2F54D

Directed evolution of human t cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without increasing apparent cross-reactivity
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
205
structure length
205
Chain Sequence
QQVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGGKLTSLLLIQSSQREQTSGRLNASLDKSAGSSTLYIAASQPGDSATYLCAVRPTSGGSYIPTFGRGTSLIVHPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed evolution of human T cell receptor CDR2 residues by phage display dramatically enhances affinity for cognate peptide-MHC without increasing apparent cross-reactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen
total genus 37
structure length 205
sequence length 205
chains with identical sequence K
ec nomenclature
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f54D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f54D02
2BDNL 2EDLA 4I13B 3UO1H 1DQJB 4KMLB 1XFPA 3JV6A 3MV7D 1CK0H 4QRRE 2D31B 5FF6B 3GM0A 3TBYB 3D0VA 2BNRA 3IDMB 3QXAA 5D7IA 5GXBB 3X12A 2IBZX 2HFTA 5ERWB 3RWCB 4JHAH 4JFHE 5J4MA 4OI9A 3BUYA 1R3LA 4U2ZA 5F9WB 2BRQA 4TSBL 3G08A 4U1KB 4OQTH 4WHTA 4GMTH 2CXKA 2H2PD 4R90H 4WV1C 4WEBL 1A1OB 1KN4H 1PSKH 1DE4A 2VKXA 4YPJA 3T2QA 2BSSB 1FZJA 1CDYA 1LEGB 2BVOA 4MNGE 4QCIA 4G7VL 4KJYB 3BT2H 3MYZA 5BCAA 3TESA 2BNQB 5JXAH 2HT3C 3L3IB 3CX5K 1CS6A 3IKCA 1ITBB 3JWDH 5J1TC 4ZFOL 1A0QH 2WINB 2FX8H 3X11B 3QIUC 5EA0H 5L0QB 1AKJA 3D0VB 1QR1A 3KPOB 3PV7A 1VERA 3N85H 3GMLA 2A0LC 5ELIA 1FFPA 3VWJB 5T1LA 1F4WL 3F8UB 1F11B 5TE7L 3TVMB 2FEEL 3EYVB 3WUWB 2WAHA 3FQUA 5K59E 5K93A 4GUPB 1JYWA 2Z4QA 4YXLH 1CTOA 4X4XA 3LKNA 1URLA 3EO0A 1QFUH 3K81A 5SWSB 1DBML 3DVFA 5GIRA 3SPVA 3BO8A 4R2GB 2CDEA 1GJIA 4P5TD 4PJEB 2LTQC 1CBVH 3KDMB 1HN1A 3MLUH 5DRNA 1IQDA 3Q5TA 3O6LH 3S98A 2V7NA 3BPNB 4W4NA 5D7IF 2ICEA 2P43B 2QV2A 3D48R 3N9GH 4NKOA 3VGFA 3CVIH 3RVWC 2HKHL 1JVKA 3IDXL 4PJIB 4P4KD 3RWJA 4LLWA 1FVDA 5CJBA 2DLEA 3H9SB 2GHWB 2ZOLB 3L3OB 4M5ZH 1LO4L 1UWEL 3K3QA 5C1MB 1WCBB 5GSRA 2GCYB 3W81A 3ZKNC 2E7BA 3MFGB 1KN2H 2IAMD 3DPBA 3FRUB 5HHMB 5I73C 1CBVL 2IALB 4UIKH 5L6YH 1YEHH 3HZMB 1AIFB 1FVCA 2VDQL 4EXPX 1MAJA 1NBQA 1WICA 1Q0YL 3VI3E 4OFDA 1NC4B 2F53E 1JRHI 5CEZL 1S3KH 3HZKB 4JVPA 1YEDA 5DHVA 5DTFB 3VFOA 5JZ7D 4HKZB 3G6DL 4YDJB 3BKCL 1YEFH 3JWNC 2J6EA 4XNMA 5HHNA 1JNNH 5LGJA 1RJCA 1U8HB 3QNZB 1QP1A 4JHWL 5I1IH 4OZIB 1IRAY 1NBZB 1CG9B 3PF2A 4HWZA 1DP0A 3DXAE 4OLWL 1MJ8H 4N0FA 5C0CB 4Q97A 3FB7B 2NX5D 5E24E 5F7HA 4HW6A 3T4YB 5DJ8A 4PJIE 4PGBA 5ADOL 5KS9B 3MLYH 1BJ1J 5EUOE 3GHEL 1A1MB 1B4JH 5TQ2H 5AG9A 5DSCB 3QDJE 4IDLA 3U9PL 1AY1H 3GSRA 4GXUM 1NBYB 1HDMA 1YEFL 5IB2B 1YMMB 2YS4A 4XGZB 2AS5M 2VSCA 4ZFFB 5HJ3B 2HFGH 3U9UA 2ZSVA 2Q87A 2VXSL 4HC1H 2EH8H 2AK4D 4JDTL 4DVRL 5EOCJ 4MD0A 4IDJL 4U31A 3GMRA 3O6ML 2NYYD 5IFJA 1OP3K 2MTPA 1MHCB 3VWJD 2KQNA 5C6PB 1MWAL 3VXMA 2RBLA 4X6DB 2HLFD 2W65B 1E4XH 1MCWM 4RMVA 5CEYA 2V5TA 5HGHA 5TDPB 4E0RA 2CPCA 4NQDA 1BOYA 5HHOA 4UOJA 3RWHA 4RFEA 3SGEH 2ICES 4Z7NE 1J0YA 4OQTL 3JTTA 4X5WA 2BDNH 3OBAA 1CFTA 1FORL 1NJ9B 2BNQD 2OL3A 4U7MA 4LPTA 2PW2A 4X6DF 1CLYH 4MAUH 2CUIA 3VFOB 2X1WL 1QHOA 5SWQA 3P4OB 2D0FA 3WFBL 2WUBH 3HPJA 1A21A 3V4UL 4RFEB 5HHOB 4KVCL 2ITCB 2EO1A 2HVJA 4LCYB 3JWDL 4PRHA 5GGVH 1I3RB 3ZE2F 1K8IB 3HI1A 4WO4C 4M43H 3HNTL 2A6JB 4KFZC 4PS4H 5LWYL 1QSED 1TVDA 4GMTL 1IILE 1ZVSB 5MENE 5ICXA 2EYTA 2B1AH 4UU9B 1YECH 3Q1SL 1JTOA 3S5LB 1OQXA 1UYWH 4FHBD 2EYRB 2XFXB 3B6SA 2FLRT 1MCQA 4UMGA 1IC4H 1S7WA 1RZJL 5IB5B 3DYMA 4K3HA 4PRNA 1GZQB 5JA9A 4OZFA 4QXUL 4EBQH 4RWHA 5AUMB 1RJYB 2R1XA 3O0RL 3SCMC 3ZT7A 4JY4B 4JFED 2GIYA 3E6HA 4Z8FL 4XP4L 5GGVL 2CIKA 4JFDD 4PPTA 4YDLC 3MRLA 2R1YA 5EULV 3DRTB 5D71L 2EE3A 1UXWA 1EPFA 4ZS6D 5JO5B 5I8OH 4HAGA 1OARH 4QHLB 1FNHA 5F89B 3RDTB 3Q6FA 8FABA 5ACLA 2DKUA 4XI5D 4DGYH 4ENEC 3KPMB 1MNUH 4YFLI 5GGRA 3WL9B 4IRJB 1R3HA 2CIIB 3KJ6H 1AJ7L 1PLGL 1U92A 3D3VE 1KSRA 2D7OA 5TF1H 1IJ9A 2LTQB 2YUVA 4X0KB 4PB9L 1QSFA 3EOYG 1GRWA 2B5IC 2YD3A 1YEDB 5DHVB 4K8RL 3DARA 1JWUA 3U82B 1RURH 4MJ2A 3VWJA 1PQZB 4NRZB 3HUJB 5B21A 2R0LH 3IDYB 3BRGC 3AU1A 1TZHA 4Y4KB 1RZ7L 4JO3H 3VFRB 1YNLL 2GITA 1RUML 4X4MA 1WWCA 1HOCB 1MPAL 4FG6D 3QIUB 3TBTB 4JRXE 3EIFA 2VDQH 3RKDC 2EDOA 3W11D 1Q0YH 2F9BT 1ZVSA 1RIUH 4KGLA 3MXVL 1HHJA 2HKHH 2OL3H 5IMLA 1DBAH 2I07B 4IOSD 4YDKL 2X4RB 3S3JA 2ZCHL 4Y16D 2CJUL 3BPNC 4PUBL 5F1SA 1IQWH 4U1KA 2GTZB 4QXTA 3VFVB 1P84J 2WIIA 2W91A 2HVKA 3IDIB 5ILTL 1FLRL 1P6AB 4YHKL 3FN3A 2NXZB 3ZE0F 5L6YL 4H1LA 2XOTA 1I8LA 3HPLB 4KHTL 5AYUL 4JKPL 2OK0H 1TNMA 1I75A 3LHPL 2MKWA 3NVQA 1DL7L 3FFCB 3WNNA 1VENA 3GSUA 4XCNA 5DRWA 1KGCE 2GT9A 4NQVA 4QRTB 5D70L 1RK0A 3DECA 5DWUH 1BVKB 4P2QE 2IH3A 2VLRE 4Y4FB 5A1AA 2ZCHH 5F7KC 5TPWH 4GAYB 3AAZA 3HE6D 2DQUH 2B7DT 2XN9E 4YUEH 1EGJH 3FO1B 1A3LL 3AC0A 3QEGL 3X3FL 1U8QB 4X6CB 2PR4L 4HEME 5HGAA 3ARRA 1NMBH 2ARJA 1V3KA 1G7LA 2LU3A 2KH2B 2DQFB 4Z0XB 2X44D 2ZSWB 2ZG1A 3DHJA 3ECBB 5IW3A 3QDMD 2K1MA 2W9EL 3QAZB 3BVNB 1JL8A 3RWDB 2XXCB 3SDXA 3U30B 1BZ7A 4YDVA 1A1OA 4PV9B 3NCJH 3DX6A 1HSBB 1H0DA 3DMMB 1G6RL 1JNLL 4QHMB 1KT2B 2DQTL 5C0BD 5INDA 2YSSB 2H26A 4RMSA 4HWZB 5D93C 2XPGA 4MA3A 4Z0BL 2UWEF 5EPMA 1T1WB 2CUHA 3DVNA 1QRNE 3RHWF 1ZTXL 5GIRB 1EFQA 1FGVL 5D70H 3RWGA 2YXFA 3N0PB 3LY6A 4UDUA 4XPTH 4KRPD 4ODVH 4HIJA 2VLRA 2ICWB 4I5BB 5I15H 5DJXA 3EGSA 4OZFH 1VEMA 4FN0A 3C6SA 1A2YA 4H5SB 4G8IA 1BQHG 3V4VL 3WIFA 4LPYA 1G1CA 3E1F1 4OZ4B 3ARZA 1EXUB 5F7EL 2ESVD 2A1WH 2V5MA 5CIPH 5T5FH 2UWEE 2ZCLH 3EYSL 4FQ2L 5CGYC 3KYMA 4O4YH 1KELL 1T2QH 4V1DE 3NIFF 2VH5L 5KJRL 4RAVB 3HC0B 4WNQB 3OKKB 1F4YH 1KT2A 3G5ZB 3VXQB 2ADIA 5DMKA 3S35H 2A6KB 4PGEB 4LLVA 4XH2A 4LLDA 1WBZB 4LCWB 12E8H 3G5YB 2R8SL 3OF6A 4NZDA 2ERJB 1JHLH 3ALWA 25C8L 4P5TC 1N3NA 4OM1H 2CDGA 3ARXA 1I3GH 5M95B 2DICA 4Z0XA 1TITA 4UINH 5IW1B 3L6FA 5L8LB 1N6VA 4RNRA 1MCRA 5KW9L 1N8ZB 1RIHH 5IVNA 4HWEL 1I1AC 1LILA 1JUFB 3H9SE 1IAMA 1J0IA 2NCMA 1HZHL 1NGPH 2GSIA 4C83A 2FX9L 4ZPTA 1EBAA 3VXSA 3BD5A 1RU9H 4N9OB 1NSNL 4U1IB 3K2MC 2FO4A 3W0WB 1VKXB 2WWKT 3L5WB 3QUZB 1LO3L 4PGZA 3GMLB 4YHIB 3SCMA 1HH6B 3LZFH 1AJ7H 1PLGH 5L2KB 4J23A 1UFUA 4Y5VC 1JF1B 2JCCB 4KVNH 4JFDA 1OSZB 5A2KH 2WZPD 2ESVE 2NY1D 3RDTC 1IGJA 3RTQC 4RA3A 2QQKL 3FZUC 5JLZB 4AG4H 4YR6A 4WI7A 4WW2F 5DK0B 4DWHA 1IT9H 4XPAH 4EKXA 1XR8B 2A9MH 4D3CL 1MPAH 4LEOB 3P9MB 2NQCA 5C07A 1TTUA 2APFA 2HVKB 3BPOB 1KJ3L 4LCWA 3B2VH 4XNQA 2DD8H 3ALXA 4HKBA 3ZDZE 3BT2L 3MFFB 2YD6A 2K7PA 1P9MA 1LO3H 5DR5H 1FSKB 1L0QA 3MV9E 3OKKA 3G08B 5L9DH 2P5EE 4LFHG 2QSVA 3SGJA 4P0DA 4XC3L 1BEYL 3WBDA 1LE5B 4IRSA 3IB4A 5DMJB 1OAKL 4MJIE 3PHOA 3WFCL 3GMPB 5KSBA 4GJTB 4OM0L 2BVTA 4TNWF 4O2CA 3TBTA 2CJUH 4PUBH 2LAGB 4JFHD 3BIKA 4O58L 1F3RB 1KEML 1G7QA 2RR3A 3RPKA 1RU9L 5GS3A 4POUB 1L7IL 4MJ6B 3VW3H 1QUNA 4PJXA 3DUUB 2D3VA 5GHWH 5JDSB 3LD8C 1OGTB 1WT5A 1MHHA 2H6PB 3T2NL 3KHQA 1FDLH 4UV7L 4PJAA 4NYLA 1CVSC 2MPAL 4JGUA 3ARYA 3SDYH 5J3HC 2V9TA 2W0FA 5AEAA 5DD0H 3L3HB 1MLBA 4HH9B 1S7QB 3PQYA 4IEFB 2EZ0C 4W6WB 2ZZUT 3QRGH 3WD5L 1S5IL 4L5FH 5IV2B 4MA8L 2RCSH 5SV3A 1F90L 1V3MA 5EORL 5DJZB 1V3JA 4HHAB 5TJWK 4D8PA 2AJVL 5IK3A 3MRKB 1HCFX 3WFHA 2CK0L 1LD9A 4NC1C 2CH8A 1X44A 4CMMA 3ARBB 3K8LA 2EECA 4JJHA 5CILH 1RJLA 2VDKH 3I85A 4ZPVB 1C5CH 3BYTA 1MCSA 2IEPA 3H8NA 4GAGH 4HIHB 4O9HL 4M8VA 2XFXA 3B6SB 2DTML 3EZJB 4JGJA 4JZJC 2Z8VC 1S7UB 3B9VA 2OJZH 3SKMA 3PHSA 4UQ3A 2A77L 1AQKL 2HRPL 3ES6A 4A6YH 4OGXH 4YHYC 1OAZH 4GAYA 4BM7A 4YE4L 3TO2B 4K8RD 3BRDA 5ICZA 4G9FA 3MOAH 1JFQH 2UZIH 1LGVA 2VWEE 3NABH 3SGEI 3U83A 4M1DH 4OGZA 1P7QB 4LCWE 1OP9A 2X89D 5ANMB 2XZQL 5BRZB 5CZXD 2J6EL 1JN6B 1H15B 4MCZB 1C5CL 3RGVC 1A4JA 1A6WH 1MUJB 4HWBA 1KIRA 1YUHB 3GIVB 1P7QA 4LSRH 4TOYH 1MRDL 3TV3H 5TFSL 4I2XB 2NY1B 5DJ0B 5EUOA 4Y2DB 2XKNA 4KY1H 5JNYA 1F2XK 4NOBA 3T8XB 3ESVF 1E6JH 2LU4A 3NZ8A 4ONHA 3O3AB 5D4QA 3OKEA 1RSFA 2WK2A 4R0LA 4S10A 2FD6H 1DVFD 4G7YH 3ILQD 2R56L 3QPQC 3U4EB 2DB8A 4QO1A 2B1HH 2EDEA 4PY8I 5HJ3A 4AMKH 3IETA 2GKIA 3I75A 1MCFA 2WBJD 4NOFA 4LAJH 25C8H 3IF1B 3UYRL 1B4RA 5CHNB 4N9GA 3LAFA 5HHQA 2Q7YB 1KTDB 3VCLB 4MXVF 1IFHH 4PLKC 2R1WA 4X98A 3OR7A 2G60H 4GKNB 4GKOA 3LPGA 2VLJB 3ZYOA 4H8WL 1C08B 3MRHB 5DJ2B 5EBGA 4ZSOE 4NQEA 1NGPL 1XF1A 1FNEB 2R56H 4HKJB 2C1PA 1NFIB 4HXBL 5CJQH 4AM0B 1AP2A 1YEGL 3KPSB 3LCYA 2I9LA 4NGHH 2P24A 4OZGB 3NN8A 1MEXL 3ARDD 3ZTJH 5ABDE 2VC2L 1K4CB 3SKJL 2P8MB 5C9JA 4PJ9D 3MV01 1KJVB 4DGIL 2DLHA 3VJ6A 3ZDYE 3SCMD 1G7PA 2APVA 1DZBA 1SY6H 1G9NH 4HS6B 4OT1H 3IETB 1GC1H 1KB9J 4MZ3A 3G5VA 1XF3B 3G9AB 3P9LB 5KSBB 2ZNXA 3MX0A 4M6AA 1KG0B 3R0MA 3MRDB 2UWEA 4XHJD 2UYLA 1RUPH 4HLZH 5C9KA 3GO1L 1ZAGA 2DWDA 5D1XB 3CDYA 4PRHB 3MV7A 4HKBB 5EZIH 1VADA 4PG2C 5BXFA 3MJ6A 5LJYH 1RZJC 4POZD 2KQMA 1L6XA 3M1BA 4LCCB 4JCLA 3JVGC 5A3ID 1G7HB 2XTJE 4CUCA 1IGTA 3MTRA 3S88H 2MOVA 3AXLB 3LOWA 4PJEE 2W9DH 1RZGA 3D3VA 2DAVA 1FP5A 1F4AA 3S4SA 2XWTA 4F3FA 5GHWL 5I73B 2FH6A 2Z4QB 1J5OH 1DLHA 3FQUB 4H88H 1SEQH 3RZWA 1FN4B 4C55A 1ZHLA 3W0WA 2RQ8A 2PO6B 2HFGL 1KCUL 3LMJH 4I48A 2CLRA 4G6FB 1G9NL 3WD5H 4AL8L 5B3JE 1T1XA 4Y4FD 3TWCL 3DYOA 3FB8A 5GRVL 1CLZL 4X6DE 4RMTA 4G6MH 1UZ6F 3IDJA 4L3EA 5IOPA 2OTPA 3F12A 4JHBA 3HI5L 3MMEA 3T0WA 2QEJA 2HTLD 5DSCA 5DS8A 3MLTA 3C9NB 4XPBL 3GO1H 5CD5C 5K9OA 4HLZG 4HCRH 4HFUH 1I7ZA 4L1HA 1FZJB 1NGWB 3P0YH 4LHUD 1OGAA 1R3IH 5DYOB 1UQSA 3EOBA 4LASL 1QKZL 1XF2B 4QOKE 1DLFH 3LS5H 4LSSL 3GSXA 4LF3A 4LGPB 4YWGH 4Y8AA 4NP4L 1FNSH 2G5BB 3UBXB 4KI5D 1I8MB 3RX7A 1U8MB 4O2EB 2XQYK 4ZS6C 4K94C 4ZOBA 3UJTL 1EHNA 2NNAB 4OCRH 3VGGA 4F9LC 2YZ8A 2IG2H 5DWUL 1KJ2A 4LDOB 1YDPA 2HT2C 1C8PA 1KUMA 4K7PX 2NLJB 4F7TB 4LLYB 1IKFL 2CRYA 4HGWB 5FB8A 3GDBA 3NOIA 4LRIA 3V0WL 3MODL 4NRYB 4PJIF 5C09A 4D9QD 2Z91A 1I1FB 1IKNC 2VIRB 3BP6A 1WBYB 1NGXB 3I6GB 5KBNC 3DO7A 1N2RB 3BN9C 4UINL 3QA3B 5CP7A 4LKXA 1X3DA 2AEIT 2D9CA 1WIPA 3MV8E 5KSAB 2HJFB 4RIRA 4N5UA 4V1DB 3T65B 5TE6L 1KCLA 3K0WA 1HWGB 2B1AL 4L8SA 2XZQH 3UDWC 1R3IL 1MHEA 1MREL 3MNZA 2NY1C 5E6YA 3RDTD 2IFFL 1VFAB 4XP5L 4LCUA 3CLFL 2DIAA 3GBML 1WTLA 2YUXA 1J87A 1QNZH 1N6UA 2KZWA 2ZCLL 4JFEB 4LBEB 1JPSL 3H2WA 2ARJB 1CF8H 3WSQL 3HC4L 4OIAA 4M4PA 1OD9A 1T66D 3AGVA 1BBDL 3WUWA 4R7DB 2VWEC 4I0PD 5F7NC 5FUZH 4YHMH 2QQNL 5CJOL 5JDJA 2J88H 4F9PC 5E2TH 4XHJC 2ZUWA 3F6IA 1BJMA 3PP4H 1B88A 4PJAE 3ULUD 5EO1B 4IIQA 1XAUA 3Q2CA 5IF0A 1LEKA 2EDFA 4J3TA 4ZDHA 5HHOD 4WHDA 3C09C 4O51A 1F4YL 4ZYKA 1NCUA 5GZND 1KJMA 1J1XL 1AXSA 1KIPA 4JFFA 4JKLA 3HI6H 1T89A 1LP9E 2V9QA 1PSKL 5E4IA 4KK8C 4YFDB 4CBPA 4JDVB 4PP2B 3EFFB 3UTSB 4JQVA 1HH9B 2A6KA 3CXHJ 4PJHE 1W0VB 4OBRA 3EFDL 4HDIB 4ELMA 1W72H 2KZ1B 4XTRD 2F5BH 4GRLA 3O2VH 5JOEA 1TENA 5FCSH 2V2XB 2AEWA 5B38B 5JXEA 1JMZA 3TBSA 5BQ7A 5JA8B 5IEHA 4O5LL 4I2XE 2NX5E 3RIAK 3DSFH 1BQHA 4LARH 4EI5A 2YD9A 5IHBA 4XXCC 1U8KA 5EFIA 1F4WH 2HT3D 4H5SA 4NQCE 4PJGB 4KHTH 4HV8A 2WWMD 5FB8B 1XR9A 4C4KO 4G6AC 5C0JB 5AD0B 5J9PB 4HIJB 4M6NL 4ISVA 4HS3A 4DAGL 4BK4A 4GG6A 1MIMH 4HT1L 2AV1A 1ZGLB 2BVYA 4CU8A 1S8DB 2NXZC 1J5OL 1BVLB 3O3DB 2BVPB 1CFBA 4NC2B 1YEJL 3L3GA 1XIWD 2QTEA 2HFEA 4MD4B 4ZXBA 5HGDA 4QHLA 3BEWB 5F89A 1FLRH 4Y4HA 4M7ZC 3OJMB 1OPGH 4FFWD 1IBGL 2XNAB 3LQZA 1MELA 3F7QA 1FG2A 4G5ZH 3OGCB 4P2CG 4PJ7F 2HFFA 3MRLB 1IC1A 3RU8L 1QRNB 3DX7B 4WGVB 1NEZB 1OWWA 4GQ9H 3QUMH 5CKAA 5DLML 3E2HB 4V2CB 2DQDL 3RVVC 3OSKA 3WFCH 5TGBB 4WWKD 5E94A 1H3PH 1W0YT 1NAMA 3C5JA 2FX7L 4ZTOH 3D2UD 5EN2B 4L9DA 5IMKA 2EDTA 4JQXA 4OLWH 2X70B 5GS2D 1MVUB 4NWTH 3VA2C 1JGEB 3ILPA 1YY9D 4ELMF 2CLRB 1RVFL 1J86A 3CFCH 1WF5A 2BVEA 3S34H 3O4OB 2IG2L 5FYLD 3RWIA 1VSCA 1DTUA 3A6OA 3MCKA 1RV6X 1U8LA 4JFOB 4U1GC 4Y16C 5FYKU 3CDGA 5T3XD 3QEHB 4HFUL 2DM4A 4YZFF 3GK8H 4LU5H 1IKFH 2PW2B 2PW1A 2FR4B 3MYJB 3QUKB 5C0ND 5GS1A 1DLFL 3VFNB 1JHTB 5BVPH 1NMAL 1OCWH 4KZDH 5F7EH 3GBNL 5FCUH 4JN1H 2KKQA 2XWBA 3OKDA 2VABB 2Y6SD 4QXTB 3E3QE 1HSAB 3LVEA 3UTOA 5I1AA 5CGYD 1I3GL 2DWDB 4LVNB 2CLZA 3VXNA 4U1LB 4U6TA 3MRMB 5DRXB 4TTGA 1W0WA 3BN3B 4HF5L 3C6LA 5HI5C 5D1QA 3L3KB 4ODVL 3UEZA 2VQUA 1IEBB 2VR5A 4S1RL 2XA8L 5EBMB 1UB6A 4AH2B 2O93L 4X7SH 1DSFH 4D9QE 5EU6A 4PJ7A 2P4AB 3KXFD 3LIZL 2AV7B 4Q9QL 2EC8A 4QY8B 1G7PB 2GY7B 3MV7E 3F7YB 3FT2A 3HR6A 4EI6B 4NO0D 1T83A 4XRCB 2J8OA 3QWOB 4R0LC 3HRZA 3BZDA 1S7VA 3HUJA 1BMGA 3LB6D 1FIEA 4WI2A 3TN0B 4MDIA 1MFNA 3DBXA 2E7CA 4I77L 1GGIH 4P23C 5EB9A 5TQ0L 1BD2B 2ZUSA 2XIDA 3CSYA 3HG1A 4GXVH 1U58A 5TE4H 3FB5B 2H9GA 1W72B 3TYFB 1FORH 3MOBL 1MCDA 4X83A 2VERN 3FO0L 3MBXH 3QXWA 1WWAX 2XQBH 5F3BA 5I1EH 4Q9BA 4OZIA 2Z31A 4TSAL 3SY0B 1FL5A 2F74A 3TC9A 3AS1A 5D6DA 4R8WL 5L0QC 4XNMB 5HHNB 3RGHA 4G8FB 3RGVA 3DGGB 4ODHH 5DHYB 1J8HE 1GAFH 1T1ZB 2V2WA 3DTXA 5E8EA 2BFVL 4U1HA 4G42B 4IRSC 4XC1H 3E8UH 3PP4L 3C87A 4BZ2H 2R2HA 1CXHA 3QUXA 4C54A 4JPWL 3KLHD 5C0NC 3KYNA 1ZLSH 2XRAH 3QCVL 4JRYA 2BHYA 4QXGH 5CHNA 5IJVA 5D9SB 4S2SA 1MQ8A 3BAEL 4PRNB 3QEUA 1KLUB 3TH4T 5ETUA 2VXQH 3CFBA 3MJGX 4M48L 4NDMA 2HMIC 3D39E 1AC6A 4JZJA 1A6AA 5CJQL 1I8KB 3MRJB 3VFPA 3OKEB 1LO0H 5I74C 1KB5B 3PWLA 3TCLB 1L0YA 2VLRD 5EOCH 1Y18A 1INDL 3RWJB 5GGVY 1CIUA 5IROA 5E9DD 2C4FU 1D6EB 1CL7H 5B8CA 2BNRE 1INQA 4LIQE 1IMHC 2PTTB 4N0CC 5HHPB 1K2DB 1TETL 3FRPG 4LSTL 3DX9B 1A4JB 1L7IH 3EO9L 2Q6WA 4N5ED 5F1IA 5DHVH 3SDCA 1XF5B 1VACB 4OSUH 2YD1A 1JMXA 3OF6D 2J1KA 1G9MH 5DQ9A 3UC0H 1WBXB 1OB1A 5D1XD 1A1NA 1MFBL 3AMKA 2VITA 4NQSA 1JV5B 5C08D 1U93B 3MBEB 4Y19A 2BC4A 2GYSA 2VOTA 3PWJA 5BV7L 4YBLC 1R24A 1VA9A 2EKSB 4MWFA 2EDKA 4HJJH 1WV7T 1ADQH 2YMXH 4JY6A 1NGZA 3GMMA 1DQQB 4P5MA 5TH2B 2EXYD 3JV4A 5MENB 1FL6A 3MJ9L 4PJGE 1F4XL 4RGNC 4W81A 3NCYS 2XN9A 1NFKA 2EE2A 3IJSA 4JHZA 1AGFA 1FYTB 2V7HA 4H0HB 2V5YA 3LHPH 4HZLB 5DD3L 2FSEB 3VXOB 2WINA 2DIBA 2YPLD 2BSTB 4X6FB 1MJ7L 3D5OF 1T5WB 3ARBA 1FVEA 3NFPA 4XHQA 2YWYA 4BFEA 2Y7QA 4DUWA 1TETH 2DYPA 4LPWA 4N8PA 2Y36H 3G5XA 2OBGA 3RUGF 3MODH 2XI9A 2P1YA 3MV8D 3G6JA 1E4KC 5EU7E 5ENWA 1RVFH 3FB7A 2V6HA 3BRFA 2P7TA 4OF3A 1BQUA 3NCCB 4AEHL 3T1FA 3K2UH 3MRRA 1FCCA 5CSZA 1MHPH 1D9KC 4WUUA 4ALAH 1VPOL 4C59B 3VDCA 3DVGB 1Z3GL 1CI5A 5DQJB 1D5XA 3MV9B 5LAXA 5L7XH 4M1CC 3LKPA 1RK1B 5MERA 1OP3H 2L4OA 1GOGA 4G6FD 5T1MB 4U1MB 4G6JL 1OCWL 3N1FC 3ZYZA 4XNZC 4M1CD 3MRFA 4MQTB 2IALA 2CKBL 4OZHA 4R4FL 4U6YB 1IGCH 1IC7H 4X8JB 1KENH 1ZHBB 1N64L 4YEEA 4JPIA 5IBUG 4PGJA 3VG9C 3MOAL 4I0PC 3NPZB 3GMPA 1QLEH 2ZUQC 3GNMH 4DW2L 2Q8AL 1DDHA 32C2A 4OF0A 4Y2DD 1BX2A 1AC0A 2ED8A 1S5HB 3CZFB 4PRIE 3RZCB 4K94H 4J8RB 4BH8A 3X17A 4G9DA 5GGTA 35C8H 1S7TA 2IH1A 1NCDH 2I60L 4Q2ZA 2R29L 4H20H 2FJHA 4Y2DC 1T0NA 4X7CC 3WIHA 1HXYA 4TSAH 5C07B 2FGZA 3ARUA 1H3VA 2R4RH 3G04B 5CJ5A 1KTRL 4Z8FH 3NA4A 1P4LA 3QEQD 1RMFL 5F3HA 4FQIL 1ZT4B 3PE9A 5J06A 3ULUF 1GGIL 3LKNB 4S11A 1QLFA 3JWOL 3IFOA 4F7PA 1CDBA 2H32B 2NX5A 4C56D 1I8LC 2XRAL 4ZTPL 1S7RB 3RAJL 4PTUA 2QKIA 4GS7B 3EAKA 4LSVH 3SCMB 1ZA6A 2AEPH 2G2RB 3FO2A 5I76A 3UO1L 1ODAA 3FO0H 1RUAL 4D9RD 3QWQB 4GRWB 4R4FH 4PY7B 5C6TL 4CADB 1A9EB 5I2IB 5KZCB 2F5BL 1NFDE 4K7FA 3CLFH 3FQWA 3CU7A 1KB5L 4JHAL 5DJYB 5HYSA 1I9IH 4LNRB 3BD3A 3PWPA 4N1HB 3U0TB 4DK3A 3ARBD 4WW1B 1X5ZA 4F2MA 2I24N 2IGFH 1V5JA 5JHDE 2XTJB 3JTSA 3D39A 2Z93B 4OAWA 2FJGA 3C5SB 3ZHKA 3BKMH 3WNKA 1CE6B 4QLRA 3H7BA 3QH3B 4BQ9A 3LEYL 3NAAL 1E0OB 1HKLH 4APQA 3BKJL 5F71A 3V6BR 5GJTH 2ADIB 5GGQH 5DMKB 1H3UA 3GJEB 4Z7VB 3BGAA 2DBLL 3QQ4B 3D25B 1IEHA 3BMWA 3STZB 1ORQB 3D85A 3OKLB 2YD2A 3OXSB 4KRNA 5EZIL 4JG0L 1VGEL 1A3QA 4TULH 4E5XA 5I1JL 2A6IB 2B5IB 3SOBL 3B9EA 2KBGA 2NPLX 3JBG7 3PP3H 3QUYD 4URTB 4WIQA 1SVCP 4MNQA 5I1GL 3FQTA 2MCPH 1DL7H 3ARFD 2ILLA 2V17H 3U46A 3RU8H 3JWDC 3CFDA 3RY5A 1A6TB 4KVNL 2R23A 4XBPB 4GQPH 2DBLH 1LDPL 1BZQK 2PTUA 3BDBA 2VYRE 2HKFL 3HUJE 4LCCC 2Z92A 4HK0A 4UNTA 5BV7C 3P0VL 4A6YA 5GGUB 1TTGA 1QBAA 3RNKB 4PRPA 3MLUL 1HCVA 4AL8H 4E41E 4JM4L 5KVFL 4QOKA 3O9WC 4HUVA 1JRHL 4Y5XB 5BS0B 3KPQA 1FHGA 2EO9A 1S7XA 2R9HC 4XMPH 3S7GA 4JFZH 2BJML 1NUFA 2H45A 4LPVA 5J7CC 1CT8A 1NCTA 3IDXH 4OCMC 5FDWB 4J3UA 4J7RA 3TZVB 3I02A 4AYFA 4I1NB 1MJ7H 4M6ML 3I3BA 1ZHKA 4O02H 1B90A 4ZO8A 2GK0A 3T4AA 1N4XL 3X3GL 3ARFB 4WGWB 1M6OB 2SEBA 3O3BB 1IGFL 5I66B 5E8OB 2R69L 3OL2A 4PJ8C 3CLEH 3QUZD 3RI5F 4LMQE 2FB4L 2HN7B 5L2JA 3DOSA 2DQCL 2DS4A 5FM5M 3RL2A 4D0BB 3B2UD 3KPNA 4M6NH 1MJJA 4PJHF 2IANE 1S9WA 3P4NB 5JPMB 1RK0B 4GQ9L 4NSKA 2OQJB 3QIBD 4FA8A 4N8CH 4NHCH 3GSQA 5EUKB 5IEKA 3PDOB 2C4XA 4D0CB 1Y0LB 1TDQA 3IJYA 2ZP0T 3QXUA 4QNPF 1ORSA 35C8L 3H9HA 1UJ3B 3TYGH 4HBCL 2G75A 2RCSL 3ARTA 4OB5L 5F7UA 2EDJA 3MZGB 4EEEA 3B4NA 1EEQA 3GZKA 5K9QI 2DQEH 3L95B 1WLHA 5IKCA 5HYJE 1AQKH 3PGCA 1IM3B 4Q58C 2GTZA 3L1OL 4N0RA 4NZTL 4RWYH 1AHWB 1E6OL 2UZYB 2YEZA 3CVHH 4HSQA 5F96L 3CCHA 1NDMA 2ZCKH 3TT1L 4P2RD 2BOBA 2CK2A 2FCBA 5ECJE 1TZGL 1J05A 4XNZB 1H9VA 1ZLWK 3CMGA 3U1SH 2EKJA 5F6IB 1EBPA 5KZCD 3C8KB 3PDGA 1EJ6A 1HQ4B 5I17A 4XMKH 5HVGB 3DLQR 4WI8A 4QHNB 2F15A 3T3MF 4CDHA 5IHZB 5IROC 1A6UL 4PD4J 4MQ7A 3X13B 1P2CB 2JELH 4OB5H 2HRPH 4C56B 4XC1L 1TZHB 4UTAL 3FFDB 4YFLF 3UJJL 3F7RA 3BX7C 1KPVB 5FKAB 4EVNB 2YPLA 4DZ8A 4YHOH 3WEXA 2GSGB 4PJ5A 3QEQB 1DN0B 1HIML 1BBDH 3ZKQD 2DJUA 4QTIH 2PYED 1AGBB 3DHMA 2DQIH 5HGBB 3EUUA 1UZ8A 1FO0H 3MLSL 2BY0A 4Q0XH 3O6FD 4TQEL 4RAUB 1JHKL 1MLCA 3CX5J 4AEIL 4Y19E 3ZDYF 1RUAH 3VFWA 3A67L 3EYUL 1FPTH 4X5XA 2X4TB 4JO2H 5CLWA 5D6DC 5HYJA 5C0GB 5IB3A 3I6LD 3AS0A 3QUYB 1UXWB 4NO2B 3B9KB 1HEZB 4MAYB 1HHKA 3NTCH 2JCCF 1I85C 1UKTA 4YNYA 4UT9H 2YPVL 2C4FT 4K7PY 3SO5A 5I8KL 1LEIA 3SGDI 1CGUA 2A6DB 3LSOA 4LL9A 1A6ZB 4L9LA 2L7JA 1JPTH 1BJ1H 3D2UA 1U8JA 3CNKA 1I85A 1G7MA 2XA8H 4XBGA 4XBEH 5IB5A 1BQLH 3PXHA 2FYYB 3RVXC 2VZUA 4DZBB 1RZKH 4FNLL 4RBPK 4U1JB 1B0GA 4JFXB 1H5BB 1T83C 3PNWB 2CUMA 3BE1H 2MQ0A 4AENB 5BZDA 2YWZA 5EZOL 5A2IH 5HDLA 1M1SA 4NPYA 4RDQF 5ID0A 2VL5B 3VDBA 4GRMA 4NNYA 4OIBA 5CINL 4IMLA 3UROR 1MCLA 3KPTA 5T3ZL 4JG0H 2XTJD 3ZE1E 4M62H 2UV3A 5EUKA 5IEKB 1DUZA 3C6LC 3MCLH 2WBJC 3C8DA 5A2FA 1YPZE 3IDNA 1F3JB 4P46B 5DO2C 4QF1A 4DKAA 2CLVB 3BW9A 2XTJC 2X4NB 2VXQL 1S9XA 3KPNB 1QA9B 1LDPH 2NY5L 2Y25A 5EBLB 2ESVB 2HYMA 2HN7A 5DZOA 1KFAH 4Z5RA 1MEXH 5IB4A 4L3CA 3HE7A 2HKFH 3DI2B 1MWAB 4UUJA 5EC1B 5E6ID 4NCDA 3ARFA 4X6EA 5JW5A 4PJDB 1MHCA 4GRWE 2UUDH 3RPIA 5MEND 3RFZC 1F58H 3T2OA 5F44A 1BIIA 2ZSVB 2DKMA 5K9JH 3MBED 1QPXA 1QFPA 1ULVA 4E42A 1H8OA 1AFVL 1T04A 4MS8C 4JRXB 3P9WB 4JR9L 2X4OA 3I50L 3BKYH 4B0MM 3D0LA 4YBHA 1PG7H 3QEQE 5HHME 4HPOH 5I1LB 4GAFB 1R5WB 5ID1B 5DJAA 1C12A 5F7WC 3ZO0A 4L9LC 4XP9L 2AI0L 1AD0A 3T0VA 1VDGA 2C1OA 3QDMB 3LRSB 3OX8B 4ODSH 3T3PE 2X4UA 1EVUA 2NY7L 2IBGA 5ISZA 1WC7B 4UT6L 5M7QA 4ODBD 3Q3GB 3VXTA 5I19L 4DN3L 1OHQA 2GJ6B 2V2TB 2J3SA 1NCAL 4NHCL 4ELKA 4HKZA 4YDJA 4H26A 4XWGL 1YQVL 4JDZB 2J12B 4IOFC 3ZKSD 1QFUL 1KC5H 2HRLA 4R4ND 1ZGLM 1FFNB 5FUCE 1O7SA 1Z5LB 4OD1H 4FTVB 1ETZA 4M6OL 2DI7A 4GBXC 1AIFA 4TSCH 5EO9A 3B5TA 2YKLH 3B5HA 1GGBH 1FYHB 2F53D 1NGQH 2E7LC 1HKFA 4X7TA 1YEIL 3F5WB 4J12A 3ROOB 1VPOH 5F96H 2Q7NA 3MV8B 3B5GA 2NXZD 1NCAH 1YPZA 3CXDL 4LLWB 4Z77B 3N1QC 3U2SB 3WE6B 2VXVH 4Y5VA 5E5RB 3GRWH 2QHRL 4UQ2A 4HPOL 2UVEA 3BSZH 2Y36L 4AIOA 3MUJA 5K9QG 4Y16B 1SM3H 5ALBL 4MDJA 3LRHA 4R3SA 2JK5B 4YAQA 5ALCH 1BD2D 1AQDB 1SJHB 2FRGP 5FO7B 5IJKC 3GGWB 2CDEB 1IC7L 4PY7A 3O81A 2EYSB 2H1PH 2NY4D 4GW4B 3TN0D 5GS0L 1X6LA 4YO0A 3QFJD 5HVFB 4WEUD 3C08H 2A9NH 3DO3A 4NO0B 4A2LA 2OTUB 4Y7MA 5T33L 2DOCA 4JN2B 2A83B 3H7LA 3BOVA 4KKBC 1X5YA 3QIWA 3AVEA 3IDGA 5GRVK 2DJSA 5IFHL 3OPZH 2DIJA 4HWBL 4P3DA 3MGTA 5GGQL 3MRQA 3UPRB 3P4MB 2AXFA 2AJSL 1NCCH 4GG6E 1YY8A 1AGEB 5AAWA 1YMMD 4LDLB 5GZOD 5FO8B 4NZRH 2J5LB 2EDRA 4NFCA 1X6NA 4CN4A 2IC2A 4OFYA 2YPVH 2DJ4A 3N1MC 5E8DH 3ZTJG 4JREB 4YEFA 3IGAA 4JVUA 2HWZL 1EZVX 1CFSB 1SM3L 1WFOA 1G0DA 3MV8A 3L7EA 5KAQG 1QSVA 5E2WH 4P23B 5DT1L 3A67H 1BZ9B 1UWGL 3PABB 3IFLH 5DK2A 3TNMA 5C0CD 4IMKC 3VGAC 5KG9B 3IXTB 3T2PA 1KCRH 5D7LE 3V9FA 1UT9A 4LVHC 4ODXB 3E6FA 2WUCL 4Z7WF 5DEFA 1DEEA 3FN0H 4PJHA 4WFED 4IRJC 2Z35A 3O9WA 3KPPA 5T1KA 3IS0X 3REVB 4TUOB 1RJZB 3QNYA 1EERB 3R06A 5EZLA 4WJ5B 3QG6A 3HFML 3OTTA 5J12B 2PN5A 5EU5B 4ORGA 2X05A 3GSOA 5DJDB 4Q9RH 4Z7QF 3ZMRA 3VGBA 1EO5A 3HMXL 3QP3A 1NUNB 2Z35B 2ZUXA 3DSNA 1NEZG 5DJCB 3T0BA 4DK6A 4Y4KC 4M93B 4J3OC 4WWKB 5I1CL 1ACYL 5JORA 3UTTB 2YUZA 3LB6C 5INCB 1T21A 4G8EB 1BAFL 1YN7B 4WI9A 4WI6A 3O4LB 4HD9A 3EJYD 1JPST 1FV1A 3G5XB 1P84K 4F37K 1M71B 1MF2H 3V6OA 3BHBA 3SBWA 2AP2A 3L9RA 5I6XC 1WCQA 4LSTH 2I9TA 2BERA 5FXCH 4LCIH 3QZWG 5H2BB 3CDCA 3L3DA 1CR9H 1BPVA 1AI1L 1GC1C 3QZWB 4DN4L 4JJ5B 5TF0A 5FO8A 3EFDH 4JY5L 5HVHC 2YK1L 5DUBA 2P5WE 4IOFD 4UZGA 5L88H 3DX8A 4JR9H 3PV6B 4XZUB 3TT3H 3K8KA 1L9NA 3GEWB 5AWNL 3PHQA 3QNXB 4APQC 1YN6B 4QRQB 4KDTC 2AJYL 1JPFA 2X4SB 4GAJL 2A73A 4L3CB 2ARWA 1J1PL 1BBJB 1RZFH 4Z5RB 4TRPL 1RHFA 3IJHA 5E1AB 4EN3C 3OAUH 4CMHB 2ESVA 4D0DB 4OIIL 2K7QA 1C1EL 1T6WA 1ONQB 4GW4A 1DCLA 2C3VA 1YNTB 3GMQA 2CO6B 5FO7A 5CSGA 2QQLH 1WZ1L 1OAXH 3DV6A 4DN3H 2XTLA 3KHOA 1MCOL 5ESAA 1NLDL 4YIQB 4N0CD 4OFVA 4O02L 3UTSD 3T0EC 5JHLL 1OSPL 1A4KA 5FA4A 1S9VA 4G8GA 2R29H 1IGFH 1FZKA 2VQ1A 4NHUA 4Z7WB 1J1PH 1B0WA 2B0SL 1P4IH 3HMWL 1T5XA 5I9QC 1KB5A 3IU4H 3O4LD 3PWLB 3KR3H 3FQRA 3K2UL 1FO0A 4YHLL 4AZ8A 2WQRA 1DQLH 3TLRA 3C5ZA 5C0BA 3RUGB 4NUJB 4U1JA 4FQIH 4NRXB 3WKNA 2JB6A 3VWJC 1JGDA 3MXVH 4PYHA 4S2SB 4XXDB 1EJOL 1UVQA 2DLTA 3D2UB 1R3JA 4G80A 3RBSA 4U1NB 5D7IE 2FL5B 3DRQA 4OTXL 5FYKE 4K07A 5I71B 4G6JH 2ID5A 3EBAA 5ALBH 3MNVA 4I0PB 4M61B 5IG7A 2FB4H 2X1PA 1QRND 1ZKAA 4MHHI 4U1HB 1NMAH 1SBBA 4YHKH 3TBWA 1SQ2N 5IP4A 3GB7A 4YHLH 2IPKB 1G7JA 2ADJA 4BSWB 3OKNB 1T7WA 3LQAL 2DRUA 2ORBL 3CIQA 2VISA 5D7JA 1LO2H 1N5AA 1VFBB 2W07A 1JZ8A 4RQQB 2FWOA 1J18A 4NM8H 4MNHB 4OFPA 5HPMA 4OLVH 4OCXH 1W72A 5LBSH 2W60B 5DGQA 1SYSA 2AK4A 2GJJA 1LNUB 4TVSa 3J7HA 2L7UA 2JIXD 4FFYL 4L29A 4EQ2A 2VDLL 5JW4Q 5KSAC 3ZHDA 2ZOKA 3BZEA 2NR6C 1DBJH 3CGTA 1ZT1B 3FOMB 1MAKA 5ALCL 3CFEA 5KVDL 2VDNH 3V8CA 2KPNA 1Q72H 4MXWH 4N90D 1DQLL 3THMH 4V1DD 3BESR 5KSBE 3GSVB 2AV7A 1D9KA 2XWJA 5CAYB 4KGJA 1NGYA 5F97E 2X09A 4MCYB 1NL0H 1TPXC 5BVJB 1JK8A 1ES0A 5T3ZH 3FTGA 1QBLH 4NKMA 4U1NA 4ZTPH 1FIGH 3V0AC 2DKSA 3W9EA 5GRJH 4P2RE 4M5ZL 1G9NC 2X10A 5IIEB 3O41A 4G7YL 3RA7H 2VDPL 4LLMB 4MJ5B 1OVZA 3ULVE 4RGMC 2B1HL 4GKZB 5IFHH 4XNXH 4N0YL 5T3XE 3UTPD 5C6TH 4KPHL 3BZFA 3QFJB 1WFTA 1CU4H 3O8XC 1YEHL 3PGDB 4U6XA 3BPCB 5EBLA 3ZYJA 2BVQB 2E3VA 1MJUL 4Y5YB 5JHDD 1KTLA 4M4RA 5IUSA 3QUZC 2BZDA 3CFIC 5F9JB 1S9YB 2F54A 2YR3A 3CFJB 1I1YB 4J3WA 5GSVA 5GZNC 3BKML 4DGVH 4AIZA 3CDGB 5GGSY 5GJSL 4ODTH 3TPKA 5F9AC 4HUUB 3NAAH 3WXWH 3HAEG 3WN5C 5EC2A 3EYUH 2JLLA 4K3DL 4HKXB 4IOIA 2APTA 1JZ4A 3CVHB 1QFHA 3MUHL 3PXJA 5F7LB 1EAPB 3OB8A 3V5HB 3GSNB 4FQCH 4H0IA 7CGTA 2MSPA 3D87B 3HZVA 3VGEA 5I66A 2F8VA 5I1JH 1XCQA 2GFBA 3AS2A 4NZJA 5I8CA 4JZNB 3BJ91 1SY6L 1F8TH 3W9EB 1F13A 5EIIA 2Q3AA 3I2CH 3PV6A 4R90L 5FGSA 4OFKA 4EI5D 2PCPA 2C26A 1NGYB 1P5UA 4BFIB 4CNIA 4DN4H 1ZV5A 2HJLB 3ZLQC 5CMAB 5EZOH 2G5RA 3WLBB 1E28A 2VZOA 4MHHG 4JQIH 2JCCE 4Z7WE 5GRYA 1T20A 4HFWB 1R6VA 5D1ZB 3S35X 1HXMB 1OSPH 1BVLA 4XWOC 3NCFB 1Z6JT 1EO8H 5EIVA 1MH5B 4ODWB 2ATKA 5IMMA 4XPGL 3QDME 3GI8H 3QEQA 2MHAA 1FJ1B 3FCTA 4PRHD 5SX5H 3EYOB 1UXSB 3QUXC 43CAB 5J9PA 1I7UA 3VWKA 3K80A 4GO6B 4MSWA 3TA3D 2D0GA 2NY5H 3BIBX 1XGRA 5LGKA 3B8SA 4KKAC 4PJ8B 4XNUL 4PJGA 5TDNB 3TBWB 5JTWA 4Y5XC 4JAMA 4KMTL 3QUXD 1ZHNA 2ATPA 1IM9A 5GISL 1LO5A 2VLLA 4EN3B 3R06B 3RVTC 2A6IA 1T0MB 1K4DB 1R5VB 2OLDA 5FYJH 2Z0BA 3EZ8A 3V5KB 3FT4B 2XACC 1I1AD 4K3EL 3ULSA 1U95A 1ORQA 4PD4K 5E95B 2ZUYA 2E9JA 2APXA 2WBKA 2X1QA 4FQJL 1E27B 4PJ9B 1C5DA 1I7RA 4FQLH 5F1NA 3BXNB 3FQNB 4PJDE 3ARDB 5I71C 1AHWA 1MAML 1HNGA 2YEZB 3EFFA 1EHXA 3CFKA 2DI9A 1XGPA 1J9CT 3S37H 3IFPB 1FO0B 1EHLH 2R15A 4XX1G 1KXQE 4DKFH 3PIQB 2OTWB 2ZKHL 4KQ4L 4Z7WA 3MRNA 5E1HB 1LO4H 1OP5H 5EBWA 3VFUA 5C0RH 4P46D 3QI9A 2XYCA 3V6OE 1A7PL 4J3SA 1JCKA 5JQ6H 1JWMB 1Y0LA 2X4PA 4HWBH 1FE8L 5DJ6A 3O6FA 2N7BA 2R0WH 3NFNA 2F53A 1DBJL 3HMWH 2OQJA 4U49A 2BX5A 3THML 1J8HB 4FXGA 3LQAH 2AXFB 4NNXA 5HHXH 4HG4K 2HLAB 2QJDA 3RNQB 1VGKA 5KVMC 5I18L 1BFVH 3IDGB 5CBAB 4L8CB 3MA9L 5DFVD 3K46A 5D96B 1LWRA 4FQ1H 5IM7B 5GS1C 2R0ZH 1S7RA 4KQ3L 5JXEC 4NQTA 4JLRB 1MFCH 3NCYP 3RWEA 1DVFB 3RNQA 4J1UB 3S4SG 3LN5B 4WY7H 1WFNA 4S1SL 2XV6B 2XN9D 4XZUA 5E99L 5CJXC 1IGIH 3BEVB 4HQQL 2BSRA 3OZ9H 1UG9A 5F9OL 2ZUTA 1S7SB 1JWMA 1QFOA 5EU3B 4ZFZA 4S1QL 1UC6A 1DN2A 4L8DB 5KVEH 1QHPA 3JUYA 2JJSA 4DGVL 1FNFA 1YPZB 3TN0C 1NC2D 1UWXH 1GOHA 3ARGD 1D6VL 4R97C 5MHSD 4P5TA 4DKEL 3O4LA 1P1ZB 4F7EB 2HAZA 4PTTA 2HG5B 3MR9B 3VMPA 1MWAH 2Z91B 4PGCA 4Q6IA 2EIDA 4J1UA 4WWKA 1R0AL 1NCWH 1ZK9A 3W9DB 4Y1AE 1T03H 4P4KC 3VFGH 1Z5LA 4UB0L 1JYXA 2AQ3A 3HC4H 3O45B 3RAJH 3C6LD 4BUGA 5GS2H 3VH8A 1O5DT 1KB9K 3O8XB 4XVSL 2MMXA 4QRRA 2Q86B 1F8TL 5C0AB 1JZ7A 4NT6B 3SDDA 4YHZL 4UILL 2AEQL 3D18A 4GW1A 1U3HB 5DQJA 1OP5K 2ITDA 3CMOL 4BSVA 4WY7L 4YGVB 3U0WL 3VWKB 3L5JA 4JFDE 5GS0D 2NY5C 5B39G 2WNGA 4I3SL 3MO1B 3KYOB 3WHXA 3LKSB 1NCWL 1M7DB 2F54E 4L8SC 2FBJL 4L8BA 3T08A 5CD3B 2MCG1 2Y7QB 1AR2A 1MRFL 1JIBA 5D93B 2OTWA 1V05A 3UXFA 3HI6L 2OS7A 1FFQA 3HFMH 4K9EC 2OR8A 4JM2F 4UAOB 2NY6D 3QIBB 4P4RA 5EOTB 5BS0E 1S7SA 3MBEC 4F37F 4JFYB 3KAAA 3BXNA 1L4IA 2WBJB 4IS6A 1KPUA 4FZEL 5I1CH 1YY8B 3EJZD 4K7FB 2FNBA 5IQ7L 5CKGA 3P4MA 3IAPA 1FZOB 5C08E 2PO6A 4HC1A 3FT3B 2Y9RT 4XPFL 5SV4A 5BJTA 5J89A 4RCAA 2DMKA 2ENYA 4JE4B 5ACZB 2R2BA 5FYJL 3MGOA 5DVMA 2H3NB 4PYGA 2ZJSL 2W59A 2Y06L 3MLRL 1TCRA 3HMXH 5D6CB 5C0AA 4K23L 4NO0A 5KS9E 4DKDC 2AXGA 4HX1B 3FFCE 5DVOA 3AXLA 1ACYH 3O0RH 3I9GH 1NC2A 4CW1B 3OJVC 4FQXC 1FJ1A 3FCTB 1R5IB 4FP8H 2E6PA 1ND0A 2EDHA 4YPGA 1A9BB 1A3RL 2HLFC 4QYOA 4RGNE 3WDIA 4YHNA 2AK4E 1TVHB 1UENA 1AH1A 3ME0A 1CDIA 5GISH 2F54D 1P7QD 2PKDA 5F7YC 4FQHA 4Y0GA 2UYLB 5BO1L 1M7IA 4HIXL 1IEAB 3VRIB 3CK0L 5KVFH 2BY1A 4WW2B 4HH8A 3QJFB 1DDHB 3QRFM 3BPCA 4APQD 3V79C 1CZ8L 3IS1X 1I8KA 5H35A 2HMID 3TO4A 5DMGD 3C2AL 1AR1C 4BK5A 1P7KA 2X5PA 5F1NB 2NXYD 1C5DB 1I7RB 4DKFL 4WDIA 5EU7C 4OCXL 1RQ5A 5D9SA 1ZANL 5L2KD 1ZMYA 2IF7A 3AUVA 5FYKH 3QDGD 2ZKHH 3REWB 1KJVA 4XVUC 3TIDA 5F72S 1RD6A 1FFNA 2WQ8A 5CZVH 2O5XL 5JIPA 4P49A 4G6KH 3SHSA 5D96C 5C0GA 2LE9A 4PLJD 2NZ9D 1C1EH 3RZCC 4YX2H 4QWWD 5IT2H 3FONB 3MJ7B 4GW5A 4S1DD 1BP3B 2X4UB 1A8JH 1FNEA 2HTLC 3BZEB 3VXUE 4OGAD 1F6LL 4YXLL 3ZSTA 4OBSA 4PG2A 1V7ML 2CD0A 4PJ9C 4OF6A 1SEQL 4S1DC 2YRPA 4XMKL 3DURA 1C5BL 1ZEAH 4HXAL 5C0IA 4P3CL 5D5MB 5HPMB 3OXRA 3TN0A 4P57B 4EDXB 2CRIA 1HI6B 4S1SH 3M45A 1BF2A 4R4BB 3W0WE 3JV5A 3UP1A 4WFHE 5E08L 3NFSH 3MUZ1 4TUJB 5DUPL 4GKZA 1R0AH 4LPUA 1XMWA 2HT4D 1AO7B 4YQXL 5IJKA 1JK8B 4JPKH 4LOUD 4OCNC 1QQDA 2OI9C 3CSBA 4YHZH 5JNYB 4TUJA 4K71C 4OJFL 4TVPL 3ZE1F 1U93A 3MBEA 3L3JB 3RUGA 4NQSB 1LK2A 4KRPB 3G6JF 3AREA 3V5HA 1JGUH 3L5HA 2D7MA 2EC9U 4J6RL 4NKDB 4NJAL 3WHE0 2G75B 3O4LE 4Z7UE 3QFDA 2BP3A 2IPUK 4OLYH 5AZ2L 2F58H 5D5MA 2EDXA 5CBEA 1MIEH 1HHGA 4ONGH 1GVIA 1XGRB 1D5BB 4EUPH 2E7LA 3IDNB 4P46A 1INEH 1BJ8A 5FO9A 3G6AA 2HWZH 3MOBH 2VDLH 2GI7A 3RZCD 3D9AL 4WO4A 1Q9WB 2W9LA 4NNYB 3P4NA 4OGYH 4PRAB 1ROWA 5ISZD 1G7JB 3A6BH 3A6CH 5KVDH 4DKEH 2DI8A 1HQRA 5LG1A 3VXME 5C86A 3W0WD 2E7HA 3HB3D 1HNFA 1QSFE 2GAZA 3BP5B 3V8OA 4JZJB 5C71A 3WLBA 4IM8A 3R1GL 1MF2L 4R97B 1ZLVK 1N6QH 2FJFA 43C9A 1QBLL 1PKOA 3VGAB 1I3VA 3O3BA 1JE6A 1ED3A 1Q9KB 1PKQE 4KK9C 4EDWH 2IFGA 2FZ3B 3RA7L 1JPGB 4GXUN 3DETC 3MCLL 5ITFB 3V4PL 2C7UB 2NMSA 2VKWA 3F62A 3QQ3A 5E5MA 5GGRY 4FNLH 1JNHA 4PR5B 1T7VA 4JZNA 7FABL 5GZOC 5H37G 2IQ9L 3BH8B 5C08A 1J0KA 4UOW0 2E27L 2VLMD 1NDGA 3GSNA 1BFOA 3GJFB 2QBWA 4XAWH 1N59B 3W11C 3VFTA 1Q9WA 3SKNB 3NABL 1K3ZA 3OAZK 5I75B 2H41A 4GKSA 5EH1A 4P48A 4OUUA 4UOW1 2D7TL 5CBEB 1ZS8B 2CQVA 4MQXC 1OF2B 1KEGH 2YPLB 3U46B 1KXVC 5AD0A 1NMCC 5DEGB 1A5FL 1UGNA 2IPKA 5DJCA 4OV6F 4X7EC 4XMLH 3KLAA 4K3GA 2EIZB 1A22B 4Y5YA 1G7QB 2VN4A 5KW9H 2R2BB 1XCTB 5C0RL 1I9RH 1LE9B 4LSPL 3I6KA 4U0QB 1YN6A 1OAUL 4HBQA 4HJJL 4OD2B 5FUOH 1Q9OB 3QIUD 4OTXH 2DBJA 3RIFF 4CVXA 1SYVB 4PJ8D 4LDEB 3V4PH 3MLRH 3VXSD 3HUJF 3QUMA 5JPNA 3FOLB 5DK3A 3KR3L 3QXDA 4Y4KD 2YC1A 3OKMB 3UAJC 1CDCA 3HZYB 2YXMA 1W0VA 2NW3B 3VXNB 1SY6A 4FQQA 3MLWL 1FLTX 1HH9A 5C0BB 4KUCD 2YPKA 4UT6H 5H2BA 3FQRB 3HNSL 4TNVK 4XMLL 1T5XB 2EDYA 3UAJD 4AT6B 5E2VL 3SGKA 5D1ZD 4H25A 1T6VN 4QHUB 3QCUH 4F8QA 3O4OC 1UJ3A 4DOHE 1KNOB 4HIIA 1EO8L 1AHWC 4LRNL 4D0CA 1ZT1A 5DEGA 3BIAX 5HYSB 4OCWL 2HT2D 3QO1B 5EO1A 4FXKB 4U6HA 2F5AL 4EOWL 2BRRL 1JF1A 2JCCA 5INCA 5F6IC 3IDYC 4ZFOB 3DURB 4Z9KB 3S97C 2GQHA 4U1SB 2NY7H 3UZEA 5I1DB 4MB5A 3GKZA 1S9WB 1UJ3C 5T3XL 1PG7W 5GGSB 5F9OH 1EEZA 5DUPH 4LKCA 5FGBA 3FO2B 3WFDL 5DA0B 1OGAD 4GW5B 1CDGA 2ADJB 4LSPH 5C0DA 5DD0L 4WUUE 3X14B 4R26L 4QRUA 4RNRB 3FMGL 1QBMH 3GM8A 5E8NB 1KBGL 3DVIA 1YC8A 2EYSA 4PGCB 2Z8WC 3EDDA 1NANI 3UTZB 3QQ3B 5E5MB 4JRYE 4JM2A 5CEXB 4LSDA 3ZKXC 1CT8B 4FTVE 4XB7A 3EYQD 2X89A 3QXTA 2OI9B 2IANA 3LEXB 4KH2A 2DM7A 1VFAA 1FNAA 4LLDB 3GNML 4DW2H 1MJUH 2I5YL 3WO4C 5HHXL 4NQXB 3KPQB 5CJ8A 5GRUH 4KQ4H 3RTQD 4BH8B 1IAOB 1S5HA 3CZFA 3DV4A 2AQ1A 3QRGL 1UH4A 3D69B 1S5IH 4L5FL 2BVPA 4OCWH 2OP4L 3UTPE 1CLCA 1P6FA 3NH7H 4LAQL 2YD7A 4GLRI 4M7KL 3WLWC 1A9BA 4Q74A 2Q76B 3CFCL 5D5ME 4KTDL 3UPRA 4XWOD 3C6SB 5SWZB 1DVFA 4PG9A 4CN6A 5JOPD 3BP4A 3KG5A 1XGQA 4WV1A 4WU7A 4K71B 3CXHK 2P5EA 5E2UH 1OW0C 1T3FA 1FIGL 4P2RA 3QJHB 3QFDB 4S1QH 3MGOB 5GJSH 4LPCA 3TA3C 2EH8L 4JDTH 4DVRH 1Z9SA 3FO9B 1VGKB 3OWEA 4WENB 3AM8A 2QSCL 4CDGC 3OXSA 3WN5A 5IEHB 4KK5C 1JF5A 5DT1H 4U1SA 2XPGB 3TCXA 4ZO7A 2HH0L 4YAQB 3RVTD 3KS0H 3NIGF 3M07A 1KPUB 4JN1L 1JGLL 3MLPA 2J7LA 2I27N 4PB0H 3S5LG 1F97A 4OLZH 1X4XA 3FN0L 3SKOA 3TFKD 4YDVB 1YNKH 4P9HH 3O11A 1SMAA 3PWVA 4H25B 3QZWA 4MA7H 3NCMA 1BF8A 2G9HB 4G9FD 2E9BA 5IGXL 4UNVA 4L8BB 5CD3A 4I18B 1CL7I 1QKZH 5IF0B 2FSEA 1XGYH 5L2KE 1CQKA 3KPRB 5EG6C 3P73B 5F8QC 2BSRB 2NW3A 2D03L 3OHXA 4ZFGH 3PWVB 4QTHA 5I1HL 4P46C 7FABH 3RVUC 1SJEB 2DLGA 5IVXB 4XAWL 5I2IA 1MCHA 4TPRH 3BGFB 4P5MB 3FT4A 3MRQB 3P0GB 1YN7A 5TDOA 1T0MA 1U2CA 3DROB 3QWRA 3MRBB 1MRFH 5IHUH 4XP6H 5C0FA 4LMQI 2IAMB 4LLQA 4JN2A 1KLGB 4Z7NF 3S4SB 2Q86A 4C58B 5HI3D 4B5EA 1I7UB 2R8SH 4Z7UB 1QSEA 1WIOA 1I3UA 2HH0H 3MR9A 2MHAB 1JGLH 5DUMH 2ADFL 2R39A 1RHHA 2QADB 4W6XB 3MNWB 3E6FB 2FX8L 3V0VA 3NFNB 2FJHB 5HHPA 3PQYE 3UMTA 5IW6A 1FBIH 1PEZA 2X4PB 3QBTB 4ODUA 5D7JC 4DOHB 1KELH 4M6OH 4TSCL 1AD9A 1XIWB 4OLXH 5B4MD 2VL5A 1N59A 2GK2A 3T3ME 1NDGB 5IMLB 5F6HI 3D69A 3PWUB 5JUEH 4WEBH 4R2GD 1D5MB 2DLFH 3UJIL 4NUGL 1A6AB 1IEAA 2OR7A 3VRIA 2D7PA 3GSWA 5SWSD 1RY7B 4NDMB 5JIHA 2P48B 1UZ6E 2V9RA 4JM2B 4PJ9A 5CEXA 4NQXA 3TT3L 1Q94A 2Q3ZA 4KU1A 4NFBA 5D8JH 3HNSH 1DJSA 1NLDH 1ETZB 5M94B 3KLHC 1R5IA 3WSQH 1AGDB 1FNGA 3MGTB 4Z7UA 5F7FA 2BRRH 2XT1B 5KN5A 3N85L 4LRNH 5E6IA 5J8OA 1YYLL 4H0GA 3SDAB 1D5IL 1IAIM 4WEMB 2BOCB 2NTFA 3MV9A 3V6FB 4NM4H 3T1WA 1ZA3A 2AABH 1U8NB 1C7TA 1GCFA 4XC3H 4YXKL 4WTWA 4HUMB 5HDOA 2GUOB 2NY0D 4ETQB 3KNBB 3U4BH 1P5VA 4MB4A 3KWWB 3UDWA 2H32H 3FN9A 2W0LA 3AMLA 3D0LB 4JFYA 4F7CB 5AG8A 4AT6A 1NC4D 3PGDA 4U6XB 3BH9B 4I18A 3MMEB 2PR4H 2LABA 4X99A 3VXOA 1LK2B 4OZFB 4HZLA 1Q1JL 4OKVB 1KJ2H 2NW2A 1JWSA 4KDTA 5E7BA 4R96A 5GRUL 5KOVC 5JR1H 2VTFA 1UB6B 4I4WA 1VEPA 1ZANH 4LRIC 1M7DA 1OT2A 1XGPB 3LKSA 5T1DL 5L8KB 4NN6C 4Z95H 3GKWH 1ZLUK 1DQQA 1HQ4A 3SDDD 3T0AA 2RHEA 3CUPB 5I17B 5H94A 3AY4A 5BVJA 1MFCL 1I1RA 1W8NA 4Y2DA 2DQHL 3S8WA 1GL4B 2AKRB 5F70A 1ZHNB 2VITB 2AK1L 4FQXD 4F9LA 4WFGD 5BMFL 3UTSE 3MRCB 1CD0A 2WUCH 3VD9A 3MLYL 4W4OA 5I1KH 4P57A 4PRDB 3HI5H 4EDXA 3B9AA 4L4TB 3IYLW 1A7NH 1VACA 2VLKE 3QUKA 3ZHLA 1CXFA 4JB9L 1M7XA 1E4JA 2ATKB 5IMMB 3NZHH 2J8UF 3P0YL 4OD3H 3KNBA 43CAA 3EYOA 4NC0B 3WNMA 3MLSH 2J5LC 4JPVH 2FWOB 2B4CL 4OUUB 1RIVL 3RJDA 1U8NA 1NLBH 2A74A 1TFHA 2WANA 1EDQA 1D6EA 4PJ5D 3SQOL 5BZDB 3V6FA 4HULB 2AK1H 3MRGA 1JGUL 5EU4B 4X4YA 4HFWA 1T20B 5FHBH 2XZAH 1T4KA 4M1GH 4ZODA 3BUTA 3ABZA 3BKCH 5I8KH 4HPYH 3ORJA 3U9UB 2OCFD 3REWA 3UYPA 4JB9H 1P4BH 1PKQB 4LLMA 5JXED 3FL7A 4ZNEA 4LVHB 1BIIB 1AE6H 1H3PL 1ZHKB 3VD5A 4PLJC 4EZMA 3V0WH 4IMKA 4WUKH 2JB6B 5GRXG 2NY4B 1GZPB 2M2DA 1L6ZA 1JPGA 4WHYG 3WFBH 2E7MA 4FZEH 3U7WH 1MFEL 3I9GL 4L4TE 4ZUTA 3ZZ1A 1K3IA 4N68A 5E8EB 1OAYH 3PWUA 5EWIL 5T5FL 2X4TA 5C0DB 3JVGA 4LIQH 3AB0B 2DMCA 4ZXBB 1NBZA 3QCTL 2YBRA 4LKCB 2UY6A 5LWYH 5B22A 3PWPE 4G9FE 3N1GC 1ZGLA 4NYLB 1V7NL 1FQ9C 1A6TA 4HS3B 2VSDA 5GQBA 2F53B 4QRSA 1FGNL 5DUML 1D5BA 1F6AB 2WUBL 1DQTA 4HGMA 3F7YA 3FT2B 4MB3A 5IQ7H 3QIBC 3BZ4A 1U8OA 4GLRH 1QD0A 5EA0L 2CMRH 4QHKI 3GHBH 4KROD 2SEBB 2EIEA 5IVZB 2QR0A 3IAGC 4XP6L 2PO6D 1UYWL 4R0LB 1YC7A 3ARDA 3Q48A 1II4E 1MI5A 2FGWH 2GJ6D 5FYJE 5T1LD 3RY4A 4GRLB 4FS0A 5I15L 3ARFC 5IIEA 4QXWA 3C2AH 2BOBB 3GIZL 1PKQA 4KTEH 5D72L 5DRZB 3S3PA 1MSPA 5IVZA 2XICA 3RIFK 4RFNC 5HI4C 4ZUVB 4MA1B 4N0UB 3O6KL 1A7OH 3MV11 1T2QL 5K9KB 1B9ZA 1EEUA 3EYQC 1JN6A 5E9DE 2O5XH 1RFDL 5TE4L 4X9FA 1NCBL 5KS9F 4KKNA 4ETQA 4MNHA 4ZD3H 3T0EB 4ODSL 4YX2L 1FFRA 5K59F 2C3VB 3MJ7A 1TQCB 3MLWH 3SJVB 3WDJA 4BA8A 2MWCA 3SKNA 4RFOL 1PY4A 5I9QB 4D9RE 3BFOA 3G6DH 4X6BA 5ESVB 5CP3A 1UWEH 5E6IB 4YDIL 4QRRD 5KN5B 3GJFK 5FYKL 1OAUH 3QSKB 3O45A 4C56A 2BOCA 5I74B 5JIIA 2BNRD 4ZUTB 5F1OB 4OCYL 3S3SA 3T4AB 3STZA 1JNHB 3ARWA 1Q72L 4MXWL 1U0QA 1GC1L 3TBVB 3IKCB 1LD9B 4TNWK 1CCZA 1QFWH 4NUJA 1YEGH 5MP6H 1LEGA 2BVOB 5I8CB 5H35B 4JJ5A 4MLIA 5B3JF 5BS0A 3ULUC 1JWSB 4Z95L 3VXQA 1UCBH 2NY3C 2P49B 5FA3B 3S6CA 4XTRC 3C5ZB 5D2LB 2DL9A 4AG4L 1BX2B 5C0EA 1OWRM 2VAAA 3BH9A 1YQ2A 3SGKC 4CJ1A 1HQRB 2EEDA 1EVTC 5EC2B 3X12B 1AGEA 1ZHBA 2B8OT 2DL2A 4UV4H 4PJAB 2N56A 6FABL 2H1PL 3JV6B 4L4VD 5LCVL 5BRZE 5I18H 3WFEH 4M1GL 1NBVH 2WLYA 4FZ8L 3JV0A 5T1DH 3UZQA 3HE7C 4OD3L 4YDIH 4M1DL 4D9LL 1Y6MR 1ONQA 3LH2H 2BXYA 5MERB 4HX1A 1KIUA 2NTFB 3QT2A 2AXGB 4NKDA 5DO2D 4Z78A 4ZNEE 3VXRD 5D7KD 4F8TA 3ARPA 1CDUA 4MAYD 5LXGL 1EEZB 1XGYL 2AAVA 4Y5YC 5J1AA 1KN2L 1SHMA 2H3NA 2BY3A 3QNXA 4WHYH 1EGJA 2WBWB 4NO3A 1B0RA 2EXWC 5AYUH 3NH7L 2XZCH 1OTUC 2W9DL 2XZAL 4I8DA 2P7TB 5DUBB 2JK5A 4BH7B 5C07E 3QO1A 3O6FB 5E8PA 3GUTA 4XX1E 2F58L 4PP2A 4HIIB 1P4BL 2PXYD 3ULVF 1L7TH 2OMBA 1X5LA 3Q0HA 4EDWL 5E2UL 3OHXB 3MUGA 2FJGB 3WKMH 3QIBA 2ZSWA 4LHJB 4XT1C 5H37H 1A6WL 3S36X 2CRZA 1DQMH 5ADPL 4U0RC 3V4UH 3ULUL 3PQYD 1BFSA 1I7TA 2YA0A 4LSSH 3HZYA 1G7LB 1IAKB 4Z0BH 1ZLWH 1F5WA 2A1WL 4JQIL 1IM9D 1CGSH 1FGVH 4JFFD 2JJUA 1IL1A 4NO3B 1QSFD 3WN5B 3QUZA 4FTVA 4CVXB 2EDNA 3LN9A 4ZNCD 3DWTA 1UEYA 1X7QB 1N5AB 1SVZA 3RL1B 3VMOA 5HXMA 2WWKO 3OKNA 5FUOL 1IGYB 2J8UE 3QG6B 1A14H 1FO0L 2ITDB 4MNQB 1NEUA 3C60C 1JP5A 4P2RB 5D2NE 4PJ8A 4KKLC 3U79A 3NCJL 1OL0A 2DLFL 4WU7B 4Z7VE 4RGND 1YPZF 1ZOXA 5SWZA 5DF0A 1FNGB 5KTEH 3RL1A 3DRQB 4YXHL 4PTTB 5KG9A 2BFVH 1PW3A 3VD3A 1IGML 4HEPG 3GHEH 3DX9A 3CX2A 4N8VB 1WISA 3HG1E 4XXDA 3UBXI 1HXMA 3GHBL 2H8PB 2Q8AH 3TH3T 1ZT7A 5D2LA 1KN4L 1VEOA 4Y5VB 3PG2A 4Z7OE 1NUDA 1QFWM 5DC9B 8CGTA 2IFFH 5B39A 3BQUD 3O11B 3LDBB 2BXZA 3U0PB 3U0TA 1MRCL 1I1FA 1HOCA 3V0VB 2OZ4L 4MS8D 5IJVB 4IRZH 4TYUA 4ONFH 5D5MF 1KIQB 3BWUC 1RIHL 3ARDC 1H8NA 5C3TA 4D3CH 2R0WL 2J8UA 2O5ZL 4TRPH 2EE6A 2RAMA 5ILTH 3RVVD 2FEDD 3RP1A 4K23H 3P40A 3O3UN 4BJLA 4Z7OF 5E1AA 1RAMA 1V8HA 4LLQB 4P2QB 1TMCB 5DR5L 4FP8L 1EHAA 1JZ6A 1KIQA 1NCNA 3LZFL 2R0KH 2OR9L 3BP4B 1OTSD 3QYCA 1KCKA 3WUZA 4PRPE 3V7AG 5DQDL 4RRPG 2GTWB 1C12B 4IMLB 3U0PA 1SJHA 1CD9B 1OTSC 4RFNB 3LEVH 4MDJB 2OM5A 4F57H 1UB5B 3KPRA 1CN4A 5JW4N 2OK0L 3RVUD 4KI5E 1T5WA 1RJYA 5E99H 4CU7A 1PAMA 3EO1B 2P5ED 4PJ7B 2FYYA 1NAMH 3CVIL 3IJSB 5ETUB 3WFEL 4YHPA 3BDYL 4EXKA 1AFVH 4HMCA 1FAKT 3NZHL 4N8VA 5BV7H 5SWSE 1NANH 1ZSDB 2IQAA 5DZNA 3ZTNL 4ONFL 2VE6B 3LSOB 1NGZB 4JPVL 4L4TD 3M17B 3DXAA 2FHFA 2ZUUA 4OD2A 2H2SC 2ZG3A 3T8XA 5JMRA 4K8RC 4OCLC 3MRFB 2CKNA 4IJ3B 1HHKB 5JZ7C 4BQ8A 4JRYD 1WGOA 4UV4L 5DHYA 4ZAKA 1QSZA 1TJGL 1YUHA 5CZXC 5ESVA 1XCTA 5F3BB 4JAMB 1KJ2L 1FZMB 4K8RH 3REVA 3T0DA 3OX8A 1XF5A 1T3FB 3M8OH 2NY2D 4LCCA 1KV3A 1UZ8B 2IAND 4ODWA 3GMNA 3MZTA 4GRWF 4PG9B 2W60A 2Q8BL 3OR6A 3RBGA 3VU2A 3ZTNH 3VXMD 1IKNA 5DD1L 3ZE2E 5ENWB 5FK9B 3VD7A 1U8LB 4JFOA 3HN3A 3VRJA 4B50A 5ID0B 2NY3B 1WZKA 4M7KH 2C9AA 3B83A 4A6YL 4L3AA 1Q1JH 2VAAB 4N0UA 3H0TA 4M02A 1BVZA 3DV4B 3EKCA 3ESUF 3V6OC 4DAGH 4KUCF 1MQKH 5LGHH 5LVEA 5FA3A 3B3IB 5IMKB 5JIKA 4R7NB 3ZKND 4JCMA 4CAGA 5EN2A 2ED7A 4HIHA 1Z0MA 4ONGL 3GUTB 1R3JB 4M6MH 3C8KA 2YC1B 2VDKL 3GRWL 3GSRB 4JPKL 4X6EB 2N7AA 2EICA 2R69H 1T22B 3GSNL 3TIEB 1SYVA 2VXSH 4HC1L 2HJKA 3HE6A 3QR2A 5A2JH 2XWBB 1HEZA 4MAYA 2GFBB 3CDFA 5EU4A 5C07D 4F80A 4X4YB 1T1ZA 4LQ1A 4ZAKC 1GH7A 5L8JB 3EYSH 4FQ2H 1IE5A 3MYJA 1NFIA 4I18C 5CILL 4NQDE 4FQHB 4G8GD 3HNTH 2Q8BH 2XKUA 3O3DA 1OF2A 4JM2D 1S9XB 4MD5B 3BMVA 1AGBA 3N50A 3QDHA 4LSVL 4P2YA 4U3XA 3WKML 1CLYL 4LVNC 3GK8L 4HGKC 4LU5L 4HUUA 3WLWD 2VXTH 2R4RL 4XCFL 4PRDA 2R1WB 4PJXB 3MLVL 4X98B 3GBMH 4QOKD 1OAZL 1B6DA 4QHUA 4KV5F 3L3JA 1GZQA 4PJBE 4U6VH 3RRQA 2QADD 1QSEE 4GRWH 5TQ0H 1NAMB 3C5JB 1J12A 3PNWA 4OF5A 3HE6B 2YD5A 3MV9D 3TIEA 3FQNA 4NZUL 4NKMB 4IRSB 3W2DH 3UJIH 4I4WB 2QADC 5BOPA 3DUSB 4U05A 5HHVH 1MFEH 4P2OC 1AO7A 2XNAA 5IVXE 1J10A 5A2LH 4R7NA 3PGCB 3MXWL 3EJYC 1WWWX 3PP3K 1CVRA 3HG1D 2R2CA 4FMKA 4XP4H 3FOMA 4X6BB 3QUYA 4JFEE 2JJSC 4D94A 3LQAC 3BO8B 5C0IB 1RZ7H 4JO3L 2MQ3A 1S8DA 3KWWA 1FV1B 5BRZA 1FL5B 2FD6L 4A2MA 1WC7A 4PRAA 4R4NC 4RAUA 5FK9A 1F6FB 2GSGA 3WHE1 1I9EA 4L29B 5I1GH 1KEGL 4NUGH 2VISB 5D7JB 4X80L 1PX3A 4G9FB 5B8CC 3FONA 3FQTB 1FPTL 5I1LA 5TF1L 1Y6NR 1U3HA 5DJDA 1AKJD 2YBRB 4L4TA 2DDQH 1P69B 1REIA 3SDAA 2GSIB 4C83B 1CFQB 1DBAL 1I1CA 3S37X 3WIHH 3B8YA 2OYPA 3PL6D 1E28B 1EA9C 1I4FA 3VDAA 1EV2E 1YNLH 5SX5K 3B9DA 4H1LG 5C08B 2RIKA 1VESA 4NQCA 1Q38A 4QNPE 3PWPD 3F65A 3M17A 5BMFH 1NSNH 1RZKL 5ITFA 4Y89A 1TJGH 4LCUB 2GJ6E 4KUZL 1WJ3A 2QR0B 3L7EB 3UC0L 4WDIB 3ARSA 4IRJD 1UCTA 1RUPL 5EOCL 3EO1A 4OKVA 4P99A 2M26A 5IVOA 1CGTA 1NAKH 4AEFA 1A7OL 1DBKH 1ZLSL 3TO4B 3WFZA 1DBMH 3RNKA 2GAZB 3L95A 5SWZD 5IKCB 5DVLA 3MRGB 1HI6A 5FGBC 4QRSB 1XF4A 3VFNA 4MXVE 1EH9A 3OXRB 5EORH 3TPUB 4QYOB 2OJZL 2J8HA 2A74B 2VLKA 2HTKD 3WIFB 3LN5A 5D1ZC 3GSQB 3QEHA 4P3DB 2EXYC 5IBLC 1G9ML 1MCNA 2AW2A 1I1YA 3CSGA 3M8OL 1INDH 1S9YA 2WIMA 3T0EE 4ZMAT 2UZIL 3RI5K 3DYPA 3AM8C 3E3QC 1U3ZA 4YBQC 2DQUL 3MJ8A 3ULVL 2DTMH 1UACL 3QISA 5C2BL 2ICWJ 4JFEA 4LBEA 2X2YA 3FMGH 1UKSA 3IRPX 4E5XB 3ULUH 1I9JL 2DM2A 5CGTA 3BZFB 4IBLT 1T22A 2X4SA 3TWCH 5IVXA 4OV5B 3BI9X 3U7WL 1QFWL 2VL4A 1EEYB 1MQKL 3PL6C 1G7MB 2GK0B 4BQBA 5LGHL 5E94B 3WJJC 3CUPA 3GSXB 1XGUB 1ZTXH 2ZCKL 3TT1H 3DMMC 2ICEB 1S3KL 4PJFE 5FDWA 4KXZI 3BN9D 3BDXA 2MPAH 3QCTH 1OGAB 4YNYB 3B3IA 5DYOA 1JZ2A 4H88L 1T4KB 3MRNB 3VFUB 1D9KD 3Q5YA 4P9ML 3WE6A 2NW2B 1FG9C 1JNNL 2CRMA 4LASH 4LNVA 4V1DA 5DD1H 1NH6A 4O58H 5KAQF 3JTSB 1EGJL 4BELD 3HRPA 3VFWB 3MPCA 4F7CA 3KPRE 4Z7UF 5GGUA 5KTEL 1G6RH 1CK0L 3FB8B 4X8JA 4J2XA 3BHBB 4PJ5E 1GGYA 4WUUD 1KCSL 5L2KA 1HH6A 5EU6E 3GMNB 3V5KA 3CAFA 3GSOB 4RQQA 2YD4A 2YHGA 4I77H 5L7XL 3PL6A 2G2RA 4K94L 1YEKH 3KPOA 4H26B 2ZNWA 4B41A 4X7SL 2CGRL 4OLUH 3SEPA 2IAMA 3GSNH 4NT6A 4ORGB 4F7PB 4KZEL 3MRBA 4QGTA 3R8BB 5HSFA 5E56A 2XZCL 3MNVB 3LPFA 4KTEL 4M00A 1F42A 1YYMH 5D72H 5IG7B 5FOBA 3HAEH 2FL5A 1P1ZA 4F7EA 2VE6A 1IL1B 1CFVH 1MI5E 4KK9D 3G5YA 5DJAB 4U3HA 1NL0L 1MCKA 1T0NB 1UQSB 4XH2B 3HR5B 3TJEH 4QTIL 4ELMB 1IAKA 5HD8C 1MREH 1N5YL 2VXVL 5ITBH 2I07A 4Y4HC 2X41A 4RAVA 3AB0C 4ZXBC 1EMTL 5K33A 3UYOD 4WW1A 4J4PA 2WLZA 1CGVA 1QRKA 4RSVA 1FGNH 4NN5B 4XP5H 4JPIB 3FQWB 5FA4B 4YE4H 1A4KB 2YUWA 4X6CE 1CDHA 1RURL 3QHZL 1JHLL 5EIQA 4LNRA 5D1QC 2VC2H 4UT9L 3EDJA 3QCVH 3MC0A 3MCG1 1R24B 4I5BA 4QRUB 3LEVL 3BP7A 1B0RB 1JV5A 2QL1A 4TVPE 5J1AB 2CGRH 5IM7A 4OCYH 1BQLL 5HY9B 4ZD3L 3VXSE 3Q6GH 1TCRB 5GGTH 4P4KB 3SN6N 3DNKA 2J8UB 5E03A 1AGDA 3QJHA 2DQJH 5F3HB 3BD4A 4EBQL 1JPFB 3BP7B 4KUZH 5E8OA 3EJJX 3GGWA 3OAYK 3KPMA 1X5XA 4LHQB 5BJTB 1NCCL 2ADGA 4GRLC 4G6AD 4J3XA 1I8MA 2PYFA 1RUKH 2DDQL 5GSVB 3WNOA 1U3HC 4PV8A 4QHKJ 4Y16A 1Q94B 4WTZA 4FXGB 4M62L 3B43A 4KI1A 4P5TB 2IGFL 4UBDC 1HYSC 1NCBH 3O6LL 2CIKB 2BVQA 4MNGB 5FHAL 2Q7YA 15C8H 4E41B 1CZ8H 1D5IH 4YJZL 4Z7VF 2G9HA 1IAOA 3QG7H 2CR6A 5K9JL 3KXFE 1YJDC 3STBA 1ZT7B 3JUZA 4G6ML 3RGVD 4Z77A 4IIQC 2BHZA 2H8PA 1OAKH 5FUCC 4HK0B 4M9PA 3TVMD 2EYTB 3WO3B 4M7ZB 4HCRL 2P46B 3WCYA 5C2BH 1FSKC 3NIFE 1DEDA 1BFTA 5C7XH 2XG4A 2VZVA 4I2XA 4G42A 1DLHB 3F58L 3P2TA 4K2UH 3ZSSA 2IPTH 3KPSA 4KDVA 2HVJB 4LCYA 4LQFL 5DVNA 2BSED 3U36B 4DEPC 2O26U 5ADOH 1TNNA 1K85A 2C1PB 1IGYA 5DD5H 1EIBA 3QG7L 5L9DL 1CFQA 1F3DH 5D7LB 2BMKA 3LKQA 2OMNA 3DROA 4UI2A 4WI4A 5FYLH 2QLVB 2V5RA 4H1LB 3VH8B 5CBAA 4U33A 5CFHA 4L8CA 1XH3B 4XAKD 3QQNA 4PJHB 4YC2C 4X4ZA 3U7YL 1X5IA 4OM0H 3TGXA 4Q6IB 3GKWL 5HVHB 3T0EA 1K2DA 1KXTB 4MDIB 4DZ8B 4RX4D 1I7TB 3H42H 1FAIL 1UH2A 1NFDF 3GB7B 3TO4C 4DFHA 3VXMB 4MA8H 1MHPL 1CFSA 1NGWA 2V17L 5HI5D 1NGQL 5E08H 4HLJA 4ZUVA 2X1OA 1B4JL 3BYYA 5EU6B 5TQ2L 1L7TL 3AREC 3SKOB 1WAAE 5DXWA 2FLBT 3LH2L 4BFIA 5E8PB 1YMMA 2DQDH 3GMMB 1A6VH 3RWFA 3ULVH 3MRMA 5DRXA 4FABL 2VQTA 1GGTA 4JRYB 4U1LA 5EIIB 4X7DC 4NRZA 3VH8G 3NGBB 5I1AB 1X5HA 4PJDA 1U91B 3H6JA 3I6KB 5I76B 4JFZL 1PEWA 4TPRL 1JHTA 2A83A 5FEBA 4ZQKB 4PTUB 2EIZA 5FHBL 4EQ3A 2X4NA 2AVGA 2F74B 2P5EB 2A9NL 3ARVA 3WL9A 1CF8L 1QA9A 4LPXA 1ZS8A 4KHXH 1B6UA 4OZGF 3VMNA 1BD2A 1MH5A 1AQDA 3RHWK 1MHHB 2H6PA 3OPZL 4NPYB 4F9PA 3TO2A 4JO1H 1AXTH 1IZJA 2DQCH 1FNSL 4D0DA 5C0EB 3TFKC 4CL7A 4Y1AD 3SKMB 5AUMA 3TV3L 3QHZH 4L4JA 3GJFA 3RZCA 1B0GB 1FFOA 1QACA 2A73B 4OCRL 2G60L 4KAQH 2H2PC 4KY1L 5GSRB 3FHQA 3VFPB 4P2QD 4PIRF 2YD8A 4X9GA 1YEKL 3CFKB 4XB8A 3PHQB 1ZWIA 4FABH 3MSPA 1DSFL 1E4WL 3O3AA 2C7UA 3KVQA 1GXEA 3V95A 1EX0A 4S1RH 5LKNA 4OI8A 2KL6A 5SX4I 2XKNB 5EUOB 3ARED 5IK3B