2F4VQ

30s ribosome + designer antibiotic
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 15
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2f4vQ00
1FL0A 2R92H 1U0LA 2K5NA 1AH9A 3PSIA 3W1BA 5FJ8H 3KJPA 1MKHA 1X56A 4YHHL 2OTLA 4POGA 1XNRQ 4UP9A 2OCEA 4LF6Q 4IPHA 3HOYH 2PI2A 1J5EQ 3OYYA 1UEBA 1Q1BA 1IBKQ 1VQLA 3HOZG 5IYCH 4JI6Q 2ES2A 5LMNQ 3BU2A 4JI5L 1KAWA 4R4OA 1NY4A 3PUXA 4DK6C 3I4OA 2Q2UA 2JA5G 2JA6G 4IFDJ 4XTCS 1S40A 2VNUD 4HIKA 4B3RL 1DGSA 2KHIA 4R4CA 2F3IA 3GD7A 3M9BA 2CCZA 2YYZA 1QVCA 2YV5A 1EOVA 3AFQA 3E0EA 2VS1A 3B6YA 3UDIA 5C0XJ 1ASYA 2IY5B 4UP7A 2F4VL 3TRZA 1N32Q 2NN6G 3WWVA 3ULJA 2DGYA 4DV0Q 1JJ2A 4JI2Q 4DNIA 2ZTCA 2N3SA 3UDFA 4RMFA 1EIFA 1ASZA 4KHZA 1SN8A 4DV5L 4JG2A 4DV7Q 2K50A 3K81C 4EX5A 1K83H 3HOXH 2PMZE 4PZ6A 3F2BA 1KD1C 2CFMA 3RN2A 2VQFL 1AE3A 2WB1E 4X62Q 1BBUA 4GOPC 2JA8H 5GADC 4GKKQ 4YY3Q 2Z0SA 1PYSB 3RR5A 5IYBG 1UE1A 2OQ0A 1V1QA 4UP8A 1QUQA 2IX0A 3NELA 1SROA 2JJQA 4JI1Q 4A3EG 3S2DH 4IO9A 4X62L 1I3QH 4Y7NH 3GTMH 4BY7H 2MO0A 1L0WA 1IZ6A 3NBHB 3A5UA 4BBSH 4DV2Q 5C0XG 4XIGS 1VQFA 1PHJA 2KENA 4Y52H 2K75A 4A3FG 4J15A 3ULLA 1EUJA 3F2CA 1S72A 4AYBG 5JJKA 3I4NG 1N8RC 4DV1L 4HIOA 2NN6I 4LF4L 3DM3A 4NXML 2IT1A 4LW1A 4R4IA 1Q1EA 1E22A 4YHHQ 4JI7Q 4LUZA 4JI7L 2UXBQ 3GTGH 3ERSX 4A3EH 1Q86C 4KHPQ 3J80i 3TEHB 1IBLQ 2CKZB 1GO3E 1SMXA 2ZTEA 3MXNB 1YHAA 4LFCL 1H95A 1FJGL 1FJGQ 2UXDQ 3TQYA 3KF6A 2JK8A 2ZTDA 3ZJYC 1PH8A 1EYGA 2DUDA 3CP0A 4JI6L 1VQHA 4L5SA 1OXTA 4DAMA 4R4TA 2MFIA 4L5QA 5GAGC 2A19A 5GAHC 2UUAQ 5C44H 1HNWL 4P71A 5IE8A 1HJPA 3U50C 1G291 3CF5A 4GLAC 3S2HH 3CCEA 4IFDG 2WP8J 2PQAA 1B8AA 1HNZL 1NMGA 1VQDA 2WFWA 3J81i 4DR7L 4GNXB 2WB1G 2NZOA 3DLLA 1NE3A 3AQQA 3GDEA 1IBML 4DR1L 1WYDA 1G51A 3BZCA 2KHJA 4DR1Q 1J6QA 2OWOA 4HIMA 1SRUA 1TWAH 1I50H 1Q46A 3S1QH 2BH8A 3RLFA 1CSPA 3GTJH 2GN5A 5C4XH 5AJ3Q 1XPRA 2Q2TA 4JI4L 4LFBL 3G6EA 3UDGA 1VQOA 4QL5A 1LM0A 5IP7H 5IYDG 3CPWA 4TVAB 4OO1G 2RF4A 3HKSA 3HKZE 5C44G 1CKNB 3UE0A 1VQ7A 2NZHA 3H15A 4C3JH 1YJWA 2E2JH 1EIYB 4C3HH 2NVYH 4DV4L 4GOPA 3CC2A 3TS2A 4GS3A 1CSQA 1PH4A 5IYBH 3KLWA 1NTGA 2HT1A 5IP9G 1TXYA 3U4ZA 2KCTA 1B7YB 3OW2A 1YIJA 1K9MC 1I94Q 1PVOA 5IY0A 4QIWE 4DV3Q 2RHQB 3UDXA 3F2DA 1KIXA 3STBD 1HR0W 1KC8C 1SE8A 3T1HL 1YI2A 2OTJA 2F4VQ 4HJ7A 2VUMH 5IP7G 4AQYQ 3HOUH 4BBSG 2IHFA 3CCLA 4JI2L 2E8GA 1WJJA 2JA8G 1IBKL 2VL6A 3EBEA 3PIOA 2B29A 4A3GG 2VUMG 3UE1A 1KHIA 4A3LH 4GNXC 4MTNA 5FLMH 4B3TQ 1GVPA 1LTLA 2B63G 1EQQA 1HNXQ 1N33Q 2A8VA 1OTCA 4A4IA 3K7UC 1XMOL 4BY7G 3KYHC 1VQNA 1I5FA 2Q2HA 4JCVE 3KFUA 4LFCQ 1I6HH 4L5TA 3Q8DA 2UU9Q 4JI5Q 4YCVA 2RCNA 4PMWA 2AMCB 1XMOQ 1K8AC 1X3FA 3OTOQ 3SGIA 1QZGA 1Y14B 3NEMA 1SFOH 4DV4Q 4OXPA 4YCWA 1QZHA 1X9NA 1K73C 3JC66 4A3GH 4OO1I 3PUYA 2R93G 4JI0L 2E5LQ 1XNQL 3FKIH 1YHBA 5C4XG 5H1SE 4DV1Q 3NENA 1YJNA 1JMCA 3FP9A 5J3BA 1Y1WG 4LF5L 1Y1VG 4IPGA 4TQUS 5M5XH 1OXUA 2MO1A 2WAQE 4IPCA 1CKNA 3JAMc 1R9TH 3MEFA 4POFA 2ASBA 2K5VA 5BR8L 1IL2A 4PG3A 1X54A 2I5HA 1V43A 4LF7L 1E7ZA 1JJGA 3HFZB 4GN3B 3W1GA 1N34Q 3GTOH 1E3PA 1L1OA 2E2HH 2NVQH 3HKZG 3HOWG 4YWKA 4ALPA 4NB3A 4EQ5A 1S3OA 1GKHA 2VZAA 4GKKL 1A62A 3IRBA 1K8GA 1UE5A 2JA9A 4DPGA 3FKIG 4JI0Q 1TWCH 3FHWA 1OXVA 4MNOA 1MJCA 1VQIA 3CCQA 2WAQG 3HOVH 3M3YH 1Y1WH 1BVSA 4A3KG 1Y1VH 4JBJA 4A3MH 5LMNW 4P74A 1SR3A 1N32L 3HOXG 2Q2IA 4A3KH 3PF5A 2JEBI 1PH5A 4BXXG 4GLVB 5FLMG 1YITA 5IYDH 5JJLA 1KL9A 3STBC 4P75A 1B70B 4RG1A 1XNQQ 1HNZQ 1W3SA 1XMQL 3J81j 3H0GH 4A3BH 2AKWB 2KBNA 4BY1G 5C4JH 5HGQA 4LUOA 4B3TL 4K0KL 4IPDA 1A8VA 3RNUA 3H0GG 2B3GA 3I7FA 5AJ3L 2PI2E 2UU9L 1VQGA 4A3IG 4BA2I 4HIDA 3L7ZC 1PH3A 5K36G 3AYHB 1N36L 4OONA 4C3IH 4A3DG 2PQAB 4BXXH 1WCMG 1PV4A 2MNAA 1X55A 2D0PA 4DR5L 2I5MX 1PH9A 3OTOL 1GM5A 2ALYB 4LF8L 1VQAA 4B3RQ 2PNHA 3PCOB 4A3DH 4A93G 4WJ4A 2IHEA 2R7ZG 4IOAA 2R7DA 3S14H 4LF4Q 1LYLA 3K0XA 3RLNA 4HJ5A 2JA6H 1CKMA 4UPAA 4A3IH 3M4QA 3A74A 4LF5Q 1T9HA 1D7QA 2JE6I 1QVFA 2R93H 1KXLA 1YEZA 3EIVA 1E1OA 4YCUA 1M1KC 3ICEA 4ME3A 2QGQA 1UE6A 3J80c 1WI5A 4PZ8A 3T1HQ 1HNXL 1X3EA 5M5YH 3PO3G 3M4OH 2V1CC 4PZ7A 4WJ3M 1W2BA 4JI4Q 4KLKA 4LWCA 1EWIA 5ELNA 5DLQE 1JJCB 4C2MH 2CWPA 4OX9L 3E9IA 3CC7A 4GN5A 1X3GA 1RIPA 3CCRA 2QEXA 1WFQA 4X64L 1Q12A 3CMAA 4DR3Q 2UUCL 4LNQA 3GTKH 1VQBA 5JEAJ 3CCSA 2UUBL 2AHOB 4OWTB 4DV6L 3AFPA 1Q81C 3M7NA 1VCIA 1NBWA 4GN4B 3S17H 2UUCQ 4X64Q 3KJOA 2D0OA 2K4KA 4JI8L 4AIMA 3GTLH 1A63A 1HR0L 1PH1A 4QGUA 4DR7Q 1KRTA 4B3MQ 2OQKA 2GVAA 2YTVA 1PFSA 1U5KA 5BR8Q 5C3EH 1VS0A 4HJAA 3S1RH 1VQ4A 2YU9H 1N33L 1XPUA 2ZM6L 1PYBA 3AEVA 2KCMA 4B3SQ 3M4PA 2VW9A 4X6AH 4QQBX 3H3VH 3HOVG 4BA1I 3A0JA 1VQ6A 4LFBQ 4DV6Q 1X65A 1V9PA 1L1OC 1JB7A 1YZ6A 4BBRG 3JAMi 2R92G 5IWAL 1FVIA 2VQEQ 2FXQA 4A3FH 4YWMA 1KRSA 3CPFA 4GLXA 4A93H 1N34L 2R7ZH 3D31A 1I94L 4LFAL 1QVGA 4HJ9A 4DR4Q 1UE7A 3PUVA 4JC0A 1VQPA 4YWLA 1TWGH 4NXNQ 3RN5A 4DUZL 4DUZQ 4AYBE 1YHQA 3HOZH 4A3CH 3ULPA 3CAMA 1WCMH 3K8AA 3KF8B 1AE2A 5M3MH 1GD7A 2EXDA 1HR0Q 5JJIA 1VQJA 3I56A 2BA0A 2JA5H 3I4MG 1VQ9A 3F8TA 1E24A 2ID0A 4DAYB 4A3CG 4L5RC 4LF9Q 1HH2P 5LMUQ 4JI3Q 2LXKA 2UXBL 1HZCA 1L1OB 4B3SL 4MZ9A 3L0OA 4K0KQ 4JV5L 2AWNA 2NVXH 2D62A 2Z6KA 4DV7L 4DV5Q 3PO2H 1XNRL 3K7AH 3PV0A 3T1YQ 2Y0SG 5IWAQ 2VQEL 4JI3L 5LMUL 1OXSC 3PO2G 1N36Q 4DR6L 1WOCA 2EQSA 4YY3L 3GO5A 3LGJA 5ELOA 3S24A 2ATWA 4DV2L 2I5LX 2VY3A 4IJHA 2QA4A 2GVBA 1SLJA 4AH6A 1C0AA 2R7FA 4JI1L 2K14A 2H5XA 3PF4A 2YTXA 2HIVA 1K0RA 2IX1A 3CCVA 1TWHH 1X6OA 2RHSB 1M90C 3CQZH 1BKBA 2JA7G 4JI8Q 4JYAQ 4JYAL 1JT8A 3CCUA 1D8LA 4DK3C 2HHHQ 1CKOA 1HZ9A 3E9HA 4KHPL 3J7ZC 3PUWA 2VQFQ 3T1YL 5GQOA 2ZM6Q 3D0FA 4LF9L 4IFDI 2XTIA 1NMFA 1BBWA 1P16A 1VQKA 4GOPB 3GTPH 2K5HA 2HHHL 4QJFA 5E7NA 1YNXA 3G71A 1IBLL 4DR3L 1PH7A 1K3RA 5FJ8G 3I55A 5GAEC 3G48A 3G4SA 4O2DA 2UXDL 1VQ5A 2JA7H 4JBKA 3HOUG 1JE5A 2N8NA 3L2PA 4APVA 1C7YA 4LFAQ 1KQSA 4LF8Q 5JEAG 2UUAL 4A3LG 4O0AA 4NXNL 1QUQB 3I4NH 1YJ9A 5C3EG 2ZJPA 5M3FG 1IXRA 2UUBQ 5M5WH 2L15A 1PH2A 2NVTH 4NXMQ 2BH2A 1EFWA 4IOCA 4OWXB 3ER0A 4IJLA 1IBMQ 1XPOA 3J81c 4OX9Q 3CCMA 4BBRH 1A0IA 1P8LA 3W5OA 1PA6A 3GTQH 3S1NH 3I4MH 1CUKA 1PH6A 4X66Q 3S1MH 1LUZA 2ZJRA 1OXXK 4KI0A 1XMQQ 3J7A5 3CCJA 1HZAA 4X65Q 3I2ZA 3KOJA 1Q82C 5GROA 1FGUA 4A76A 1IYJB 1MIUA 1UWVA 3BJUA 2UXCQ 2E2IH 3EN2A 3H3VI 3HOYG 1Q8KA 4DV3L 4GKJL 3S15H 4GNXA 5IYCG 5HY6A 2JEAI 4P72A 2F52A 3M85A 4A75A 1HZBA 2LXJA 4B3ML 3PUZA 4DR5Q 4JOIC 3PO3H 2K52A 2A1AA 3RZOH 1G6PA 2HQLA 4LUVA 3PGZA 4DV0L 3CC4A 4DKAC 1XTDA 5IP9H 3CXCA 4QY7A 4JOIA 4DUYL 4X65L 1O7IA 3VDYA 4A3MG 4AQYL 3RZDH 2I0QA 4LF6L 3HOWH 4JBWA 4A3JH 4H02A 4JV5Q 1YVCA 1RL2A 4X66L 4LF7Q 1C9OA 2CQOA 1TWFH 1MJEA 5C0XI 3KF6B 2XGTA 1Z9FA 2LSSA 3KDFB 3U58A 2MQHA 5LMNL 3BZKA 1VQMA 4R4QA 4DUYQ 4UY8C 1EQRA 4GKJQ 3TS0A 2UXCL 4NPSA 4DR6Q 1L2FA 3CD6A 4P73A 1J5EL 4OWWB 3CW2C 5FLXc 4FDBA 1E1TA 3F1ZA 2AWOA 5IT9c 5M3FH 2N78A 3A5ZB 1Z47A 4JBMA 1YBYA 2E5LL 4DR4L 1VQCA 2EIFA 2N49A 4DR2Q 4DR2L 2Z6KC 2R6GA 2JQOA 3K80C 1HNWQ 2ZJQA 2Y0SE 4A3JG 1XJVA 4A3BG 1NJIC 2BA1A 1VQEA 2YTYA 2HIXA 3RLOA 4BY1H 1VQ8A 4HJ8A 1N9WA 2C35B 3TREA 5EAYA 1Q7YC 2B63H 3CMEA 3S16H 4R1JA 3PIPA 3KDFA 5M3MG 2CWAA 3U4VA
chains in the Genus database with same CATH superfamily
2R92H 4IQZA 1U0LA 3MXUA 3PSIA 3W1BA 1MKHA 4YHHL 2NVQB 2OCEA 4LF6Q 4IPHA 1DJRD 3HOYH 4TRDA 1IBKQ 3L9AX 4IALA 4OIJA 4F8MA 5CGKA 5LMNQ 1KAWA 4R4OA 3PUXA 5C5LA 4XTCS 3D3RA 3OPOA 1ICFB 1DGSA 1F77A 4R4CA 3M3YB 4K8IA 2K05A 5CV6A 4QUFA 1JC7A 2CVRA 5ELCA 3HOZB 3DUZA 3B6YA 1ASYA 3TRZA 5KNBA 1K8OA 4DV0Q 2DGYA 1K0SA 2LKVA 2ZTCA 1I4QA 1B3QA 4DV5L 3C1FA 5IGEA 5EQ0A 3K81C 1KABA 4PZ6A 3K59A 1EY8A 4GOPC 1AE3A 3SVMA 1ENAA 2LMCB 2QF7A 2Z0SA 3RR5A 3TP6A 5BN5A 3I8ZA 5IYBG 1UE1A 1EIGA 3EJIA 1YNNC 1LTAD 4EGVA 1EZ8A 4QMGA 2JJQA 4JI1Q 1SSOA 4BY7H 1I3QH 3GTMH 4K5WA 3NBHB 3A5UA 2R3ZA 1T5EA 2JYOA 1PHJA 5JOBA 1XX8A 2EYFA 3ULLA 1A3UA 3F2CA 1LTRD 3DMUA 4AYBG 3I4NG 2JA6B 4LF4L 3CRLC 4DA2A 1Q1EA 1RHPA 4YHHQ 4IURA 4LUZA 2UXBQ 3GTGH 2HUGA 4C2MB 4N8FA 4A3EH 4PV1C 1Q86C 2K32A 4F7XA 1BDOA 3K5OA 1EQVA 4LFCL 1D5XC 1FJGQ 2UXDQ 3TQYA 1VQHA 1BUVT 4DAMA 1JOQA 4R4TA 2MFIA 5IGCA 2A19A 1HFNA 4FNFA 5IE8A 3W2DA 1FNUA 3O13A 1ILQA 3CCEA 3S2HH 1B8AA 1NMGA 1PDQA 1BCPB 4X3KA 1J6QA 5D14A 1SJHD 1TS4A 4F88A 2Q2TA 5C4XH 2A6HC 3T56B 1VQOA 5IP7H 4TVAB 1I4GA 1RTNA 2FINB 1VQ7A 2JP1A 1TS5A 2NVYH 3CC2A 5CC4A 1CSQA 1D5MC 2WKDA 4ME5A 1KDCA 3K7AB 5JJZA 2HT1A 1TXYA 2NUCA 4C3JG 1B7YB 1YIJA 3G6JB 1K9MC 2EDGA 3MXGA 4DV3Q 3NPPA 3WOEA 1KIXA 3S1QB 1A15A 1SE8A 2VUMH 2PQEA 2XNAC 2IHFA 1QNUA 2JA5B 5C4JB 2A69D 4A3DB 2VUMG 2F0HA 1KHIA 4GNXC 1EWHA 4MTNA 1HNXQ 4A4IA 3S15B 1XMOL 3K5MA 4BY7G 3KYHC 2E75C 3C46A 4PNYA 2Q2HA 2H1EA 2BCOA 4QUCA 4BBSB 1HTLD 2Q8TA 2UU9Q 4YCVA 1CI3M 2RCNA 4DAPA 3OTOQ 4FYDA 3NEMA 4X3SA 4OO1I 2EJGC 4OXPA 5EKKA 2F0OA 3PUYA 4Q5VA 2B2VC 1XNQL 1D2BA 3U9OA 5JVH3 5C4XG 5CV7A 5E1FA 5H1SE 3NENA 5KNDA 1TWHB 4LF5L 2A69C 3MEFA 2ASBA 2K5VA 4G7OC 4PG3A 2Z9HA 3HFZB 1N34Q 3GTOH 2VB3X 1L1OA 2VZAA 4S3SA 3I3CA 1MJCA 1VQIA 3MXNA 3M3YH 1PMRA 1KLGD 4A3KG 1LLRD 2QEJC 3SK5A 3LWEA 2E2IB 3HOXG 4A3KH 4GLVB 2LY7A 1ESRA 1O78A 5DM63 2Q8IB 3GTOB 2R61A 4A3BH 4C3JB 2KBNA 3PMFA 5C4JH 3Q22A 4K0KL 5I2XA 5IIFA 2KHSA 3I7FA 4JVZA 4E6IA 5AJ3L 4EQPA 4HR7B 2UU9L 1VQGA 2F0QA 4A3IG 3IFDA 4A3MB 4BA2I 1PH3A 5K36G 3AYHB 4C3IH 4FF1A 2VXWA 2F0EA 1I4XA 4DK0A 2I5MX 2L9HA 3QJYA 1GM5A 2X69A 2K28A 1SYBA 4FXKC 4B3RQ 1VDZA 2IHEA 2K01A 4IOAA 4CDCC 2JA6H 4HJ5A 3MXPA 1A2TA 1T9HA 3OSOA 1DONA 1ZKOA 4CDDC 3OMGA 1PYWD 3ICEA 4ME3A 4XQNA 3T1HQ 4CKEA 5FOBB 3PO3G 4WJ3M 3J7YW 1H9KA 2JXMB 1DXMA 5G3LF 2VB2X 4LWCA 5ELFA 1EYCA 2B2WC 3FMCA 3ND8A 1A3TA 1X3GA 2IX3A 1RIPA 3T4AC 3CCRA 1IW7C 1WFQA 5I4DA 3CMAA 3GTKH 1LT3D 4RGTA 4DV6L 4N8X1 3AFPA 3C2PA 1AFPA 1DD2A 3S17H 2D0OA 1R4PB 4J6HA 1CFMA 2K04A 1HR0L 1PH1A 1FNWA 1TY2A 2N88A 3HG9A 1M8AA 2F0GA 2GVAA 5C3EH 1U4RA 4HJAA 1N33L 4M8AA 2KCMA 4X6AH 4BA1I 2FJ2A 5KYLA 1B3AA 4BBRG 1TWGB 3GQBA 5IWAL 4A3FH 4QB4A 4YWMA 5M9OA 1N34L 1H9MA 4LFAL 3QOLA 3AMUA 4PMCA 3PUVA 4JC0A 1CT1D 4DUZL 1LT4D 5CYUA 5KYIA 3NK9A 3KF8B 2K6AA 1GD7A 1I4RA 3DWAA 3T13A 5CORA 3I56A 2JA5H 3I4MG 1VQ9A 1TWFB 3F8TA 1E24A 5LL6X 4LF9Q 1HH2P 4JI3Q 2RBMA 1HZCA 4K0KQ 2AWNA 4G4KA 1EY7A 2D62A 3CKIB 4DV5Q 4DV7L 1XNRL 3K7AH 1D7QA 3T1YQ 2PW7A 4JI3L 1LTTD 5KIXA 3PO2G 3OIPA 1V8QA 3EVQA 3MFGA 1WOCA 3HEJA 5ELOA 4DV2L 4IJHA 2GVBA 5EPLA 4HSVA 2L12A 4Z9CB 2J7ZA 2H5XA 4DF7A 3PF4A 1LTGD 3RZDB 3HKZB 3HOWB 1U4MA 5D3IB 2RDGA 5C3XA 2ZXOA 1VMCA 3FDTA 2RDHA 2HHHQ 2RCFA 3KLRA 1Y8PB 3EQLC 3T1YL 3E0JA 5GQOA 2XTIA 1EY6A 1P16A 2E74C 1VQKA 3GTPH 4TKOB 1FD7D 4FF4A 3G71A 1IBLL 4DR3L 2RDFA 5FJ8G 5GAEC 2E2HB 3G48A 1VQ5A 3H3VC 4JBKA 3KF8A 3L2PA 2F0MA 5JEAG 1SYFA 1TS2A 4NXNL 4K14A 4B9WA 5C44B 3ITPA 2ZJPA 1ET6A 1QJOA 2EVBA 1SYGA 2L15A 2XSCA 1EFWA 4OWXB 3QB3A 4IJLA 1XYIA 3VYRA 4OX9Q 3WOFA 4CJ1B 3SK6A 4BBRH 3FPUB 3CCMA 1PA6A 3GTQH 1PH6A 2CW0D 4KI0A 4DFAA 2NWGA 3CCJA 3VA7A 2KEEA 2RKSA 2HQEA 1SAPA 2B2UC 3Q24A 2E2IH 1QCBD 1Q8KA 4RHRA 2HDLA 3D6CA 3NXWA 5IYCG 2OXPA 2F52A 2D5DA 3M85A 1HZBA 4B3ML 3H0GB 3MC0B 1Q3LA 2K52A 2A1AA 3RZOH 3PO2B 1IYVA 1KNEA 1I3QB 3GTMB 1H9SB 1XTDA 3GP7A 3CXCA 4DUYL 3HOUB 4X65L 1O7IA 4A3JH 3TSSA 4LF7Q 1C9OA 1PTOD 4TSSA 3OWFA 2LSSA 1PRTD 2MJ8A 1RTOA 4DUYQ 4UY8C 4GKJQ 2UXCL 1SXTA 1L2FA 5FLXc 4FDBA 1J9OA 3HP3A 5ELEA 4JBMA 2EIFA 4DR2Q 2JQOA 3K80C 3CU7A 1XJVA 2F0TA 3J80E 1NJIC 2BA1A 2YTYA 2OEOA 2C9OA 3MTSA 1Q7YC 2B63H 3S16H 4J1MA 3CMEA 1LACA 2EOTA 3PIPA 2CWAA 4A3IH 1FL0A 2DY7A 5M5XB 1HA6A 1XNRQ 2YU9B 2EY6A 4EQNA 1GXDC 3OYYA 4NDXA 1CQVA 1K83B 3V96A 4I7ZC 4IUQA 2DJGC 2JN4A 4IFDJ 4LMQD 5JPNC 2VNUD 2F3IA 3GD7A 1WTPA 1HFGA 2CHBD 1F2ZA 2NVYB 3E0EA 4KHVA 3KBGA 4PMBA 3J81E 4UP7A 2F4VL 1F2MA 1N32Q 3ULJA 4DNIA 1JWMD 2N3SA 4KHZA 1CA5A 4KKUA 2AQ3B 3N6RA 2CFMA 3VYUA 2VQFL 1BBUA 1CZWA 5C4ZA 5G3LD 1RODA 2G5DA 1QUQA 3BVGA 4IO9A 3S2DH 4IUTA 4X62L 3AB9A 3T51B 1IZ6A 4BBSH 1DCZA 5IGGA 4DV2Q 2KENA 3BZDB 2Q8RE 3OMCA 2KECA 4A3FG 1NR4A 3OWEB 4OL7A 5JJKA 5CR3A 3DM3A 3LNNA 2IT1A 1BO0A 4KKTA 4LW1A 4JI7Q 4L6TB 1MD2D 3J80i 1GO3E 1YHAA 1H95A 5C0XH 1JE4A 3KF6A 2JK8A 3HGBA 1PH8A 1EYGA 1FR3A 2DUDA 3CP0A 4ABNA 1AN8A 2UUAQ 1SNPA 1HTPA 1HNWL 3TZDA 2J4XA 1G291 3BS1A 2O5JC 3CF5A 1DM0B 4IFDG 2PQAA 3A7AB 5DNFA 2WFWA 3I70A 1IBML 4H13C 4DR1L 1WYDA 3BZCA 2A6ED 3C1EA 2OWOA 3I90A 1Z6HA 4ZYSA 4BBRB 4K2KA 1Q46A 4JW0A 1BR9A 1CSPA 4LFBL 1Y69U 3KLSX 3G6EA 3UDGA 3QWNA 2AUKA 3SK8A 2A68D 4IUPA 3UE0A 5BN4A 2F3VA 4C3JH 3H15A 1STHA 2G9DA 4C3HH 4GOPA 1T5XD 3D4WA 1PH4A 3KLWA 1NTGA 5IP9G 3PIO3 3U4ZA 2KCTA 4XT1B 1I94Q 3NTIA 3GTQB 4ZRZA 4QIWE 2RHQB 3UDXA 3STBD 2OTJA 1TR5A 1YI2A 2F4VQ 4HJ7A 5IP7G 3R93A 5IGDA 4BBSG 3LWUA 3CCLA 3A56A 4I7AA 1SNOA 2DNEA 2G9HD 4DGZA 4A3GG 1HCZA 5FLMH 4B3TQ 2B63G 2A8VA 3MVVA 1WTQA 1WTOA 1CTMA 3TMEA 5C5MA 1LV9A 1I5FA 1SBBB 3KFUA 4LFCQ 4L5TA 3Q8DA 4IZ8A 1C4QA 5CBAE 4CHTB 4N9TA 1K8AC 3SGIA 1Y14B 3SDZA 1SFOH 2K5QA 3GTLB 4IUNA 4YCWA 3JC66 4CBVA 2RSOA 1YHBA 4ID6A 5KGUA 1GOZA 3FP9A 4TQUS 1ICWA 4A3IB 2R92B 2B2VA 1OXUA 5FO9B 1AZQA 3JAMc 4POFA 2I5HA 1V43A 5IT9E 4GN3B 3W1GA 2WIIB 1E3PA 3HKZG 3HOWG 5E3FA 4EQ5A 3PIP3 2KEDA 4GKKL 4JI0Q 4LAAA 5CMDA 4MNOA 3U9SA 1Y1WH 4JBJA 4DK1A 3SEBA 1GUNA 4BXXG 5FLMG 3E3XA 4R8NA 3QR8A 5EPJA 3S1RB 1DOMA 4RG1A 2CH4A 1W3SA 4KMUC 4KD3A 2BE5D 3J81j 2LS01 4K6LA 1ESFA 2AKWB 1HRJA 4XDXA 5HGQA 1XWEA 4RGNA 1PTOF 5EBDA 1JB3A 1A8VA 4HN7A 1SE2A 2PI2E 1E2VA 3NSWA 4HIDA 3L7ZC 1JCKB 4J8QA 4BXXH 1JWUD 2MNAA 3OTOL 2ALYB 3R3OA 1VQAA 1MSHA 4A93G 2R7DA 1CKMA 5I6YA 4LF5Q 3A74A 5LL6S 2JE6I 1EYDA 1YEZA 4YCUA 1M1KC 2DN8A 3P1HA 1WI5A 4PZ8A 1EEID 4PZ7A 1W2BA 1A6XA 4JI4Q 4KLKA 5DLQE 4C2MH 1S5DD 3CC7A 5T1GA 1HQRD 3A8JE 4XQQA 1SNCA 4DR3Q 1CHQD 4LNQA 3VR4A 1EY4A 1VQBA 2AHOB 4OWTB 2AQ1B 1Q81C 1VCIA 2PW5A 1DOLA 4C56C 3R2IA 4RHSA 2K4KA 2WKCA 4AIMA 5F2DA 1A63A 4KJOA 2L55A 1KRTA 2OQKA 4P2CB 2A5HA 1U5KA 5I9OA 5IGFA 1PYBA 3AEVA 4B3SQ 4H44C 4QQBX 3H3VH 3HOVG 3D8GA 4A93B 4RH6A 3A0JA 4QIWB 1VQ6A 4LFBQ 1X65A 1UUPA 1V9PA 1L1OC 1Q8IA 1Y8NB 1JB7A 2R92G 2DJFC 2R7ZH 1D1KA 1VQPA 4YWLA 1TWGH 3RZOB 1H9SA 1U4LA 4AYBE 4DUZQ 1YHQA 4A3CH 3ULPA 2QCPX 1WCMH 3CAMA 3K8AA 1DYQA 1S5ED 1ET9A 1CZGA 2EYPA 4DAYB 1SMYD 1WTHA 3NBIA 4KN7C 3A55A 4RA8A 5K5PA 5EGTA 1EYAA 2UXBL 4B3SL 4C3HB 1GUOA 3PO2H 3PV0A 2Y0SG 2VQEL 1HUMA 4ZKBB 4YY3L 3LGJA 2VUMB 3MZ5A 4G7ZC 1LT5D 1SLJA 4AH6A 1C0AA 2R7FA 3NWSA 3NUCA 1TY0A 4JI1L 2K14A 1S4ZA 2F0KA 3SHLA 3Q0AA 1TWHH 1X6OA 1M90C 2JA7G 2HD3A 1BKBA 1H9RA 4JYAQ 1BNZA 1JT8A 3CCUA 4K5VA 3KLSA 1U9RA 1HZ9A 4KHPL 3J7ZC 1WVLA 3PUWA 2VQFQ 5A35A 2ZM6Q 4IFDI 4LF9L 5J1ZA 1DZ1A 3Q23A 4GOPB 5EPKA 1YNXA 5BN3A 2F0IA 3I55A 5TSSA 1IHZA 1KDBA 4O2DA 5ELDA 3T53B 2QILA 2JA7H 2O5IC 1JE5A 4DNTB 2FFKB 4LFAQ 2NBFA 1KQSA 2UUAL 4A3LG 3I4NH 1G91A 5C3EG 1GHJA 3TP7A 1IXRA 1STYA 2BH2A 1QILA 5E4XA 3J81c 5HURA 2Z4HA 3TZUA 3S1NH 1A0IA 3W5OA 4U673 4KN4C 1UEAB 1L0XB 3S1MH 3L3OC 4A3BB 1OXXK 1STAA 2R7ZB 3KOJA 1FGUA 3K0YA 1BCPD 1UWVA 2UXCQ 4FXDA 4K6DA 4AYBB 3K6OA 1BOSA 4BS9A 1EWCA 1BF4A 1II3A 1WTVA 2CQAA 1HPCA 3PUZA 4WRDA 2O4XA 4B9XA 2PNRC 2K7VA 4XQJA 1M4VA 1G6PA 4LUVA 3CC4A 4DKAC 5IP9H 4JOIA 3RZDH 3VDYA 3HOWH 4A3MG 4FF3A 4LF6L 1GUTA 4H02A 1YVCA 1GUGA 4X66L 2CQOA 1MJEA 1GUWA 3KF6B 2A68C 5CV4A 4R4QA 4NKLA 2B2TC 3QIAA 1BXTA 3TDQA 2XWBB 3URYA 5M3FH 3OIQA 2GA4B 2OF1A 2Z6KC 3BVZA 1HNWQ 4A3JG 3S17B 4A3BG 1LTSD 2PZUA 4BY1H 1VQEA 1LO5D 1SYEA 1NSNS 1SYCA 2C35B 3TREA 2WV6D 1C48A 1RL2A 2EY5A 1AEXA 2K5NA 1JOKA 1O7LA 3BDOA 4RKBA 2TSSA 3KJPA 5C3EB 1QNKA 2PI2A 1J5EQ 1UEBA 4A3FB 5IYCH 2L5TA 4JI6Q 2SNSA 3BU2A 1NY4A 2JA5G 1VF5C 4KKSA 4B3RL 2MUYA 2CCZA 2I07B 2YYZA 2YV5A 2VS1A 2IY5B 5C4HA 3S1MB 3BG3A 2NN6G 4GZYC 3WWVA 1KLUD 1JJ2A 1I4HA 2DNCA 3VYTA 3K58A 4RMFA 1EIFA 4DNRB 3BDCA 1AZPA 1ASZA 1SN8A 5C6AA 4DV7Q 3NWTA 1K83H 5L37A 2P5ZX 4A3JB 3RN2A 2WB1E 4X62Q 4GKKQ 2JA8H 2RSNA 2R93B 1SMYC 2KA7A 1V1QA 2OQ0A 4UP8A 4OO1H 1TVXA 4MHEA 2E76C 1SROA 3AU7A 4A3EG 4Y7NH 1SE3A 2MO0A 1L0WA 2IPKD 4IUUA 5KNCA 4Y52H 2K75A 4J15A 1E0BA 1EUJA 1S72A 2XRQD 1N8RC 4LJZC 4DV1L 4HIOA 2NN6I 2J0TD 3M4YA 1WD0A 3A54A 4JI7L 5IGBA 4HCSA 4MTKA 1NR2A 2HCCA 5M3FB 4KHPQ 3TEHB 1IBLQ 2BOSA 2CKZB 4FP5D 5DEHA 2ZTEA 3MXNB 3J81L 4FVMA 1FJGL 4K5XA 1S5FD 1EZ6A 2B2TA 4X3UA 2XN9C 2XIWA 1WTRA 4L5SA 4HSPA 5GAGC 1QWYA 4RCOA 1MI2A 3SK4A 5C44H 4P71A 3OHXC 1HJPA 1MGSA 3U50C 2E2JB 4GLAC 1XTCD 2PMZB 2A73B 1HNZL 1VQDA 4GNXB 2WB1G 3DLLA 1NE3A 3AQQA 3EA6A 3GDEA 1G51A 2WACA 2KHJA 4DR1Q 4HIMA 5CV9A 1EL0A 1TWAH 1I50H 2CH4W 3RLFA 3ONAB 3GTJH 1FGBD 2GN5A 5EKIA 1SDFA 1ZXTA 3H09A 1LM0A 3FVQA 3CPWA 4C1NK 5C44G 1CKNB 2NZHA 3M7GA 3WDNA 2E2JH 1EIYB 2JA8B 4DV4L 1W6KA 4GS3A 2X6GA 4CGYB 3RUZA 2KQ3A 3DXJC 5IY0A 1Q90A 3F2DA 5FK9C 4M1UB 3W3AA 3HOUH 1WJJA 1IBKL 4A3LH 3EBEA 3PIOA 1PFMA 1GVPA 4KY5A 1EQQA 1G6ZA 3K7UC 3BYYB 2EYLA 1VQNA 2F0NA 4LK1C 1V1OA 2QW7A 3KBXA 2AMCB 2EXZA 3I72A 3KK7A 3S9WA 2BDNA 4A3GH 2EYMA 2ZXRA 2R93G 3FKIH 5CV5A 4DV1Q 3DHQA 3NE5B 5J3BA 5M5YB 3CRKC 3UI2A 1Y1WG 1Y1VG 4IPGA 5M5XH 4IUVA 2OT2A 2WAQE 4IPCA 1B44D 3EFXD 2F4IA 5BR8L 1STBA 1IL2A 4LF7L 5M5WB 2NVTB 1CQFA 3GTJB 3ERQA 4FF2A 2NTSA 2EYOA 2WB1B 3IFTA 2E2HH 2NVQH 4ALPA 4NB3A 2EY1A 1S3OA 2XRSD 3IRBA 2JA9A 3I4MB 3FKIG 3FHWA 1B50A 1WTWA 4DXFA 1B2TA 1R4QB 1BVSA 1D6EC 2O2LD 4UDUC 4P74A 1SR3A 4XXEA 1N32L 3PF5A 1PH5A 5IYDH 5JJLA 1PZKD 3STBC 4P75A 1XNQQ 2L11A 1WCMB 5FKAC 5AFWA 2ZXPA 4BY1G 4Q0FA 4HEDA 4IPDA 1EY5A 2B3GA 5A2QE 2EZVA 1N36L 4OONA 4A3DG 2PQAB 1X55A 2D0PA 5A2QL 4F87A 3BYTB 4LF8L 4DN4M 4WJ4A 2PPBC 2R7ZG 1JQYD 3S14H 4DU9A 1LYLA 1YNND 3RLNA 1IKMA 3M4QA 2M00A 1QVFA 2R93H 5FO8B 1KXLA 5FO7B 2WAQB 2QGQA 1EY0A 1UE6A 3J80c 5M5YH 2Z8LA 1EWIA 1JJCB 4OX9L 1EIHA 4GN5A 1NAPA 3DWQA 3D4DA 2F1MA 2L4NA 4CDEC 4X64L 2QEXA 2PO4A 2Z1CA 5JEAJ 2UUBL 3QO2A 1B53A 4OGQC 4C3HG 1TQOA 1E2WA 4GN4B 2UUCQ 4X64Q 2FMCA 3KJOA 4JI8L 3TP8A 5COYA 3VR6A 4QGUA 2IW3A 3N52A 3R8BA 4B3MQ 2YTVA 1PFSA 5BR8Q 1VQ4A 1VS0A 3S1RH 2SNMA 2LFNA 3M4PA 3J7AF 1LT6D 3R2TA 2NB0A 1CA6A 4DV6Q 1YZ6A 4ZKCB 2VQEQ 4V190 3K5NA 2BE5C 4OHJA 1I94L 1QVGA 3ZYYX 4HJ9A 1UE7A 5D3DA 4NXNQ 3RN5A 5I6WA 5T1IA 1O7ZA 3HOZH 5KEEA 2F0SA 4UHVA 5E4WC 1AE2A 5M3MH 1VQJA 2BA0A 1ML0D 4IN3A 1Z7TA 2ID0A 2F3WA 1SEBD 5LMUQ 3S14B 5I2YA 2LXKA 1L1OB 1RKNA 3L0OA 2TMPA 1ZEQX 2NVXH 1EQTA 5LMUL 1N36Q 4BWGB 4DR6L 2EQSA 3GO5A 3S24A 2E2DC 2QA4A 3C3LA 2YTXA 2HIVA 2K1BA 4FXGC 3CQZH 3TP5A 4JYAL 4HTHA 3A7LA 1NUCA 1D8LA 2AUJD 4KTAA 4DK3C 4HMJA 1CKOA 3E9HA 3S2HB 1F2YA 1CK1A 2SDFA 2AQ2B 1FNVA 1SYDA 5J22A 1BBWA 3P75A 5E7NA 1X3PA 4KK7A 3BDLA 1G8ZD 4HCEA 4CJ2C 3K57A 2UXDL 1QG7A 4APVA 1C7YA 5J39A 4O0AA 1QUQB 2F0WA 1YJ9A 1YNJD 5M3FG 1SE4A 2UUBQ 5M5WH 2NVTH 2K5WA 3A8KE 2EYJA 1Y8OB 3HRZC 1XPOA 3SE0A 2XVSA 1P8LA 3I4MH 1PRTC 2MHVA 4RKLA 4X66Q 2ZJRA 2A6EC 1B9MA 1HZAA 2JA7B 1Q82C 4O42A 5GROA 2NZ1D 3MFYA 1HQMC 2IL8A 5M3MB 3HOYG 3EROA 3FEWX 4GKJL 2D2CC 3S15H 4GNXA 5HY6A 2JEAI 4A75A 2A74C 2LXJA 5ELBA 1ZYRC 4JOIC 1PZID 5NUCA 1G2SA 2HQLA 3PGZA 4DV0L 4Y7NB 5EJWA 1QOHA 4L8JA 4JBWA 3H94A 2SOBA 2A6HD 5C0XI 3MAQA 3U58A 1KDAA 2MQHA 2FMMA 5LMNL 1VQMA 2PCFB 4R9WA 4KD4A 4DR6Q 2WINB 1J5EL 1RDPD 2QKIC 1OO9B 2AWOA 2N78A 1Z47A 2E5LL 4DR2L 2R6GA 4ZQ3A 2ZJQA 2Y0SE 4DAYA 4OELB 2HIXA 1MBYA 3RLOA 1TWAB 1VQ8A 1PZJD 1N9WA 1NNXA 1FYCA 4R1JA 3VR3A 5M3MG 3HOYB 1HUNA 3U4VA 1AH9A 5FJ8H 2MPMA 1B9NA 1SJED 3SR1A 2N55A 1X56A 5KRUA 2OTLA 4POGA 4A3KB 4JK1C 4UP9A 2ICEC 3E6ZX 4C1NI 4ODGA 1Q1BA 2F0DA 3A8IE 4ILWA 4RWSC 1VQLA 3HOZG 1J8IA 3P20A 3HOXB 2ES2A 4JI5L 1Y1WB 4DK6C 2JA6G 3I4OA 2Q2UA 3GTPB 4BY1B 3D4RA 3FPPA 1S40A 1TWCB 1HXYD 1PFBA 4HIKA 3Q6SA 2KHIA 1VF7A 3DM1A 3HOVB 1I6VC 3M9BA 1QVCA 1EOVA 3VR5A 3AFQA 4QF4A 1LTID 3UDIA 5C0XJ 4EQOA 4RGOS 1F2LA 4JI2Q 3UDFA 4ZUIA 4RGMA 1EU4A 4JG2A 1GHKA 2K50A 4EX5A 3HOXH 2PMZE 3F2BA 1KD1C 2B8FA 4DAVA 1PTOH 1RF2D 2ZT9C 5GADC 1X32A 4YY3Q 1PYSB 1V1PB 3J80L 3GTGB 2B2UA 2IX0A 3NELA 1CM9A 1STGA 2QDBA 2Y0SB 1BBXC 1I6HB 5C0XG 4XIGS 1VQFA 3P7JA 3E5SA 4G7HC 1IW7D 3GTKB 3F2UA 1L0YB 4NXML 4R4IA 3PQIA 4CJ0B 1E22A 2KOLA 1D1IA 1ONLA 5JPMC 3M4OB 2I46A 3ERSX 4H0LC 1SMXA 4PQXA 5C3WA 2ZTDA 3ZJYC 4JI6L 1OXTA 4WFN3 5GAHC 4L5QA 2F0LA 2KCCA 3G7LA 3MWYW 3BVMA 1MHWC 2F0JA 2WP8J 4K2LA 3J81i 1RCVD 2F0FA 4KV6A 4DR7L 2NZOA 4ZUJA 4JPBW 1AP0A 2FHTA 2CW0C 3MEHA 1SRUA 3S1QH 2BH8A 1XPRA 4JI4L 5AJ3Q 4XYQA 2KUMA 3HS0C 4QL5A 3QG1A 5IYDG 4OO1G 2NYZD 2RF4A 3HKSA 3HKZE 1I50B 1MSGA 1PLFA 4XT3B 3I4NB 2EJFC 1B1ZA 1C8CA 1YJWA 4HMIA 3MA2B 2PZWA 1ZYRD 3TS2A 1LABA 2H4OA 1F9SA 5IYBH 1STEA 4NMZA 3OW2A 1PVOA 1HR0W 1KC8C 3T1HL 3DEOA 1DOKA 1GJXA 4AQYQ 1EEFD 3NQTA 2KVMA 4JI2L 2E8GA 1H9JA 3CHBD 2JA8G 1BCPF 4CKCA 2VL6A 5JEAH 2B29A 2KCNA 3UE1A 4FO2A 1LTLA 1N33Q 1OTCA 5HGTA 3ND9A 4ZCKA 2Z6BA 4C3IB 4JCVE 1I6HH 3H6MA 4JI5Q 4NW2A 4PMWA 5EBCA 1EOTA 1XMOQ 3IL8A 1X3FA 1QZGA 3JAME 5K36H 4DV4Q 1HHVA 1QZHA 1X9NA 1K73C 1NCVA 4N9PA 1S5BD 4R8IA 2E5LQ 4JI0L 5DM73 1YJNA 1JMCA 2QDLA 3IAYA 4H7BA 1GUSA 2MO1A 1UAPA 1JR0D 1CKNA 1RD9D 1VMPA 1R9TH 4YIJA 1PRTF 2L1BA 2RA4A 1A2UA 1X54A 2JSOA 1E7ZA 1JJGA 5DAUA 2MP1A 1E2ZA 3JAML 1QB5D 1K28A 4YWKA 5CBEE 1GKHA 1A62A 1K8GA 1UE5A 4DPGA 1TWCH 1OXVA 4OIKA 1O80A 3CCQA 2WAQG 3NTHA 3HOVH 4ZK9B 1Y1VH 4WJWA 4A3MH 5LMNW 5ISRA 5D65A 2PZTA 2Q2IA 4X3TA 4C3IG 2JEBI 1YITA 1KL9A 5JAVA 1B70B 1HNZQ 1EU3A 4RFBA 1XMQL 3H0GH 3TN2A 2KJXA 4B3TL 4LUOA 3I4LA 1LTBD 1SNMA 2RQXA 4CDFC 5C4XB 3RNUA 1BCPC 3H0GG 1G2TA 1Y1VB 2EYHA 1WCMG 2F0VA 1PV4A 3V2TA 2V4DA 4DR5L 3TBIB 1PH9A 3GV6A 1IYUA 3CQZB 3X3NA 3S2DB 2PNHA 3PCOB 4A3DH 4ULLA 4LF4Q 3K0XA 1PRTB 4UPAA 4IFDH 1TS3A 1ENCA 1O7YA 3EIVA 1E1OA 1HNXL 1UNSA 4DXGA 1X3EA 1BQQT 3M4OH 1S5CD 2V1CC 3OOCA 2B39A 3KUPA 1TT2A 1WD1A 5ELNA 1ENFA 2CWPA 3E9IA 2C5CA 1EFID 2K33A 3VR2A 1TU2B 5LHY1 1Q12A 2UUCL 4B08A 3CCSA 4O1NA 1JWSD 3M7NA 3RMHA 1NBWA 5FLXL 4OEMB 1XXGA 3FRPB 1SFOB 3GTLH 2L0CA 4DR7Q 3NQIA 1JOOA 4I65A 4WORA 2YU9H 1XPUA 2EPBA 2ZM6L 1V1PA 2VW9A 4HAEA 1JICA 1YNJC 2IJ0A 3JAMi 5FLXE 2B2YA 1FVIA 1W6JA 2FXQA 3NBHA 1K3BC 1KRSA 3CPFA 4GLXA 4A93H 4KJNA 3D31A 4U68A 4MIUA 4DR4Q 3NP8A 3D6WA 4L63B 4RCNA 1CHPD 2EXDA 1HR0Q 3DWPA 5JJIA 4UAIA 1I4PA 5IT9L 4A3CG 4L5RC 5EKLA 2EE1A 2MGSA 4MZ9A 4JV5L 2ENBA 1STNA 2Z6KA 2B8GA 1PFNA 1EY9A 3HZXA 5IWAQ 1D5ZC 1OXSC 4G57A 4XYOA 4ZAIA 1SNDA 2B2YC 5I9PA 2F0PA 2ATWA 2I5LX 2VY3A 3SXHA 3DEPA 4CKBA 4BY7B 1K0RA 2IX1A 3CCVA 2RHSB 1ILPA 4JI8Q 4V0BA 2F0UA 2HDMA 3FKIB 1QE6A 2HCIA 1PXUA 1HA5A 3D0FA 1NMFA 1A3VA 2PYKA 2XWJB 1AW7A 4MN3A 2K5HA 2HHHL 2EY2A 4QJFA 3K5LA 1RJTA 1IL8A 2F03A 1PH7A 1K3RA 2M9VA 3G4SA 3HOUG 1KAAA 2N8NA 1PTOC 2NTTA 1KNAA 1TIID 1F9PA 4LF8Q 3GV3A 1R9TB 2EJMA 2SEBD 1K8MA 1PH2A 3QOJA 4NXMQ 1JORA 4IOCA 3VA5A 2BDOA 3ER0A 1IBMQ 2ICIA 1TKWB 1X3QA 5IOCA 1CUKA 1U4PA 4NP5A 3V05A 1LUZA 1XMQQ 3J7A5 4X65Q 3S1NB 3I2ZA 5CV8A 4A76A 2NVXB 4EVOA 1IYJB 2X6LA 1MIUA 5JVG3 3BJUA 3EN2A 3H3VI 4DV3L 1PTOB 2B2WA 4ZLTF 1WTXA 4P72A 3MHBA 2NN6H 4RAUC 2D9UA 4DR5Q 3PO3H 4KY6A 2IWHA 2M2LA 5IODA 3RD4A 1IKLA 1SNQA 4QY7A 4QCLA 4AQYL 2I0QA 3VYSA 4JV5Q 2K03A 1TWFH 3I73A 2XGTA 1Z9FA 3KDFB 3I91A 3H91A 3BZKA 3X3MA 1EQRA 3TS0A 4NPSA 4K8JA 3LX0A 3NHHA 4P73A 3CD6A 4OWWB 1F9QA 3CW2C 1E1TA 2DY8A 3F1ZA 5IT9c 3PO3B 3A5ZB 4KY7A 1YBYA 4DR4L 4A3GB 1VQCA 2N49A 1F9RA 2B63B 3S16B 2K5DA 3NTKA 1KTKA 2Z4IA 1B4OA 3T16A 3OW7A 4HJ8A 5EAYA 3IKJA 3J7AV 3KDFA 2RVLA 4A3EB
chains in the Genus database with same CATH topology
1FL0A 2R92H 1U0LA 2K5NA 1AH9A 3PSIA 3W1BA 5FJ8H 3KJPA 1MKHA 1X56A 4YHHL 2OTLA 4POGA 1XNRQ 4UP9A 2OCEA 4LF6Q 4IPHA 3HOYH 2PI2A 1J5EQ 3OYYA 1UEBA 1Q1BA 1IBKQ 1VQLA 3HOZG 5IYCH 4JI6Q 2ES2A 5LMNQ 3BU2A 4JI5L 1KAWA 4R4OA 1NY4A 3PUXA 4DK6C 3I4OA 2Q2UA 2JA5G 2JA6G 4IFDJ 4XTCS 1S40A 2VNUD 4HIKA 4B3RL 1DGSA 2KHIA 4R4CA 2F3IA 3GD7A 3M9BA 2CCZA 2YYZA 1QVCA 2YV5A 1EOVA 3AFQA 3E0EA 2VS1A 3B6YA 3UDIA 5C0XJ 1ASYA 2IY5B 4UP7A 2F4VL 3TRZA 1N32Q 2NN6G 3WWVA 3ULJA 2DGYA 4DV0Q 1JJ2A 4JI2Q 4DNIA 2ZTCA 2N3SA 3UDFA 4RMFA 1EIFA 1ASZA 4KHZA 1SN8A 4DV5L 4JG2A 4DV7Q 2K50A 3K81C 4EX5A 1K83H 3HOXH 2PMZE 4PZ6A 3F2BA 1KD1C 2CFMA 3RN2A 2VQFL 1AE3A 2WB1E 4X62Q 1BBUA 4GOPC 2JA8H 5GADC 4GKKQ 4YY3Q 2Z0SA 1PYSB 3RR5A 5IYBG 1UE1A 2OQ0A 1V1QA 4UP8A 1QUQA 2IX0A 3NELA 1SROA 2JJQA 4JI1Q 4A3EG 3S2DH 4IO9A 4X62L 1I3QH 4Y7NH 3GTMH 4BY7H 2MO0A 1L0WA 1IZ6A 3NBHB 3A5UA 4BBSH 4DV2Q 5C0XG 4XIGS 1VQFA 1PHJA 2KENA 4Y52H 2K75A 4A3FG 4J15A 3ULLA 1EUJA 3F2CA 1S72A 4AYBG 5JJKA 3I4NG 1N8RC 4DV1L 4HIOA 2NN6I 4LF4L 3DM3A 4NXML 2IT1A 4LW1A 4R4IA 1Q1EA 1E22A 4YHHQ 4JI7Q 4LUZA 4JI7L 2UXBQ 3GTGH 3ERSX 4A3EH 1Q86C 4KHPQ 3J80i 3TEHB 1IBLQ 2CKZB 1GO3E 1SMXA 2ZTEA 3MXNB 1YHAA 4LFCL 1H95A 1FJGL 1FJGQ 2UXDQ 3TQYA 3KF6A 2JK8A 2ZTDA 3ZJYC 1PH8A 1EYGA 2DUDA 3CP0A 4JI6L 1VQHA 4L5SA 1OXTA 4DAMA 4R4TA 2MFIA 4L5QA 5GAGC 2A19A 5GAHC 2UUAQ 5C44H 1HNWL 4P71A 5IE8A 1HJPA 3U50C 1G291 3CF5A 4GLAC 3S2HH 3CCEA 4IFDG 2WP8J 2PQAA 1B8AA 1HNZL 1NMGA 1VQDA 2WFWA 3J81i 4DR7L 4GNXB 2WB1G 2NZOA 3DLLA 1NE3A 3AQQA 3GDEA 1IBML 4DR1L 1WYDA 1G51A 3BZCA 2KHJA 4DR1Q 1J6QA 2OWOA 4HIMA 1SRUA 1TWAH 1I50H 1Q46A 3S1QH 2BH8A 3RLFA 1CSPA 3GTJH 2GN5A 5C4XH 5AJ3Q 1XPRA 2Q2TA 4JI4L 4LFBL 3G6EA 3UDGA 1VQOA 4QL5A 1LM0A 5IP7H 5IYDG 3CPWA 4TVAB 4OO1G 2RF4A 3HKSA 3HKZE 5C44G 1CKNB 3UE0A 1VQ7A 2NZHA 3H15A 4C3JH 1YJWA 2E2JH 1EIYB 4C3HH 2NVYH 4DV4L 4GOPA 3CC2A 3TS2A 4GS3A 1CSQA 1PH4A 5IYBH 3KLWA 1NTGA 2HT1A 5IP9G 1TXYA 3U4ZA 2KCTA 1B7YB 3OW2A 1YIJA 1K9MC 1I94Q 1PVOA 5IY0A 4QIWE 4DV3Q 2RHQB 3UDXA 3F2DA 1KIXA 3STBD 1HR0W 1KC8C 1SE8A 3T1HL 1YI2A 2OTJA 2F4VQ 4HJ7A 2VUMH 5IP7G 4AQYQ 3HOUH 4BBSG 2IHFA 3CCLA 4JI2L 2E8GA 1WJJA 2JA8G 1IBKL 2VL6A 3EBEA 3PIOA 2B29A 4A3GG 2VUMG 3UE1A 1KHIA 4A3LH 4GNXC 4MTNA 5FLMH 4B3TQ 1GVPA 1LTLA 2B63G 1EQQA 1HNXQ 1N33Q 2A8VA 1OTCA 4A4IA 3K7UC 1XMOL 4BY7G 3KYHC 1VQNA 1I5FA 2Q2HA 4JCVE 3KFUA 4LFCQ 1I6HH 4L5TA 3Q8DA 2UU9Q 4JI5Q 4YCVA 2RCNA 4PMWA 2AMCB 1XMOQ 1K8AC 1X3FA 3OTOQ 3SGIA 1QZGA 1Y14B 3NEMA 1SFOH 4DV4Q 4OXPA 4YCWA 1QZHA 1X9NA 1K73C 3JC66 4A3GH 4OO1I 3PUYA 2R93G 4JI0L 2E5LQ 1XNQL 3FKIH 1YHBA 5C4XG 5H1SE 4DV1Q 3NENA 1YJNA 1JMCA 3FP9A 5J3BA 1Y1WG 4LF5L 1Y1VG 4IPGA 4TQUS 5M5XH 1OXUA 2MO1A 2WAQE 4IPCA 1CKNA 3JAMc 1R9TH 3MEFA 4POFA 2ASBA 2K5VA 5BR8L 1IL2A 4PG3A 1X54A 2I5HA 1V43A 4LF7L 1E7ZA 1JJGA 3HFZB 4GN3B 3W1GA 1N34Q 3GTOH 1E3PA 1L1OA 2E2HH 2NVQH 3HKZG 3HOWG 4YWKA 4ALPA 4NB3A 4EQ5A 1S3OA 1GKHA 2VZAA 4GKKL 1A62A 3IRBA 1K8GA 1UE5A 2JA9A 4DPGA 3FKIG 4JI0Q 1TWCH 3FHWA 1OXVA 4MNOA 1MJCA 1VQIA 3CCQA 2WAQG 3HOVH 3M3YH 1Y1WH 1BVSA 4A3KG 1Y1VH 4JBJA 4A3MH 5LMNW 4P74A 1SR3A 1N32L 3HOXG 2Q2IA 4A3KH 3PF5A 2JEBI 1PH5A 4BXXG 4GLVB 5FLMG 1YITA 5IYDH 5JJLA 1KL9A 3STBC 4P75A 1B70B 4RG1A 1XNQQ 1HNZQ 1W3SA 1XMQL 3J81j 3H0GH 4A3BH 2AKWB 2KBNA 4BY1G 5C4JH 5HGQA 4LUOA 4B3TL 4K0KL 4IPDA 1A8VA 3RNUA 3H0GG 2B3GA 3I7FA 5AJ3L 2PI2E 2UU9L 1VQGA 4A3IG 4BA2I 4HIDA 3L7ZC 1PH3A 5K36G 3AYHB 1N36L 4OONA 4C3IH 4A3DG 2PQAB 4BXXH 1WCMG 1PV4A 2MNAA 1X55A 2D0PA 4DR5L 2I5MX 1PH9A 3OTOL 1GM5A 2ALYB 4LF8L 1VQAA 4B3RQ 2PNHA 3PCOB 4A3DH 4A93G 4WJ4A 2IHEA 2R7ZG 4IOAA 2R7DA 3S14H 4LF4Q 1LYLA 3K0XA 3RLNA 4HJ5A 2JA6H 1CKMA 4UPAA 4A3IH 3M4QA 3A74A 4LF5Q 1T9HA 1D7QA 2JE6I 1QVFA 2R93H 1KXLA 1YEZA 3EIVA 1E1OA 4YCUA 1M1KC 3ICEA 4ME3A 2QGQA 1UE6A 3J80c 1WI5A 4PZ8A 3T1HQ 1HNXL 1X3EA 5M5YH 3PO3G 3M4OH 2V1CC 4PZ7A 4WJ3M 1W2BA 4JI4Q 4KLKA 4LWCA 1EWIA 5ELNA 5DLQE 1JJCB 4C2MH 2CWPA 4OX9L 3E9IA 3CC7A 4GN5A 1X3GA 1RIPA 3CCRA 2QEXA 1WFQA 4X64L 1Q12A 3CMAA 4DR3Q 2UUCL 4LNQA 3GTKH 1VQBA 5JEAJ 3CCSA 2UUBL 2AHOB 4OWTB 4DV6L 3AFPA 1Q81C 3M7NA 1VCIA 1NBWA 4GN4B 3S17H 2UUCQ 4X64Q 3KJOA 2D0OA 2K4KA 4JI8L 4AIMA 3GTLH 1A63A 1HR0L 1PH1A 4QGUA 4DR7Q 1KRTA 4B3MQ 2OQKA 2GVAA 2YTVA 1PFSA 1U5KA 5BR8Q 5C3EH 1VS0A 4HJAA 3S1RH 1VQ4A 2YU9H 1N33L 1XPUA 2ZM6L 1PYBA 3AEVA 2KCMA 4B3SQ 3M4PA 2VW9A 4X6AH 4QQBX 3H3VH 3HOVG 4BA1I 3A0JA 1VQ6A 4LFBQ 4DV6Q 1X65A 1V9PA 1L1OC 1JB7A 1YZ6A 4BBRG 3JAMi 2R92G 5IWAL 1FVIA 2VQEQ 2FXQA 4A3FH 4YWMA 1KRSA 3CPFA 4GLXA 4A93H 1N34L 2R7ZH 3D31A 1I94L 4LFAL 1QVGA 4HJ9A 4DR4Q 1UE7A 3PUVA 4JC0A 1VQPA 4YWLA 1TWGH 4NXNQ 3RN5A 4DUZL 4DUZQ 4AYBE 1YHQA 3HOZH 4A3CH 3ULPA 3CAMA 1WCMH 3K8AA 3KF8B 1AE2A 5M3MH 1GD7A 2EXDA 1HR0Q 5JJIA 1VQJA 3I56A 2BA0A 2JA5H 3I4MG 1VQ9A 3F8TA 1E24A 2ID0A 4DAYB 4A3CG 4L5RC 4LF9Q 1HH2P 5LMUQ 4JI3Q 2LXKA 2UXBL 1HZCA 1L1OB 4B3SL 4MZ9A 3L0OA 4K0KQ 4JV5L 2AWNA 2NVXH 2D62A 2Z6KA 4DV7L 4DV5Q 3PO2H 1XNRL 3K7AH 3PV0A 3T1YQ 2Y0SG 5IWAQ 2VQEL 4JI3L 5LMUL 1OXSC 3PO2G 1N36Q 4DR6L 1WOCA 2EQSA 4YY3L 3GO5A 3LGJA 5ELOA 3S24A 2ATWA 4DV2L 2I5LX 2VY3A 4IJHA 2QA4A 2GVBA 1SLJA 4AH6A 1C0AA 2R7FA 4JI1L 2K14A 2H5XA 3PF4A 2YTXA 2HIVA 1K0RA 2IX1A 3CCVA 1TWHH 1X6OA 2RHSB 1M90C 3CQZH 1BKBA 2JA7G 4JI8Q 4JYAQ 4JYAL 1JT8A 3CCUA 1D8LA 4DK3C 2HHHQ 1CKOA 1HZ9A 3E9HA 4KHPL 3J7ZC 3PUWA 2VQFQ 3T1YL 5GQOA 2ZM6Q 3D0FA 4LF9L 4IFDI 2XTIA 1NMFA 1BBWA 1P16A 1VQKA 4GOPB 3GTPH 2K5HA 2HHHL 4QJFA 5E7NA 1YNXA 3G71A 1IBLL 4DR3L 1PH7A 1K3RA 5FJ8G 3I55A 5GAEC 3G48A 3G4SA 4O2DA 2UXDL 1VQ5A 2JA7H 4JBKA 3HOUG 1JE5A 2N8NA 3L2PA 4APVA 1C7YA 4LFAQ 1KQSA 4LF8Q 5JEAG 2UUAL 4A3LG 4O0AA 4NXNL 1QUQB 3I4NH 1YJ9A 5C3EG 2ZJPA 5M3FG 1IXRA 2UUBQ 5M5WH 2L15A 1PH2A 2NVTH 4NXMQ 2BH2A 1EFWA 4IOCA 4OWXB 3ER0A 4IJLA 1IBMQ 1XPOA 3J81c 4OX9Q 3CCMA 4BBRH 1A0IA 1P8LA 3W5OA 1PA6A 3GTQH 3S1NH 3I4MH 1CUKA 1PH6A 4X66Q 3S1MH 1LUZA 2ZJRA 1OXXK 4KI0A 1XMQQ 3J7A5 3CCJA 1HZAA 4X65Q 3I2ZA 3KOJA 1Q82C 5GROA 1FGUA 4A76A 1IYJB 1MIUA 1UWVA 3BJUA 2UXCQ 2E2IH 3EN2A 3H3VI 3HOYG 1Q8KA 4DV3L 4GKJL 3S15H 4GNXA 5IYCG 5HY6A 2JEAI 4P72A 2F52A 3M85A 4A75A 1HZBA 2LXJA 4B3ML 3PUZA 4DR5Q 4JOIC 3PO3H 2K52A 2A1AA 3RZOH 1G6PA 2HQLA 4LUVA 3PGZA 4DV0L 3CC4A 4DKAC 1XTDA 5IP9H 3CXCA 4QY7A 4JOIA 4DUYL 4X65L 1O7IA 3VDYA 4A3MG 4AQYL 3RZDH 2I0QA 4LF6L 3HOWH 4JBWA 4A3JH 4H02A 4JV5Q 1YVCA 1RL2A 4X66L 4LF7Q 1C9OA 2CQOA 1TWFH 1MJEA 5C0XI 3KF6B 2XGTA 1Z9FA 2LSSA 3KDFB 3U58A 2MQHA 5LMNL 3BZKA 1VQMA 4R4QA 4DUYQ 4UY8C 1EQRA 4GKJQ 3TS0A 2UXCL 4NPSA 4DR6Q 1L2FA 3CD6A 4P73A 1J5EL 4OWWB 3CW2C 5FLXc 4FDBA 1E1TA 3F1ZA 2AWOA 5IT9c 5M3FH 2N78A 3A5ZB 1Z47A 4JBMA 1YBYA 2E5LL 4DR4L 1VQCA 2EIFA 2N49A 4DR2Q 4DR2L 2Z6KC 2R6GA 2JQOA 3K80C 1HNWQ 2ZJQA 2Y0SE 4A3JG 1XJVA 4A3BG 1NJIC 2BA1A 1VQEA 2YTYA 2HIXA 3RLOA 4BY1H 1VQ8A 4HJ8A 1N9WA 2C35B 3TREA 5EAYA 1Q7YC 2B63H 3CMEA 3S16H 4R1JA 3PIPA 3KDFA 5M3MG 2CWAA 3U4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FL0 A;  2R92 H;  1U0L A;  2K5N A;  1AH9 A;  3PSI A;  3W1B A;  5FJ8 H;  3KJP A;  1MKH A;  1X56 A;  4YHH L;  2OTL A;  4POG A;  1XNR Q;  4UP9 A;  2OCE A;  4LF6 Q;  4IPH A;  3HOY H;  2PI2 A;  1J5E Q;  3OYY A;  1UEB A;  1Q1B A;  1IBK Q;  1VQL A;  3HOZ G;  5IYC H;  4JI6 Q;  2ES2 A;  5LMN Q;  3BU2 A;  4JI5 L;  1KAW A;  4R4O A;  1NY4 A;  3PUX A;  4DK6 C;  3I4O A;  2Q2U A;  2JA5 G;  2JA6 G;  4IFD J;  4XTC S;  1S40 A;  2VNU D;  4HIK A;  4B3R L;  1DGS A;  2KHI A;  4R4C A;  2F3I A;  3GD7 A;  3M9B A;  2CCZ A;  2YYZ A;  1QVC A;  2YV5 A;  1EOV A;  3AFQ A;  3E0E A;  2VS1 A;  3B6Y A;  3UDI A;  5C0X J;  1ASY A;  2IY5 B;  4UP7 A;  2F4V L;  3TRZ A;  1N32 Q;  2NN6 G;  3WWV A;  3ULJ A;  2DGY A;  4DV0 Q;  1JJ2 A;  4JI2 Q;  4DNI A;  2ZTC A;  2N3S A;  3UDF A;  4RMF A;  1EIF A;  1ASZ A;  4KHZ A;  1SN8 A;  4DV5 L;  4JG2 A;  4DV7 Q;  2K50 A;  3K81 C;  4EX5 A;  1K83 H;  3HOX H;  2PMZ E;  4PZ6 A;  3F2B A;  1KD1 C;  2CFM A;  3RN2 A;  2VQF L;  1AE3 A;  2WB1 E;  4X62 Q;  1BBU A;  4GOP C;  2JA8 H;  5GAD C;  4GKK Q;  4YY3 Q;  2Z0S A;  1PYS B;  3RR5 A;  5IYB G;  1UE1 A;  2OQ0 A;  1V1Q A;  4UP8 A;  1QUQ A;  2IX0 A;  3NEL A;  1SRO A;  2JJQ A;  4JI1 Q;  4A3E G;  3S2D H;  4IO9 A;  4X62 L;  1I3Q H;  4Y7N H;  3GTM H;  4BY7 H;  2MO0 A;  1L0W A;  1IZ6 A;  3NBH B;  3A5U A;  4BBS H;  4DV2 Q;  5C0X G;  4XIG S;  1VQF A;  1PHJ A;  2KEN A;  4Y52 H;  2K75 A;  4A3F G;  4J15 A;  3ULL A;  1EUJ A;  3F2C A;  1S72 A;  4AYB G;  5JJK A;  3I4N G;  1N8R C;  4DV1 L;  4HIO A;  2NN6 I;  4LF4 L;  3DM3 A;  4NXM L;  2IT1 A;  4LW1 A;  4R4I A;  1Q1E A;  1E22 A;  4YHH Q;  4JI7 Q;  4LUZ A;  4JI7 L;  2UXB Q;  3GTG H;  3ERS X;  4A3E H;  1Q86 C;  4KHP Q;  3J80 i;  3TEH B;  1IBL Q;  2CKZ B;  1GO3 E;  1SMX A;  2ZTE A;  3MXN B;  1YHA A;  4LFC L;  1H95 A;  1FJG L;  1FJG Q;  2UXD Q;  3TQY A;  3KF6 A;  2JK8 A;  2ZTD A;  3ZJY C;  1PH8 A;  1EYG A;  2DUD A;  3CP0 A;  4JI6 L;  1VQH A;  4L5S A;  1OXT A;  4DAM A;  4R4T A;  2MFI A;  4L5Q A;  5GAG C;  2A19 A;  5GAH C;  2UUA Q;  5C44 H;  1HNW L;  4P71 A;  5IE8 A;  1HJP A;  3U50 C;  1G29 1;  3CF5 A;  4GLA C;  3S2H H;  3CCE A;  4IFD G;  2WP8 J;  2PQA A;  1B8A A;  1HNZ L;  1NMG A;  1VQD A;  2WFW A;  3J81 i;  4DR7 L;  4GNX B;  2WB1 G;  2NZO A;  3DLL A;  1NE3 A;  3AQQ A;  3GDE A;  1IBM L;  4DR1 L;  1WYD A;  1G51 A;  3BZC A;  2KHJ A;  4DR1 Q;  1J6Q A;  2OWO A;  4HIM A;  1SRU A;  1TWA H;  1I50 H;  1Q46 A;  3S1Q H;  2BH8 A;  3RLF A;  1CSP A;  3GTJ H;  2GN5 A;  5C4X H;  5AJ3 Q;  1XPR A;  2Q2T A;  4JI4 L;  4LFB L;  3G6E A;  3UDG A;  1VQO A;  4QL5 A;  1LM0 A;  5IP7 H;  5IYD G;  3CPW A;  4TVA B;  4OO1 G;  2RF4 A;  3HKS A;  3HKZ E;  5C44 G;  1CKN B;  3UE0 A;  1VQ7 A;  2NZH A;  3H15 A;  4C3J H;  1YJW A;  2E2J H;  1EIY B;  4C3H H;  2NVY H;  4DV4 L;  4GOP A;  3CC2 A;  3TS2 A;  4GS3 A;  1CSQ A;  1PH4 A;  5IYB H;  3KLW A;  1NTG A;  2HT1 A;  5IP9 G;  1TXY A;  3U4Z A;  2KCT A;  1B7Y B;  3OW2 A;  1YIJ A;  1K9M C;  1I94 Q;  1PVO A;  5IY0 A;  4QIW E;  4DV3 Q;  2RHQ B;  3UDX A;  3F2D A;  1KIX A;  3STB D;  1HR0 W;  1KC8 C;  1SE8 A;  3T1H L;  1YI2 A;  2OTJ A;  2F4V Q;  4HJ7 A;  2VUM H;  5IP7 G;  4AQY Q;  3HOU H;  4BBS G;  2IHF A;  3CCL A;  4JI2 L;  2E8G A;  1WJJ A;  2JA8 G;  1IBK L;  2VL6 A;  3EBE A;  3PIO A;  2B29 A;  4A3G G;  2VUM G;  3UE1 A;  1KHI A;  4A3L H;  4GNX C;  4MTN A;  5FLM H;  4B3T Q;  1GVP A;  1LTL A;  2B63 G;  1EQQ A;  1HNX Q;  1N33 Q;  2A8V A;  1OTC A;  4A4I A;  3K7U C;  1XMO L;  4BY7 G;  3KYH C;  1VQN A;  1I5F A;  2Q2H A;  4JCV E;  3KFU A;  4LFC Q;  1I6H H;  4L5T A;  3Q8D A;  2UU9 Q;  4JI5 Q;  4YCV A;  2RCN A;  4PMW A;  2AMC B;  1XMO Q;  1K8A C;  1X3F A;  3OTO Q;  3SGI A;  1QZG A;  1Y14 B;  3NEM A;  1SFO H;  4DV4 Q;  4OXP A;  4YCW A;  1QZH A;  1X9N A;  1K73 C;  3JC6 6;  4A3G H;  4OO1 I;  3PUY A;  2R93 G;  4JI0 L;  2E5L Q;  1XNQ L;  3FKI H;  1YHB A;  5C4X G;  5H1S E;  4DV1 Q;  3NEN A;  1YJN A;  1JMC A;  3FP9 A;  5J3B A;  1Y1W G;  4LF5 L;  1Y1V G;  4IPG A;  4TQU S;  5M5X H;  1OXU A;  2MO1 A;  2WAQ E;  4IPC A;  1CKN A;  3JAM c;  1R9T H;  3MEF A;  4POF A;  2ASB A;  2K5V A;  5BR8 L;  1IL2 A;  4PG3 A;  1X54 A;  2I5H A;  1V43 A;  4LF7 L;  1E7Z A;  1JJG A;  3HFZ B;  4GN3 B;  3W1G A;  1N34 Q;  3GTO H;  1E3P A;  1L1O A;  2E2H H;  2NVQ H;  3HKZ G;  3HOW G;  4YWK A;  4ALP A;  4NB3 A;  4EQ5 A;  1S3O A;  1GKH A;  2VZA A;  4GKK L;  1A62 A;  3IRB A;  1K8G A;  1UE5 A;  2JA9 A;  4DPG A;  3FKI G;  4JI0 Q;  1TWC H;  3FHW A;  1OXV A;  4MNO A;  1MJC A;  1VQI A;  3CCQ A;  2WAQ G;  3HOV H;  3M3Y H;  1Y1W H;  1BVS A;  4A3K G;  1Y1V H;  4JBJ A;  4A3M H;  5LMN W;  4P74 A;  1SR3 A;  1N32 L;  3HOX G;  2Q2I A;  4A3K H;  3PF5 A;  2JEB I;  1PH5 A;  4BXX G;  4GLV B;  5FLM G;  1YIT A;  5IYD H;  5JJL A;  1KL9 A;  3STB C;  4P75 A;  1B70 B;  4RG1 A;  1XNQ Q;  1HNZ Q;  1W3S A;  1XMQ L;  3J81 j;  3H0G H;  4A3B H;  2AKW B;  2KBN A;  4BY1 G;  5C4J H;  5HGQ A;  4LUO A;  4B3T L;  4K0K L;  4IPD A;  1A8V A;  3RNU A;  3H0G G;  2B3G A;  3I7F A;  5AJ3 L;  2PI2 E;  2UU9 L;  1VQG A;  4A3I G;  4BA2 I;  4HID A;  3L7Z C;  1PH3 A;  5K36 G;  3AYH B;  1N36 L;  4OON A;  4C3I H;  4A3D G;  2PQA B;  4BXX H;  1WCM G;  1PV4 A;  2MNA A;  1X55 A;  2D0P A;  4DR5 L;  2I5M X;  1PH9 A;  3OTO L;  1GM5 A;  2ALY B;  4LF8 L;  1VQA A;  4B3R Q;  2PNH A;  3PCO B;  4A3D H;  4A93 G;  4WJ4 A;  2IHE A;  2R7Z G;  4IOA A;  2R7D A;  3S14 H;  4LF4 Q;  1LYL A;  3K0X A;  3RLN A;  4HJ5 A;  2JA6 H;  1CKM A;  4UPA A;  4A3I H;  3M4Q A;  3A74 A;  4LF5 Q;  1T9H A;  1D7Q A;  2JE6 I;  1QVF A;  2R93 H;  1KXL A;  1YEZ A;  3EIV A;  1E1O A;  4YCU A;  1M1K C;  3ICE A;  4ME3 A;  2QGQ A;  1UE6 A;  3J80 c;  1WI5 A;  4PZ8 A;  3T1H Q;  1HNX L;  1X3E A;  5M5Y H;  3PO3 G;  3M4O H;  2V1C C;  4PZ7 A;  4WJ3 M;  1W2B A;  4JI4 Q;  4KLK A;  4LWC A;  1EWI A;  5ELN A;  5DLQ E;  1JJC B;  4C2M H;  2CWP A;  4OX9 L;  3E9I A;  3CC7 A;  4GN5 A;  1X3G A;  1RIP A;  3CCR A;  2QEX A;  1WFQ A;  4X64 L;  1Q12 A;  3CMA A;  4DR3 Q;  2UUC L;  4LNQ A;  3GTK H;  1VQB A;  5JEA J;  3CCS A;  2UUB L;  2AHO B;  4OWT B;  4DV6 L;  3AFP A;  1Q81 C;  3M7N A;  1VCI A;  1NBW A;  4GN4 B;  3S17 H;  2UUC Q;  4X64 Q;  3KJO A;  2D0O A;  2K4K A;  4JI8 L;  4AIM A;  3GTL H;  1A63 A;  1HR0 L;  1PH1 A;  4QGU A;  4DR7 Q;  1KRT A;  4B3M Q;  2OQK A;  2GVA A;  2YTV A;  1PFS A;  1U5K A;  5BR8 Q;  5C3E H;  1VS0 A;  4HJA A;  3S1R H;  1VQ4 A;  2YU9 H;  1N33 L;  1XPU A;  2ZM6 L;  1PYB A;  3AEV A;  2KCM A;  4B3S Q;  3M4P A;  2VW9 A;  4X6A H;  4QQB X;  3H3V H;  3HOV G;  4BA1 I;  3A0J A;  1VQ6 A;  4LFB Q;  4DV6 Q;  1X65 A;  1V9P A;  1L1O C;  1JB7 A;  1YZ6 A;  4BBR G;  3JAM i;  2R92 G;  5IWA L;  1FVI A;  2VQE Q;  2FXQ A;  4A3F H;  4YWM A;  1KRS A;  3CPF A;  4GLX A;  4A93 H;  1N34 L;  2R7Z H;  3D31 A;  1I94 L;  4LFA L;  1QVG A;  4HJ9 A;  4DR4 Q;  1UE7 A;  3PUV A;  4JC0 A;  1VQP A;  4YWL A;  1TWG H;  4NXN Q;  3RN5 A;  4DUZ L;  4DUZ Q;  4AYB E;  1YHQ A;  3HOZ H;  4A3C H;  3ULP A;  3CAM A;  1WCM H;  3K8A A;  3KF8 B;  1AE2 A;  5M3M H;  1GD7 A;  2EXD A;  1HR0 Q;  5JJI A;  1VQJ A;  3I56 A;  2BA0 A;  2JA5 H;  3I4M G;  1VQ9 A;  3F8T A;  1E24 A;  2ID0 A;  4DAY B;  4A3C G;  4L5R C;  4LF9 Q;  1HH2 P;  5LMU Q;  4JI3 Q;  2LXK A;  2UXB L;  1HZC A;  1L1O B;  4B3S L;  4MZ9 A;  3L0O A;  4K0K Q;  4JV5 L;  2AWN A;  2NVX H;  2D62 A;  2Z6K A;  4DV7 L;  4DV5 Q;  3PO2 H;  1XNR L;  3K7A H;  3PV0 A;  3T1Y Q;  2Y0S G;  5IWA Q;  2VQE L;  4JI3 L;  5LMU L;  1OXS C;  3PO2 G;  1N36 Q;  4DR6 L;  1WOC A;  2EQS A;  4YY3 L;  3GO5 A;  3LGJ A;  5ELO A;  3S24 A;  2ATW A;  4DV2 L;  2I5L X;  2VY3 A;  4IJH A;  2QA4 A;  2GVB A;  1SLJ A;  4AH6 A;  1C0A A;  2R7F A;  4JI1 L;  2K14 A;  2H5X A;  3PF4 A;  2YTX A;  2HIV A;  1K0R A;  2IX1 A;  3CCV A;  1TWH H;  1X6O A;  2RHS B;  1M90 C;  3CQZ H;  1BKB A;  2JA7 G;  4JI8 Q;  4JYA Q;  4JYA L;  1JT8 A;  3CCU A;  1D8L A;  4DK3 C;  2HHH Q;  1CKO A;  1HZ9 A;  3E9H A;  4KHP L;  3J7Z C;  3PUW A;  2VQF Q;  3T1Y L;  5GQO A;  2ZM6 Q;  3D0F A;  4LF9 L;  4IFD I;  2XTI A;  1NMF A;  1BBW A;  1P16 A;  1VQK A;  4GOP B;  3GTP H;  2K5H A;  2HHH L;  4QJF A;  5E7N A;  1YNX A;  3G71 A;  1IBL L;  4DR3 L;  1PH7 A;  1K3R A;  5FJ8 G;  3I55 A;  5GAE C;  3G48 A;  3G4S A;  4O2D A;  2UXD L;  1VQ5 A;  2JA7 H;  4JBK A;  3HOU G;  1JE5 A;  2N8N A;  3L2P A;  4APV A;  1C7Y A;  4LFA Q;  1KQS A;  4LF8 Q;  5JEA G;  2UUA L;  4A3L G;  4O0A A;  4NXN L;  1QUQ B;  3I4N H;  1YJ9 A;  5C3E G;  2ZJP A;  5M3F G;  1IXR A;  2UUB Q;  5M5W H;  2L15 A;  1PH2 A;  2NVT H;  4NXM Q;  2BH2 A;  1EFW A;  4IOC A;  4OWX B;  3ER0 A;  4IJL A;  1IBM Q;  1XPO A;  3J81 c;  4OX9 Q;  3CCM A;  4BBR H;  1A0I A;  1P8L A;  3W5O A;  1PA6 A;  3GTQ H;  3S1N H;  3I4M H;  1CUK A;  1PH6 A;  4X66 Q;  3S1M H;  1LUZ A;  2ZJR A;  1OXX K;  4KI0 A;  1XMQ Q;  3J7A 5;  3CCJ A;  1HZA A;  4X65 Q;  3I2Z A;  3KOJ A;  1Q82 C;  5GRO A;  1FGU A;  4A76 A;  1IYJ B;  1MIU A;  1UWV A;  3BJU A;  2UXC Q;  2E2I H;  3EN2 A;  3H3V I;  3HOY G;  1Q8K A;  4DV3 L;  4GKJ L;  3S15 H;  4GNX A;  5IYC G;  5HY6 A;  2JEA I;  4P72 A;  2F52 A;  3M85 A;  4A75 A;  1HZB A;  2LXJ A;  4B3M L;  3PUZ A;  4DR5 Q;  4JOI C;  3PO3 H;  2K52 A;  2A1A A;  3RZO H;  1G6P A;  2HQL A;  4LUV A;  3PGZ A;  4DV0 L;  3CC4 A;  4DKA C;  1XTD A;  5IP9 H;  3CXC A;  4QY7 A;  4JOI A;  4DUY L;  4X65 L;  1O7I A;  3VDY A;  4A3M G;  4AQY L;  3RZD H;  2I0Q A;  4LF6 L;  3HOW H;  4JBW A;  4A3J H;  4H02 A;  4JV5 Q;  1YVC A;  1RL2 A;  4X66 L;  4LF7 Q;  1C9O A;  2CQO A;  1TWF H;  1MJE A;  5C0X I;  3KF6 B;  2XGT A;  1Z9F A;  2LSS A;  3KDF B;  3U58 A;  2MQH A;  5LMN L;  3BZK A;  1VQM A;  4R4Q A;  4DUY Q;  4UY8 C;  1EQR A;  4GKJ Q;  3TS0 A;  2UXC L;  4NPS A;  4DR6 Q;  1L2F A;  3CD6 A;  4P73 A;  1J5E L;  4OWW B;  3CW2 C;  5FLX c;  4FDB A;  1E1T A;  3F1Z A;  2AWO A;  5IT9 c;  5M3F H;  2N78 A;  3A5Z B;  1Z47 A;  4JBM A;  1YBY A;  2E5L L;  4DR4 L;  1VQC A;  2EIF A;  2N49 A;  4DR2 Q;  4DR2 L;  2Z6K C;  2R6G A;  2JQO A;  3K80 C;  1HNW Q;  2ZJQ A;  2Y0S E;  4A3J G;  1XJV A;  4A3B G;  1NJI C;  2BA1 A;  1VQE A;  2YTY A;  2HIX A;  3RLO A;  4BY1 H;  1VQ8 A;  4HJ8 A;  1N9W A;  2C35 B;  3TRE A;  5EAY A;  1Q7Y C;  2B63 H;  3CME A;  3S16 H;  4R1J A;  3PIP A;  3KDF A;  5M3M G;  2CWA A;  3U4V A; 
#chains in the Genus database with same CATH topology
 2R92 H;  4IQZ A;  1U0L A;  3MXU A;  3PSI A;  3W1B A;  1MKH A;  4YHH L;  2NVQ B;  2OCE A;  4LF6 Q;  4IPH A;  1DJR D;  3HOY H;  4TRD A;  1IBK Q;  3L9A X;  4IAL A;  4OIJ A;  4F8M A;  5CGK A;  5LMN Q;  1KAW A;  4R4O A;  3PUX A;  5C5L A;  4XTC S;  3D3R A;  3OPO A;  1ICF B;  1DGS A;  1F77 A;  4R4C A;  3M3Y B;  4K8I A;  2K05 A;  5CV6 A;  4QUF A;  1JC7 A;  2CVR A;  5ELC A;  3HOZ B;  3DUZ A;  3B6Y A;  1ASY A;  3TRZ A;  5KNB A;  1K8O A;  4DV0 Q;  2DGY A;  1K0S A;  2LKV A;  2ZTC A;  1I4Q A;  1B3Q A;  4DV5 L;  3C1F A;  5IGE A;  5EQ0 A;  3K81 C;  1KAB A;  4PZ6 A;  3K59 A;  1EY8 A;  4GOP C;  1AE3 A;  3SVM A;  1ENA A;  2LMC B;  2QF7 A;  2Z0S A;  3RR5 A;  3TP6 A;  5BN5 A;  3I8Z A;  5IYB G;  1UE1 A;  1EIG A;  3EJI A;  1YNN C;  1LTA D;  4EGV A;  1EZ8 A;  4QMG A;  2JJQ A;  4JI1 Q;  1SSO A;  4BY7 H;  1I3Q H;  3GTM H;  4K5W A;  3NBH B;  3A5U A;  2R3Z A;  1T5E A;  2JYO A;  1PHJ A;  5JOB A;  1XX8 A;  2EYF A;  3ULL A;  1A3U A;  3F2C A;  1LTR D;  3DMU A;  4AYB G;  3I4N G;  2JA6 B;  4LF4 L;  3CRL C;  4DA2 A;  1Q1E A;  1RHP A;  4YHH Q;  4IUR A;  4LUZ A;  2UXB Q;  3GTG H;  2HUG A;  4C2M B;  4N8F A;  4A3E H;  4PV1 C;  1Q86 C;  2K32 A;  4F7X A;  1BDO A;  3K5O A;  1EQV A;  4LFC L;  1D5X C;  1FJG Q;  2UXD Q;  3TQY A;  1VQH A;  1BUV T;  4DAM A;  1JOQ A;  4R4T A;  2MFI A;  5IGC A;  2A19 A;  1HFN A;  4FNF A;  5IE8 A;  3W2D A;  1FNU A;  3O13 A;  1ILQ A;  3CCE A;  3S2H H;  1B8A A;  1NMG A;  1PDQ A;  1BCP B;  4X3K A;  1J6Q A;  5D14 A;  1SJH D;  1TS4 A;  4F88 A;  2Q2T A;  5C4X H;  2A6H C;  3T56 B;  1VQO A;  5IP7 H;  4TVA B;  1I4G A;  1RTN A;  2FIN B;  1VQ7 A;  2JP1 A;  1TS5 A;  2NVY H;  3CC2 A;  5CC4 A;  1CSQ A;  1D5M C;  2WKD A;  4ME5 A;  1KDC A;  3K7A B;  5JJZ A;  2HT1 A;  1TXY A;  2NUC A;  4C3J G;  1B7Y B;  1YIJ A;  3G6J B;  1K9M C;  2EDG A;  3MXG A;  4DV3 Q;  3NPP A;  3WOE A;  1KIX A;  3S1Q B;  1A15 A;  1SE8 A;  2VUM H;  2PQE A;  2XNA C;  2IHF A;  1QNU A;  2JA5 B;  5C4J B;  2A69 D;  4A3D B;  2VUM G;  2F0H A;  1KHI A;  4GNX C;  1EWH A;  4MTN A;  1HNX Q;  4A4I A;  3S15 B;  1XMO L;  3K5M A;  4BY7 G;  3KYH C;  2E75 C;  3C46 A;  4PNY A;  2Q2H A;  2H1E A;  2BCO A;  4QUC A;  4BBS B;  1HTL D;  2Q8T A;  2UU9 Q;  4YCV A;  1CI3 M;  2RCN A;  4DAP A;  3OTO Q;  4FYD A;  3NEM A;  4X3S A;  4OO1 I;  2EJG C;  4OXP A;  5EKK A;  2F0O A;  3PUY A;  4Q5V A;  2B2V C;  1XNQ L;  1D2B A;  3U9O A;  5JVH 3;  5C4X G;  5CV7 A;  5E1F A;  5H1S E;  3NEN A;  5KND A;  1TWH B;  4LF5 L;  2A69 C;  3MEF A;  2ASB A;  2K5V A;  4G7O C;  4PG3 A;  2Z9H A;  3HFZ B;  1N34 Q;  3GTO H;  2VB3 X;  1L1O A;  2VZA A;  4S3S A;  3I3C A;  1MJC A;  1VQI A;  3MXN A;  3M3Y H;  1PMR A;  1KLG D;  4A3K G;  1LLR D;  2QEJ C;  3SK5 A;  3LWE A;  2E2I B;  3HOX G;  4A3K H;  4GLV B;  2LY7 A;  1ESR A;  1O78 A;  5DM6 3;  2Q8I B;  3GTO B;  2R61 A;  4A3B H;  4C3J B;  2KBN A;  3PMF A;  5C4J H;  3Q22 A;  4K0K L;  5I2X A;  5IIF A;  2KHS A;  3I7F A;  4JVZ A;  4E6I A;  5AJ3 L;  4EQP A;  4HR7 B;  2UU9 L;  1VQG A;  2F0Q A;  4A3I G;  3IFD A;  4A3M B;  4BA2 I;  1PH3 A;  5K36 G;  3AYH B;  4C3I H;  4FF1 A;  2VXW A;  2F0E A;  1I4X A;  4DK0 A;  2I5M X;  2L9H A;  3QJY A;  1GM5 A;  2X69 A;  2K28 A;  1SYB A;  4FXK C;  4B3R Q;  1VDZ A;  2IHE A;  2K01 A;  4IOA A;  4CDC C;  2JA6 H;  4HJ5 A;  3MXP A;  1A2T A;  1T9H A;  3OSO A;  1DON A;  1ZKO A;  4CDD C;  3OMG A;  1PYW D;  3ICE A;  4ME3 A;  4XQN A;  3T1H Q;  4CKE A;  5FOB B;  3PO3 G;  4WJ3 M;  3J7Y W;  1H9K A;  2JXM B;  1DXM A;  5G3L F;  2VB2 X;  4LWC A;  5ELF A;  1EYC A;  2B2W C;  3FMC A;  3ND8 A;  1A3T A;  1X3G A;  2IX3 A;  1RIP A;  3T4A C;  3CCR A;  1IW7 C;  1WFQ A;  5I4D A;  3CMA A;  3GTK H;  1LT3 D;  4RGT A;  4DV6 L;  4N8X 1;  3AFP A;  3C2P A;  1AFP A;  1DD2 A;  3S17 H;  2D0O A;  1R4P B;  4J6H A;  1CFM A;  2K04 A;  1HR0 L;  1PH1 A;  1FNW A;  1TY2 A;  2N88 A;  3HG9 A;  1M8A A;  2F0G A;  2GVA A;  5C3E H;  1U4R A;  4HJA A;  1N33 L;  4M8A A;  2KCM A;  4X6A H;  4BA1 I;  2FJ2 A;  5KYL A;  1B3A A;  4BBR G;  1TWG B;  3GQB A;  5IWA L;  4A3F H;  4QB4 A;  4YWM A;  5M9O A;  1N34 L;  1H9M A;  4LFA L;  3QOL A;  3AMU A;  4PMC A;  3PUV A;  4JC0 A;  1CT1 D;  4DUZ L;  1LT4 D;  5CYU A;  5KYI A;  3NK9 A;  3KF8 B;  2K6A A;  1GD7 A;  1I4R A;  3DWA A;  3T13 A;  5COR A;  3I56 A;  2JA5 H;  3I4M G;  1VQ9 A;  1TWF B;  3F8T A;  1E24 A;  5LL6 X;  4LF9 Q;  1HH2 P;  4JI3 Q;  2RBM A;  1HZC A;  4K0K Q;  2AWN A;  4G4K A;  1EY7 A;  2D62 A;  3CKI B;  4DV5 Q;  4DV7 L;  1XNR L;  3K7A H;  1D7Q A;  3T1Y Q;  2PW7 A;  4JI3 L;  1LTT D;  5KIX A;  3PO2 G;  3OIP A;  1V8Q A;  3EVQ A;  3MFG A;  1WOC A;  3HEJ A;  5ELO A;  4DV2 L;  4IJH A;  2GVB A;  5EPL A;  4HSV A;  2L12 A;  4Z9C B;  2J7Z A;  2H5X A;  4DF7 A;  3PF4 A;  1LTG D;  3RZD B;  3HKZ B;  3HOW B;  1U4M A;  5D3I B;  2RDG A;  5C3X A;  2ZXO A;  1VMC A;  3FDT A;  2RDH A;  2HHH Q;  2RCF A;  3KLR A;  1Y8P B;  3EQL C;  3T1Y L;  3E0J A;  5GQO A;  2XTI A;  1EY6 A;  1P16 A;  2E74 C;  1VQK A;  3GTP H;  4TKO B;  1FD7 D;  4FF4 A;  3G71 A;  1IBL L;  4DR3 L;  2RDF A;  5FJ8 G;  5GAE C;  2E2H B;  3G48 A;  1VQ5 A;  3H3V C;  4JBK A;  3KF8 A;  3L2P A;  2F0M A;  5JEA G;  1SYF A;  1TS2 A;  4NXN L;  4K14 A;  4B9W A;  5C44 B;  3ITP A;  2ZJP A;  1ET6 A;  1QJO A;  2EVB A;  1SYG A;  2L15 A;  2XSC A;  1EFW A;  4OWX B;  3QB3 A;  4IJL A;  1XYI A;  3VYR A;  4OX9 Q;  3WOF A;  4CJ1 B;  3SK6 A;  4BBR H;  3FPU B;  3CCM A;  1PA6 A;  3GTQ H;  1PH6 A;  2CW0 D;  4KI0 A;  4DFA A;  2NWG A;  3CCJ A;  3VA7 A;  2KEE A;  2RKS A;  2HQE A;  1SAP A;  2B2U C;  3Q24 A;  2E2I H;  1QCB D;  1Q8K A;  4RHR A;  2HDL A;  3D6C A;  3NXW A;  5IYC G;  2OXP A;  2F52 A;  2D5D A;  3M85 A;  1HZB A;  4B3M L;  3H0G B;  3MC0 B;  1Q3L A;  2K52 A;  2A1A A;  3RZO H;  3PO2 B;  1IYV A;  1KNE A;  1I3Q B;  3GTM B;  1H9S B;  1XTD A;  3GP7 A;  3CXC A;  4DUY L;  3HOU B;  4X65 L;  1O7I A;  4A3J H;  3TSS A;  4LF7 Q;  1C9O A;  1PTO D;  4TSS A;  3OWF A;  2LSS A;  1PRT D;  2MJ8 A;  1RTO A;  4DUY Q;  4UY8 C;  4GKJ Q;  2UXC L;  1SXT A;  1L2F A;  5FLX c;  4FDB A;  1J9O A;  3HP3 A;  5ELE A;  4JBM A;  2EIF A;  4DR2 Q;  2JQO A;  3K80 C;  3CU7 A;  1XJV A;  2F0T A;  3J80 E;  1NJI C;  2BA1 A;  2YTY A;  2OEO A;  2C9O A;  3MTS A;  1Q7Y C;  2B63 H;  3S16 H;  4J1M A;  3CME A;  1LAC A;  2EOT A;  3PIP A;  2CWA A;  4A3I H;  1FL0 A;  2DY7 A;  5M5X B;  1HA6 A;  1XNR Q;  2YU9 B;  2EY6 A;  4EQN A;  1GXD C;  3OYY A;  4NDX A;  1CQV A;  1K83 B;  3V96 A;  4I7Z C;  4IUQ A;  2DJG C;  2JN4 A;  4IFD J;  4LMQ D;  5JPN C;  2VNU D;  2F3I A;  3GD7 A;  1WTP A;  1HFG A;  2CHB D;  1F2Z A;  2NVY B;  3E0E A;  4KHV A;  3KBG A;  4PMB A;  3J81 E;  4UP7 A;  2F4V L;  1F2M A;  1N32 Q;  3ULJ A;  4DNI A;  1JWM D;  2N3S A;  4KHZ A;  1CA5 A;  4KKU A;  2AQ3 B;  3N6R A;  2CFM A;  3VYU A;  2VQF L;  1BBU A;  1CZW A;  5C4Z A;  5G3L D;  1ROD A;  2G5D A;  1QUQ A;  3BVG A;  4IO9 A;  3S2D H;  4IUT A;  4X62 L;  3AB9 A;  3T51 B;  1IZ6 A;  4BBS H;  1DCZ A;  5IGG A;  4DV2 Q;  2KEN A;  3BZD B;  2Q8R E;  3OMC A;  2KEC A;  4A3F G;  1NR4 A;  3OWE B;  4OL7 A;  5JJK A;  5CR3 A;  3DM3 A;  3LNN A;  2IT1 A;  1BO0 A;  4KKT A;  4LW1 A;  4JI7 Q;  4L6T B;  1MD2 D;  3J80 i;  1GO3 E;  1YHA A;  1H95 A;  5C0X H;  1JE4 A;  3KF6 A;  2JK8 A;  3HGB A;  1PH8 A;  1EYG A;  1FR3 A;  2DUD A;  3CP0 A;  4ABN A;  1AN8 A;  2UUA Q;  1SNP A;  1HTP A;  1HNW L;  3TZD A;  2J4X A;  1G29 1;  3BS1 A;  2O5J C;  3CF5 A;  1DM0 B;  4IFD G;  2PQA A;  3A7A B;  5DNF A;  2WFW A;  3I70 A;  1IBM L;  4H13 C;  4DR1 L;  1WYD A;  3BZC A;  2A6E D;  3C1E A;  2OWO A;  3I90 A;  1Z6H A;  4ZYS A;  4BBR B;  4K2K A;  1Q46 A;  4JW0 A;  1BR9 A;  1CSP A;  4LFB L;  1Y69 U;  3KLS X;  3G6E A;  3UDG A;  3QWN A;  2AUK A;  3SK8 A;  2A68 D;  4IUP A;  3UE0 A;  5BN4 A;  2F3V A;  4C3J H;  3H15 A;  1STH A;  2G9D A;  4C3H H;  4GOP A;  1T5X D;  3D4W A;  1PH4 A;  3KLW A;  1NTG A;  5IP9 G;  3PIO 3;  3U4Z A;  2KCT A;  4XT1 B;  1I94 Q;  3NTI A;  3GTQ B;  4ZRZ A;  4QIW E;  2RHQ B;  3UDX A;  3STB D;  2OTJ A;  1TR5 A;  1YI2 A;  2F4V Q;  4HJ7 A;  5IP7 G;  3R93 A;  5IGD A;  4BBS G;  3LWU A;  3CCL A;  3A56 A;  4I7A A;  1SNO A;  2DNE A;  2G9H D;  4DGZ A;  4A3G G;  1HCZ A;  5FLM H;  4B3T Q;  2B63 G;  2A8V A;  3MVV A;  1WTQ A;  1WTO A;  1CTM A;  3TME A;  5C5M A;  1LV9 A;  1I5F A;  1SBB B;  3KFU A;  4LFC Q;  4L5T A;  3Q8D A;  4IZ8 A;  1C4Q A;  5CBA E;  4CHT B;  4N9T A;  1K8A C;  3SGI A;  1Y14 B;  3SDZ A;  1SFO H;  2K5Q A;  3GTL B;  4IUN A;  4YCW A;  3JC6 6;  4CBV A;  2RSO A;  1YHB A;  4ID6 A;  5KGU A;  1GOZ A;  3FP9 A;  4TQU S;  1ICW A;  4A3I B;  2R92 B;  2B2V A;  1OXU A;  5FO9 B;  1AZQ A;  3JAM c;  4POF A;  2I5H A;  1V43 A;  5IT9 E;  4GN3 B;  3W1G A;  2WII B;  1E3P A;  3HKZ G;  3HOW G;  5E3F A;  4EQ5 A;  3PIP 3;  2KED A;  4GKK L;  4JI0 Q;  4LAA A;  5CMD A;  4MNO A;  3U9S A;  1Y1W H;  4JBJ A;  4DK1 A;  3SEB A;  1GUN A;  4BXX G;  5FLM G;  3E3X A;  4R8N A;  3QR8 A;  5EPJ A;  3S1R B;  1DOM A;  4RG1 A;  2CH4 A;  1W3S A;  4KMU C;  4KD3 A;  2BE5 D;  3J81 j;  2LS0 1;  4K6L A;  1ESF A;  2AKW B;  1HRJ A;  4XDX A;  5HGQ A;  1XWE A;  4RGN A;  1PTO F;  5EBD A;  1JB3 A;  1A8V A;  4HN7 A;  1SE2 A;  2PI2 E;  1E2V A;  3NSW A;  4HID A;  3L7Z C;  1JCK B;  4J8Q A;  4BXX H;  1JWU D;  2MNA A;  3OTO L;  2ALY B;  3R3O A;  1VQA A;  1MSH A;  4A93 G;  2R7D A;  1CKM A;  5I6Y A;  4LF5 Q;  3A74 A;  5LL6 S;  2JE6 I;  1EYD A;  1YEZ A;  4YCU A;  1M1K C;  2DN8 A;  3P1H A;  1WI5 A;  4PZ8 A;  1EEI D;  4PZ7 A;  1W2B A;  1A6X A;  4JI4 Q;  4KLK A;  5DLQ E;  4C2M H;  1S5D D;  3CC7 A;  5T1G A;  1HQR D;  3A8J E;  4XQQ A;  1SNC A;  4DR3 Q;  1CHQ D;  4LNQ A;  3VR4 A;  1EY4 A;  1VQB A;  2AHO B;  4OWT B;  2AQ1 B;  1Q81 C;  1VCI A;  2PW5 A;  1DOL A;  4C56 C;  3R2I A;  4RHS A;  2K4K A;  2WKC A;  4AIM A;  5F2D A;  1A63 A;  4KJO A;  2L55 A;  1KRT A;  2OQK A;  4P2C B;  2A5H A;  1U5K A;  5I9O A;  5IGF A;  1PYB A;  3AEV A;  4B3S Q;  4H44 C;  4QQB X;  3H3V H;  3HOV G;  3D8G A;  4A93 B;  4RH6 A;  3A0J A;  4QIW B;  1VQ6 A;  4LFB Q;  1X65 A;  1UUP A;  1V9P A;  1L1O C;  1Q8I A;  1Y8N B;  1JB7 A;  2R92 G;  2DJF C;  2R7Z H;  1D1K A;  1VQP A;  4YWL A;  1TWG H;  3RZO B;  1H9S A;  1U4L A;  4AYB E;  4DUZ Q;  1YHQ A;  4A3C H;  3ULP A;  2QCP X;  1WCM H;  3CAM A;  3K8A A;  1DYQ A;  1S5E D;  1ET9 A;  1CZG A;  2EYP A;  4DAY B;  1SMY D;  1WTH A;  3NBI A;  4KN7 C;  3A55 A;  4RA8 A;  5K5P A;  5EGT A;  1EYA A;  2UXB L;  4B3S L;  4C3H B;  1GUO A;  3PO2 H;  3PV0 A;  2Y0S G;  2VQE L;  1HUM A;  4ZKB B;  4YY3 L;  3LGJ A;  2VUM B;  3MZ5 A;  4G7Z C;  1LT5 D;  1SLJ A;  4AH6 A;  1C0A A;  2R7F A;  3NWS A;  3NUC A;  1TY0 A;  4JI1 L;  2K14 A;  1S4Z A;  2F0K A;  3SHL A;  3Q0A A;  1TWH H;  1X6O A;  1M90 C;  2JA7 G;  2HD3 A;  1BKB A;  1H9R A;  4JYA Q;  1BNZ A;  1JT8 A;  3CCU A;  4K5V A;  3KLS A;  1U9R A;  1HZ9 A;  4KHP L;  3J7Z C;  1WVL A;  3PUW A;  2VQF Q;  5A35 A;  2ZM6 Q;  4IFD I;  4LF9 L;  5J1Z A;  1DZ1 A;  3Q23 A;  4GOP B;  5EPK A;  1YNX A;  5BN3 A;  2F0I A;  3I55 A;  5TSS A;  1IHZ A;  1KDB A;  4O2D A;  5ELD A;  3T53 B;  2QIL A;  2JA7 H;  2O5I C;  1JE5 A;  4DNT B;  2FFK B;  4LFA Q;  2NBF A;  1KQS A;  2UUA L;  4A3L G;  3I4N H;  1G91 A;  5C3E G;  1GHJ A;  3TP7 A;  1IXR A;  1STY A;  2BH2 A;  1QIL A;  5E4X A;  3J81 c;  5HUR A;  2Z4H A;  3TZU A;  3S1N H;  1A0I A;  3W5O A;  4U67 3;  4KN4 C;  1UEA B;  1L0X B;  3S1M H;  3L3O C;  4A3B B;  1OXX K;  1STA A;  2R7Z B;  3KOJ A;  1FGU A;  3K0Y A;  1BCP D;  1UWV A;  2UXC Q;  4FXD A;  4K6D A;  4AYB B;  3K6O A;  1BOS A;  4BS9 A;  1EWC A;  1BF4 A;  1II3 A;  1WTV A;  2CQA A;  1HPC A;  3PUZ A;  4WRD A;  2O4X A;  4B9X A;  2PNR C;  2K7V A;  4XQJ A;  1M4V A;  1G6P A;  4LUV A;  3CC4 A;  4DKA C;  5IP9 H;  4JOI A;  3RZD H;  3VDY A;  3HOW H;  4A3M G;  4FF3 A;  4LF6 L;  1GUT A;  4H02 A;  1YVC A;  1GUG A;  4X66 L;  2CQO A;  1MJE A;  1GUW A;  3KF6 B;  2A68 C;  5CV4 A;  4R4Q A;  4NKL A;  2B2T C;  3QIA A;  1BXT A;  3TDQ A;  2XWB B;  3URY A;  5M3F H;  3OIQ A;  2GA4 B;  2OF1 A;  2Z6K C;  3BVZ A;  1HNW Q;  4A3J G;  3S17 B;  4A3B G;  1LTS D;  2PZU A;  4BY1 H;  1VQE A;  1LO5 D;  1SYE A;  1NSN S;  1SYC A;  2C35 B;  3TRE A;  2WV6 D;  1C48 A;  1RL2 A;  2EY5 A;  1AEX A;  2K5N A;  1JOK A;  1O7L A;  3BDO A;  4RKB A;  2TSS A;  3KJP A;  5C3E B;  1QNK A;  2PI2 A;  1J5E Q;  1UEB A;  4A3F B;  5IYC H;  2L5T A;  4JI6 Q;  2SNS A;  3BU2 A;  1NY4 A;  2JA5 G;  1VF5 C;  4KKS A;  4B3R L;  2MUY A;  2CCZ A;  2I07 B;  2YYZ A;  2YV5 A;  2VS1 A;  2IY5 B;  5C4H A;  3S1M B;  3BG3 A;  2NN6 G;  4GZY C;  3WWV A;  1KLU D;  1JJ2 A;  1I4H A;  2DNC A;  3VYT A;  3K58 A;  4RMF A;  1EIF A;  4DNR B;  3BDC A;  1AZP A;  1ASZ A;  1SN8 A;  5C6A A;  4DV7 Q;  3NWT A;  1K83 H;  5L37 A;  2P5Z X;  4A3J B;  3RN2 A;  2WB1 E;  4X62 Q;  4GKK Q;  2JA8 H;  2RSN A;  2R93 B;  1SMY C;  2KA7 A;  1V1Q A;  2OQ0 A;  4UP8 A;  4OO1 H;  1TVX A;  4MHE A;  2E76 C;  1SRO A;  3AU7 A;  4A3E G;  4Y7N H;  1SE3 A;  2MO0 A;  1L0W A;  2IPK D;  4IUU A;  5KNC A;  4Y52 H;  2K75 A;  4J15 A;  1E0B A;  1EUJ A;  1S72 A;  2XRQ D;  1N8R C;  4LJZ C;  4DV1 L;  4HIO A;  2NN6 I;  2J0T D;  3M4Y A;  1WD0 A;  3A54 A;  4JI7 L;  5IGB A;  4HCS A;  4MTK A;  1NR2 A;  2HCC A;  5M3F B;  4KHP Q;  3TEH B;  1IBL Q;  2BOS A;  2CKZ B;  4FP5 D;  5DEH A;  2ZTE A;  3MXN B;  3J81 L;  4FVM A;  1FJG L;  4K5X A;  1S5F D;  1EZ6 A;  2B2T A;  4X3U A;  2XN9 C;  2XIW A;  1WTR A;  4L5S A;  4HSP A;  5GAG C;  1QWY A;  4RCO A;  1MI2 A;  3SK4 A;  5C44 H;  4P71 A;  3OHX C;  1HJP A;  1MGS A;  3U50 C;  2E2J B;  4GLA C;  1XTC D;  2PMZ B;  2A73 B;  1HNZ L;  1VQD A;  4GNX B;  2WB1 G;  3DLL A;  1NE3 A;  3AQQ A;  3EA6 A;  3GDE A;  1G51 A;  2WAC A;  2KHJ A;  4DR1 Q;  4HIM A;  5CV9 A;  1EL0 A;  1TWA H;  1I50 H;  2CH4 W;  3RLF A;  3ONA B;  3GTJ H;  1FGB D;  2GN5 A;  5EKI A;  1SDF A;  1ZXT A;  3H09 A;  1LM0 A;  3FVQ A;  3CPW A;  4C1N K;  5C44 G;  1CKN B;  2NZH A;  3M7G A;  3WDN A;  2E2J H;  1EIY B;  2JA8 B;  4DV4 L;  1W6K A;  4GS3 A;  2X6G A;  4CGY B;  3RUZ A;  2KQ3 A;  3DXJ C;  5IY0 A;  1Q90 A;  3F2D A;  5FK9 C;  4M1U B;  3W3A A;  3HOU H;  1WJJ A;  1IBK L;  4A3L H;  3EBE A;  3PIO A;  1PFM A;  1GVP A;  4KY5 A;  1EQQ A;  1G6Z A;  3K7U C;  3BYY B;  2EYL A;  1VQN A;  2F0N A;  4LK1 C;  1V1O A;  2QW7 A;  3KBX A;  2AMC B;  2EXZ A;  3I72 A;  3KK7 A;  3S9W A;  2BDN A;  4A3G H;  2EYM A;  2ZXR A;  2R93 G;  3FKI H;  5CV5 A;  4DV1 Q;  3DHQ A;  3NE5 B;  5J3B A;  5M5Y B;  3CRK C;  3UI2 A;  1Y1W G;  1Y1V G;  4IPG A;  5M5X H;  4IUV A;  2OT2 A;  2WAQ E;  4IPC A;  1B44 D;  3EFX D;  2F4I A;  5BR8 L;  1STB A;  1IL2 A;  4LF7 L;  5M5W B;  2NVT B;  1CQF A;  3GTJ B;  3ERQ A;  4FF2 A;  2NTS A;  2EYO A;  2WB1 B;  3IFT A;  2E2H H;  2NVQ H;  4ALP A;  4NB3 A;  2EY1 A;  1S3O A;  2XRS D;  3IRB A;  2JA9 A;  3I4M B;  3FKI G;  3FHW A;  1B50 A;  1WTW A;  4DXF A;  1B2T A;  1R4Q B;  1BVS A;  1D6E C;  2O2L D;  4UDU C;  4P74 A;  1SR3 A;  4XXE A;  1N32 L;  3PF5 A;  1PH5 A;  5IYD H;  5JJL A;  1PZK D;  3STB C;  4P75 A;  1XNQ Q;  2L11 A;  1WCM B;  5FKA C;  5AFW A;  2ZXP A;  4BY1 G;  4Q0F A;  4HED A;  4IPD A;  1EY5 A;  2B3G A;  5A2Q E;  2EZV A;  1N36 L;  4OON A;  4A3D G;  2PQA B;  1X55 A;  2D0P A;  5A2Q L;  4F87 A;  3BYT B;  4LF8 L;  4DN4 M;  4WJ4 A;  2PPB C;  2R7Z G;  1JQY D;  3S14 H;  4DU9 A;  1LYL A;  1YNN D;  3RLN A;  1IKM A;  3M4Q A;  2M00 A;  1QVF A;  2R93 H;  5FO8 B;  1KXL A;  5FO7 B;  2WAQ B;  2QGQ A;  1EY0 A;  1UE6 A;  3J80 c;  5M5Y H;  2Z8L A;  1EWI A;  1JJC B;  4OX9 L;  1EIH A;  4GN5 A;  1NAP A;  3DWQ A;  3D4D A;  2F1M A;  2L4N A;  4CDE C;  4X64 L;  2QEX A;  2PO4 A;  2Z1C A;  5JEA J;  2UUB L;  3QO2 A;  1B53 A;  4OGQ C;  4C3H G;  1TQO A;  1E2W A;  4GN4 B;  2UUC Q;  4X64 Q;  2FMC A;  3KJO A;  4JI8 L;  3TP8 A;  5COY A;  3VR6 A;  4QGU A;  2IW3 A;  3N52 A;  3R8B A;  4B3M Q;  2YTV A;  1PFS A;  5BR8 Q;  1VQ4 A;  1VS0 A;  3S1R H;  2SNM A;  2LFN A;  3M4P A;  3J7A F;  1LT6 D;  3R2T A;  2NB0 A;  1CA6 A;  4DV6 Q;  1YZ6 A;  4ZKC B;  2VQE Q;  4V19 0;  3K5N A;  2BE5 C;  4OHJ A;  1I94 L;  1QVG A;  3ZYY X;  4HJ9 A;  1UE7 A;  5D3D A;  4NXN Q;  3RN5 A;  5I6W A;  5T1I A;  1O7Z A;  3HOZ H;  5KEE A;  2F0S A;  4UHV A;  5E4W C;  1AE2 A;  5M3M H;  1VQJ A;  2BA0 A;  1ML0 D;  4IN3 A;  1Z7T A;  2ID0 A;  2F3W A;  1SEB D;  5LMU Q;  3S14 B;  5I2Y A;  2LXK A;  1L1O B;  1RKN A;  3L0O A;  2TMP A;  1ZEQ X;  2NVX H;  1EQT A;  5LMU L;  1N36 Q;  4BWG B;  4DR6 L;  2EQS A;  3GO5 A;  3S24 A;  2E2D C;  2QA4 A;  3C3L A;  2YTX A;  2HIV A;  2K1B A;  4FXG C;  3CQZ H;  3TP5 A;  4JYA L;  4HTH A;  3A7L A;  1NUC A;  1D8L A;  2AUJ D;  4KTA A;  4DK3 C;  4HMJ A;  1CKO A;  3E9H A;  3S2H B;  1F2Y A;  1CK1 A;  2SDF A;  2AQ2 B;  1FNV A;  1SYD A;  5J22 A;  1BBW A;  3P75 A;  5E7N A;  1X3P A;  4KK7 A;  3BDL A;  1G8Z D;  4HCE A;  4CJ2 C;  3K57 A;  2UXD L;  1QG7 A;  4APV A;  1C7Y A;  5J39 A;  4O0A A;  1QUQ B;  2F0W A;  1YJ9 A;  1YNJ D;  5M3F G;  1SE4 A;  2UUB Q;  5M5W H;  2NVT H;  2K5W A;  3A8K E;  2EYJ A;  1Y8O B;  3HRZ C;  1XPO A;  3SE0 A;  2XVS A;  1P8L A;  3I4M H;  1PRT C;  2MHV A;  4RKL A;  4X66 Q;  2ZJR A;  2A6E C;  1B9M A;  1HZA A;  2JA7 B;  1Q82 C;  4O42 A;  5GRO A;  2NZ1 D;  3MFY A;  1HQM C;  2IL8 A;  5M3M B;  3HOY G;  3ERO A;  3FEW X;  4GKJ L;  2D2C C;  3S15 H;  4GNX A;  5HY6 A;  2JEA I;  4A75 A;  2A74 C;  2LXJ A;  5ELB A;  1ZYR C;  4JOI C;  1PZI D;  5NUC A;  1G2S A;  2HQL A;  3PGZ A;  4DV0 L;  4Y7N B;  5EJW A;  1QOH A;  4L8J A;  4JBW A;  3H94 A;  2SOB A;  2A6H D;  5C0X I;  3MAQ A;  3U58 A;  1KDA A;  2MQH A;  2FMM A;  5LMN L;  1VQM A;  2PCF B;  4R9W A;  4KD4 A;  4DR6 Q;  2WIN B;  1J5E L;  1RDP D;  2QKI C;  1OO9 B;  2AWO A;  2N78 A;  1Z47 A;  2E5L L;  4DR2 L;  2R6G A;  4ZQ3 A;  2ZJQ A;  2Y0S E;  4DAY A;  4OEL B;  2HIX A;  1MBY A;  3RLO A;  1TWA B;  1VQ8 A;  1PZJ D;  1N9W A;  1NNX A;  1FYC A;  4R1J A;  3VR3 A;  5M3M G;  3HOY B;  1HUN A;  3U4V A;  1AH9 A;  5FJ8 H;  2MPM A;  1B9N A;  1SJE D;  3SR1 A;  2N55 A;  1X56 A;  5KRU A;  2OTL A;  4POG A;  4A3K B;  4JK1 C;  4UP9 A;  2ICE C;  3E6Z X;  4C1N I;  4ODG A;  1Q1B A;  2F0D A;  3A8I E;  4ILW A;  4RWS C;  1VQL A;  3HOZ G;  1J8I A;  3P20 A;  3HOX B;  2ES2 A;  4JI5 L;  1Y1W B;  4DK6 C;  2JA6 G;  3I4O A;  2Q2U A;  3GTP B;  4BY1 B;  3D4R A;  3FPP A;  1S40 A;  1TWC B;  1HXY D;  1PFB A;  4HIK A;  3Q6S A;  2KHI A;  1VF7 A;  3DM1 A;  3HOV B;  1I6V C;  3M9B A;  1QVC A;  1EOV A;  3VR5 A;  3AFQ A;  4QF4 A;  1LTI D;  3UDI A;  5C0X J;  4EQO A;  4RGO S;  1F2L A;  4JI2 Q;  3UDF A;  4ZUI A;  4RGM A;  1EU4 A;  4JG2 A;  1GHK A;  2K50 A;  4EX5 A;  3HOX H;  2PMZ E;  3F2B A;  1KD1 C;  2B8F A;  4DAV A;  1PTO H;  1RF2 D;  2ZT9 C;  5GAD C;  1X32 A;  4YY3 Q;  1PYS B;  1V1P B;  3J80 L;  3GTG B;  2B2U A;  2IX0 A;  3NEL A;  1CM9 A;  1STG A;  2QDB A;  2Y0S B;  1BBX C;  1I6H B;  5C0X G;  4XIG S;  1VQF A;  3P7J A;  3E5S A;  4G7H C;  1IW7 D;  3GTK B;  3F2U A;  1L0Y B;  4NXM L;  4R4I A;  3PQI A;  4CJ0 B;  1E22 A;  2KOL A;  1D1I A;  1ONL A;  5JPM C;  3M4O B;  2I46 A;  3ERS X;  4H0L C;  1SMX A;  4PQX A;  5C3W A;  2ZTD A;  3ZJY C;  4JI6 L;  1OXT A;  4WFN 3;  5GAH C;  4L5Q A;  2F0L A;  2KCC A;  3G7L A;  3MWY W;  3BVM A;  1MHW C;  2F0J A;  2WP8 J;  4K2L A;  3J81 i;  1RCV D;  2F0F A;  4KV6 A;  4DR7 L;  2NZO A;  4ZUJ A;  4JPB W;  1AP0 A;  2FHT A;  2CW0 C;  3MEH A;  1SRU A;  3S1Q H;  2BH8 A;  1XPR A;  4JI4 L;  5AJ3 Q;  4XYQ A;  2KUM A;  3HS0 C;  4QL5 A;  3QG1 A;  5IYD G;  4OO1 G;  2NYZ D;  2RF4 A;  3HKS A;  3HKZ E;  1I50 B;  1MSG A;  1PLF A;  4XT3 B;  3I4N B;  2EJF C;  1B1Z A;  1C8C A;  1YJW A;  4HMI A;  3MA2 B;  2PZW A;  1ZYR D;  3TS2 A;  1LAB A;  2H4O A;  1F9S A;  5IYB H;  1STE A;  4NMZ A;  3OW2 A;  1PVO A;  1HR0 W;  1KC8 C;  3T1H L;  3DEO A;  1DOK A;  1GJX A;  4AQY Q;  1EEF D;  3NQT A;  2KVM A;  4JI2 L;  2E8G A;  1H9J A;  3CHB D;  2JA8 G;  1BCP F;  4CKC A;  2VL6 A;  5JEA H;  2B29 A;  2KCN A;  3UE1 A;  4FO2 A;  1LTL A;  1N33 Q;  1OTC A;  5HGT A;  3ND9 A;  4ZCK A;  2Z6B A;  4C3I B;  4JCV E;  1I6H H;  3H6M A;  4JI5 Q;  4NW2 A;  4PMW A;  5EBC A;  1EOT A;  1XMO Q;  3IL8 A;  1X3F A;  1QZG A;  3JAM E;  5K36 H;  4DV4 Q;  1HHV A;  1QZH A;  1X9N A;  1K73 C;  1NCV A;  4N9P A;  1S5B D;  4R8I A;  2E5L Q;  4JI0 L;  5DM7 3;  1YJN A;  1JMC A;  2QDL A;  3IAY A;  4H7B A;  1GUS A;  2MO1 A;  1UAP A;  1JR0 D;  1CKN A;  1RD9 D;  1VMP A;  1R9T H;  4YIJ A;  1PRT F;  2L1B A;  2RA4 A;  1A2U A;  1X54 A;  2JSO A;  1E7Z A;  1JJG A;  5DAU A;  2MP1 A;  1E2Z A;  3JAM L;  1QB5 D;  1K28 A;  4YWK A;  5CBE E;  1GKH A;  1A62 A;  1K8G A;  1UE5 A;  4DPG A;  1TWC H;  1OXV A;  4OIK A;  1O80 A;  3CCQ A;  2WAQ G;  3NTH A;  3HOV H;  4ZK9 B;  1Y1V H;  4WJW A;  4A3M H;  5LMN W;  5ISR A;  5D65 A;  2PZT A;  2Q2I A;  4X3T A;  4C3I G;  2JEB I;  1YIT A;  1KL9 A;  5JAV A;  1B70 B;  1HNZ Q;  1EU3 A;  4RFB A;  1XMQ L;  3H0G H;  3TN2 A;  2KJX A;  4B3T L;  4LUO A;  3I4L A;  1LTB D;  1SNM A;  2RQX A;  4CDF C;  5C4X B;  3RNU A;  1BCP C;  3H0G G;  1G2T A;  1Y1V B;  2EYH A;  1WCM G;  2F0V A;  1PV4 A;  3V2T A;  2V4D A;  4DR5 L;  3TBI B;  1PH9 A;  3GV6 A;  1IYU A;  3CQZ B;  3X3N A;  3S2D B;  2PNH A;  3PCO B;  4A3D H;  4ULL A;  4LF4 Q;  3K0X A;  1PRT B;  4UPA A;  4IFD H;  1TS3 A;  1ENC A;  1O7Y A;  3EIV A;  1E1O A;  1HNX L;  1UNS A;  4DXG A;  1X3E A;  1BQQ T;  3M4O H;  1S5C D;  2V1C C;  3OOC A;  2B39 A;  3KUP A;  1TT2 A;  1WD1 A;  5ELN A;  1ENF A;  2CWP A;  3E9I A;  2C5C A;  1EFI D;  2K33 A;  3VR2 A;  1TU2 B;  5LHY 1;  1Q12 A;  2UUC L;  4B08 A;  3CCS A;  4O1N A;  1JWS D;  3M7N A;  3RMH A;  1NBW A;  5FLX L;  4OEM B;  1XXG A;  3FRP B;  1SFO B;  3GTL H;  2L0C A;  4DR7 Q;  3NQI A;  1JOO A;  4I65 A;  4WOR A;  2YU9 H;  1XPU A;  2EPB A;  2ZM6 L;  1V1P A;  2VW9 A;  4HAE A;  1JIC A;  1YNJ C;  2IJ0 A;  3JAM i;  5FLX E;  2B2Y A;  1FVI A;  1W6J A;  2FXQ A;  3NBH A;  1K3B C;  1KRS A;  3CPF A;  4GLX A;  4A93 H;  4KJN A;  3D31 A;  4U68 A;  4MIU A;  4DR4 Q;  3NP8 A;  3D6W A;  4L63 B;  4RCN A;  1CHP D;  2EXD A;  1HR0 Q;  3DWP A;  5JJI A;  4UAI A;  1I4P A;  5IT9 L;  4A3C G;  4L5R C;  5EKL A;  2EE1 A;  2MGS A;  4MZ9 A;  4JV5 L;  2ENB A;  1STN A;  2Z6K A;  2B8G A;  1PFN A;  1EY9 A;  3HZX A;  5IWA Q;  1D5Z C;  1OXS C;  4G57 A;  4XYO A;  4ZAI A;  1SND A;  2B2Y C;  5I9P A;  2F0P A;  2ATW A;  2I5L X;  2VY3 A;  3SXH A;  3DEP A;  4CKB A;  4BY7 B;  1K0R A;  2IX1 A;  3CCV A;  2RHS B;  1ILP A;  4JI8 Q;  4V0B A;  2F0U A;  2HDM A;  3FKI B;  1QE6 A;  2HCI A;  1PXU A;  1HA5 A;  3D0F A;  1NMF A;  1A3V A;  2PYK A;  2XWJ B;  1AW7 A;  4MN3 A;  2K5H A;  2HHH L;  2EY2 A;  4QJF A;  3K5L A;  1RJT A;  1IL8 A;  2F03 A;  1PH7 A;  1K3R A;  2M9V A;  3G4S A;  3HOU G;  1KAA A;  2N8N A;  1PTO C;  2NTT A;  1KNA A;  1TII D;  1F9P A;  4LF8 Q;  3GV3 A;  1R9T B;  2EJM A;  2SEB D;  1K8M A;  1PH2 A;  3QOJ A;  4NXM Q;  1JOR A;  4IOC A;  3VA5 A;  2BDO A;  3ER0 A;  1IBM Q;  2ICI A;  1TKW B;  1X3Q A;  5IOC A;  1CUK A;  1U4P A;  4NP5 A;  3V05 A;  1LUZ A;  1XMQ Q;  3J7A 5;  4X65 Q;  3S1N B;  3I2Z A;  5CV8 A;  4A76 A;  2NVX B;  4EVO A;  1IYJ B;  2X6L A;  1MIU A;  5JVG 3;  3BJU A;  3EN2 A;  3H3V I;  4DV3 L;  1PTO B;  2B2W A;  4ZLT F;  1WTX A;  4P72 A;  3MHB A;  2NN6 H;  4RAU C;  2D9U A;  4DR5 Q;  3PO3 H;  4KY6 A;  2IWH A;  2M2L A;  5IOD A;  3RD4 A;  1IKL A;  1SNQ A;  4QY7 A;  4QCL A;  4AQY L;  2I0Q A;  3VYS A;  4JV5 Q;  2K03 A;  1TWF H;  3I73 A;  2XGT A;  1Z9F A;  3KDF B;  3I91 A;  3H91 A;  3BZK A;  3X3M A;  1EQR A;  3TS0 A;  4NPS A;  4K8J A;  3LX0 A;  3NHH A;  4P73 A;  3CD6 A;  4OWW B;  1F9Q A;  3CW2 C;  1E1T A;  2DY8 A;  3F1Z A;  5IT9 c;  3PO3 B;  3A5Z B;  4KY7 A;  1YBY A;  4DR4 L;  4A3G B;  1VQC A;  2N49 A;  1F9R A;  2B63 B;  3S16 B;  2K5D A;  3NTK A;  1KTK A;  2Z4I A;  1B4O A;  3T16 A;  3OW7 A;  4HJ8 A;  5EAY A;  3IKJ A;  3J7A V;  3KDF A;  2RVL A;  4A3E B; 
#chains in the Genus database with same CATH homology
 1FL0 A;  2R92 H;  1U0L A;  2K5N A;  1AH9 A;  3PSI A;  3W1B A;  5FJ8 H;  3KJP A;  1MKH A;  1X56 A;  4YHH L;  2OTL A;  4POG A;  1XNR Q;  4UP9 A;  2OCE A;  4LF6 Q;  4IPH A;  3HOY H;  2PI2 A;  1J5E Q;  3OYY A;  1UEB A;  1Q1B A;  1IBK Q;  1VQL A;  3HOZ G;  5IYC H;  4JI6 Q;  2ES2 A;  5LMN Q;  3BU2 A;  4JI5 L;  1KAW A;  4R4O A;  1NY4 A;  3PUX A;  4DK6 C;  3I4O A;  2Q2U A;  2JA5 G;  2JA6 G;  4IFD J;  4XTC S;  1S40 A;  2VNU D;  4HIK A;  4B3R L;  1DGS A;  2KHI A;  4R4C A;  2F3I A;  3GD7 A;  3M9B A;  2CCZ A;  2YYZ A;  1QVC A;  2YV5 A;  1EOV A;  3AFQ A;  3E0E A;  2VS1 A;  3B6Y A;  3UDI A;  5C0X J;  1ASY A;  2IY5 B;  4UP7 A;  2F4V L;  3TRZ A;  1N32 Q;  2NN6 G;  3WWV A;  3ULJ A;  2DGY A;  4DV0 Q;  1JJ2 A;  4JI2 Q;  4DNI A;  2ZTC A;  2N3S A;  3UDF A;  4RMF A;  1EIF A;  1ASZ A;  4KHZ A;  1SN8 A;  4DV5 L;  4JG2 A;  4DV7 Q;  2K50 A;  3K81 C;  4EX5 A;  1K83 H;  3HOX H;  2PMZ E;  4PZ6 A;  3F2B A;  1KD1 C;  2CFM A;  3RN2 A;  2VQF L;  1AE3 A;  2WB1 E;  4X62 Q;  1BBU A;  4GOP C;  2JA8 H;  5GAD C;  4GKK Q;  4YY3 Q;  2Z0S A;  1PYS B;  3RR5 A;  5IYB G;  1UE1 A;  2OQ0 A;  1V1Q A;  4UP8 A;  1QUQ A;  2IX0 A;  3NEL A;  1SRO A;  2JJQ A;  4JI1 Q;  4A3E G;  3S2D H;  4IO9 A;  4X62 L;  1I3Q H;  4Y7N H;  3GTM H;  4BY7 H;  2MO0 A;  1L0W A;  1IZ6 A;  3NBH B;  3A5U A;  4BBS H;  4DV2 Q;  5C0X G;  4XIG S;  1VQF A;  1PHJ A;  2KEN A;  4Y52 H;  2K75 A;  4A3F G;  4J15 A;  3ULL A;  1EUJ A;  3F2C A;  1S72 A;  4AYB G;  5JJK A;  3I4N G;  1N8R C;  4DV1 L;  4HIO A;  2NN6 I;  4LF4 L;  3DM3 A;  4NXM L;  2IT1 A;  4LW1 A;  4R4I A;  1Q1E A;  1E22 A;  4YHH Q;  4JI7 Q;  4LUZ A;  4JI7 L;  2UXB Q;  3GTG H;  3ERS X;  4A3E H;  1Q86 C;  4KHP Q;  3J80 i;  3TEH B;  1IBL Q;  2CKZ B;  1GO3 E;  1SMX A;  2ZTE A;  3MXN B;  1YHA A;  4LFC L;  1H95 A;  1FJG L;  1FJG Q;  2UXD Q;  3TQY A;  3KF6 A;  2JK8 A;  2ZTD A;  3ZJY C;  1PH8 A;  1EYG A;  2DUD A;  3CP0 A;  4JI6 L;  1VQH A;  4L5S A;  1OXT A;  4DAM A;  4R4T A;  2MFI A;  4L5Q A;  5GAG C;  2A19 A;  5GAH C;  2UUA Q;  5C44 H;  1HNW L;  4P71 A;  5IE8 A;  1HJP A;  3U50 C;  1G29 1;  3CF5 A;  4GLA C;  3S2H H;  3CCE A;  4IFD G;  2WP8 J;  2PQA A;  1B8A A;  1HNZ L;  1NMG A;  1VQD A;  2WFW A;  3J81 i;  4DR7 L;  4GNX B;  2WB1 G;  2NZO A;  3DLL A;  1NE3 A;  3AQQ A;  3GDE A;  1IBM L;  4DR1 L;  1WYD A;  1G51 A;  3BZC A;  2KHJ A;  4DR1 Q;  1J6Q A;  2OWO A;  4HIM A;  1SRU A;  1TWA H;  1I50 H;  1Q46 A;  3S1Q H;  2BH8 A;  3RLF A;  1CSP A;  3GTJ H;  2GN5 A;  5C4X H;  5AJ3 Q;  1XPR A;  2Q2T A;  4JI4 L;  4LFB L;  3G6E A;  3UDG A;  1VQO A;  4QL5 A;  1LM0 A;  5IP7 H;  5IYD G;  3CPW A;  4TVA B;  4OO1 G;  2RF4 A;  3HKS A;  3HKZ E;  5C44 G;  1CKN B;  3UE0 A;  1VQ7 A;  2NZH A;  3H15 A;  4C3J H;  1YJW A;  2E2J H;  1EIY B;  4C3H H;  2NVY H;  4DV4 L;  4GOP A;  3CC2 A;  3TS2 A;  4GS3 A;  1CSQ A;  1PH4 A;  5IYB H;  3KLW A;  1NTG A;  2HT1 A;  5IP9 G;  1TXY A;  3U4Z A;  2KCT A;  1B7Y B;  3OW2 A;  1YIJ A;  1K9M C;  1I94 Q;  1PVO A;  5IY0 A;  4QIW E;  4DV3 Q;  2RHQ B;  3UDX A;  3F2D A;  1KIX A;  3STB D;  1HR0 W;  1KC8 C;  1SE8 A;  3T1H L;  1YI2 A;  2OTJ A;  2F4V Q;  4HJ7 A;  2VUM H;  5IP7 G;  4AQY Q;  3HOU H;  4BBS G;  2IHF A;  3CCL A;  4JI2 L;  2E8G A;  1WJJ A;  2JA8 G;  1IBK L;  2VL6 A;  3EBE A;  3PIO A;  2B29 A;  4A3G G;  2VUM G;  3UE1 A;  1KHI A;  4A3L H;  4GNX C;  4MTN A;  5FLM H;  4B3T Q;  1GVP A;  1LTL A;  2B63 G;  1EQQ A;  1HNX Q;  1N33 Q;  2A8V A;  1OTC A;  4A4I A;  3K7U C;  1XMO L;  4BY7 G;  3KYH C;  1VQN A;  1I5F A;  2Q2H A;  4JCV E;  3KFU A;  4LFC Q;  1I6H H;  4L5T A;  3Q8D A;  2UU9 Q;  4JI5 Q;  4YCV A;  2RCN A;  4PMW A;  2AMC B;  1XMO Q;  1K8A C;  1X3F A;  3OTO Q;  3SGI A;  1QZG A;  1Y14 B;  3NEM A;  1SFO H;  4DV4 Q;  4OXP A;  4YCW A;  1QZH A;  1X9N A;  1K73 C;  3JC6 6;  4A3G H;  4OO1 I;  3PUY A;  2R93 G;  4JI0 L;  2E5L Q;  1XNQ L;  3FKI H;  1YHB A;  5C4X G;  5H1S E;  4DV1 Q;  3NEN A;  1YJN A;  1JMC A;  3FP9 A;  5J3B A;  1Y1W G;  4LF5 L;  1Y1V G;  4IPG A;  4TQU S;  5M5X H;  1OXU A;  2MO1 A;  2WAQ E;  4IPC A;  1CKN A;  3JAM c;  1R9T H;  3MEF A;  4POF A;  2ASB A;  2K5V A;  5BR8 L;  1IL2 A;  4PG3 A;  1X54 A;  2I5H A;  1V43 A;  4LF7 L;  1E7Z A;  1JJG A;  3HFZ B;  4GN3 B;  3W1G A;  1N34 Q;  3GTO H;  1E3P A;  1L1O A;  2E2H H;  2NVQ H;  3HKZ G;  3HOW G;  4YWK A;  4ALP A;  4NB3 A;  4EQ5 A;  1S3O A;  1GKH A;  2VZA A;  4GKK L;  1A62 A;  3IRB A;  1K8G A;  1UE5 A;  2JA9 A;  4DPG A;  3FKI G;  4JI0 Q;  1TWC H;  3FHW A;  1OXV A;  4MNO A;  1MJC A;  1VQI A;  3CCQ A;  2WAQ G;  3HOV H;  3M3Y H;  1Y1W H;  1BVS A;  4A3K G;  1Y1V H;  4JBJ A;  4A3M H;  5LMN W;  4P74 A;  1SR3 A;  1N32 L;  3HOX G;  2Q2I A;  4A3K H;  3PF5 A;  2JEB I;  1PH5 A;  4BXX G;  4GLV B;  5FLM G;  1YIT A;  5IYD H;  5JJL A;  1KL9 A;  3STB C;  4P75 A;  1B70 B;  4RG1 A;  1XNQ Q;  1HNZ Q;  1W3S A;  1XMQ L;  3J81 j;  3H0G H;  4A3B H;  2AKW B;  2KBN A;  4BY1 G;  5C4J H;  5HGQ A;  4LUO A;  4B3T L;  4K0K L;  4IPD A;  1A8V A;  3RNU A;  3H0G G;  2B3G A;  3I7F A;  5AJ3 L;  2PI2 E;  2UU9 L;  1VQG A;  4A3I G;  4BA2 I;  4HID A;  3L7Z C;  1PH3 A;  5K36 G;  3AYH B;  1N36 L;  4OON A;  4C3I H;  4A3D G;  2PQA B;  4BXX H;  1WCM G;  1PV4 A;  2MNA A;  1X55 A;  2D0P A;  4DR5 L;  2I5M X;  1PH9 A;  3OTO L;  1GM5 A;  2ALY B;  4LF8 L;  1VQA A;  4B3R Q;  2PNH A;  3PCO B;  4A3D H;  4A93 G;  4WJ4 A;  2IHE A;  2R7Z G;  4IOA A;  2R7D A;  3S14 H;  4LF4 Q;  1LYL A;  3K0X A;  3RLN A;  4HJ5 A;  2JA6 H;  1CKM A;  4UPA A;  4A3I H;  3M4Q A;  3A74 A;  4LF5 Q;  1T9H A;  1D7Q A;  2JE6 I;  1QVF A;  2R93 H;  1KXL A;  1YEZ A;  3EIV A;  1E1O A;  4YCU A;  1M1K C;  3ICE A;  4ME3 A;  2QGQ A;  1UE6 A;  3J80 c;  1WI5 A;  4PZ8 A;  3T1H Q;  1HNX L;  1X3E A;  5M5Y H;  3PO3 G;  3M4O H;  2V1C C;  4PZ7 A;  4WJ3 M;  1W2B A;  4JI4 Q;  4KLK A;  4LWC A;  1EWI A;  5ELN A;  5DLQ E;  1JJC B;  4C2M H;  2CWP A;  4OX9 L;  3E9I A;  3CC7 A;  4GN5 A;  1X3G A;  1RIP A;  3CCR A;  2QEX A;  1WFQ A;  4X64 L;  1Q12 A;  3CMA A;  4DR3 Q;  2UUC L;  4LNQ A;  3GTK H;  1VQB A;  5JEA J;  3CCS A;  2UUB L;  2AHO B;  4OWT B;  4DV6 L;  3AFP A;  1Q81 C;  3M7N A;  1VCI A;  1NBW A;  4GN4 B;  3S17 H;  2UUC Q;  4X64 Q;  3KJO A;  2D0O A;  2K4K A;  4JI8 L;  4AIM A;  3GTL H;  1A63 A;  1HR0 L;  1PH1 A;  4QGU A;  4DR7 Q;  1KRT A;  4B3M Q;  2OQK A;  2GVA A;  2YTV A;  1PFS A;  1U5K A;  5BR8 Q;  5C3E H;  1VS0 A;  4HJA A;  3S1R H;  1VQ4 A;  2YU9 H;  1N33 L;  1XPU A;  2ZM6 L;  1PYB A;  3AEV A;  2KCM A;  4B3S Q;  3M4P A;  2VW9 A;  4X6A H;  4QQB X;  3H3V H;  3HOV G;  4BA1 I;  3A0J A;  1VQ6 A;  4LFB Q;  4DV6 Q;  1X65 A;  1V9P A;  1L1O C;  1JB7 A;  1YZ6 A;  4BBR G;  3JAM i;  2R92 G;  5IWA L;  1FVI A;  2VQE Q;  2FXQ A;  4A3F H;  4YWM A;  1KRS A;  3CPF A;  4GLX A;  4A93 H;  1N34 L;  2R7Z H;  3D31 A;  1I94 L;  4LFA L;  1QVG A;  4HJ9 A;  4DR4 Q;  1UE7 A;  3PUV A;  4JC0 A;  1VQP A;  4YWL A;  1TWG H;  4NXN Q;  3RN5 A;  4DUZ L;  4DUZ Q;  4AYB E;  1YHQ A;  3HOZ H;  4A3C H;  3ULP A;  3CAM A;  1WCM H;  3K8A A;  3KF8 B;  1AE2 A;  5M3M H;  1GD7 A;  2EXD A;  1HR0 Q;  5JJI A;  1VQJ A;  3I56 A;  2BA0 A;  2JA5 H;  3I4M G;  1VQ9 A;  3F8T A;  1E24 A;  2ID0 A;  4DAY B;  4A3C G;  4L5R C;  4LF9 Q;  1HH2 P;  5LMU Q;  4JI3 Q;  2LXK A;  2UXB L;  1HZC A;  1L1O B;  4B3S L;  4MZ9 A;  3L0O A;  4K0K Q;  4JV5 L;  2AWN A;  2NVX H;  2D62 A;  2Z6K A;  4DV7 L;  4DV5 Q;  3PO2 H;  1XNR L;  3K7A H;  3PV0 A;  3T1Y Q;  2Y0S G;  5IWA Q;  2VQE L;  4JI3 L;  5LMU L;  1OXS C;  3PO2 G;  1N36 Q;  4DR6 L;  1WOC A;  2EQS A;  4YY3 L;  3GO5 A;  3LGJ A;  5ELO A;  3S24 A;  2ATW A;  4DV2 L;  2I5L X;  2VY3 A;  4IJH A;  2QA4 A;  2GVB A;  1SLJ A;  4AH6 A;  1C0A A;  2R7F A;  4JI1 L;  2K14 A;  2H5X A;  3PF4 A;  2YTX A;  2HIV A;  1K0R A;  2IX1 A;  3CCV A;  1TWH H;  1X6O A;  2RHS B;  1M90 C;  3CQZ H;  1BKB A;  2JA7 G;  4JI8 Q;  4JYA Q;  4JYA L;  1JT8 A;  3CCU A;  1D8L A;  4DK3 C;  2HHH Q;  1CKO A;  1HZ9 A;  3E9H A;  4KHP L;  3J7Z C;  3PUW A;  2VQF Q;  3T1Y L;  5GQO A;  2ZM6 Q;  3D0F A;  4LF9 L;  4IFD I;  2XTI A;  1NMF A;  1BBW A;  1P16 A;  1VQK A;  4GOP B;  3GTP H;  2K5H A;  2HHH L;  4QJF A;  5E7N A;  1YNX A;  3G71 A;  1IBL L;  4DR3 L;  1PH7 A;  1K3R A;  5FJ8 G;  3I55 A;  5GAE C;  3G48 A;  3G4S A;  4O2D A;  2UXD L;  1VQ5 A;  2JA7 H;  4JBK A;  3HOU G;  1JE5 A;  2N8N A;  3L2P A;  4APV A;  1C7Y A;  4LFA Q;  1KQS A;  4LF8 Q;  5JEA G;  2UUA L;  4A3L G;  4O0A A;  4NXN L;  1QUQ B;  3I4N H;  1YJ9 A;  5C3E G;  2ZJP A;  5M3F G;  1IXR A;  2UUB Q;  5M5W H;  2L15 A;  1PH2 A;  2NVT H;  4NXM Q;  2BH2 A;  1EFW A;  4IOC A;  4OWX B;  3ER0 A;  4IJL A;  1IBM Q;  1XPO A;  3J81 c;  4OX9 Q;  3CCM A;  4BBR H;  1A0I A;  1P8L A;  3W5O A;  1PA6 A;  3GTQ H;  3S1N H;  3I4M H;  1CUK A;  1PH6 A;  4X66 Q;  3S1M H;  1LUZ A;  2ZJR A;  1OXX K;  4KI0 A;  1XMQ Q;  3J7A 5;  3CCJ A;  1HZA A;  4X65 Q;  3I2Z A;  3KOJ A;  1Q82 C;  5GRO A;  1FGU A;  4A76 A;  1IYJ B;  1MIU A;  1UWV A;  3BJU A;  2UXC Q;  2E2I H;  3EN2 A;  3H3V I;  3HOY G;  1Q8K A;  4DV3 L;  4GKJ L;  3S15 H;  4GNX A;  5IYC G;  5HY6 A;  2JEA I;  4P72 A;  2F52 A;  3M85 A;  4A75 A;  1HZB A;  2LXJ A;  4B3M L;  3PUZ A;  4DR5 Q;  4JOI C;  3PO3 H;  2K52 A;  2A1A A;  3RZO H;  1G6P A;  2HQL A;  4LUV A;  3PGZ A;  4DV0 L;  3CC4 A;  4DKA C;  1XTD A;  5IP9 H;  3CXC A;  4QY7 A;  4JOI A;  4DUY L;  4X65 L;  1O7I A;  3VDY A;  4A3M G;  4AQY L;  3RZD H;  2I0Q A;  4LF6 L;  3HOW H;  4JBW A;  4A3J H;  4H02 A;  4JV5 Q;  1YVC A;  1RL2 A;  4X66 L;  4LF7 Q;  1C9O A;  2CQO A;  1TWF H;  1MJE A;  5C0X I;  3KF6 B;  2XGT A;  1Z9F A;  2LSS A;  3KDF B;  3U58 A;  2MQH A;  5LMN L;  3BZK A;  1VQM A;  4R4Q A;  4DUY Q;  4UY8 C;  1EQR A;  4GKJ Q;  3TS0 A;  2UXC L;  4NPS A;  4DR6 Q;  1L2F A;  3CD6 A;  4P73 A;  1J5E L;  4OWW B;  3CW2 C;  5FLX c;  4FDB A;  1E1T A;  3F1Z A;  2AWO A;  5IT9 c;  5M3F H;  2N78 A;  3A5Z B;  1Z47 A;  4JBM A;  1YBY A;  2E5L L;  4DR4 L;  1VQC A;  2EIF A;  2N49 A;  4DR2 Q;  4DR2 L;  2Z6K C;  2R6G A;  2JQO A;  3K80 C;  1HNW Q;  2ZJQ A;  2Y0S E;  4A3J G;  1XJV A;  4A3B G;  1NJI C;  2BA1 A;  1VQE A;  2YTY A;  2HIX A;  3RLO A;  4BY1 H;  1VQ8 A;  4HJ8 A;  1N9W A;  2C35 B;  3TRE A;  5EAY A;  1Q7Y C;  2B63 H;  3CME A;  3S16 H;  4R1J A;  3PIP A;  3KDF A;  5M3M G;  2CWA A;  3U4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...