0K L;  4HED A;  1PH4 A;  1U9R A;  2BCO A;  5IP9 G;  2IT1 A;  4ZLT F;  4OEM B;  1DOK A;  4M8A A;  3EA6 A;  2F3V A;  4A3B G;  3IFT A;  1NY4 A;  2NVQ B;  1SLJ A;  4LAA A;  3OWE B;  1QNU A;  4G4K A;  5JVH 3;  1K8O A;  4EVO A;  4B3M Q;  3ERO A;  4DR2 L;  5I2X A;  1HZB A;  1JMC A;  3E6Z X;  3C2P A;  1VQ9 A;  4A3K G;  1G6Z A;  2EYL A;  3S1R B;  2GN5 A;  1CKN A;  4F87 A;  2ZXR A;  4GKK Q;  4X62 Q;  3A5Z B;  1J5E Q;  2ES2 A;  4JCV E;  5C5L A;  4X64 L;  5D3D A;  4LNQ A;  4IPD A;  3K58 A;  3M4P A;  3PMF A;  3PV0 A;  4AH6 A;  1STH A;  4YWK A;  5IOD A;  3VYR A;  4ME5 A;  1RJT A;  4HSV A;  4OL7 A;  4X65 Q;  3CU7 A;  5BN5 A;  1WTR A;  3HGB A;  4O0A A;  2KHJ A;  4DV3 Q;  5M5X H;  1HH2 P;  1VQ5 A;  1TWF B;  4YCU A;  3NHH A;  1QB5 D;  2NVY H;  1X65 A;  1JIC A;  3QWN A;  2AQ3 B;  3G48 A;  5C3W A;  1PH3 A;  3HOW H;  4LF8 L;  4OIK A;  1T5E A;  2F4I A;  4K2L A;  1U0L A;  1K0S A;  2KCT A;  1PHJ A;  4PV1 C;  5JAV A;  1S4Z A;  2EDG A;  3U9O A;  3GTL H;  4MTN A;  4BBR H;  2R61 A;  5EKI A;  3BZK A;  5KYL A;  2QEX A;  1SNM A;  1XPR A;  3UE1 A;  2PW7 A;  4B3T L;  3WOF A;  3KOJ A;  5C4X B;  3NUC A;  3FVQ A;  2H1E A;  5I4D A;  2WAQ B;  2KUM A;  2X69 A;  3S2H H;  4HN7 A;  1STA A;  1VQF A;  1FGB D;  5IWA Q;  2K52 A;  2BE5 D;  1KC8 C;  3D0F A;  1YNJ D;  1VQE A;  4ZUJ A;  1EZ6 A;  5IGF A;  2EJM A;  2F3I A;  1UNS A;  1D1I A;  3S14 H;  4FVM A;  3S15 B;  2VQE L;  1HQM C;  1JE4 A;  3I4N G;  4NW2 A;  3CCU A;  1TWH H;  2ICI A;  5IGE A;  3SHL A;  4NKL A;  3MEF A;  5JJI A;  3M3Y H;  1EFI D;  3S1N H;  2B63 G;  2AUK A;  1L0W A;  4RHR A;  2A6H D;  4BA1 I;  5LHY 1;  4O1N A;  1RIP A;  1FYC A;  4HJ7 A;  2Z6B A;  1C0A A;  1IBL Q;  1Q8I A;  4A93 G;  2L12 A;  1SMY C;  4AIM A;  3S2D B;  3CQZ B;  1CQV A;  1ENC A;  1WD1 A;  3E9I A;  4ODG A;  5KGU A;  1FGU A;  4FF3 A;  4RHS A;  2LXK A;  1K83 B;  4QUF A;  3A8I E;  3RR5 A;  4K14 A;  5E1F A;  3Q22 A;  1FJG Q;  4YCW A;  1GD7 A;  1STE A;  4I7A A;  2K04 A;  2O5I C;  4DV5 Q;  5C3E H;  2NVX H;  4G7Z C;  3AEV A;  2VB2 X;  4C3H H;  1VQJ A;  4L5Q A;  2NUC A;  2TSS A;  2SEB D;  5M3M B;  1PZK D;  2OCE A;  2NTS A;  2RDG A;  1A2T A;  5IE8 A;  3C1F A;  1A3T A;  5KIX A;  1GOZ A;  2E2I H;  2CCZ A;  4KI0 A;  3EBE A;  3R93 A;  3E5S A;  1D2B A;  4JI5 L;  3PO2 H;  1X55 A;  4CKC A;  3K5N A;  1F9P A;  1H95 A;  1AEX A;  4DFA A;  4O2D A;  1IHZ A;  4JI4 L;  2G9H D;  5KRU A;  5BR8 L;  3DWQ A;  5CGK A;  1WJJ A;  3RLF A;  3U58 A;  4CHT B;  2A19 A;  2L0C A;  2SNM A;  2K14 A;  5A2Q L;  1CK1 A;  3FKI B;  3JC6 6;  4YY3 L;  2WB1 B;  4HIO A;  3VR5 A;  2B2Y C;  3CF5 A;  1WTO A;  3HOX B;  3A8J E;  1BR9 A;  4UP9 A;  4C2M B;  3J80 c;  4OWX B;  2WIN B;  4QY7 A;  3SVM A;  1BBU A;  2QA4 A;  2BDO A;  4KTA A;  1IYJ B;  1VDZ A;  2L4N A;  2I5L X;  1Y1V G;  1HR0 W;  3TRZ A;  4A3G H;  1TWG H;  2MPM A;  1HR0 Q;  2SOB A;  1VQL A;  1QWY A;  3JAM i;  1STB A;  5IP7 H;  1TY0 A;  2RHQ B;  2NN6 H;  1VQN A;  3GTO H;  2CWA A;  4YHH L;  5AJ3 Q;  1SE8 A;  2F0G A;  3IRB A;  1OXV A;  3OHX C;  5FLX c;  5IYC H;  2PYK A;  3I90 A;  5E3F A;  1H9K A;  2D0P A;  4FXD A;  1TS5 A;  4LF5 Q;  3NBI A;  3FKI G;  1NMF A;  4FNF A;  3GP7 A;  1VQO A;  3GTQ H;  1TS2 A;  2EYP A;  4DV2 Q;  1HNZ Q;  3KF8 A;  3BVZ A;  4OX9 L;  1C9O A;  1XX8 A;  3A54 A;  2UUC L;  3A56 A;  5GAH C;  4DR3 L;  1IKM A;  4XXE A;  3D4W A;  1LT6 D;  1UE5 A;  4IFD G;  2EYJ A;  2PZT A;  3VYU A;  4K8J A;  4OHJ A;  1I5F A;  2F03 A;  1JOR A;  4KKT A;  1BOS A;  4LF6 L;  2UXD Q;  4GNX A;  1A6X A;  3V96 A;  4K0K Q;  2N3S A;  2NVY B;  5C4H A;  5COY A;  3E0E A;  3CC7 A;  4K8I A;  2M9V A;  2HIV A;  4KHZ A;  1HUM A;  1P8L A;  1PTO D;  4Q0F A;  2NZH A;  1TWA B;  1OTC A;  2DGY A;  4JYA L;  3I8Z A;  2KCM A;  4KY7 A;  2K5N A;  3U4V A;  4IUP A;  3F2C A;  2YU9 H;  3GTL B;  5D14 A;  2G5D A;  1VQK A; 
#chains in the Genus database with same CATH homology
 4GOP C;  2B63 H;  5DLQ E;  2I5M X;  1VQI A;  4FDB A;  4R4O A;  3K7A H;  3ULL A;  3HOV G;  4B3R Q;  1TWC H;  4DV7 Q;  4DR2 Q;  1CKO A;  4A3F H;  1YEZ A;  3J7A 5;  3KJP A;  1K8A C;  3HOZ G;  3T1Y Q;  2JA6 H;  4JI1 L;  3VDY A;  1IBK L;  1WI5 A;  4IJL A;  2UXB Q;  1AE2 A;  4JBW A;  1FJG L;  3TS0 A;  4JI8 Q;  2DUD A;  1XMQ L;  2JJQ A;  4DV5 L;  3OTO Q;  4DV6 L;  1LYL A;  4NXM L;  5IY0 A;  1WFQ A;  5C4X H;  1SR3 A;  1S40 A;  5K36 G;  4A3C G;  1X6O A;  3PO3 G;  1MJE A;  4OWT B;  3S16 H;  4X64 Q;  1S72 A;  2B3G A;  3U4Z A;  2ZM6 Q;  4HJ8 A;  3K7U C;  4MZ9 A;  3RZD H;  3GD7 A;  3ER0 A;  4RMF A;  1EQR A;  4A3J G;  5EAY A;  4DR7 Q;  2ZJP A;  4GKJ L;  2K75 A;  4PZ8 A;  5GQO A;  5GAG C;  1X54 A;  3HOW G;  1EFW A;  1MKH A;  3KF6 B;  3LGJ A;  1UEB A;  1Z47 A;  1N32 L;  3A5U A;  1EUJ A;  4JI0 L;  3S15 H;  4NXN Q;  1N33 Q;  1WOC A;  1IZ6 A;  1NMG A;  3K8A A;  5ELN A;  4DV0 Q;  4BXX G;  3J81 i;  3EN2 A;  2N78 A;  4UPA A;  3J80 i;  4EX5 A;  3KFU A;  2R93 G;  1EQQ A;  1N36 Q;  2F4V L;  4HJ5 A;  3HOV H;  1E3P A;  4OXP A;  2HT1 A;  1Y14 B;  1X3E A;  5M3M G;  2HHH L;  4HIK A;  3ICE A;  5JJK A;  1QUQ A;  4QGU A;  2IHF A;  2UUA Q;  2YTX A;  4LF8 Q;  4R4I A;  3HOZ H;  4DR6 Q;  4C3I H;  2WAQ E;  1B7Y B;  1I3Q H;  4DUY Q;  3HKS A;  1W3S A;  2JA5 G;  4JI6 L;  1JJG A;  1Q1B A;  3HOU G;  2R7Z H;  1E1T A;  2YTV A;  3PO3 H;  5C44 G;  2ZTC A;  1KRT A;  3I4M H;  4GLX A;  2Z6K C;  4DKA C;  4R1J A;  3ZJY C;  4B3T Q;  4JI2 Q;  2MNA A;  1E24 A;  4A3J H;  3ULJ A;  2UXC L;  2QGQ A;  3TEH B;  2VY3 A;  2ZTD A;  3EIV A;  2MFI A;  1UWV A;  4QL5 A;  5C0X J;  1ASZ A;  3A74 A;  4PMW A;  1X56 A;  1K83 H;  4BBS H;  4HJA A;  1YHA A;  1QUQ B;  2Q2H A;  4IFD J;  2RCN A;  2Q2U A;  1D8L A;  4LF9 L;  1Q46 A;  2N8N A;  5IT9 c;  3PUX A;  3PUZ A;  3W5O A;  2VQF Q;  1PH5 A;  3GDE A;  1K3R A;  1HZ9 A;  1K0R A;  1HR0 L;  1KIX A;  3S17 H;  4IFD I;  2NVQ H;  2WB1 G;  3AFQ A;  2UUB Q;  4A3L H;  3HFZ B;  3KDF A;  5LMU Q;  2OQK A;  1CUK A;  4DR1 Q;  3HOX G;  3MXN B;  2VQE Q;  1YI2 A;  3M7N A;  3STB C;  3G4S A;  4A3M G;  1XPO A;  1J6Q A;  3I55 A;  1OXT A;  1QZG A;  1B70 B;  2PI2 E;  2PNH A;  3WWV A;  5IYB G;  1QVG A;  4MNO A;  3KYH C;  4LW1 A;  1PYB A;  5AJ3 L;  3PSI A;  4A75 A;  4DUZ L;  3E9H A;  3TRE A;  1G6P A;  4AQY L;  2C35 B;  4HID A;  3H0G G;  2JA7 G;  2CKZ B;  2R93 H;  4JV5 Q;  4KLK A;  1V43 A;  2YV5 A;  4DPG A;  3Q8D A;  4C3J H;  5C44 H;  4LFA Q;  3CCJ A;  1A62 A;  4LF5 L;  1OXX K;  3GO5 A;  5JJL A;  1YVC A;  4QJF A;  1NBW A;  2Q2T A;  4UY8 C;  2BA1 A;  2R7F A;  3NBH B;  2JA8 H;  3HOY H;  3S1Q H;  1VQ4 A;  2PI2 A;  2CWP A;  3KDF B;  4JC0 A;  5ELO A;  1N34 L;  5C3E G;  4DAY B;  1LUZ A;  2HQL A;  1GVP A;  4DV2 L;  5E7N A;  1HNZ L;  1O7I A;  1UE1 A;  4JBJ A;  1I94 Q;  3KF8 B;  3GTP H;  3CAM A;  1R9T H;  4HJ9 A;  4L5T A;  4BY7 G;  1PH2 A;  5C4J H;  2E5L Q;  4IOC A;  2VL6 A;  1G29 1;  1YIJ A;  3G71 A;  2VS1 A;  3D31 A;  2BH2 A;  2VUM G;  1X3G A;  2F52 A;  3CCS A;  1FL0 A;  1WCM H;  3FKI H;  3S1M H;  3H15 A;  4LF4 Q;  1BKB A;  3HOX H;  1YJ9 A;  1P16 A;  4AYB G;  2A8V A;  4P73 A;  4C2M H;  4IPC A;  1Y1W H;  2UU9 Q;  5FLM G;  2FXQ A;  3FHW A;  1GM5 A;  1YJN A;  1I50 H;  3I7F A;  2IX0 A;  3PF5 A;  4LUV A;  2AKW B;  3RLN A;  1YJW A;  2UXD L;  1PYS B;  4GNX B;  4GNX C;  1KQS A;  2JA7 H;  4ALP A;  4K0K L;  4X66 L;  4P71 A;  1XNR L;  1A63 A;  1PH4 A;  5IP9 G;  3I56 A;  1EOV A;  2IT1 A;  4OON A;  3J81 j;  1IBM L;  3H3V H;  3T1H L;  2K50 A;  4EQ5 A;  4JI5 Q;  4JI3 L;  2GVB A;  4A3B G;  1TXY A;  1K9M C;  4ME3 A;  1Z9F A;  4JOI A;  1NY4 A;  1SLJ A;  3F2B A;  2E2J H;  1AE3 A;  2KHI A;  2WB1 E;  4H02 A;  4BY1 H;  5IYD G;  2RHS B;  3F1Z A;  4JI4 Q;  4B3R L;  4B3M Q;  4IPH A;  4DV7 L;  5BR8 Q;  4DR2 L;  1JT8 A;  2BH8 A;  1HZB A;  4DV4 Q;  2ZJR A;  1VQC A;  1JMC A;  1VQH A;  2JK8 A;  3T1Y L;  2UXB L;  1U5K A;  4WJ3 M;  4RG1 A;  1VQ9 A;  4A3K G;  3A0J A;  4JI8 L;  3L7Z C;  5LMN W;  4P74 A;  5FLM H;  4QQB X;  2GN5 A;  3SGI A;  1CKN A;  3OTO L;  5LMN Q;  1M1K C;  4GKK Q;  4LFB Q;  4A3G G;  1WYD A;  2JE6 I;  4YY3 Q;  2JA9 A;  3A5Z B;  4X62 Q;  5M3F H;  1J5E Q;  5JEA G;  2ES2 A;  1NJI C;  3BZC A;  4A4I A;  4BBR G;  1EIF A;  4JCV E;  4X64 L;  1VQB A;  4LNQ A;  4IPD A;  2ZM6 L;  5IP7 G;  3M4P A;  1XMO Q;  3GTJ H;  2ALY B;  3PV0 A;  4AH6 A;  5IP9 H;  2NN6 G;  2VW9 A;  4DR7 L;  4DR5 L;  4YWK A;  2JEA I;  1VQ6 A;  1MIU A;  4A3I G;  1W2B A;  4KHP Q;  3PUW A;  2MO1 A;  3RZO H;  3CCE A;  4YWM A;  4APV A;  1Q81 C;  5GRO A;  2R92 G;  4LWC A;  4NXN L;  4X65 Q;  1N33 L;  4A3B H;  2YYZ A;  5IYC G;  4DV0 L;  1VQP A;  4A3C H;  4O0A A;  4DV3 Q;  2KHJ A;  2Z0S A;  2OTJ A;  2ID0 A;  4DK6 C;  3S2D H;  2AHO B;  3CQZ H;  5M5X H;  2K4K A;  1N36 L;  1HH2 P;  1VQ5 A;  4AYB E;  4YCU A;  3OYY A;  2AMC B;  1X65 A;  2NVY H;  4A3D G;  3G48 A;  4YHH Q;  1PH3 A;  1ASY A;  2UUA L;  2ASB A;  4LF8 L;  1NTG A;  4A3E G;  3HOW H;  4OO1 G;  4LUZ A;  4DR6 L;  1VQK A;  4LFC Q;  4DUY L;  1U0L A;  4P72 A;  3RN2 A;  4POF A;  3PIP A;  4L5S A;  1PH6 A;  4DV1 Q;  2KCT A;  4POG A;  1PHJ A;  2NVT H;  4BXX H;  1GO3 E;  1FVI A;  4JG2 A;  3I2Z A;  1N8R C;  3GTL H;  4MTN A;  4BBR H;  2Y0S G;  1QVF A;  3GTK H;  1SFO H;  1XNQ Q;  3BZK A;  3H3V I;  1XPR A;  2QEX A;  2H5X A;  3UE1 A;  5M3M H;  4B3T L;  1VQM A;  2D62 A;  4JI2 L;  3KOJ A;  1DGS A;  3JAM c;  4DR4 Q;  2GVA A;  1HNW Q;  4OX9 Q;  2KEN A;  1Q8K A;  2UUC Q;  2R7D A;  3S2H H;  4GLA C;  3UDF A;  2KBN A;  1GKH A;  2JA5 H;  3UDI A;  2R92 H;  3HOU H;  1VQF A;  5HGQ A;  3F2D A;  5IWA Q;  2K52 A;  4DR3 Q;  1KC8 C;  2VQF L;  2V1C C;  3D0F A;  1VQE A;  1PH8 A;  1B8A A;  4R4Q A;  3DM3 A;  2EIF A;  2F3I A;  1VS0 A;  5M5Y H;  2UUB L;  3S14 H;  5LMU L;  4DR1 L;  4JBM A;  2PQA A;  2VQE L;  1XJV A;  3I4N G;  1BVS A;  3CCU A;  4UP7 A;  1TWH H;  3PIO A;  4LF6 Q;  2NZO A;  4A3E H;  2VNU D;  3CCR A;  2YTY A;  4BBS G;  3MEF A;  3CCV A;  3I4O A;  1A8V A;  3NEL A;  1YHB A;  2E2H H;  3M3Y H;  5JJI A;  3S1N H;  3UDG A;  5C0X G;  1EIY B;  2B63 G;  1G51 A;  1L0W A;  3J7Z C;  2RF4 A;  4JV5 L;  1A0I A;  1SN8 A;  1YZ6 A;  3G6E A;  4BA1 I;  2EQS A;  4LFA L;  1HNX Q;  3STB D;  2MQH A;  4JI7 Q;  3U50 C;  2JA6 G;  3K80 C;  3CPW A;  4B3S Q;  1RIP A;  4A3M H;  4HJ7 A;  4JYA Q;  3DLL A;  1N9W A;  3CPF A;  1E1O A;  1KD1 C;  4TQU S;  5IYB H;  1IBL Q;  4L5R C;  2EXD A;  3PO2 G;  4LUO A;  1X3F A;  1C0A A;  3K0X A;  3KJO A;  4A93 G;  4X6A H;  4AIM A;  1I94 L;  4TVA B;  4LF7 L;  2N49 A;  4GLV B;  2XTI A;  3H0G H;  1LTL A;  3E9I A;  3W1B A;  3CCM A;  1FGU A;  1VCI A;  2E5L L;  1Q86 C;  4IPG A;  2LXK A;  4XTC S;  3NEM A;  1T9H A;  4PG3 A;  3RR5 A;  4Y7N H;  3FP9 A;  4JI1 Q;  1IBK Q;  1Q12 A;  4LF4 L;  1FJG Q;  4YCW A;  1GD7 A;  1M90 C;  1XMQ Q;  4DV5 Q;  3UDX A;  4DV6 Q;  5C3E H;  2NVX H;  2UU9 L;  4NXM Q;  3TS2 A;  4IOA A;  4QIW E;  1K73 C;  1MJC A;  1V9P A;  3AEV A;  1VQ8 A;  3K81 C;  4C3H H;  4PZ6 A;  1QZH A;  1VQJ A;  1EYG A;  4L5Q A;  4P75 A;  2Y0S E;  3GTG H;  4GOP B;  3M4O H;  4BY7 H;  3BU2 A;  2VUM H;  2OCE A;  2NN6 I;  1KL9 A;  4R4C A;  3PGZ A;  4GKJ Q;  1KXL A;  1PFS A;  2D0O A;  5IE8 A;  3KF6 A;  5GAE C;  4YWL A;  3S24 A;  4UP8 A;  3NEN A;  2CCZ A;  2E2I H;  1N32 Q;  4KI0 A;  3EBE A;  1VQA A;  4JI0 Q;  1YBY A;  1JJC B;  2CQO A;  4JI5 L;  2JQO A;  3PO2 H;  1X55 A;  5HY6 A;  4HIM A;  1Q82 C;  3AFP A;  3CME A;  2R7Z G;  4A93 H;  4GN4 B;  1H95 A;  5M5W H;  4JOI C;  2B29 A;  1K8G A;  3CC4 A;  2I5H A;  3I4M G;  1CSQ A;  1BBW A;  2F4V Q;  3HKZ G;  4O2D A;  1PH7 A;  1EWI A;  4JI4 L;  2ZJQ A;  2HHH Q;  1Q1E A;  4B3M L;  5BR8 L;  3CCQ A;  2ATW A;  4DR5 Q;  4OO1 I;  4DV4 L;  1WJJ A;  1S3O A;  2Q2I A;  3RLF A;  3U58 A;  2OWO A;  1VQD A;  2WP8 J;  3PUV A;  1PH1 A;  1AH9 A;  2A19 A;  4JI6 Q;  2K14 A;  1XPU A;  1VQ7 A;  5H1S E;  3BJU A;  5LMN L;  3CP0 A;  3L0O A;  4GKK L;  4LFB L;  3JC6 6;  1CKN B;  4YY3 L;  4X62 L;  4PZ7 A;  4HIO A;  1SMX A;  1J5E L;  2Z6K A;  3RN5 A;  3CF5 A;  1QVC A;  5IYD H;  1YNX A;  2OQ0 A;  4JBK A;  4UP9 A;  4A3L G;  3J81 c;  1IL2 A;  4OWW B;  1UE7 A;  4OWX B;  3J80 c;  1XMO L;  2UXC Q;  4QY7 A;  4J15 A;  1L2F A;  1BBU A;  2QA4 A;  3RNU A;  2MO0 A;  1IYJ B;  4A3K H;  1I6H H;  4KHP L;  1TWA H;  1HZA A;  2I5L X;  3UE0 A;  1Y1V G;  4LF9 Q;  3PCO B;  2AWO A;  1JJ2 A;  1HR0 W;  4X65 L;  3TRZ A;  4A3G H;  1TWG H;  1HR0 Q;  2HIX A;  4DV3 L;  1VQL A;  1X9N A;  3JAM i;  2JEB I;  5IP7 H;  2IX1 A;  2JA8 G;  3HOY G;  2RHQ B;  3ULP A;  2R6G A;  4NB3 A;  1Q7Y C;  1PH9 A;  1VQN A;  2WFW A;  3GTO H;  3PUY A;  2CWA A;  4YHH L;  2VZA A;  3M85 A;  1HJP A;  2BA0 A;  5AJ3 Q;  4A3I H;  1SE8 A;  1PVO A;  3IRB A;  5C0X I;  4LFC L;  4DUZ Q;  4AQY Q;  1JE5 A;  3W1G A;  5FJ8 G;  1OXV A;  2CFM A;  3CW2 C;  5IYC H;  5FLX c;  2E8G A;  1E7Z A;  4DV1 L;  3CD6 A;  1RL2 A;  3GTM H;  3CCL A;  2D0P A;  4DNI A;  1WCM G;  1OXS C;  3CMA A;  3FKI G;  4LF5 Q;  1NE3 A;  1NMF A;  2LXJ A;  1XNQ L;  2LSS A;  1VQO A;  4BA2 I;  3GTQ H;  1N34 Q;  1KAW A;  3PF4 A;  4XIG S;  4A3D H;  4GN3 B;  1Y1W G;  4GS3 A;  4DAM A;  4DV2 Q;  4DR4 L;  1HZC A;  4WJ4 A;  3L2P A;  4A76 A;  1HNZ Q;  4Y52 H;  1HNW L;  1KRS A;  1KHI A;  3F8T A;  1C9O A;  4OX9 L;  2IHE A;  2UUC L;  3OW2 A;  1YIT A;  2PMZ E;  4YCV A;  1Y1V H;  3HKZ E;  1CSP A;  3S1R H;  3CC2 A;  5IWA L;  5GAH C;  4DR3 L;  2XGT A;  3AQQ A;  4IJH A;  1LM0 A;  3TQY A;  1UE5 A;  4A3F G;  4IFD G;  1VQG A;  1C7Y A;  2L15 A;  3M4Q A;  1I5F A;  1OXU A;  4GN5 A;  5J3B A;  2OTL A;  4R4T A;  2PQA B;  1YHQ A;  1L1O A;  2AWN A;  5C4X G;  4GOP A;  4LF6 L;  2K5H A;  2K5V A;  3ERS X;  2ZTE A;  1CKM A;  2WAQ G;  2IY5 B;  2UXD Q;  4GNX A;  4LF7 Q;  1D7Q A;  1XTD A;  1V1Q A;  3KLW A;  4BY1 G;  1SRO A;  5FJ8 H;  1E22 A;  4K0K Q;  2N3S A;  3RLO A;  4X66 Q;  1XNR Q;  3CXC A;  1JB7 A;  3E0E A;  3CC7 A;  2HIV A;  4KHZ A;  4DK3 C;  1PV4 A;  1HNX L;  1P8L A;  2I0Q A;  4JI7 L;  2A1A A;  2NZH A;  3I4N H;  1IBM Q;  1OTC A;  4B3S L;  5JEA J;  3T1H Q;  4IO9 A;  2DGY A;  4JYA L;  4JI3 Q;  2KCM A;  1TWF H;  1UE6 A;  1SRU A;  2K5N A;  4NPS A;  3U4V A;  3F2C A;  1PA6 A;  1IXR A;  1IBL L;  2YU9 H;  3B6Y A;  1L1O B;  3M9B A;  1L1O C;  5GAD C;  5M3F G;  3AYH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...