2F54D

Directed evolution of human t cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without increasing apparent cross-reactivity
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
205
structure length
205
Chain Sequence
QQVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGGKLTSLLLIQSSQREQTSGRLNASLDKSAGSSTLYIAASQPGDSATYLCAVRPTSGGSYIPTFGRGTSLIVHPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen
publication title Directed evolution of human T cell receptor CDR2 residues by phage display dramatically enhances affinity for cognate peptide-MHC without increasing apparent cross-reactivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 205
sequence length 205
chains with identical sequence K
ec nomenclature
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f54D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f54D02
1WUNT 2W9EH 4TVSa 4OI7A 4Q6IB 4PRPB 3WCYA 2M26A 1GOHA 4GKNB 1IARB 1JYXA 1FC1A 2F53E 4JHAH 4QRPE 4KI5C 3U0WL 2DD8L 1EUTA 3BPLC 4EDWL 1VFUA 1TCRB 3G6JA 4KJYA 4OB5L 1LP9B 4R2GD 3UTTA 2R0KH 3S36H 1A6VH 2NYYC 2XWTB 3U9PH 1BX2B 3I6LD 3KPRD 5E9DE 4I77L 1CT8B 5EBMB 2GJ6E 2B2XH 3G6DH 4E41A 4I4WB 4OLWH 4XBGB 4LCYB 3BEVB 2XTJB 2MCPH 5BJTA 4ZFZB 1R0AL 4P5TA 1T04B 4JN1H 1A4KA 1DBJL 3TYGL 5I8KL 6FABH 3UDWA 1ETZA 1WVZA 4HK3N 5ISZB 3KPLB 3DBXB 5DEGB 4P3DB 1CI5A 3NGBC 4EXPX 2X9XA 4K71B 4KXZH 3HR5B 1NMBL 4EI5A 3MRMA 3DXAE 2OTUA 1TZGL 4ZXBB 5IFHH 1MAKA 1IM3A 2AK4A 3W0WA 5GZNC 4Z5RB 2YUZA 3EYVB 3QQ3B 5F89B 4QRSB 2YWYA 1KYOJ 3QDGA 2K7QA 4NZRH 5ANME 1IAKB 2DWDB 4XAKE 2AK1L 4H1LA 4HS3A 2N4IA 4I0PD 5DFVC 4ZUTB 3TYFB 4QRRA 2YPVH 1W0VA 5EZJA 1VESA 4Q97A 2BOBB 4LGPB 2X1PA 4CMMA 4OTXH 2D7OA 2ITCA 2Q8BH 4PJAE 4R0LA 3LSOB 2FGWL 1F4XL 2FZ3A 1UKSA 1JNHB 4X7EC 3W9EB 5DURD 4ZSOA 5JQ6L 4AEHH 2KZ1B 1XCTA 2HT3C 5C1MB 5DJAB 3MRDA 5C0BE 2FYYB 2PYED 5MEQB 1AY1L 1DVFD 4LQFL 3CSGA 4JPWL 2FEEI 4HUMB 1QSVA 2IMMA 2ZPKH 1OT2A 4WHTA 4WW2F 4M48L 4ELKA 3TBVA 2MQCA 5EA0H 1GRWA 2LTQC 3H2WA 2I9TA 3WFBL 3G08B 2AP2A 1FNAA 1SEQL 1CDYA 5C0RH 1J87A 3P30L 5CZXD 3IRPX 4LSTH 2KZWA 1QBAA 1YN6B 3V4PH 3FZUD 4XPBL 4BELD 5DTFB 4NM8H 3IDJB 1KCKA 4BKLB 3QNZB 3HC3H 3LS4L 3O6FC 5H35A 4UQ3A 1NEUA 3HNVH 2HN7B 1I9RH 5DFWH 1FNSL 5DJYB 5F6HI 1FLTX 1JPFA 3MC0A 3LIZL 2B4CH 2XN9B 1KJ3H 3B83A 4F37F 1TVHB 5IKCA 5E24E 1BFOB 4BSVB 4OLZH 4EEEA 4U6XA 4O2CB 2FATH 1PG7L 1BQLL 4YGAB 1IFHL 1HXYB 5IMKB 3SBWA 5ENWB 4IMLB 4TOYH 4FFWD 1AC0A 3CSYA 4FQLH 3PP4L 4KJPD 4V1DA 1QO3A 5E5UB 3RPKA 1J8HB 3BPNB 1R5IB 4LHQB 2ZZUT 1GPOL 5HI5C 4LARL 4R3SB 4FQHB 3MJ7A 3RX8A 4M8VA 3LD8C 2EE3A 4O2EA 1RURL 2PUQT 4G9DA 4J8RA 5CJOH 3ZDYE 5T3ZE 4AM0B 4XRCB 3B5TA 3OPZL 2CDFB 5KAQF 3L3GA 4W6WB 3D0LA 4RISL 3WO4C 5EU5B 4LHUB 3SE4C 1K4DB 3KYKH 5ESQA 1ADQH 3N85H 4CVXA 3U6RB 5F7FA 3T2NL 2F54B 2IFFH 3WN5B 1NC4A 3FQNA 2R4RL 1BGXL 3JV4B 1LO4L 2J2ZA 1IC7L 1ZHBA 1I7TA 2NX5B 1MH5B 4OV6F 3ZT7A 2HFEA 2MHAA 3SO3C 4K2UL 2KDGA 3O2DH 4G6AC 2BOCB 2BK8A 4Y5VC 3ZTJH 3V8OA 3R0NA 4F15C 1F4YH 3SGJC 1HQ4B 1QRKA 3EIFA 5AG8A 2PXYD 5ERWA 2FX7H 4JN2A 3TPKA 4FXKA 5DJZB 3MXVL 5B3JE 1EPFA 2VUYA 1OW0A 3RL2A 4NQDD 1YNLH 5F71A 4MD0A 3PGFH 1VDGA 5IESL 4Y2OA 4PB0H 5SWZD 4ZFFB 4ODWA 3VXSA 3FRPG 4LNVA 2Q86A 2A77H 3D39D 3RKDD 5GS1B 3PWPB 4HK0A 4Q7DA 3H9SB 4HS8L 4JLRA 4Z7QF 4K23L 2WBWB 4K07A 1CG9A 1VHPA 5IW1B 3O4LA 4LF3B 1INEH 4PJAF 4TNWK 4XCCL 1HOCB 5DK0B 3IKKA 4QOKB 3U7YH 4QHLB 5KSAD 3AB0C 1TVBB 3CXHJ 5T5FH 3RX5A 1J86A 4DJMA 1T21B 2HT4C 4Y19B 3U82B 1DBKH 4KKAC 1KLGA 2OL3L 1FH5H 2J8OA 4NZUL 4TTDC 1RPQA 5E8DH 5JUEH 1KPVB 3ARFC 2MFNA 4JDVA 3B2UD 4PRIA 2NXZD 2PTTB 4XP4L 4GG8B 2G9HA 4KKBD 2HG5B 3MRQA 4K7PH 4QHNA 4OZ4A 5MENB 3LRSB 3RGVC 2WM0A 3UTPE 2C3VB 3B2VL 3C87A 4HXBH 4NQXB 3GIVB 2CLZA 4WUKH 3V4VL 1TQBC 4N9OB 3MRBA 5GISH 3GSWA 3VXOA 1FZOA 3EO9H 4JHWL 1E6JH 1OTUD 4NZTL 4RGNC 4NRYA 4G6JL 4G42A 1GGYA 2PW2B 1QSZA 2JELL 1PDKA 3NACL 3WKMH 4Y16B 4OGYH 3MNVB 5C6PB 1X4ZA 5ACMA 4LCCC 4ALAL 3T2PA 1VERA 2VTFA 5KSBA 3Q3GB 5GRVK 4RMQA 3OKNB 1TQCC 4HS6A 3MLUH 5K59E 4LRIA 1E6OH 3QULA 1KC5H 3A0OA 2FCBA 2EKSA 3BJLA 3FFDB 4BA8A 2XG4A 5FUCE 4W68A 4ZFOB 5HYJA 1SYVA 1J0HA 3MXWL 4M93B 3LPWA 4UB0H 3BW9A 5CP7A 4JFYA 2ARJA 2VLKD 2NY3B 1K6QL 4PG9B 2NZIA 1B9ZA 4KQ4H 3ZDYF 4K8RL 1S9WB 3S98A 2FR4B 3O3BB 3LDBB 2XQYG 3MLVH 2AXGA 3UTZB 1OOAA 5SWSD 1DL7H 3MOQA 1FGNH 1WBXB 1FIGH 1RZKH 3X11A 4RMSA 2NY4C 2Y1VA 5KOMC 4XNUL 1SJHB 4NNXA 2P44B 1DSFL 1G0YR 4WFGD 2FSEA 4ZS7H 2Z31D 4QYOB 2YD5A 4WU7A 3ARDD 1U8KA 3WL9A 2B20A 3OR7B 2YD3A 1N0XL 3TM6A 4MS8C 1UXSA 35C8H 2VISA 4G7VH 4YGVA 2DB8A 3OQ3B 5LXGH 4X0KA 3MNWB 5KVFH 4PRAA 4LCWB 5B3JF 1E4XI 2DQDH 3BSZH 3SKUD 2QKIA 4NQUA 4F3FA 2IAMC 3QUMH 1T7ZA 2CLRB 1DJSA 2CDEB 2EDDA 3VFOA 4LLVB 3NH7L 4PJHA 3VI4E 2NY6C 4NT6B 4PG2C 1QNZL 2QSQA 3OKMB 5T33L 5JQHC 4JZJA 2BP3A 2NMSA 1T5WB 4MAUH 4L4TE 4K94L 3KYAA 5C3TA 5FKAB 3PWNA 1FG9C 2OM5A 2YD7A 1Q1JH 3TO4B 4KZDL 2HKFH 3VXNA 1AIFA 4KPHH 4TVPL 3ZZ1A 1U3HB 4P3CH 1VFAA 4DGVL 5EOCL 4AMKL 3JV6A 5FHBL 1HH6A 3RBSA 1OTSC 5E6ID 3QEUA 2R29H 4YEFA 3TO2A 2P5WE 3QUZD 2NY1B 1B6DA 3L7FA 4L8BB 4HCRA 1P69B 4NO5B 2AS5M 3K7UA 4OJFH 2JE8A 4R8WL 1RI8A 2GTZB 3REWB 1TIUA 3CLFL 3WLWC 2CMRH 1U36A 1CD1A 5HHVH 5DD3H 3U2SA 3HMWH 4Y4HB 5C08D 5FYLL 4LASH 5MERA 1S7XA 1IM9A 3O8XC 2R8SH 3PWJB 4PJBB 3UO1H 1YY9C 4KC3B 2ZCKL 3W39B 3L3JB 1IEAB 3GJFK 4JKLA 2VYRE 1RK0B 1NLDL 1OAUL 1T1XB 1T22A 4M62L 2HRPL 4Z7WA 5IM7A 3SPVA 2VDLH 1F13A 1JN6A 1NGWB 4I48A 3JWOH 4R7DA 5D2NE 2CPCA 3DX9B 4P2QE 4PTTB 4HUWB 1JIBA 1U9KA 5K59F 4TSCL 5CIPH 5GGTH 4X4XB 3OKOB 1WEJL 3VRIA 2R1YB 3B43A 3IB4A 2FWOB 5JW4Q 5EIIA 3GKZA 3PP3K 4GRMB 5HSFA 2AJXH 1X5HA 5IG7A 3PQYE 4JFED 3WFZA 4JY5L 1IZKA 4X9BA 1H3PH 3F5WB 1I3RB 3L9RB 3RVTC 4HV8A 5ITBH 4NKDB 4HPOH 3MGOB 4OGZA 5DF0A 3B9DA 4RFOL 5GGRY 1FYTA 2JIXB 1G7QB 4DCQA 2UVFA 1H3GA 43CAA 1L0QA 1AQDB 1RV6X 3HZKA 5F1IB 3CNKA 4WCYL 2Y7QB 2J8UA 1FVDA 1TPXB 5DT1H 3JV5A 3P4MB 5FUZH 4G5ZL 5KN5A 3R1GL 4BK4A 3UTSE 1JTOA 4RZCA 5IK3B 1J5OH 3ROLA 2EH7H 4NHUB 5D8JH 1T5XB 5J6HA 5FM5M 3S37X 2HFGL 1YMHB 1N6VA 3ARXA 4TYUA 2QSVA 1W2KT 1JRHH 4M6NH 5C07B 1ZLUH 5E8EA 4JJHA 1N6QL 2IPTH 3VI4F 1XZ0B 2NR6C 2DQJH 3QWOA 5E2VL 2F19H 3JTSA 2BNQD 4HMCA 1MEXL 5FM5O 3RVWD 1D6EA 1OGAA 4WV1B 1Y0LA 1UVQB 4MB4A 1OP5K 1NBVH 5EULV 1A6WL 1A7OL 4PRHE 5JR1H 1ZSDA 4LSPL 2EDQA 1JZ7A 4GS7C 4QT5A 1QBML 1YY8B 3OAZH 1MUJB 1S5IL 3FQXA 3QHFL 5DJ8B 5HI4D 4BFGA 1EHLH 3OF6D 4MXQC 1I1YB 3QJFA 5D93C 1QHOA 2O5YL 3VMPA 4DKDC 2AQ1A 1YEKH 3VH8B 4DFHA 4Q74A 3ME0A 1HSBA 2XKSA 1UWEH 2IAND 3PGDB 1A7RH 4F7MA 4G9FB 4N5ED 1AJ7H 2DBJA 3NIFE 4QNPE 4H20L 4URTB 3RVVC 2PO6A 2CIIA 1LEKA 4G80B 5IQ7L 1GJIA 4WWKA 1H5BC 1WISA 3ARVA 4HT1L 3RY6A 1R3HA 1T66D 1IGTA 2NLJA 3GGWB 3HE6C 3LMJL 1I1AC 4YJZL 5FA3B 2VITB 2BSRB 4R2GB 5EC1B 5CINH 3KYNB 4GBXA 3X13B 5KS9A 1W0WB 1MJJA 5HGDB 4A6YH 1AGDA 5EC2B 3FB6A 4OGXL 5DUML 3KPRB 2OS7A 2RAMA 1AE6L 3RY4A 2XTLA 2N1KA 4JZOB 1A2YA 3ZHKA 5C0IA 4JPKL 4XVTL 5EU3A 4YXKL 2X5PA 1GGCL 4C56E 2Y06H 3IDYB 4PR5B 4CRPA 1Z5LB 4NWUL 2ZUYA 2C9AA 2HVKB 4IMKC 4X7SL 3FCTB 1NCWL 3F6IA 3V4UH 2VIRB 4I8DA 3BQUD 1WZMA 4OF7A 3QDMD 3VXPB 3ARQA 1IC4L 1JNLH 3GJEB 1M4KA 1ORQA 3MLZL 3WHXA 1OARL 4JRXA 4LVNB 3RDTC 3VFGH 5I19H 2Y07H 3OZ9L 4FQXB 1VGKB 3MUY1 3PWLA 4WEBH 1YPZA 1RUAH 5F9OL 5J6GA 2QJDA 3O3UN 6CGTA 2C7UA 5FDWB 1UKTA 3O3EB 2H3NA 2VLMD 3QCTL 3V7AG 4I0PB 1EHAA 4JM2C 5J06A 3LH2H 5EZOH 1CFQA 4QTIL 4PGBA 2Y23A 3T0XA 5T3XD 3LN5A 2R1XB 1MHCB 3SJVA 3MLSL 4JB9H 1IBGL 3QQ4B 1OF2B 2H6PA 5E08L 1OAKL 4CDHA 4OV5B 1G0DA 4JO3H 1NANH 3DUSB 5EORH 1SHMA 4NKMA 2X4TA 4HKZB 5HYSB 1OAZL 4X9FA 2JJSC 2FX9H 4DUXA 1H8SA 1EGJH 5F6HJ 5DD5H 3VA2C 3L95A 2OL3A 2VZ3A 3F6LA 3WNKA 3FB5A 2PYEB 3RAJH 1FCGA 4BSWB 1S9KC 1DVFB 3ULUH 3L3IB 4L8SC 1WBYA 3FO9B 3DIFA 2ENYA 4MJID 5J11B 5BXFB 5HHOE 5DDHB 1KCLA 2D2OA 2R0LL 3HZYB 3M1BB 3QI9C 1ZVSB 3NA4A 3AUVA 1A7QH 2ATKA 1NFDE 1AKJD 3VFSA 2JCCE 4RWYH 1F58H 3Q5TA 1PY4A 1T0MB 2BMKB 2BHUA 1ITCA 5IB1A 5F44A 4IRSC 1P9MA 1AR1D 1RJYA 2CD0A 4GXVH 1X5AA 1QVOB 1CFNA 2QHLA 1CDGA 3EJZD 4FNLL 5IVNA 4GG6B 1QFUH 3UPCA 3FB8A 5E03A 4LLDA 2A83A 4MCZB 4XXCC 4KRPD 2A6JB 5EFIA 3ESUF 2DLIA 3GMOA 2ZCHL 2WP3T 4H88L 4LU5L 4WW2C 4XMLL 4HD9A 3FQTB 1MPAH 1VCAA 3NIFF 3FT2B 4QNPF 3EO0B 4L3EE 2VZVA 1NGQL 2WNGA 4NWTL 3V52H 1EJOH 3T09A 5CSZB 5ICYA 4HG4J 2GITB 1MIMH 4UDUA 4ZFGL 4KK6D 5B8CC 5I6XB 3VRJB 4HW6A 1BJ1J 4XI5D 1QFWH 4N1CA 3LKSA 3MV8A 4X6DE 1YEIL 5E4EB 2DQFA 3NFSH 3BI9X 4Y4FA 3SDDD 1PYWA 5JIIA 3W2DL 4OF8A 3JTTB 3MBED 4X7CC 1I9IH 2ZOLB 1G6RH 3ARED 2VXTH 4BH8B 5C0CD 5C9KA 4U33A 4R97C 3DWTA 3V6BR 1A14L 3F62A 2EXYC 5IEHB 4OM1L 1NAMB 2BNUA 3JWOC 4UU9B 4Y4KD 1G9EA 4ZTPL 4ISVA 3V0VB 4TPRL 1OWWA 1BOGA 4EOWH 1T1WA 4PIRF 4MB3A 3VXUE 4ONFL 2PNDA 1BVZA 4M61A 3WIFB 5DA0B 4GT7A 1SY6L 2R2EA 1G9NL 3EHBD 2PXYB 3HKFA 5EBLA 4LRNH 4EUPG 2V5SA 2D7TL 2VZUA 5AD0A 5JXED 4G3YH 1CCZA 3EOAB 5JNYA 1FCCA 2OZ4H 4LHUG 2GSIB 1D5BB 1U8JB 5I0DA 1J1PH 2HTLC 1T20A 4NQDB 4IRZH 5E5MB 4HX1B 1EAPB 5L7XL 1JGDB 4J4PD 4OKVA 1GHFH 3SHSA 5SWZB 3OXSA 4NOFA 3NCCB 1L7IL 3IS0X 2RGSA 5IJKC 3D39B 2P5EE 3GNML 5C09D 5DMGD 1A6TB 1LE5B 3WYRA 4N9GA 3TCLA 3E6FA 1X7QA 4HQQL 4PBXA 5GS0L 3FB7B 1VGEL 3QISA 1X5YA 3Q6GL 1DBBH 4RMWA 5DJDB 4XMPH 1KJ2H 2XZAH 2KKQA 3F7VB 1JGUH 5BRZE 4PREA 4ZOEA 3HRZB 3S36X 1PKQA 5T1MB 4Q6IA 3FT4B 3QEHB 3SE9L 2RR3A 4PRPA 5HDBE 3IFLH 1J05B 4GKNA 3ARYA 3SGKC 5I1EL 5GS0C 4KZEH 4J3XA 1UZ6E 4LPUA 3TLRA 1S7RB 3ARZA 3GMQB 2NXZB 3DYPA 3WXVL 5GGUB 1TCRA 1LP9A 1ZLVH 1YQVH 3W5MA 5EN2B 3IYLW 1QBLH 2XWTA 1BX2A 1GH7A 1NFDF 5BV7H 1MFNA 2JCCF 1C5DB 1DFBL 1K9TA 1V7ML 5GRYA 1CT8A 5DD6B 5EBMA 1UWXH 4KI1A 5J13C 4DUWA 2NNAB 4I4WA 4XBGA 4LCYA 1AHWC 3BEVA 2FLRT 4ZFZA 4OZGB 3RWHB 3H6JA 1QSFB 1T04A 2HT2D 3GMPB 3K8KA 3QIWD 2ID5A 3A6CL 5CBEB 5ISZA 3KPLA 1KGCE 3DBXA 4P23B 2J88H 3DV6B 4P3DA 5DEGA 5B39B 4OCSL 3NIGE 1D9KC 1RZ8B 1CFTB 3WHE1 1JZ3A 1KNOB 4MAYC 4MNGE 3LZFH 4ZXBA 2WWMC 3G04B 3O6MH 4XNYL 2YA2A 5BS0B 3BN9C 4Z5RA 4NQCE 5AWNH 3EYVA 4DVBB 2J5LB 3QQ3A 3MO1B 1OCWL 2UWEE 5F89A 4QRSA 3T4AB 1J1OH 5EO0B 2DQEL 3P9LB 2CJUH 4HJ0C 4P2CG 1NGYB 3NTCL 1IAKA 2DWDA 5LGJB 4P4KC 2IALB 4ZUTA 3TYFA 2H1PL 4MHHG 1F42A 4X4MA 5T5NG 3EFDL 2BOBA 4DOHB 1NCBL 3INUH 4X6DF 5J4MA 2I60L 5TJWK 5SWSB 4XNMB 3LAFA 5D1XC 4Y2DC 3WFCL 2GCYB 25C8H 3LSOA 4DAGL 4LSSL 1JNHA 2P24B 3W9EA 3EOTL 4NSKB 4D8PB 1T89A 1TJHH 3DUHA 4FN0A 1FFRA 5DJAA 3ARDB 5T3ZL 4WGWB 2FYYA 3UPRB 5MEQA 3B9KC 5D2LE 3MLXL 5D1QD 2X1QA 5JIKA 5KANG 5C0AD 5D96C 1CIDA 1A9EB 3DPBA 4R4BB 5TPWL 1HH9B 1CGWA 1FRGL 1OTTD 3SQOL 3G08A 3BE1L 3VGAB 2A6KB 4IOFC 5J9PB 1YN6A 2WIIB 5IVXB 1KEGH 3GI8L 4WFED 4XNXH 5FIEA 4YC2C 3QNYB 5DTFA 3IDJA 3U30B 2NY6B 1IGCL 3QNZA 4BKLA 1C8PA 1VENA 1RZ7L 4M7KH 4D0BB 3TEUA 2HN7A 5DJYA 3NMEA 1PGRB 4JR9H 3L6FB 2FX8L 4EN3C 2XN9A 3DYOA 2MTPA 1TVHA 2ICWI 1BFOA 4GAJL 4Z0BL 4BSVA 2IPUG 3QXWA 2APTA 4O2CA 1YEGL 4YQXL 1HXYA 5IMKA 2DI7A 5ENWA 4XP5L 4IMLA 3SDCD 4GW4B 4L1HA 2DM4A 4NKOB 2E9WA 3CDGA 5E6IB 3QAZC 4EKXA 4LIQL 5HDBF 4JKKA 1YMMD 1J8HA 1KPRB 1R5IA 1DR9A 1A6UH 3H3BC 1G6VK 4R3SA 4FQHA 1UZ6F 1IE5A 4S2SB 5GRJH 3FO1B 2VABB 3WE6B 1MHHB 1MNUH 1WV7T 3FO0H 5E7BA 4AM0A 3BP5B 4XRCA 3ULUD 4TSBL 3TBSA 3MJ8B 2CDFA 4OFYA 2EDHA 4EUPA 1DLFH 1BEYH 5EU5A 4PJ8C 1SJVA 5DZNA 1BFSA 4LHUA 1K4DA 4YHYB 3QXDB 2F5BH 3TFKC 1VSCA 1OM3H 1S78D 3FOLB 2EYTB 2OP4H 3U6RA 5C6TH 2F54A 1FNHA 3WN5A 2IJ0C 4PJGB 3DX6B 3Q5YA 1QRND 4ERSL 1HZHL 3JV4A 1Z3GH 4F33B 4KKCC 2NX5A 4PJEB 1MH5A 2E7LA 4XC1L 4F2MB 5LBSH 2BOCA 2H45A 3BKCH 4ONHB 1JHKL 1I8LC 2OR9L 2HTKD 4CBPA 3NIGF 3DARA 1HQ4A 3N1FC 1RZFH 3DHMA 3DO3A 1A7PL 2BHZA 5HI3C 1WICA 5DJZA 1RULL 2BVEA 1MCPL 1P1ZB 4OZIE 1NCDL 1OWRM 2AJUH 4K3EL 2UWEF 3V6FB 4PJCE 1CFVL 4O4YL 1ZT7B 5AZEH 4ZFFA 4U1MB 2AGJH 4JO4H 5GS1A 4M43H 2ZUSA 3PWPA 4U4BA 5D70L 2QQKL 3H9SA 4XB7A 4JFEB 1B4RA 4HIXH 2YWZA 5IHLB 4WI4A 1MAMH 2X4NA 2P46B 1ZHNB 3JWDL 3D1MC 4UTBH 1X5XA 3GZKA 1CTNA 3KPPB 4TQEH 2F8XC 3C09C 5F9JB 5CKAA 4TRPL 5DK0A 1HOCA 1LQSR 4K7PX 4QOKA 4QHLA 5D5ME 3GHEH 3U7WH 1TVBA 4NO3B 4DK6A 2ZNWA 1T21A 4Y19A 1MQ8A 3VGBA 3P4NB 2VH5L 2YKLH 1KPVA 1NEZB 2F5AH 2LU7A 2VDNH 5D2LF 5E2TL 5FUCC 2FD6H 4PYGA 3JWDC 3TCXA 2PTTA 4IIQC 3QRGH 4L1DA 5DO2D 3HUJB 1WITA 1LO2L 4GG8A 4XHJC 2HG5A 5DMYA 5MENA 3LRSA 5I1DB 2C3VA 2FEDC 4WDIB 4NQXA 3HR6A 5BVPH 1MCJA 3GIVA 3QDAA 5K33A 4LVEA 5ESAB 4Y88A 2V7NB 5I8CB 3NCJL 4GRLD 1ED3B 3F7PC 2FJHB 2PW2A 1K2DB 4WI9A 5ICZB 4OCRL 2R56L 1A6AB 2BNQB 5HYQA 4P59H 4Y16A 4IRJC 4YDLC 2GAZB 4PGEB 3MNVA 5JMRA 4EQ2A 4F7CB 3JVGC 3QP3A 4G8EB 3ZTNH 3Q3GA 3NA9L 3QEGH 3OKNA 2AEPH 3U1SL 4M5YH 2Z8SA 3FFDA 1XF4B 5CUSH 4JFFD 4ZFOA 4Y7MA 4I5BB 1ZANL 4EXKA 5LG1A 1ZLUK 4C57C 2IANB 4X6CB 4P99A 3RGHA 4JFQB 2YXFA 2V2WB 4PG9A 3RY5A 1S9WA 1UZ8B 2ZWLT 2FR4A 3O3BA 5FM4A 5F7NC 3UTZA 1XIWA 1WBXA 1MJ7L 1DQDH 3IKCB 3QBTB 4KAQH 4K3DL 1XF3B 1GC1L 1IAII 1SJHA 4O5LL 1JNNL 2XA8H 3NCFB 3UJJL 4QYOA 2XT1B 5BV7C 2VDRL 1BFTA 1BP3B 1U42A 3OR7A 2B39A 2YSSB 5FKPB 3S34H 4MNQE 2Y4SA 1M1SA 1NAML 4YX2L 3RRQA 2P7TB 5I1IH 2GUOB 3DJ9A 3LHPH 2C3GA 5IIEB 1MJUH 5HGBB 3EYSH 2Q3ZA 5E8PB 5F9WC 3X3FH 4M3JA 3MNWA 5L0QC 1IGFL 4MXWL 4LCWA 4LSVH 3KPSE 5FGBA 4OZIF 1PEZA 1YC8A 2CLRA 5KVDL 4PJCF 5SV4A 2CDEA 4LLVA 3KYOB 3BQUB 1HHHB 3QDMB 4NT6A 2OYPA 3LB6C 1BQHB 3OKMA 3HNTL 4OF5A 3TZVC 1F3JB 1SY6A 5ADPH 1T5WA 1S7VB 4K3HA 5FKAA 5CBAB 3ECBB 2HKHL 3TO4A 4AIOA 2GJJA 1U3HA 3KXFE 2CRYA 5D5MF 3EUUA 3F8UB 1WWWX 3QXUA 5DC0A 3DVGB 3QUKB 5D2NC 1MF2L 5JXAL 2ICEB 4I1NB 4YXLL 5F96H 2NXYD 1KFAH 2WAHA 2EH8L 1G1CA 4L8BA 4HKXB 4CUCA 4NO5A 3QXVA 2YRPA 1A1MB 1ZAGA 1LDPL 3MODL 4HWBL 3EOBB 2AJSL 2OTPA 4QLRA 2GTZA 4GAFB 3UYRL 5LWYL 3REWA 3GBNL 4XMKL 4YXHH 2X4SB 5KSAC 4MQ7B 5HGAB 2CKBH 5D1ZD 3LQAL 2DLTA 4CN1A 4Y4HA 1CZ8H 5CD5D 4WO4C 1CE1H 2Q8AH 3B4NA 2DYPB 4GQ9H 4L8CB 4MJIB 2XIDA 1LK2B 3VJ6B 5ID1B 1RUQL 3PWJA 3QPXH 4PJBA 2GK0B 4ZPVB 1NUGA 3QUMB 3BZDA 3W39A 2X6MA 3L3JA 1IEAA 2YN5A 4I18B 5GJTH 1HHKB 1AKJB 5IBTL 4XPAH 5A40E 1RK0A 4KRLB 1T1XA 3MSPA 4BFEA 1NGWA 4L4VE 5H2BB 1ZTXL 1T2JA 5I17B 3CVHH 3DX9A 3IDGB 4PTTA 4HUWA 3TN0D 4QHKJ 4N0UB 1SVCP 2RCSL 2B0SL 1HINH 3OKOA 3GK8H 4X4XA 4NHCL 4JRYD 2NY0D 2R1YA 3ULVE 1CDJA 4D0CB 2FWOA 1RZJH 4GRMA 3WS6C 5FCUH 2WW8A 4KRPB 4V1DD 1E4JA 4NN6B 5K93A 1LO3L 3HC0B 4JZNB 5D4QA 2E27L 3SCMD 5CJBA 3BAEH 1G1YA 3F5WA 1I3RA 4QWWC 3L9RA 5GZOC 4NKDA 1ORSB 3MGOA 1YYMH 1Q94B 1G7PB 2DIJA 4LEXL 4LPXA 4FOMA 2EC9T 4P2RA 2JIXA 1G7QA 1A1NB 4YHOH 1AQDA 5F1IA 2DI9A 4M6MH 3RZCC 2VAJA 2WZPD 1U3ZA 1YYLH 4XCFL 2Y7QA 4R7NB 2EEBA 3LKOB 1G9ML 3QIUB 3MCLH 5F72S 3P4MA 3SDDB 2EYSB 3WIHA 1C1EH 3MBEB 1CD9B 2A73B 3PJSB 4NGHL 3AREB 3VG9B 4ZS6C 1DLHB 3H0TB 3QHTC 5IK3A 5C0CB 4RGMB 5E1AB 1UJ3B 4NHUA 5C8JB 1RJLB 2VDPL 4LKCB 1T5XA 2Z31C 4MQSB 1T3FB 4UT7H 4Y1AE 1YMHA 1FDLL 2HP4A 3KJ6L 4Y4KB 5C07A 5I8OH 1QFOA 1RFDL 1XZ0A 4JG1H 4HBQA 1S7TB 3NVQA 1IQWL 5CIPB 4EI6B 2F53B 4C54A 2VL5B 4R4FH 3X17A 4NRZB 5JIHA 3VWJD 1KIQB 5FGRA 3PF2A 4OCLC 3SDYH 1OAQH 4YE4H 4WV1A 2Z9TA 4EVNB 2EC9U 1P6FA 1UVQA 4PJ5E 2OQJB 1MCWM 2WINB 2EDLA 3FAXA 4WHYH 5HDQH 3KS0H 4PLKC 4UAOB 2A1WH 5HPOA 4JY6B 3BDBA 1YY8A 1MUJA 5C09B 3O2WL 2KPNA 4I3RL 4XVUC 5DJ8A 2VKWA 4PLJD 4U1SB 1I1YA 2F8OA 3G6JE 5EO1B 3UTTE 3VH8A 3X14B 4GFTB 1R3KB 5IW3A 4M1CC 3PGDA 1E4XL 4ORGB 4G9FA 2GQHA 2HJFB 2M1KA 4JQVC 1UWGL 1FBIL 3BESR 1JP5A 4HIIB 4PRID 3BKJH 4G80A 4HBCL 4E41E 4OLVL 4YDJB 3QUZC 3GGWA 5FM8A 2K7PA 3OWEA 4XZUB 2VITA 5FA3A 2BSRA 5EC1A 5BO1L 3KYNA 1W0WA 1WGOA 1LO0H 4KK5C 4XP9L 1GAFL 2GJZB 5HGDA 4FFYL 5DC9B 4UILL 3FTGB 5EC2A 3KPRA 3S35L 1GGIL 3BIAX 3HC3L 2AK4E 4JZOA 3W0WE 3BT2H 4GSDH 2X1OA 1HIMH 3GBML 3HTLX 2YPKB 1TTUA 5DLMH 1S9XB 1CICD 3CFCL 3QDGE 1MCHA 4AK1A 4PR5A 1Z5LA 3BKYH 2I9LB 2HVKA 5BOZG 3FCTA 1H15B 4QRRE 3QIWB 3ULVF 2VIRA 1OY3B 4OF6A 3VXPA 1NSNL 3GJEA 4TUKH 3D25B 3DTXB 3TBWB 1ZLVK 3NN8B 1N7MH 5I1AB 2YD4A 4ZSOE 4OSUL 4FQXA 4CADB 1VGKA 3DSFL 1MFEH 1KBGL 3NZHL 3R8BB 1P4BL 5EU6B 4WFHD 3BX7C 1UWXK 5FDWA 5GXBB 1YNTB 1QKZH 3O3EA 5DJCB 3LEYH 4I0PA 2MQ0A 3FQWB 1BQUA 5JOPE 3GM0A 4ODTL 1CU4H 2YD1A 4KK9D 2X1XR 2R1XA 1MHCA 3NPZB 3AMLA 3OX8B 1FO0B 3T0AA 1OVZA 5IV2B 3QQ4A 1OF2A 4BSJA 4OV5A 5B39G 3DUSA 5JPMB 5DFTA 5DRXB 1MFCL 2IFFL 2FO4B 2H2PC 3R4DA 3QDHA 4HKZA 3RTQD 5HYSA 5CGYC 1GCFA 2HWZL 5DC4B 2N56A 4AY0A 3L3KB 4UV4H 3QIBD 4A6YB 1NGXB 1FFQA 1KN2L 2PYEA 3I02B 4BSWA 3C6LD 1DVFA 4YBLC 4NC0B 3L3IA 5D1QB 3FO9A 5C0AB 4Q9BA 4BZ1L 5BXFA 1UEYA 5DDHA 3SEPA 4HH8A 3M1BA 3HZYA 1AGFB 4JO1L 1ZVSA 1UM5H 3B8YA 3V5HB 4XTRD 1S3KH 3P0YH 4QRTB 4P9HH 2VRAA 3LQZB 4AQ1B 3C2AL 4ODHL 4BZ2L 2BMKA 3MRKB 4DKEL 4CJ0A 2DM3A 4Z7NE 4KKNA 4NQTA 3T0BA 3QO0B 4V1DE 5FYJH 1QVOA 1CFSB 3CZJA 1UA6L 1RMFL 1F45A 4GG6A 4ZTOH 2ZJSH 2YMXL 4MA7H 2EDOA 3G6JF 5A3IC 4HG4K 5GRWA 1BIIB 4MCZA 1QYGH 2BY0A 4NPYB 4N0YL 2A6JA 3IVKB 4OIBA 4WWID 1GOFA 4OZFH 3ARGC 1FL3B 2AW2A 2FHBA 3FQTA 3MGAA 1MQKL 5TQ2L 3SDCB 3FT2A 4E0RB 3EO0A 2JB5H 4QXWA 3BD4A 4XNQB 1YMMB 3ARPA 4IS6A 5HI4C 5CSZA 2GITA 2APVA 1EVTC 4XC3H 5JW3L 5FOJA 4HXBL 4U6YB 3HG1D 3VRJA 4JFHE 3CDCA 1HYSC 1DBAL 2PYFB 4ZAKC 2VDKL 2Y6SC 3H3PL 4GJTB 3BDXA 5C7XH 4KROC 2WMPA 1OSPH 4A2LA 3JTTA 3ZO0A 2ZOLA 4MB5A 4NN7B 2AQ2A 4O2FB 3A67H 3L5XL 4BH8A 3CX5K 1WT5A 1I3UA 4GRWB 4NNYB 1U95B 4ZOCA 4FRWA 5E5RB 2DQUL 1INDL 5IEHA 3VXSE 2I5YL 5MEPB 1NAMA 5FO7B 4UU9A 2B5IB 2W59A 3LKNB 3M8OH 3V0VA 5C2BH 1Z6JT 2DTSA 1EO7A 4OFPA 5HHXL 5ABDE 5TE6L 2ED8A 3WIFA 3M17B 3O4LE 2CQVA 2PXYA 5ALBL 1RZJC 4UB0L 4OCWL 3EOAA 5E2WL 2GSIA 1D5BA 1WIOA 1U8JA 4CVUA 1A3LH 4NQDA 2W9DL 4HUVB 5E5MA 4HX1A 3PGCB 1EAPA 3MA7B 1JGDA 4WU5B 1PY9A 5IOPB 4M9PA 5SWZA 1CGVA 1HWHB 3D39A 1MI5D 1XGYH 3WD5H 4NJAL 1CDIA 4PRIE 1RVFL 1A6TA 2F15A 2YPLD 1LE5A 3MA9H 4HLZH 2EDJA 5AEAA 1IKFH 2XZCL 3D2UD 2X4PB 3FB7A 1FYHB 2NY2C 5T3XL 3VFTB 1AD0B 4YR6B 1FORL 5DJDA 7FABH 3GO1H 4D9RD 2VSDA 3KJ4C 4GXUM 1JF5A 3ALXA 3F7VA 5TE7L 3K3QA 4KJQC 2BVOB 4PB9L 3HRZA 3QUYC 4JFZL 1KN4L 5T1MA 4N8CH 4DEPB 3FT4A 3QEHA 2COQA 4X7FC 3B6SB 4HPYL 2J6EL 1J05A 3WIIH 1G6RB 4FG6D 2FDBP 1E0OB 3D0VB 2FL5B 3MJ9L 1S7RA 3P11L 3EJYD 3GMQA 4HWBA 4PGDA 5GGUA 5JORB 3CLEL 1BLNA 2HLFC 5EN2A 5DMIL 5HHPB 4PRNB 4X5LA 1YJDH 2LFGA 5HYIA 4FZ8H 5KSBE 1C5DA 2IG2L 4X5WB 5DD6A 4Z7NF 1UYWH 4GRLB 4V2CB 1FGVL 5I1HH 5HYJE 2NNAA 2G2RB 3UCRA 3AAZB 4OZGA 2X70B 1NEZG 3RWHA 1JHLL 5I18L 1QSFA 3G5YB 5I74C 3GMPA 5CGMA 3WJJC 32C2B 5CBEA 5IROC 3F58H 4P23A 3DV6A 1DQML 2ERJB 4KVCH 5B39A 4YPJA 1RZ8A 1CFTA 4U7SA 2WLZA 1KNOA 1FLRH 1T83C 4LLQB 3IU4L 1ZGLB 1CK0L 4HXAH 1X3DA 3G04A 3CDYA 5M7QA 1JMZA 5BS0A 4DVBA 1KJ2B 4JFFB 3MO1A 3T4AA 5EO0A 3Q1SH 3P9LA 4LDLB 1R3JB 3L1OH 1NGYA 2PO6D 3IJHB 3PHOB 3TJEH 5LGJA 1YECL 2IALA 4F7TB 2D9QB 4GW5B 2EXWD 5AG9A 3VXQB 1EX0A 5ACLA 3C9NB 1C7SA 1LO5B 3NFPB 5SWSA 4XNMA 2IQAB 4L4TB 3VMOA 5LGKA 2GCYA 1ZS8B 5D7KE 4OM0H 1KCRL 4K55A 2P24A 2A0LC 1MFBH 1II4E 1P2CB 4NSKA 4D8PA 2VLLB 4U1GC 3ARDA 4PJHE 3HPLB 3UPRA 5GJSL 2G5RA 3C6SB 3MROB 4NFBA 1CLZH 1A9EA 4R4BA 4Z9KB 3TH3T 1NLBH 1ZWIB 4GKOA 1HH9A 4KVNH 1MAJA 2ENSA 3AVEA 3SDXE 5F9WB 5D7LD 4P9ML 5TDNB 3TT1H 3RIAF 4OQTH 3O0RL 2A6KA 4JO2H 5I30H 5J9PA 3TT3H 2AJXL 5IVXA 2WIIA 4QTHB 1M71B 3QNYA 4IJ3B 3MRFA 3N9GH 5EOQH 1MSPA 3C60D 4NCC2 3BZ4B 3VW3H 2W07A 3L6FA 5JMOC 2H32B 5KVMC 4AG4L 4MMZC 4M1GL 2MJWA 3GSVB 5I75C 1EBPA 1UC6A 1RK1B 1MCWW 5KTEH 4KDVA 5J1AB 3QYCA 4OCYH 4GW4A 5HGHB 4NKOA 4YNYB 1PQZB 3IXAB 5E6IA 5FUZL 1NL0H 5CP3H 1KPRA 2GKIA 3PL6D 3WJLA 2NXYB 5BMFL 1BQHG 2EH7L 2QADD 4GAGH 4S2SA 3S7GA 3VGDA 5C0FB 2IBBA 3FO1A 3HPJB 4OLXL 3KYMB 2VABA 4LSRH 3WE6A 1MHHA 4AEFA 5GRUH 3BP5A 4FQ2L 4Z7WE 5I71C 4O9HL 1GGBL 2OI9B 3MJ8A 4M6NL 4P2OD 3T2QA 4HUKB 1QQDB 4JKPH 2X7LB 5D1ZB 3RNQB 2UZIL 5KSBF 2AJVH 1KELH 3LN9A 4ODVH 3W5NA 5DUBB 4UI2A 2B1AH 3QXDA 4KQ3L 1A02N 2F19L 4NQSB 4PRBB 2R2BB 1AC6A 1N8ZB 5BZWB 1WBZB 3QQ9C 4C4KO 4G7YH 4LP4A 4PJGA 3DX6A 2R0ZH 4F33A 1FIEA 4PJEA 1JTTA 2ZCLL 3X3GH 4XWGL 4F2MA 5FYJD 5AZ2H 3WDHA 2Z92B 4ONHA 1B3JA 3MACH 3UPAA 3X12B 1F4WL 3LPGA 1CBVH 2D03L 3BH9B 3FL7A 3ARTA 3NABH 4P2YA 1VACB 4UT6L 1U2HA 4X7DC 4OD1L 1P4LB 2Q20A 1J1XH 4WNQB 3RUGB 1J7VR 2A6DB 4OGAC 2AEQL 1P1ZA 4LCIL 4NOBA 1FYTE 4XPHL 1K8IB 1QSED 5CEZH 2NY0B 3V6FA 5F21B 3ZYJA 2X44D 3EDDA 1ZT7A 3CMOL 3TV3H 3MZGB 2CDGB 4U1MA 3BWAB 4EDXB 4NKIH 1FAIH 2J8UE 4KHTL 1YNKH 4FABH 4U6HB 4Y5YC 2AV1B 4JFEA 4MZ2A 3CFKB 3SCMB 2O61B 1MRCH 2VR9A 3I6GB 1FO0L 3CC5B 1ZHNA 1J0KA 4L9DA 1IAIH 5I1GL 3ILPB 3KPPA 5F9JA 3CJJA 4YPGB 4NBXB 4LOUC 5IMLB 2G60H 1FNLA 5E94B 4NO3A 2DIBA 3GHBL 4PJHF 5EO9B 3P4NA 3RWDB 1NEZA 1AGEB 1ADQA 1I7UB 4EQ3A 5I76B 5E2UH 5E99H 5AYUH 3E8UH 1OGAE 1UH3A 3HUJA 5T1DL 1K5NB 5DR5L 3FFCD 3IAPA 3S96B 5TDPB 3TVMC 3SDXF 5CJ5A 4LSQL 5I1DA 4ZO8A 1IMHC 4WDIA 4DTGL 3O2DA 1PSKL 4M7JH 2BFVL 5ESAA 2V7NA 5I8CA 2G75B 4AH2B 5DVOA 5AYQA 5FECB 5L9DL 2YD6A 4YDIH 1ED3A 4Y5XC 2AABH 3MLWH 1FSKB 3NCYS 5HTSA 5F93C 2FJHA 4NP4L 3EFFB 1K2DA 2EDEA 5DQDL 5ICZA 4KMTH 3VWJB 1A6AA 1T0NB 2BNQA 1MHPH 3K2UL 1NMAL 4NNPH 1S7UB 2GAZA 4PGEA 1N2RB 2VDOH 2DQHH 2BVQB 3OBAA 4WI8A 4F7CA 2DMCA 1NPUA 5EZOL 1QLFB 4G8EA 4Q9CA 5DUPH 1TETH 2VNCA 2RHEA 4J7RA 1XF4A 5TFSH 3P4LA 2E6PA 4I5BA 1JPTL 4ZODA 3C5ZD 1IVLA 2IBZX 4D3CL 5KS9E 2FX9L 2HH0H 2IANA 4X6CA 3DURB 1I3VA 4LAQH 4JFQA 2V2WA 1HILB 1L7TL 2HVJB 4PJ9D 1UZ8A 4HFUL 4Z7WF 2J4WL 1IC5L 1CWVA 3KPNB 4RA0C 3B8SA 4Z7VB 3SGEI 3IKCA 2CRZA 4DZ8B 1HWGB 4KTDH 1UM6L 3CSPA 1XF3A 1JZ4A 5IFAL 5GGVY 5CFHA 2A9MH 3T0DA 1MIEL 3GSNH 2E7MA 2Z8WC 1IJ9A 3PXHA 4RWYL 5CEYB 4MA3B 2YSSA 4APQD 5F1NB 4F58L 3MRRB 4P46D 4J3OC 1IEHA 4UTAH 4GXVL 1WZKA 2P7TA 2GUOA 4F9LA 1B4JL 4JRXE 5IIEA 5CAYB 3ARBC 3V2AR 2CGRL 5E8PA 3SOBH 1S78C 1PEWA 1YPZE 1A7NL 1VKXB 2DOCA 1HKLH 1A0QL 1CICB 3L3OB 2Z0BA 4KTEH 1SYSB 4ZPTB 5IHUH 5FGCE 1W72H 3I9GH 2YD2A 3KYOA 3O9WC 4JQIH 4RRPG 3BQUA 1HHHA 3QDMA 3AS1A 4IDJL 5GGQL 1SBSL 1BQHA 1P7QB 2FLBT 2J8UF 4M5ZL 3SJVE 1F3JA 3HI5H 3HC4L 4FQJL 3DMMC 2WBJC 1S7VA 2QQLL 1MIML 5CBAA 1DQTA 3ECBA 4HSQA 3D9AL 1D6VL 3H3KA 3ULVL 3QDJD 3KLHD 1GIGL 2RBLA 4JQXC 3S9DB 5KZCD 3I85A 1R5VB 3DVGA 3QUKA 1VEPA 3DETD 1EEQA 5LQBL 2JB6B 1KXTB 2ICEA 1BZ9B 3D5OF 1EAJA 4DFIA 4DQOL 3K74B 1OAYH 4HKXA 1E4WL 2FO1A 3ULVC 4I0KA 1A1MA 2WUCL 4JFXA 3UC0H 3EOBA 1NUDA 2QSTA 3ZKMD 3RTQB 4YFLI 2X4SA 4J6RL 3W11C 3BP4B 3QIBB 3ALWA 4MQ7A 5HGAA 1M6OB 3ZL4H 1IZJA 1NUFA 1BVLB 1U8NB 3C6LB 4MJ2A 3UZVB 2DYPA 1TJGL 1TNMA 3QNXB 5FHAL 4L8CA 4MJIA 5CCKH 1LK2A 1U3YA 3VJ6A 4DGYH 1MCKA 4N0CC 1K4CB 2EE6A 2GK0A 4ZPVA 3QUMA 4W6XB 5CEXB 2Z35B 5D6DA 1JWSB 4I18A 2W0KA 1HHKA 1AKJA 1A9BB 4JFOB 4Y0GA 5E8OB 5CJXA 4GMSL 3QUXD 2AERT 4PD4J 5CJQH 5A2JH 3M45A 1MWAH 2IF7A 4YFDB 2XKNB 5H2BA 2VLRD 1KCUH 4NUGH 1BFVH 4U0RB 5I17A 3EYQC 1QTYT 1F3DH 3G9AB 3WFDH 4RAVB 4N0UA 2XNAB 5FYKU 1K8DB 3VFRB 4D0CA 4FMFA 3BGFB 5KS9F 3RU8H 3T08A 3MV8E 4P49A 4LPVA 2AJYL 2ADIB 2LVEA 2Y36H 2VXQL 3E6HB 5JW4M 3HC0A 4JZNA 2FGZA 1RIVL 4N0RA 4QY8B 3WXWH 3VXME 3U0TB 1WWAX 2EZ0D 4O58H 1QOKA 5DWUH 2W0LA 4HC1H 2IGFL 4KUCF 1ORSA 5INCB 4OBSA 1Q94A 5I15H 1G7PA 4Y8DC 2ICES 1GOGA 3LKPB 4OFYD 4M6OL 3O2VH 4CL7A 3HI1B 1A1NA 2CKBB 3HG1B 4M1DL 5TE4H 4R7NA 3AFLA 2P5EB 2VZTA 1KB9J 3LKOA 2EDFA 2DQGH 1UG9A 2YK1L 3QIUA 4D9LH 3SDDA 4MA8L 1SEBB 2EYSA 4UNUA 1Q72L 3MFFB 5MHSD 3MBEA 1GZQB 2A73A 3PJSA 1BF8A 3AREA 2VC2H 1DLHA 3H0TA 5C0CA 3OG6B 2GY7B 3TWCH 5E1AA 1YPZF 1UJ3A 3WHE0 5C8JA 1RJLA 3NCMA 5FYKD 4LKCA 3CFDB 1T3FA 1HCVA 1WC7B 2VN4A 4MVBC 4XCYB 4Y4KA 4KU1A 1P4IH 1KJVB 3I2CL 3CVHB 3OKDB 4L9LB 4KKLD 1S7TA 4EI6A 1HHJB 5CIPA 2F53A 2VL5A 4NRZA 3I50L 4P5TC 1KIQA 1F90L 3RA7H 5CEZD 1LK3H 4UOW1 2VXUL 5I1JH 4TVPE 3UDWC 2VZ1A 1J1OL 4EVNA 5JXEA 3MX0A 1W0YT 4UT9L 2OQJA 3VRLE 4XVSH 5D7JD 1PKQE 4EI5C 3H9SD 2Q1EA 1FPTH 2BRRH 4PRPE 3U9UB 1KB5B 3RVXC 4J4PA 5GS3A 3RJQB 5DXWA 3S97C 5LVEA 5A2IH 3LKQA 3JUYA 4JY6A 1MI5B 5C09A 4OD3H 4OF0A 5F1KC 2YPLB 4LLYB 3PDDA 4MHHI 4U1SA 4NFCA 5D7SH 3SKNB 5EO1A 3D2UB 1LP9E 3IF1B 3X14A 1WFTA 4YDVB 4YHLH 1R3KA 2VLJD 4Y19D 5IMMB 4ORGA 1W8OA 4XPFH 3NIDE 2HJFA 4YAQB 5KW9L 1BF2A 5ALCH 1VFOA 4HIIA 1PFCA 2HMID 4NN5C 1U8OB 5HVHC 1I3GH 4R0LC 4YDJA 2XTJE 3I3BA 1OAXH 1YDPB 2IQ9H 2A9NH 2BVYA 1JI2A 2BNRD 2CK0L 3MOBL 5CWSB 3VGEA 4X8JB 5J12C 3BHBB 5KANI 1XGQB 4NO0B 4XZUA 2DQCL 3ZKXC 3EBAA 3QHZH 5ISZE 1F02I 3N1QC 4X6FB 2GJZA 2DS4A 5AUMA 3FTGA 3S8WA 3GMMB 4RWHA 4UQ2B 4LFHD 5FO8B 2CUMA 2OSLB 5F7EL 3U0WH 3TA3D 2DD8H 2YPKA 4H0HB 4Y16D 4EDWH 1S9XA 3WS3B 3ZKNC 1YUHB 4JVUA 4YHKL 2LU4A 5HHMD 3QR2A 5FV2A 4M6AA 2I9LA 1H15A 4OFDA 3QIWA 5IT2H 4X4ME 3U4BL 3OGOE 1CDCA 1CL7L 1ZEAL 3HE7D 4I77H 3D25A 3DTXA 3TBWA 2HJLB 2UZXB 2YA1A 3WNNA 3NN8A 1GZPB 5I1AA 1R0AH 3O11B 4CADA 3F65A 1RU9L 4B7IA 1DBJH 1H3WM 5EU6A 3TYGH 5I8KH 3SBWC 3WEXB 1KIRB 2K9UA 3UBXG 1YNTA 2AQ3A 4PBWD 5DJCA 1NMBH 3FQWA 2VQTA 1TZGH 5L2KD 3P0GB 1A64A 1WZ1L 1FO0A 1JGEB 5IV2A 2QL1A 3E3QE 4U1KB 5JPMA 5DRXA 3T1WA 3V9FA 2FO4A 3I3DA 5IUSA 4IOSD 3HB3D 2PN5A 2AK1H 1SMOA 3L3KA 4LDOB 4A6YA 1NGXA 5HDOA 5A2FA 4HF5L 4NRXB 4EIZC 2RQ8A 1X6LA 3IETB 2AI0L 2NTFB 3I02A 1YZZA 3NOIA 1D3CA 1A3RL 8FABA 5D1QA 3P40A 1PZ5B 1OD7A 5C0AA 4TTGA 1AI1L 2FGWH 1F4XH 1MVUB 2XN9E 1MHEA 4LCWD 4AEIL 3V6OA 4WJ5B 1AGFA 5IBLD 4G8GE 3V5HA 2R23B 1B0GB 5E0QA 5JQ6H 4QRTA 3CFBB 2W91A 3LQZA 4HDIB 3VD7A 5SX4I 5AZEL 4UBDD 3RKPA 1EH9A 1AY1H 3MRKA 4LQFH 5DHVH 4JPWH 3VRLF 1AXTL 4KK8C 3O3DB 3QO0A 1A5FL 1B0RB 4F7PB 1J8HE 1CFSA 3C60B 4M48H 3BH8B 1I1FB 1OW0C 5F7LB 4F80A 3SKJL 4XBEL 1HHGB 1SEQH 4UTBL 4XWOC 3VFUB 3P30H 3PG2A 3FN9A 1LP9F 2E9BA 5J3HC 4R90L 1BIIA 4NPYA 2EIDA 4XPBH 3IVKA 4QCIA 3GJFH 1DBML 1FL3A 1MREL 3NIDF 1T7WA 5C3LD 3LS4H 3SDCA 2D31B 1FNSH 2A74B 4E0RA 2VDNL 1CR9L 4NQVB 1I1CA 3LIZH 3D3VD 5IB4A 4XNQA 1YMMA 2F54E 4KFZC 3PL6B 2E6QA 1C12A 5SV3A 3VDBA 2NX5E 4J3VA 5JW5B 4U6YA 5I73B 1PG7H 4Y4HD 1BQLH 1IFHH 5I9QB 2PYFA 4XT1C 4G6KL 1EUUA 1CQYA 3PWUB 5E56A 4CW1B 1U8IB 4P2OB 5HY9B 3PP4H 1T6VN 4ETQB 1GPOH 4LARH 1O7SA 4XH2B 4LVHB 3VXRD 4O2FA 3DLQR 2P1YA 5GGVL 1YC7A 4NNYA 1R5WB 1RURH 1U95A 1Y6MR 2W0PA 1QUNA 4NQED 4HUUB 1BHGA 5D5MB 1B2WL 4ZYKB 3UXFA 1CVRA 3OPZH 5MEPA 5FO7A 5CJ8A 4RISH 3IAQA 3LKNA 3PWPE 5DGRA 3H9SE 5HJ3B 2QHRL 4L8DB 1HSAB 3M17A 3T2NH 3VCLB 1WQVT 3NFNB 1T03L 2R4RH 1BGXH 1LO4H 5IBUG 1IC7H 4QOKE 4UZGA 1QSEB 4OZFB 4HUVA 4K2UH 2GY5A 3I84A 3PGCA 4QXGL 3MA7A 4WU5A 5IOPA 4LRIC 1V7NH 4MYWB 5F3BB 4Y5YB 4S0SD 5DI8B 3RP1A 4YDKL 4MA1C 3MXVH 4JREB 2X4PA 3RPIB 4OFKA 2JIXD 3VFTA 1MCBA 4IOIB 4Y8AA 1AD0A 4YR6A 3W81A 5MENE 5GHWL 5JTWA 3GMNB 5IESH 1RD6A 2YS4A 4TUOB 4FQCL 2BVOA 1OP5H 4HHAB 4F8QA 2DLHA 5EUOB 4HS8H 1F8TL 3B6SA 2FECL 1O7VA 1S7QB 4F9PA 4K23H 1G6RA 2DLFL 4ODXB 4NUJB 4ZDHB 3T3PE 3D0VA 2FL5A 3NPSC 1XMWA 1L6ZA 5JORA 4XCCH 1KCSL 3FFCB 3B5GA 4HLJA 3DVNB 5HHPA 4PRNA 4JVWA 4YFLF 3WFEL 2OL3H 1DQLL 1UCBL 4NZUH 1GYAA 4X5WA 2ZG1A 4G8FB 3T0ED 5FDYA 4GRLA 2R0WL 2XRAL 4XP4H 3MMEB 3MV7D 2G2RA 4P5KA 2OZ4A 2ESVD 3AAZA 2LABA 2X70A 5DMKB 3B2VH 4ETYA 4ONGL 4XNZB 32C2A 3V4VH 1JF6A 2X2YA 3OJDB 4OI9A 4MJ4A 3VGGA 4JZJC 4FZEL 4JHWH 4NZTH 3QZWB 3F12A 1IKNA 4G6JH 4LLQA 1ZGLA 3AM8A 3QCUL 4HGMA 2JELH 4HCRL 3NACH 3Q2CA 1U2CA 4NCC1 4JDTL 4JFFA 1F00I 2VB5A 5CZVL 3C5ZB 5A1AA 3GUTA 1DQJB 4E42B 1R3JA 4WW1B 3PHOA 3IJHA 4ALAH 1DN0B 4F7TA 2ZP0T 3QT2A 4GW5A 4OZHB 1S9YB 4RMRA 2Y72A 4PJ9B 2Q76B 4AIXA 3C9NA 2YUXA 1IGML 4KI5D 5I1KL 5I1CL 1LO5A 3NFPA 1ERNA 3HAEH 3ESVF 3MXWH 3BDYL 4LCWE 2V2XB 1P2CA 2NYYD 1K6QH 2VLLA 4K8RH 4W70A 3MRLB 3HHRB 5JZ7C 4PP1C 5ILTL 3HPLA 4APQB 5L88L 1AFVL 3C6SA 4P46B 4JM2F 5C92A 5D9SB 2ZOKB 4RFNC 4XNUH 1ZWIA 2DWEB 5D7IF 1DSFH 1KTRL 3AS3A 4HWZB 2R4SL 5FCSH 5TDNA 1KPUB 5BW7A 5CLTA 1AQKL 1N0XH 3O81A 4LK4A 4FTVD 2OTWB 4PUBL 4QTHA 1M71A 5ADOL 2D3VA 4ZUUB 1BD2D 1KB5L 3G9VA 4CKVX 1S8DB 4FQXD 5GZND 4KUZL 3BZ4A 3QG7L 5I8EB 4HIEB 1ZVYA 3TPUA 2WP3O 4Z7UB 1RJCA 3QFJE 5GIRB 2WBJB 2H32A 4I2XB 4BUHA 3GSVA 4DN4L 3NH7H 1DCLA 3QDJB 1RK1A 2XOTA 1XGPB 5J1AA 5L6YL 1QZ1A 1QNZH 3DV4B 5KZCB 1N6UA 2JKXA 5T33H 5HGHA 3OGCB 1FG2B 5EU7E 4YNYA 2EDWA 1PQZA 3IXAA 4CMHC 1MLCB 4AENA 4LVOB 4K94H 5M95B 4PJBE 2FRGP 3T3PF 5IHZB 4KZDH 1INQB 2HT3D 5C0FA 3HPJA 4TVPH 5T5NF 2VAAB 3K8MA 3KYMA 3TBTB 3GKWL 4UT7L 3LEXB 5EOCH 4AMKH 4DGVH 2DM2A 5FHBH 1XF2B 1NCAL 4PJFB 4QXUL 3H8NA 1QQDA 1PX4A 2X7LA 5D1ZA 2QQQA 4HKJB 3RNQA 3ZMRA 3IDNB 3K4DA 3PNWB 2AJ3B 2LE9A 1J18A 4FQ1L 4NQSA 4O02L 4X80L 4EZMA 4PRBA 2R2BA 1N8ZA 5BZWA 2D0HA 1WBZA 4R8WH 1JTPA 3CLFH 1LILA 4OUUB 2BY1A 5FFLA 3IDMB 3O6FD 2BSSB 2Z92A 4FQIL 1UXWB 5FYLH 3QUXB 4TUJA 3X12A 5E00B 4CN6A 2ZUQC 3BH9A 2QEJA 2VLRB 3RIAK 4C55A 1VACA 1FNEA 1AD9B 1AO7D 1P4LA 3FAWA 4WNQA 5D6CB 5GGSB 3RUGA 3TN0A 3SKOB 2A6DA 4P2RE 2ZCKH 2ORBL 4JRYA 1MCLA 4F57L 1OQXA 5B4MC 1NLDH 1OAUH 2V9TA 4M02A 4M62H 2FB4L 2HRPH 5CLWA 5HD8C 2CDGA 3BWAA 4OBRA 1MCQA 1F6FB 4EDXA 4U6HA 5ECJE 3JWNC 5HI5D 5JHDD 2AV1A 1PZUB 3CFKA 3P9MB 2DQIL 3SCMA 3SGEH 4Q9RL 2O61A 3I6GA 1WEJH 4JFDD 3CC5A 1RAMA 3ILPA 3QEQD 3PXJA 3QPQC 4PJ5B 3MV9D 1VADB 2K1MA 4WY7L 2DDQH 1I4FB 3ILQC 4YPGA 5IMLA 4LSUL 5DRNB 1IEBB 2PO6C 3DOSA 5E94A 5C07E 5JIPA 1BM3L 3D87B 3ES6B 5EO9A 4WWKC 3D48R 4EBQL 1TDQA 4JY5H 3RWDA 1V5JA 3RY6C 3E2HC 4XVJL 1KIPB 1AGEA 1I7UA 4XP6L 5I76A 5ELIA 2GK2A 1FVEB 1TTGA 3MYJB 4RMTA 15C8L 2H9GB 1EMTL 4RFOH 4Z8FL 4GBXC 2KUTA 2Q6WB 1K5NA 3MLTB 4GXUN 3S96A 5TDPA 4FMKA 4G6AD 1OB1B 4UINL 1EEZB 4WCYH 1RIHL 4G43B 3R8QA 2W92A 1TZIB 2G75A 4AH2A 5FECA 4G5ZH 2OJZL 3R1GH 1V3LA 4DW2L 2E7HA 3IXTB 3EFFA 1LE9B 4HUXB 3VWJA 1T0NA 1XR9B 1BBDL 1MFEL 1U41A 1BPVA 4G9FE 1S7UA 2HFGH 3PWVB 5TDOB 1N2RA 4I3GA 1G7HB 2BVQA 1CE6B 1JJUA 5D7JB 1N6QH 3L3HB 4LIQE 2DKMA 3STZB 5F6IC 5E2VH 4E9LA 5C0JB 1NKOA 3CK0L 1MEXH 2D4FA 3KPTA 2X05A 2APFA 2XQBL 1BECA 3CXDL 1BVKB 4PJBF 1MCSA 1A6WH 1A7OH 4M7ZC 4U1HB 5EZLB 1CF8L 2VLJB 3DURA 5DD1L 3O45B 2HT4D 4LSPH 4U1JB 1W0VB 4KKAD 5JA8B 4ZD3L 2HVJA 3I6LE 4HJGB 3KPRE 3OB0H 1PX3A 3ARFD 3KPNA 3GEWB 1QBMH 2XZQL 1S5IH 3QHFH 2I07B 5FXCH 4Z7VA 1WIUA 5HVHB 1L9NA 1TNNA 2BJML 1MY5A 5K9OB 2O5YH 4KRNA 4NFDA 4PTUB 3HRPA 3GRWL 1BOYA 1FZKA 3RGVD 4K9EL 2BNRB 2QADC 4J3SA 4RQQB 1Q0XL 1G7MB 1EHNA 3DGCR 5EBWB 1JMXA 1KJMB 5CEYA 4MA3A 4FXLA 2KQMA 5F1NA 3MRRA 3O41B 4H20H 4KHXL 1U91B 5IQ7H 4RGND 4RGOL 4EUPH 1CVSC 2H26B 4BUGA 4HT1H 1U93B 5KOVC 1QFWM 3HMXL 3LMJH 3G5XB 1QSFD 4PJ7B 2BVUA 4K9EC 3TA3B 4PP2B 5M94B 1IGIL 1VKXA 3TNNB 1CICA 3KLAB 1FV1B 4P23D 3L3OA 5HHMB 2QSCL 1SYSA 1QYGL 4ZPTA 4POYA 1P9MC 3DVIA 1JI1A 2ADJB 4OGXH 5DUMH 3ARSA 1AE6H 2FJGB 3HE7B 4WTWA 2DBLL 3LPFA 2OMNA 2P8PB 1P7QA 5BS0D 4W6YB 3H9ZA 4JPKH 4LPYA 4XVTH 4YXKH 5F1SA 4WHCA 1GGCH 4BFIB 1HXMB 4OIIL 3EDEA 5HGGS 1DANT 4PGZA 4NWUH 1VA9A 4X7SH 1NCWH 3MTRA 3C08L 2PYEE 2J3SA 5C6WH 1IC4H 4TNWF 1F3RB 3TIEA 1WJ3A 1R5VA 1IGYB 3LRGA 1P5UA 2JB6A 3MLZH 2NY4D 3GMLB 1OARH 4OFVA 1IQDB 1OLZA 5L2KB 1BZ9A 3C8KB 3OZ9H 1ZE3C 3S4SB 1C5CL 3K1KC 1TITA 3MRJB 3GSNB 2EO1A 4K8RC 5F9OH 3REVB 1NMCC 1CLCA 4HKBB 4YZFE 3RTQA 2C3WA 1ZGLM 4MS8D 2CIKB 3QCTH 4Y4FC 3DVFA 1JHTB 2YHGA 3BP4A 3QIBA 3VWKB 1HHIA 2VE6B 1M6OA 4U3CA 3RVUC 4HWNA 2XKUA 4QF1B 4QTIH 4U0QB 2YUWA 4CVWA 1BVLA 2NTSP 1U8NA 3BP6B 4PD4K 3C6LA 5F7MC 3MLSH 1IBGH 2WUBL 4LSDA 1OAKH 3D69B 4GG6E 3QNXA 4J3UA 1K4CA 1OAZH 4OT1L 1OLLA 4YK4C 4KDTA 3NAAL 5IQ9B 4ZNEE 2Z35A 4P5MB 5CEXA 1JWSA 1W72B 1QA9B 1UENA 2WK2A 2NY6D 4MD4B 5HVGB 4JFOA 3THML 1LEIB 1A9BA 2DJSA 1EO8L 5E8OA 3TNMB 2FIRT 2XKNA 1I9EA 1EJ6A 2R0LH 4ODSL 4RAVA 2XNAA 2RIKA 1K8DA 1P84K 1MRDL 3MLRL 3VFRA 3AXLB 1T1YB 3L5IA 2ADIA 4LCUB 2VOTA 5HHQB 3E6HA 1ZLWH 4K94C 4FP8L 1C16B 4X9IA 4ENEC 3H9HB 1YEHL 4MX7B 4PJXB 4QY8A 4U6VL 3U0TA 4Z18A 1X5ZA 3D3VB 2P4AB 2V9RA 5INCA 4MMXC 1A3QA 3MRCB 4Q6IC 3HI1A 5T1LD 2CKBA 1I8KB 1KENL 2ZCHH 3HG1A 4H88H 4LU5H 1U3JA 4XMLH 2EECA 4JDVB 1NGQH 5TH2B 4NWTH 4GMTH 2XQYK 2ZSWB 1SEBA 1EEUA 3O8XD 3MFFA 4KY1L 5C0NC 1GZQA 1VEOA 2Z91B 3VXRB 4ZFGH 1WCQA 2JJUA 3OG4B 4NQDE 4XX1G 4HULB 4S1DC 3RI5F 1FQ9C 4NQEB 4TULL 3MLYL 4L5FL 5FYLD 3CFDA 5GS2H 5SWZE 1YEIH 1WC7A 1MWAB 4MWFB 2Q3AA 4XCYA 3D39E 4KVCL 3W2DH 1KJVA 3CVHA 4R26L 3OKDA 2XTJC 2X4RB 4L9LA 2NW3B 1HHJA 1OGTB 2OLDA 3GMRB 5TQ0L 1CD8A 1A14H 3D6GA 3TJHC 3ARWA 1AXIB 2YD8A 4OM1H 3BPOB 2YBRB 4K71C 2Y5EA 4R4NC 4ZTPH 4TPRH 1KB5A 4ZXBC 3OJVC 3CH8A 2HAZA 4ONFH 3PIQB 2X89D 3O4OB 1MI5A 4I9WD 3VU2A 3RVTD 4ZG1A 2EDYA 3VFVB 1SY6H 1G9NH 2YPLA 1L6XA 4OD2B 4LLYA 1FL6B 2D7TH 3SKNA 5E8NB 3D2UA 3QO1B 3BYYA 3IF1A 4YDVA 5H94B 1PLGL 3OAUH 3WNMA 5LGHL 3MR9B 2GW5A 3LS5L 5IMMA 4GO6B 4XPGL 5L7XH 1HQRB 4YAQA 4YZFF 2C3HA 5IB2B 2F9BT 1L7IH 2VUOA 3GNMH 3LV3B 5IP4A 1U8OA 2L0DA 5JHLL 4HQQH 5GS0H 1VGEH 1YDPA 3Q6GH 1T89C 1T1ZB 4OZGE 5CWSA 4S1SL 4GG6F 3BHBA 1XGQA 4X6BB 4NO0A 3SDAB 3ZKMC 1N4XL 1SM3L 2OXHA 4X6FA 3L7EB 3SE9H 1ZLSL 3GMMA 2NR6D 2Z8RA 4UQ2A 5FO8A 4XP1L 3UEZA 5I1EH 3CFJB 2C3XA 1F11A 1Y18B 4TNVF 1N5YL 2OSLA 3E3QC 3MRIB 4M7LL 3T0EB 2BX5A 2Y9RT 5BS0E 2FJFB 3WXVH 4PYHA 3MV7B 3WS3A 4X4YB 5T1KD 1YUHA 4O00A 2ESVB 5DJ2B 2NY5L 2VLKE 5SX5H 4GH7B 4YWGL 1JPSL 1T7XA 4GQPH 1DFBH 2WQRA 4LQ1A 4POZD 4IHOB 1V7MH 3V95A 3O3AB 1BAFH 3EDKA 5SWSE 4OIAA 4FXGB 2HJLA 4MXQD 5CD3B 1GZPA 2GFBB 4UV7L 3SDXB 4PY8J 3O11A 4WFGE 2NY5C 3WFHB 3IFNL 4J23A 2V17L 4M8QB 3A6CH 4U3XA 3WEXA 1KIRA 2OJEB 5D71L 3JV6B 1WFOA 4X5XB 3RVVD 2X9WA 1UB6B 2NY7L 4OCSH 3O6LL 4MCYB 2R9HC 1B6UA 2ZKHL 3BPNC 4ODVL 1TJIH 4XNYH 3DRTB 3HE6D 4HJJL 1JGEA 1I1AD 2DICA 3BPLB 4U1KA 1OCWH 3RWIB 3TH4T 2DQEH 3C5JB 1K3ZA 4N90D 4HLZG 4D9QD 3NTCH 1AP2B 3BEWB 4R6UA 1MCOL 5IVXE 1U8PB 1ZK9A 2E9JA 3EKCA 5FYKL 5AZ2L 2V6HA 4NRXA 3EFDH 1NCBH 1QLRB 3IETA 2NTFA 4M03A 5MERB 2I60H 4PV8B 3CZFB 4C83B 3T04D 2AEIT 1PZ5A 2ILLA 3IDUA 3WFCH 1WZLA 1IM9B 1MVUA 3WN5C 1Q9LB 3GSXB 4LSSH 4DAGH 1ZXQA 4FFVC 4WJ5A 4N68A 3WDJA 5A43C 2FBJL 3EOTH 2XFXB 4FFZL 1B0GA 2E7LC 5D7LA 1CIUA 2OMBA 3CFBA 5T3ZH 4HDIA 3UROR 3NGBB 4FTVB 4S10A 3MLXH 4I3SL 1ZKAA 3CSBA 4XXDB 3G6AB 3O3DA 3RDTD 1BD2B 1B0RA 1YEFL 5CHNB 5TPWH 3C60A 4F7PA 3SE3A 3SE8H 2VSCA 4KKLC 3RL1B 3BH8A 1R6VA 1I1FA 2EIZB 1FRGH 2W9LA 1JGLL 3SQOH 3MRNB 3ZHLA 1HHGA 3BE1H 1RUML 3QFDB 3VFUA 1F2QA 4RAHA 1I8MB 1WFUA 3GI8H 4JM2D 5GS1C 3BKML 3M07A 1PG7X 2C1PB 1IGCH 1JZ2A 1RZ7H 5C08E 4DN3L 2D31A 2A74A 2D7QA 4NQVA 3ARUA 2O5ZL 2FX8H 4CMHB 1EXUB 3PL6A 4HH9B 4PJGE 4GAJH 1EZVX 1CXEA 4Z0BH 3KAAA 4OZGF 1YEGH 4PJEE 5JW5A 3P73B 4YQXH 2VQUA 3OKEB 4XP5H 5JW4N 3PHQB 2DYPD 3PWUA 4M00A 4CW1A 1U8IA 4P2OA 5HY9A 4LIQH 2J8HA 4ETQA 4M4RA 3QI9D 3GRWA 4XH2A 2LTQB 4YUEL 3MCG1 4MQTB 2WLYA 1R5WA 4XBPB 3VG0L 1ND0A 5IHBA 4HUUA 4JG0L 2DKUA 2Q7YB 3V5DB 3ZHDA 5DHVB 4ZYKA 1I9JL 4TSBH 1UACL 1BZ7B 3O6FB 1X5KA 4JFEE 5HJ3A 3HMXA 4L8DA 1HSAA 1FFOB 4W4OA 2IPKB 4MNHB 1LGVA 4ZFOL 3QQNA 4Q0XL 4Y16C 3VCLA 1D6EB 1AO7B 3D18B 3NFNA 1NCCL 4ERSH 1HZHH 1A47A 2Z4QB 5FF6B 3R0MA 3DX8B 1CXKA 4HWEL 1QSEA 4OZFA 3GJFB 4XC1H 1N59B 2C26A 1OPGL 4H8WL 5K9QG 5KJRL 1C08B 1JHKH 2OR9H 1T6WA 2QQNL 1N5AB 4ESKA 5F3BA 1N64L 1ZMYA 5K9JL 5DI8A 4KJWC 1A7PH 5FB8B 5JHDB 3MOAL 4KTDL 3HUJE 1RULH 3MFGB 3QCVL 3RPIA 5F97E 1MCPH 2YEZB 3LD8B 5IF0B 1NCDH 2A9ML 2NY3C 4IOIA 2PETA 4JFDB 3WSQL 3UMTA 4K3EH 3GSNL 3IGAB 3GMNA 1CFVH 4O4YH 4QHKI 3QEQB 4CU8A 3MV9B 4TUOA 3LDBC 2R2HB 2HFFB 3QIUD 1XIWC 4HHAA 2JJVA 5IVXF 3WO4B 1S7SA 5EUOA 1T2QL 5D70H 2QQKH 3VD9A 1S7QA 1NAKL 2JJWA 4ODXA 4NUJA 4ZDHA 1M7IB 3WUWB 3JWDH 1KLUB 2BNQE 4H5SB 3N1MC 4TRPH 2NZ9C 5GS2D 2EXYD 3RFZC 3FFCA 1WLHA 4XAWL 3DVNA 1EDQA 4OFIA 3SO3B 5LKNA 1AGDB 4Y5VB 2VH5H 5JDJA 2F53D 4QRPD 4F15B 4AQOA 1WWCA 4G8FA 4KH2A 5E2TH 5EU3B 1CDBA 3HI5L 1CLYL 1MFAL 1MCEA 3MMEA 2DQTL 1LO2H 3DO7B 3DECA 5FGBC 1QHPA 2HTLD 4PJDE 5KVEL 4DKFL 2IANE 3CGTA 4X6CE 5DMKA 5E9DD 1H3XA 3OJDA 2GJ6D 1UM4L 3NCJH 4NJ9L 3EYUL 1G9NC 1TXKA 3DYMA 4CNIB 3N06B 2J7LA 2DF3A 1J10A 4OCRH 3JXAA 1QBBA 2R56H 3GSUB 5HXMA 3TO4C 4B41A 4BZYA 1F5WA 5DD0L 3PHSA 1U3HC 3C5ZA 5CZKA 1DQJA 2D0FA 4WW1A 1JBJA 3AB0B 3MUZ1 5B38B 3HZVB 3RX7A 3DXAD 4PJEF 1DN0A 2PCPB 3HFML 2X42A 4OZHA 1VFBB 1S9YA 3NA9H 4PJ9A 1EFXD 2Q76A 3U1SH 5GS0D 1HYRC 5F9AC 3ARFB 2NY1C 3OSKA 1RJZB 3PV6B 1ZANH 4LLAA 1MCCA 4G6ML 4K3GA 1KULA 2PR4L 2DMKA 4XAKD 5DVLA 2V2XA 3RGVB 4CU6A 1G0XA 5MP6L 1J8KA 4Y4HC 3MRLA 1TQBB 5C9JB 3QDME 4KGJA 4APQA 5EU7C 2BY2A 1CGXA 5CJQL 4XCEB 1IL1B 2VDML 4P46A 1R3IL 4RGNB 1MJ7H 5D9SA 2ZOKA 1E4KA 4K3DH 1GC1H 2DWEA 4O5LH 1WFNA 1XEDA 1JNNH 4DGIL 4HWZA 3OB0K 3UJJH 1KYOK 5C0BD 2VDRH 1KPUA 3UAJC 4U1LB 3U0PB 2VZOA 5H37H 1X44A 4LCCB 1IGJB 2OTWA 1D9KD 1NAMH 3HR5A 2VLME 4G8IB 3EOYG 4ZUUA 4LHJB 1TQCB 1F2XK 2BHYA 2WWMD 4JAMB 1R24B 1S8DA 5T3XE 3BN9D 5DK2B 4QXTB 5I8EA 4OKDA 2VR4A 2DTML 4HEME 4HIEA 5EU6D 4Z7UA 3LOWA 1IGFH 4MXWH 2G5BB 5GIRA 3HUJF 1EERB 5I15L 4HJ0D 2A6IB 4I2XA 4LFHG 5CILL 2A38A 4P4KD 2IFGA 4GAYB 5KVDH 1F4AA 4UIKL 3V0AC 2NPLX 3HS0B 3IAGC 3QDJA 1PVHA 1XGPA 3DV4A 2WANA 3HNTH 1FG2A 3OGCA 1RIUL 3HAEB 5D1XD 4Y2DD 3WIHL 1MLCA 2NY4B 2C4XA 4MJIE 4YIQB 3HI6L 1B88A 4YBQC 2OXGA 2V7HB 4U6TA 1CGSL 2HKHH 5IHZA 1INQA 2QR0B 3U4EB 2VAAA 1NCTA 3TBTA 1FE8H 3LEXA 4M9OA 1TPXC 1XF2A 3BP7B 4PJFA 4UOW0 2ZUVA 4FHBD 1MF2H 5JXAH 4HKJA 4YXLH 1BJ1H 1TTFA 1NANI 5IWLA 3IDNA 3PNWA 2EIBA 2AJ3A 5JLZB 3VXMB 3BGAA 2EH8H 4N0UE 4OLEA 5T3ZD 1LDPH 3MODH 4OQTA 2AJSH 1V3MA 3UYRH 4IOFD 5LWYH 3GBNH 4XMKH 2IAMB 3DHJA 4PJDF 1LD9B 1FJ1B 1MCDA 3S4SG 4X6CF 4OUUA 3IDMA 5EWIL 1U8LB 3LQAH 2D7NA 2BSSA 4C4KT 1UXWA 5DRZB 1YEEL 3QUXA 3OMZA 2BC4B 3LEVL 5E00A 4WHDA 2AXJA 4JPIB 4EN3D 2VLRA 1NGPL 1P6AB 2O5XL 4WV1C 1AD9A 5GRXG 1RUQH 4S1QL 5D6CA 5GGSA 3SKOA 5E6YA 1J88A 1A4JB 5IBTH 1FZMB 1RQ5A 3C2SA 4U7KA 3MCKB 3UYOD 3OXSB 3OHXB 3ULSB 3EW3B 2L7UA 4XCNB 3SO5A 1JVKA 4IBLT 1ZTXH 2XG5A 5CP3A 3KHQA 3EZ8A 1IRAY 1ZA3B 5GRVL 1TVDA 3P9MA 3FT3B 2RCSH 2B0SH 5C0CE 1OSZB 1C5BL 4NHCH 1NBQA 1YEJL 3BD3A 1VADA 1I4FA 2JJTA 1NDGB 1MOEA 4JPVL 4HIJB 1LMKA 5DRNA 4BFBD 5T1LB 1IEBA 3VGHA 4PJ8D 3ES6A 1LO3H 1FNFA 3LY6A 2E27H 3GSOB 3TFKD 1KIPA 3K4AA 4JGMA 1FVEA 3S37L 3MYJA 3O8XB 3GIZL 2H9GA 4R2GC 3UJTL 1WAAA 4LEXH 2Q6WA 4ZOAA 3MLTA 4KKCD 1VPOL 2Q87A 3L5JA 1ZLWK 1QFWI 3H42L 1OB1A 1EEZA 5IT2L 4G43A 4XCFH 3HNSL 1TZIA 1G9MH 2LV4A 4OCXL 3UJIL 5C09E 1XR8B 5HI3D 4NGHH 1RUPH 2B1HL 2F58L 3IXTA 3WNLA 5JDSB 1LWRA 3IDYC 4PV9B 1LE9A 4PJIB 3UTPD 4HUXA 1B0WA 3KPOB 1XR9A 4WI6A 1V3JA 2VDPH 5IGXL 2H8PB 3BN3B 3PWVA 5TDOA 1FDLH 1W8NA 3A6OA 3STLB 3EDJA 3KJ6H 3CXHK 1JL8A 4F37K 1G7HA 1E27B 1CE6A 5D7JA 1RUKL 3L3HA 4WTXA 3VD4A 2BDNL 4QO1A 1RFDH 3STZA 4LVNC 3RBGA 3QJHB 3PUCA 1A1OB 3O6KL 4GW1B 1IQWH 5GQBA 4PGCB 4FQXC 12E8L 5IW1A 1BMGA 5C0JA 3UBXI 4LF3A 5CGTA 1TLKA 1MJ8L 1RZIB 1NBYB 4KWUA 2HRLA 1XGRB 1BVKA 5D72L 5EZLA 4U1HA 2DKSA 2W38A 4I0PC 2VLJA 3SKMB 3O45A 4U1JA 4XPTL 5F1OB 4HJGA 2IPUK 4Z7QE 2IC2A 1RY7B 3P77B 2I07A 3O2WH 4I3RH 3S88L 5I1LB 4ODUB 4XHJD 5K9OA 4PTUA 3KR3L 2BNRA 1E4XH 2FEDD 4K7FB 4RQQA 4PLNC 1G7MA 5EBWA 1KJMA 4CJ1A 1DVFC 1UWGH 1FBIH 3O41A 1ZGLP 1MVFA 3VE0B 5EB9A 5FUOL 1U91A 5J11C 4HBCH 2H26A 4OLVH 4D0DB 5F7KC 1U93A 2F74B 2VDQL 2LQRA 3G5XA 4PJ7A 3EO1B 3TA3A 4PP2A 1KEML 5B22A 4IRJD 5J8OA 3TNNA 5CZXC 5BO1H 1JV5B 3CU7A 5EU6E 5JW4R 5T1KB 3KLAA 1FV1A 2X09A 2VXSL 1JFQL 5LAXB 4XP9H 3FZUC 1GAFH 4FFYH 4UILH 1FP5A 2ADJA 3S35H 1GGIH 2FJGA 3HE7A 4GS7B 3IDXL 4RMVA 4BQCA 2P8PA 5DQ9B 2N7BA 3GBMH 4K7PY 5D93B 4BFIA 3CFCH 1HXMA 1Q0YL 5LCVL 4G8GB 2NQCA 4YH6A 3ORJA 4KGLA 4K3JL 5HYEA 2BSTB 1NSNH 4FFWC 3F7YB 5L8KB 3CDGB 1IGYA 4L4TD 4KJPC 3K8LA 2DI8A 3GMLA 5C0AE 1H5BB 4HEPG 1IQDA 1A8JH 5EZIL 5L2KA 3C8KA 4G6FD 4ELMB 4JM4L 2WWKO 3V6OE 5SX5K 3S4SA 3HE6B 4JKMA 3TESA 4OSUH 1I1AB 3DSFH 3MRJA 3GSNA 5I6XC 3C8HA 5TF1L 1KBGH 3NZHH 5KVGL 1P4BH 5F3HB 1ODAA 3REVA 2R69L 2EDKA 1PAMA 4HKBA 3VH8G 2CIKA 5E4EC 3TBSB 1Q9KB 1JHTA 5F8QC 4WFEE 3VWKA 3VFPB 4GKZB 4EUPB 2VE6A 2MKLC 4QF1A 4AYFA 2P5WD 1GC1C 4ODTH 4H26B 3ETBF 2EICA 4JJ5B 2OK0L 3BP6A 1HE7A 2DN7A 1WT5C 1KACB 3D69A 1MFCH 3B9EA 3GB7B 2HWZH 3FQRB 2ADFL 5IQ9A 4P5MA 1W72A 3FMGL 1QA9A 1KN2H 3BUTA 4MD4A 1LEIA 2CLVB 3D85D 5IEKB 3LB6D 3TNMA 2MPAL 4AL8L 2VXVL 3MNZB 1V7NL 3P0VL 3TZVD 4D94A 3DUUB 4Z76B 3P3YA 4BZ1H 2PXYC 3RDTB 3TIDB 1YMME 5CMAB 1BBJB 2V5RA 4JO1H 3R06B 1BQSA 3AY4A 4WUUB 3T77B 3MUGB 2ADGB 1J0YA 4ONOA 1U6AL 4ZOBA 4BM7A 4YEEA 2BVPB 4BH7B 3K81A 3C2AH 3AROA 4ODHH 2VQ1B 4HK3J 4BZ2H 3AXLA 3MBXL 1T1YA 2DL2A 1CN4A 4DKEH 2UY7A 3RKDC 3ULUE 1K85A 4JM2B 3CH1B 4LCUA 4P2QD 4YHZL 5HHQA 1JGVL 4O51B 1UA6H 1C16A 1HNGA 2I25N 3H9HA 5D7IB 3W9DB 2YOCA 4MX7A 4PJXA 4PBVC 1RMFH 2X4NB 3V0WL 1ACYL 2E5EA 3CMGA 3D3VA 4GRWE 2YMXH 1I85A 3WUZA 3NZ8B 3E1F1 3GI9L 1QRNE 3PQYD 3MRCA 4N0YH 1CL7I 4GUPB 5L2JB 1A22B 2XXCB 3HA0A 1IT9L 1XT5A 1I8KA 1MRFL 4HIHB 4WO4D 3RQ3A 4MJ5B 5TQ2H 1MQKH 4DVRL 3VGFA 5FOBB 3ZYIA 5DHYB 4L8SB 4L29B 3KNBB 5TH2A 3B2UC 4DZBB 3VXTB 2ZSWA 2NXZC 4TSAL 4Q9QL 3UYPA 3QI9B 4KKBC 1IC1A 2Z91A 4HZLB 3VXRA 4PS4L 4LNRB 2W0FB 1MFDL 4OLUL 1G7LB 5JW3H 2DLGA 3LQAC 4NQEA 3LQMA 1DBAH 2P48B 4NM4L 2VDKH 3H3PH 5HYSG 4IRSB 1MWAA 4MWFA 1OTUC 4PRDB 3KDMB 3MV01 5JOEA 3UTSD 2VN7A 1J11A 2NW2B 2OX5A 2X4RA 2NW3A 3L5XH 1OGTA 4RSVA 4W4NA 5INDB 2JF1A 3GMRA 5HYQB 2PTVA 2DQUH 4S1RL 1INDH 4JY4B 4PFEA 4P23C 2I5YH 2W9EL 1QACA 2YBRA 1Z9MA 3FJTA 4WW2B 1ONQB 2X1WL 2IWGA 1Z9SA 5HHXH 1HNFA 4JHAL 3PIQA 5TE6H 4QWWD 3EGSB 5K9KB 4HC1A 2J5LC 5GZOD 1I8IB 3VFVA 3GSQB 1F97A 4OD2A 5ALBH 1FL6A 2R0KL 4OCWH 4Z7OE 5E8NA 3QO1A 3S36L 4PRHD 5E2WH 1A6VL 1TCMA 4H0IA 5H94A 3U9PL 5B8CB 2W9DH 5IJVB 4Z0XB 3MR9A 1HQRA 3RZCD 5IB2A 5GRZA 1XIWB 2B2XL 3LV3A 3G6DL 4NJAH 1X5FA 1RVFH 4OLWL 2SEBB 2MCPL 2XZCH 4ZS6D 5F70A 5T3XH 1G84A 1P53A 1FORH 1T1ZA 4R97B 2FIKB 4JN1L 3ARDC 6FABL 4X6BA 5TE7H 1S9VB 1DEDA 3SDAA 1DE4B 1G9MC 4PB9H 4JFZH 1KN4H 4NO2B 1U0QA 3L7EA 2LAAA 4HPYH 2J6EH 5IFHL 1QEWB 4QRPB 3CFJA 1Y18A 3MJ9H 3MRIA 3RI5K 3T0EA 3P11H 4NC2B