2F4VQ

30s ribosome + designer antibiotic
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2f4vQ00
3CMAA 1HZCA 4LFCL 2NZHA 2LXKA 5GAEC 1QUQB 1CKMA 1OXSC 2HT1A 1HNWL 3PF5A 1BKBA 1MJCA 2MNAA 2JA6H 3ULJA 4DR2L 2XTIA 1M90C 2BA0A 1L1OC 4JI5Q 4OX9Q 4JYAQ 4B3RQ 4NXNL 3BZKA 1V1QA 4EQ5A 1EIFA 4YCUA 2K14A 4GS3A 4L5QA 3S24A 5C3EH 3HOUH 2BA1A 1NMGA 1Q1BA 3ULPA 3ICEA 2YYZA 2VQEL 4A76A 4A3MH 5FJ8G 1P8LA 1WCMG 1N8RC 3PO2H 3W1GA 3T1HL 3D31A 5LMUQ 3K7AH 4GNXB 2ALYB 3OW2A 4DNIA 1XNRL 1HJPA 5FLXc 2CWPA 4JCVE 4R4CA 5HY6A 4C3JH 4DV7L 3KDFA 4DR3Q 4OXPA 1NTGA 1NBWA 1SLJA 3UE1A 1XMQQ 4JI6Q 2HHHL 3Q8DA 4GOPB 4GN3B 2PQAB 1E22A 2VQFL 1EYGA 4HJAA 2OTLA 3OTOQ 2GN5A 2JA5G 1RIPA 2AMCB 2MQHA 5AJ3L 3KFUA 3NBHB 3PUVA 3G48A 4C2MH 5IT9c 1VQMA 1Y1WG 2UXBQ 1WCMH 3HOWG 4X62Q 4UP8A 2CFMA 4DR6L 4DUYL 1PA6A 1VQ4A 2R93H 1VQ8A 2CQOA 4GLVB 4LF9Q 4JC0A 3A74A 3GTJH 4LF6Q 4P74A 1A62A 4JI0Q 4LF7Q 4A3BG 2ASBA 3FKIG 1IL2A 2JEAI 2OQ0A 2JA5H 1QZGA 1H95A 4KI0A 1TWHH 5H1SE 3I56A 1X65A 1IBLL 4JI1Q 3RNUA 1Q46A 1Y1WH 1N34L 2LSSA 1PH4A 3HOWH 5JJLA 1JE5A 4LW1A 3PV0A 1VQFA 5C0XI 2CKZB 1D8LA 1MKHA 5LMNW 2UUCL 1VQKA 1NMFA 4B3SQ 1I3QH 2KHIA 3PSIA 2AWOA 3PUXA 3TEHB 3HFZB 2ZJRA 1JB7A 4JBWA 3AQQA 4UP9A 3J80c 2BH8A 1EOVA 3KJPA 3FKIH 3GTMH 1LM0A 3K81C 5M3FG 1VQHA 1PH9A 1YZ6A 1WOCA 3A5UA 1N33L 3S1RH 4B3TL 3CW2C 4BA1I 1PH5A 2F3IA 2I5HA 3F8TA 1XMOQ 2VUMG 4DR1Q 5C44G 3GTKH 1IBMQ 2A1AA 4FDBA 4YY3Q 2ATWA 4YWKA 3U4VA 1K9MC 1LTLA 1QVCA 3W1BA 4JBMA 1VQGA 4DV4L 4JI7Q 3FP9A 4KHPL 2XGTA 1CSPA 3AYHB 3T1YQ 3I4OA 1G291 1MJEA 2E5LQ 4NXML 1YEZA 5M3FH 1I50H 4AQYQ 4HJ9A 4QY7A 4HIDA 2K5HA 3CXCA 5M5YH 1U0LA 1YI2A 3I55A 2JA9A 3BJUA 2VUMH 5C44H 1Y14B 3G4SA 1PH7A 3BZCA 4X66L 1V9PA 2EXDA 2B63G 4TVAB 4JI3L 4DKAC 4DV0Q 5M3MG 1VQCA 3CP0A 4JI4Q 1VQ7A 1N9WA 1IXRA 4JBKA 3UDGA 3CCSA 4BY1G 1YITA 3M4QA 1Q8KA 4YHHQ 3I2ZA 1D7QA 3E9HA 4KLKA 4JBJA 3STBD 4B3MQ 1FVIA 2NN6I 4PMWA 3A5ZB 4DV6Q 2N3SA 4OO1I 4A93G 1G51A 2EQSA 1S72A 4JI2L 4IPCA 2N78A 2JJQA 3NEMA 3RZDH 1GD7A 4DV3Q 1S40A 2B63H 1E24A 1QVGA 3GDEA 4LF8L 3CCRA 4A3GG 2IHEA 2R92G 2JQOA 3PUWA 3JAMi 1I94L 5JEAG 1WYDA 3K7UC 4BY1H 1VQAA 4TQUS 3IRBA 1LYLA 2B3GA 3SGIA 1HH2P 3CAMA 2KCTA 4XTCS 4DAYB 2R7ZH 3GTLH 4NPSA 4DR7Q 2PI2E 3KLWA 1HZ9A 1UEBA 2YU9H 3M7NA 4A93H 1KRSA 2ZTCA 4NB3A 3PO2G 1CKOA 3CC2A 1XNQL 4PG3A 1AE3A 2OQKA 4A3GH 2K52A 2R92H 4KHZA 2D0OA 4A3JG 1HNXL 3KF6A 5IYDG 1OTCA 5IP9G 1C9OA 4GKJL 2WB1G 1XJVA 3U4ZA 5C0XJ 1L0WA 4IO9A 2E8GA 4GKKL 3TRZA 3CC4A 3OYYA 4JG2A 2RCNA 2OTJA 1B8AA 5K36G 1XNRQ 4UY8C 1G6PA 2UXCQ 4LFBL 3PIPA 2F4VQ 1L1OB 5IYCG 3A0JA 3H3VI 1SROA 3HKSA 2ZTEA 4J15A 1YHAA 3KF8B 4DR5L 3S1QH 3CQZH 3LGJA 4C3HH 3I4NG 2R93G 5M5WH 4A3JH 1YJNA 1ASYA 4IPDA 1VQEA 1TWAH 4O0AA 4EX5A 2ID0A 5IP9H 2QEXA 5IYDH 1J5EQ 4PZ8A 4DUZL 4LF4L 5LMNL 1X9NA 4OWXB 1FGUA 4X65L 2ZJPA 3JC66 2NVTH 3M3YH 4LF5Q 3UDIA 3J81i 4WJ4A 4WJ3M 3RN5A 4AIMA 3CCLA 4YCWA 4APVA 4X64Q 4JI8L 5GADC 3BU2A 1SRUA 1HR0Q 5IYCH 2ZM6Q 2I0QA 4B3RL 2AKWB 2WB1E 1EQRA 2KHJA 4OX9L 3TS2A 3B6YA 2MO0A 1P16A 2K4KA 3AFPA 3I4NH 1K83H 1N36Q 1N32Q 2UXDQ 4Y52H 4HIMA 3TREA 1C7YA 1IBLQ 5LMUL 3KDFB 2KENA 2RHQB 1NY4A 2NVXH 3EIVA 1VQ6A 4JV5Q 2HIXA 4DR3L 5J3BA 3PGZA 2IHFA 5GQOA 1KIXA 1I5FA 5BR8Q 4DR4Q 3ULLA 1YJWA 4JI6L 4H02A 1E3PA 1O7IA 4R4QA 4R4TA 2GVAA 1SN8A 2V1CC 2VY3A 1T9HA 3M4PA 3M85A 1A63A 3PCOB 1SR3A 4P73A 5DLQE 1SMXA 2FXQA 1VQIA 1QZHA 1N33Q 2Z0SA 4YWMA 4L5RC 1PVOA 3S17H 3DLLA 3UDXA 4LF9L 4IFDG 1KD1C 4LF6L 3HOYH 4JI0L 3PO3G 5C4XG 1HNZQ 4LF7L 2ZJQA 2MO1A 1XNQQ 1OXVA 4MZ9A 1VQLA 1A8VA 5GROA 4LUOA 1X54A 3S2DH 1YJ9A 3HOVG 1C0AA 4JI1L 3F2DA 1W2BA 4DPGA 2E2JH 3L0OA 3G6EA 1Q1EA 2JA8G 2L15A 1AE2A 4B3SL 5IWAQ 3GTOH 3S2HH 4IJLA 2F52A 5C4XH 3CCUA 3PO3H 4A3LH 4BY7G 4DV1L 2UUBQ 3EBEA 1U5KA 4MNOA 5GAGC 1EUJA 4BA2I 4LUZA 1VQJA 3S14H 1M1KC 3HOVH 1KC8C 1YHBA 1EFWA 1OXUA 2E2HH 1XPOA 3HOXH 2NZOA 4DV5Q 3H0GG 5ELNA 2JA8H 1Z9FA 2R7ZG 1K8GA 1LUZA 4UPAA 3CMEA 4YY3L 1PYBA 3FHWA 1GO3E 3STBC 1XPRA 1FJGQ 4BXXG 5GAHC 3MXNB 4BY7H 1TXYA 1IBKQ 2Q2UA 3T1YL 1Y1VH 1PFSA 3RZOH 1HZBA 4P75A 4RMFA 2E5LL 2K5VA 4AQYL 4R1JA 2VNUD 1YNXA 3S15H 4HJ5A 2UUAQ 3I7FA 4K0KL 5E7NA 4DV2Q 1L2FA 4QQBX 1X3FA 2AHOB 2K5NA 3H0GH 4GLAC 4DK6C 5IYBG 2K75A 3W5OA 1NE3A 1RL2A 1X3GA 4BBRG 3VDYA 1Q86C 4A3LG 4KHPQ 3E0EA 1BBUA 2JEBI 3J7ZC 4LFCQ 4BXXH 1JT8A 1HNWQ 1NJIC 1VQBA 3L7ZC 1PH2A 1QUQA 4YHHL 1PYSB 5FLMG 4DR2Q 3RLFA 4GKKQ 4B3ML 5C4JH 4NXNQ 2Z6KA 4DV6L 2PMZE 1VQNA 2HQLA 2D0PA 3PUZA 2JK8A 3GO5A 4A3CG 5IYBH 4DV3L 5ELOA 3GTPH 4BBRH 2VQEQ 2YTYA 3GD7A 1K73C 4QIWE 2E2IH 4GLXA 3S1MH 5C0XG 3PF4A 4QJFA 1IYJB 4AH6A 3T1HQ 3GTGH 1CKNA 3M9BA 1EWIA 3HOZG 2OCEA 2WAQG 1J6QA 2EIFA 1PH3A 1X55A 3HKZG 4DV7Q 4GNXA 3CD6A 1BVSA 3WWVA 5IE8A 2NVYH 4LFAL 4QGUA 1KAWA 5JJKA 2R7FA 5LMNQ 2DGYA 4A4IA 5FLMH 2HHHQ 2Z6KC 4DR7L 1Q12A 2Q2IA 1JJ2A 2VQFQ 1UE1A 4GN5A 1AH9A 4OWWB 3F2BA 1V43A 2LXJA 3PUYA 2NVQH 3CCQA 4GOPA 3L2PA 2PQAA 5AJ3Q 3CPWA 2ES2A 1PH1A 2UU9L 4JI8Q 4A3CH 3TQYA 3KF6B 4IPHA 1WI5A 3ERSX 3HOZH 3JAMc 4DR6Q 4DUYQ 1PH8A 4GNXC 1PHJA 1K8AC 5HGQA 1B70B 3CC7A 3NELA 1UE6A 4IOCA 2JA7G 1OXXK 4JI5L 1GKHA 1CKNB 4JYAL 3RLOA 4PZ6A 3CCJA 4BBSG 2KBNA 3J80i 3ER0A 3KYHC 1KRTA 4GOPC 2VL6A 2YV5A 1BBWA 4A3KG 2A19A 2UXCL 2ZTDA 1S3OA 1TWCH 4OONA 2F4VL 2WAQE 3S16H 3HKZE 4O2DA 1SE8A 3CCMA 3U50C 1N34Q 1EIYB 1XTDA 3CCEA 3CPFA 3RN2A 2GVBA 2D62A 2YTVA 1YVCA 4R4IA 4R4OA 2UUCQ 2A8VA 3ZJYC 3U58A 4POGA 1DGSA 1QVFA 1J5EL 3M4OH 2PNHA 4L5TA 1UWVA 4RG1A 4HJ8A 2IT1A 1XMQL 1Q7YC 2JA7H 3HOYG 4BBSH 2C35B 5FJ8H 1JMCA 4LF5L 3OTOL 3K8AA 1HZAA 2QGQA 3PIOA 3E9IA 1IZ6A 1Z47A 3DM3A 4A3KH 2JE6I 4X64L 4A3FG 2UXBL 2NN6G 2I5LX 4X62L 1HR0L 2PI2A 2ZM6L 4OO1G 4POFA 3MEFA 4B3TQ 5IY0A 4GN4B 2Y0SG 2R6GA 1X6OA 4HIKA 1WJJA 3AEVA 5M5XH 1N36L 1N32L 4Y7NH 2UXDL 1CSQA 2VZAA 1KL9A 5JJIA 1VQOA 3AFQA 2WFWA 1A0IA 4DV4Q 3J81c 3J7A5 1VCIA 4JV5L 1VQ9A 4HIOA 4JOIA 2CWAA 4UP7A 4A3FH 2CCZA 4NXMQ 5BR8L 2IX0A 4DR4L 3I4MG 1KHIA 2N8NA 2Q2HA 4LUVA 4P71A 1K3RA 1X56A 3UE0A 1Q81C 2KCMA 1E7ZA 2WP8J 2VW9A 3RR5A 4DV1Q 4A3BH 1EQQA 5IP7G 1KXLA 4IFDJ 3CF5A 1E1TA 3F1ZA 4ME3A 4X66Q 3RLNA 4L5SA 4JI3Q 2YTXA 1TWGH 2I5MX 4IJHA 1KQSA 1VQDA 1B7YB 2R7DA 1Y1VG 1HR0W 1VQ5A 1FL0A 4JOIC 3H15A 2Y0SE 1UE5A 2B29A 4ALPA 4DAMA 3I4MH 3EN2A 1HNZL 3NENA 4A3EG 1CUKA 1XMOL 3UDFA 4YCVA 1JJCB 4JI2Q 1OXTA 1VS0A 4DK3C 4DR1L 1IBML 4P72A 5IP7H 1ASZA 1GM5A 2K50A 4X6AH 4LF8Q 1YBYA 4HJ7A 1I6HH 1I94Q 4JI7L 2IY5B 4A3IG 3GTQH 4LWCA 4IOAA 5IWAL 4OWTB 4A75A 1W3SA 4XIGS 2Q2TA 1XPUA 1GVPA 3D0FA 1R9TH 2H5XA 2VS1A 1UE7A 4AYBG 4A3EH 2RHSB 2UUBL 4A3DG 2MFIA 3S1NH 3H3VH 2AWNA 4QL5A 4DV0L 4JI4L 1YHQA 3TS0A 1HNXQ 1SFOH 4DV5L 4PZ7A 4A3IH 2QA4A 3KJOA 1PV4A 1YIJA 3KOJA 4GKJQ 1X3EA 1MIUA 4YWLA 1TWFH 5JEAJ 3HOXG 1FJGL 4IFDI 4IPGA 4LNQA 3G71A 5M3MH 5EAYA 2DUDA 1IBKL 4A3DH 1E1OA 4MTNA 4C3IH 2JA6G 4LFBQ 3CCVA 2RF4A 1PH6A 2BH2A 3K80C 2OWOA 1K0RA 4LFAQ 2UUAL 4DR5Q 2IX1A 4K0KQ 3F2CA 1L1OA 2HIVA 1WFQA 4DV2L 5C3EG 3HOUG 4LF4Q 1VQPA 4DUZQ 4A3MG 4AYBE 2UU9Q 1JJGA 4X65Q 3K0XA 2N49A 3J81j 1Q82C
chains in the Genus database with same CATH superfamily
4F7XA 4DAVA 2MPMA 3NHHA 3CMAA 5GAEC 2HT1A 3F2UA 4OEMB 4CJ0B 5IGCA 1HNWL 1MJCA 5JVG3 2BA0A 4JYAQ 1PTOB 1A2UA 4YCUA 4GS3A 3E5SA 2EJMA 3BVMA 2KCNA 2VQEL 1EY7A 3TP8A 3PO2H 2K32A 3FKIB 1D5MC 1HJPA 5ELFA 5FLXc 4DV7L 1KLGD 1XMQQ 1RODA 4KY7A 2HHHL 2F3VA 3Q8DA 1JR0D 3BVZA 3OTOQ 3GTKB 1KNAA 2MQHA 5AJ3L 3PUVA 4KTAA 1VQMA 2Z4IA 4X62Q 2KQ3A 4UP8A 4QF4A 1V1PA 1IW7D 3T51B 3Q24A 1VQ4A 2L4NA 1TS3A 5M3FB 3GTJH 4P74A 1A62A 1STAA 1BCPD 4JI0Q 4LF7Q 5J1ZA 3FKIG 2JA5H 1QZGA 5H1SE 1IBLL 5KIXA 3T53B 5C0XI 1VQFA 4N9PA 5LMNW 1D8LA 1VQKA 1ZKOA 4B3SQ 2LFNA 1EQVA 2KHIA 2ZJRA 3J80c 3KJPA 1DXMA 2LMCB 2B63B 4K8IA 5M3FG 1YZ6A 1ET6A 2EYOA 3F8TA 2ZT9C 3V96A 3H91A 2A1AA 2OT2A 4FDBA 1U4RA 3VYTA 3U4VA 1LTLA 1QVCA 3W1BA 4B08A 4Z9CB 4JI7Q 2XGTA 2RKSA 3RUZA 3I4OA 1MJEA 4K6LA 3MXNA 1I50H 2EY6A 4QY7A 2K5HA 2KCCA 2VUMH 4KD4A 2N55A 1PH7A 2B63G 1F2MA 3BZCA 4KKSA 2EXDA 4KJNA 4X66L 3TP7A 1PZJD 3KBGA 3CP0A 4JI4Q 1N9WA 1K0SA 4JBKA 1JWMD 5I4DA 1DZ1A 3STBD 2F0DA 4B3MQ 1PFBA 4PMWA 4DV6Q 4OO1I 2N3SA 1HQRD 1S72A 2N78A 1E24A 4LF8L 3R3OA 3CCRA 2JQOA 4G7ZC 1NAPA 1VQAA 3MFYA 3OSOA 4XTCS 2PZWA 2PI2E 1HZ9A 1K83B 1KRSA 3NWTA 3PO2G 2K01A 1AE3A 4A3GH 4O42A 2NVXB 1OTCA 4GKJL 4IUUA 3U4ZA 1AZPA 4IO9A 3MAQA 3OYYA 1HXYD 2OTJA 3MVVA 4JVZA 1QE6A 4FO2A 4LFBL 2DN8A 1SROA 5C3WA 1G6ZA 5D3DA 2QEXA 1TWAH 2L5TA 4EX5A 1J5EQ 4PZ8A 4PNYA 4K2LA 2ZJPA 3M3YH 5CYUA 4K5VA 3J81i 4WJ4A 4KV6A 3RN5A 1RTNA 4YCWA 1LT6D 3I8ZA 5C5MA 4EQPA 4X64Q 4JI8L 5T1IA 5JJZA 5GADC 4ZUIA 5JAVA 4B3RL 2WB1E 2KHJA 1KDAA 2I46A 2MO0A 1P16A 3AFPA 3I4NH 1N36Q 1IW7C 2UXDQ 3KBXA 3S2HB 4G4KA 4I65A 1A15A 3PO3B 2O2LD 1BCPC 3KDFB 1X32A 4OELB 2RHQB 1NY4A 5J22A 4DR3L 1KIXA 5KNBA 1IYVA 4DR4Q 1H9SB 3ULLA 4JI6L 5IOCA 3TMEA 5FOBB 1GUGA 1S5FD 1HFGA 1SN8A 1SJED 1DOKA 2JA8B 1HFNA 2V1CC 2WACA 4MHEA 4FF2A 2D9UA 4P73A 2FXQA 2Z0SA 4IUPA 1PVOA 4FF1A 3DLLA 3H09A 1YNJC 4LF9L 4IFDG 2EVBA 1AZQA 3S15B 3T13A 2ZXRA 3PO3G 1HNZQ 1XNQQ 1OXVA 1F2ZA 1DOLA 3UI2A 5A2QL 2PMZB 3L0OA 4DNTB 2JA8G 2L15A 4F88A 3FEWX 1D5XC 5I9OA 5C4JB 4F87A 3H94A 5C4XH 3CCUA 5IGGA 2F0FA 1SMYD 2UUBQ 3EVQA 4EVOA 1ENAA 3VYRA 1XWEA 5GAGC 1TS4A 3PIP3 1M1KC 1XX8A 3GTGB 4ZAIA 1YHBA 1KC8C 1V1OA 2CQAA 3VR6A 2N88A 1Z9FA 1LUZA 1GO3E 3STBC 1FJGQ 3K6OA 2KJXA 1TXYA 1XXGA 3RZOH 4P75A 1SNQA 4AQYL 4R1JA 3HOZB 4B9WA 3TZUA 4ZQ3A 2WAQB 3HKZB 1X3FA 2K5DA 3R2IA 4DK6C 1E2ZA 5IYBG 1RL2A 3EJIA 4E6IA 4FNFA 5DNFA 4LFCQ 5TSSA 1PH2A 1BOSA 5IGEA 4DR2Q 1GUWA 2KHSA 4QB4A 2FINB 4LAAA 4KN7C 4A3CG 3GTPH 4BBRH 1K8MA 4A3LH 1PMRA 2RA4A 3S1MH 2CW0D 1LTTD 4QJFA 3HOZG 4Q0FA 2Z4HA 2OCEA 2WAQG 4A3KB 3HKZG 4U68A 1BVSA 1FNUA 1PDQA 4LFAL 5JJKA 4A4IA 5FLMH 2NYZD 2Z6KC 3I3CA 1JJ2A 5A2QE 1UE1A 4GN5A 1R4QB 5G3LD 2R61A 4Y7NB 4GOPA 3TSSA 1GUSA 4ZYSA 3TQYA 1KDCA 3QOJA 3MZ5A 4L8JA 4DR6Q 4DUYQ 2B2UC 1PHJA 1B70B 3I70A 1OXXK 1HRJA 1GKHA 3CCJA 1NR2A 2XIWA 2KBNA 3J80i 3KYHC 4KY5A 3W2DA 3E3XA 1KRTA 2YV5A 1EOTA 1BBWA 4A3KG 2A19A 2SNSA 4OONA 5HURA 4O2DA 1N34Q 3U50C 2JN4A 3OHXC 3RN2A 2D62A 2A8VA 3ZJYC 3M4OH 1A2TA 3EROA 4L5TA 1UWVA 1BCPB 1Q7YC 2C35B 5FJ8H 4LF5L 4XYOA 2C5CA 2QGQA 1IZ6A 1Z47A 2G5DA 2H4OA 2NN6G 3VR4A 1TVXA 3MEFA 4B3TQ 4QCLA 4GN4B 4XDXA 1KTKA 3AEVA 5M5XH 1N32L 4ZUJA 4U673 3MEHA 1GJXA 4HN7A 2FHTA 4ZK9B 3AFQA 1A0IA 3TBIB 4RKLA 4S3SA 2OEOA 2CCZA 1PRTF 5I9PA 2LY7A 5BR8L 2IX0A 2L12A 4UDUC 2N8NA 4P71A 4LUVA 1U9RA 1K3RA 4A3IB 2WP8J 3C1FA 3MWYW 1LV9A 4A3BH 4DV1Q 1EQQA 4IFDJ 3CF5A 1TR5A 5A35A 3RLNA 3TP5A 5M3MB 1TWGH 2I5MX 4V0BA 2F0GA 1DOMA 2R7DA 1SMYC 3HP3A 1ILPA 2Y0SE 1UE5A 1Q3LA 3I4MH 3DEOA 3Q0AA 2WINB 1EY9A 4YCVA 5EPKA 1EWCA 1GM5A 4X6AH 2VXWA 3MXUA 5EPLA 3HOXB 5HGTA 1I94Q 5I2XA 2IY5B 4A3IG 2JA6B 2F0TA 4IOAA 1FNVA 4OWTB 5C5LA 1W3SA 1EQTA 1R9TH 2X69A 4HTHA 2J0TD 1CA5A 1UE7A 1PFMA 4AYBG 4LJZC 3JAME 3H3VH 1O80A 2K05A 3K7AB 2EJGC 4MTKA 5CV9A 1YHQA 4C3JB 4A3JB 2DY8A 4KY6A 4TKOB 2QA4A 1X3EA 1QOHA 4RH6A 2RDFA 1MIUA 2F0IA 3HOXG 3C1EA 1DM0B 5LHY1 1EU3A 5EAYA 3VA7A 2DUDA 4MTNA 4C3IH 2JA6G 1PH6A 3MTSA 5C6AA 2CW0C 2L55A 4DR5Q 2UUAL 2IX1A 1L1OA 2B2TA 2KECA 1VQPA 3T4AC 2B2YC 2DNCA 4X65Q 3K0XA 1HZCA 3OIQA 4C3JG 1WTQA 1QUQB 1CKMA 1OXSC 2B2WA 3PF5A 1TWHB 1ILQA 1LABA 1SYBA 2XTIA 1EYCA 4OX9Q 1S5CD 4EQ5A 3S24A 5JVH3 1Q1BA 3ULPA 3ICEA 1LO5D 4X3KA 4A76A 1B9MA 5FJ8G 4ILWA 5EPJA 3W1GA 5LMUQ 2ALYB 3QR8A 1F9QA 2E74C 3GTMB 5HY6A 3K59A 1AFPA 1BQQT 4G57A 4GN3B 4TRDA 3A8JE 2AUJD 4RHSA 1SYFA 3NBHB 4C2MH 5IT9c 2L11A 3VYUA 1PYWD 2E2JB 1GHJA 1PA6A 2CQOA 3K5NA 4IUQA 4JC0A 3IFDA 3K5OA 4A3BG 1ICFB 3HG9A 1PRTD 1IL2A 5C44B 2OQ0A 3C3LA 4RFBA 4JI1Q 1Q46A 2LSSA 1WTHA 3GV3A 3IKJA 1ENCA 1PTOH 4JBMA 2CKZB 4B9XA 1TIID 3K5MA 3ND9A 1E0BA 3PSIA 3TEHB 4K5XA 4JBWA 1LTGD 3FKIH 3RZDB 3C2PA 4OIKA 3R2TA 1WOCA 2DY7A 3A5UA 1QB5D 2XWJB 4BA1I 4HSVA 4DR1Q 5C44G 3GTKH 3SE0A 1JB3A 2F0JA 4CDEC 1VQGA 4A93B 3FP9A 4ZLTF 1HA6A 2E5LQ 3NP8A 5M3FH 4CKBA 4HJ9A 4HIDA 4CKEA 3BJUA 2XRSD 3BDLA 4IN3A 4TVAB 4JI3L 5D65A 4DKAC 4DAYA 4RCNA 1VQCA 4HEDA 1II3A 3UDGA 1EZ8A 4YHHQ 1SYDA 1ZXTA 3I2ZA 5NUCA 1STYA 4JBJA 3S1QB 2K33A 4C3HB 2HD3A 4A93G 3X3MA 4JI2L 4IPCA 2WV6D 2XWBB 2Q8IB 2B63H 4JK1C 2B2YA 1QVGA 2F03A 5C4HA 5JEAG 2BOSA 5FO7B 3VDYA 3IRBA 3CAMA 4DAYB 1SAPA 5CV5A 4NPSA 1UEBA 1BNZA 2PZTA 2HCCA 1CKOA 2X6LA 3CC2A 1FR3A 4KHZA 4C3HG 2D0OA 1HNXL 2J7ZA 5IYDG 3L3OC 1CHQD 1UUPA 1L0WA 4GKKL 5CC4A 3TRZA 5J39A 4JG2A 2RCNA 4UY8C 2KEEA 1G6PA 3PIPA 2F4VQ 5IYCG 3HKSA 2PW7A 4J15A 4FYDA 2F0QA 5F2DA 3S17B 2EYHA 1EY6A 4IPDA 1VQEA 4O0AA 3OMCA 4LF4L 4DUZL 3QG1A 1EYDA 5LMNL 3HOYB 2O4XA 3JC66 2NVTH 2ZXOA 3UDIA 1MHWC 4ZRZA 4AIMA 2A6ED 3CCLA 4APVA 4HCEA 1Z7TA 4FXDA 1SRUA 3H6MA 2I0QA 3TS2A 1EQRA 1HCZA 2EJFC 4DK1A 1K83H 4Y52H 1Z6HA 4N8X1 2MGSA 1IBLQ 1ICWA 3MHBA 2NVXH 3ONAB 1PRTC 4DN4M 5D3IB 5J3BA 1Q8IA 3HOVB 2L9HA 2E2DC 3OW7A 4PV1C 5GQOA 1YJWA 4H02A 2E2HB 1E3PA 1O7IA 4IALA 2K6AA 2K03A 1D6EC 3TDQA 3M85A 1A63A 3PCOB 1SR3A 1V1PB 2ICEC 4DNRB 1SMXA 4YWMA 3URYA 4L5RC 1YNJD 2RVLA 3UDXA 4FVMA 1KABA 4G7OC 4RGNA 4JI0L 2F0HA 5DM63 3FPPA 2IWHA 4LF7L 4M8AA 2MO1A 1VDZA 1VQLA 3S1NB 1I4QA 1X54A 3NQTA 4BWGB 1K3BC 4UAIA 3HOVG 3F2DA 1GUOA 1EWHA 1Y8PB 1JORA 3AB9A 1HA5A 1Q1EA 4GZYC 4B3SL 2RSOA 4IFDH 3S2HH 1LLRD 2F0UA 3P75A 2F52A 3PO3H 2AQ2B 2Z6BA 3A7LA 3VR5A 2E2IB 3J7AV 4BA2I 1VQJA 2F0PA 4DV5Q 5ELNA 2EYPA 2JA8H 1B3AA 4ZKCB 1MD2D 2A6HD 3D4RA 4CDCC 2NVQB 2A74C 4C1NI 3MXNB 1AW7A 3IL8A 3N6RA 4XQQA 5L37A 1D1KA 1YNXA 2EY5A 3S15H 1EY5A 4MN3A 1XYIA 2K5NA 1NE3A 1Q86C 3PQIA 2F0KA 1MBYA 4KHPQ 1STHA 5CBEE 1BBUA 1CTMA 1G8ZD 2Z8LA 3CHBD 1JT8A 1BXTA 3SEBA 1TWCB 2A68C 3SK8A 3RLFA 1CQVA 4B3ML 5C4JH 4NXNQ 2J4XA 4DV6L 1L0XB 2PMZE 3PUZA 5IODA 4K8JA 5IYBH 2Z9HA 1K73C 4BBSB 5C0XG 3PF4A 3T1HQ 1NSNS 1E2VA 3GTGH 1EWIA 2TMPA 4IURA 3NTKA 4GNXA 1S5DD 4KN4C 3WWVA 3CD6A 5COYA 1L0YB 3SXHA 3QWNA 4IUVA 2IW3A 2B39A 2VQFQ 2JXMB 1WVLA 4OWWB 1V43A 3PUYA 3CCQA 2K5WA 2PQAA 1JE4A 1K28A 3CPWA 1PH1A 2ES2A 4JI8Q 4A3CH 3K58A 1NCVA 1WI5A 1FNWA 3HOZH 3JAMc 3SDZA 5E1FA 2A6EC 1K8AC 1U4LA 2BDOA 4IOCA 3OMGA 4JI5L 3U9OA 1PXUA 4PZ6A 4BBSG 4NMZA 3ER0A 4GOPC 2O5IC 3W3AA 2WAQE 4ULLA 4DXFA 1EIHA 1CQFA 3HKZE 1SE8A 3CCMA 3CCEA 5JPMC 2K7VA 3CPFA 4R4IA 1STBA 2UUCQ 3K0YA 4DF7A 1J5EL 4FXKC 4RG1A 4HJ8A 1PTOF 1SYCA 3TP6A 1PRTB 5FLXL 4A3KH 3DM3A 1X3PA 4X64L 2UXBL 1K8OA 2PI2A 4OO1G 3GTQB 4WFN3 3QJYA 4J6HA 1X6OA 2QCPX 1BDOA 1M8AA 1N36L 2UXDL 4Y7NH 2VZAA 4KMUC 1CFMA 2WKDA 4A3EB 3A8IE 4DV4Q 2OF1A 3J7A5 4WJWA 3WDNA 4JOIA 4UP7A 4NXMQ 3G7LA 2NN6H 4DR4L 1KHIA 1SFOB 1D1IA 1ML0D 2NZ1D 1E7ZA 3A56A 5CMDA 2VW9A 5IP7G 4IZ8A 3F1ZA 4ME3A 1DD2A 1JCKB 2BDNA 1LT3D 1VQDA 1B7YB 4A3DB 1JQYD 1LT4D 2DNEA 2C9OA 2XN9C 4ALPA 2FMCA 3EN2A 4WRDA 3J80L 1HNZL 4A3EG 1XMOL 1XNQL 1JJCB 4DK3C 5KYIA 1IBML 2QF7A 1ONLA 1OO9B 2A6HC 5KNCA 4OHJA 2FJ2A 2TSSA 1SBBB 2K04A 1UNSA 1I4HA 1I4GA 3SR1A 2Q2TA 3D0FA 3NXWA 5C3EB 2H5XA 3HOUB 1KDBA 1WTPA 2UUBL 2B8FA 4A3DG 2MFIA 4P2CB 4A3MB 2AWNA 2KA7A 4QUFA 3KK7A 5DM73 4DV0L 2XRQD 4DAPA 1ENFA 3LNNA 4PZ7A 4A3IH 1VMPA 1PV4A 5FLXE 1FJGL 4IPGA 4LNQA 5M3MH 1J9OA 2EXZA 2NB0A 1WCMB 2XNAC 4LFAQ 1ESRA 4H13C 2OWOA 3F2CA 3NTHA 5CV6A 5C3EG 2R93B 3HOUG 3KF8A 5C3XA 4A3MG 4AYBE 3HOXH 4LFCL 1BKBA 2MNAA 2JA6H 3ULJA 1Y1WB 4EGVA 3HOWB 4DR2L 1SJHD 1L1OC 2B2TC 3BZKA 1HUNA 1V1QA 1B3QA 1I3QB 1NMGA 2YYZA 1N8RC 1WCMG 2A69D 3K7AH 4IUTA 1WD1A 4DNIA 2B2WC 1XNRL 4JCVE 4RAUC 4C3JH 4X3SA 1PTOD 5T1GA 1NTGA 1NBWA 3J80E 2MP1A 4X3TA 3S1RB 4GOPB 1EYGA 4HJAA 2OTLA 2GN5A 1B4OA 3VA5A 1RIPA 1I6VC 3G48A 3NWSA 2PCFB 1Y1WG 3HOWG 3OOCA 4DR6L 3M4YA 3OWEB 4DUYL 1MGSA 1ESFA 1O78A 2A5HA 3A74A 2QEJC 3MC0B 3MA2B 4LF6Q 2VB3X 5M5YB 1I4XA 4ODGA 2HDLA 4KI0A 1TWHH 4V190 1C48A 1X65A 2F0NA 1IKLA 3J7YW 1N34L 1HUMA 3KLRA 5JJLA 4RGMA 4LW1A 3PV0A 1MKHA 2RQXA 1NMFA 2AWOA 2PW5A 3PUXA 3HFZB 3K5LA 1JB7A 4UP9A 3AQQA 3IAYA 2BH8A 5CV4A 1EOVA 2F0OA 3HEJA 1F9PA 3GTMH 1Y8NB 2NBFA 1LM0A 1PH9A 1VQHA 2SOBA 3H3VC 2JSOA 1N33L 4B3TL 1EEID 2D5DA 1Y69U 3CW2C 2IPKD 5E4WC 1PH5A 2F3IA 2NTSA 4BY1B 4C56C 4LK1C 5CBAE 2R7ZB 3GTLB 1NNXA 4YY3Q 2ATWA 5EKIA 1K9MC 3SK5A 2YU9B 3P20A 3BDCA 1A3VA 1CSPA 3T1YQ 1G291 2F0LA 1YEZA 2B2VA 1O7ZA 2R92B 1H9JA 3DM1A 3CXCA 3AMUA 2D2CC 1U4MA 3I55A 2IL8A 5C44H 1Y14B 3MXPA 4CDDC 3D4DA 1V9PA 2AQ3B 4FXGC 5M3MG 3BYYB 1VQ7A 2PNRC 1IXRA 1FGBD 1AEXA 1F9RA 4BY1G 1YITA 3E6ZX 1Q8KA 1D7QA 4WORA 3E9HA 4KLKA 3CQZB 5M5WB 2X6GA 3A5ZB 3QB3A 2EQSA 2IJ0A 3RZDH 1GD7A 4DV3Q 3DHQA 2CH4A 2EOTA 1CK1A 1QNKA 1NR4A 1S40A 5EKKA 2IHEA 4XT1B 2R92G 3PUWA 3JAMi 1I94L 3VR3A 1A6XA 1LYLA 3DUZA 1HH2P 2KCTA 4LMQD 1TQOA 4TSSA 4DR7Q 3HGBA 1ZEQX 3KLWA 3M7NA 5I6WA 4XQNA 4A93H 2ZTCA 4K2KA 4PG3A 1KNEA 2OQKA 1LACA 1SYEA 2KUMA 4A3JG 5JEAH 3KF6A 5IP9G 2ENBA 3EFXD 4PQXA 4RGTA 1DCZA 4YIJA 3DWQA 3CC4A 3J7AF 1G2SA 5K36G 3LX0A 2UXCQ 1L1OB 4DGZA 3A0JA 2JP1A 3H3VI 5IGBA 1JWSD 4DR5L 2A69C 3S1QH 3LGJA 4C3HH 1YJNA 3QO2A 5IYDH 1PTOC 2ID0A 1X9NA 4OWXB 1FGUA 1MI2A 1S5ED 4X65L 4F8MA 1T5XD 2NTTA 3S2DB 2SEBD 4FP5D 3BU2A 1HR0Q 5IYCH 2ZM6Q 4OX9L 1D2BA 1EIGA 2E75C 3A7AB 1VMCA 1JICA 5BN3A 3GTOB 4HIMA 3TREA 1C7YA 5LMUL 2F0EA 2KENA 3FDTA 1VQ6A 4JV5Q 2HIXA 3IFTA 3S14B 3PGZA 2IHFA 1I5FA 2ZXPA 4O1NA 4C1NK 4R4QA 4R4TA 5ELBA 1SNDA 2V4DA 3HRZC 3M4PA 1JOKA 1R4PB 3VYSA 1HTPA 5DLQE 1QZHA 4BY7B 1JOOA 1QJOA 1Y1VB 3S17H 3X3NA 3G6JB 2RCFA 3HOYH 2EYLA 2ZJQA 3H0GB 2K1BA 3FPUB 1A8VA 3TZDA 4QUCA 4LUOA 1H9RA 3BYTB 1YJ9A 1Y8OB 3KUPA 1JWUD 4JI1L 4DPGA 2L1BA 3G6EA 3ZYYX 4QIWB 1AE2A 5EBDA 2VB2X 5IWAQ 4DK0A 3EA6A 4IJLA 1FYCA 1RTOA 1QILA 4BY7G 3N52A 3EBEA 4HCSA 3T16A 3VR2A 1EUJA 3I72A 1MSGA 4XXEA 3HOVH 4K5WA 1EFWA 1OXUA 2E2HH 2FMMA 2NZOA 3H0GG 5C4ZA 4M1UB 2NVYB 3Q22A 4UPAA 3CMEA 3CU7A 1S5BD 3FHWA 4R8IA 3KLSA 4BXXG 5GAHC 4CBVA 1IBKQ 2HQEA 1LTSD 2RBMA 4RMFA 4UHVA 2E5LL 2K5VA 2VNUD 4HJ5A 1QWYA 2HCIA 3LWEA 3DWPA 4DV2Q 1L2FA 4QQBX 3I73A 2AHOB 4GLAC 1EU4A 3W5OA 1X3GA 3E0EA 4NW2A 1HNWQ 2A68D 3L7ZC 3WOFA 3S16B 4YHHL 1PYSB 1EYAA 4JPBW 4GKKQ 1A3TA 2E76C 1EY0A 1VQNA 4CJ1B 4PMCA 3GO5A 2JA7B 3RD4A 5ELOA 2VQEQ 2E2IH 3GD7A 1EFID 4GLXA 1IYJB 4AH6A 3M9BA 1SE4A 1J6QA 2EIFA 3EQLC 1X55A 4DV7Q 2Z1CA 1KAWA 1STEA 5LMNQ 5CV7A 2DGYA 2HHHQ 4K0KL 1AH9A 3F2BA 2LXJA 2NVQH 2DJGC 5AJ3Q 2UU9L 4KD3A 4H7BA 5C0XH 1ZYRD 1PH8A 4GNXC 4A3FB 2MUYA 2WKCA 4KKUA 2JA7G 2EDGA 1GUNA 4JYAL 3ND8A 3QIAA 1O7YA 4OIJA 2M9VA 1S3OA 1TWCH 2QILA 2DJFC 4RKBA 4KHVA 2F4VL 4ZCKA 3PMFA 4N8FA 3BVGA 1YVCA 4POGA 1CZGA 2XSCA 1QVFA 3QOLA 2PNHA 1XMQL 3HOYG 1BO0A 2IT1A 1XTCD 4BBSH 1JMCA 3SVMA 3OTOL 3R93A 3E9IA 1J8IA 2JE6I 4A3FG 1F2YA 2ICIA 2I5LX 4X62L 1HPCA 1RD9D 1I6HB 1SNCA 4X3UA 5IY0A 2R6GA 2KOLA 1WJJA 3GV6A 4QMGA 5EKLA 5IT9L 2MJ8A 1KL9A 3A54A 3NUCA 1RDPD 1VQOA 2WFWA 3TN2A 4RHRA 1VCIA 4HIOA 2RDGA 4HSPA 4OO1H 2MHVA 1KXLA 1E1TA 4X66Q 4L5SA 1TWFB 5EJWA 2QW7A 3J81L 5IIFA 2YTXA 3R8BA 4IJHA 1VQ5A 1FL0A 3BS1A 4HAEA 4JOIC 4I7AA 3H15A 3DMUA 3OIPA 4NKLA 4RGOS 4DAMA 3LWUA 3NQIA 3NENA 3UDFA 1OXTA 1H9KA 5IP7H 3BZDB 1ASZA 2EPBA 4LF8Q 4HJ7A 3CRKC 4IUNA 4JI7L 2Q8RE 4EQNA 3GTQH 1SNPA 1O7LA 2QDLA 4A75A 1PZKD 1XPUA 1GVPA 1RHPA 2VS1A 2HUGA 4A3EH 4PMBA 3PO2B 1EY8A 2OXPA 4JI4L 1JC7A 3DXJC 3TS0A 1SFOH 2KEDA 4DV5L 3KJOA 2H1EA 3KOJA 1YIJA 4GKJQ 3L9AX 4DXGA 4YWLA 5JEAJ 4IFDI 2NVTB 1TU2B 3PIO3 4A3DH 1T5EA 4LFBQ 2RF4A 2BH2A 2SDFA 3NPPA 1K0RA 2QDBA 5IT9E 4CJ2C 1SNOA 1B50A 3GTJB 1JOQA 3SK6A 2N49A 2M00A 1F9SA 4KHPL 3J81j 1RJTA 3SHLA 2NZHA 2LXKA 3P7JA 4DA2A 2BE5D 3NE5B 2JA5B 1DYQA 1PZID 2PO4A 1M90C 4JI5Q 4B3RQ 3RMHA 2NUCA 4NXNL 2PQEA 1EIFA 1ZYRC 2K14A 4L5QA 5C3EH 3HOUH 2BA1A 5KRUA 3J81E 5KGUA 4A3MH 5LL6X 1P8LA 3FRPB 4I7ZC 3D31A 3T1HL 1LTID 1Q90A 4ZKBB 3D4WA 4GNXB 3OW2A 2CWPA 3KLSX 4R4CA 3C46A 3KDFA 4DR3Q 4OXPA 1HTLD 1M4VA 1SLJA 3UE1A 4JI6Q 1TT2A 5ELEA 2PQAB 1E22A 2VQFL 1H9SA 2JA5G 2AMCB 3KFUA 3ERQA 1WTRA 5G3LF 3DWAA 2UXBQ 1WCMH 5JOBA 3V05A 2CFMA 4NP5A 2R93H 1VQ8A 1STGA 4GLVB 4LF9Q 1I50B 4RWSC 2CVRA 2ASBA 2EY2A 2JEAI 2VUMB 1H95A 3I56A 3RNUA 3NTIA 1Y1WH 3HOWH 1RF2D 1PH4A 5M9OA 1JE5A 4FF4A 3DEPA 2UUCL 1BUVT 1I3QH 1WTVA 3D8GA 5CV8A 5CR3A 1SSOA 1IKMA 1TKWB 5KEEA 1F2LA 3K81C 3S1RH 1UEAB 1LTAD 2I5HA 1YNND 1XMOQ 2VUMG 1IBMQ 4YWKA 3I91A 1G2TA 3NBIA 1CA6A 4DV4L 3AYHB 1CI3M 4NXML 2I07B 4N9TA 4AQYQ 4A3GB 5ELCA 3FVQA 5M5YH 1U0LA 1YI2A 5KNDA 2JA9A 1PFNA 3G4SA 3I90A 3I4LA 4DV0Q 2P5ZX 3CCSA 5KYLA 2B2VC 3M4QA 4K14A 4JW0A 1FVIA 2NN6I 1SDFA 1TWAB 2R3ZA 1G51A 2WB1B 1X3QA 2JJQA 3NEMA 3M3YB 3GDEA 4A3GG 1AP0A 1B2TA 1WYDA 3WOEA 3K7UC 4BY1H 4TQUS 1B9NA 2B3GA 3SGIA 2R7ZH 3GTLH 2XVSA 3S9WA 1WTOA 3I4NB 2YU9H 3K57A 1W6JA 4NB3A 1CT1D 3NK9A 4XQJA 2K52A 4EQOA 2R92H 1GOZA 4HMIA 4MIUA 4NDXA 2BE5C 1C9OA 4ME5A 2WB1G 1XJVA 5C0XJ 5DEHA 2E8GA 4L6TB 3E0JA 3MXGA 5CGKA 1CZWA 2PYKA 1B8AA 5FK9C 1XNRQ 5BN4A 2CH4W 2ZTEA 1YHAA 2CHBD 3KF8B 3CQZH 3I4NG 2R93G 5M5WH 4A3JH 1ASYA 5IP9H 3ITPA 5FKAC 3NSWA 1RCVD 4LF5Q 2LKVA 2K28A 1C8CA 4WJ3M 5K36H 1E2WA 1CHPD 2LS01 5IGDA 2AKWB 3HS0C 3B6YA 1I4RA 2K4KA 1GXDC 1N32Q 4RCOA 1V8QA 1QNUA 4XT3B 5C4XB 3BDOA 3JAML 4L63B 1GHKA 3EIVA 5BN5A 2M2LA 3CRLC 5BR8Q 3M7GA 5FO8B 1NUCA 1LTBD 2GVAA 1SXTA 4HR7B 1LT5D 2VY3A 1T9HA 3Q6SA 5LL6S 2F3WA 1F77A 1VQIA 1N33Q 1WD0A 3RZOB 2B8GA 4ABNA 1KD1C 2HDMA 2WIIB 4LF6L 5C4XG 4MZ9A 3D6WA 5GROA 1YNNC 1WTWA 3S2DH 4J1MA 2AUKA 1C0AA 1W2BA 1TS5A 2EZVA 2AQ1B 2G9HD 2E2JH 3CKIB 1B53A 2EYJA 4R8NA 1A3UA 1STNA 2F0SA 3GTOH 2F0MA 2JYOA 3OPOA 4DV1L 4AYBB 1U5KA 2EYMA 4MNOA 3GTPB 4BBRB 4LUZA 3S14H 3S1MB 1TS2A 1IYUA 1D5ZC 1XPOA 2R7ZG 1K8GA 5D14A 3MFGA 1PYBA 4YY3L 2F0VA 3A8KE 5JPNC 1XPRA 4J8QA 4BY7H 3U9SA 1KAAA 3GP7A 3T1YL 1Y1VH 1PFSA 2Q2UA 1HZBA 2BCOA 2F1MA 2UUAQ 3I7FA 4Q5VA 5E7NA 2NWGA 1H9MA 3H0GH 2F4IA 2K75A 5CORA 4BBRG 1PLFA 4RA8A 4A3LG 3FMCA 2JEBI 3D3RA 3J7ZC 4BXXH 2GA4B 3GQBA 1NJIC 2F0WA 1VQBA 5E3FA 4CGYB 1QUQA 1CM9A 5AFWA 2EYFA 5FLMG 2Z6KA 5EGTA 2HQLA 2D0PA 4BS9A 4K6DA 3M4OB 2JK8A 4DV3L 5I2YA 3AU7A 2YTYA 4QIWE 1SE2A 1CKNA 1AN8A 1PH3A 1MSHA 2B2UA 5IE8A 2NVYH 4G7HC 4QGUA 1IL8A 2R7FA 4DR7L 1Q12A 2Q2IA 3OWFA 1EL0A 4CDFC 5M5XB 3L2PA 2RSNA 4ID6A 2Q8TA 3KF6B 2QKIC 1U4PA 4IPHA 3NBHA 1WTXA 3ERSX 4DFAA 5HGQA 2PPBC 3CC7A 3NELA 1UE6A 3O13A 5EBCA 1SEBD 1CKNB 3RLOA 5ISRA 5I6YA 1G91A 2Y0SB 3D6CA 1UAPA 4A3BB 2VL6A 2A73B 1SYGA 4H44C 2ZTDA 2UXCL 4KK7A 3S16H 1RKNA 1TWGB 1GUTA 1BF4A 1EIYB 1XTDA 3V2TA 2GVBA 4IQZA 2YTVA 4DU9A 4R4OA 2EY1A 2SNMA 3U58A 4KKTA 1DGSA 2JA7H 3I4MB 3K8AA 1HZAA 3PIOA 1BR9A 1HR0L 2ZM6L 2EE1A 4POFA 3A55A 1DONA 5E4XA 2Y0SG 4FF3A 4HIKA 1SE3A 1DJRD 1EZ6A 1CSQA 2PZUA 4HMJA 1IHZA 1R9TB 1I4PA 5JJIA 1HQMC 3J81c 1BCPF 4JV5L 5DAUA 1VQ9A 2CWAA 4A3FH 4H0LC 3I4MG 4OGQC 2Q2HA 4CKCA 1SNMA 1B1ZA 1X56A 3UE0A 1Q81C 2KCMA 3RR5A 3BG3A 5IGFA 2L0CA 4R9WA 1QCBD 4JI3Q 1KQSA 1HR0W 1Y1VG 2KVMA 4C3IB 3P1HA 1LTRD 2B29A 5K5PA 1CUKA 4DR1L 4JI2Q 1VS0A 4OL7A 1KLUD 4P72A 2K50A 1ET9A 1YBYA 2RDHA 1I6HH 1QG7A 1C4QA 4LWCA 3SK4A 5IWAL 1B44D 4XIGS 4CHTB 1FD7D 1S4ZA 1TY0A 1VF7A 1TY2A 1EY4A 2RHSB 3S1NH 4C3IG 1HHVA 4QL5A 3T56B 1HNXQ 4XYQA 2IX3A 4KJOA 5ELDA 1W6KA 2G9DA 1TWFH 3G71A 2K5QA 1EEFD 1IBKL 1E1OA 4C2MB 3CCVA 3K80C 3Q23A 2O5JC 4K0KQ 2FFKB 2HIVA 1WFQA 3HZXA 5EQ0A 4DV2L 1BBXC 1VF5C 4LF4Q 5FO9B 4DUZQ 2UU9Q 1JJGA 1Q82C
chains in the Genus database with same CATH topology
3CMAA 1HZCA 4LFCL 2NZHA 2LXKA 5GAEC 1QUQB 1CKMA 1OXSC 2HT1A 1HNWL 3PF5A 1BKBA 1MJCA 2MNAA 2JA6H 3ULJA 4DR2L 2XTIA 1M90C 2BA0A 1L1OC 4JI5Q 4OX9Q 4JYAQ 4B3RQ 4NXNL 3BZKA 1V1QA 4EQ5A 1EIFA 4YCUA 2K14A 4GS3A 4L5QA 3S24A 5C3EH 3HOUH 2BA1A 1NMGA 1Q1BA 3ULPA 3ICEA 2YYZA 2VQEL 4A76A 4A3MH 5FJ8G 1P8LA 1WCMG 1N8RC 3PO2H 3W1GA 3T1HL 3D31A 5LMUQ 3K7AH 4GNXB 2ALYB 3OW2A 4DNIA 1XNRL 1HJPA 5FLXc 2CWPA 4JCVE 4R4CA 5HY6A 4C3JH 4DV7L 3KDFA 4DR3Q 4OXPA 1NTGA 1NBWA 1SLJA 3UE1A 1XMQQ 4JI6Q 2HHHL 3Q8DA 4GOPB 4GN3B 2PQAB 1E22A 2VQFL 1EYGA 4HJAA 2OTLA 3OTOQ 2GN5A 2JA5G 1RIPA 2AMCB 2MQHA 5AJ3L 3KFUA 3NBHB 3PUVA 3G48A 4C2MH 5IT9c 1VQMA 1Y1WG 2UXBQ 1WCMH 3HOWG 4X62Q 4UP8A 2CFMA 4DR6L 4DUYL 1PA6A 1VQ4A 2R93H 1VQ8A 2CQOA 4GLVB 4LF9Q 4JC0A 3A74A 3GTJH 4LF6Q 4P74A 1A62A 4JI0Q 4LF7Q 4A3BG 2ASBA 3FKIG 1IL2A 2JEAI 2OQ0A 2JA5H 1QZGA 1H95A 4KI0A 1TWHH 5H1SE 3I56A 1X65A 1IBLL 4JI1Q 3RNUA 1Q46A 1Y1WH 1N34L 2LSSA 1PH4A 3HOWH 5JJLA 1JE5A 4LW1A 3PV0A 1VQFA 5C0XI 2CKZB 1D8LA 1MKHA 5LMNW 2UUCL 1VQKA 1NMFA 4B3SQ 1I3QH 2KHIA 3PSIA 2AWOA 3PUXA 3TEHB 3HFZB 2ZJRA 1JB7A 4JBWA 3AQQA 4UP9A 3J80c 2BH8A 1EOVA 3KJPA 3FKIH 3GTMH 1LM0A 3K81C 5M3FG 1VQHA 1PH9A 1YZ6A 1WOCA 3A5UA 1N33L 3S1RH 4B3TL 3CW2C 4BA1I 1PH5A 2F3IA 2I5HA 3F8TA 1XMOQ 2VUMG 4DR1Q 5C44G 3GTKH 1IBMQ 2A1AA 4FDBA 4YY3Q 2ATWA 4YWKA 3U4VA 1K9MC 1LTLA 1QVCA 3W1BA 4JBMA 1VQGA 4DV4L 4JI7Q 3FP9A 4KHPL 2XGTA 1CSPA 3AYHB 3T1YQ 3I4OA 1G291 1MJEA 2E5LQ 4NXML 1YEZA 5M3FH 1I50H 4AQYQ 4HJ9A 4QY7A 4HIDA 2K5HA 3CXCA 5M5YH 1U0LA 1YI2A 3I55A 2JA9A 3BJUA 2VUMH 5C44H 1Y14B 3G4SA 1PH7A 3BZCA 4X66L 1V9PA 2EXDA 2B63G 4TVAB 4JI3L 4DKAC 4DV0Q 5M3MG 1VQCA 3CP0A 4JI4Q 1VQ7A 1N9WA 1IXRA 4JBKA 3UDGA 3CCSA 4BY1G 1YITA 3M4QA 1Q8KA 4YHHQ 3I2ZA 1D7QA 3E9HA 4KLKA 4JBJA 3STBD 4B3MQ 1FVIA 2NN6I 4PMWA 3A5ZB 4DV6Q 2N3SA 4OO1I 4A93G 1G51A 2EQSA 1S72A 4JI2L 4IPCA 2N78A 2JJQA 3NEMA 3RZDH 1GD7A 4DV3Q 1S40A 2B63H 1E24A 1QVGA 3GDEA 4LF8L 3CCRA 4A3GG 2IHEA 2R92G 2JQOA 3PUWA 3JAMi 1I94L 5JEAG 1WYDA 3K7UC 4BY1H 1VQAA 4TQUS 3IRBA 1LYLA 2B3GA 3SGIA 1HH2P 3CAMA 2KCTA 4XTCS 4DAYB 2R7ZH 3GTLH 4NPSA 4DR7Q 2PI2E 3KLWA 1HZ9A 1UEBA 2YU9H 3M7NA 4A93H 1KRSA 2ZTCA 4NB3A 3PO2G 1CKOA 3CC2A 1XNQL 4PG3A 1AE3A 2OQKA 4A3GH 2K52A 2R92H 4KHZA 2D0OA 4A3JG 1HNXL 3KF6A 5IYDG 1OTCA 5IP9G 1C9OA 4GKJL 2WB1G 1XJVA 3U4ZA 5C0XJ 1L0WA 4IO9A 2E8GA 4GKKL 3TRZA 3CC4A 3OYYA 4JG2A 2RCNA 2OTJA 1B8AA 5K36G 1XNRQ 4UY8C 1G6PA 2UXCQ 4LFBL 3PIPA 2F4VQ 1L1OB 5IYCG 3A0JA 3H3VI 1SROA 3HKSA 2ZTEA 4J15A 1YHAA 3KF8B 4DR5L 3S1QH 3CQZH 3LGJA 4C3HH 3I4NG 2R93G 5M5WH 4A3JH 1YJNA 1ASYA 4IPDA 1VQEA 1TWAH 4O0AA 4EX5A 2ID0A 5IP9H 2QEXA 5IYDH 1J5EQ 4PZ8A 4DUZL 4LF4L 5LMNL 1X9NA 4OWXB 1FGUA 4X65L 2ZJPA 3JC66 2NVTH 3M3YH 4LF5Q 3UDIA 3J81i 4WJ4A 4WJ3M 3RN5A 4AIMA 3CCLA 4YCWA 4APVA 4X64Q 4JI8L 5GADC 3BU2A 1SRUA 1HR0Q 5IYCH 2ZM6Q 2I0QA 4B3RL 2AKWB 2WB1E 1EQRA 2KHJA 4OX9L 3TS2A 3B6YA 2MO0A 1P16A 2K4KA 3AFPA 3I4NH 1K83H 1N36Q 1N32Q 2UXDQ 4Y52H 4HIMA 3TREA 1C7YA 1IBLQ 5LMUL 3KDFB 2KENA 2RHQB 1NY4A 2NVXH 3EIVA 1VQ6A 4JV5Q 2HIXA 4DR3L 5J3BA 3PGZA 2IHFA 5GQOA 1KIXA 1I5FA 5BR8Q 4DR4Q 3ULLA 1YJWA 4JI6L 4H02A 1E3PA 1O7IA 4R4QA 4R4TA 2GVAA 1SN8A 2V1CC 2VY3A 1T9HA 3M4PA 3M85A 1A63A 3PCOB 1SR3A 4P73A 5DLQE 1SMXA 2FXQA 1VQIA 1QZHA 1N33Q 2Z0SA 4YWMA 4L5RC 1PVOA 3S17H 3DLLA 3UDXA 4LF9L 4IFDG 1KD1C 4LF6L 3HOYH 4JI0L 3PO3G 5C4XG 1HNZQ 4LF7L 2ZJQA 2MO1A 1XNQQ 1OXVA 4MZ9A 1VQLA 1A8VA 5GROA 4LUOA 1X54A 3S2DH 1YJ9A 3HOVG 1C0AA 4JI1L 3F2DA 1W2BA 4DPGA 2E2JH 3L0OA 3G6EA 1Q1EA 2JA8G 2L15A 1AE2A 4B3SL 5IWAQ 3GTOH 3S2HH 4IJLA 2F52A 5C4XH 3CCUA 3PO3H 4A3LH 4BY7G 4DV1L 2UUBQ 3EBEA 1U5KA 4MNOA 5GAGC 1EUJA 4BA2I 4LUZA 1VQJA 3S14H 1M1KC 3HOVH 1KC8C 1YHBA 1EFWA 1OXUA 2E2HH 1XPOA 3HOXH 2NZOA 4DV5Q 3H0GG 5ELNA 2JA8H 1Z9FA 2R7ZG 1K8GA 1LUZA 4UPAA 3CMEA 4YY3L 1PYBA 3FHWA 1GO3E 3STBC 1XPRA 1FJGQ 4BXXG 5GAHC 3MXNB 4BY7H 1TXYA 1IBKQ 2Q2UA 3T1YL 1Y1VH 1PFSA 3RZOH 1HZBA 4P75A 4RMFA 2E5LL 2K5VA 4AQYL 4R1JA 2VNUD 1YNXA 3S15H 4HJ5A 2UUAQ 3I7FA 4K0KL 5E7NA 4DV2Q 1L2FA 4QQBX 1X3FA 2AHOB 2K5NA 3H0GH 4GLAC 4DK6C 5IYBG 2K75A 3W5OA 1NE3A 1RL2A 1X3GA 4BBRG 3VDYA 1Q86C 4A3LG 4KHPQ 3E0EA 1BBUA 2JEBI 3J7ZC 4LFCQ 4BXXH 1JT8A 1HNWQ 1NJIC 1VQBA 3L7ZC 1PH2A 1QUQA 4YHHL 1PYSB 5FLMG 4DR2Q 3RLFA 4GKKQ 4B3ML 5C4JH 4NXNQ 2Z6KA 4DV6L 2PMZE 1VQNA 2HQLA 2D0PA 3PUZA 2JK8A 3GO5A 4A3CG 5IYBH 4DV3L 5ELOA 3GTPH 4BBRH 2VQEQ 2YTYA 3GD7A 1K73C 4QIWE 2E2IH 4GLXA 3S1MH 5C0XG 3PF4A 4QJFA 1IYJB 4AH6A 3T1HQ 3GTGH 1CKNA 3M9BA 1EWIA 3HOZG 2OCEA 2WAQG 1J6QA 2EIFA 1PH3A 1X55A 3HKZG 4DV7Q 4GNXA 3CD6A 1BVSA 3WWVA 5IE8A 2NVYH 4LFAL 4QGUA 1KAWA 5JJKA 2R7FA 5LMNQ 2DGYA 4A4IA 5FLMH 2HHHQ 2Z6KC 4DR7L 1Q12A 2Q2IA 1JJ2A 2VQFQ 1UE1A 4GN5A 1AH9A 4OWWB 3F2BA 1V43A 2LXJA 3PUYA 2NVQH 3CCQA 4GOPA 3L2PA 2PQAA 5AJ3Q 3CPWA 2ES2A 1PH1A 2UU9L 4JI8Q 4A3CH 3TQYA 3KF6B 4IPHA 1WI5A 3ERSX 3HOZH 3JAMc 4DR6Q 4DUYQ 1PH8A 4GNXC 1PHJA 1K8AC 5HGQA 1B70B 3CC7A 3NELA 1UE6A 4IOCA 2JA7G 1OXXK 4JI5L 1GKHA 1CKNB 4JYAL 3RLOA 4PZ6A 3CCJA 4BBSG 2KBNA 3J80i 3ER0A 3KYHC 1KRTA 4GOPC 2VL6A 2YV5A 1BBWA 4A3KG 2A19A 2UXCL 2ZTDA 1S3OA 1TWCH 4OONA 2F4VL 2WAQE 3S16H 3HKZE 4O2DA 1SE8A 3CCMA 3U50C 1N34Q 1EIYB 1XTDA 3CCEA 3CPFA 3RN2A 2GVBA 2D62A 2YTVA 1YVCA 4R4IA 4R4OA 2UUCQ 2A8VA 3ZJYC 3U58A 4POGA 1DGSA 1QVFA 1J5EL 3M4OH 2PNHA 4L5TA 1UWVA 4RG1A 4HJ8A 2IT1A 1XMQL 1Q7YC 2JA7H 3HOYG 4BBSH 2C35B 5FJ8H 1JMCA 4LF5L 3OTOL 3K8AA 1HZAA 2QGQA 3PIOA 3E9IA 1IZ6A 1Z47A 3DM3A 4A3KH 2JE6I 4X64L 4A3FG 2UXBL 2NN6G 2I5LX 4X62L 1HR0L 2PI2A 2ZM6L 4OO1G 4POFA 3MEFA 4B3TQ 5IY0A 4GN4B 2Y0SG 2R6GA 1X6OA 4HIKA 1WJJA 3AEVA 5M5XH 1N36L 1N32L 4Y7NH 2UXDL 1CSQA 2VZAA 1KL9A 5JJIA 1VQOA 3AFQA 2WFWA 1A0IA 4DV4Q 3J81c 3J7A5 1VCIA 4JV5L 1VQ9A 4HIOA 4JOIA 2CWAA 4UP7A 4A3FH 2CCZA 4NXMQ 5BR8L 2IX0A 4DR4L 3I4MG 1KHIA 2N8NA 2Q2HA 4LUVA 4P71A 1K3RA 1X56A 3UE0A 1Q81C 2KCMA 1E7ZA 2WP8J 2VW9A 3RR5A 4DV1Q 4A3BH 1EQQA 5IP7G 1KXLA 4IFDJ 3CF5A 1E1TA 3F1ZA 4ME3A 4X66Q 3RLNA 4L5SA 4JI3Q 2YTXA 1TWGH 2I5MX 4IJHA 1KQSA 1VQDA 1B7YB 2R7DA 1Y1VG 1HR0W 1VQ5A 1FL0A 4JOIC 3H15A 2Y0SE 1UE5A 2B29A 4ALPA 4DAMA 3I4MH 3EN2A 1HNZL 3NENA 4A3EG 1CUKA 1XMOL 3UDFA 4YCVA 1JJCB 4JI2Q 1OXTA 1VS0A 4DK3C 4DR1L 1IBML 4P72A 5IP7H 1ASZA 1GM5A 2K50A 4X6AH 4LF8Q 1YBYA 4HJ7A 1I6HH 1I94Q 4JI7L 2IY5B 4A3IG 3GTQH 4LWCA 4IOAA 5IWAL 4OWTB 4A75A 1W3SA 4XIGS 2Q2TA 1XPUA 1GVPA 3D0FA 1R9TH 2H5XA 2VS1A 1UE7A 4AYBG 4A3EH 2RHSB 2UUBL 4A3DG 2MFIA 3S1NH 3H3VH 2AWNA 4QL5A 4DV0L 4JI4L 1YHQA 3TS0A 1HNXQ 1SFOH 4DV5L 4PZ7A 4A3IH 2QA4A 3KJOA 1PV4A 1YIJA 3KOJA 4GKJQ 1X3EA 1MIUA 4YWLA 1TWFH 5JEAJ 3HOXG 1FJGL 4IFDI 4IPGA 4LNQA 3G71A 5M3MH 5EAYA 2DUDA 1IBKL 4A3DH 1E1OA 4MTNA 4C3IH 2JA6G 4LFBQ 3CCVA 2RF4A 1PH6A 2BH2A 3K80C 2OWOA 1K0RA 4LFAQ 2UUAL 4DR5Q 2IX1A 4K0KQ 3F2CA 1L1OA 2HIVA 1WFQA 4DV2L 5C3EG 3HOUG 4LF4Q 1VQPA 4DUZQ 4A3MG 4AYBE 2UU9Q 1JJGA 4X65Q 3K0XA 2N49A 3J81j 1Q82C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA A;  1HZC A;  4LFC L;  2NZH A;  2LXK A;  5GAE C;  1QUQ B;  1CKM A;  1OXS C;  2HT1 A;  1HNW L;  3PF5 A;  1BKB A;  1MJC A;  2MNA A;  2JA6 H;  3ULJ A;  4DR2 L;  2XTI A;  1M90 C;  2BA0 A;  1L1O C;  4JI5 Q;  4OX9 Q;  4JYA Q;  4B3R Q;  4NXN L;  3BZK A;  1V1Q A;  4EQ5 A;  1EIF A;  4YCU A;  2K14 A;  4GS3 A;  4L5Q A;  3S24 A;  5C3E H;  3HOU H;  2BA1 A;  1NMG A;  1Q1B A;  3ULP A;  3ICE A;  2YYZ A;  2VQE L;  4A76 A;  4A3M H;  5FJ8 G;  1P8L A;  1WCM G;  1N8R C;  3PO2 H;  3W1G A;  3T1H L;  3D31 A;  5LMU Q;  3K7A H;  4GNX B;  2ALY B;  3OW2 A;  4DNI A;  1XNR L;  1HJP A;  5FLX c;  2CWP A;  4JCV E;  4R4C A;  5HY6 A;  4C3J H;  4DV7 L;  3KDF A;  4DR3 Q;  4OXP A;  1NTG A;  1NBW A;  1SLJ A;  3UE1 A;  1XMQ Q;  4JI6 Q;  2HHH L;  3Q8D A;  4GOP B;  4GN3 B;  2PQA B;  1E22 A;  2VQF L;  1EYG A;  4HJA A;  2OTL A;  3OTO Q;  2GN5 A;  2JA5 G;  1RIP A;  2AMC B;  2MQH A;  5AJ3 L;  3KFU A;  3NBH B;  3PUV A;  3G48 A;  4C2M H;  5IT9 c;  1VQM A;  1Y1W G;  2UXB Q;  1WCM H;  3HOW G;  4X62 Q;  4UP8 A;  2CFM A;  4DR6 L;  4DUY L;  1PA6 A;  1VQ4 A;  2R93 H;  1VQ8 A;  2CQO A;  4GLV B;  4LF9 Q;  4JC0 A;  3A74 A;  3GTJ H;  4LF6 Q;  4P74 A;  1A62 A;  4JI0 Q;  4LF7 Q;  4A3B G;  2ASB A;  3FKI G;  1IL2 A;  2JEA I;  2OQ0 A;  2JA5 H;  1QZG A;  1H95 A;  4KI0 A;  1TWH H;  5H1S E;  3I56 A;  1X65 A;  1IBL L;  4JI1 Q;  3RNU A;  1Q46 A;  1Y1W H;  1N34 L;  2LSS A;  1PH4 A;  3HOW H;  5JJL A;  1JE5 A;  4LW1 A;  3PV0 A;  1VQF A;  5C0X I;  2CKZ B;  1D8L A;  1MKH A;  5LMN W;  2UUC L;  1VQK A;  1NMF A;  4B3S Q;  1I3Q H;  2KHI A;  3PSI A;  2AWO A;  3PUX A;  3TEH B;  3HFZ B;  2ZJR A;  1JB7 A;  4JBW A;  3AQQ A;  4UP9 A;  3J80 c;  2BH8 A;  1EOV A;  3KJP A;  3FKI H;  3GTM H;  1LM0 A;  3K81 C;  5M3F G;  1VQH A;  1PH9 A;  1YZ6 A;  1WOC A;  3A5U A;  1N33 L;  3S1R H;  4B3T L;  3CW2 C;  4BA1 I;  1PH5 A;  2F3I A;  2I5H A;  3F8T A;  1XMO Q;  2VUM G;  4DR1 Q;  5C44 G;  3GTK H;  1IBM Q;  2A1A A;  4FDB A;  4YY3 Q;  2ATW A;  4YWK A;  3U4V A;  1K9M C;  1LTL A;  1QVC A;  3W1B A;  4JBM A;  1VQG A;  4DV4 L;  4JI7 Q;  3FP9 A;  4KHP L;  2XGT A;  1CSP A;  3AYH B;  3T1Y Q;  3I4O A;  1G29 1;  1MJE A;  2E5L Q;  4NXM L;  1YEZ A;  5M3F H;  1I50 H;  4AQY Q;  4HJ9 A;  4QY7 A;  4HID A;  2K5H A;  3CXC A;  5M5Y H;  1U0L A;  1YI2 A;  3I55 A;  2JA9 A;  3BJU A;  2VUM H;  5C44 H;  1Y14 B;  3G4S A;  1PH7 A;  3BZC A;  4X66 L;  1V9P A;  2EXD A;  2B63 G;  4TVA B;  4JI3 L;  4DKA C;  4DV0 Q;  5M3M G;  1VQC A;  3CP0 A;  4JI4 Q;  1VQ7 A;  1N9W A;  1IXR A;  4JBK A;  3UDG A;  3CCS A;  4BY1 G;  1YIT A;  3M4Q A;  1Q8K A;  4YHH Q;  3I2Z A;  1D7Q A;  3E9H A;  4KLK A;  4JBJ A;  3STB D;  4B3M Q;  1FVI A;  2NN6 I;  4PMW A;  3A5Z B;  4DV6 Q;  2N3S A;  4OO1 I;  4A93 G;  1G51 A;  2EQS A;  1S72 A;  4JI2 L;  4IPC A;  2N78 A;  2JJQ A;  3NEM A;  3RZD H;  1GD7 A;  4DV3 Q;  1S40 A;  2B63 H;  1E24 A;  1QVG A;  3GDE A;  4LF8 L;  3CCR A;  4A3G G;  2IHE A;  2R92 G;  2JQO A;  3PUW A;  3JAM i;  1I94 L;  5JEA G;  1WYD A;  3K7U C;  4BY1 H;  1VQA A;  4TQU S;  3IRB A;  1LYL A;  2B3G A;  3SGI A;  1HH2 P;  3CAM A;  2KCT A;  4XTC S;  4DAY B;  2R7Z H;  3GTL H;  4NPS A;  4DR7 Q;  2PI2 E;  3KLW A;  1HZ9 A;  1UEB A;  2YU9 H;  3M7N A;  4A93 H;  1KRS A;  2ZTC A;  4NB3 A;  3PO2 G;  1CKO A;  3CC2 A;  1XNQ L;  4PG3 A;  1AE3 A;  2OQK A;  4A3G H;  2K52 A;  2R92 H;  4KHZ A;  2D0O A;  4A3J G;  1HNX L;  3KF6 A;  5IYD G;  1OTC A;  5IP9 G;  1C9O A;  4GKJ L;  2WB1 G;  1XJV A;  3U4Z A;  5C0X J;  1L0W A;  4IO9 A;  2E8G A;  4GKK L;  3TRZ A;  3CC4 A;  3OYY A;  4JG2 A;  2RCN A;  2OTJ A;  1B8A A;  5K36 G;  1XNR Q;  4UY8 C;  1G6P A;  2UXC Q;  4LFB L;  3PIP A;  2F4V Q;  1L1O B;  5IYC G;  3A0J A;  3H3V I;  1SRO A;  3HKS A;  2ZTE A;  4J15 A;  1YHA A;  3KF8 B;  4DR5 L;  3S1Q H;  3CQZ H;  3LGJ A;  4C3H H;  3I4N G;  2R93 G;  5M5W H;  4A3J H;  1YJN A;  1ASY A;  4IPD A;  1VQE A;  1TWA H;  4O0A A;  4EX5 A;  2ID0 A;  5IP9 H;  2QEX A;  5IYD H;  1J5E Q;  4PZ8 A;  4DUZ L;  4LF4 L;  5LMN L;  1X9N A;  4OWX B;  1FGU A;  4X65 L;  2ZJP A;  3JC6 6;  2NVT H;  3M3Y H;  4LF5 Q;  3UDI A;  3J81 i;  4WJ4 A;  4WJ3 M;  3RN5 A;  4AIM A;  3CCL A;  4YCW A;  4APV A;  4X64 Q;  4JI8 L;  5GAD C;  3BU2 A;  1SRU A;  1HR0 Q;  5IYC H;  2ZM6 Q;  2I0Q A;  4B3R L;  2AKW B;  2WB1 E;  1EQR A;  2KHJ A;  4OX9 L;  3TS2 A;  3B6Y A;  2MO0 A;  1P16 A;  2K4K A;  3AFP A;  3I4N H;  1K83 H;  1N36 Q;  1N32 Q;  2UXD Q;  4Y52 H;  4HIM A;  3TRE A;  1C7Y A;  1IBL Q;  5LMU L;  3KDF B;  2KEN A;  2RHQ B;  1NY4 A;  2NVX H;  3EIV A;  1VQ6 A;  4JV5 Q;  2HIX A;  4DR3 L;  5J3B A;  3PGZ A;  2IHF A;  5GQO A;  1KIX A;  1I5F A;  5BR8 Q;  4DR4 Q;  3ULL A;  1YJW A;  4JI6 L;  4H02 A;  1E3P A;  1O7I A;  4R4Q A;  4R4T A;  2GVA A;  1SN8 A;  2V1C C;  2VY3 A;  1T9H A;  3M4P A;  3M85 A;  1A63 A;  3PCO B;  1SR3 A;  4P73 A;  5DLQ E;  1SMX A;  2FXQ A;  1VQI A;  1QZH A;  1N33 Q;  2Z0S A;  4YWM A;  4L5R C;  1PVO A;  3S17 H;  3DLL A;  3UDX A;  4LF9 L;  4IFD G;  1KD1 C;  4LF6 L;  3HOY H;  4JI0 L;  3PO3 G;  5C4X G;  1HNZ Q;  4LF7 L;  2ZJQ A;  2MO1 A;  1XNQ Q;  1OXV A;  4MZ9 A;  1VQL A;  1A8V A;  5GRO A;  4LUO A;  1X54 A;  3S2D H;  1YJ9 A;  3HOV G;  1C0A A;  4JI1 L;  3F2D A;  1W2B A;  4DPG A;  2E2J H;  3L0O A;  3G6E A;  1Q1E A;  2JA8 G;  2L15 A;  1AE2 A;  4B3S L;  5IWA Q;  3GTO H;  3S2H H;  4IJL A;  2F52 A;  5C4X H;  3CCU A;  3PO3 H;  4A3L H;  4BY7 G;  4DV1 L;  2UUB Q;  3EBE A;  1U5K A;  4MNO A;  5GAG C;  1EUJ A;  4BA2 I;  4LUZ A;  1VQJ A;  3S14 H;  1M1K C;  3HOV H;  1KC8 C;  1YHB A;  1EFW A;  1OXU A;  2E2H H;  1XPO A;  3HOX H;  2NZO A;  4DV5 Q;  3H0G G;  5ELN A;  2JA8 H;  1Z9F A;  2R7Z G;  1K8G A;  1LUZ A;  4UPA A;  3CME A;  4YY3 L;  1PYB A;  3FHW A;  1GO3 E;  3STB C;  1XPR A;  1FJG Q;  4BXX G;  5GAH C;  3MXN B;  4BY7 H;  1TXY A;  1IBK Q;  2Q2U A;  3T1Y L;  1Y1V H;  1PFS A;  3RZO H;  1HZB A;  4P75 A;  4RMF A;  2E5L L;  2K5V A;  4AQY L;  4R1J A;  2VNU D;  1YNX A;  3S15 H;  4HJ5 A;  2UUA Q;  3I7F A;  4K0K L;  5E7N A;  4DV2 Q;  1L2F A;  4QQB X;  1X3F A;  2AHO B;  2K5N A;  3H0G H;  4GLA C;  4DK6 C;  5IYB G;  2K75 A;  3W5O A;  1NE3 A;  1RL2 A;  1X3G A;  4BBR G;  3VDY A;  1Q86 C;  4A3L G;  4KHP Q;  3E0E A;  1BBU A;  2JEB I;  3J7Z C;  4LFC Q;  4BXX H;  1JT8 A;  1HNW Q;  1NJI C;  1VQB A;  3L7Z C;  1PH2 A;  1QUQ A;  4YHH L;  1PYS B;  5FLM G;  4DR2 Q;  3RLF A;  4GKK Q;  4B3M L;  5C4J H;  4NXN Q;  2Z6K A;  4DV6 L;  2PMZ E;  1VQN A;  2HQL A;  2D0P A;  3PUZ A;  2JK8 A;  3GO5 A;  4A3C G;  5IYB H;  4DV3 L;  5ELO A;  3GTP H;  4BBR H;  2VQE Q;  2YTY A;  3GD7 A;  1K73 C;  4QIW E;  2E2I H;  4GLX A;  3S1M H;  5C0X G;  3PF4 A;  4QJF A;  1IYJ B;  4AH6 A;  3T1H Q;  3GTG H;  1CKN A;  3M9B A;  1EWI A;  3HOZ G;  2OCE A;  2WAQ G;  1J6Q A;  2EIF A;  1PH3 A;  1X55 A;  3HKZ G;  4DV7 Q;  4GNX A;  3CD6 A;  1BVS A;  3WWV A;  5IE8 A;  2NVY H;  4LFA L;  4QGU A;  1KAW A;  5JJK A;  2R7F A;  5LMN Q;  2DGY A;  4A4I A;  5FLM H;  2HHH Q;  2Z6K C;  4DR7 L;  1Q12 A;  2Q2I A;  1JJ2 A;  2VQF Q;  1UE1 A;  4GN5 A;  1AH9 A;  4OWW B;  3F2B A;  1V43 A;  2LXJ A;  3PUY A;  2NVQ H;  3CCQ A;  4GOP A;  3L2P A;  2PQA A;  5AJ3 Q;  3CPW A;  2ES2 A;  1PH1 A;  2UU9 L;  4JI8 Q;  4A3C H;  3TQY A;  3KF6 B;  4IPH A;  1WI5 A;  3ERS X;  3HOZ H;  3JAM c;  4DR6 Q;  4DUY Q;  1PH8 A;  4GNX C;  1PHJ A;  1K8A C;  5HGQ A;  1B70 B;  3CC7 A;  3NEL A;  1UE6 A;  4IOC A;  2JA7 G;  1OXX K;  4JI5 L;  1GKH A;  1CKN B;  4JYA L;  3RLO A;  4PZ6 A;  3CCJ A;  4BBS G;  2KBN A;  3J80 i;  3ER0 A;  3KYH C;  1KRT A;  4GOP C;  2VL6 A;  2YV5 A;  1BBW A;  4A3K G;  2A19 A;  2UXC L;  2ZTD A;  1S3O A;  1TWC H;  4OON A;  2F4V L;  2WAQ E;  3S16 H;  3HKZ E;  4O2D A;  1SE8 A;  3CCM A;  3U50 C;  1N34 Q;  1EIY B;  1XTD A;  3CCE A;  3CPF A;  3RN2 A;  2GVB A;  2D62 A;  2YTV A;  1YVC A;  4R4I A;  4R4O A;  2UUC Q;  2A8V A;  3ZJY C;  3U58 A;  4POG A;  1DGS A;  1QVF A;  1J5E L;  3M4O H;  2PNH A;  4L5T A;  1UWV A;  4RG1 A;  4HJ8 A;  2IT1 A;  1XMQ L;  1Q7Y C;  2JA7 H;  3HOY G;  4BBS H;  2C35 B;  5FJ8 H;  1JMC A;  4LF5 L;  3OTO L;  3K8A A;  1HZA A;  2QGQ A;  3PIO A;  3E9I A;  1IZ6 A;  1Z47 A;  3DM3 A;  4A3K H;  2JE6 I;  4X64 L;  4A3F G;  2UXB L;  2NN6 G;  2I5L X;  4X62 L;  1HR0 L;  2PI2 A;  2ZM6 L;  4OO1 G;  4POF A;  3MEF A;  4B3T Q;  5IY0 A;  4GN4 B;  2Y0S G;  2R6G A;  1X6O A;  4HIK A;  1WJJ A;  3AEV A;  5M5X H;  1N36 L;  1N32 L;  4Y7N H;  2UXD L;  1CSQ A;  2VZA A;  1KL9 A;  5JJI A;  1VQO A;  3AFQ A;  2WFW A;  1A0I A;  4DV4 Q;  3J81 c;  3J7A 5;  1VCI A;  4JV5 L;  1VQ9 A;  4HIO A;  4JOI A;  2CWA A;  4UP7 A;  4A3F H;  2CCZ A;  4NXM Q;  5BR8 L;  2IX0 A;  4DR4 L;  3I4M G;  1KHI A;  2N8N A;  2Q2H A;  4LUV A;  4P71 A;  1K3R A;  1X56 A;  3UE0 A;  1Q81 C;  2KCM A;  1E7Z A;  2WP8 J;  2VW9 A;  3RR5 A;  4DV1 Q;  4A3B H;  1EQQ A;  5IP7 G;  1KXL A;  4IFD J;  3CF5 A;  1E1T A;  3F1Z A;  4ME3 A;  4X66 Q;  3RLN A;  4L5S A;  4JI3 Q;  2YTX A;  1TWG H;  2I5M X;  4IJH A;  1KQS A;  1VQD A;  1B7Y B;  2R7D A;  1Y1V G;  1HR0 W;  1VQ5 A;  1FL0 A;  4JOI C;  3H15 A;  2Y0S E;  1UE5 A;  2B29 A;  4ALP A;  4DAM A;  3I4M H;  3EN2 A;  1HNZ L;  3NEN A;  4A3E G;  1CUK A;  1XMO L;  3UDF A;  4YCV A;  1JJC B;  4JI2 Q;  1OXT A;  1VS0 A;  4DK3 C;  4DR1 L;  1IBM L;  4P72 A;  5IP7 H;  1ASZ A;  1GM5 A;  2K50 A;  4X6A H;  4LF8 Q;  1YBY A;  4HJ7 A;  1I6H H;  1I94 Q;  4JI7 L;  2IY5 B;  4A3I G;  3GTQ H;  4LWC A;  4IOA A;  5IWA L;  4OWT B;  4A75 A;  1W3S A;  4XIG S;  2Q2T A;  1XPU A;  1GVP A;  3D0F A;  1R9T H;  2H5X A;  2VS1 A;  1UE7 A;  4AYB G;  4A3E H;  2RHS B;  2UUB L;  4A3D G;  2MFI A;  3S1N H;  3H3V H;  2AWN A;  4QL5 A;  4DV0 L;  4JI4 L;  1YHQ A;  3TS0 A;  1HNX Q;  1SFO H;  4DV5 L;  4PZ7 A;  4A3I H;  2QA4 A;  3KJO A;  1PV4 A;  1YIJ A;  3KOJ A;  4GKJ Q;  1X3E A;  1MIU A;  4YWL A;  1TWF H;  5JEA J;  3HOX G;  1FJG L;  4IFD I;  4IPG A;  4LNQ A;  3G71 A;  5M3M H;  5EAY A;  2DUD A;  1IBK L;  4A3D H;  1E1O A;  4MTN A;  4C3I H;  2JA6 G;  4LFB Q;  3CCV A;  2RF4 A;  1PH6 A;  2BH2 A;  3K80 C;  2OWO A;  1K0R A;  4LFA Q;  2UUA L;  4DR5 Q;  2IX1 A;  4K0K Q;  3F2C A;  1L1O A;  2HIV A;  1WFQ A;  4DV2 L;  5C3E G;  3HOU G;  4LF4 Q;  1VQP A;  4DUZ Q;  4A3M G;  4AYB E;  2UU9 Q;  1JJG A;  4X65 Q;  3K0X A;  2N49 A;  3J81 j;  1Q82 C; 
#chains in the Genus database with same CATH topology
 4F7X A;  4DAV A;  2MPM A;  3NHH A;  3CMA A;  5GAE C;  2HT1 A;  3F2U A;  4OEM B;  4CJ0 B;  5IGC A;  1HNW L;  1MJC A;  5JVG 3;  2BA0 A;  4JYA Q;  1PTO B;  1A2U A;  4YCU A;  4GS3 A;  3E5S A;  2EJM A;  3BVM A;  2KCN A;  2VQE L;  1EY7 A;  3TP8 A;  3PO2 H;  2K32 A;  3FKI B;  1D5M C;  1HJP A;  5ELF A;  5FLX c;  4DV7 L;  1KLG D;  1XMQ Q;  1ROD A;  4KY7 A;  2HHH L;  2F3V A;  3Q8D A;  1JR0 D;  3BVZ A;  3OTO Q;  3GTK B;  1KNA A;  2MQH A;  5AJ3 L;  3PUV A;  4KTA A;  1VQM A;  2Z4I A;  4X62 Q;  2KQ3 A;  4UP8 A;  4QF4 A;  1V1P A;  1IW7 D;  3T51 B;  3Q24 A;  1VQ4 A;  2L4N A;  1TS3 A;  5M3F B;  3GTJ H;  4P74 A;  1A62 A;  1STA A;  1BCP D;  4JI0 Q;  4LF7 Q;  5J1Z A;  3FKI G;  2JA5 H;  1QZG A;  5H1S E;  1IBL L;  5KIX A;  3T53 B;  5C0X I;  1VQF A;  4N9P A;  5LMN W;  1D8L A;  1VQK A;  1ZKO A;  4B3S Q;  2LFN A;  1EQV A;  2KHI A;  2ZJR A;  3J80 c;  3KJP A;  1DXM A;  2LMC B;  2B63 B;  4K8I A;  5M3F G;  1YZ6 A;  1ET6 A;  2EYO A;  3F8T A;  2ZT9 C;  3V96 A;  3H91 A;  2A1A A;  2OT2 A;  4FDB A;  1U4R A;  3VYT A;  3U4V A;  1LTL A;  1QVC A;  3W1B A;  4B08 A;  4Z9C B;  4JI7 Q;  2XGT A;  2RKS A;  3RUZ A;  3I4O A;  1MJE A;  4K6L A;  3MXN A;  1I50 H;  2EY6 A;  4QY7 A;  2K5H A;  2KCC A;  2VUM H;  4KD4 A;  2N55 A;  1PH7 A;  2B63 G;  1F2M A;  3BZC A;  4KKS A;  2EXD A;  4KJN A;  4X66 L;  3TP7 A;  1PZJ D;  3KBG A;  3CP0 A;  4JI4 Q;  1N9W A;  1K0S A;  4JBK A;  1JWM D;  5I4D A;  1DZ1 A;  3STB D;  2F0D A;  4B3M Q;  1PFB A;  4PMW A;  4DV6 Q;  4OO1 I;  2N3S A;  1HQR D;  1S72 A;  2N78 A;  1E24 A;  4LF8 L;  3R3O A;  3CCR A;  2JQO A;  4G7Z C;  1NAP A;  1VQA A;  3MFY A;  3OSO A;  4XTC S;  2PZW A;  2PI2 E;  1HZ9 A;  1K83 B;  1KRS A;  3NWT A;  3PO2 G;  2K01 A;  1AE3 A;  4A3G H;  4O42 A;  2NVX B;  1OTC A;  4GKJ L;  4IUU A;  3U4Z A;  1AZP A;  4IO9 A;  3MAQ A;  3OYY A;  1HXY D;  2OTJ A;  3MVV A;  4JVZ A;  1QE6 A;  4FO2 A;  4LFB L;  2DN8 A;  1SRO A;  5C3W A;  1G6Z A;  5D3D A;  2QEX A;  1TWA H;  2L5T A;  4EX5 A;  1J5E Q;  4PZ8 A;  4PNY A;  4K2L A;  2ZJP A;  3M3Y H;  5CYU A;  4K5V A;  3J81 i;  4WJ4 A;  4KV6 A;  3RN5 A;  1RTN A;  4YCW A;  1LT6 D;  3I8Z A;  5C5M A;  4EQP A;  4X64 Q;  4JI8 L;  5T1I A;  5JJZ A;  5GAD C;  4ZUI A;  5JAV A;  4B3R L;  2WB1 E;  2KHJ A;  1KDA A;  2I46 A;  2MO0 A;  1P16 A;  3AFP A;  3I4N H;  1N36 Q;  1IW7 C;  2UXD Q;  3KBX A;  3S2H B;  4G4K A;  4I65 A;  1A15 A;  3PO3 B;  2O2L D;  1BCP C;  3KDF B;  1X32 A;  4OEL B;  2RHQ B;  1NY4 A;  5J22 A;  4DR3 L;  1KIX A;  5KNB A;  1IYV A;  4DR4 Q;  1H9S B;  3ULL A;  4JI6 L;  5IOC A;  3TME A;  5FOB B;  1GUG A;  1S5F D;  1HFG A;  1SN8 A;  1SJE D;  1DOK A;  2JA8 B;  1HFN A;  2V1C C;  2WAC A;  4MHE A;  4FF2 A;  2D9U A;  4P73 A;  2FXQ A;  2Z0S A;  4IUP A;  1PVO A;  4FF1 A;  3DLL A;  3H09 A;  1YNJ C;  4LF9 L;  4IFD G;  2EVB A;  1AZQ A;  3S15 B;  3T13 A;  2ZXR A;  3PO3 G;  1HNZ Q;  1XNQ Q;  1OXV A;  1F2Z A;  1DOL A;  3UI2 A;  5A2Q L;  2PMZ B;  3L0O A;  4DNT B;  2JA8 G;  2L15 A;  4F88 A;  3FEW X;  1D5X C;  5I9O A;  5C4J B;  4F87 A;  3H94 A;  5C4X H;  3CCU A;  5IGG A;  2F0F A;  1SMY D;  2UUB Q;  3EVQ A;  4EVO A;  1ENA A;  3VYR A;  1XWE A;  5GAG C;  1TS4 A;  3PIP 3;  1M1K C;  1XX8 A;  3GTG B;  4ZAI A;  1YHB A;  1KC8 C;  1V1O A;  2CQA A;  3VR6 A;  2N88 A;  1Z9F A;  1LUZ A;  1GO3 E;  3STB C;  1FJG Q;  3K6O A;  2KJX A;  1TXY A;  1XXG A;  3RZO H;  4P75 A;  1SNQ A;  4AQY L;  4R1J A;  3HOZ B;  4B9W A;  3TZU A;  4ZQ3 A;  2WAQ B;  3HKZ B;  1X3F A;  2K5D A;  3R2I A;  4DK6 C;  1E2Z A;  5IYB G;  1RL2 A;  3EJI A;  4E6I A;  4FNF A;  5DNF A;  4LFC Q;  5TSS A;  1PH2 A;  1BOS A;  5IGE A;  4DR2 Q;  1GUW A;  2KHS A;  4QB4 A;  2FIN B;  4LAA A;  4KN7 C;  4A3C G;  3GTP H;  4BBR H;  1K8M A;  4A3L H;  1PMR A;  2RA4 A;  3S1M H;  2CW0 D;  1LTT D;  4QJF A;  3HOZ G;  4Q0F A;  2Z4H A;  2OCE A;  2WAQ G;  4A3K B;  3HKZ G;  4U68 A;  1BVS A;  1FNU A;  1PDQ A;  4LFA L;  5JJK A;  4A4I A;  5FLM H;  2NYZ D;  2Z6K C;  3I3C A;  1JJ2 A;  5A2Q E;  1UE1 A;  4GN5 A;  1R4Q B;  5G3L D;  2R61 A;  4Y7N B;  4GOP A;  3TSS A;  1GUS A;  4ZYS A;  3TQY A;  1KDC A;  3QOJ A;  3MZ5 A;  4L8J A;  4DR6 Q;  4DUY Q;  2B2U C;  1PHJ A;  1B70 B;  3I70 A;  1OXX K;  1HRJ A;  1GKH A;  3CCJ A;  1NR2 A;  2XIW A;  2KBN A;  3J80 i;  3KYH C;  4KY5 A;  3W2D A;  3E3X A;  1KRT A;  2YV5 A;  1EOT A;  1BBW A;  4A3K G;  2A19 A;  2SNS A;  4OON A;  5HUR A;  4O2D A;  1N34 Q;  3U50 C;  2JN4 A;  3OHX C;  3RN2 A;  2D62 A;  2A8V A;  3ZJY C;  3M4O H;  1A2T A;  3ERO A;  4L5T A;  1UWV A;  1BCP B;  1Q7Y C;  2C35 B;  5FJ8 H;  4LF5 L;  4XYO A;  2C5C A;  2QGQ A;  1IZ6 A;  1Z47 A;  2G5D A;  2H4O A;  2NN6 G;  3VR4 A;  1TVX A;  3MEF A;  4B3T Q;  4QCL A;  4GN4 B;  4XDX A;  1KTK A;  3AEV A;  5M5X H;  1N32 L;  4ZUJ A;  4U67 3;  3MEH A;  1GJX A;  4HN7 A;  2FHT A;  4ZK9 B;  3AFQ A;  1A0I A;  3TBI B;  4RKL A;  4S3S A;  2OEO A;  2CCZ A;  1PRT F;  5I9P A;  2LY7 A;  5BR8 L;  2IX0 A;  2L12 A;  4UDU C;  2N8N A;  4P71 A;  4LUV A;  1U9R A;  1K3R A;  4A3I B;  2WP8 J;  3C1F A;  3MWY W;  1LV9 A;  4A3B H;  4DV1 Q;  1EQQ A;  4IFD J;  3CF5 A;  1TR5 A;  5A35 A;  3RLN A;  3TP5 A;  5M3M B;  1TWG H;  2I5M X;  4V0B A;  2F0G A;  1DOM A;  2R7D A;  1SMY C;  3HP3 A;  1ILP A;  2Y0S E;  1UE5 A;  1Q3L A;  3I4M H;  3DEO A;  3Q0A A;  2WIN B;  1EY9 A;  4YCV A;  5EPK A;  1EWC A;  1GM5 A;  4X6A H;  2VXW A;  3MXU A;  5EPL A;  3HOX B;  5HGT A;  1I94 Q;  5I2X A;  2IY5 B;  4A3I G;  2JA6 B;  2F0T A;  4IOA A;  1FNV A;  4OWT B;  5C5L A;  1W3S A;  1EQT A;  1R9T H;  2X69 A;  4HTH A;  2J0T D;  1CA5 A;  1UE7 A;  1PFM A;  4AYB G;  4LJZ C;  3JAM E;  3H3V H;  1O80 A;  2K05 A;  3K7A B;  2EJG C;  4MTK A;  5CV9 A;  1YHQ A;  4C3J B;  4A3J B;  2DY8 A;  4KY6 A;  4TKO B;  2QA4 A;  1X3E A;  1QOH A;  4RH6 A;  2RDF A;  1MIU A;  2F0I A;  3HOX G;  3C1E A;  1DM0 B;  5LHY 1;  1EU3 A;  5EAY A;  3VA7 A;  2DUD A;  4MTN A;  4C3I H;  2JA6 G;  1PH6 A;  3MTS A;  5C6A A;  2CW0 C;  2L55 A;  4DR5 Q;  2UUA L;  2IX1 A;  1L1O A;  2B2T A;  2KEC A;  1VQP A;  3T4A C;  2B2Y C;  2DNC A;  4X65 Q;  3K0X A;  1HZC A;  3OIQ A;  4C3J G;  1WTQ A;  1QUQ B;  1CKM A;  1OXS C;  2B2W A;  3PF5 A;  1TWH B;  1ILQ A;  1LAB A;  1SYB A;  2XTI A;  1EYC A;  4OX9 Q;  1S5C D;  4EQ5 A;  3S24 A;  5JVH 3;  1Q1B A;  3ULP A;  3ICE A;  1LO5 D;  4X3K A;  4A76 A;  1B9M A;  5FJ8 G;  4ILW A;  5EPJ A;  3W1G A;  5LMU Q;  2ALY B;  3QR8 A;  1F9Q A;  2E74 C;  3GTM B;  5HY6 A;  3K59 A;  1AFP A;  1BQQ T;  4G57 A;  4GN3 B;  4TRD A;  3A8J E;  2AUJ D;  4RHS A;  1SYF A;  3NBH B;  4C2M H;  5IT9 c;  2L11 A;  3VYU A;  1PYW D;  2E2J B;  1GHJ A;  1PA6 A;  2CQO A;  3K5N A;  4IUQ A;  4JC0 A;  3IFD A;  3K5O A;  4A3B G;  1ICF B;  3HG9 A;  1PRT D;  1IL2 A;  5C44 B;  2OQ0 A;  3C3L A;  4RFB A;  4JI1 Q;  1Q46 A;  2LSS A;  1WTH A;  3GV3 A;  3IKJ A;  1ENC A;  1PTO H;  4JBM A;  2CKZ B;  4B9X A;  1TII D;  3K5M A;  3ND9 A;  1E0B A;  3PSI A;  3TEH B;  4K5X A;  4JBW A;  1LTG D;  3FKI H;  3RZD B;  3C2P A;  4OIK A;  3R2T A;  1WOC A;  2DY7 A;  3A5U A;  1QB5 D;  2XWJ B;  4BA1 I;  4HSV A;  4DR1 Q;  5C44 G;  3GTK H;  3SE0 A;  1JB3 A;  2F0J A;  4CDE C;  1VQG A;  4A93 B;  3FP9 A;  4ZLT F;  1HA6 A;  2E5L Q;  3NP8 A;  5M3F H;  4CKB A;  4HJ9 A;  4HID A;  4CKE A;  3BJU A;  2XRS D;  3BDL A;  4IN3 A;  4TVA B;  4JI3 L;  5D65 A;  4DKA C;  4DAY A;  4RCN A;  1VQC A;  4HED A;  1II3 A;  3UDG A;  1EZ8 A;  4YHH Q;  1SYD A;  1ZXT A;  3I2Z A;  5NUC A;  1STY A;  4JBJ A;  3S1Q B;  2K33 A;  4C3H B;  2HD3 A;  4A93 G;  3X3M A;  4JI2 L;  4IPC A;  2WV6 D;  2XWB B;  2Q8I B;  2B63 H;  4JK1 C;  2B2Y A;  1QVG A;  2F03 A;  5C4H A;  5JEA G;  2BOS A;  5FO7 B;  3VDY A;  3IRB A;  3CAM A;  4DAY B;  1SAP A;  5CV5 A;  4NPS A;  1UEB A;  1BNZ A;  2PZT A;  2HCC A;  1CKO A;  2X6L A;  3CC2 A;  1FR3 A;  4KHZ A;  4C3H G;  2D0O A;  1HNX L;  2J7Z A;  5IYD G;  3L3O C;  1CHQ D;  1UUP A;  1L0W A;  4GKK L;  5CC4 A;  3TRZ A;  5J39 A;  4JG2 A;  2RCN A;  4UY8 C;  2KEE A;  1G6P A;  3PIP A;  2F4V Q;  5IYC G;  3HKS A;  2PW7 A;  4J15 A;  4FYD A;  2F0Q A;  5F2D A;  3S17 B;  2EYH A;  1EY6 A;  4IPD A;  1VQE A;  4O0A A;  3OMC A;  4LF4 L;  4DUZ L;  3QG1 A;  1EYD A;  5LMN L;  3HOY B;  2O4X A;  3JC6 6;  2NVT H;  2ZXO A;  3UDI A;  1MHW C;  4ZRZ A;  4AIM A;  2A6E D;  3CCL A;  4APV A;  4HCE A;  1Z7T A;  4FXD A;  1SRU A;  3H6M A;  2I0Q A;  3TS2 A;  1EQR A;  1HCZ A;  2EJF C;  4DK1 A;  1K83 H;  4Y52 H;  1Z6H A;  4N8X 1;  2MGS A;  1IBL Q;  1ICW A;  3MHB A;  2NVX H;  3ONA B;  1PRT C;  4DN4 M;  5D3I B;  5J3B A;  1Q8I A;  3HOV B;  2L9H A;  2E2D C;  3OW7 A;  4PV1 C;  5GQO A;  1YJW A;  4H02 A;  2E2H B;  1E3P A;  1O7I A;  4IAL A;  2K6A A;  2K03 A;  1D6E C;  3TDQ A;  3M85 A;  1A63 A;  3PCO B;  1SR3 A;  1V1P B;  2ICE C;  4DNR B;  1SMX A;  4YWM A;  3URY A;  4L5R C;  1YNJ D;  2RVL A;  3UDX A;  4FVM A;  1KAB A;  4G7O C;  4RGN A;  4JI0 L;  2F0H A;  5DM6 3;  3FPP A;  2IWH A;  4LF7 L;  4M8A A;  2MO1 A;  1VDZ A;  1VQL A;  3S1N B;  1I4Q A;  1X54 A;  3NQT A;  4BWG B;  1K3B C;  4UAI A;  3HOV G;  3F2D A;  1GUO A;  1EWH A;  1Y8P B;  1JOR A;  3AB9 A;  1HA5 A;  1Q1E A;  4GZY C;  4B3S L;  2RSO A;  4IFD H;  3S2H H;  1LLR D;  2F0U A;  3P75 A;  2F52 A;  3PO3 H;  2AQ2 B;  2Z6B A;  3A7L A;  3VR5 A;  2E2I B;  3J7A V;  4BA2 I;  1VQJ A;  2F0P A;  4DV5 Q;  5ELN A;  2EYP A;  2JA8 H;  1B3A A;  4ZKC B;  1MD2 D;  2A6H D;  3D4R A;  4CDC C;  2NVQ B;  2A74 C;  4C1N I;  3MXN B;  1AW7 A;  3IL8 A;  3N6R A;  4XQQ A;  5L37 A;  1D1K A;  1YNX A;  2EY5 A;  3S15 H;  1EY5 A;  4MN3 A;  1XYI A;  2K5N A;  1NE3 A;  1Q86 C;  3PQI A;  2F0K A;  1MBY A;  4KHP Q;  1STH A;  5CBE E;  1BBU A;  1CTM A;  1G8Z D;  2Z8L A;  3CHB D;  1JT8 A;  1BXT A;  3SEB A;  1TWC B;  2A68 C;  3SK8 A;  3RLF A;  1CQV A;  4B3M L;  5C4J H;  4NXN Q;  2J4X A;  4DV6 L;  1L0X B;  2PMZ E;  3PUZ A;  5IOD A;  4K8J A;  5IYB H;  2Z9H A;  1K73 C;  4BBS B;  5C0X G;  3PF4 A;  3T1H Q;  1NSN S;  1E2V A;  3GTG H;  1EWI A;  2TMP A;  4IUR A;  3NTK A;  4GNX A;  1S5D D;  4KN4 C;  3WWV A;  3CD6 A;  5COY A;  1L0Y B;  3SXH A;  3QWN A;  4IUV A;  2IW3 A;  2B39 A;  2VQF Q;  2JXM B;  1WVL A;  4OWW B;  1V43 A;  3PUY A;  3CCQ A;  2K5W A;  2PQA A;  1JE4 A;  1K28 A;  3CPW A;  1PH1 A;  2ES2 A;  4JI8 Q;  4A3C H;  3K58 A;  1NCV A;  1WI5 A;  1FNW A;  3HOZ H;  3JAM c;  3SDZ A;  5E1F A;  2A6E C;  1K8A C;  1U4L A;  2BDO A;  4IOC A;  3OMG A;  4JI5 L;  3U9O A;  1PXU A;  4PZ6 A;  4BBS G;  4NMZ A;  3ER0 A;  4GOP C;  2O5I C;  3W3A A;  2WAQ E;  4ULL A;  4DXF A;  1EIH A;  1CQF A;  3HKZ E;  1SE8 A;  3CCM A;  3CCE A;  5JPM C;  2K7V A;  3CPF A;  4R4I A;  1STB A;  2UUC Q;  3K0Y A;  4DF7 A;  1J5E L;  4FXK C;  4RG1 A;  4HJ8 A;  1PTO F;  1SYC A;  3TP6 A;  1PRT B;  5FLX L;  4A3K H;  3DM3 A;  1X3P A;  4X64 L;  2UXB L;  1K8O A;  2PI2 A;  4OO1 G;  3GTQ B;  4WFN 3;  3QJY A;  4J6H A;  1X6O A;  2QCP X;  1BDO A;  1M8A A;  1N36 L;  2UXD L;  4Y7N H;  2VZA A;  4KMU C;  1CFM A;  2WKD A;  4A3E B;  3A8I E;  4DV4 Q;  2OF1 A;  3J7A 5;  4WJW A;  3WDN A;  4JOI A;  4UP7 A;  4NXM Q;  3G7L A;  2NN6 H;  4DR4 L;  1KHI A;  1SFO B;  1D1I A;  1ML0 D;  2NZ1 D;  1E7Z A;  3A56 A;  5CMD A;  2VW9 A;  5IP7 G;  4IZ8 A;  3F1Z A;  4ME3 A;  1DD2 A;  1JCK B;  2BDN A;  1LT3 D;  1VQD A;  1B7Y B;  4A3D B;  1JQY D;  1LT4 D;  2DNE A;  2C9O A;  2XN9 C;  4ALP A;  2FMC A;  3EN2 A;  4WRD A;  3J80 L;  1HNZ L;  4A3E G;  1XMO L;  1XNQ L;  1JJC B;  4DK3 C;  5KYI A;  1IBM L;  2QF7 A;  1ONL A;  1OO9 B;  2A6H C;  5KNC A;  4OHJ A;  2FJ2 A;  2TSS A;  1SBB B;  2K04 A;  1UNS A;  1I4H A;  1I4G A;  3SR1 A;  2Q2T A;  3D0F A;  3NXW A;  5C3E B;  2H5X A;  3HOU B;  1KDB A;  1WTP A;  2UUB L;  2B8F A;  4A3D G;  2MFI A;  4P2C B;  4A3M B;  2AWN A;  2KA7 A;  4QUF A;  3KK7 A;  5DM7 3;  4DV0 L;  2XRQ D;  4DAP A;  1ENF A;  3LNN A;  4PZ7 A;  4A3I H;  1VMP A;  1PV4 A;  5FLX E;  1FJG L;  4IPG A;  4LNQ A;  5M3M H;  1J9O A;  2EXZ A;  2NB0 A;  1WCM B;  2XNA C;  4LFA Q;  1ESR A;  4H13 C;  2OWO A;  3F2C A;  3NTH A;  5CV6 A;  5C3E G;  2R93 B;  3HOU G;  3KF8 A;  5C3X A;  4A3M G;  4AYB E;  3HOX H;  4LFC L;  1BKB A;  2MNA A;  2JA6 H;  3ULJ A;  1Y1W B;  4EGV A;  3HOW B;  4DR2 L;  1SJH D;  1L1O C;  2B2T C;  3BZK A;  1HUN A;  1V1Q A;  1B3Q A;  1I3Q B;  1NMG A;  2YYZ A;  1N8R C;  1WCM G;  2A69 D;  3K7A H;  4IUT A;  1WD1 A;  4DNI A;  2B2W C;  1XNR L;  4JCV E;  4RAU C;  4C3J H;  4X3S A;  1PTO D;  5T1G A;  1NTG A;  1NBW A;  3J80 E;  2MP1 A;  4X3T A;  3S1R B;  4GOP B;  1EYG A;  4HJA A;  2OTL A;  2GN5 A;  1B4O A;  3VA5 A;  1RIP A;  1I6V C;  3G48 A;  3NWS A;  2PCF B;  1Y1W G;  3HOW G;  3OOC A;  4DR6 L;  3M4Y A;  3OWE B;  4DUY L;  1MGS A;  1ESF A;  1O78 A;  2A5H A;  3A74 A;  2QEJ C;  3MC0 B;  3MA2 B;  4LF6 Q;  2VB3 X;  5M5Y B;  1I4X A;  4ODG A;  2HDL A;  4KI0 A;  1TWH H;  4V19 0;  1C48 A;  1X65 A;  2F0N A;  1IKL A;  3J7Y W;  1N34 L;  1HUM A;  3KLR A;  5JJL A;  4RGM A;  4LW1 A;  3PV0 A;  1MKH A;  2RQX A;  1NMF A;  2AWO A;  2PW5 A;  3PUX A;  3HFZ B;  3K5L A;  1JB7 A;  4UP9 A;  3AQQ A;  3IAY A;  2BH8 A;  5CV4 A;  1EOV A;  2F0O A;  3HEJ A;  1F9P A;  3GTM H;  1Y8N B;  2NBF A;  1LM0 A;  1PH9 A;  1VQH A;  2SOB A;  3H3V C;  2JSO A;  1N33 L;  4B3T L;  1EEI D;  2D5D A;  1Y69 U;  3CW2 C;  2IPK D;  5E4W C;  1PH5 A;  2F3I A;  2NTS A;  4BY1 B;  4C56 C;  4LK1 C;  5CBA E;  2R7Z B;  3GTL B;  1NNX A;  4YY3 Q;  2ATW A;  5EKI A;  1K9M C;  3SK5 A;  2YU9 B;  3P20 A;  3BDC A;  1A3V A;  1CSP A;  3T1Y Q;  1G29 1;  2F0L A;  1YEZ A;  2B2V A;  1O7Z A;  2R92 B;  1H9J A;  3DM1 A;  3CXC A;  3AMU A;  2D2C C;  1U4M A;  3I55 A;  2IL8 A;  5C44 H;  1Y14 B;  3MXP A;  4CDD C;  3D4D A;  1V9P A;  2AQ3 B;  4FXG C;  5M3M G;  3BYY B;  1VQ7 A;  2PNR C;  1IXR A;  1FGB D;  1AEX A;  1F9R A;  4BY1 G;  1YIT A;  3E6Z X;  1Q8K A;  1D7Q A;  4WOR A;  3E9H A;  4KLK A;  3CQZ B;  5M5W B;  2X6G A;  3A5Z B;  3QB3 A;  2EQS A;  2IJ0 A;  3RZD H;  1GD7 A;  4DV3 Q;  3DHQ A;  2CH4 A;  2EOT A;  1CK1 A;  1QNK A;  1NR4 A;  1S40 A;  5EKK A;  2IHE A;  4XT1 B;  2R92 G;  3PUW A;  3JAM i;  1I94 L;  3VR3 A;  1A6X A;  1LYL A;  3DUZ A;  1HH2 P;  2KCT A;  4LMQ D;  1TQO A;  4TSS A;  4DR7 Q;  3HGB A;  1ZEQ X;  3KLW A;  3M7N A;  5I6W A;  4XQN A;  4A93 H;  2ZTC A;  4K2K A;  4PG3 A;  1KNE A;  2OQK A;  1LAC A;  1SYE A;  2KUM A;  4A3J G;  5JEA H;  3KF6 A;  5IP9 G;  2ENB A;  3EFX D;  4PQX A;  4RGT A;  1DCZ A;  4YIJ A;  3DWQ A;  3CC4 A;  3J7A F;  1G2S A;  5K36 G;  3LX0 A;  2UXC Q;  1L1O B;  4DGZ A;  3A0J A;  2JP1 A;  3H3V I;  5IGB A;  1JWS D;  4DR5 L;  2A69 C;  3S1Q H;  3LGJ A;  4C3H H;  1YJN A;  3QO2 A;  5IYD H;  1PTO C;  2ID0 A;  1X9N A;  4OWX B;  1FGU A;  1MI2 A;  1S5E D;  4X65 L;  4F8M A;  1T5X D;  2NTT A;  3S2D B;  2SEB D;  4FP5 D;  3BU2 A;  1HR0 Q;  5IYC H;  2ZM6 Q;  4OX9 L;  1D2B A;  1EIG A;  2E75 C;  3A7A B;  1VMC A;  1JIC A;  5BN3 A;  3GTO B;  4HIM A;  3TRE A;  1C7Y A;  5LMU L;  2F0E A;  2KEN A;  3FDT A;  1VQ6 A;  4JV5 Q;  2HIX A;  3IFT A;  3S14 B;  3PGZ A;  2IHF A;  1I5F A;  2ZXP A;  4O1N A;  4C1N K;  4R4Q A;  4R4T A;  5ELB A;  1SND A;  2V4D A;  3HRZ C;  3M4P A;  1JOK A;  1R4P B;  3VYS A;  1HTP A;  5DLQ E;  1QZH A;  4BY7 B;  1JOO A;  1QJO A;  1Y1V B;  3S17 H;  3X3N A;  3G6J B;  2RCF A;  3HOY H;  2EYL A;  2ZJQ A;  3H0G B;  2K1B A;  3FPU B;  1A8V A;  3TZD A;  4QUC A;  4LUO A;  1H9R A;  3BYT B;  1YJ9 A;  1Y8O B;  3KUP A;  1JWU D;  4JI1 L;  4DPG A;  2L1B A;  3G6E A;  3ZYY X;  4QIW B;  1AE2 A;  5EBD A;  2VB2 X;  5IWA Q;  4DK0 A;  3EA6 A;  4IJL A;  1FYC A;  1RTO A;  1QIL A;  4BY7 G;  3N52 A;  3EBE A;  4HCS A;  3T16 A;  3VR2 A;  1EUJ A;  3I72 A;  1MSG A;  4XXE A;  3HOV H;  4K5W A;  1EFW A;  1OXU A;  2E2H H;  2FMM A;  2NZO A;  3H0G G;  5C4Z A;  4M1U B;  2NVY B;  3Q22 A;  4UPA A;  3CME A;  3CU7 A;  1S5B D;  3FHW A;  4R8I A;  3KLS A;  4BXX G;  5GAH C;  4CBV A;  1IBK Q;  2HQE A;  1LTS D;  2RBM A;  4RMF A;  4UHV A;  2E5L L;  2K5V A;  2VNU D;  4HJ5 A;  1QWY A;  2HCI A;  3LWE A;  3DWP A;  4DV2 Q;  1L2F A;  4QQB X;  3I73 A;  2AHO B;  4GLA C;  1EU4 A;  3W5O A;  1X3G A;  3E0E A;  4NW2 A;  1HNW Q;  2A68 D;  3L7Z C;  3WOF A;  3S16 B;  4YHH L;  1PYS B;  1EYA A;  4JPB W;  4GKK Q;  1A3T A;  2E76 C;  1EY0 A;  1VQN A;  4CJ1 B;  4PMC A;  3GO5 A;  2JA7 B;  3RD4 A;  5ELO A;  2VQE Q;  2E2I H;  3GD7 A;  1EFI D;  4GLX A;  1IYJ B;  4AH6 A;  3M9B A;  1SE4 A;  1J6Q A;  2EIF A;  3EQL C;  1X55 A;  4DV7 Q;  2Z1C A;  1KAW A;  1STE A;  5LMN Q;  5CV7 A;  2DGY A;  2HHH Q;  4K0K L;  1AH9 A;  3F2B A;  2LXJ A;  2NVQ H;  2DJG C;  5AJ3 Q;  2UU9 L;  4KD3 A;  4H7B A;  5C0X H;  1ZYR D;  1PH8 A;  4GNX C;  4A3F B;  2MUY A;  2WKC A;  4KKU A;  2JA7 G;  2EDG A;  1GUN A;  4JYA L;  3ND8 A;  3QIA A;  1O7Y A;  4OIJ A;  2M9V A;  1S3O A;  1TWC H;  2QIL A;  2DJF C;  4RKB A;  4KHV A;  2F4V L;  4ZCK A;  3PMF A;  4N8F A;  3BVG A;  1YVC A;  4POG A;  1CZG A;  2XSC A;  1QVF A;  3QOL A;  2PNH A;  1XMQ L;  3HOY G;  1BO0 A;  2IT1 A;  1XTC D;  4BBS H;  1JMC A;  3SVM A;  3OTO L;  3R93 A;  3E9I A;  1J8I A;  2JE6 I;  4A3F G;  1F2Y A;  2ICI A;  2I5L X;  4X62 L;  1HPC A;  1RD9 D;  1I6H B;  1SNC A;  4X3U A;  5IY0 A;  2R6G A;  2KOL A;  1WJJ A;  3GV6 A;  4QMG A;  5EKL A;  5IT9 L;  2MJ8 A;  1KL9 A;  3A54 A;  3NUC A;  1RDP D;  1VQO A;  2WFW A;  3TN2 A;  4RHR A;  1VCI A;  4HIO A;  2RDG A;  4HSP A;  4OO1 H;  2MHV A;  1KXL A;  1E1T A;  4X66 Q;  4L5S A;  1TWF B;  5EJW A;  2QW7 A;  3J81 L;  5IIF A;  2YTX A;  3R8B A;  4IJH A;  1VQ5 A;  1FL0 A;  3BS1 A;  4HAE A;  4JOI C;  4I7A A;  3H15 A;  3DMU A;  3OIP A;  4NKL A;  4RGO S;  4DAM A;  3LWU A;  3NQI A;  3NEN A;  3UDF A;  1OXT A;  1H9K A;  5IP7 H;  3BZD B;  1ASZ A;  2EPB A;  4LF8 Q;  4HJ7 A;  3CRK C;  4IUN A;  4JI7 L;  2Q8R E;  4EQN A;  3GTQ H;  1SNP A;  1O7L A;  2QDL A;  4A75 A;  1PZK D;  1XPU A;  1GVP A;  1RHP A;  2VS1 A;  2HUG A;  4A3E H;  4PMB A;  3PO2 B;  1EY8 A;  2OXP A;  4JI4 L;  1JC7 A;  3DXJ C;  3TS0 A;  1SFO H;  2KED A;  4DV5 L;  3KJO A;  2H1E A;  3KOJ A;  1YIJ A;  4GKJ Q;  3L9A X;  4DXG A;  4YWL A;  5JEA J;  4IFD I;  2NVT B;  1TU2 B;  3PIO 3;  4A3D H;  1T5E A;  4LFB Q;  2RF4 A;  2BH2 A;  2SDF A;  3NPP A;  1K0R A;  2QDB A;  5IT9 E;  4CJ2 C;  1SNO A;  1B50 A;  3GTJ B;  1JOQ A;  3SK6 A;  2N49 A;  2M00 A;  1F9S A;  4KHP L;  3J81 j;  1RJT A;  3SHL A;  2NZH A;  2LXK A;  3P7J A;  4DA2 A;  2BE5 D;  3NE5 B;  2JA5 B;  1DYQ A;  1PZI D;  2PO4 A;  1M90 C;  4JI5 Q;  4B3R Q;  3RMH A;  2NUC A;  4NXN L;  2PQE A;  1EIF A;  1ZYR C;  2K14 A;  4L5Q A;  5C3E H;  3HOU H;  2BA1 A;  5KRU A;  3J81 E;  5KGU A;  4A3M H;  5LL6 X;  1P8L A;  3FRP B;  4I7Z C;  3D31 A;  3T1H L;  1LTI D;  1Q90 A;  4ZKB B;  3D4W A;  4GNX B;  3OW2 A;  2CWP A;  3KLS X;  4R4C A;  3C46 A;  3KDF A;  4DR3 Q;  4OXP A;  1HTL D;  1M4V A;  1SLJ A;  3UE1 A;  4JI6 Q;  1TT2 A;  5ELE A;  2PQA B;  1E22 A;  2VQF L;  1H9S A;  2JA5 G;  2AMC B;  3KFU A;  3ERQ A;  1WTR A;  5G3L F;  3DWA A;  2UXB Q;  1WCM H;  5JOB A;  3V05 A;  2CFM A;  4NP5 A;  2R93 H;  1VQ8 A;  1STG A;  4GLV B;  4LF9 Q;  1I50 B;  4RWS C;  2CVR A;  2ASB A;  2EY2 A;  2JEA I;  2VUM B;  1H95 A;  3I56 A;  3RNU A;  3NTI A;  1Y1W H;  3HOW H;  1RF2 D;  1PH4 A;  5M9O A;  1JE5 A;  4FF4 A;  3DEP A;  2UUC L;  1BUV T;  1I3Q H;  1WTV A;  3D8G A;  5CV8 A;  5CR3 A;  1SSO A;  1IKM A;  1TKW B;  5KEE A;  1F2L A;  3K81 C;  3S1R H;  1UEA B;  1LTA D;  2I5H A;  1YNN D;  1XMO Q;  2VUM G;  1IBM Q;  4YWK A;  3I91 A;  1G2T A;  3NBI A;  1CA6 A;  4DV4 L;  3AYH B;  1CI3 M;  4NXM L;  2I07 B;  4N9T A;  4AQY Q;  4A3G B;  5ELC A;  3FVQ A;  5M5Y H;  1U0L A;  1YI2 A;  5KND A;  2JA9 A;  1PFN A;  3G4S A;  3I90 A;  3I4L A;  4DV0 Q;  2P5Z X;  3CCS A;  5KYL A;  2B2V C;  3M4Q A;  4K14 A;  4JW0 A;  1FVI A;  2NN6 I;  1SDF A;  1TWA B;  2R3Z A;  1G51 A;  2WB1 B;  1X3Q A;  2JJQ A;  3NEM A;  3M3Y B;  3GDE A;  4A3G G;  1AP0 A;  1B2T A;  1WYD A;  3WOE A;  3K7U C;  4BY1 H;  4TQU S;  1B9N A;  2B3G A;  3SGI A;  2R7Z H;  3GTL H;  2XVS A;  3S9W A;  1WTO A;  3I4N B;  2YU9 H;  3K57 A;  1W6J A;  4NB3 A;  1CT1 D;  3NK9 A;  4XQJ A;  2K52 A;  4EQO A;  2R92 H;  1GOZ A;  4HMI A;  4MIU A;  4NDX A;  2BE5 C;  1C9O A;  4ME5 A;  2WB1 G;  1XJV A;  5C0X J;  5DEH A;  2E8G A;  4L6T B;  3E0J A;  3MXG A;  5CGK A;  1CZW A;  2PYK A;  1B8A A;  5FK9 C;  1XNR Q;  5BN4 A;  2CH4 W;  2ZTE A;  1YHA A;  2CHB D;  3KF8 B;  3CQZ H;  3I4N G;  2R93 G;  5M5W H;  4A3J H;  1ASY A;  5IP9 H;  3ITP A;  5FKA C;  3NSW A;  1RCV D;  4LF5 Q;  2LKV A;  2K28 A;  1C8C A;  4WJ3 M;  5K36 H;  1E2W A;  1CHP D;  2LS0 1;  5IGD A;  2AKW B;  3HS0 C;  3B6Y A;  1I4R A;  2K4K A;  1GXD C;  1N32 Q;  4RCO A;  1V8Q A;  1QNU A;  4XT3 B;  5C4X B;  3BDO A;  3JAM L;  4L63 B;  1GHK A;  3EIV A;  5BN5 A;  2M2L A;  3CRL C;  5BR8 Q;  3M7G A;  5FO8 B;  1NUC A;  1LTB D;  2GVA A;  1SXT A;  4HR7 B;  1LT5 D;  2VY3 A;  1T9H A;  3Q6S A;  5LL6 S;  2F3W A;  1F77 A;  1VQI A;  1N33 Q;  1WD0 A;  3RZO B;  2B8G A;  4ABN A;  1KD1 C;  2HDM A;  2WII B;  4LF6 L;  5C4X G;  4MZ9 A;  3D6W A;  5GRO A;  1YNN C;  1WTW A;  3S2D H;  4J1M A;  2AUK A;  1C0A A;  1W2B A;  1TS5 A;  2EZV A;  2AQ1 B;  2G9H D;  2E2J H;  3CKI B;  1B53 A;  2EYJ A;  4R8N A;  1A3U A;  1STN A;  2F0S A;  3GTO H;  2F0M A;  2JYO A;  3OPO A;  4DV1 L;  4AYB B;  1U5K A;  2EYM A;  4MNO A;  3GTP B;  4BBR B;  4LUZ A;  3S14 H;  3S1M B;  1TS2 A;  1IYU A;  1D5Z C;  1XPO A;  2R7Z G;  1K8G A;  5D14 A;  3MFG A;  1PYB A;  4YY3 L;  2F0V A;  3A8K E;  5JPN C;  1XPR A;  4J8Q A;  4BY7 H;  3U9S A;  1KAA A;  3GP7 A;  3T1Y L;  1Y1V H;  1PFS A;  2Q2U A;  1HZB A;  2BCO A;  2F1M A;  2UUA Q;  3I7F A;  4Q5V A;  5E7N A;  2NWG A;  1H9M A;  3H0G H;  2F4I A;  2K75 A;  5COR A;  4BBR G;  1PLF A;  4RA8 A;  4A3L G;  3FMC A;  2JEB I;  3D3R A;  3J7Z C;  4BXX H;  2GA4 B;  3GQB A;  1NJI C;  2F0W A;  1VQB A;  5E3F A;  4CGY B;  1QUQ A;  1CM9 A;  5AFW A;  2EYF A;  5FLM G;  2Z6K A;  5EGT A;  2HQL A;  2D0P A;  4BS9 A;  4K6D A;  3M4O B;  2JK8 A;  4DV3 L;  5I2Y A;  3AU7 A;  2YTY A;  4QIW E;  1SE2 A;  1CKN A;  1AN8 A;  1PH3 A;  1MSH A;  2B2U A;  5IE8 A;  2NVY H;  4G7H C;  4QGU A;  1IL8 A;  2R7F A;  4DR7 L;  1Q12 A;  2Q2I A;  3OWF A;  1EL0 A;  4CDF C;  5M5X B;  3L2P A;  2RSN A;  4ID6 A;  2Q8T A;  3KF6 B;  2QKI C;  1U4P A;  4IPH A;  3NBH A;  1WTX A;  3ERS X;  4DFA A;  5HGQ A;  2PPB C;  3CC7 A;  3NEL A;  1UE6 A;  3O13 A;  5EBC A;  1SEB D;  1CKN B;  3RLO A;  5ISR A;  5I6Y A;  1G91 A;  2Y0S B;  3D6C A;  1UAP A;  4A3B B;  2VL6 A;  2A73 B;  1SYG A;  4H44 C;  2ZTD A;  2UXC L;  4KK7 A;  3S16 H;  1RKN A;  1TWG B;  1GUT A;  1BF4 A;  1EIY B;  1XTD A;  3V2T A;  2GVB A;  4IQZ A;  2YTV A;  4DU9 A;  4R4O A;  2EY1 A;  2SNM A;  3U58 A;  4KKT A;  1DGS A;  2JA7 H;  3I4M B;  3K8A A;  1HZA A;  3PIO A;  1BR9 A;  1HR0 L;  2ZM6 L;  2EE1 A;  4POF A;  3A55 A;  1DON A;  5E4X A;  2Y0S G;  4FF3 A;  4HIK A;  1SE3 A;  1DJR D;  1EZ6 A;  1CSQ A;  2PZU A;  4HMJ A;  1IHZ A;  1R9T B;  1I4P A;  5JJI A;  1HQM C;  3J81 c;  1BCP F;  4JV5 L;  5DAU A;  1VQ9 A;  2CWA A;  4A3F H;  4H0L C;  3I4M G;  4OGQ C;  2Q2H A;  4CKC A;  1SNM A;  1B1Z A;  1X56 A;  3UE0 A;  1Q81 C;  2KCM A;  3RR5 A;  3BG3 A;  5IGF A;  2L0C A;  4R9W A;  1QCB D;  4JI3 Q;  1KQS A;  1HR0 W;  1Y1V G;  2KVM A;  4C3I B;  3P1H A;  1LTR D;  2B29 A;  5K5P A;  1CUK A;  4DR1 L;  4JI2 Q;  1VS0 A;  4OL7 A;  1KLU D;  4P72 A;  2K50 A;  1ET9 A;  1YBY A;  2RDH A;  1I6H H;  1QG7 A;  1C4Q A;  4LWC A;  3SK4 A;  5IWA L;  1B44 D;  4XIG S;  4CHT B;  1FD7 D;  1S4Z A;  1TY0 A;  1VF7 A;  1TY2 A;  1EY4 A;  2RHS B;  3S1N H;  4C3I G;  1HHV A;  4QL5 A;  3T56 B;  1HNX Q;  4XYQ A;  2IX3 A;  4KJO A;  5ELD A;  1W6K A;  2G9D A;  1TWF H;  3G71 A;  2K5Q A;  1EEF D;  1IBK L;  1E1O A;  4C2M B;  3CCV A;  3K80 C;  3Q23 A;  2O5J C;  4K0K Q;  2FFK B;  2HIV A;  1WFQ A;  3HZX A;  5EQ0 A;  4DV2 L;  1BBX C;  1VF5 C;  4LF4 Q;  5FO9 B;  4DUZ Q;  2UU9 Q;  1JJG A;  1Q82 C; 
#chains in the Genus database with same CATH homology
 3CMA A;  1HZC A;  4LFC L;  2NZH A;  2LXK A;  5GAE C;  1QUQ B;  1CKM A;  1OXS C;  2HT1 A;  1HNW L;  3PF5 A;  1BKB A;  1MJC A;  2MNA A;  2JA6 H;  3ULJ A;  4DR2 L;  2XTI A;  1M90 C;  2BA0 A;  1L1O C;  4JI5 Q;  4OX9 Q;  4JYA Q;  4B3R Q;  4NXN L;  3BZK A;  1V1Q A;  4EQ5 A;  1EIF A;  4YCU A;  2K14 A;  4GS3 A;  4L5Q A;  3S24 A;  5C3E H;  3HOU H;  2BA1 A;  1NMG A;  1Q1B A;  3ULP A;  3ICE A;  2YYZ A;  2VQE L;  4A76 A;  4A3M H;  5FJ8 G;  1P8L A;  1WCM G;  1N8R C;  3PO2 H;  3W1G A;  3T1H L;  3D31 A;  5LMU Q;  3K7A H;  4GNX B;  2ALY B;  3OW2 A;  4DNI A;  1XNR L;  1HJP A;  5FLX c;  2CWP A;  4JCV E;  4R4C A;  5HY6 A;  4C3J H;  4DV7 L;  3KDF A;  4DR3 Q;  4OXP A;  1NTG A;  1NBW A;  1SLJ A;  3UE1 A;  1XMQ Q;  4JI6 Q;  2HHH L;  3Q8D A;  4GOP B;  4GN3 B;  2PQA B;  1E22 A;  2VQF L;  1EYG A;  4HJA A;  2OTL A;  3OTO Q;  2GN5 A;  2JA5 G;  1RIP A;  2AMC B;  2MQH A;  5AJ3 L;  3KFU A;  3NBH B;  3PUV A;  3G48 A;  4C2M H;  5IT9 c;  1VQM A;  1Y1W G;  2UXB Q;  1WCM H;  3HOW G;  4X62 Q;  4UP8 A;  2CFM A;  4DR6 L;  4DUY L;  1PA6 A;  1VQ4 A;  2R93 H;  1VQ8 A;  2CQO A;  4GLV B;  4LF9 Q;  4JC0 A;  3A74 A;  3GTJ H;  4LF6 Q;  4P74 A;  1A62 A;  4JI0 Q;  4LF7 Q;  4A3B G;  2ASB A;  3FKI G;  1IL2 A;  2JEA I;  2OQ0 A;  2JA5 H;  1QZG A;  1H95 A;  4KI0 A;  1TWH H;  5H1S E;  3I56 A;  1X65 A;  1IBL L;  4JI1 Q;  3RNU A;  1Q46 A;  1Y1W H;  1N34 L;  2LSS A;  1PH4 A;  3HOW H;  5JJL A;  1JE5 A;  4LW1 A;  3PV0 A;  1VQF A;  5C0X I;  2CKZ B;  1D8L A;  1MKH A;  5LMN W;  2UUC L;  1VQK A;  1NMF A;  4B3S Q;  1I3Q H;  2KHI A;  3PSI A;  2AWO A;  3PUX A;  3TEH B;  3HFZ B;  2ZJR A;  1JB7 A;  4JBW A;  3AQQ A;  4UP9 A;  3J80 c;  2BH8 A;  1EOV A;  3KJP A;  3FKI H;  3GTM H;  1LM0 A;  3K81 C;  5M3F G;  1VQH A;  1PH9 A;  1YZ6 A;  1WOC A;  3A5U A;  1N33 L;  3S1R H;  4B3T L;  3CW2 C;  4BA1 I;  1PH5 A;  2F3I A;  2I5H A;  3F8T A;  1XMO Q;  2VUM G;  4DR1 Q;  5C44 G;  3GTK H;  1IBM Q;  2A1A A;  4FDB A;  4YY3 Q;  2ATW A;  4YWK A;  3U4V A;  1K9M C;  1LTL A;  1QVC A;  3W1B A;  4JBM A;  1VQG A;  4DV4 L;  4JI7 Q;  3FP9 A;  4KHP L;  2XGT A;  1CSP A;  3AYH B;  3T1Y Q;  3I4O A;  1G29 1;  1MJE A;  2E5L Q;  4NXM L;  1YEZ A;  5M3F H;  1I50 H;  4AQY Q;  4HJ9 A;  4QY7 A;  4HID A;  2K5H A;  3CXC A;  5M5Y H;  1U0L A;  1YI2 A;  3I55 A;  2JA9 A;  3BJU A;  2VUM H;  5C44 H;  1Y14 B;  3G4S A;  1PH7 A;  3BZC A;  4X66 L;  1V9P A;  2EXD A;  2B63 G;  4TVA B;  4JI3 L;  4DKA C;  4DV0 Q;  5M3M G;  1VQC A;  3CP0 A;  4JI4 Q;  1VQ7 A;  1N9W A;  1IXR A;  4JBK A;  3UDG A;  3CCS A;  4BY1 G;  1YIT A;  3M4Q A;  1Q8K A;  4YHH Q;  3I2Z A;  1D7Q A;  3E9H A;  4KLK A;  4JBJ A;  3STB D;  4B3M Q;  1FVI A;  2NN6 I;  4PMW A;  3A5Z B;  4DV6 Q;  2N3S A;  4OO1 I;  4A93 G;  1G51 A;  2EQS A;  1S72 A;  4JI2 L;  4IPC A;  2N78 A;  2JJQ A;  3NEM A;  3RZD H;  1GD7 A;  4DV3 Q;  1S40 A;  2B63 H;  1E24 A;  1QVG A;  3GDE A;  4LF8 L;  3CCR A;  4A3G G;  2IHE A;  2R92 G;  2JQO A;  3PUW A;  3JAM i;  1I94 L;  5JEA G;  1WYD A;  3K7U C;  4BY1 H;  1VQA A;  4TQU S;  3IRB A;  1LYL A;  2B3G A;  3SGI A;  1HH2 P;  3CAM A;  2KCT A;  4XTC S;  4DAY B;  2R7Z H;  3GTL H;  4NPS A;  4DR7 Q;  2PI2 E;  3KLW A;  1HZ9 A;  1UEB A;  2YU9 H;  3M7N A;  4A93 H;  1KRS A;  2ZTC A;  4NB3 A;  3PO2 G;  1CKO A;  3CC2 A;  1XNQ L;  4PG3 A;  1AE3 A;  2OQK A;  4A3G H;  2K52 A;  2R92 H;  4KHZ A;  2D0O A;  4A3J G;  1HNX L;  3KF6 A;  5IYD G;  1OTC A;  5IP9 G;  1C9O A;  4GKJ L;  2WB1 G;  1XJV A;  3U4Z A;  5C0X J;  1L0W A;  4IO9 A;  2E8G A;  4GKK L;  3TRZ A;  3CC4 A;  3OYY A;  4JG2 A;  2RCN A;  2OTJ A;  1B8A A;  5K36 G;  1XNR Q;  4UY8 C;  1G6P A;  2UXC Q;  4LFB L;  3PIP A;  2F4V Q;  1L1O B;  5IYC G;  3A0J A;  3H3V I;  1SRO A;  3HKS A;  2ZTE A;  4J15 A;  1YHA A;  3KF8 B;  4DR5 L;  3S1Q H;  3CQZ H;  3LGJ A;  4C3H H;  3I4N G;  2R93 G;  5M5W H;  4A3J H;  1YJN A;  1ASY A;  4IPD A;  1VQE A;  1TWA H;  4O0A A;  4EX5 A;  2ID0 A;  5IP9 H;  2QEX A;  5IYD H;  1J5E Q;  4PZ8 A;  4DUZ L;  4LF4 L;  5LMN L;  1X9N A;  4OWX B;  1FGU A;  4X65 L;  2ZJP A;  3JC6 6;  2NVT H;  3M3Y H;  4LF5 Q;  3UDI A;  3J81 i;  4WJ4 A;  4WJ3 M;  3RN5 A;  4AIM A;  3CCL A;  4YCW A;  4APV A;  4X64 Q;  4JI8 L;  5GAD C;  3BU2 A;  1SRU A;  1HR0 Q;  5IYC H;  2ZM6 Q;  2I0Q A;  4B3R L;  2AKW B;  2WB1 E;  1EQR A;  2KHJ A;  4OX9 L;  3TS2 A;  3B6Y A;  2MO0 A;  1P16 A;  2K4K A;  3AFP A;  3I4N H;  1K83 H;  1N36 Q;  1N32 Q;  2UXD Q;  4Y52 H;  4HIM A;  3TRE A;  1C7Y A;  1IBL Q;  5LMU L;  3KDF B;  2KEN A;  2RHQ B;  1NY4 A;  2NVX H;  3EIV A;  1VQ6 A;  4JV5 Q;  2HIX A;  4DR3 L;  5J3B A;  3PGZ A;  2IHF A;  5GQO A;  1KIX A;  1I5F A;  5BR8 Q;  4DR4 Q;  3ULL A;  1YJW A;  4JI6 L;  4H02 A;  1E3P A;  1O7I A;  4R4Q A;  4R4T A;  2GVA A;  1SN8 A;  2V1C C;  2VY3 A;  1T9H A;  3M4P A;  3M85 A;  1A63 A;  3PCO B;  1SR3 A;  4P73 A;  5DLQ E;  1SMX A;  2FXQ A;  1VQI A;  1QZH A;  1N33 Q;  2Z0S A;  4YWM A;  4L5R C;  1PVO A;  3S17 H;  3DLL A;  3UDX A;  4LF9 L;  4IFD G;  1KD1 C;  4LF6 L;  3HOY H;  4JI0 L;  3PO3 G;  5C4X G;  1HNZ Q;  4LF7 L;  2ZJQ A;  2MO1 A;  1XNQ Q;  1OXV A;  4MZ9 A;  1VQL A;  1A8V A;  5GRO A;  4LUO A;  1X54 A;  3S2D H;  1YJ9 A;  3HOV G;  1C0A A;  4JI1 L;  3F2D A;  1W2B A;  4DPG A;  2E2J H;  3L0O A;  3G6E A;  1Q1E A;  2JA8 G;  2L15 A;  1AE2 A;  4B3S L;  5IWA Q;  3GTO H;  3S2H H;  4IJL A;  2F52 A;  5C4X H;  3CCU A;  3PO3 H;  4A3L H;  4BY7 G;  4DV1 L;  2UUB Q;  3EBE A;  1U5K A;  4MNO A;  5GAG C;  1EUJ A;  4BA2 I;  4LUZ A;  1VQJ A;  3S14 H;  1M1K C;  3HOV H;  1KC8 C;  1YHB A;  1EFW A;  1OXU A;  2E2H H;  1XPO A;  3HOX H;  2NZO A;  4DV5 Q;  3H0G G;  5ELN A;  2JA8 H;  1Z9F A;  2R7Z G;  1K8G A;  1LUZ A;  4UPA A;  3CME A;  4YY3 L;  1PYB A;  3FHW A;  1GO3 E;  3STB C;  1XPR A;  1FJG Q;  4BXX G;  5GAH C;  3MXN B;  4BY7 H;  1TXY A;  1IBK Q;  2Q2U A;  3T1Y L;  1Y1V H;  1PFS A;  3RZO H;  1HZB A;  4P75 A;  4RMF A;  2E5L L;  2K5V A;  4AQY L;  4R1J A;  2VNU D;  1YNX A;  3S15 H;  4HJ5 A;  2UUA Q;  3I7F A;  4K0K L;  5E7N A;  4DV2 Q;  1L2F A;  4QQB X;  1X3F A;  2AHO B;  2K5N A;  3H0G H;  4GLA C;  4DK6 C;  5IYB G;  2K75 A;  3W5O A;  1NE3 A;  1RL2 A;  1X3G A;  4BBR G;  3VDY A;  1Q86 C;  4A3L G;  4KHP Q;  3E0E A;  1BBU A;  2JEB I;  3J7Z C;  4LFC Q;  4BXX H;  1JT8 A;  1HNW Q;  1NJI C;  1VQB A;  3L7Z C;  1PH2 A;  1QUQ A;  4YHH L;  1PYS B;  5FLM G;  4DR2 Q;  3RLF A;  4GKK Q;  4B3M L;  5C4J H;  4NXN Q;  2Z6K A;  4DV6 L;  2PMZ E;  1VQN A;  2HQL A;  2D0P A;  3PUZ A;  2JK8 A;  3GO5 A;  4A3C G;  5IYB H;  4DV3 L;  5ELO A;  3GTP H;  4BBR H;  2VQE Q;  2YTY A;  3GD7 A;  1K73 C;  4QIW E;  2E2I H;  4GLX A;  3S1M H;  5C0X G;  3PF4 A;  4QJF A;  1IYJ B;  4AH6 A;  3T1H Q;  3GTG H;  1CKN A;  3M9B A;  1EWI A;  3HOZ G;  2OCE A;  2WAQ G;  1J6Q A;  2EIF A;  1PH3 A;  1X55 A;  3HKZ G;  4DV7 Q;  4GNX A;  3CD6 A;  1BVS A;  3WWV A;  5IE8 A;  2NVY H;  4LFA L;  4QGU A;  1KAW A;  5JJK A;  2R7F A;  5LMN Q;  2DGY A;  4A4I A;  5FLM H;  2HHH Q;  2Z6K C;  4DR7 L;  1Q12 A;  2Q2I A;  1JJ2 A;  2VQF Q;  1UE1 A;  4GN5 A;  1AH9 A;  4OWW B;  3F2B A;  1V43 A;  2LXJ A;  3PUY A;  2NVQ H;  3CCQ A;  4GOP A;  3L2P A;  2PQA A;  5AJ3 Q;  3CPW A;  2ES2 A;  1PH1 A;  2UU9 L;  4JI8 Q;  4A3C H;  3TQY A;  3KF6 B;  4IPH A;  1WI5 A;  3ERS X;  3HOZ H;  3JAM c;  4DR6 Q;  4DUY Q;  1PH8 A;  4GNX C;  1PHJ A;  1K8A C;  5HGQ A;  1B70 B;  3CC7 A;  3NEL A;  1UE6 A;  4IOC A;  2JA7 G;  1OXX K;  4JI5 L;  1GKH A;  1CKN B;  4JYA L;  3RLO A;  4PZ6 A;  3CCJ A;  4BBS G;  2KBN A;  3J80 i;  3ER0 A;  3KYH C;  1KRT A;  4GOP C;  2VL6 A;  2YV5 A;  1BBW A;  4A3K G;  2A19 A;  2UXC L;  2ZTD A;  1S3O A;  1TWC H;  4OON A;  2F4V L;  2WAQ E;  3S16 H;  3HKZ E;  4O2D A;  1SE8 A;  3CCM A;  3U50 C;  1N34 Q;  1EIY B;  1XTD A;  3CCE A;  3CPF A;  3RN2 A;  2GVB A;  2D62 A;  2YTV A;  1YVC A;  4R4I A;  4R4O A;  2UUC Q;  2A8V A;  3ZJY C;  3U58 A;  4POG A;  1DGS A;  1QVF A;  1J5E L;  3M4O H;  2PNH A;  4L5T A;  1UWV A;  4RG1 A;  4HJ8 A;  2IT1 A;  1XMQ L;  1Q7Y C;  2JA7 H;  3HOY G;  4BBS H;  2C35 B;  5FJ8 H;  1JMC A;  4LF5 L;  3OTO L;  3K8A A;  1HZA A;  2QGQ A;  3PIO A;  3E9I A;  1IZ6 A;  1Z47 A;  3DM3 A;  4A3K H;  2JE6 I;  4X64 L;  4A3F G;  2UXB L;  2NN6 G;  2I5L X;  4X62 L;  1HR0 L;  2PI2 A;  2ZM6 L;  4OO1 G;  4POF A;  3MEF A;  4B3T Q;  5IY0 A;  4GN4 B;  2Y0S G;  2R6G A;  1X6O A;  4HIK A;  1WJJ A;  3AEV A;  5M5X H;  1N36 L;  1N32 L;  4Y7N H;  2UXD L;  1CSQ A;  2VZA A;  1KL9 A;  5JJI A;  1VQO A;  3AFQ A;  2WFW A;  1A0I A;  4DV4 Q;  3J81 c;  3J7A 5;  1VCI A;  4JV5 L;  1VQ9 A;  4HIO A;  4JOI A;  2CWA A;  4UP7 A;  4A3F H;  2CCZ A;  4NXM Q;  5BR8 L;  2IX0 A;  4DR4 L;  3I4M G;  1KHI A;  2N8N A;  2Q2H A;  4LUV A;  4P71 A;  1K3R A;  1X56 A;  3UE0 A;  1Q81 C;  2KCM A;  1E7Z A;  2WP8 J;  2VW9 A;  3RR5 A;  4DV1 Q;  4A3B H;  1EQQ A;  5IP7 G;  1KXL A;  4IFD J;  3CF5 A;  1E1T A;  3F1Z A;  4ME3 A;  4X66 Q;  3RLN A;  4L5S A;  4JI3 Q;  2YTX A;  1TWG H;  2I5M X;  4IJH A;  1KQS A;  1VQD A;  1B7Y B;  2R7D A;  1Y1V G;  1HR0 W;  1VQ5 A;  1FL0 A;  4JOI C;  3H15 A;  2Y0S E;  1UE5 A;  2B29 A;  4ALP A;  4DAM A;  3I4M H;  3EN2 A;  1HNZ L;  3NEN A;  4A3E G;  1CUK A;  1XMO L;  3UDF A;  4YCV A;  1JJC B;  4JI2 Q;  1OXT A;  1VS0 A;  4DK3 C;  4DR1 L;  1IBM L;  4P72 A;  5IP7 H;  1ASZ A;  1GM5 A;  2K50 A;  4X6A H;  4LF8 Q;  1YBY A;  4HJ7 A;  1I6H H;  1I94 Q;  4JI7 L;  2IY5 B;  4A3I G;  3GTQ H;  4LWC A;  4IOA A;  5IWA L;  4OWT B;  4A75 A;  1W3S A;  4XIG S;  2Q2T A;  1XPU A;  1GVP A;  3D0F A;  1R9T H;  2H5X A;  2VS1 A;  1UE7 A;  4AYB G;  4A3E H;  2RHS B;  2UUB L;  4A3D G;  2MFI A;  3S1N H;  3H3V H;  2AWN A;  4QL5 A;  4DV0 L;  4JI4 L;  1YHQ A;  3TS0 A;  1HNX Q;  1SFO H;  4DV5 L;  4PZ7 A;  4A3I H;  2QA4 A;  3KJO A;  1PV4 A;  1YIJ A;  3KOJ A;  4GKJ Q;  1X3E A;  1MIU A;  4YWL A;  1TWF H;  5JEA J;  3HOX G;  1FJG L;  4IFD I;  4IPG A;  4LNQ A;  3G71 A;  5M3M H;  5EAY A;  2DUD A;  1IBK L;  4A3D H;  1E1O A;  4MTN A;  4C3I H;  2JA6 G;  4LFB Q;  3CCV A;  2RF4 A;  1PH6 A;  2BH2 A;  3K80 C;  2OWO A;  1K0R A;  4LFA Q;  2UUA L;  4DR5 Q;  2IX1 A;  4K0K Q;  3F2C A;  1L1O A;  2HIV A;  1WFQ A;  4DV2 L;  5C3E G;  3HOU G;  4LF4 Q;  1VQP A;  4DUZ Q;  4A3M G;  4AYB E;  2UU9 Q;  1JJG A;  4X65 Q;  3K0X A;  2N49 A;  3J81 j;  1Q82 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...