2F4VQ

30s ribosome + designer antibiotic
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2f4vQ00
4JCVE 1AE2A 4JI4L 2EXDA 1PH5A 1B8AA 1V1QA 4UY8C 1VQKA 2ES2A 4JI8Q 4Y52H 1XPOA 1AE3A 2CFMA 2PQAA 2CWPA 2MO1A 2PI2A 4IPDA 1YHQA 1X55A 1VQHA 1VQGA 3K7AH 2EQSA 2AHOB 2NVYH 5M3FH 1TWGH 1HR0Q 2XTIA 4GOPB 4B3MQ 4JI0Q 3PO2G 4LFBQ 1C0AA 1VQEA 2A1AA 2MO0A 1FJGQ 4DV0Q 4JOIA 4OXPA 3PGZA 3U50C 4DUYL 3CC4A 1XNQQ 3JC66 3DM3A 2R93G 1GVPA 4C3IH 2PI2E 2Q2IA 4DV4L 2K50A 4LUVA 1Q86C 1HNXL 4POGA 3HOWG 2XGTA 4DV7L 5C3EG 3PV0A 5JJLA 2NN6I 3M4OH 2JA7G 5GAHC 2UXCL 1GKHA 1U0LA 2IY5B 1N9WA 4MTNA 4DV6Q 4A93H 1DGSA 2K5HA 3M9BA 1TWFH 4JI2Q 4A3EH 4AYBG 2B63H 2YYZA 3KF6A 4R4QA 4YHHQ 4DV3Q 4ME3A 1Z47A 3E0EA 1VQ7A 3TS0A 2EIFA 1G51A 3T1YQ 4JI6L 1AH9A 3RLFA 3D31A 4DR7L 5GQOA 1YNXA 5LMUL 1PH2A 1L0WA 2KHJA 3KFUA 4A3BG 2UXBL 3CW2C 1HZBA 1JT8A 4DR4L 2Q2HA 2R6GA 2VQFL 1EIFA 2UUCQ 5LMNQ 4JBMA 4JV5L 1HR0W 3NEMA 1XMQL 1X56A 1S40A 1WJJA 4HJ5A 4PZ8A 3STBC 1RL2A 4YCVA 4UPAA 4IOAA 1P8LA 3G6EA 3UDFA 1E24A 1OXTA 1X9NA 4H02A 3U58A 1NBWA 3RR5A 4AH6A 2OTJA 4A3MG 4BXXG 4DV5L 1NTGA 4X66Q 1PHJA 1GM5A 3OYYA 1VQLA 4QJFA 1TWAH 1VQCA 2R93H 1JB7A 2WP8J 2N49A 1EQRA 1X3FA 5C0XJ 3W5OA 3S1QH 3HOWH 5C3EH 3CCRA 3L0OA 3K81C 2I0QA 2KBNA 3CCLA 3I7FA 2JA7H 3A5UA 3GTGH 3E9HA 2VZAA 1B70B 2MFIA 2D0PA 2MNAA 5BR8L 2VW9A 4J15A 3J80c 4DR1Q 1P16A 4LF5Q 4P74A 4HJ7A 5IWAL 5K36G 1KD1C 4HJ9A 4P75A 4WJ3M 4X65Q 3AQQA 1IBLQ 3HFZB 2KCMA 5M3MG 5LMNW 3S1NH 4A3BH 4GKKL 1YZ6A 3ER0A 4GN5A 4LFCL 4A76A 4EQ5A 2E5LL 1BBUA 2WAQG 2N78A 2Q2TA 4DR3L 3S17H 4DR2L 1EWIA 3TRZA 4DPGA 4KHPQ 1IYJB 1E22A 1KRTA 2HHHQ 1J5EQ 4JI7L 1I6HH 1IBKL 1NY4A 4OX9L 4A3MH 2E2HH 4B3SQ 4LF8Q 2RHSB 4BXXH 3GTJH 3K8AA 3I4NG 1YITA 3ZJYC 1CKNB 3FHWA 1KIXA 1UE7A 4JI8L 1VQ9A 3A5ZB 1S72A 3AEVA 4BA2I 5FLMG 1N34Q 2VY3A 3CPWA 2L15A 4IPCA 4A3KG 2CCZA 1ASZA 1Y1VG 3ICEA 2WFWA 4LF6L 2JA8G 4LFBL 4JI0L 3J7A5 1CSQA 4P73A 1VQAA 4POFA 1XNRQ 1OXUA 1SN8A 2ZTEA 3KDFA 4JG2A 4GNXC 2WB1E 1N8RC 1FJGL 4DV0L 4A3CG 1XNQL 2IHEA 2JEAI 4BY7G 2A19A 3PUYA 2YV5A 3CCUA 3F8TA 3RLOA 1Q81C 1OTCA 1QVFA 2K5VA 5M3MH 4DUZQ 2ID0A 1Y1WG 4O2DA 3CCSA 4ALPA 2JJQA 4DK6C 2UUBQ 1YJNA 4NXNQ 4DR6Q 1YJWA 1O7IA 4DV6L 4C3HH 5M5YH 2JA9A 4JI2L 2NVQH 1Q1BA 3KYHC 3CF5A 1PA6A 4B3TQ 2JK8A 1GD7A 4OWXB 1QVCA 3KJOA 4OO1G 2LXJA 3E9IA 3HKSA 3ULPA 1Q7YC 4YCUA 4IOCA 2IX0A 4DV3L 4R1JA 1YJ9A 1CKNA 4JI3Q 4A3GG 5J3BA 4DAYB 1PH6A 3I4NH 3PUVA 1Q82C 1I94Q 2OWOA 2OQKA 3HOVG 4GS3A 2R7DA 1HNZQ 5C4XG 4L5SA 4OWWB 1WFQA 2UUCL 4DV1Q 2HIXA 1J6QA 5LMNL 1VS0A 3AYHB 1TWHH 2K5NA 4MZ9A 4LFAQ 2RHQB 5IP7G 5FLMH 4QIWE 1XTDA 2KENA 3B6YA 4A3KH 2OTLA 3M7NA 4LUOA 3RN5A 1I50H 4R4CA 1Y1VH 1WCMG 3D0FA 3K80C 2C35B 4R4OA 3S24A 4DKAC 5AJ3Q 2JA8H 1CSPA 2JA6G 2CWAA 4GNXB 1EYGA 3A74A 3SGIA 1IBML 2QEXA 1CKMA 5HY6A 4A3CH 4X66L 1W3SA 4BY7H 4WJ4A 5IE8A 4DR5L 4C2MH 1N36Q 2DUDA 2N8NA 4GLAC 4AYBE 1K8AC 3PIPA 1WYDA 4GKJQ 1QVGA 5JJKA 1Y1WH 4X64Q 3ERSX 1K83H 3HOXG 2VNUD 1UEBA 3U4ZA 1WI5A 2UUAQ 1XJVA 1LYLA 2FXQA 5C0XG 1CKOA 4X62L 4DR1L 4OO1I 5IYDG 1KRSA 2K14A 2KHIA 4O0AA 5C4JH 4LF5L 3S16H 5H1SE 1UE6A 2IT1A 3G71A 1XPUA 2JA5G 4A3GH 3M4QA 4X65L 4L5RC 1VQ6A 4LW1A 3PUZA 5C44G 4DV2Q 1EUJA 1YEZA 2I5LX 4HJ8A 3BJUA 3IRBA 4L5TA 2JE6I 1K8GA 1C7YA 1XMOQ 4JI4Q 3HOVH 1HZAA 1MJCA 4YCWA 3CC7A 3RN2A 5C4XH 1K73C 1NJIC 1H95A 3TREA 2F52A 5IP7H 4R4TA 3S2HH 2ATWA 2ALYB 4GNXA 4KHPL 1K0RA 4A4IA 2K4KA 1WCMH 2HHHL 1J5EL 4YWMA 1YI2A 2JA6H 3KF8B 3CCVA 3CD6A 4IFDG 4B3SL 3S14H 2I5MX 3H3VI 1KAWA 4A75A 3H3VH 2IX1A 2NZHA 4IO9A 1V9PA 1S3OA 3H0GG 3H15A 2VQEQ 1PH8A 1HNXQ 3GDEA 1A8VA 4P71A 3J80i 1VQBA 3HOXH 1KC8C 1LTLA 4BY1G 3KDFB 2R92G 2UXCQ 1Y14B 3HOUG 2Q2UA 1WOCA 3A0JA 2ZTCA 3U4VA 5C0XI 2JQOA 4LWCA 3FKIG 4NPSA 4B3RL 1XNRL 3W1GA 1KQSA 3KOJA 5IYDH 2Z6KC 1IZ6A 1UWVA 1JJCB 2YTVA 3CAMA 2YU9H 1L1OC 2Y0SE 2ZTDA 2WAQE 3GTLH 4JYAQ 4IFDJ 1RIPA 3TEHB 4JI6Q 2IHFA 2JA5H 5GAEC 4DAMA 5IYCG 3JAMc 2UU9L 3I55A 3ULJA 5C44H 4A3DG 3S2DH 3S1MH 3TS2A 4DUZL 5ELOA 4AIMA 4JI5Q 4P72A 2UXDL 4KI0A 3RLNA 2UUBL 1M90C 1XMQQ 4BBSG 4K0KQ 1E3PA 4PG3A 1PH9A 1B7YB 2ZM6Q 4B3TL 4YY3Q 2GVAA 4LF7Q 4XTCS 1VQ4A 1PYSB 4XIGS 1X3GA 3OTOQ 1MKHA 3J7ZC 1VQPA 4IFDI 2OQ0A 5M5XH 4UP8A 4JBJA 1X6OA 1T9HA 4JI3L 3EIVA 1SFOH 4NXMQ 1PH7A 4JC0A 4QY7A 1I94L 1ASYA 1K3RA 1HR0L 4B3ML 1IL2A 3H0GH 1QUQB 3CMAA 1HNZL 1V43A 2QA4A 5GROA 3MEFA 2E2JH 4DV1L 2NZOA 4BY1H 2R92H 3HOUH 4GLXA 2HT1A 3T1HQ 2R7ZG 5BR8Q 5IT9c 4GOPC 1U5KA 5GADC 1PH4A 3FKIH 3PF4A 4R4IA 2KCTA 5FJ8G 4KHZA 4HIDA 4HJAA 3LGJA 3UDIA 1KHIA 1L1OB 4BA1I 2BH8A 2PMZE 5IYCH 4LUZA 4LF9Q 1NMFA 2Z0SA 3BU2A 3WWVA 4A3JG 4A3DH 4GKJL 3K7UC 3HKZG 4YHHL 2A8VA 2VUMG 3NENA 4X64L 1SLJA 1YVCA 5ELNA 3S15H 3M4PA 4Y7NH 1VQOA 1HZCA 3T1YL 4DR2Q 4BBSH 4QQBX 3CP0A 3NBHB 2CKZB 3STBD 2UUAL 3AFPA 3KJPA 4FDBA 4AQYQ 1E7ZA 4JI7Q 1UE5A 3MXNB 4DK3C 3G48A 4HIOA 1XPRA 1CUKA 2CQOA 4IPHA 1Q8KA 4NB3A 1QUQA 1EIYB 1YHAA 5E7NA 4DV2L 1VQNA 4TVAB 1K9MC 1TWCH 1VQDA 4A3FG 1XMOL 2GN5A 1JJGA 4HIMA 2RCNA 3UE0A 4A3IG 4UP9A 1HNWQ 5IP9G 2LXKA 1D7QA 2F4VQ 4QL5A 4LF4Q 2YTXA 1N32Q 3EN2A 5IYBG 3PO3G 4GN3B 2B29A 2Z6KA 1A62A 1W2BA 4LF6Q 4YWKA 2R7ZH 1L1OA 4OWTB 4LNQA 1X54A 3Q8DA 2V1CC 2K52A 5FJ8H 4YWLA 1IXRA 1PVOA 3HOYG 4GLVB 3NELA 2QGQA 5IY0A 1N33Q 2HIVA 1VCIA 4BBRG 2NVTH 4JI1Q 3G4SA 3OW2A 1NE3A 4A3JH 3TQYA 1EOVA 2VQEL 2ZJRA 4PMWA 2VUMH 1G6PA 1X3EA 3F2DA 2LSSA 1L2FA 1E1TA 3W1BA 1HJPA 1IBLL 2R7FA 2AWNA 1NMGA 2DGYA 1KL9A 1OXVA 3UE1A 3BZKA 4JBKA 3ULLA 1BKBA 1LM0A 3GTQH 1I3QH 1YIJA 4JYAL 2I5HA 1HH2P 2OCEA 1VQ8A 3KLWA 2HQLA 3RNUA 4A3FH 1OXXK 1A63A 1KXLA 3EBEA 4JI5L 4LF8L 4A3IH 4DUYQ 2ASBA 5JJIA 5IP9H 4GOPA 3RZDH 4K0KL 1SR3A 5IYBH 3PO3H 2F3IA 2JEBI 4DV4Q 3HOZG 2ZM6L 2NVXH 3PUWA 1YHBA 4YY3L 3I56A 4APVA 4LF7L 3PO2H 1EFWA 4IPGA 5HGQA 1Q46A 3OTOL 4DV7Q 1C9OA 4PZ7A 1IBMQ 1VQJA 1N34L 1FL0A 3HOYH 4A3LG 1SE8A 1UE1A 1TXYA 4HIKA 4DR5Q 4NXML 4BBRH 3PSIA 4UP7A 3CQZH 5EAYA 1VQMA 1QZHA 1SMXA 3J81c 3DLLA 2ZJQA 5GAGC 5M5WH 2ZJPA 3GTMH 3F1ZA 4RMFA 3J81i 3PIOA 1JMCA 4DR7Q 2VL6A 3I4OA 3VDYA 4JOIC 4EX5A 2E8GA 5LMUQ 1EQQA 3GTKH 2VS1A 3T1HL 1MJEA 2UXBQ 3JAMi 4X62Q 1VQ5A 1FGUA 3CPFA 3K0XA 4DR4Q 2VQFQ 3BZCA 4JV5Q 2YTYA 4IJHA 4NXNL 3M85A 4DR6L 3F2BA 4LF9L 3FP9A 1PV4A 1D8LA 1GO3E 1LUZA 3PCOB 3I4MG 3PUXA 4QGUA 3S1RH 2PNHA 4DV5Q 1R9TH 3UDXA 2Y0SG 3CCJA 4L5QA 1BVSA 1MIUA 2N3SA 5JEAG 3HOZH 4OONA 5DLQE 4AQYL 1FVIA 3I2ZA 4DNIA 3GTPH 1SRUA 4PZ6A 3L2PA 1E1OA 1VQIA 3UDGA 2BA1A 4LFAL 1QZGA 2AKWB 4A3LH 3GD7A 5M3FG 2PQAB 1Z9FA 3GO5A 3PF5A 5AJ3L 1M1KC 3CCMA 3RZOH 1HZ9A 1G291 1PFSA 4KLKA 1PH1A 2AMCB 1SROA 4GN4B 4JBWA 5IWAQ 1HNWL 1PYBA 2GVBA 3CC2A 2B3GA 4RG1A 2F4VL 5FLXc 4IJLA 4LF4L 1N32L 2RF4A 2D62A 1I5FA 1PH3A 1VQFA 1N36L 2BH2A 1JJ2A 1Q1EA 2MQHA 2E2IH 5JEAJ 4GKKQ 4B3RQ 3HKZE 1Q12A 2BA0A 2AWOA 2WB1G 1BBWA 3L7ZC 4TQUS 2E5LQ 4LFCQ 3CCQA 2NN6G 4MNOA 4C3JH 3F2CA 1A0IA 1JE5A 4DR3Q 4A93G 3AFQA 1N33L 2H5XA 2UU9Q 4JI1L 4A3EG 2B63G 3CCEA 3I4MH 3J81j 3GTOH 3M3YH 1YBYA 3CXCA 1IBKQ 1X65A 4OX9Q 1OXSC 2D0OA 2UXDQ 3KF6B 4X6AH 3CMEA 2K75A
chains in the Genus database with same CATH superfamily
4JCVE 1AE2A 1ML0D 2XWJB 1RJTA 1V1QA 2ES2A 2CFMA 4BY1B 1SNOA 1VQGA 3K7AH 2AHOB 4GOPB 2D9UA 1CI3M 1G6ZA 2EY5A 3PGZA 2DY8A 3MXPA 1EYCA 4DV4L 1HNXL 3BYTB 4DV7L 5JJLA 2NN6I 2UXCL 2NN6H 4K14A 1U0LA 4BBSB 2K5HA 2KOLA 1TWFH 4WRDA 2XSCA 3GTOB 3DMUA 5CV5A 2EY6A 4K2KA 4YHHQ 3R93A 1ENCA 4XQQA 1Z47A 3T1YQ 3RLFA 1AN8A 3D31A 1TIID 1PH2A 5JAVA 3CW2C 4CDEC 4DR4L 2Q2HA 1EIFA 5LMNQ 4JBMA 2G9HD 4JV5L 3A8IE 1X56A 2EY1A 3VR5A 1RL2A 4IOAA 2R7ZB 1OXTA 3U58A 3I73A 1EEFD 1LT6D 3RMHA 4AH6A 1S5BD 4CBVA 1NTGA 2IW3A 2NVTB 4C3IB 1JB7A 1EQRA 3W3AA 2K5DA 4U673 1V1OA 5E4XA 3S1QH 3HOWH 5C3EH 4H13C 3OIQA 3K81C 3OOCA 3GTGH 4HMJA 3FPPA 3I8ZA 4FO2A 3DM1A 2CW0C 1SYBA 2TMPA 2FJ2A 4HJ7A 2O4XA 1I3QB 3MAQA 1B44D 2F0SA 1ICFB 5LMNW 3S1NH 1II3A 2XNAC 5D14A 1Z7TA 3ER0A 4GN5A 4LFCL 4A76A 2KECA 3I70A 4K5XA 2TSSA 3QB3A 1KRTA 5TSSA 4OX9L 4LF8Q 2RHSB 3K8AA 1CHQD 3H6MA 5C5LA 3I4NG 3GV6A 4R8NA 2Z6BA 1MSHA 2A69D 4QF4A 1BDOA 1UE7A 1GUSA 1F9QA 4BA2I 4R8IA 4M8AA 4IPCA 2L5TA 2CCZA 1Y1VG 2M00A 3J7A5 4P73A 1XNRQ 2NYZD 4POFA 3GTLH 2I07B 2B2VC 2KCCA 4DV0L 1WTWA 2A19A 2EE1A 2YV5A 4X3KA 5CMDA 2WACA 3CKIB 3F8TA 3RLOA 2K5VA 5M3MH 4DUZQ 1JCKB 1CQFA 3NWTA 4BWGB 5CV4A 2N88A 1Q1BA 1PA6A 3CF5A 4K8IA 3ND8A 5DAUA 4A3GG 1T5XD 2PZTA 2A73B 2O2LD 2OWOA 2OQKA 3HOVG 3TZUA 2K01A 1QVFA 1VS0A 2RHQB 2KENA 1I50H 4DKAC 1IW7C 2KQ3A 2C35B 1LTSD 1EYGA 3A74A 3SGIA 2QEXA 4X66L 1MGSA 1W3SA 2KUMA 5IGCA 5J39A 3G6JB 1N36Q 2N8NA 3I4MB 4IUQA 4AYBE 3PIPA 4GKJQ 4HTHA 2VB2X 5T1GA 2MUYA 4K5VA 1TT2A 1WI5A 3BVGA 4HCSA 5M5YB 4OO1I 1TS5A 3VYUA 5IYDG 5D65A 4OO1H 3LWEA 1O78A 4DAYA 5H1SE 3G71A 1XPUA 3K7AB 5FK9C 3KBGA 4X65L 3HS0C 4LW1A 3I4NB 4KD3A 1S4ZA 1C7YA 1SJED 2IX3A 1HZAA 2A6HC 4YCWA 3CC7A 1WTPA 1TWHB 2H4OA 3WOFA 3QO2A 2FMCA 4R4TA 4P2CB 1DJRD 1J9OA 3CRLC 4GNXA 3ND9A 4A4IA 1EL0A 4I7ZC 2Z4IA 3R2IA 5CBAE 4B3SL 1ICWA 1KAWA 3H3VC 4A75A 3MWYW 4C2MB 1EFID 2IX1A 2NZHA 1ESFA 1JOOA 5EKKA 1K83B 3HG9A 5KYIA 1PMRA 3U4VA 1SBBB 3P1HA 2JQOA 5C0XI 4LWCA 5C0XH 3KOJA 5NUCA 3TBIB 1IKLA 5LL6X 2YU9H 1KLUD 2Y0SE 4JYAQ 4A3GB 1DM0B 4DAMA 2UU9L 3I55A 3ULJA 4A3DG 3S2DH 3TS2A 4NKLA 3HOVB 4CJ2C 2F0EA 5ELOA 4JI5Q 3NQIA 1PRTC 2QEJC 3EFXD 3GV3A 1XMQQ 3OWEB 4CKBA 5FOBB 3MC0B 3KF8A 4YY3Q 2GVAA 3EQLC 1PYSB 2PQEA 3OTOQ 1KDCA 1MKHA 5C3EB 2RDGA 2XN9C 1TS4A 1PH7A 4JC0A 1K3RA 1HR0L 2EJMA 3CMAA 1V43A 3MEFA 5FLXL 2NZOA 2O5IC 3VR4A 4ZUIA 1HA6A 3S1NB 4GOPC 1PH4A 1MI2A 4NDXA 1CZGA 5I9PA 3LGJA 1KNAA 1L1OB 1AZPA 4DAVA 4V190 4LF9Q 4LUZA 1CFMA 2Z0SA 1EY0A 3WWVA 3UI2A 2M9VA 3K7UC 3HKZG 2A8VA 2VUMG 4X64L 1SLJA 2BDOA 1VQOA 4DR2Q 1NR4A 4DNRB 2UUAL 3AFPA 3SXHA 4FDBA 5CGKA 4JI7Q 1UE5A 4ZRZA 4RGOS 3TP8A 4HIOA 1XPRA 1CUKA 5JOBA 2CQOA 2EYFA 1Q8KA 4NB3A 5E7NA 4DV2L 2EPBA 3OHXC 1TWCH 1VQDA 3GTLB 3I72A 1M8AA 2F0IA 1JJGA 4HIMA 1STAA 2RCNA 4XYQA 2E2JB 5IP9G 4QL5A 4KKUA 5IYBG 3PO3G 3QG1A 1R4PB 4FVMA 4K2LA 1PRTF 2FINB 4H0LC 4B9XA 1F2LA 4Z9CB 2CW0D 1H9SB 2HCCA 2F0LA 2QGQA 1A2TA 1N33Q 1CT1D 4A3DB 1QG7A 1KLGD 4K6DA 4LAAA 3TQYA 1EOVA 2ZJRA 1SEBD 3S15B 1G6PA 1X3EA 2LSSA 1L2FA 3T16A 3P7JA 4OGQC 5AFWA 3MXNA 1IBLL 1NMGA 3L3OC 2JYOA 3BZKA 3GTQH 3ULLA 1BKBA 1LM0A 1SYDA 3OMGA 2I5HA 1VQ8A 4C1NK 2ICEC 3NWSA 4A3IH 2ASBA 2X69A 3RZDH 1SR3A 3MXGA 2E2DC 4FNFA 2ZM6L 3KK7A 3PUWA 2DY7A 1C48A 1EFWA 1Q46A 4KTAA 3IAYA 1VQJA 3J7AV 1B3QA 1SE8A 4NXML 1ET9A 2C5CA 3CQZH 1QZHA 1SMXA 2EJFC 2ZJQA 3HKZB 2VUMB 2XVSA 1BCPC 1ILPA 1ZXTA 3PIOA 1B50A 4X3SA 2F03A 3T1HL 2L4NA 4X62Q 2DNCA 1FGUA 4C56C 2YTYA 1CZWA 5EKLA 1GO3E 3PCOB 1LT4D 3PUXA 2PNHA 2F0VA 2P5ZX 3CCJA 4L5QA 4ILWA 1BVSA 2E76C 3PO3B 2K05A 1KDBA 2N3SA 1LABA 4UAIA 1PYWD 3DWQA 3BZDB 1IW7D 1MHWC 5D3IB 3I2ZA 5DLQE 4AQYL 3K58A 4PZ6A 4LFAL 2F0FA 1A3UA 2MHVA 5HURA 5IIFA 2AKWB 1QNUA 3GD7A 2FMMA 1XX8A 5M3FG 5CBEE 3MA2B 5T1IA 3FVQA 3KBXA 1M1KC 4FF4A 4KLKA 1PH1A 2YU9B 4GN4B 1HNWL 4RFBA 3CC2A 2B3GA 5FLXc 4LF4L 1N32L 1UNSA 5JEAJ 2BA0A 4Q0FA 1JE5A 4F8MA 4A93G 4MN3A 3E3XA 2XIWA 3GTOH 4S3SA 1PTOH 1X65A 2A6HD 4IUTA 3KF6B 3CMEA 3CAMA 2CH4W 3HEJA 3K0YA 1BCPF 3NE5B 2B2WA 4JI4L 1PH5A 1FGBD 4Y52H 1RODA 1AE3A 1XXGA 2PQAA 2HQEA 1YHQA 1X55A 5KNDA 1W6JA 5COYA 2NVYH 2KVMA 2XTIA 4B3MQ 4JI0Q 2MO0A 1FJGQ 4JOIA 4OXPA 1SSOA 4O42A 3KLRA 2R93G 3FDTA 5A35A 4C3IH 2CHBD 4LUVA 4K6LA 4POGA 3BDOA 1GUOA 3BYYB 2IY5B 1N9WA 4JI2Q 2B63H 4A3EH 2SEBD 1D1KA 1Q90A 4DV3Q 3E0EA 4JVZA 2EIFA 1PRTD 1SMYC 2VXWA 1ET6A 1AH9A 2PYKA 5GQOA 1YNXA 4RCOA 2WINB 1L0WA 2KHJA 2MPMA 2UXBL 4CDCC 2UUCQ 2VQFL 3MZ5A 1S40A 1ESRA 4UPAA 1TWGB 3NUCA 2ZT9C 5M3FB 5JPNC 3UDFA 3G6EA 4HSVA 3RR5A 1GOZA 4A3MG 4DV5L 1VQLA 3D6WA 1K3BC 3T53B 1IKMA 2KCNA 5ELEA 5C0XJ 2K5WA 2WIIB 3EVQA 3Q0AA 4EGVA 4FF2A 3CCLA 4RH6A 2MFIA 2MNAA 5J1ZA 5BR8L 4J15A 3J80c 4DR1Q 4LF5Q 2AUJD 4P75A 5DEHA 1OO9B 1LTAD 2Z4HA 4B9WA 2KCMA 3D4DA 2ZXOA 5JVG3 1TS3A 4EQ5A 1BBUA 2WAQG 4OHJA 4ZAIA 4DR3L 1STNA 4DPGA 5EKIA 4KHPQ 3E5SA 3QOLA 1EZ8A 1IBKL 4DF7A 1S5FD 5EBDA 3A54A 1SAPA 2R93B 4K8JA 1YITA 3ZJYC 3CQZB 3FHWA 1RTOA 1VQ9A 1S72A 3AEVA 4PNYA 1N34Q 3CPWA 5IT9L 2B8GA 3ICEA 1LO5D 4LF6L 1CSQA 4DAPA 1Y8OB 1XWEA 5G3LF 4JG2A 4GNXC 1N8RC 4XT1B 4A3CG 1HPCA 2IHEA 2JEAI 4BY7G 2RVLA 3CCUA 4OL7A 3C2PA 2V4DA 1OTCA 1MD2D 3SEBA 2ID0A 1Y1WG 4ALPA 2PO4A 1H9MA 4DK6C 1YJNA 4NXNQ 2EYLA 1O7IA 5I4DA 5M5YH 5ISRA 4B3TQ 3DUZA 2JK8A 4OWXB 2LXJA 3E9IA 1I6HB 4YCUA 4IOCA 3P20A 1G8ZD 2E2HB 4R1JA 1YJ9A 1SYCA 3VYTA 4G7HC 1B2TA 5J3BA 1PH6A 3I4NH 3PUVA 1Q82C 1I94Q 1LTRD 2F0PA 1FNVA 2R7DA 4MTKA 5C4XG 4L5SA 2HIXA 5A2QE 4TKOB 5LMNL 3AYHB 1TWHH 2K5NA 5ELBA 2AQ3B 3B6YA 3T13A 4RA8A 1Y1VH 1RF2D 1WCMG 3D0FA 1UEAB 3KLSA 5AJ3Q 1CSPA 2JA6G 1IBML 1CKMA 3NTKA 1BCPD 5CV8A 4WJ4A 2MJ8A 3D4RA 4KN4C 4C2MH 2DUDA 2KA7A 5JJKA 1PTOB 2J4XA 1K83H 3CRKC 1PXUA 4MHEA 2WAQB 1UEBA 4DK0A 2XRQD 5I6YA 4QB4A 1W6KA 3R8BA 1LYLA 4O0AA 2K7VA 2IT1A 2K03A 2JA5G 4A3GH 3R3OA 2RKSA 2NVYB 1TS2A 2JE6I 1XMOQ 3HOVH 3SK8A 1G2TA 4K5WA 1NUCA 2FHTA 2NB0A 3LNNA 1K0RA 4KK7A 3DWAA 4YWMA 3FEWX 3CD6A 5CV7A 5CV9A 4BY7B 2B63B 4A3EB 3J81L 1JOQA 1S3OA 3H0GG 2F4IA 2OT2A 1Y1WB 4ME5A 1HNXQ 3GDEA 1LTLA 2DNEA 3DWPA 3MTSA 3NP8A 2UXCQ 1WOCA 2L55A 3DEPA 4U68A 3FKIG 1XNRL 5IYDH 2YTVA 1IZ6A 2B2TA 4IFDJ 1RIPA 2IHFA 1TR5A 5IYCG 3JAMc 2AQ2B 1CTMA 4DUZL 5C4XB 4G57A 4KI0A 1PZID 3MXUA 2WKDA 4K0KQ 3S2HB 4PG3A 5IGGA 1D5ZC 1WCMB 4XIGS 1VQPA 1GHKA 4JPBW 3J7ZC 3S14B 5M5XH 4ABNA 1X6OA 1T9HA 3EIVA 3K57A 1LTID 1F9PA 1ASYA 1QUQB 3TMEA 5GROA 2E2JH 2CQAA 2F1MA 1VF5C 1KDAA 2X6LA 2B2UC 2OXPA 2HT1A 4KY7A 5IT9c 5GADC 5FJ8G 4KHZA 1WTXA 4HJAA 3M4YA 1TQOA 2BH8A 1NAPA 2JA5B 2F0DA 1SMYD 3S1MB 3BU2A 4A3JG 4A3DH 1QNKA 4GKJL 3NENA 5ELNA 1DONA 3S15H 3M4PA 2L9HA 1HZCA 1A15A 4M1UB 1STBA 4QQBX 5G3LD 1K8OA 1U4PA 3LWUA 4DNTB 1SNQA 1PZJD 4DGZA 3KJPA 1E7ZA 5DNFA 3N6RA 1STGA 3U9SA 1BOSA 3SDZA 5M9OA 1A6XA 1SFOB 1HUNA 3Q23A 2RQXA 3H94A 1BBXC 3H0GB 4A3FG 1FYCA 2Z9HA 2F3WA 2LXKA 1D7QA 2PZWA 2B29A 2Z6KA 3FKIB 1L1OA 4LNQA 1ILQA 1IXRA 2EYHA 2F0JA 3HOYG 3NELA 1PVOA 5IY0A 3MVVA 1S5ED 5JJZA 2EDGA 2VUMH 3G7LA 4Y7NB 3VR2A 3F2DA 4FF1A 2I46A 1I4GA 2LFNA 2K32A 5I2XA 2AWNA 3TSSA 1KL9A 1OXVA 1K0SA 2F0HA 4PMCA 4JYAL 3U9OA 1Y1VB 1ENFA 2OCEA 3NK9A 4HCEA 1A63A 4JI5L 4DUYQ 5IP9H 3WDNA 3KLSX 5IYBH 3PO3H 2F3IA 1H9SA 2JEBI 3HOZG 2NVXH 4YY3L 3I56A 1EY4A 5HGQA 3OTOL 5JVH3 2B2WC 1FL0A 2K6AA 4A3LG 4NW2A 5LHY1 1UE1A 1E2ZA 1YNJC 1J8IA 1SYEA 3PSIA 4A3JB 1VQMA 3J81c 5KIXA 3GTMH 1JWMD 5C3WA 4DR7Q 3K6OA 4JOIC 5LMUQ 2E8GA 5C5MA 2ICIA 2E75C 1M4VA 1LT5D 3RD4A 4C3JG 3S9WA 4QMGA 4IJHA 4DR6L 4KY6A 3M85A 4LF9L 3FP9A 1GJXA 1LUZA 1JICA 1G91A 4KKTA 1UUPA 3UDXA 2Y0SG 3I91A 1PFMA 1D6EC 5I2YA 5JEAG 2L11A 4UHVA 5D3DA 1FVIA 1D2BA 1AW7A 2QW7A 4L63B 5ELFA 1Z9FA 1H9JA 4QUCA 3CCMA 1G291 4EQOA 2M2LA 5DM73 3NTHA 4EQNA 3E0JA 5IWAQ 2HCIA 1PYBA 2D2CC 4RG1A 4IJLA 4N8X1 4RKBA 3GTKB 2D62A 1I5FA 5EBCA 1VQFA 1JJ2A 1Q1EA 3SHLA 4JW0A 1QB5D 4GKKQ 3HKZE 3I4LA 1Q12A 1EQVA 2WB1G 3L7ZC 3WOEA 2E5LQ 3CCQA 2Q8TA 1FNUA 3AFQA 1L0XB 1N33L 2H5XA 2UU9Q 3CCEA 2LMCB 3M3YH 1YBYA 1PTOC 5C4HA 3CXCA 5M5XB 1FNWA 1OXSC 4IURA 3DXJC 2K75A 1F9RA 3HOZB 1NSNS 2EXDA 4UY8C 3GTPB 4JI8Q 1XPOA 2CWPA 2MO1A 2PI2A 4IPDA 2R61A 1VQHA 1JC7A 5M3FH 1TWGH 1HR0Q 4LFBQ 3AMUA 1JWSD 1VQEA 1EOTA 2A1AA 1ZYRC 3CC4A 2IL8A 3U50C 1XNQQ 3JC66 2SDFA 4F7XA 3VR6A 2PI2E 2Q2IA 5FLXE 4ZCKA 4IZ8A 3PV0A 2JA7G 1GKHA 3OMCA 1IYUA 5E3FA 4DV6Q 4A93H 5DM63 3K59A 4RGMA 2YYZA 1LV9A 1Z6HA 3KF6A 4R4QA 4ME3A 1VQ7A 3IFTA 3TS0A 1A2UA 3MFGA 1G51A 4JI6L 1SE4A 3BG3A 5I6WA 4A3BG 1U9RA 4FXGC 3DEOA 1A3TA 1JE4A 1HZBA 1D1IA 4I7AA 2B2UA 5HGTA 1HR0W 3NEMA 1Y8NB 3T51B 3T56B 1WJJA 3STBC 2BDNA 4YCVA 1IL8A 1U4LA 1I4QA 1P8LA 4H02A 2OTJA 4BXXG 1PHJA 1HUMA 3OYYA 4WJWA 4QJFA 3J80L 1TWAH 1VQCA 2R93H 2DN8A 1PTOF 2HDMA 1B1ZA 2N49A 3K5MA 1EYDA 3W5OA 1QILA 2WB1B 4IUNA 4FP5D 2KBNA 3I7FA 3A5UA 2LS01 1Q3LA 2VZAA 1B70B 2D0PA 2BCOA 1P16A 2D5DA 4P74A 5K36G 3Q24A 3KUPA 4WJ3M 2QCPX 5IGEA 1O7ZA 4H44C 1IBLQ 2N55A 3PIP3 1YZ6A 3NSWA 4C3HG 1EWIA 2NVXB 4RHSA 2HHHQ 1J5EQ 1RD9D 1I6HH 4A3MH 2E2HH 1ZKOA 4QIWB 2L12A 2OF1A 1CKNB 3QWNA 1D5XC 3GTMB 5FO8B 5FLMG 1C8CA 2JA7B 2VY3A 2L15A 4A3KG 3GP7A 1L0YB 2JA8G 2KJXA 4JI0L 5EPJA 1VQAA 3A7AB 1OXUA 1SN8A 2ZTEA 4FXKC 1FJGL 2A74C 4IUVA 2PPBC 3PUYA 4A3BB 1RDPD 3FPUB 1MSGA 1EY8A 3CCSA 2VB3X 2J7ZA 3IFDA 2EZVA 2UUBQ 4KN7C 3S17B 1VMCA 2IWHA 1HRJA 2JA9A 4JI2L 1GD7A 2DJGC 3QJYA 1V8QA 1Q7YC 5IOCA 2IX0A 4DV3L 3V2TA 3MEHA 3GTJB 4JI3Q 1EY7A 5F2DA 3F2UA 2B2TC 1JQYD 2EYPA 1HNZQ 4RGNA 4F87A 1WFQA 2UUCL 4DV1Q 1J6QA 4LFAQ 4MZ9A 5IP7G 4KJNA 1XTDA 1O80A 3M7NA 2OTLA 3RN5A 1YNJD 4R4OA 2C9OA 2CWAA 4HEDA 5FO9B 5HY6A 1CHPD 3VA7A 5J22A 2K04A 3BS1A 4BY7H 1XTCD 2HDLA 4A3CH 4X3UA 4DR5L 1K8AC 3M3YB 1DYQA 1WYDA 4WORA 2QDLA 2X6GA 1Y1WH 4DA2A 3HOXG 3EA6A 2F0TA 2VNUD 4HMIA 1EQTA 1JOKA 2PW5A 4N9PA 2NVQB 4DR1L 4Q5VA 1KRSA 2K14A 4LF5L 1GXDC 3S16H 2HUGA 5I9OA 1HQRD 3M4QA 1VQ6A 2A5HA 5C44G 4N8FA 1YEZA 4HJ8A 3IRBA 1TVXA 1K8GA 4JI4Q 3TP6A 2PNRC 1DOMA 1MJCA 1NJIC 4XQJA 5C4XH 3NPPA 3TREA 1Q8IA 3S2HH 3C3LA 2ALYB 4KHPL 2JA8B 1HFGA 1WCMH 3BDCA 3D4WA 2JA6H 4KKSA 3CCVA 4IFDG 3S14H 2I5MX 4A93B 4IO9A 4MIUA 1V9PA 3EJIA 2A6EC 1SE2A 4CKCA 4R9WA 2VQEQ 1PH8A 4P71A 1A8VA 1KC8C 3JAML 4BY1G 1B9MA 2R92G 3HOUG 2Q2UA 3A0JA 2F3VA 3RUZA 1EYAA 1LLRD 4B3RL 1EU4A 3W1GA 5C4JB 2Z6KC 2AUKA 5EJWA 1JJCB 1PTOD 1SXTA 1S5DD 1L1OC 2WAQE 3TEHB 2JA5H 5GAEC 4KD4A 3S1MH 3BDLA 4OEMB 5EPKA 4AIMA 2UXDL 3RLNA 2EY2A 1TWAB 3SK5A 4BBSG 1B7YB 4B3TL 4LF7Q 3HP3A 4O1NA 4XTCS 4IUUA 1X3GA 1JWUD 1ZYRD 1H9KA 1SFOH 2Q8RE 4QY7A 1I94L 3NXWA 1Y8PB 1TKWB 4B08A 3H0GH 3IL8A 2QA4A 1D5MC 1BR9A 5E4WC 1PDQA 4JK1C 1EWCA 2R7ZG 5BR8Q 5IODA 1SNCA 3FKIH 3PF4A 2NTSA 1KHIA 4ID6A 5IYCH 5C44B 1CA6A 3EROA 4DXFA 4YHHL 2EOTA 4A3MB 1YVCA 1PRTB 4Y7NH 3T1YL 2EVBA 2NTTA 1NNXA 3NTIA 2Z8LA 3QIAA 3PIO3 3STBD 1FD7D 3Q6SA 1F2YA 4NP5A 4KV6A 4DK3C 3AU7A 2B39A 1QUQA 4FXDA 1X3PA 1VQNA 1PFNA 1WTRA 1HA5A 2GN5A 3N52A 1XMOL 1EEID 4UP9A 3NHHA 2F4VQ 2R92B 3HOUB 2YTXA 4ODGA 1GHJA 1W2BA 1A62A 4LF6Q 2H1EA 4YWKA 1X54A 3Q8DA 2V1CC 5FJ8H 3SR1A 4NMZA 5IT9E 4GLVB 2EYMA 1EY6A 2Q8IB 2HIVA 1VCIA 4BBRG 1F2MA 4JI1Q 3G4SA 3OW2A 1NE3A 4A3JH 4H7BA 1NR2A 4TRDA 4PMWA 1KNEA 1A3VA 1E1TA 3W1BA 5K5PA 3I3CA 3ONAB 2DGYA 2WV6D 2EXZA 2EJGC 2K28A 4JBKA 4RHRA 1YIJA 2NZ1D 2KHSA 3PMFA 1HH2P 3KLWA 2HQLA 3RNUA 4A3FH 4PQXA 1KXLA 2BOSA 4LF8L 5JJIA 1EU3A 4K0KL 1DCZA 3OIPA 1BNZA 3SK6A 4DV4Q 1STHA 1YHBA 4APVA 1C4QA 3CU7A 3PO2H 5KYLA 1QE6A 4IPGA 4DV7Q 1SJHD 1IBMQ 3A8JE 4RKLA 3HOYH 3NBIA 1TXYA 4HIKA 1WVLA 4UP7A 1TY2A 5EAYA 2JXMB 2ZJPA 3S16B 1STEA 3FMCA 3TZDA 4FF3A 3J81i 2ZXRA 5ELDA 1JMCA 2VL6A 2SNSA 1AEXA 3I4OA 1LTGD 3K5NA 3VDYA 4EX5A 3GTKH 1EQQA 2VS1A 1QJOA 1MBYA 3CPFA 3K0XA 4DR4Q 3BZCA 4JV5Q 1T5EA 1NCVA 1G2SA 4RGTA 3F2BA 1PV4A 1D8LA 3I4MG 3H91A 2AQ1B 2JA6B 1F9SA 1LT3D 1R9TH 2NUCA 1B4OA 2LY7A 1MIUA 2QDBA 5C6AA 3HOZH 2ZXPA 3GTPH 1HCZA 1SRUA 5LL6S 3BVMA 1VQIA 2BA1A 4ZLTF 1UAPA 4A3LH 3FRPB 4BBRB 3GO5A 3PF5A 3CHBD 4IUPA 1HZ9A 5IGBA 5M5WB 3VYSA 1BCPB 1SROA 4JBWA 5KNBA 1B3AA 5CR3A 1BF4A 3J81E 2RF4A 4HR7B 1N36L 4CDDC 2O5JC 3QOJA 1BUVT 4TQUS 1JORA 1I6VC 4LFCQ 3SK4A 2NN6G 4MNOA 4C3JH 3F2CA 4DK1A 3QR8A 3W2DA 2A68C 4QCLA 3J81j 3A8KE 3S1RB 4OX9Q 2D0OA 3A56A 1DD2A 4HN7A 5C4ZA 1EY9A 4ULLA 4OWTB 3HZXA 1DOKA 3HGBA 5JEAH 1ZEQX 1B8AA 1VQKA 2HD3A 1CA5A 2EQSA 1C0AA 4PV1C 3PO2G 3RZOB 2A6ED 4DV0Q 1FR3A 1SNDA 1KABA 4DUYL 4XDXA 3DM3A 4QUFA 1GVPA 3NQTA 2K50A 2E2IB 2B8FA 1B53A 1SDFA 1Q86C 3R2TA 3HOWG 1AP0A 2L1BA 2NBFA 2XGTA 5C3EG 3M4OH 5GAHC 1RKNA 2F0KA 2MP1A 4KMUC 4MTNA 1DGSA 3M9BA 1TY0A 4AYBG 1QWYA 4ZQ3A 4OIJA 5ELCA 3PQIA 1E2VA 5KRUA 1AFPA 4DFAA 1WTQA 4DR7L 1S5CD 2JN4A 5LMUL 2G5DA 3KFUA 4C1NI 1JT8A 1PFBA 4ZUJA 2R6GA 1GUWA 5KEEA 3HRZC 1QCBD 1XMQL 4HJ5A 4PZ8A 1E24A 5FKAC 1X9NA 1NBWA 1ONLA 2IPKD 4X66Q 1GM5A 2PW7A 4F88A 4OIKA 1I4PA 1GUGA 5BN3A 2WP8J 1TU2B 1X3FA 3OW7A 1HHVA 3CCRA 3L0OA 2I0QA 2JA7H 3E9HA 1TWFB 1BO0A 2VW9A 1DOLA 4TSSA 1STYA 2JP1A 2RA4A 1EWHA 2PZUA 1AZQA 5FO7B 5IWAL 1KD1C 4HJ9A 1IYVA 2Z1CA 4X65Q 3J7AF 1I4RA 3AQQA 3DHQA 3HFZB 2SOBA 5M3MG 4A3FB 3H09A 4A3BH 4GKKL 1JR0D 2E5LL 1RCVD 2Q2TA 2N78A 3S17H 4DR2L 3TRZA 4XT3B 1IYJB 3PO2B 4ZKCB 1E22A 4JI7L 4YIJA 1O7LA 1NY4A 1HTLD 4B3SQ 4BXXH 5CYUA 3HOYB 3GTJH 2K33A 4I65A 1YNNC 1KIXA 2LKVA 3S1QB 3HOWB 4LK1C 4JI8L 3V96A 3A5ZB 3VYRA 1XYIA 3O13A 3GTGB 3VR3A 1ASZA 2WFWA 4LFBL 4AYBB 3KDFA 2WB1E 3TDQA 1XNQL 1RTNA 5K36H 2EYJA 3ZYYX 5IGDA 3L9AX 4LJZC 1Q81C 1WD0A 1CQVA 1PZKD 4O2DA 5L37A 1R9TB 4J1MA 2JJQA 4DR6Q 1YJWA 4DV6L 4C3HH 2NVQH 3KYHC 3T4AC 3KJOA 1QVCA 4OO1G 3HKSA 1SNPA 3ULPA 1CKNA 4DAYB 4GS3A 4KY5A 2BE5C 1KTKA 4XYOA 4OWWB 5FLMH 2CVRA 4QIWE 4A3KH 3Q22A 4LUOA 4R4CA 3S24A 3K80C 2JA8H 4GNXB 4C3JB 5IGFA 3BVZA 3J7YW 1HFNA 5IE8A 1WTHA 4L6TB 1ENAA 1SNMA 4XXEA 4GLAC 2B2YC 1R4QB 5M3MB 1QVGA 3LX0A 2K1BA 4X64Q 3ERSX 2Y0SB 2EYOA 3P75A 3U4ZA 4CDFC 1GUTA 1QOHA 2UUAQ 3I90A 1XJVA 2FXQA 5C0XG 1CKOA 4X62L 2KHIA 5C4JH 2RSNA 1UE6A 1GUNA 1X3QA 4KJOA 3NBHA 1V1PA 4L5RC 3PUZA 4DV2Q 1EUJA 2I5LX 3BJUA 1WD1A 4L5TA 4OELB 1EY5A 2QKIC 4LMQD 3RN2A 1K73C 1H95A 2SNMA 2F0UA 2F52A 5IP7H 2ATWA 1I50B 2B2VA 1JB3A 1X32A 2K4KA 2HHHL 1J5EL 1YI2A 3KF8B 3M4OB 3C1EA 3H3VI 2KEDA 3H3VH 3ERQA 3H15A 1PLFA 3J80i 3HOXH 1VQBA 3MFYA 3D8GA 4KHVA 4GZYC 3KDFB 1Y14B 4CHTB 2K5QA 2ZTCA 4DN4M 2PCFB 1IHZA 4NPSA 2A68D 1KQSA 4IQZA 1CM9A 4UDUC 4J6HA 1UWVA 3GQBA 2ZTDA 4N9TA 3X3NA 4JI6Q 5C44H 1E2WA 2NWGA 4CGYB 4P72A 4CJ1B 2UUBL 1M90C 4EQPA 1E3PA 1BQQT 1PH9A 1HTPA 4WFN3 2ZM6Q 1E0BA 4DU9A 1VQ4A 3TP7A 4IFDI 2OQ0A 4UP8A 4JBJA 4IFDH 2CH4A 4JI3L 4NXMQ 4V0BA 2F0MA 4B3ML 1IL2A 1HNZL 4DV1L 3J80E 2F0QA 4BY1H 2R92H 1K8MA 3HOUH 4ZKBB 3TN2A 4GLXA 3T1HQ 1U5KA 4R4IA 2KCTA 5C3XA 4HIDA 3ITPA 3K5OA 3UDIA 4BA1I 1LTTD 2PMZE 2IJ0A 1VDZA 1WTOA 3S2DB 4RWSC 1NMFA 2F0GA 5CV6A 3AB9A 2F0WA 2FFKB 2RCFA 4BBSH 2WKCA 3CP0A 3NBHB 2CKZB 1V1PB 1BXTA 4AQYQ 2G9DA 3MXNB 1H9RA 3G48A 4IPHA 1EIYB 1YHAA 4TVAB 4BS9A 1K9MC 1VMPA 4A3IG 3UE0A 2GA4B 3C46A 4PMBA 1HNWQ 4LF4Q 1N32Q 3EN2A 3MHBA 4GN3B 5KGUA 2A69C 1LACA 2R7ZH 4E6IA 2K52A 1K28A 4YWLA 4IALA 2J0TD 1EIGA 3E6ZX 3OPOA 4C3HB 2NVTH 3OSOA 3V05A 1U4RA 2VQEL 4G7OC 1F77A 4G7ZC 2KEEA 3OWFA 1HJPA 2DJFC 2R7FA 5BN5A 1SYGA 3UE1A 2QF7A 1O7YA 1I3QH 4A3KB 4RCNA 1I4HA 1RHPA 1TWCB 4HSPA 4X3TA 1YNND 1OXXK 3VA5A 3EBEA 4GOPA 4LF7L 3D3RA 1C9OA 2RDHA 4PZ7A 5CORA 1N34L 2PMZB 1F2ZA 2MGSA 2F0OA 4DR5Q 3SVMA 2QILA 2RDFA 4BBRH 4DXGA 4ZYSA 3DLLA 5GAGC 5M5WH 1SYFA 3F1ZA 3D6CA 4L8JA 4RMFA 1LTBD 5EQ0A 1EIHA 2ENBA 5CC4A 1EZ6A 1MJEA 3IKJA 4ZK9B 3JAMi 2UXBQ 1VQ5A 3GTQB 1HXYD 2VQFQ 1I4XA 4CKEA 4FYDA 2F0NA 4RAUC 2XRSD 3M7GA 3C1FA 4NXNL 3A55A 5JPMC 1U4MA 2OEOA 5EGTA 5BN4A 2JSOA 4QGUA 3S1RH 4A3IB 2BE5D 4DV5Q 4EVOA 2B2YA 3RZDB 5A2QL 2XWBB 3URYA 4OONA 5KNCA 1VF7A 1HQMC 5EPLA 4HAEA 4DNIA 4CJ0B 1WTVA 3HOXB 3L2PA 4XQNA 1E1OA 3UDGA 2R3ZA 1QZGA 1SE3A 3K5LA 2PQAB 1KAAA 5AJ3L 3RZOH 1PFSA 2AMCB 2GVBA 1DXMA 2F4VL 2E74C 4C3IG 2L0CA 1PH3A 1B9NA 2BH2A 1CK1A 2MQHA 2E2IH 4B3RQ 2RBMA 3JAME 3A7LA 2AWOA 1BBWA 5E1FA 3TP5A 1Y69U 1A0IA 4DR3Q 3SE0A 2B63G 4JI1L 4A3EG 3I4MH 4IN3A 3X3MA 2RSOA 4G4KA 1IBKQ 1DZ1A 2UXDQ 4J8QA 4X6AH
chains in the Genus database with same CATH topology
4JCVE 1AE2A 4JI4L 2EXDA 1PH5A 1B8AA 1V1QA 4UY8C 1VQKA 2ES2A 4JI8Q 4Y52H 1XPOA 1AE3A 2CFMA 2PQAA 2CWPA 2MO1A 2PI2A 4IPDA 1YHQA 1X55A 1VQHA 1VQGA 3K7AH 2EQSA 2AHOB 2NVYH 5M3FH 1TWGH 1HR0Q 2XTIA 4GOPB 4B3MQ 4JI0Q 3PO2G 4LFBQ 1C0AA 1VQEA 2A1AA 2MO0A 1FJGQ 4DV0Q 4JOIA 4OXPA 3PGZA 3U50C 4DUYL 3CC4A 1XNQQ 3JC66 3DM3A 2R93G 1GVPA 4C3IH 2PI2E 2Q2IA 4DV4L 2K50A 4LUVA 1Q86C 1HNXL 4POGA 3HOWG 2XGTA 4DV7L 5C3EG 3PV0A 5JJLA 2NN6I 3M4OH 2JA7G 5GAHC 2UXCL 1GKHA 1U0LA 2IY5B 1N9WA 4MTNA 4DV6Q 4A93H 1DGSA 2K5HA 3M9BA 1TWFH 4JI2Q 4A3EH 4AYBG 2B63H 2YYZA 3KF6A 4R4QA 4YHHQ 4DV3Q 4ME3A 1Z47A 3E0EA 1VQ7A 3TS0A 2EIFA 1G51A 3T1YQ 4JI6L 1AH9A 3RLFA 3D31A 4DR7L 5GQOA 1YNXA 5LMUL 1PH2A 1L0WA 2KHJA 3KFUA 4A3BG 2UXBL 3CW2C 1HZBA 1JT8A 4DR4L 2Q2HA 2R6GA 2VQFL 1EIFA 2UUCQ 5LMNQ 4JBMA 4JV5L 1HR0W 3NEMA 1XMQL 1X56A 1S40A 1WJJA 4HJ5A 4PZ8A 3STBC 1RL2A 4YCVA 4UPAA 4IOAA 1P8LA 3G6EA 3UDFA 1E24A 1OXTA 1X9NA 4H02A 3U58A 1NBWA 3RR5A 4AH6A 2OTJA 4A3MG 4BXXG 4DV5L 1NTGA 4X66Q 1PHJA 1GM5A 3OYYA 1VQLA 4QJFA 1TWAH 1VQCA 2R93H 1JB7A 2WP8J 2N49A 1EQRA 1X3FA 5C0XJ 3W5OA 3S1QH 3HOWH 5C3EH 3CCRA 3L0OA 3K81C 2I0QA 2KBNA 3CCLA 3I7FA 2JA7H 3A5UA 3GTGH 3E9HA 2VZAA 1B70B 2MFIA 2D0PA 2MNAA 5BR8L 2VW9A 4J15A 3J80c 4DR1Q 1P16A 4LF5Q 4P74A 4HJ7A 5IWAL 5K36G 1KD1C 4HJ9A 4P75A 4WJ3M 4X65Q 3AQQA 1IBLQ 3HFZB 2KCMA 5M3MG 5LMNW 3S1NH 4A3BH 4GKKL 1YZ6A 3ER0A 4GN5A 4LFCL 4A76A 4EQ5A 2E5LL 1BBUA 2WAQG 2N78A 2Q2TA 4DR3L 3S17H 4DR2L 1EWIA 3TRZA 4DPGA 4KHPQ 1IYJB 1E22A 1KRTA 2HHHQ 1J5EQ 4JI7L 1I6HH 1IBKL 1NY4A 4OX9L 4A3MH 2E2HH 4B3SQ 4LF8Q 2RHSB 4BXXH 3GTJH 3K8AA 3I4NG 1YITA 3ZJYC 1CKNB 3FHWA 1KIXA 1UE7A 4JI8L 1VQ9A 3A5ZB 1S72A 3AEVA 4BA2I 5FLMG 1N34Q 2VY3A 3CPWA 2L15A 4IPCA 4A3KG 2CCZA 1ASZA 1Y1VG 3ICEA 2WFWA 4LF6L 2JA8G 4LFBL 4JI0L 3J7A5 1CSQA 4P73A 1VQAA 4POFA 1XNRQ 1OXUA 1SN8A 2ZTEA 3KDFA 4JG2A 4GNXC 2WB1E 1N8RC 1FJGL 4DV0L 4A3CG 1XNQL 2IHEA 2JEAI 4BY7G 2A19A 3PUYA 2YV5A 3CCUA 3F8TA 3RLOA 1Q81C 1OTCA 1QVFA 2K5VA 5M3MH 4DUZQ 2ID0A 1Y1WG 4O2DA 3CCSA 4ALPA 2JJQA 4DK6C 2UUBQ 1YJNA 4NXNQ 4DR6Q 1YJWA 1O7IA 4DV6L 4C3HH 5M5YH 2JA9A 4JI2L 2NVQH 1Q1BA 3KYHC 3CF5A 1PA6A 4B3TQ 2JK8A 1GD7A 4OWXB 1QVCA 3KJOA 4OO1G 2LXJA 3E9IA 3HKSA 3ULPA 1Q7YC 4YCUA 4IOCA 2IX0A 4DV3L 4R1JA 1YJ9A 1CKNA 4JI3Q 4A3GG 5J3BA 4DAYB 1PH6A 3I4NH 3PUVA 1Q82C 1I94Q 2OWOA 2OQKA 3HOVG 4GS3A 2R7DA 1HNZQ 5C4XG 4L5SA 4OWWB 1WFQA 2UUCL 4DV1Q 2HIXA 1J6QA 5LMNL 1VS0A 3AYHB 1TWHH 2K5NA 4MZ9A 4LFAQ 2RHQB 5IP7G 5FLMH 4QIWE 1XTDA 2KENA 3B6YA 4A3KH 2OTLA 3M7NA 4LUOA 3RN5A 1I50H 4R4CA 1Y1VH 1WCMG 3D0FA 3K80C 2C35B 4R4OA 3S24A 4DKAC 5AJ3Q 2JA8H 1CSPA 2JA6G 2CWAA 4GNXB 1EYGA 3A74A 3SGIA 1IBML 2QEXA 1CKMA 5HY6A 4A3CH 4X66L 1W3SA 4BY7H 4WJ4A 5IE8A 4DR5L 4C2MH 1N36Q 2DUDA 2N8NA 4GLAC 4AYBE 1K8AC 3PIPA 1WYDA 4GKJQ 1QVGA 5JJKA 1Y1WH 4X64Q 3ERSX 1K83H 3HOXG 2VNUD 1UEBA 3U4ZA 1WI5A 2UUAQ 1XJVA 1LYLA 2FXQA 5C0XG 1CKOA 4X62L 4DR1L 4OO1I 5IYDG 1KRSA 2K14A 2KHIA 4O0AA 5C4JH 4LF5L 3S16H 5H1SE 1UE6A 2IT1A 3G71A 1XPUA 2JA5G 4A3GH 3M4QA 4X65L 4L5RC 1VQ6A 4LW1A 3PUZA 5C44G 4DV2Q 1EUJA 1YEZA 2I5LX 4HJ8A 3BJUA 3IRBA 4L5TA 2JE6I 1K8GA 1C7YA 1XMOQ 4JI4Q 3HOVH 1HZAA 1MJCA 4YCWA 3CC7A 3RN2A 5C4XH 1K73C 1NJIC 1H95A 3TREA 2F52A 5IP7H 4R4TA 3S2HH 2ATWA 2ALYB 4GNXA 4KHPL 1K0RA 4A4IA 2K4KA 1WCMH 2HHHL 1J5EL 4YWMA 1YI2A 2JA6H 3KF8B 3CCVA 3CD6A 4IFDG 4B3SL 3S14H 2I5MX 3H3VI 1KAWA 4A75A 3H3VH 2IX1A 2NZHA 4IO9A 1V9PA 1S3OA 3H0GG 3H15A 2VQEQ 1PH8A 1HNXQ 3GDEA 1A8VA 4P71A 3J80i 1VQBA 3HOXH 1KC8C 1LTLA 4BY1G 3KDFB 2R92G 2UXCQ 1Y14B 3HOUG 2Q2UA 1WOCA 3A0JA 2ZTCA 3U4VA 5C0XI 2JQOA 4LWCA 3FKIG 4NPSA 4B3RL 1XNRL 3W1GA 1KQSA 3KOJA 5IYDH 2Z6KC 1IZ6A 1UWVA 1JJCB 2YTVA 3CAMA 2YU9H 1L1OC 2Y0SE 2ZTDA 2WAQE 3GTLH 4JYAQ 4IFDJ 1RIPA 3TEHB 4JI6Q 2IHFA 2JA5H 5GAEC 4DAMA 5IYCG 3JAMc 2UU9L 3I55A 3ULJA 5C44H 4A3DG 3S2DH 3S1MH 3TS2A 4DUZL 5ELOA 4AIMA 4JI5Q 4P72A 2UXDL 4KI0A 3RLNA 2UUBL 1M90C 1XMQQ 4BBSG 4K0KQ 1E3PA 4PG3A 1PH9A 1B7YB 2ZM6Q 4B3TL 4YY3Q 2GVAA 4LF7Q 4XTCS 1VQ4A 1PYSB 4XIGS 1X3GA 3OTOQ 1MKHA 3J7ZC 1VQPA 4IFDI 2OQ0A 5M5XH 4UP8A 4JBJA 1X6OA 1T9HA 4JI3L 3EIVA 1SFOH 4NXMQ 1PH7A 4JC0A 4QY7A 1I94L 1ASYA 1K3RA 1HR0L 4B3ML 1IL2A 3H0GH 1QUQB 3CMAA 1HNZL 1V43A 2QA4A 5GROA 3MEFA 2E2JH 4DV1L 2NZOA 4BY1H 2R92H 3HOUH 4GLXA 2HT1A 3T1HQ 2R7ZG 5BR8Q 5IT9c 4GOPC 1U5KA 5GADC 1PH4A 3FKIH 3PF4A 4R4IA 2KCTA 5FJ8G 4KHZA 4HIDA 4HJAA 3LGJA 3UDIA 1KHIA 1L1OB 4BA1I 2BH8A 2PMZE 5IYCH 4LUZA 4LF9Q 1NMFA 2Z0SA 3BU2A 3WWVA 4A3JG 4A3DH 4GKJL 3K7UC 3HKZG 4YHHL 2A8VA 2VUMG 3NENA 4X64L 1SLJA 1YVCA 5ELNA 3S15H 3M4PA 4Y7NH 1VQOA 1HZCA 3T1YL 4DR2Q 4BBSH 4QQBX 3CP0A 3NBHB 2CKZB 3STBD 2UUAL 3AFPA 3KJPA 4FDBA 4AQYQ 1E7ZA 4JI7Q 1UE5A 3MXNB 4DK3C 3G48A 4HIOA 1XPRA 1CUKA 2CQOA 4IPHA 1Q8KA 4NB3A 1QUQA 1EIYB 1YHAA 5E7NA 4DV2L 1VQNA 4TVAB 1K9MC 1TWCH 1VQDA 4A3FG 1XMOL 2GN5A 1JJGA 4HIMA 2RCNA 3UE0A 4A3IG 4UP9A 1HNWQ 5IP9G 2LXKA 1D7QA 2F4VQ 4QL5A 4LF4Q 2YTXA 1N32Q 3EN2A 5IYBG 3PO3G 4GN3B 2B29A 2Z6KA 1A62A 1W2BA 4LF6Q 4YWKA 2R7ZH 1L1OA 4OWTB 4LNQA 1X54A 3Q8DA 2V1CC 2K52A 5FJ8H 4YWLA 1IXRA 1PVOA 3HOYG 4GLVB 3NELA 2QGQA 5IY0A 1N33Q 2HIVA 1VCIA 4BBRG 2NVTH 4JI1Q 3G4SA 3OW2A 1NE3A 4A3JH 3TQYA 1EOVA 2VQEL 2ZJRA 4PMWA 2VUMH 1G6PA 1X3EA 3F2DA 2LSSA 1L2FA 1E1TA 3W1BA 1HJPA 1IBLL 2R7FA 2AWNA 1NMGA 2DGYA 1KL9A 1OXVA 3UE1A 3BZKA 4JBKA 3ULLA 1BKBA 1LM0A 3GTQH 1I3QH 1YIJA 4JYAL 2I5HA 1HH2P 2OCEA 1VQ8A 3KLWA 2HQLA 3RNUA 4A3FH 1OXXK 1A63A 1KXLA 3EBEA 4JI5L 4LF8L 4A3IH 4DUYQ 2ASBA 5JJIA 5IP9H 4GOPA 3RZDH 4K0KL 1SR3A 5IYBH 3PO3H 2F3IA 2JEBI 4DV4Q 3HOZG 2ZM6L 2NVXH 3PUWA 1YHBA 4YY3L 3I56A 4APVA 4LF7L 3PO2H 1EFWA 4IPGA 5HGQA 1Q46A 3OTOL 4DV7Q 1C9OA 4PZ7A 1IBMQ 1VQJA 1N34L 1FL0A 3HOYH 4A3LG 1SE8A 1UE1A 1TXYA 4HIKA 4DR5Q 4NXML 4BBRH 3PSIA 4UP7A 3CQZH 5EAYA 1VQMA 1QZHA 1SMXA 3J81c 3DLLA 2ZJQA 5GAGC 5M5WH 2ZJPA 3GTMH 3F1ZA 4RMFA 3J81i 3PIOA 1JMCA 4DR7Q 2VL6A 3I4OA 3VDYA 4JOIC 4EX5A 2E8GA 5LMUQ 1EQQA 3GTKH 2VS1A 3T1HL 1MJEA 2UXBQ 3JAMi 4X62Q 1VQ5A 1FGUA 3CPFA 3K0XA 4DR4Q 2VQFQ 3BZCA 4JV5Q 2YTYA 4IJHA 4NXNL 3M85A 4DR6L 3F2BA 4LF9L 3FP9A 1PV4A 1D8LA 1GO3E 1LUZA 3PCOB 3I4MG 3PUXA 4QGUA 3S1RH 2PNHA 4DV5Q 1R9TH 3UDXA 2Y0SG 3CCJA 4L5QA 1BVSA 1MIUA 2N3SA 5JEAG 3HOZH 4OONA 5DLQE 4AQYL 1FVIA 3I2ZA 4DNIA 3GTPH 1SRUA 4PZ6A 3L2PA 1E1OA 1VQIA 3UDGA 2BA1A 4LFAL 1QZGA 2AKWB 4A3LH 3GD7A 5M3FG 2PQAB 1Z9FA 3GO5A 3PF5A 5AJ3L 1M1KC 3CCMA 3RZOH 1HZ9A 1G291 1PFSA 4KLKA 1PH1A 2AMCB 1SROA 4GN4B 4JBWA 5IWAQ 1HNWL 1PYBA 2GVBA 3CC2A 2B3GA 4RG1A 2F4VL 5FLXc 4IJLA 4LF4L 1N32L 2RF4A 2D62A 1I5FA 1PH3A 1VQFA 1N36L 2BH2A 1JJ2A 1Q1EA 2MQHA 2E2IH 5JEAJ 4GKKQ 4B3RQ 3HKZE 1Q12A 2BA0A 2AWOA 2WB1G 1BBWA 3L7ZC 4TQUS 2E5LQ 4LFCQ 3CCQA 2NN6G 4MNOA 4C3JH 3F2CA 1A0IA 1JE5A 4DR3Q 4A93G 3AFQA 1N33L 2H5XA 2UU9Q 4JI1L 4A3EG 2B63G 3CCEA 3I4MH 3J81j 3GTOH 3M3YH 1YBYA 3CXCA 1IBKQ 1X65A 4OX9Q 1OXSC 2D0OA 2UXDQ 3KF6B 4X6AH 3CMEA 2K75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JCV E;  1AE2 A;  4JI4 L;  2EXD A;  1PH5 A;  1B8A A;  1V1Q A;  4UY8 C;  1VQK A;  2ES2 A;  4JI8 Q;  4Y52 H;  1XPO A;  1AE3 A;  2CFM A;  2PQA A;  2CWP A;  2MO1 A;  2PI2 A;  4IPD A;  1YHQ A;  1X55 A;  1VQH A;  1VQG A;  3K7A H;  2EQS A;  2AHO B;  2NVY H;  5M3F H;  1TWG H;  1HR0 Q;  2XTI A;  4GOP B;  4B3M Q;  4JI0 Q;  3PO2 G;  4LFB Q;  1C0A A;  1VQE A;  2A1A A;  2MO0 A;  1FJG Q;  4DV0 Q;  4JOI A;  4OXP A;  3PGZ A;  3U50 C;  4DUY L;  3CC4 A;  1XNQ Q;  3JC6 6;  3DM3 A;  2R93 G;  1GVP A;  4C3I H;  2PI2 E;  2Q2I A;  4DV4 L;  2K50 A;  4LUV A;  1Q86 C;  1HNX L;  4POG A;  3HOW G;  2XGT A;  4DV7 L;  5C3E G;  3PV0 A;  5JJL A;  2NN6 I;  3M4O H;  2JA7 G;  5GAH C;  2UXC L;  1GKH A;  1U0L A;  2IY5 B;  1N9W A;  4MTN A;  4DV6 Q;  4A93 H;  1DGS A;  2K5H A;  3M9B A;  1TWF H;  4JI2 Q;  4A3E H;  4AYB G;  2B63 H;  2YYZ A;  3KF6 A;  4R4Q A;  4YHH Q;  4DV3 Q;  4ME3 A;  1Z47 A;  3E0E A;  1VQ7 A;  3TS0 A;  2EIF A;  1G51 A;  3T1Y Q;  4JI6 L;  1AH9 A;  3RLF A;  3D31 A;  4DR7 L;  5GQO A;  1YNX A;  5LMU L;  1PH2 A;  1L0W A;  2KHJ A;  3KFU A;  4A3B G;  2UXB L;  3CW2 C;  1HZB A;  1JT8 A;  4DR4 L;  2Q2H A;  2R6G A;  2VQF L;  1EIF A;  2UUC Q;  5LMN Q;  4JBM A;  4JV5 L;  1HR0 W;  3NEM A;  1XMQ L;  1X56 A;  1S40 A;  1WJJ A;  4HJ5 A;  4PZ8 A;  3STB C;  1RL2 A;  4YCV A;  4UPA A;  4IOA A;  1P8L A;  3G6E A;  3UDF A;  1E24 A;  1OXT A;  1X9N A;  4H02 A;  3U58 A;  1NBW A;  3RR5 A;  4AH6 A;  2OTJ A;  4A3M G;  4BXX G;  4DV5 L;  1NTG A;  4X66 Q;  1PHJ A;  1GM5 A;  3OYY A;  1VQL A;  4QJF A;  1TWA H;  1VQC A;  2R93 H;  1JB7 A;  2WP8 J;  2N49 A;  1EQR A;  1X3F A;  5C0X J;  3W5O A;  3S1Q H;  3HOW H;  5C3E H;  3CCR A;  3L0O A;  3K81 C;  2I0Q A;  2KBN A;  3CCL A;  3I7F A;  2JA7 H;  3A5U A;  3GTG H;  3E9H A;  2VZA A;  1B70 B;  2MFI A;  2D0P A;  2MNA A;  5BR8 L;  2VW9 A;  4J15 A;  3J80 c;  4DR1 Q;  1P16 A;  4LF5 Q;  4P74 A;  4HJ7 A;  5IWA L;  5K36 G;  1KD1 C;  4HJ9 A;  4P75 A;  4WJ3 M;  4X65 Q;  3AQQ A;  1IBL Q;  3HFZ B;  2KCM A;  5M3M G;  5LMN W;  3S1N H;  4A3B H;  4GKK L;  1YZ6 A;  3ER0 A;  4GN5 A;  4LFC L;  4A76 A;  4EQ5 A;  2E5L L;  1BBU A;  2WAQ G;  2N78 A;  2Q2T A;  4DR3 L;  3S17 H;  4DR2 L;  1EWI A;  3TRZ A;  4DPG A;  4KHP Q;  1IYJ B;  1E22 A;  1KRT A;  2HHH Q;  1J5E Q;  4JI7 L;  1I6H H;  1IBK L;  1NY4 A;  4OX9 L;  4A3M H;  2E2H H;  4B3S Q;  4LF8 Q;  2RHS B;  4BXX H;  3GTJ H;  3K8A A;  3I4N G;  1YIT A;  3ZJY C;  1CKN B;  3FHW A;  1KIX A;  1UE7 A;  4JI8 L;  1VQ9 A;  3A5Z B;  1S72 A;  3AEV A;  4BA2 I;  5FLM G;  1N34 Q;  2VY3 A;  3CPW A;  2L15 A;  4IPC A;  4A3K G;  2CCZ A;  1ASZ A;  1Y1V G;  3ICE A;  2WFW A;  4LF6 L;  2JA8 G;  4LFB L;  4JI0 L;  3J7A 5;  1CSQ A;  4P73 A;  1VQA A;  4POF A;  1XNR Q;  1OXU A;  1SN8 A;  2ZTE A;  3KDF A;  4JG2 A;  4GNX C;  2WB1 E;  1N8R C;  1FJG L;  4DV0 L;  4A3C G;  1XNQ L;  2IHE A;  2JEA I;  4BY7 G;  2A19 A;  3PUY A;  2YV5 A;  3CCU A;  3F8T A;  3RLO A;  1Q81 C;  1OTC A;  1QVF A;  2K5V A;  5M3M H;  4DUZ Q;  2ID0 A;  1Y1W G;  4O2D A;  3CCS A;  4ALP A;  2JJQ A;  4DK6 C;  2UUB Q;  1YJN A;  4NXN Q;  4DR6 Q;  1YJW A;  1O7I A;  4DV6 L;  4C3H H;  5M5Y H;  2JA9 A;  4JI2 L;  2NVQ H;  1Q1B A;  3KYH C;  3CF5 A;  1PA6 A;  4B3T Q;  2JK8 A;  1GD7 A;  4OWX B;  1QVC A;  3KJO A;  4OO1 G;  2LXJ A;  3E9I A;  3HKS A;  3ULP A;  1Q7Y C;  4YCU A;  4IOC A;  2IX0 A;  4DV3 L;  4R1J A;  1YJ9 A;  1CKN A;  4JI3 Q;  4A3G G;  5J3B A;  4DAY B;  1PH6 A;  3I4N H;  3PUV A;  1Q82 C;  1I94 Q;  2OWO A;  2OQK A;  3HOV G;  4GS3 A;  2R7D A;  1HNZ Q;  5C4X G;  4L5S A;  4OWW B;  1WFQ A;  2UUC L;  4DV1 Q;  2HIX A;  1J6Q A;  5LMN L;  1VS0 A;  3AYH B;  1TWH H;  2K5N A;  4MZ9 A;  4LFA Q;  2RHQ B;  5IP7 G;  5FLM H;  4QIW E;  1XTD A;  2KEN A;  3B6Y A;  4A3K H;  2OTL A;  3M7N A;  4LUO A;  3RN5 A;  1I50 H;  4R4C A;  1Y1V H;  1WCM G;  3D0F A;  3K80 C;  2C35 B;  4R4O A;  3S24 A;  4DKA C;  5AJ3 Q;  2JA8 H;  1CSP A;  2JA6 G;  2CWA A;  4GNX B;  1EYG A;  3A74 A;  3SGI A;  1IBM L;  2QEX A;  1CKM A;  5HY6 A;  4A3C H;  4X66 L;  1W3S A;  4BY7 H;  4WJ4 A;  5IE8 A;  4DR5 L;  4C2M H;  1N36 Q;  2DUD A;  2N8N A;  4GLA C;  4AYB E;  1K8A C;  3PIP A;  1WYD A;  4GKJ Q;  1QVG A;  5JJK A;  1Y1W H;  4X64 Q;  3ERS X;  1K83 H;  3HOX G;  2VNU D;  1UEB A;  3U4Z A;  1WI5 A;  2UUA Q;  1XJV A;  1LYL A;  2FXQ A;  5C0X G;  1CKO A;  4X62 L;  4DR1 L;  4OO1 I;  5IYD G;  1KRS A;  2K14 A;  2KHI A;  4O0A A;  5C4J H;  4LF5 L;  3S16 H;  5H1S E;  1UE6 A;  2IT1 A;  3G71 A;  1XPU A;  2JA5 G;  4A3G H;  3M4Q A;  4X65 L;  4L5R C;  1VQ6 A;  4LW1 A;  3PUZ A;  5C44 G;  4DV2 Q;  1EUJ A;  1YEZ A;  2I5L X;  4HJ8 A;  3BJU A;  3IRB A;  4L5T A;  2JE6 I;  1K8G A;  1C7Y A;  1XMO Q;  4JI4 Q;  3HOV H;  1HZA A;  1MJC A;  4YCW A;  3CC7 A;  3RN2 A;  5C4X H;  1K73 C;  1NJI C;  1H95 A;  3TRE A;  2F52 A;  5IP7 H;  4R4T A;  3S2H H;  2ATW A;  2ALY B;  4GNX A;  4KHP L;  1K0R A;  4A4I A;  2K4K A;  1WCM H;  2HHH L;  1J5E L;  4YWM A;  1YI2 A;  2JA6 H;  3KF8 B;  3CCV A;  3CD6 A;  4IFD G;  4B3S L;  3S14 H;  2I5M X;  3H3V I;  1KAW A;  4A75 A;  3H3V H;  2IX1 A;  2NZH A;  4IO9 A;  1V9P A;  1S3O A;  3H0G G;  3H15 A;  2VQE Q;  1PH8 A;  1HNX Q;  3GDE A;  1A8V A;  4P71 A;  3J80 i;  1VQB A;  3HOX H;  1KC8 C;  1LTL A;  4BY1 G;  3KDF B;  2R92 G;  2UXC Q;  1Y14 B;  3HOU G;  2Q2U A;  1WOC A;  3A0J A;  2ZTC A;  3U4V A;  5C0X I;  2JQO A;  4LWC A;  3FKI G;  4NPS A;  4B3R L;  1XNR L;  3W1G A;  1KQS A;  3KOJ A;  5IYD H;  2Z6K C;  1IZ6 A;  1UWV A;  1JJC B;  2YTV A;  3CAM A;  2YU9 H;  1L1O C;  2Y0S E;  2ZTD A;  2WAQ E;  3GTL H;  4JYA Q;  4IFD J;  1RIP A;  3TEH B;  4JI6 Q;  2IHF A;  2JA5 H;  5GAE C;  4DAM A;  5IYC G;  3JAM c;  2UU9 L;  3I55 A;  3ULJ A;  5C44 H;  4A3D G;  3S2D H;  3S1M H;  3TS2 A;  4DUZ L;  5ELO A;  4AIM A;  4JI5 Q;  4P72 A;  2UXD L;  4KI0 A;  3RLN A;  2UUB L;  1M90 C;  1XMQ Q;  4BBS G;  4K0K Q;  1E3P A;  4PG3 A;  1PH9 A;  1B7Y B;  2ZM6 Q;  4B3T L;  4YY3 Q;  2GVA A;  4LF7 Q;  4XTC S;  1VQ4 A;  1PYS B;  4XIG S;  1X3G A;  3OTO Q;  1MKH A;  3J7Z C;  1VQP A;  4IFD I;  2OQ0 A;  5M5X H;  4UP8 A;  4JBJ A;  1X6O A;  1T9H A;  4JI3 L;  3EIV A;  1SFO H;  4NXM Q;  1PH7 A;  4JC0 A;  4QY7 A;  1I94 L;  1ASY A;  1K3R A;  1HR0 L;  4B3M L;  1IL2 A;  3H0G H;  1QUQ B;  3CMA A;  1HNZ L;  1V43 A;  2QA4 A;  5GRO A;  3MEF A;  2E2J H;  4DV1 L;  2NZO A;  4BY1 H;  2R92 H;  3HOU H;  4GLX A;  2HT1 A;  3T1H Q;  2R7Z G;  5BR8 Q;  5IT9 c;  4GOP C;  1U5K A;  5GAD C;  1PH4 A;  3FKI H;  3PF4 A;  4R4I A;  2KCT A;  5FJ8 G;  4KHZ A;  4HID A;  4HJA A;  3LGJ A;  3UDI A;  1KHI A;  1L1O B;  4BA1 I;  2BH8 A;  2PMZ E;  5IYC H;  4LUZ A;  4LF9 Q;  1NMF A;  2Z0S A;  3BU2 A;  3WWV A;  4A3J G;  4A3D H;  4GKJ L;  3K7U C;  3HKZ G;  4YHH L;  2A8V A;  2VUM G;  3NEN A;  4X64 L;  1SLJ A;  1YVC A;  5ELN A;  3S15 H;  3M4P A;  4Y7N H;  1VQO A;  1HZC A;  3T1Y L;  4DR2 Q;  4BBS H;  4QQB X;  3CP0 A;  3NBH B;  2CKZ B;  3STB D;  2UUA L;  3AFP A;  3KJP A;  4FDB A;  4AQY Q;  1E7Z A;  4JI7 Q;  1UE5 A;  3MXN B;  4DK3 C;  3G48 A;  4HIO A;  1XPR A;  1CUK A;  2CQO A;  4IPH A;  1Q8K A;  4NB3 A;  1QUQ A;  1EIY B;  1YHA A;  5E7N A;  4DV2 L;  1VQN A;  4TVA B;  1K9M C;  1TWC H;  1VQD A;  4A3F G;  1XMO L;  2GN5 A;  1JJG A;  4HIM A;  2RCN A;  3UE0 A;  4A3I G;  4UP9 A;  1HNW Q;  5IP9 G;  2LXK A;  1D7Q A;  2F4V Q;  4QL5 A;  4LF4 Q;  2YTX A;  1N32 Q;  3EN2 A;  5IYB G;  3PO3 G;  4GN3 B;  2B29 A;  2Z6K A;  1A62 A;  1W2B A;  4LF6 Q;  4YWK A;  2R7Z H;  1L1O A;  4OWT B;  4LNQ A;  1X54 A;  3Q8D A;  2V1C C;  2K52 A;  5FJ8 H;  4YWL A;  1IXR A;  1PVO A;  3HOY G;  4GLV B;  3NEL A;  2QGQ A;  5IY0 A;  1N33 Q;  2HIV A;  1VCI A;  4BBR G;  2NVT H;  4JI1 Q;  3G4S A;  3OW2 A;  1NE3 A;  4A3J H;  3TQY A;  1EOV A;  2VQE L;  2ZJR A;  4PMW A;  2VUM H;  1G6P A;  1X3E A;  3F2D A;  2LSS A;  1L2F A;  1E1T A;  3W1B A;  1HJP A;  1IBL L;  2R7F A;  2AWN A;  1NMG A;  2DGY A;  1KL9 A;  1OXV A;  3UE1 A;  3BZK A;  4JBK A;  3ULL A;  1BKB A;  1LM0 A;  3GTQ H;  1I3Q H;  1YIJ A;  4JYA L;  2I5H A;  1HH2 P;  2OCE A;  1VQ8 A;  3KLW A;  2HQL A;  3RNU A;  4A3F H;  1OXX K;  1A63 A;  1KXL A;  3EBE A;  4JI5 L;  4LF8 L;  4A3I H;  4DUY Q;  2ASB A;  5JJI A;  5IP9 H;  4GOP A;  3RZD H;  4K0K L;  1SR3 A;  5IYB H;  3PO3 H;  2F3I A;  2JEB I;  4DV4 Q;  3HOZ G;  2ZM6 L;  2NVX H;  3PUW A;  1YHB A;  4YY3 L;  3I56 A;  4APV A;  4LF7 L;  3PO2 H;  1EFW A;  4IPG A;  5HGQ A;  1Q46 A;  3OTO L;  4DV7 Q;  1C9O A;  4PZ7 A;  1IBM Q;  1VQJ A;  1N34 L;  1FL0 A;  3HOY H;  4A3L G;  1SE8 A;  1UE1 A;  1TXY A;  4HIK A;  4DR5 Q;  4NXM L;  4BBR H;  3PSI A;  4UP7 A;  3CQZ H;  5EAY A;  1VQM A;  1QZH A;  1SMX A;  3J81 c;  3DLL A;  2ZJQ A;  5GAG C;  5M5W H;  2ZJP A;  3GTM H;  3F1Z A;  4RMF A;  3J81 i;  3PIO A;  1JMC A;  4DR7 Q;  2VL6 A;  3I4O A;  3VDY A;  4JOI C;  4EX5 A;  2E8G A;  5LMU Q;  1EQQ A;  3GTK H;  2VS1 A;  3T1H L;  1MJE A;  2UXB Q;  3JAM i;  4X62 Q;  1VQ5 A;  1FGU A;  3CPF A;  3K0X A;  4DR4 Q;  2VQF Q;  3BZC A;  4JV5 Q;  2YTY A;  4IJH A;  4NXN L;  3M85 A;  4DR6 L;  3F2B A;  4LF9 L;  3FP9 A;  1PV4 A;  1D8L A;  1GO3 E;  1LUZ A;  3PCO B;  3I4M G;  3PUX A;  4QGU A;  3S1R H;  2PNH A;  4DV5 Q;  1R9T H;  3UDX A;  2Y0S G;  3CCJ A;  4L5Q A;  1BVS A;  1MIU A;  2N3S A;  5JEA G;  3HOZ H;  4OON A;  5DLQ E;  4AQY L;  1FVI A;  3I2Z A;  4DNI A;  3GTP H;  1SRU A;  4PZ6 A;  3L2P A;  1E1O A;  1VQI A;  3UDG A;  2BA1 A;  4LFA L;  1QZG A;  2AKW B;  4A3L H;  3GD7 A;  5M3F G;  2PQA B;  1Z9F A;  3GO5 A;  3PF5 A;  5AJ3 L;  1M1K C;  3CCM A;  3RZO H;  1HZ9 A;  1G29 1;  1PFS A;  4KLK A;  1PH1 A;  2AMC B;  1SRO A;  4GN4 B;  4JBW A;  5IWA Q;  1HNW L;  1PYB A;  2GVB A;  3CC2 A;  2B3G A;  4RG1 A;  2F4V L;  5FLX c;  4IJL A;  4LF4 L;  1N32 L;  2RF4 A;  2D62 A;  1I5F A;  1PH3 A;  1VQF A;  1N36 L;  2BH2 A;  1JJ2 A;  1Q1E A;  2MQH A;  2E2I H;  5JEA J;  4GKK Q;  4B3R Q;  3HKZ E;  1Q12 A;  2BA0 A;  2AWO A;  2WB1 G;  1BBW A;  3L7Z C;  4TQU S;  2E5L Q;  4LFC Q;  3CCQ A;  2NN6 G;  4MNO A;  4C3J H;  3F2C A;  1A0I A;  1JE5 A;  4DR3 Q;  4A93 G;  3AFQ A;  1N33 L;  2H5X A;  2UU9 Q;  4JI1 L;  4A3E G;  2B63 G;  3CCE A;  3I4M H;  3J81 j;  3GTO H;  3M3Y H;  1YBY A;  3CXC A;  1IBK Q;  1X65 A;  4OX9 Q;  1OXS C;  2D0O A;  2UXD Q;  3KF6 B;  4X6A H;  3CME A;  2K75 A; 
#chains in the Genus database with same CATH topology
 4JCV E;  1AE2 A;  1ML0 D;  2XWJ B;  1RJT A;  1V1Q A;  2ES2 A;  2CFM A;  4BY1 B;  1SNO A;  1VQG A;  3K7A H;  2AHO B;  4GOP B;  2D9U A;  1CI3 M;  1G6Z A;  2EY5 A;  3PGZ A;  2DY8 A;  3MXP A;  1EYC A;  4DV4 L;  1HNX L;  3BYT B;  4DV7 L;  5JJL A;  2NN6 I;  2UXC L;  2NN6 H;  4K14 A;  1U0L A;  4BBS B;  2K5H A;  2KOL A;  1TWF H;  4WRD A;  2XSC A;  3GTO B;  3DMU A;  5CV5 A;  2EY6 A;  4K2K A;  4YHH Q;  3R93 A;  1ENC A;  4XQQ A;  1Z47 A;  3T1Y Q;  3RLF A;  1AN8 A;  3D31 A;  1TII D;  1PH2 A;  5JAV A;  3CW2 C;  4CDE C;  4DR4 L;  2Q2H A;  1EIF A;  5LMN Q;  4JBM A;  2G9H D;  4JV5 L;  3A8I E;  1X56 A;  2EY1 A;  3VR5 A;  1RL2 A;  4IOA A;  2R7Z B;  1OXT A;  3U58 A;  3I73 A;  1EEF D;  1LT6 D;  3RMH A;  4AH6 A;  1S5B D;  4CBV A;  1NTG A;  2IW3 A;  2NVT B;  4C3I B;  1JB7 A;  1EQR A;  3W3A A;  2K5D A;  4U67 3;  1V1O A;  5E4X A;  3S1Q H;  3HOW H;  5C3E H;  4H13 C;  3OIQ A;  3K81 C;  3OOC A;  3GTG H;  4HMJ A;  3FPP A;  3I8Z A;  4FO2 A;  3DM1 A;  2CW0 C;  1SYB A;  2TMP A;  2FJ2 A;  4HJ7 A;  2O4X A;  1I3Q B;  3MAQ A;  1B44 D;  2F0S A;  1ICF B;  5LMN W;  3S1N H;  1II3 A;  2XNA C;  5D14 A;  1Z7T A;  3ER0 A;  4GN5 A;  4LFC L;  4A76 A;  2KEC A;  3I70 A;  4K5X A;  2TSS A;  3QB3 A;  1KRT A;  5TSS A;  4OX9 L;  4LF8 Q;  2RHS B;  3K8A A;  1CHQ D;  3H6M A;  5C5L A;  3I4N G;  3GV6 A;  4R8N A;  2Z6B A;  1MSH A;  2A69 D;  4QF4 A;  1BDO A;  1UE7 A;  1GUS A;  1F9Q A;  4BA2 I;  4R8I A;  4M8A A;  4IPC A;  2L5T A;  2CCZ A;  1Y1V G;  2M00 A;  3J7A 5;  4P73 A;  1XNR Q;  2NYZ D;  4POF A;  3GTL H;  2I07 B;  2B2V C;  2KCC A;  4DV0 L;  1WTW A;  2A19 A;  2EE1 A;  2YV5 A;  4X3K A;  5CMD A;  2WAC A;  3CKI B;  3F8T A;  3RLO A;  2K5V A;  5M3M H;  4DUZ Q;  1JCK B;  1CQF A;  3NWT A;  4BWG B;  5CV4 A;  2N88 A;  1Q1B A;  1PA6 A;  3CF5 A;  4K8I A;  3ND8 A;  5DAU A;  4A3G G;  1T5X D;  2PZT A;  2A73 B;  2O2L D;  2OWO A;  2OQK A;  3HOV G;  3TZU A;  2K01 A;  1QVF A;  1VS0 A;  2RHQ B;  2KEN A;  1I50 H;  4DKA C;  1IW7 C;  2KQ3 A;  2C35 B;  1LTS D;  1EYG A;  3A74 A;  3SGI A;  2QEX A;  4X66 L;  1MGS A;  1W3S A;  2KUM A;  5IGC A;  5J39 A;  3G6J B;  1N36 Q;  2N8N A;  3I4M B;  4IUQ A;  4AYB E;  3PIP A;  4GKJ Q;  4HTH A;  2VB2 X;  5T1G A;  2MUY A;  4K5V A;  1TT2 A;  1WI5 A;  3BVG A;  4HCS A;  5M5Y B;  4OO1 I;  1TS5 A;  3VYU A;  5IYD G;  5D65 A;  4OO1 H;  3LWE A;  1O78 A;  4DAY A;  5H1S E;  3G71 A;  1XPU A;  3K7A B;  5FK9 C;  3KBG A;  4X65 L;  3HS0 C;  4LW1 A;  3I4N B;  4KD3 A;  1S4Z A;  1C7Y A;  1SJE D;  2IX3 A;  1HZA A;  2A6H C;  4YCW A;  3CC7 A;  1WTP A;  1TWH B;  2H4O A;  3WOF A;  3QO2 A;  2FMC A;  4R4T A;  4P2C B;  1DJR D;  1J9O A;  3CRL C;  4GNX A;  3ND9 A;  4A4I A;  1EL0 A;  4I7Z C;  2Z4I A;  3R2I A;  5CBA E;  4B3S L;  1ICW A;  1KAW A;  3H3V C;  4A75 A;  3MWY W;  4C2M B;  1EFI D;  2IX1 A;  2NZH A;  1ESF A;  1JOO A;  5EKK A;  1K83 B;  3HG9 A;  5KYI A;  1PMR A;  3U4V A;  1SBB B;  3P1H A;  2JQO A;  5C0X I;  4LWC A;  5C0X H;  3KOJ A;  5NUC A;  3TBI B;  1IKL A;  5LL6 X;  2YU9 H;  1KLU D;  2Y0S E;  4JYA Q;  4A3G B;  1DM0 B;  4DAM A;  2UU9 L;  3I55 A;  3ULJ A;  4A3D G;  3S2D H;  3TS2 A;  4NKL A;  3HOV B;  4CJ2 C;  2F0E A;  5ELO A;  4JI5 Q;  3NQI A;  1PRT C;  2QEJ C;  3EFX D;  3GV3 A;  1XMQ Q;  3OWE B;  4CKB A;  5FOB B;  3MC0 B;  3KF8 A;  4YY3 Q;  2GVA A;  3EQL C;  1PYS B;  2PQE A;  3OTO Q;  1KDC A;  1MKH A;  5C3E B;  2RDG A;  2XN9 C;  1TS4 A;  1PH7 A;  4JC0 A;  1K3R A;  1HR0 L;  2EJM A;  3CMA A;  1V43 A;  3MEF A;  5FLX L;  2NZO A;  2O5I C;  3VR4 A;  4ZUI A;  1HA6 A;  3S1N B;  4GOP C;  1PH4 A;  1MI2 A;  4NDX A;  1CZG A;  5I9P A;  3LGJ A;  1KNA A;  1L1O B;  1AZP A;  4DAV A;  4V19 0;  4LF9 Q;  4LUZ A;  1CFM A;  2Z0S A;  1EY0 A;  3WWV A;  3UI2 A;  2M9V A;  3K7U C;  3HKZ G;  2A8V A;  2VUM G;  4X64 L;  1SLJ A;  2BDO A;  1VQO A;  4DR2 Q;  1NR4 A;  4DNR B;  2UUA L;  3AFP A;  3SXH A;  4FDB A;  5CGK A;  4JI7 Q;  1UE5 A;  4ZRZ A;  4RGO S;  3TP8 A;  4HIO A;  1XPR A;  1CUK A;  5JOB A;  2CQO A;  2EYF A;  1Q8K A;  4NB3 A;  5E7N A;  4DV2 L;  2EPB A;  3OHX C;  1TWC H;  1VQD A;  3GTL B;  3I72 A;  1M8A A;  2F0I A;  1JJG A;  4HIM A;  1STA A;  2RCN A;  4XYQ A;  2E2J B;  5IP9 G;  4QL5 A;  4KKU A;  5IYB G;  3PO3 G;  3QG1 A;  1R4P B;  4FVM A;  4K2L A;  1PRT F;  2FIN B;  4H0L C;  4B9X A;  1F2L A;  4Z9C B;  2CW0 D;  1H9S B;  2HCC A;  2F0L A;  2QGQ A;  1A2T A;  1N33 Q;  1CT1 D;  4A3D B;  1QG7 A;  1KLG D;  4K6D A;  4LAA A;  3TQY A;  1EOV A;  2ZJR A;  1SEB D;  3S15 B;  1G6P A;  1X3E A;  2LSS A;  1L2F A;  3T16 A;  3P7J A;  4OGQ C;  5AFW A;  3MXN A;  1IBL L;  1NMG A;  3L3O C;  2JYO A;  3BZK A;  3GTQ H;  3ULL A;  1BKB A;  1LM0 A;  1SYD A;  3OMG A;  2I5H A;  1VQ8 A;  4C1N K;  2ICE C;  3NWS A;  4A3I H;  2ASB A;  2X69 A;  3RZD H;  1SR3 A;  3MXG A;  2E2D C;  4FNF A;  2ZM6 L;  3KK7 A;  3PUW A;  2DY7 A;  1C48 A;  1EFW A;  1Q46 A;  4KTA A;  3IAY A;  1VQJ A;  3J7A V;  1B3Q A;  1SE8 A;  4NXM L;  1ET9 A;  2C5C A;  3CQZ H;  1QZH A;  1SMX A;  2EJF C;  2ZJQ A;  3HKZ B;  2VUM B;  2XVS A;  1BCP C;  1ILP A;  1ZXT A;  3PIO A;  1B50 A;  4X3S A;  2F03 A;  3T1H L;  2L4N A;  4X62 Q;  2DNC A;  1FGU A;  4C56 C;  2YTY A;  1CZW A;  5EKL A;  1GO3 E;  3PCO B;  1LT4 D;  3PUX A;  2PNH A;  2F0V A;  2P5Z X;  3CCJ A;  4L5Q A;  4ILW A;  1BVS A;  2E76 C;  3PO3 B;  2K05 A;  1KDB A;  2N3S A;  1LAB A;  4UAI A;  1PYW D;  3DWQ A;  3BZD B;  1IW7 D;  1MHW C;  5D3I B;  3I2Z A;  5DLQ E;  4AQY L;  3K58 A;  4PZ6 A;  4LFA L;  2F0F A;  1A3U A;  2MHV A;  5HUR A;  5IIF A;  2AKW B;  1QNU A;  3GD7 A;  2FMM A;  1XX8 A;  5M3F G;  5CBE E;  3MA2 B;  5T1I A;  3FVQ A;  3KBX A;  1M1K C;  4FF4 A;  4KLK A;  1PH1 A;  2YU9 B;  4GN4 B;  1HNW L;  4RFB A;  3CC2 A;  2B3G A;  5FLX c;  4LF4 L;  1N32 L;  1UNS A;  5JEA J;  2BA0 A;  4Q0F A;  1JE5 A;  4F8M A;  4A93 G;  4MN3 A;  3E3X A;  2XIW A;  3GTO H;  4S3S A;  1PTO H;  1X65 A;  2A6H D;  4IUT A;  3KF6 B;  3CME A;  3CAM A;  2CH4 W;  3HEJ A;  3K0Y A;  1BCP F;  3NE5 B;  2B2W A;  4JI4 L;  1PH5 A;  1FGB D;  4Y52 H;  1ROD A;  1AE3 A;  1XXG A;  2PQA A;  2HQE A;  1YHQ A;  1X55 A;  5KND A;  1W6J A;  5COY A;  2NVY H;  2KVM A;  2XTI A;  4B3M Q;  4JI0 Q;  2MO0 A;  1FJG Q;  4JOI A;  4OXP A;  1SSO A;  4O42 A;  3KLR A;  2R93 G;  3FDT A;  5A35 A;  4C3I H;  2CHB D;  4LUV A;  4K6L A;  4POG A;  3BDO A;  1GUO A;  3BYY B;  2IY5 B;  1N9W A;  4JI2 Q;  2B63 H;  4A3E H;  2SEB D;  1D1K A;  1Q90 A;  4DV3 Q;  3E0E A;  4JVZ A;  2EIF A;  1PRT D;  1SMY C;  2VXW A;  1ET6 A;  1AH9 A;  2PYK A;  5GQO A;  1YNX A;  4RCO A;  2WIN B;  1L0W A;  2KHJ A;  2MPM A;  2UXB L;  4CDC C;  2UUC Q;  2VQF L;  3MZ5 A;  1S40 A;  1ESR A;  4UPA A;  1TWG B;  3NUC A;  2ZT9 C;  5M3F B;  5JPN C;  3UDF A;  3G6E A;  4HSV A;  3RR5 A;  1GOZ A;  4A3M G;  4DV5 L;  1VQL A;  3D6W A;  1K3B C;  3T53 B;  1IKM A;  2KCN A;  5ELE A;  5C0X J;  2K5W A;  2WII B;  3EVQ A;  3Q0A A;  4EGV A;  4FF2 A;  3CCL A;  4RH6 A;  2MFI A;  2MNA A;  5J1Z A;  5BR8 L;  4J15 A;  3J80 c;  4DR1 Q;  4LF5 Q;  2AUJ D;  4P75 A;  5DEH A;  1OO9 B;  1LTA D;  2Z4H A;  4B9W A;  2KCM A;  3D4D A;  2ZXO A;  5JVG 3;  1TS3 A;  4EQ5 A;  1BBU A;  2WAQ G;  4OHJ A;  4ZAI A;  4DR3 L;  1STN A;  4DPG A;  5EKI A;  4KHP Q;  3E5S A;  3QOL A;  1EZ8 A;  1IBK L;  4DF7 A;  1S5F D;  5EBD A;  3A54 A;  1SAP A;  2R93 B;  4K8J A;  1YIT A;  3ZJY C;  3CQZ B;  3FHW A;  1RTO A;  1VQ9 A;  1S72 A;  3AEV A;  4PNY A;  1N34 Q;  3CPW A;  5IT9 L;  2B8G A;  3ICE A;  1LO5 D;  4LF6 L;  1CSQ A;  4DAP A;  1Y8O B;  1XWE A;  5G3L F;  4JG2 A;  4GNX C;  1N8R C;  4XT1 B;  4A3C G;  1HPC A;  2IHE A;  2JEA I;  4BY7 G;  2RVL A;  3CCU A;  4OL7 A;  3C2P A;  2V4D A;  1OTC A;  1MD2 D;  3SEB A;  2ID0 A;  1Y1W G;  4ALP A;  2PO4 A;  1H9M A;  4DK6 C;  1YJN A;  4NXN Q;  2EYL A;  1O7I A;  5I4D A;  5M5Y H;  5ISR A;  4B3T Q;  3DUZ A;  2JK8 A;  4OWX B;  2LXJ A;  3E9I A;  1I6H B;  4YCU A;  4IOC A;  3P20 A;  1G8Z D;  2E2H B;  4R1J A;  1YJ9 A;  1SYC A;  3VYT A;  4G7H C;  1B2T A;  5J3B A;  1PH6 A;  3I4N H;  3PUV A;  1Q82 C;  1I94 Q;  1LTR D;  2F0P A;  1FNV A;  2R7D A;  4MTK A;  5C4X G;  4L5S A;  2HIX A;  5A2Q E;  4TKO B;  5LMN L;  3AYH B;  1TWH H;  2K5N A;  5ELB A;  2AQ3 B;  3B6Y A;  3T13 A;  4RA8 A;  1Y1V H;  1RF2 D;  1WCM G;  3D0F A;  1UEA B;  3KLS A;  5AJ3 Q;  1CSP A;  2JA6 G;  1IBM L;  1CKM A;  3NTK A;  1BCP D;  5CV8 A;  4WJ4 A;  2MJ8 A;  3D4R A;  4KN4 C;  4C2M H;  2DUD A;  2KA7 A;  5JJK A;  1PTO B;  2J4X A;  1K83 H;  3CRK C;  1PXU A;  4MHE A;  2WAQ B;  1UEB A;  4DK0 A;  2XRQ D;  5I6Y A;  4QB4 A;  1W6K A;  3R8B A;  1LYL A;  4O0A A;  2K7V A;  2IT1 A;  2K03 A;  2JA5 G;  4A3G H;  3R3O A;  2RKS A;  2NVY B;  1TS2 A;  2JE6 I;  1XMO Q;  3HOV H;  3SK8 A;  1G2T A;  4K5W A;  1NUC A;  2FHT A;  2NB0 A;  3LNN A;  1K0R A;  4KK7 A;  3DWA A;  4YWM A;  3FEW X;  3CD6 A;  5CV7 A;  5CV9 A;  4BY7 B;  2B63 B;  4A3E B;  3J81 L;  1JOQ A;  1S3O A;  3H0G G;  2F4I A;  2OT2 A;  1Y1W B;  4ME5 A;  1HNX Q;  3GDE A;  1LTL A;  2DNE A;  3DWP A;  3MTS A;  3NP8 A;  2UXC Q;  1WOC A;  2L55 A;  3DEP A;  4U68 A;  3FKI G;  1XNR L;  5IYD H;  2YTV A;  1IZ6 A;  2B2T A;  4IFD J;  1RIP A;  2IHF A;  1TR5 A;  5IYC G;  3JAM c;  2AQ2 B;  1CTM A;  4DUZ L;  5C4X B;  4G57 A;  4KI0 A;  1PZI D;  3MXU A;  2WKD A;  4K0K Q;  3S2H B;  4PG3 A;  5IGG A;  1D5Z C;  1WCM B;  4XIG S;  1VQP A;  1GHK A;  4JPB W;  3J7Z C;  3S14 B;  5M5X H;  4ABN A;  1X6O A;  1T9H A;  3EIV A;  3K57 A;  1LTI D;  1F9P A;  1ASY A;  1QUQ B;  3TME A;  5GRO A;  2E2J H;  2CQA A;  2F1M A;  1VF5 C;  1KDA A;  2X6L A;  2B2U C;  2OXP A;  2HT1 A;  4KY7 A;  5IT9 c;  5GAD C;  5FJ8 G;  4KHZ A;  1WTX A;  4HJA A;  3M4Y A;  1TQO A;  2BH8 A;  1NAP A;  2JA5 B;  2F0D A;  1SMY D;  3S1M B;  3BU2 A;  4A3J G;  4A3D H;  1QNK A;  4GKJ L;  3NEN A;  5ELN A;  1DON A;  3S15 H;  3M4P A;  2L9H A;  1HZC A;  1A15 A;  4M1U B;  1STB A;  4QQB X;  5G3L D;  1K8O A;  1U4P A;  3LWU A;  4DNT B;  1SNQ A;  1PZJ D;  4DGZ A;  3KJP A;  1E7Z A;  5DNF A;  3N6R A;  1STG A;  3U9S A;  1BOS A;  3SDZ A;  5M9O A;  1A6X A;  1SFO B;  1HUN A;  3Q23 A;  2RQX A;  3H94 A;  1BBX C;  3H0G B;  4A3F G;  1FYC A;  2Z9H A;  2F3W A;  2LXK A;  1D7Q A;  2PZW A;  2B29 A;  2Z6K A;  3FKI B;  1L1O A;  4LNQ A;  1ILQ A;  1IXR A;  2EYH A;  2F0J A;  3HOY G;  3NEL A;  1PVO A;  5IY0 A;  3MVV A;  1S5E D;  5JJZ A;  2EDG A;  2VUM H;  3G7L A;  4Y7N B;  3VR2 A;  3F2D A;  4FF1 A;  2I46 A;  1I4G A;  2LFN A;  2K32 A;  5I2X A;  2AWN A;  3TSS A;  1KL9 A;  1OXV A;  1K0S A;  2F0H A;  4PMC A;  4JYA L;  3U9O A;  1Y1V B;  1ENF A;  2OCE A;  3NK9 A;  4HCE A;  1A63 A;  4JI5 L;  4DUY Q;  5IP9 H;  3WDN A;  3KLS X;  5IYB H;  3PO3 H;  2F3I A;  1H9S A;  2JEB I;  3HOZ G;  2NVX H;  4YY3 L;  3I56 A;  1EY4 A;  5HGQ A;  3OTO L;  5JVH 3;  2B2W C;  1FL0 A;  2K6A A;  4A3L G;  4NW2 A;  5LHY 1;  1UE1 A;  1E2Z A;  1YNJ C;  1J8I A;  1SYE A;  3PSI A;  4A3J B;  1VQM A;  3J81 c;  5KIX A;  3GTM H;  1JWM D;  5C3W A;  4DR7 Q;  3K6O A;  4JOI C;  5LMU Q;  2E8G A;  5C5M A;  2ICI A;  2E75 C;  1M4V A;  1LT5 D;  3RD4 A;  4C3J G;  3S9W A;  4QMG A;  4IJH A;  4DR6 L;  4KY6 A;  3M85 A;  4LF9 L;  3FP9 A;  1GJX A;  1LUZ A;  1JIC A;  1G91 A;  4KKT A;  1UUP A;  3UDX A;  2Y0S G;  3I91 A;  1PFM A;  1D6E C;  5I2Y A;  5JEA G;  2L11 A;  4UHV A;  5D3D A;  1FVI A;  1D2B A;  1AW7 A;  2QW7 A;  4L63 B;  5ELF A;  1Z9F A;  1H9J A;  4QUC A;  3CCM A;  1G29 1;  4EQO A;  2M2L A;  5DM7 3;  3NTH A;  4EQN A;  3E0J A;  5IWA Q;  2HCI A;  1PYB A;  2D2C C;  4RG1 A;  4IJL A;  4N8X 1;  4RKB A;  3GTK B;  2D62 A;  1I5F A;  5EBC A;  1VQF A;  1JJ2 A;  1Q1E A;  3SHL A;  4JW0 A;  1QB5 D;  4GKK Q;  3HKZ E;  3I4L A;  1Q12 A;  1EQV A;  2WB1 G;  3L7Z C;  3WOE A;  2E5L Q;  3CCQ A;  2Q8T A;  1FNU A;  3AFQ A;  1L0X B;  1N33 L;  2H5X A;  2UU9 Q;  3CCE A;  2LMC B;  3M3Y H;  1YBY A;  1PTO C;  5C4H A;  3CXC A;  5M5X B;  1FNW A;  1OXS C;  4IUR A;  3DXJ C;  2K75 A;  1F9R A;  3HOZ B;  1NSN S;  2EXD A;  4UY8 C;  3GTP B;  4JI8 Q;  1XPO A;  2CWP A;  2MO1 A;  2PI2 A;  4IPD A;  2R61 A;  1VQH A;  1JC7 A;  5M3F H;  1TWG H;  1HR0 Q;  4LFB Q;  3AMU A;  1JWS D;  1VQE A;  1EOT A;  2A1A A;  1ZYR C;  3CC4 A;  2IL8 A;  3U50 C;  1XNQ Q;  3JC6 6;  2SDF A;  4F7X A;  3VR6 A;  2PI2 E;  2Q2I A;  5FLX E;  4ZCK A;  4IZ8 A;  3PV0 A;  2JA7 G;  1GKH A;  3OMC A;  1IYU A;  5E3F A;  4DV6 Q;  4A93 H;  5DM6 3;  3K59 A;  4RGM A;  2YYZ A;  1LV9 A;  1Z6H A;  3KF6 A;  4R4Q A;  4ME3 A;  1VQ7 A;  3IFT A;  3TS0 A;  1A2U A;  3MFG A;  1G51 A;  4JI6 L;  1SE4 A;  3BG3 A;  5I6W A;  4A3B G;  1U9R A;  4FXG C;  3DEO A;  1A3T A;  1JE4 A;  1HZB A;  1D1I A;  4I7A A;  2B2U A;  5HGT A;  1HR0 W;  3NEM A;  1Y8N B;  3T51 B;  3T56 B;  1WJJ A;  3STB C;  2BDN A;  4YCV A;  1IL8 A;  1U4L A;  1I4Q A;  1P8L A;  4H02 A;  2OTJ A;  4BXX G;  1PHJ A;  1HUM A;  3OYY A;  4WJW A;  4QJF A;  3J80 L;  1TWA H;  1VQC A;  2R93 H;  2DN8 A;  1PTO F;  2HDM A;  1B1Z A;  2N49 A;  3K5M A;  1EYD A;  3W5O A;  1QIL A;  2WB1 B;  4IUN A;  4FP5 D;  2KBN A;  3I7F A;  3A5U A;  2LS0 1;  1Q3L A;  2VZA A;  1B70 B;  2D0P A;  2BCO A;  1P16 A;  2D5D A;  4P74 A;  5K36 G;  3Q24 A;  3KUP A;  4WJ3 M;  2QCP X;  5IGE A;  1O7Z A;  4H44 C;  1IBL Q;  2N55 A;  3PIP 3;  1YZ6 A;  3NSW A;  4C3H G;  1EWI A;  2NVX B;  4RHS A;  2HHH Q;  1J5E Q;  1RD9 D;  1I6H H;  4A3M H;  2E2H H;  1ZKO A;  4QIW B;  2L12 A;  2OF1 A;  1CKN B;  3QWN A;  1D5X C;  3GTM B;  5FO8 B;  5FLM G;  1C8C A;  2JA7 B;  2VY3 A;  2L15 A;  4A3K G;  3GP7 A;  1L0Y B;  2JA8 G;  2KJX A;  4JI0 L;  5EPJ A;  1VQA A;  3A7A B;  1OXU A;  1SN8 A;  2ZTE A;  4FXK C;  1FJG L;  2A74 C;  4IUV A;  2PPB C;  3PUY A;  4A3B B;  1RDP D;  3FPU B;  1MSG A;  1EY8 A;  3CCS A;  2VB3 X;  2J7Z A;  3IFD A;  2EZV A;  2UUB Q;  4KN7 C;  3S17 B;  1VMC A;  2IWH A;  1HRJ A;  2JA9 A;  4JI2 L;  1GD7 A;  2DJG C;  3QJY A;  1V8Q A;  1Q7Y C;  5IOC A;  2IX0 A;  4DV3 L;  3V2T A;  3MEH A;  3GTJ B;  4JI3 Q;  1EY7 A;  5F2D A;  3F2U A;  2B2T C;  1JQY D;  2EYP A;  1HNZ Q;  4RGN A;  4F87 A;  1WFQ A;  2UUC L;  4DV1 Q;  1J6Q A;  4LFA Q;  4MZ9 A;  5IP7 G;  4KJN A;  1XTD A;  1O80 A;  3M7N A;  2OTL A;  3RN5 A;  1YNJ D;  4R4O A;  2C9O A;  2CWA A;  4HED A;  5FO9 B;  5HY6 A;  1CHP D;  3VA7 A;  5J22 A;  2K04 A;  3BS1 A;  4BY7 H;  1XTC D;  2HDL A;  4A3C H;  4X3U A;  4DR5 L;  1K8A C;  3M3Y B;  1DYQ A;  1WYD A;  4WOR A;  2QDL A;  2X6G A;  1Y1W H;  4DA2 A;  3HOX G;  3EA6 A;  2F0T A;  2VNU D;  4HMI A;  1EQT A;  1JOK A;  2PW5 A;  4N9P A;  2NVQ B;  4DR1 L;  4Q5V A;  1KRS A;  2K14 A;  4LF5 L;  1GXD C;  3S16 H;  2HUG A;  5I9O A;  1HQR D;  3M4Q A;  1VQ6 A;  2A5H A;  5C44 G;  4N8F A;  1YEZ A;  4HJ8 A;  3IRB A;  1TVX A;  1K8G A;  4JI4 Q;  3TP6 A;  2PNR C;  1DOM A;  1MJC A;  1NJI C;  4XQJ A;  5C4X H;  3NPP A;  3TRE A;  1Q8I A;  3S2H H;  3C3L A;  2ALY B;  4KHP L;  2JA8 B;  1HFG A;  1WCM H;  3BDC A;  3D4W A;  2JA6 H;  4KKS A;  3CCV A;  4IFD G;  3S14 H;  2I5M X;  4A93 B;  4IO9 A;  4MIU A;  1V9P A;  3EJI A;  2A6E C;  1SE2 A;  4CKC A;  4R9W A;  2VQE Q;  1PH8 A;  4P71 A;  1A8V A;  1KC8 C;  3JAM L;  4BY1 G;  1B9M A;  2R92 G;  3HOU G;  2Q2U A;  3A0J A;  2F3V A;  3RUZ A;  1EYA A;  1LLR D;  4B3R L;  1EU4 A;  3W1G A;  5C4J B;  2Z6K C;  2AUK A;  5EJW A;  1JJC B;  1PTO D;  1SXT A;  1S5D D;  1L1O C;  2WAQ E;  3TEH B;  2JA5 H;  5GAE C;  4KD4 A;  3S1M H;  3BDL A;  4OEM B;  5EPK A;  4AIM A;  2UXD L;  3RLN A;  2EY2 A;  1TWA B;  3SK5 A;  4BBS G;  1B7Y B;  4B3T L;  4LF7 Q;  3HP3 A;  4O1N A;  4XTC S;  4IUU A;  1X3G A;  1JWU D;  1ZYR D;  1H9K A;  1SFO H;  2Q8R E;  4QY7 A;  1I94 L;  3NXW A;  1Y8P B;  1TKW B;  4B08 A;  3H0G H;  3IL8 A;  2QA4 A;  1D5M C;  1BR9 A;  5E4W C;  1PDQ A;  4JK1 C;  1EWC A;  2R7Z G;  5BR8 Q;  5IOD A;  1SNC A;  3FKI H;  3PF4 A;  2NTS A;  1KHI A;  4ID6 A;  5IYC H;  5C44 B;  1CA6 A;  3ERO A;  4DXF A;  4YHH L;  2EOT A;  4A3M B;  1YVC A;  1PRT B;  4Y7N H;  3T1Y L;  2EVB A;  2NTT A;  1NNX A;  3NTI A;  2Z8L A;  3QIA A;  3PIO 3;  3STB D;  1FD7 D;  3Q6S A;  1F2Y A;  4NP5 A;  4KV6 A;  4DK3 C;  3AU7 A;  2B39 A;  1QUQ A;  4FXD A;  1X3P A;  1VQN A;  1PFN A;  1WTR A;  1HA5 A;  2GN5 A;  3N52 A;  1XMO L;  1EEI D;  4UP9 A;  3NHH A;  2F4V Q;  2R92 B;  3HOU B;  2YTX A;  4ODG A;  1GHJ A;  1W2B A;  1A62 A;  4LF6 Q;  2H1E A;  4YWK A;  1X54 A;  3Q8D A;  2V1C C;  5FJ8 H;  3SR1 A;  4NMZ A;  5IT9 E;  4GLV B;  2EYM A;  1EY6 A;  2Q8I B;  2HIV A;  1VCI A;  4BBR G;  1F2M A;  4JI1 Q;  3G4S A;  3OW2 A;  1NE3 A;  4A3J H;  4H7B A;  1NR2 A;  4TRD A;  4PMW A;  1KNE A;  1A3V A;  1E1T A;  3W1B A;  5K5P A;  3I3C A;  3ONA B;  2DGY A;  2WV6 D;  2EXZ A;  2EJG C;  2K28 A;  4JBK A;  4RHR A;  1YIJ A;  2NZ1 D;  2KHS A;  3PMF A;  1HH2 P;  3KLW A;  2HQL A;  3RNU A;  4A3F H;  4PQX A;  1KXL A;  2BOS A;  4LF8 L;  5JJI A;  1EU3 A;  4K0K L;  1DCZ A;  3OIP A;  1BNZ A;  3SK6 A;  4DV4 Q;  1STH A;  1YHB A;  4APV A;  1C4Q A;  3CU7 A;  3PO2 H;  5KYL A;  1QE6 A;  4IPG A;  4DV7 Q;  1SJH D;  1IBM Q;  3A8J E;  4RKL A;  3HOY H;  3NBI A;  1TXY A;  4HIK A;  1WVL A;  4UP7 A;  1TY2 A;  5EAY A;  2JXM B;  2ZJP A;  3S16 B;  1STE A;  3FMC A;  3TZD A;  4FF3 A;  3J81 i;  2ZXR A;  5ELD A;  1JMC A;  2VL6 A;  2SNS A;  1AEX A;  3I4O A;  1LTG D;  3K5N A;  3VDY A;  4EX5 A;  3GTK H;  1EQQ A;  2VS1 A;  1QJO A;  1MBY A;  3CPF A;  3K0X A;  4DR4 Q;  3BZC A;  4JV5 Q;  1T5E A;  1NCV A;  1G2S A;  4RGT A;  3F2B A;  1PV4 A;  1D8L A;  3I4M G;  3H91 A;  2AQ1 B;  2JA6 B;  1F9S A;  1LT3 D;  1R9T H;  2NUC A;  1B4O A;  2LY7 A;  1MIU A;  2QDB A;  5C6A A;  3HOZ H;  2ZXP A;  3GTP H;  1HCZ A;  1SRU A;  5LL6 S;  3BVM A;  1VQI A;  2BA1 A;  4ZLT F;  1UAP A;  4A3L H;  3FRP B;  4BBR B;  3GO5 A;  3PF5 A;  3CHB D;  4IUP A;  1HZ9 A;  5IGB A;  5M5W B;  3VYS A;  1BCP B;  1SRO A;  4JBW A;  5KNB A;  1B3A A;  5CR3 A;  1BF4 A;  3J81 E;  2RF4 A;  4HR7 B;  1N36 L;  4CDD C;  2O5J C;  3QOJ A;  1BUV T;  4TQU S;  1JOR A;  1I6V C;  4LFC Q;  3SK4 A;  2NN6 G;  4MNO A;  4C3J H;  3F2C A;  4DK1 A;  3QR8 A;  3W2D A;  2A68 C;  4QCL A;  3J81 j;  3A8K E;  3S1R B;  4OX9 Q;  2D0O A;  3A56 A;  1DD2 A;  4HN7 A;  5C4Z A;  1EY9 A;  4ULL A;  4OWT B;  3HZX A;  1DOK A;  3HGB A;  5JEA H;  1ZEQ X;  1B8A A;  1VQK A;  2HD3 A;  1CA5 A;  2EQS A;  1C0A A;  4PV1 C;  3PO2 G;  3RZO B;  2A6E D;  4DV0 Q;  1FR3 A;  1SND A;  1KAB A;  4DUY L;  4XDX A;  3DM3 A;  4QUF A;  1GVP A;  3NQT A;  2K50 A;  2E2I B;  2B8F A;  1B53 A;  1SDF A;  1Q86 C;  3R2T A;  3HOW G;  1AP0 A;  2L1B A;  2NBF A;  2XGT A;  5C3E G;  3M4O H;  5GAH C;  1RKN A;  2F0K A;  2MP1 A;  4KMU C;  4MTN A;  1DGS A;  3M9B A;  1TY0 A;  4AYB G;  1QWY A;  4ZQ3 A;  4OIJ A;  5ELC A;  3PQI A;  1E2V A;  5KRU A;  1AFP A;  4DFA A;  1WTQ A;  4DR7 L;  1S5C D;  2JN4 A;  5LMU L;  2G5D A;  3KFU A;  4C1N I;  1JT8 A;  1PFB A;  4ZUJ A;  2R6G A;  1GUW A;  5KEE A;  3HRZ C;  1QCB D;  1XMQ L;  4HJ5 A;  4PZ8 A;  1E24 A;  5FKA C;  1X9N A;  1NBW A;  1ONL A;  2IPK D;  4X66 Q;  1GM5 A;  2PW7 A;  4F88 A;  4OIK A;  1I4P A;  1GUG A;  5BN3 A;  2WP8 J;  1TU2 B;  1X3F A;  3OW7 A;  1HHV A;  3CCR A;  3L0O A;  2I0Q A;  2JA7 H;  3E9H A;  1TWF B;  1BO0 A;  2VW9 A;  1DOL A;  4TSS A;  1STY A;  2JP1 A;  2RA4 A;  1EWH A;  2PZU A;  1AZQ A;  5FO7 B;  5IWA L;  1KD1 C;  4HJ9 A;  1IYV A;  2Z1C A;  4X65 Q;  3J7A F;  1I4R A;  3AQQ A;  3DHQ A;  3HFZ B;  2SOB A;  5M3M G;  4A3F B;  3H09 A;  4A3B H;  4GKK L;  1JR0 D;  2E5L L;  1RCV D;  2Q2T A;  2N78 A;  3S17 H;  4DR2 L;  3TRZ A;  4XT3 B;  1IYJ B;  3PO2 B;  4ZKC B;  1E22 A;  4JI7 L;  4YIJ A;  1O7L A;  1NY4 A;  1HTL D;  4B3S Q;  4BXX H;  5CYU A;  3HOY B;  3GTJ H;  2K33 A;  4I65 A;  1YNN C;  1KIX A;  2LKV A;  3S1Q B;  3HOW B;  4LK1 C;  4JI8 L;  3V96 A;  3A5Z B;  3VYR A;  1XYI A;  3O13 A;  3GTG B;  3VR3 A;  1ASZ A;  2WFW A;  4LFB L;  4AYB B;  3KDF A;  2WB1 E;  3TDQ A;  1XNQ L;  1RTN A;  5K36 H;  2EYJ A;  3ZYY X;  5IGD A;  3L9A X;  4LJZ C;  1Q81 C;  1WD0 A;  1CQV A;  1PZK D;  4O2D A;  5L37 A;  1R9T B;  4J1M A;  2JJQ A;  4DR6 Q;  1YJW A;  4DV6 L;  4C3H H;  2NVQ H;  3KYH C;  3T4A C;  3KJO A;  1QVC A;  4OO1 G;  3HKS A;  1SNP A;  3ULP A;  1CKN A;  4DAY B;  4GS3 A;  4KY5 A;  2BE5 C;  1KTK A;  4XYO A;  4OWW B;  5FLM H;  2CVR A;  4QIW E;  4A3K H;  3Q22 A;  4LUO A;  4R4C A;  3S24 A;  3K80 C;  2JA8 H;  4GNX B;  4C3J B;  5IGF A;  3BVZ A;  3J7Y W;  1HFN A;  5IE8 A;  1WTH A;  4L6T B;  1ENA A;  1SNM A;  4XXE A;  4GLA C;  2B2Y C;  1R4Q B;  5M3M B;  1QVG A;  3LX0 A;  2K1B A;  4X64 Q;  3ERS X;  2Y0S B;  2EYO A;  3P75 A;  3U4Z A;  4CDF C;  1GUT A;  1QOH A;  2UUA Q;  3I90 A;  1XJV A;  2FXQ A;  5C0X G;  1CKO A;  4X62 L;  2KHI A;  5C4J H;  2RSN A;  1UE6 A;  1GUN A;  1X3Q A;  4KJO A;  3NBH A;  1V1P A;  4L5R C;  3PUZ A;  4DV2 Q;  1EUJ A;  2I5L X;  3BJU A;  1WD1 A;  4L5T A;  4OEL B;  1EY5 A;  2QKI C;  4LMQ D;  3RN2 A;  1K73 C;  1H95 A;  2SNM A;  2F0U A;  2F52 A;  5IP7 H;  2ATW A;  1I50 B;  2B2V A;  1JB3 A;  1X32 A;  2K4K A;  2HHH L;  1J5E L;  1YI2 A;  3KF8 B;  3M4O B;  3C1E A;  3H3V I;  2KED A;  3H3V H;  3ERQ A;  3H15 A;  1PLF A;  3J80 i;  3HOX H;  1VQB A;  3MFY A;  3D8G A;  4KHV A;  4GZY C;  3KDF B;  1Y14 B;  4CHT B;  2K5Q A;  2ZTC A;  4DN4 M;  2PCF B;  1IHZ A;  4NPS A;  2A68 D;  1KQS A;  4IQZ A;  1CM9 A;  4UDU C;  4J6H A;  1UWV A;  3GQB A;  2ZTD A;  4N9T A;  3X3N A;  4JI6 Q;  5C44 H;  1E2W A;  2NWG A;  4CGY B;  4P72 A;  4CJ1 B;  2UUB L;  1M90 C;  4EQP A;  1E3P A;  1BQQ T;  1PH9 A;  1HTP A;  4WFN 3;  2ZM6 Q;  1E0B A;  4DU9 A;  1VQ4 A;  3TP7 A;  4IFD I;  2OQ0 A;  4UP8 A;  4JBJ A;  4IFD H;  2CH4 A;  4JI3 L;  4NXM Q;  4V0B A;  2F0M A;  4B3M L;  1IL2 A;  1HNZ L;  4DV1 L;  3J80 E;  2F0Q A;  4BY1 H;  2R92 H;  1K8M A;  3HOU H;  4ZKB B;  3TN2 A;  4GLX A;  3T1H Q;  1U5K A;  4R4I A;  2KCT A;  5C3X A;  4HID A;  3ITP A;  3K5O A;  3UDI A;  4BA1 I;  1LTT D;  2PMZ E;  2IJ0 A;  1VDZ A;  1WTO A;  3S2D B;  4RWS C;  1NMF A;  2F0G A;  5CV6 A;  3AB9 A;  2F0W A;  2FFK B;  2RCF A;  4BBS H;  2WKC A;  3CP0 A;  3NBH B;  2CKZ B;  1V1P B;  1BXT A;  4AQY Q;  2G9D A;  3MXN B;  1H9R A;  3G48 A;  4IPH A;  1EIY B;  1YHA A;  4TVA B;  4BS9 A;  1K9M C;  1VMP A;  4A3I G;  3UE0 A;  2GA4 B;  3C46 A;  4PMB A;  1HNW Q;  4LF4 Q;  1N32 Q;  3EN2 A;  3MHB A;  4GN3 B;  5KGU A;  2A69 C;  1LAC A;  2R7Z H;  4E6I A;  2K52 A;  1K28 A;  4YWL A;  4IAL A;  2J0T D;  1EIG A;  3E6Z X;  3OPO A;  4C3H B;  2NVT H;  3OSO A;  3V05 A;  1U4R A;  2VQE L;  4G7O C;  1F77 A;  4G7Z C;  2KEE A;  3OWF A;  1HJP A;  2DJF C;  2R7F A;  5BN5 A;  1SYG A;  3UE1 A;  2QF7 A;  1O7Y A;  1I3Q H;  4A3K B;  4RCN A;  1I4H A;  1RHP A;  1TWC B;  4HSP A;  4X3T A;  1YNN D;  1OXX K;  3VA5 A;  3EBE A;  4GOP A;  4LF7 L;  3D3R A;  1C9O A;  2RDH A;  4PZ7 A;  5COR A;  1N34 L;  2PMZ B;  1F2Z A;  2MGS A;  2F0O A;  4DR5 Q;  3SVM A;  2QIL A;  2RDF A;  4BBR H;  4DXG A;  4ZYS A;  3DLL A;  5GAG C;  5M5W H;  1SYF A;  3F1Z A;  3D6C A;  4L8J A;  4RMF A;  1LTB D;  5EQ0 A;  1EIH A;  2ENB A;  5CC4 A;  1EZ6 A;  1MJE A;  3IKJ A;  4ZK9 B;  3JAM i;  2UXB Q;  1VQ5 A;  3GTQ B;  1HXY D;  2VQF Q;  1I4X A;  4CKE A;  4FYD A;  2F0N A;  4RAU C;  2XRS D;  3M7G A;  3C1F A;  4NXN L;  3A55 A;  5JPM C;  1U4M A;  2OEO A;  5EGT A;  5BN4 A;  2JSO A;  4QGU A;  3S1R H;  4A3I B;  2BE5 D;  4DV5 Q;  4EVO A;  2B2Y A;  3RZD B;  5A2Q L;  2XWB B;  3URY A;  4OON A;  5KNC A;  1VF7 A;  1HQM C;  5EPL A;  4HAE A;  4DNI A;  4CJ0 B;  1WTV A;  3HOX B;  3L2P A;  4XQN A;  1E1O A;  3UDG A;  2R3Z A;  1QZG A;  1SE3 A;  3K5L A;  2PQA B;  1KAA A;  5AJ3 L;  3RZO H;  1PFS A;  2AMC B;  2GVB A;  1DXM A;  2F4V L;  2E74 C;  4C3I G;  2L0C A;  1PH3 A;  1B9N A;  2BH2 A;  1CK1 A;  2MQH A;  2E2I H;  4B3R Q;  2RBM A;  3JAM E;  3A7L A;  2AWO A;  1BBW A;  5E1F A;  3TP5 A;  1Y69 U;  1A0I A;  4DR3 Q;  3SE0 A;  2B63 G;  4JI1 L;  4A3E G;  3I4M H;  4IN3 A;  3X3M A;  2RSO A;  4G4K A;  1IBK Q;  1DZ1 A;  2UXD Q;  4J8Q A;  4X6A H; 
#chains in the Genus database with same CATH homology
 4JCV E;  1AE2 A;  4JI4 L;  2EXD A;  1PH5 A;  1B8A A;  1V1Q A;  4UY8 C;  1VQK A;  2ES2 A;  4JI8 Q;  4Y52 H;  1XPO A;  1AE3 A;  2CFM A;  2PQA A;  2CWP A;  2MO1 A;  2PI2 A;  4IPD A;  1YHQ A;  1X55 A;  1VQH A;  1VQG A;  3K7A H;  2EQS A;  2AHO B;  2NVY H;  5M3F H;  1TWG H;  1HR0 Q;  2XTI A;  4GOP B;  4B3M Q;  4JI0 Q;  3PO2 G;  4LFB Q;  1C0A A;  1VQE A;  2A1A A;  2MO0 A;  1FJG Q;  4DV0 Q;  4JOI A;  4OXP A;  3PGZ A;  3U50 C;  4DUY L;  3CC4 A;  1XNQ Q;  3JC6 6;  3DM3 A;  2R93 G;  1GVP A;  4C3I H;  2PI2 E;  2Q2I A;  4DV4 L;  2K50 A;  4LUV A;  1Q86 C;  1HNX L;  4POG A;  3HOW G;  2XGT A;  4DV7 L;  5C3E G;  3PV0 A;  5JJL A;  2NN6 I;  3M4O H;  2JA7 G;  5GAH C;  2UXC L;  1GKH A;  1U0L A;  2IY5 B;  1N9W A;  4MTN A;  4DV6 Q;  4A93 H;  1DGS A;  2K5H A;  3M9B A;  1TWF H;  4JI2 Q;  4A3E H;  4AYB G;  2B63 H;  2YYZ A;  3KF6 A;  4R4Q A;  4YHH Q;  4DV3 Q;  4ME3 A;  1Z47 A;  3E0E A;  1VQ7 A;  3TS0 A;  2EIF A;  1G51 A;  3T1Y Q;  4JI6 L;  1AH9 A;  3RLF A;  3D31 A;  4DR7 L;  5GQO A;  1YNX A;  5LMU L;  1PH2 A;  1L0W A;  2KHJ A;  3KFU A;  4A3B G;  2UXB L;  3CW2 C;  1HZB A;  1JT8 A;  4DR4 L;  2Q2H A;  2R6G A;  2VQF L;  1EIF A;  2UUC Q;  5LMN Q;  4JBM A;  4JV5 L;  1HR0 W;  3NEM A;  1XMQ L;  1X56 A;  1S40 A;  1WJJ A;  4HJ5 A;  4PZ8 A;  3STB C;  1RL2 A;  4YCV A;  4UPA A;  4IOA A;  1P8L A;  3G6E A;  3UDF A;  1E24 A;  1OXT A;  1X9N A;  4H02 A;  3U58 A;  1NBW A;  3RR5 A;  4AH6 A;  2OTJ A;  4A3M G;  4BXX G;  4DV5 L;  1NTG A;  4X66 Q;  1PHJ A;  1GM5 A;  3OYY A;  1VQL A;  4QJF A;  1TWA H;  1VQC A;  2R93 H;  1JB7 A;  2WP8 J;  2N49 A;  1EQR A;  1X3F A;  5C0X J;  3W5O A;  3S1Q H;  3HOW H;  5C3E H;  3CCR A;  3L0O A;  3K81 C;  2I0Q A;  2KBN A;  3CCL A;  3I7F A;  2JA7 H;  3A5U A;  3GTG H;  3E9H A;  2VZA A;  1B70 B;  2MFI A;  2D0P A;  2MNA A;  5BR8 L;  2VW9 A;  4J15 A;  3J80 c;  4DR1 Q;  1P16 A;  4LF5 Q;  4P74 A;  4HJ7 A;  5IWA L;  5K36 G;  1KD1 C;  4HJ9 A;  4P75 A;  4WJ3 M;  4X65 Q;  3AQQ A;  1IBL Q;  3HFZ B;  2KCM A;  5M3M G;  5LMN W;  3S1N H;  4A3B H;  4GKK L;  1YZ6 A;  3ER0 A;  4GN5 A;  4LFC L;  4A76 A;  4EQ5 A;  2E5L L;  1BBU A;  2WAQ G;  2N78 A;  2Q2T A;  4DR3 L;  3S17 H;  4DR2 L;  1EWI A;  3TRZ A;  4DPG A;  4KHP Q;  1IYJ B;  1E22 A;  1KRT A;  2HHH Q;  1J5E Q;  4JI7 L;  1I6H H;  1IBK L;  1NY4 A;  4OX9 L;  4A3M H;  2E2H H;  4B3S Q;  4LF8 Q;  2RHS B;  4BXX H;  3GTJ H;  3K8A A;  3I4N G;  1YIT A;  3ZJY C;  1CKN B;  3FHW A;  1KIX A;  1UE7 A;  4JI8 L;  1VQ9 A;  3A5Z B;  1S72 A;  3AEV A;  4BA2 I;  5FLM G;  1N34 Q;  2VY3 A;  3CPW A;  2L15 A;  4IPC A;  4A3K G;  2CCZ A;  1ASZ A;  1Y1V G;  3ICE A;  2WFW A;  4LF6 L;  2JA8 G;  4LFB L;  4JI0 L;  3J7A 5;  1CSQ A;  4P73 A;  1VQA A;  4POF A;  1XNR Q;  1OXU A;  1SN8 A;  2ZTE A;  3KDF A;  4JG2 A;  4GNX C;  2WB1 E;  1N8R C;  1FJG L;  4DV0 L;  4A3C G;  1XNQ L;  2IHE A;  2JEA I;  4BY7 G;  2A19 A;  3PUY A;  2YV5 A;  3CCU A;  3F8T A;  3RLO A;  1Q81 C;  1OTC A;  1QVF A;  2K5V A;  5M3M H;  4DUZ Q;  2ID0 A;  1Y1W G;  4O2D A;  3CCS A;  4ALP A;  2JJQ A;  4DK6 C;  2UUB Q;  1YJN A;  4NXN Q;  4DR6 Q;  1YJW A;  1O7I A;  4DV6 L;  4C3H H;  5M5Y H;  2JA9 A;  4JI2 L;  2NVQ H;  1Q1B A;  3KYH C;  3CF5 A;  1PA6 A;  4B3T Q;  2JK8 A;  1GD7 A;  4OWX B;  1QVC A;  3KJO A;  4OO1 G;  2LXJ A;  3E9I A;  3HKS A;  3ULP A;  1Q7Y C;  4YCU A;  4IOC A;  2IX0 A;  4DV3 L;  4R1J A;  1YJ9 A;  1CKN A;  4JI3 Q;  4A3G G;  5J3B A;  4DAY B;  1PH6 A;  3I4N H;  3PUV A;  1Q82 C;  1I94 Q;  2OWO A;  2OQK A;  3HOV G;  4GS3 A;  2R7D A;  1HNZ Q;  5C4X G;  4L5S A;  4OWW B;  1WFQ A;  2UUC L;  4DV1 Q;  2HIX A;  1J6Q A;  5LMN L;  1VS0 A;  3AYH B;  1TWH H;  2K5N A;  4MZ9 A;  4LFA Q;  2RHQ B;  5IP7 G;  5FLM H;  4QIW E;  1XTD A;  2KEN A;  3B6Y A;  4A3K H;  2OTL A;  3M7N A;  4LUO A;  3RN5 A;  1I50 H;  4R4C A;  1Y1V H;  1WCM G;  3D0F A;  3K80 C;  2C35 B;  4R4O A;  3S24 A;  4DKA C;  5AJ3 Q;  2JA8 H;  1CSP A;  2JA6 G;  2CWA A;  4GNX B;  1EYG A;  3A74 A;  3SGI A;  1IBM L;  2QEX A;  1CKM A;  5HY6 A;  4A3C H;  4X66 L;  1W3S A;  4BY7 H;  4WJ4 A;  5IE8 A;  4DR5 L;  4C2M H;  1N36 Q;  2DUD A;  2N8N A;  4GLA C;  4AYB E;  1K8A C;  3PIP A;  1WYD A;  4GKJ Q;  1QVG A;  5JJK A;  1Y1W H;  4X64 Q;  3ERS X;  1K83 H;  3HOX G;  2VNU D;  1UEB A;  3U4Z A;  1WI5 A;  2UUA Q;  1XJV A;  1LYL A;  2FXQ A;  5C0X G;  1CKO A;  4X62 L;  4DR1 L;  4OO1 I;  5IYD G;  1KRS A;  2K14 A;  2KHI A;  4O0A A;  5C4J H;  4LF5 L;  3S16 H;  5H1S E;  1UE6 A;  2IT1 A;  3G71 A;  1XPU A;  2JA5 G;  4A3G H;  3M4Q A;  4X65 L;  4L5R C;  1VQ6 A;  4LW1 A;  3PUZ A;  5C44 G;  4DV2 Q;  1EUJ A;  1YEZ A;  2I5L X;  4HJ8 A;  3BJU A;  3IRB A;  4L5T A;  2JE6 I;  1K8G A;  1C7Y A;  1XMO Q;  4JI4 Q;  3HOV H;  1HZA A;  1MJC A;  4YCW A;  3CC7 A;  3RN2 A;  5C4X H;  1K73 C;  1NJI C;  1H95 A;  3TRE A;  2F52 A;  5IP7 H;  4R4T A;  3S2H H;  2ATW A;  2ALY B;  4GNX A;  4KHP L;  1K0R A;  4A4I A;  2K4K A;  1WCM H;  2HHH L;  1J5E L;  4YWM A;  1YI2 A;  2JA6 H;  3KF8 B;  3CCV A;  3CD6 A;  4IFD G;  4B3S L;  3S14 H;  2I5M X;  3H3V I;  1KAW A;  4A75 A;  3H3V H;  2IX1 A;  2NZH A;  4IO9 A;  1V9P A;  1S3O A;  3H0G G;  3H15 A;  2VQE Q;  1PH8 A;  1HNX Q;  3GDE A;  1A8V A;  4P71 A;  3J80 i;  1VQB A;  3HOX H;  1KC8 C;  1LTL A;  4BY1 G;  3KDF B;  2R92 G;  2UXC Q;  1Y14 B;  3HOU G;  2Q2U A;  1WOC A;  3A0J A;  2ZTC A;  3U4V A;  5C0X I;  2JQO A;  4LWC A;  3FKI G;  4NPS A;  4B3R L;  1XNR L;  3W1G A;  1KQS A;  3KOJ A;  5IYD H;  2Z6K C;  1IZ6 A;  1UWV A;  1JJC B;  2YTV A;  3CAM A;  2YU9 H;  1L1O C;  2Y0S E;  2ZTD A;  2WAQ E;  3GTL H;  4JYA Q;  4IFD J;  1RIP A;  3TEH B;  4JI6 Q;  2IHF A;  2JA5 H;  5GAE C;  4DAM A;  5IYC G;  3JAM c;  2UU9 L;  3I55 A;  3ULJ A;  5C44 H;  4A3D G;  3S2D H;  3S1M H;  3TS2 A;  4DUZ L;  5ELO A;  4AIM A;  4JI5 Q;  4P72 A;  2UXD L;  4KI0 A;  3RLN A;  2UUB L;  1M90 C;  1XMQ Q;  4BBS G;  4K0K Q;  1E3P A;  4PG3 A;  1PH9 A;  1B7Y B;  2ZM6 Q;  4B3T L;  4YY3 Q;  2GVA A;  4LF7 Q;  4XTC S;  1VQ4 A;  1PYS B;  4XIG S;  1X3G A;  3OTO Q;  1MKH A;  3J7Z C;  1VQP A;  4IFD I;  2OQ0 A;  5M5X H;  4UP8 A;  4JBJ A;  1X6O A;  1T9H A;  4JI3 L;  3EIV A;  1SFO H;  4NXM Q;  1PH7 A;  4JC0 A;  4QY7 A;  1I94 L;  1ASY A;  1K3R A;  1HR0 L;  4B3M L;  1IL2 A;  3H0G H;  1QUQ B;  3CMA A;  1HNZ L;  1V43 A;  2QA4 A;  5GRO A;  3MEF A;  2E2J H;  4DV1 L;  2NZO A;  4BY1 H;  2R92 H;  3HOU H;  4GLX A;  2HT1 A;  3T1H Q;  2R7Z G;  5BR8 Q;  5IT9 c;  4GOP C;  1U5K A;  5GAD C;  1PH4 A;  3FKI H;  3PF4 A;  4R4I A;  2KCT A;  5FJ8 G;  4KHZ A;  4HID A;  4HJA A;  3LGJ A;  3UDI A;  1KHI A;  1L1O B;  4BA1 I;  2BH8 A;  2PMZ E;  5IYC H;  4LUZ A;  4LF9 Q;  1NMF A;  2Z0S A;  3BU2 A;  3WWV A;  4A3J G;  4A3D H;  4GKJ L;  3K7U C;  3HKZ G;  4YHH L;  2A8V A;  2VUM G;  3NEN A;  4X64 L;  1SLJ A;  1YVC A;  5ELN A;  3S15 H;  3M4P A;  4Y7N H;  1VQO A;  1HZC A;  3T1Y L;  4DR2 Q;  4BBS H;  4QQB X;  3CP0 A;  3NBH B;  2CKZ B;  3STB D;  2UUA L;  3AFP A;  3KJP A;  4FDB A;  4AQY Q;  1E7Z A;  4JI7 Q;  1UE5 A;  3MXN B;  4DK3 C;  3G48 A;  4HIO A;  1XPR A;  1CUK A;  2CQO A;  4IPH A;  1Q8K A;  4NB3 A;  1QUQ A;  1EIY B;  1YHA A;  5E7N A;  4DV2 L;  1VQN A;  4TVA B;  1K9M C;  1TWC H;  1VQD A;  4A3F G;  1XMO L;  2GN5 A;  1JJG A;  4HIM A;  2RCN A;  3UE0 A;  4A3I G;  4UP9 A;  1HNW Q;  5IP9 G;  2LXK A;  1D7Q A;  2F4V Q;  4QL5 A;  4LF4 Q;  2YTX A;  1N32 Q;  3EN2 A;  5IYB G;  3PO3 G;  4GN3 B;  2B29 A;  2Z6K A;  1A62 A;  1W2B A;  4LF6 Q;  4YWK A;  2R7Z H;  1L1O A;  4OWT B;  4LNQ A;  1X54 A;  3Q8D A;  2V1C C;  2K52 A;  5FJ8 H;  4YWL A;  1IXR A;  1PVO A;  3HOY G;  4GLV B;  3NEL A;  2QGQ A;  5IY0 A;  1N33 Q;  2HIV A;  1VCI A;  4BBR G;  2NVT H;  4JI1 Q;  3G4S A;  3OW2 A;  1NE3 A;  4A3J H;  3TQY A;  1EOV A;  2VQE L;  2ZJR A;  4PMW A;  2VUM H;  1G6P A;  1X3E A;  3F2D A;  2LSS A;  1L2F A;  1E1T A;  3W1B A;  1HJP A;  1IBL L;  2R7F A;  2AWN A;  1NMG A;  2DGY A;  1KL9 A;  1OXV A;  3UE1 A;  3BZK A;  4JBK A;  3ULL A;  1BKB A;  1LM0 A;  3GTQ H;  1I3Q H;  1YIJ A;  4JYA L;  2I5H A;  1HH2 P;  2OCE A;  1VQ8 A;  3KLW A;  2HQL A;  3RNU A;  4A3F H;  1OXX K;  1A63 A;  1KXL A;  3EBE A;  4JI5 L;  4LF8 L;  4A3I H;  4DUY Q;  2ASB A;  5JJI A;  5IP9 H;  4GOP A;  3RZD H;  4K0K L;  1SR3 A;  5IYB H;  3PO3 H;  2F3I A;  2JEB I;  4DV4 Q;  3HOZ G;  2ZM6 L;  2NVX H;  3PUW A;  1YHB A;  4YY3 L;  3I56 A;  4APV A;  4LF7 L;  3PO2 H;  1EFW A;  4IPG A;  5HGQ A;  1Q46 A;  3OTO L;  4DV7 Q;  1C9O A;  4PZ7 A;  1IBM Q;  1VQJ A;  1N34 L;  1FL0 A;  3HOY H;  4A3L G;  1SE8 A;  1UE1 A;  1TXY A;  4HIK A;  4DR5 Q;  4NXM L;  4BBR H;  3PSI A;  4UP7 A;  3CQZ H;  5EAY A;  1VQM A;  1QZH A;  1SMX A;  3J81 c;  3DLL A;  2ZJQ A;  5GAG C;  5M5W H;  2ZJP A;  3GTM H;  3F1Z A;  4RMF A;  3J81 i;  3PIO A;  1JMC A;  4DR7 Q;  2VL6 A;  3I4O A;  3VDY A;  4JOI C;  4EX5 A;  2E8G A;  5LMU Q;  1EQQ A;  3GTK H;  2VS1 A;  3T1H L;  1MJE A;  2UXB Q;  3JAM i;  4X62 Q;  1VQ5 A;  1FGU A;  3CPF A;  3K0X A;  4DR4 Q;  2VQF Q;  3BZC A;  4JV5 Q;  2YTY A;  4IJH A;  4NXN L;  3M85 A;  4DR6 L;  3F2B A;  4LF9 L;  3FP9 A;  1PV4 A;  1D8L A;  1GO3 E;  1LUZ A;  3PCO B;  3I4M G;  3PUX A;  4QGU A;  3S1R H;  2PNH A;  4DV5 Q;  1R9T H;  3UDX A;  2Y0S G;  3CCJ A;  4L5Q A;  1BVS A;  1MIU A;  2N3S A;  5JEA G;  3HOZ H;  4OON A;  5DLQ E;  4AQY L;  1FVI A;  3I2Z A;  4DNI A;  3GTP H;  1SRU A;  4PZ6 A;  3L2P A;  1E1O A;  1VQI A;  3UDG A;  2BA1 A;  4LFA L;  1QZG A;  2AKW B;  4A3L H;  3GD7 A;  5M3F G;  2PQA B;  1Z9F A;  3GO5 A;  3PF5 A;  5AJ3 L;  1M1K C;  3CCM A;  3RZO H;  1HZ9 A;  1G29 1;  1PFS A;  4KLK A;  1PH1 A;  2AMC B;  1SRO A;  4GN4 B;  4JBW A;  5IWA Q;  1HNW L;  1PYB A;  2GVB A;  3CC2 A;  2B3G A;  4RG1 A;  2F4V L;  5FLX c;  4IJL A;  4LF4 L;  1N32 L;  2RF4 A;  2D62 A;  1I5F A;  1PH3 A;  1VQF A;  1N36 L;  2BH2 A;  1JJ2 A;  1Q1E A;  2MQH A;  2E2I H;  5JEA J;  4GKK Q;  4B3R Q;  3HKZ E;  1Q12 A;  2BA0 A;  2AWO A;  2WB1 G;  1BBW A;  3L7Z C;  4TQU S;  2E5L Q;  4LFC Q;  3CCQ A;  2NN6 G;  4MNO A;  4C3J H;  3F2C A;  1A0I A;  1JE5 A;  4DR3 Q;  4A93 G;  3AFQ A;  1N33 L;  2H5X A;  2UU9 Q;  4JI1 L;  4A3E G;  2B63 G;  3CCE A;  3I4M H;  3J81 j;  3GTO H;  3M3Y H;  1YBY A;  3CXC A;  1IBK Q;  1X65 A;  4OX9 Q;  1OXS C;  2D0O A;  2UXD Q;  3KF6 B;  4X6A H;  3CME A;  2K75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...