2F55A

Two hepatitis c virus ns3 helicase domains complexed with the same strand of dna
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
435
structure length
432
Chain Sequence
PPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGGSITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEIGLSNNGEIPFYGKAIPIEAIKGGRHLIFCHSKKKCDELAAKLTGLGLNAVAYYRGLDVSVIPPIGDVVVVATDALFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRSGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVILTHPITKYIMACMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biological identification of residues on the surface of NS3 helicase required for optimal replication of the hepatitis C virus
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/dna
molecule keywords 5'-D(P*(DU)P*(DU)P*(DU)P*(DU)P*(DU)P*(DU)P*(DU)P*(DU)P*(DU)P
total genus 113
structure length 432
sequence length 435
chains with identical sequence B, C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 2f55A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2f55A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2f55A01
3T1OA 5LB4A 4YC7A 3IGFA 4IOKA 5BN5A 5A0FA 1KZGB 4L9WA 1G8PA 2NMVA 4DJTA 3NBYC 3CIOA 5FPHA 3SFVA 2PCLA 3BC1A 4FMDB 2BM1A 4NYIR 4PZLA 3W8RA 1AJEA 2R6CA 4WA7A 1AS2A 4IDOA 2FEOA 3X2SA 3BB4A 3ZZUA 3N2IA 2QPAA 1XTSA 4LJ7A 4B44A 2GF0A 2Q6TA 3IQXA 4HZUB 5CLQA 3L0SA 1U9IC 1JR6A 5LBIA 2DFTA 2Z4SA 2NZJA 2OBMA 2EYQA 3DDCA 1G1MA 2KE5A 5JEDA 1SVKA 1E2QA 2B7BA 2NO0A 4YLGA 4ZI3A 3QOFA 4TYWA 2ZE8A 2X1VA 5KPDA 2IXGA 4EFNA 5FPSA 2DFNA 2W00A 2UKDA 2WSSD 1AZTA 3SYLA 5BYJA 1NNEA 3L2OB 1K5DA 2ZM5A 3QSYA 2D7CA 2FMXA 4URUR 3MGCA 4M1YA 4Q4HB 4A2PA 4RJLA 2YHSA 5L3SA 3QPVA 5FPKA 1YZUA 1NSFA 3SDZA 2YNMA 1MRNA 1HUQA 4K46A 3PEVA 2GRJA 3L8ZA 4UXJA 3W3AA 1ZM7A 2WSMA 3REFA 2Z43A 3U6KA 1G5PA 3VNUA 2GBLA 4PAQA 3B1VA 2GHIA 4A92A 5CYOA 1DVRA 2Z0MA 4US1R 2QM7A 1CS4C 2H92A 4URWR 1R5NA 3AGQA 5L3QB 1Z6TA 5D3MA 1GWNA 4ZO4A 5J4HA 4RZ2A 2QTHA 3HU3A 1CJKC 4MH0R 2F9MA 2JA1A 2V6JA 3VU9A 5ANRB 4TL7A 3GLGE 5FR2A 1VYVA 1QG4A 4XVUA 4DHEA 2MSCB 4MRNA 2ZYTX 2YC2C 3TE6A 2R6AA 3Q72A 2G1KA 1X86B 2V8OA 1AIPA 1KI3A 1ZNXA 2XAUA 2OESA 4LJAA 3OEHD 3UIEA 1G6OA 1YKSA 3I61A 4TYPA 4D82A 1FNNA 2WKPA 1YZKA 1NF3A 3KUDA 3EIEA 1G20E 5G41A 2JJ2A 1GOTA 4MKIA 2J5XA 4M22A 1GTVA 3DHWC 3THXB 4TL9A 2QM8A 1E2GA 1XTJA 1PLKA 1Z6AA 721PA 1XJ0A 3LRPA 2ZE6A 1N6PA 1OJLA 2HV8A 3KFXA 4OJQA 3Q9LA 2HEIA 3VHLB 2QTVB 3GJ0A 2VP0A 4HATA 1EX7A 3QXCA 4XD7A 4PHTA 3GLFB 3K09C 4RY2A 1N25A 4TTQA 4GOXA 1P2VA 4XWOA 4Y0VA 4Q1EA 1OFTA 1Z8FA 4MQBA 3KZ1E 4KFSA 1TEXA 4NCKA 2ERYA 5EP1A 5FTMA 4DB4A 2QENA 3R9WA 1G7RA 1W46A 4B74A 3QPWA 2WJGA 4LBVA 5AJXA 3RAPR 2QNRA 5CIQA 3T5GA 5EE3A 5HZKA 1ESNA 3OFND 2ZR0A 4MGKR 3EARA 4AIIA 4DKXA 1GNPA 3DMDA 3O47A 3H4MA 3CRMA 2OAQ1 4C0SA 3K0SA 1NLFA 3NBXX 1XX6A 3B1XA 4DDWA 1E2JA 2E1RA 5EE5B 2V55B 1G16A 5B30A 2QP3A 2VQSA 3RS0A 1Q1BA 5JEEA 2KBFA 3WMFA 3AUYA 3AM1A 2RCNA 1KJWA 3BE4A 4JJZA 5BYKA 3C5CA 3TVTA 2R6DA 1Z6YA 3M6AA 2HXSA 3PFIA 1KMQA 1MO6A 2OXRA 3S1AB 1IXRC 5IDVA 2G77B 5GJBA 2ASEA 4KITB 2WWYA 4MRRA 5H68A 3TAUA 4V02A 2FPLA 1ANKA 3O8DA 4ACBA 1XB2A 2YINC 1SVSA 4BFWA 1XCPA 2V1UA 3ICQB 5JJIA 2IYRA 3TSOA 4ESVA 2E87A 1PZNA 3D7MA 1N6OA 1JI0A 1N5LA 2NZ8A 5JHGB 2HCJB 3RS3A 3C14C 3IIMA 4JLKA 2ZANA 2BC9A 4Q1DA 2J0UA 2GEDA 1S3GA 2WPDD 1JR3A 3BIFA 3R7WA 4EJSB 4Q4JB 4PC7A 2VEDA 4I1OA 2CDNA 1HT2E 1KSHA 2D4HA 1GNRA 2W6JD 5C18A 2W6IA 1R4AA 1S8FA 1OIXA 1F5NA 2ZROA 2VL7A 3UG7A 1FTNA 1Q0UA 2QN6A 3BXZA 3M4YA 4MUBA 3I1FA 2XNSA 5DISB 1D9ZA 3W34A 5K8TA 5KSYA 2FPMA 1UKZA 1M2OB 3AF1A 3RSOA 1E2FA 4TSFA 4ZIRB 2ZAMA 1FMJA 1Z07A 1OSNA 5BN3A 2XEXA 1VG9B 3I5XA 2HYIC 1RRCA 4U7DA 1SXJD 1DAKA 3DM5A 3R20A 4WBSA 1SULA 4BFSA 4B3DA 3ND8A 3EA5A 4FCVA 2LKCA 4AK9A 4YMTA 1UF9A 1W4RA 2RHMA 1NIJA 3RS4A 3ZS8A 3WMEA 2EVWX 2HT1A 4NDZA 1CRQA 4OQLA 4B6EA 3M0EA 2HLDD 1E79A 1NG1A 1XTRA 1Z0AA 2VHTA 8OHMA 2VHUA 4HAXA 3QEOA 4TLAA 5GJVC 1YR8A 2ZRIA 4EJSA 4AKGA 3GFOA 1S2MA 1II8B 4LSGA 1Y3AA 3RHFA 2MMCA 5CK5A 2VLIA 4LPSA 5H1YA 4DSOA 5E7MA 5JBQA 4NPHA 1CJVC 3PV0A 2P6UA 1OT3A 4TLCA 1OH7A 1A7JA 3KJEA 4TQAA 3ZLJA 1KK0A 4QJ5A 5KSOA 1CIPA 2BKUA 4L4UA 3RWOA 1MT0A 3GJ7A 3L0PA 4CRWB 3X1YA 5AUNB 4XSGA 1TADA 2YOFA 3P4XA 1FQKA 3UWKA 5DH9A 3CX8A 1KO4A 2IS4A 1KDOA 3LDAA 1Z08A 4OQXA 2YWEA 5FI1B 5JWOA 5JZVA 2ODBA 2J87A 2PT5A 1N0WA 1HQCA 4D4MA 1LB1B 3OF5A 1ZW6A 3QG1A 4KYIB 4F4JA 3JVVA 4R2IA 1NIPA 2FSFA 4OQFA 4Q21A 2VF8A 4FWIB 1NMXA 1NG9A 1W4CA 3BH6A 4Q5IA 3OZXA 2ZSEA 5IK2D 5K8IA 3A4NA 2JLYA 3BFVA 3QF7A 3OE7A 5EP4A 3BH7A 1E69A 1F2TB 1K5GA 2XTNA 1A2BA 4K81B 5LD2C 2H16A 4DWJA 4W5WA 3WYFA 1M8PA 4AURA 4A6XA 1TPZA 1E79D 2HLDA 1R8QA 4CW7A 2KBEA 3CNNA 4KFTA 4OQNA 3HR7A 4H1UA 4DIEA 1N6HA 1N6RA 1XD8A 2ZI4A 4US2R 4UNPA 1Z83A 4KV9A 4W9MC 1YVDA 4TWZA 4TYQA 5HCIA 4POAA 4LHWA 4MYCA 4AYXA 4HDCA 2ZUDA 2PL3A 3TGPA 3K70C 2GZAA 1GRNA 4JVMA 4YMWA 2QMOA 2CNWD 4PZZA 3CPEA 3SJZA 2X19A 3W5JA 3W8NA 3W3ZB 2FG5A 2QA5A 5HKKA 3NC1C 3UKDA 3F0TA 3SQWA 5KDLA 1S3SA 4Q9JA 4DLUA 1DAGA 1GSIA 3VR1A 1LTQA 1RKBA 3LFUA 2ZI5A 1NBMD 3PR1A 1MKYA 3OEEA 3L8YA 2Z5FA 3CF2A 5HE8A 4MA4A 1CJTC 4V0ME 5DSZA 1KIMA 1GG2A 2D06A 2GJKA 3FPAA 4RKEA 1G7TA 3T35A 4DZZA 1ZC3A 4ILEA 3OIYA 3CRQA 4Q18A 1IN5A 2QE7A 2HF8A 3AUXA 3HWSA 1I2MA 1PLJA 3LVQE 3EPKA 1RRFA 3SBDA 3AF2A 2O8CB 2C95A 1T5LA 1NMZA 3U44B 4JIMA 3KQUA 4JBYA 1KHTA 2W58A 1QRAA 3AVWA 2XZPA 5L3VA 2ZR7A 3ADKA 1KNXA 4XWAA 1CKEA 1ZM3A 3QEJA 2IK8A 2AL7A 2RGBA 3ZS9A 1KI7A 1Q44A 1KK2A 2GWHA 5SZJA 2OM2A 4PPQA 4ESHA 4QKQA 1KMHB 1FQJA 2HDNB 3P27A 1T0JB 1JBKA 1JQJC 2YZ2A 3B7GA 3LW7A 2IWRA 1G9XA 3R8FA 5TB5A 2Y8EA 1KI8A 1Q21A 3CH4B 1T9HA 5KSZA 3QKTA 2DPXA 1VTKA 3V00A 1E98A 2IYVA 3KTAB 1BYUA 1YZQA 3JZAA 2QROA 4B2IA 4HZIA 4TSFD 4MYTA 5EQTA 1N0UA 3GEEA 4PZYA 3C4JA 1JB1A 3K70B 1G19A 4F93B 1E2PA 2IYTA 1XU4A 1E0SA 4IVRA 1P72A 4PC6A 4RD3A 2F1HA 3GJXC 4LJ8A 4XIGS 5CYPA 5KUTA 2EU8A 5FI0B 3MSXA 3PUVA 1RZ3A 3GPLA 4Q1CA 4ZCLA 4E5UA 2Z4RA 1T3HA 5CIWA 2GJAA 2Q0HA 2GZDA 3IHWA 3LLUA 1QVRA 1UAAA 2C9YA 1Z0IA 4NBSA 4EIWA 1AK2A 3PVSA 2FX3A 2FOLA 2GCOB 4M21A 4D4KA 4MKGA 4V0NA 1CTQA 2X77A 3DL0A 1WMSA 4DCNA 5HR5A 3AVVA 1JALA 1NLZA 3B9QA 5CM9C 1G41A 4XVRA 4CEHB 3MUFA 3BOSA 1TF7A 1TQ2A 1XEWX 5FH9A 3THWB 1W1WA 3B85A 2BMJA 2ONKA 4FINA 5K8UA 3RRYA 1FUKA 1G4UR 1KK1A 4HLUC 3LA6A 5JRJA 2QORA 1ZAKA 1DG3A 1H8HA 1MR3F 2KB0A 2VSXA 3W90A 4DCSA 2DB3A 3NEJA 2GAAA 2ZETA 2A5YB 3HPRA 4MYHA 3NVAA 4NKRA 3QBVA 4TMTA 2WWIA 4A0HA 4JT2A 3CUEF 5L3RA 4BQSA 1E96A 5TY0A 1G6HA 3BB3A 3CWQA 1I4LD 1VYTA 5AJVB 3G5UA 4JBWA 5DHAA 4GP6A 2SHKA 3PUXA 4NTZA 1H8EA 3LBNA 4Z8XA 3QQ5A 5EE9A 2F43A 3H2YA 3K70D 4RD0A 3LD9A 4D4LA 1G5RA 2VHQA 3IPYA 4LUCA 3RWMB 4A2QA 2GZHA 3W9YA 2PEYA 2QG6A 3SYKA 2EWVA 1NRJB 2ZJOA 1R0WA 2RH5A 3MMPA 2ECKA 3I5YA 3X1WA 4DIDA 2IBMA 3NBFA 4Q9HA 1CBUA 2PZFA 3RS7A 1XEXA 1NN0A 2A3RA 2REOA 4HUQB 4AC9A 2QAGB 1E9SA 3EZFA 3IEVA 1DAFA 2IL1A 4LBWA 1KDPA 3E5HA 2JCSA 4WVFA 4NMMA 4B3XA 1CU1A 3VU9B 4BEBA 2QSYA 2DHRA 3OAAD 2QBYB 1VCIA 2PEZA 5AR1A 1MABA 2ZUBA 3EG5A 2YC4C 3AQ4A 3A8TA 3NTUA 2PX0A 3IQWA 1W0KD 4FMCF 1E1RD 2R6FA 3IDQA 2JJ8A 3V4RA 4CEJB 1W47A 1J8MF 1NBME 2B6HA 2DWQA 3B78A 4HDOB 2P6NA 2J41A 2IYQA 4P4SB 3HYRA 2ZRNA 2ZU0C 5IHPA 3KKPA 4BZXA 2P65A 2WWGA 3FMOB 4PO9A 4TMWA 1WBBA 4ABYA 3I62A 1H8ED 1MRSA 3THXA 4UNQA 4MGYR 3QI2A 2ZRHA 4JLAA 2GJ8A 2FFBA 2FZ4A 2P5SA 2P6RA 4PHHA 2RMKA 2IUUA 2D74A 1FW6A 1Z06A 2WAYA 4WXPA 2OT3B 3QXJA 1YJ5A 4V0MA 3TW8B 1T4GA 1KSFX 2CK3D 2QY9A 3GLFA 1RYHA 3OEHA 3SFZA 4RD2A 4JKYA 3K9GA 5J5CA 2CVHA 4EAQA 5HE9A 5BN4A 1W5SA 1XP8A 3C15C 3CO5A 5JCPA 4Q9IA 1XBTA 1JEEA 2CCGA 2XB2A 5JJLA 1XMSA 4X8HA 4X8OA 4Z54A 1W2HA 1Z0KA 1E32A 1X3SA 1RIFA 4EPTA 2RGCA 5JSZB 1QZXA 3N2EA 3T12A 4FIDA 3NBZC 1KAGA 1XCGB 1YRAA 2GXQA 2TMKA 3E1SA 2BCGY 2YYZA 2OFXA 1AA9A 2OFOA 4JLBA 2ZPTX 1QG2A 1IN4A 1D2MA 1KI2A 521PA 1GUAA 2VYFA 4DUGA 3T06B 2FE4A 1S0UA 3RC3A 3FE2A 1KI6B 2WWWA 1RW4A 5AJZA 1AKYA 1UKYA 2RGEA 1GM5A 4IFBA 2WWXA 2V7QD 1NVVQ 3SYNA 1BIFA 2C9CA 3T5DA 5FUWA 4DT1B 4G5OA 3GJ5A 3ZD7A 1P6XA 2CEAA 1S4QA 2ORVA 4JLOA 4M9QA 4RZ3A 3REGA 2FH5B 2ZI6A 1XFAA 1IJEA 4E22A 4V0OA 3EZ2A 2RB4A 2ZRAA 3RVBA 3H0KA 3SJCA 3BBPA 1G8HA 2GXSA 3L0OA 5G3YA 3QVVA 4NYJR 2GILA 2XNDA 1WBDA 3CF0A 2WJHA 1BYIA 4LC0A 1XPRA 5E4FA 4QRHA 1I4DD 1P73A 1E9FA 2PLRA 3X1XA 3EZ6A 1UKVY 2WBLC 4FI3C 3U4QA 1QHHB 1E94E 1SVLA 1R0YA 2AXPA 4LOAA 2J1LA 4Q7JB 2BBTA 1E9CA 3AKDA 4NCHA 4HAVA 3IIKA 2YVUA 1N5IA 2OV2A 4PAMA 2PZEA 1TEVA 2J7PD 1XEFA 3C7KA 4TLEA 1QF9A 1M7GA 2WWFA 4LGMA 4JL5A 1VCMA 3VAAA 3AF3A 1G4AE 1Z0JA 5CJ2A 1W7AA 2BBWA 3BORA 3LX5A 4QG7A 1Q1EA 3B8HA 4IVPA 4M0LA 4PAOA 3I8XA 3SE0A 3HYTA 3VFDA 4YQFA 2VSFA 1X8KA 2REBA 5C4GB 4YXWA 2OILA 2ZREA 1EWRA 1Z5ZA 1LFDB 4RD6A 5JI2E 1R8SA 3CX6A 3QKSA 3GJ6A 2GXAA 4IOMA 1UBEA 2PT7A 2ONJA 1L8QA 4PSVA 1KI4A 2DCUA 3RLFA 3CRRA 1PUJA 1U9IA 4OHVA 3LLMA 2DBYA 1G7SA 2OG2A 3EA0A 4I1SA 2REXB 2CJWB 3HPQA 3GEHA 1KJYA 4BFXA 1FPMA 5EUQB 4EJSC 1ZBDA 1FNMA 2AK3A 2BCJQ 3WBJA 4IKEA 3GLGA 1CR0A 1FX0A 5FL7A 2ZRFA 2WVJA 2IYLD 4HAUA 3IIJA 4P4UA 3TR0A 1NVVR 1UDWA 1ZU5A 3ONWA 3EIHA 3PG5A 3CRW1 5AJYA 4DLVA 4E09A 4AD8A 3OE7D 3GFPA 4BZQA 4LY6A 2VP2A 4NH0A 4F4CA 1JXMA 1KYIA 3FMIA 2GAOA 2RGGA 4KAXA 1IN8A 2O8BB 2CVFA 3R9XA 2VBCA 1JQLB 1DADA 2W83A 4XWKA 3EC2A 3NDBB 2QZ4A 1AGRA 1D2NA 3QKRB 4QHTA 2OCYC 3BD9A 2O8FB 4A15A 4OQMA 3CZQA 1AN0A 4DEYA 2ORIA 1U0LA 4GOKA 3THOA 2R62A 4EQ6A 1FZQA 4KXFB 3CR8A 4EKDA 1LF0A 2R65A 3IILA 2IS6A 3I4LA 3TJZA 2BV3A 4B2LA 2VH5R 4RFSA 1BMFA 3EPHA 3AB3A 3A1UA 1U8YA 4HLUA 4KJZA 4TTRA 5G40A 1NMYA 1OIWA 4DBLC 5J4LA 4BPBA 1J90A 5TXGA 2NIPA 3BB1A 1Q1ZA 1R2QA 2ZJYA 2ZSBA 4WZBE 2V6IA 4QGAA 3LQQA 4KSCA 2EFHB 2CL0X 3CWZA 2XZOA 4M1MA 2FGKA 2O0JA 2O0KA 4M1WA 2JLWA 5K8LA 2WPDA 3FDIA 4ARZB 2N1BA 2AKAB 2R9VA 4BE7B 4DLRA 1GRRA 3SBEA 2GKSA 2VP5A 5AUPB 1W36C 3L43A 3AP1A 1SHZA 2P67A 3PITA 4QM7A 2V3CC 3TUIC 4C0AC 2FSHA 1W44A 3U3OA 2DWPA 3OIVA 3GFTA 4HLCA 4B48A 3CW2A 1L7VC 4LCBA 1EFUA 4WXRA 2G0NA 2C9OA 3TNFA 5CK4A 5KPJA 1O87A 2X2FA 3R8CA 5JLJA 1KI9A 1P9NA 2A5DA 1WP9A 4ZDWA 1P2UA 4PC2A 4LHVA 4NCIA 3ZVNA 2ZSAA 5EP3A 4WIAA 3U3MA 3VX3A 2DFKB 4KFRA 1P60A 5LDDC 4D6PA 2IC5A 3EPJA 3I73A 4XJXA 3I32A 1E1RA 3FYHA 3MD0A 3GLIB 4TL6A 1KMHA 5F9FA 3RDPA 1M7BA 3LX8A 3W6PA 121PA 4F91B 2AK2A 4QM6A 1VHTA 1U98A 3U2QA 2CL6X 1T3SA 1KO1A 3FVQA 1ZNWA 3SQXA 1EK0A 1YZLA 2ZJ5A 3MAAC 2F55A 5A5GA 3IEUA 3KDSE 2F1JA 1VYUA 4OI2A 3IO5A 1CP2A 4PPNA 1Q22A 1U0HC 1NP6A 2GDJA 4A8JC 4EPWA 2IT1A 2BWJA 3PIRA 2A5FA 4QBIA 2OO7A 1UJ2A 5DGXA 1N0VC 2I1QA 2ZRLA 4V0LA 5JRZA 4A1FA 3DKPA 3UXMA 4B3BA 2OCPA 4UNSA 4EFLA 2ZUCA 2Q9AA 3CNOA 4BFYA 3K0FB 3EC1A 3ASZA 4JVSB 1OV4A 3P26A 2RGAA 4G3XA 4MYUA 3TK1A 4BEJA 1W0KA 1XMVA 3KXKA 4I1VA 1VG8A 4BRUA 2IF2A 4BWYA 5C1BA 4M2LA 2Q3MA 2ZEJA 3FHTA 4DLWA 1F3OA 1J2JA 5SZIA 1XMIA 1KOFA 1RFLA 3KQHA 4GBMA 4N1AA 1W2GA 2JIZD 1T8TA 3CPJB 3K8YA 2IEYA 1XXHA 1F6BA 1GAJA 2WJYA 1SXJE 1EFTA 1QVAA 2OBNA 3Q5DA 1Z2AA 2FEMA 3FHCB 4IJMA 4URZR 3TRFA 4AKIA 3DEFA 1US8A 3KKQA 4S2EA 4TZ0A 1KDTA 2F9LA 5KOYA 2GESA 4Q47A 1ONBA 3OFNA 1FOEB 1R6BX 1KKLA 2G1JA 4I99A 5F98A 2GF9A 2EFDB 4KFUA 3BGWA 2BBSA 3UMSA 3LQRA 4G01B 4C0BA 3HU2A 1M1YE 1DAEA 3I8SA 4D4JA 2O8DB 2FZLA 1UBFA 2W6JA 1ZM4A 1W4BA 4DLXA 3SS8A 1B23P 3B2EA 3FMFA 4BFTA 4CT5A 3NH6A 1WE2A 5KHOC 2OFWA 3CLVA 2XOKA 3O8BA 1D2EA 2V4ZA 3RANA 5IT5A 1W49A 1ZINA 4L8GA 4WW0A 2F6RA 1OF1A 2FA9A 4Q1BA 3RNLA 3HR8A 4B76A 2ATXA 4GZLA 1CLUA 5H70A 1COWD 4B3CA 5J47A 3TBKA 4CEIA 3QIAA 3SR0A 1SVWA 1YR9A 3QXSA 1NY6A 4B75A 2IYYA 3U3JA 4YMUA 1KTVA 1IXZA 2R44A 1IXSB 1YHNA 4MKHA 2QI9C 4GFDA 2H7VA 3GLHB 1OW3B 4BLQA 1J8YF 2WMNB 3EAQA 1HY3A 1ZCAA 2HYDA 1ZMXA 1KAOA 5IF9A 4QOSA 4U02A 1RVDA 1ETUA 2B8WA 1RYFA 3H84A 2QRZA 1LNZA 1XF9A 2AHOA 3V9PA 5CITA 4HB3A 3KFVA 4XOIA 2RGXA 4C4PA 1KSJA 2J0SA 1GILA 1JJVA 1GRQA 1P2SA 3EX7C 3B6EA 2CCJA 2Q3FA 1EFCA 4Y0AA 5TV2A 2NTYC 2HCBA 4HUTA 4B6FA 2D3WA 4A0GA 4BLOA 3C8UA 5DN6A 4TYYA 1MOZA 3OHMA 2ODEA 4BLSA 4KVGA 2JDIA 1D8TA 3PXGA 2H57A 1DO2A 4BLPA 3AEZA 1E1QA 1GP2A 1CR4A 5FTLA 3MJHA 4UJ3A 3S1AA 2HUPA 4FXPA 4S35A 3U7GA 3SZRA 2P0EA 4ITRC 4URVR 3UWOA 1YE8A 1I4TD 1TMKA 3KJIA 3RYTC 4FN5A 4GPTA 2BMFA 4ZI2A 4GSYA 3TQFA 2RHDA 4OK5A 3IUYA 4XVQA 1G18A 2FDCA 4EFMA 1A82A 1LF5A 3IHLA 3TH5A 4L9SA 1IN6A 2VF7A 3LNCA 4IFEA 3SJBA 1TQ6A 2YKGA 2ZRJA 3WHKA 3NWJA 2I4IA 1G3UA 3KXIA 1NN3A 2J0UB 5L3QA 3TQCA 3K0CA 4CVNA 4MGZR 2QP9X 1CJUC 1ZM2A 2KJQA 1KDRA 2XOKD 3R9IA 3EWAA 3F3YA 4ON9A 4DDUA 2ZI9A 1ZVQA 5A4JA 1BKDR 1D6JA 3FWYA 4DCUA 1VG1A 2V54A 1G3QA 1PJRA 2W6ID 1HEIA 2FF7A 1JECA 2GCNA 2IUTA 4Z51A 1NN1A 3KQKA 1P9WA 1E9RA 4TMZA 1J7KA 5EUMA 2FSGA 2NO9A 3NXSA 1R0ZA 4LWZA 4PC1A 1E2MA 1OHHD 5KTYA 5IK2A 3CPHA 5LPNA 2J46A 1KO5A 1SVOA 1F2TA 3EASA 4CT4B 4LBYA 2WIAA 2HJGA 3GLIE 1N6LA 1XXHE 5KDOA 2QP4A 3NDPA 1NKSA 2QT0A 1AQYA 4QHYA 4O3MA 4Q9KA 3UG6A 1AM4D 4C30A 3U4QB 1BO6A 3H86A 2ZRMA 2ANCA 2JLRA 1OKKA 2OCBA 5JFGA 4DSTA 3FOZA 2CE2X 2QEQA 1XDBA 2FU5C 2VIIA 1FP6A 2X8AA 3EWSA 4I4LA 4TTPA 2ZRCA 2ZJ2A 2OCAA 2ODNA 4Q1FA 4JZKA 1AS3A 2WOJA 5DI3B 3KUCA 3P4YA 2AWOA 4D2IA 3B82A 2J7KA 2QAGC 4JLPA 2XXAA 3I92A 3EW9A 4JT4A 1KO8A 4TMXA 4W7SA 3ETLA 1MO4A 5HKKD 1P75A 4LV8B 4IDPA 1UBCA 4Z1MA 3OAAA 3AH8A 2ODWA 5J40A 3GP8A 4XSHA 3K9LA 2A5GA 4UXIA 4B3GA 5JJKA 4ZV4A 4GP7A 1BMFD 1C1YA 3FB4A 4B32A 4A2WA 1CXZA 1OFUX 1G17A 1Z0DA 3F5FA 2CLSA 3GJ3A 3GJ4A 1O3YA 3THYA 5KSPA 3PEUA 1S96A 4M9XA 2XITA 1P5ZB 2WKQA 1SXJB 3AKEA 5FUVA 4WAUA 2DY1A 3ZGXA 3J81k 4HLQB 2O8CA 4NHOA 3LWNA 2JJ1A 3DVLA 4HB0A 4AYTA 1S1MA 5C4MA 4AY2A 4ZDKA 4B73A 3WBKA 2EQBA 1Z22A 3FKSD 4OJKA 4GRAA 3LW8A 4NZYA 4D0LB 4ZKDA 4KLZA 1XJCA 5FL3A 2VO1A 2WJIA 1IBRA 3T1VA 2IS1A 1P3JA 1QHXA 1U81A 2F7SA 3TKLA 1RC8A 3RABA 3CR7A 1Q12A 4KSBA 2XSZD 4Q66C 4ASUD 3I72A 2O8EB 3U3KA 3R7WB 1DAHA 4LYAA 4CIDA 3P32A 5CB8A 1Z2CA 1IOZA 5B64A 1VCNA 3W5IA 5DN6D 3MWLA 1NKTA 1UPTA 3O8RA 4B2PA 1X1SA 4GNKA 1GFIA 2R8RA 4MDFA 4EPYA 1GNQA 1NY5A 3TIFA 1XD9A 1JPJA 2ZRDA 3GLFE 2KSQA 1LVGA 2ZTSA 3QF4A 1RPZA 4CZ2A 3A4MA 2O52A 1HA3A 5DIFA 3T61A 1Y63A 2J9RA 4I1UA 4RSGA 4PFSA 2BVNA 1KSGA 2W2VA 5L3SB 5BXQC 1DS6A 3A1VA 4Q02A 3T34A 4FWTA 4O25A 4JLVA 1JAIA 1N5KA 3B9PA 4Q4AA 5B57C 3VX4A 5FPTA 2B92A 2O5VA 4HAYA 4KYUA 1Z63A 1M6NA 5FPYA 1SXJC 1T8UA 4DLYA 5GJWC 3UMFA 4PHGA 4PQFA 2GVDC 5SZHB 1U90A 4G5QA 4NP6A 4P3YA 2A30A 1ZIOA 4PHFA 1XZPA 2QT1A 4JYBA 4Z1MD 1YR6A 2CMKA 2FWRA 2CHVA 1N6KA 3QE0A 3CM0A 1PLLA 5GJCA 1MH1A 5D3MB 4ARZA 3HDTA 2CBZA 3AP3A 3D3QA 5AWFC 2V1XA 1YRBA 2GJSA 4DC9A 5J4YA 1NBMA 2OLKA 2VRWA 4LJ5A 3VTKA 4O0MA 4US0R 1U8ZA 2VSOA 4XH9B 4DEXA 2ZU6A 5KU1A 2VHJA 2VA8A 1NLYA 2ZSFA 4TN1A 5FOTA 3VKHA 1P9RA 4NCNA 1Z29A 5G53C 4G5RA 4YDSA 4IDNA 5F2EA 1U0JA 3ZZ0A 4GT1A 1SVMA 3QKUA 3QY0A 1UDXA 1NJGA 4F38A 1OKKD 4WOPA 821PA 2NO1A 3LBIA 3GLIA 4E07A 3GJ8A 2VTKA 2UZ3A 5EXSA 2ORWA 5CLLA 1K6MA 1RJ9B 2YJTD 3UPUA 2QQEA 5EP2A 4C0KA 1R5OA 4OHWA 2CHQA 4B33A 4PPGA 3SOPA 2W0MA 1E9AA 2BJVA 2C77A 3MFYA 1TQDA 3LXRA 2QBYA 3TR5A 4WZAE 1CULC 1FTSA 1S1CA 3IPXA 3QUSA 4AKHA 3K9HA 5E7IA 3W6NA 4M8NE 2ZJ8A 3ADCA 3ZYCA 1QHNA 3TSWA 1TNDA 4M1OA 4AG6A 5FBVB 4EPRA 4GDFA 4LJYA 2PZGA 4BZPA 1R7RA 3Q7PA 4P0TA 2JDID 3L0IB 4OKSA 2RAPA 3QG5A 4HZUA 1F48A 3M1IA 3MCAA 1FMLA 1JAHA 2BEJA 4QBGB 1UEJA 3H1TA 3SEAA 3U3RA 4D81A 3PUZA 2PMKA 4DRZA 4Q7LA 3FTQA 3N70A 3X1DA 2GJ9A 3K9NA 4U5XA 1CEEA 5H8WA 2IYWA 1XWIA 2GK6A 1EWQA 1FP7A 4C0JA 3ICEA 3AF4A 3EZ7A 4TMKA 5KNBA 3AVUA 4NU0A 4UKDA 3DPUA 2J0QA 1GKUB 2N46A 3P20A 3ZH9B 4G1UC 1EXMA 2EYUA 2PJRA 3VR5A 2CE7A 2GK7A 1XXHB 4PSAA 4Q4HA 5TARA 3U60B 3U5ZB 2G3YA 1BH2A 2WICA 2EW1A 4B3FX 1S9DA 3F8TA 1X8JA 1PUIA 1OB5A 3K09A 1Q1QA 3RSLA 3JZMA 2IUSA 2CNWA 1QHGA 1F2UB 1J70A 2QMEA 1ZNYA 4JS0A 4QL3A 5J4KA 1NVWQ 4Z8YA 4PPFA 5FTNA 5GVRA 3MWKA 1VIYA 1KI1A 4IVQA 1IJFA 1KKMA 1NL3A 1GDDA 2ZAOA 4RFVA 4DDVA 2YWHA 3QXHA 1Q3HA 2FV8A 3PCRB 4ZDJA 1II9A 1Q57A 1T91A 4H9GA 4DXAA 5JI3E 4ZCIA 2D2EA 2F3TA 3Q5EA 4N0DA 4BRWA 1KY2A 4B71A 1HV8A 2HXYA 4IXMA 3K53A 3DZDA 4JBXA 3Q3JB 2ZVPX 4RCYA 2OHFA 2WKRA 5JHHB 3NEYA 3QPUA 4A0FA 4GL2A 3ZDQA 1ESMA 1QDEA 5FBRB 4L15A 3GCGA 2QRNA 2IXFA 1KZ7B 1DBSA 5CM8B 5JS8A 4LV6A 4DVGA 3HP1A 4GMDA 2GBLC 4CDGA 4MUAA 1L4UA 3U7FB 3HJNA 1DAIA 4BFZA 2G6BA 3A37A 1T3LA 2ZSDA 4AG5A 1OXVA 3I3SR 5FFMA 1BOFA 4W5JA 1IN7A 1GKIA 3UMRA 4R9UC 1E2KA 3MWJA 4QNRA 1ODFA 1T5IA 5DYGA 3NKVA 4CF7A 1SKYB 3Q7QA 2GTPA 2W0SA 2F1IA 4UNRA 1ZRHA 5JSZA 1E0AA 4MRPA 4AWXA 1XNJA 5EZ6B 3SN6A 2IXEA 4O2RA 1CF4A 1WXQA 1N6NA 2ZS7A 2FFHA 2E9SA 2EFCB 1II8A 5F3WB 4Q19A 2DR3A 3WMGA 4QNMA 2MSDB 1NJFA 2XX3A 4RCZA 2NOAA 3ECCA 2WZQA 2Q9CA 4BGDA 1D9XA 1KO7A 2FGJA 2BBOA 2RGNA 1G5TA 3X1ZA 4PSKA 1RE0A 4D25A 2RGDA 3CX7A 1NN5A 2CXXA 3VR6A 4HLDA 1WB9A 4IOLA 4QGHA 1P62B 4HEJA 2DYKA 2JJ1D 2YWGA 1OXXK 1E2DA 3A36A 2FSIA 2V9PA 1E9EA 3AVOA 3TLXA 2R6GA 2UVQA 4L5BA 4LHYA 4LJ4A 4DT1A 1JPNA 3WNBA 2NO6A 1LV7A 1E9BA 5CDFA 3WHLA 3ZD6A 1A2KC 2WJVA 3AP2A 4M1TA 4E03A 4IEIA 4D0NA 1GL9B 5DI9A 4LBZA 3RC8A 1QBKC 2XTMA 2AD1A 4NYMQ 2PH1A 3ZIAD 5TMPA 3U6BA 1RRPA 4Q00A 2C04A 3K0EA 2H8KA 4R71A 1UADA 2CL7X 1G3IA 1II0A 1DE0A 2A9KA 3KJHA 1KGDA 1LY1A 1WF3A 2G88A 3DO6A 4UQOA 2BHRA 3D6TB 2ZJZA 2VPPA 4QBHA 4RVCA 2BJWA 2ZR9A 4LI0A 1YR7A 2J7PA 2LWIA 3U7HB 2YWFA 4NYIQ 4XD7D 2EFEB 1V5WA 4LPKA 4NL4H 3N5CA 5B58C 2ZYWX 4JLMA 1YZNA 4KHZA 4M1KA 2WV9A 1XD2B 3WP1B 4FMBB 3ZJYA 1EG7A 1XTIA 2N42A 1WRBA 4J0QA 5KYKA 2BIFA 1E0JA 1N2CE 3U61B 1UFQA 2JASA 5UKDA 4PX9A 2NPFA 3AVPA 1ZUNB 1ZD1A 2P3SA 2ZRBA 3QKRA 2C2HA 4OHXA 1ZCBA 1GZSA 3QKSB 2A78A 4RZXA 3EPLA 2KI5A 4I81A 2WTUA 2JLVA 3AVYA 1OFHA 1OIVA 3GMTA 2PCJA 4KBGA 1MV5A 1XRJA 1J99A 1Z28A 4BASA 3GLHE 1VHLA 3A58B 4C2UA 1EFRD 2VHCA 4F92B 2QQ0A 3KJGA 3RS2A 3OEED 1NI3A 2CHGA 3CB4A 4EPXA 3U7EB 2D2FA 3VQTA 4IDQA 2GETA 4BUJA 2OSBA 2QAJA 4Q7MB 1U99A 4LV5B 4UJ5A 5TVKA 5HPYB 2XXAB 3G0HA 3U44A 3MLEA 4LRWA 4RD1A 2UZIR 2F3RA 3ADDA 3T1QA 1FUUA 4GZMA 2QE7D 5GADl 5FOSA 3VHXA 2ZI7A 4ZPXA 2FNAA 1SVIA 2ZITA 1JEDA 3DOEA 5FR1A 1HURA 2Q9BA 3CBQA 3TW4A 1G8FA 1G21E 1T6NA 1XPUA 1D5CA 5D3QA 5TDHA 4LHZA 5FTJA 3PQCA 2ZQ5A 1XPOA 1VG0B 1W0JA 2EWWA 5HTKA 1OPXA 2AWNA 4DCTA 3BWDD 1HT1E 3FGNA 3B5JA 3KQLA 3QENA 2ZVQX 4RZUA 5FOXA 2O8BA 4Q4JA 1Z6GA 3GEIA 5E7JA 2JLXA 1QHYA 3NHBA 3QNUA 4C3ZA 2IYUA 2BMDA 1E6CA 4W5HA 4OHYA 1EFHA 1LS6A 1CR1A 2ZRGA 1NVXQ 3AV0B 3NG1A 2O8FA 1C9KA 4IRUB 4A8JA 4ZDIA 4EUNA 1DEKA 1DTSA 3UK6A 4MKFA 5M04A 4GMXA 3QJYA 1G64A 1CRPA 2AKYA 4ZIRA 3ZVRA 1JR3E 1YQTA 4OBEA 4RFSB 4TL8A 4HDQB 1MO5A 5FBWB 3K0AA 4DUGD 4OI0A 2O8EA 4AYWA 3E2IA 3KB1A 2ZE7A 2HF9A 2IEZA 4JMPA 3MG9A 2XJ4A 2ZS8A 1W36D 2FJUA 3LBHA 3AF0A 1OB2A 4Q4LA 4QXAA 5EXXA 1M74A 2WJJA 1VDZA 1NVUQ 2P5TB 3WP0A 3ZVMA 5DNYB 2ZI3A 5B2ZA 4KU4A 2XZLA 4IOJA 4MDEA 1IM2A 1WQ1R 4TQ9A 4C7OB 3VNVA 2ZRPA 3QF4B 3RRZA 3A6PC 1VECA 2QUZA 2J3EA 1DPFA 3K0FA 1F60A 3RRNA 3WYGA 1WCV1 3BK7A 1SKYE 2ATVA 4F7WA 1ZC4A 1Z47A 1QHIA 1IAQA 3WRYC 2WWHA 1RRGA 2F43B 2IA5A 3PENA 3FKQA 5EJEA 4C0QC 4QJ3A 3KQNA 4B47A 4QHSA 2OXCA 3LH5A 3OIWA 4JKIA 1X6VA 4CEJA 3PEYA 2ERXA 1KY3A 1E3MA 5FBLB 4C2TA 1KJZA 4QGFA 4FMDF 4B43A 3SHWA 3DM9B 2BMEA 2QPTA 4JVLA 3A1SA 1EESA 4G5SA 4XTRA 3SC3A 1C4OA 3SI7A 2XGJA 3MRSA 4KO8A 2AD5A 2F1RA 3BERA 5HCNA 1YU9A 1P7CA 4IEEA 2O8DA 3NIBA 4PO1A 4D80A 4L16A 1FFHA 2IYZA 2W2TA 2PLFA 2HT6A 3CH5A 1M34E 2WSSA 4Q48A 1VCOA 2WM9B 1XMJA 2KWIA 3CRVA 4DLZA 5JMTA 1OXUA 3LVRE 1SHKA 1BS1A 5EZ5A 5FOWA 3G82C 2BM0A 4RKFA 1YZGA 2MMGA 5FUXA 2BKEA 5DE3A 3B1WA 3BRWD 4NE2A 1EFRA 2NG1A 3EZ9A 1U94A 3KB2A 4IHQA 1TL7C 2JLQA 1OH5A 2WAXA 4R7ZA 1UM8A 2OEPA 3OIUA 2DWOA 5EE1A 3AVXA 1IHUA 2L0XA 5JS7A 5C46F 1E1QD 2IWHA 4XTCS 4F4IA 3GLHA 4R98A 2YOGA 3LXXA 4PQRA 4LYJA 3AKYA 1KNQA 2AN9A 2WOOA 2ZYVX 3GQBA 4P33A 4OHZA 3WXMA 4FMCB 3B60A 2B7CA 2H17A 4EQ6B 2FFQA 2GEUA 3T15A 1OE0A 4LYHA 1OLOA 2J45A 2CCKA 2GCOA 5DO9A 3TAHA 4EDHA 1GIAA 1ZIPA 1US8B 3FFAA 4MRSA 3AGPA 5CB6A 4B35A 4CEHA 2PJZA 3KX2A 4PO8A 2QMUA 2QPOA 1SZPA 2XB4A 3AVTA 1P2TA 3NH9A 2Z83A 2CLDX 4JVNA 2QSZA 1VMAA 3AKCA 3ZVLA 5F9HA 1V43A 4O2LA 2JEOA 1GL6A 4A4DA 1DELA 1H8HD 3SHFA 2BOVA 2YOHA 4QFMA 4NCJA 3FMPB 1ZUIA 1TAGA 3CKLA 2JLUA 1ELOA 2H1LA 3K0CC 4A0RA 4V0KA 1EGAA 4JL8A 3HU1A 4Q03A 2OZEA 4P32A 1R10A 2C8VA 2GCPA 2IW3A 2GA8A 3A1WA 1R0XA 4JLDA 2AFHE 4C9BA 1F2UA 3O8CA 2QU8A 1A1VA 3CONA 2CLCX 4YONB 2OUKA 4A82A 4NONA 1KK3A 1B0UA 1OYWA 4U00A 3Q8XB 4URYR 2I3BA 3WNCA 4BLRA 5JWRA 4V03A 3UATA 2B8TA 5ELXA 2G0TA 3DKVA 5EXPA 4PR0A 1HH4A 3B13B 4FD2A 4D0GA 4PTLA 1Q3TA 4LDJA 1W5TA 2FFAA 1OXTA 3ND9A 1OYYA 1TUEA 3C5HA 1TF5A 4HUQA 5BQ5A 2QAGA 2EFGA 3A4LA 3B1YA 5GVSA 1I2DA 2CK3A 3ZQJA 2P2LA 2X2EA 4AI6A 2Q3HA 1W4AA 3VR3A 4M4SA 1AZSC 1DG1G 3EIQA 3K1JA 5E95A 1MABB 3CF6R 4TLDA 3THWA 3DZ8A 5DHFA 3IKJA 4YMSA 3ZIAA 4CYMA 1JNYA 3VKGA 4P31A 3L82B 2R2AA 3A1TA 3VR4A 2D62A 2H5EA 5JECA 3VKWA 4DCVA 4H1VA 221PA 1PV4A 4P4SA 4YMVA 2MSEB 5FOUA 4YDHB 4LJ6A 2IX3A 2BDTA 3FFBA 1GL7A 1M7HA 1A4RA 2C03A 3VMFA 2ZXUA 1LW7A 4TZ6A 2J0VA 5FTKA 1HE8B 4Q9LA 1TQ4A 3EXAA 3KKOA 2OE2A 2JLZA 3ZQ6A 5EXTA 1LS1A 1ZD9A 1E2LA 1HQYE 1L4YA 4TYNA 2QGNA 1XZQA 1W36B 2H18A 4BFVA 1E2HA 2CJWA 4N3NA 1VKJA 2PX3A 3CNLA 4TT3A 4WZ6A 1TU3A 2B21A 5KNCA 4N0EA 2A2ZA 2WIBA 5DI3A 1E2IA 1ZUHA 3QVUA 2JLSA 1G3MA 2W2XA 1Z3IX 4EPVA 2G83A 2RGNC 5KNDA 1U8AA 4PANA 4QJ4A 2WMOB 4UNNA 1JJ7A 1SKQA 4PXAA 4QC2A 5FUYA 3GLGB 4FCTA 4LHXA 4R2HA 2VP9A 4TLBA 4Q1AA 3B1ZA 4AKEA 2IHYA 1XEXB 4QGGA 1E4YA 4MITA 5LB2A 1HYQA 4IDHA 4BECA 5CJPA 2BEKA 4MGIR 5AK0A 4ASUA 5BW8A 4TMVA 1K8RA 2Z6VA 4PC3A 5FL7D 3Q85A 4OK6A 3WRXC 3THYB 1E2NA 1ZM9A 4DSUA 1VPLA 5DLQC 1X8LA 2IF0A 4C0LA 1COWA 1DAMA 1SXJA 4LJ9A 4KLNA 1ZU4A 3UANA 1OHHA 3KKMA 3OESA 1MO3A 2ZYUX 2ZJBA 2NO7A 2FN4A 2JGNA 4OI4A 4BLTA 1IY1A 3NC0C 1G291 2QTFA 2OLJA 2GNOA 1IQPA 1IONA 3C41J 3IO3A 3LO5A 3LY5A 2AFIE 3BJIC 3QXXA 3W6OA 4QBFA 1W48A 2V7QA 4KVAA 4CEIB 4JSTA 1QHSA 4TQUS 1ZNZA 3CZPA 4Q01A 1E2EA 1A5TA 2PBRA 1YZTA 1WDTA 2IYSA 1E99A 2OAP1 4YXWD 5L8VA 1NSTA 2J59A 3NHAA 1TF2A 2QGZA 3WYAA 3DOFA 1CR2A 3P1JA 4G0NA 1SGWA 2XNDD 3IBYA 4LC1A 1TUIA 2XSZA 2GVZC 4OYHA 3PJRA 4JJKA 4FCWA 1IY2A 1AQUA 2G9NA 5JCZA 3ASYA 1XD2A 4JLNA 1ZD8A 4JL6A 4URXR 4ACAA 2HJVA 3LAWA 1U2RA 4M9SA 1N5JA 3VR2A 2ZS9A 4LYFA 4G5GA 1XTQA 4HAWA 2C99A 4HB2A 2A7QA 1HTWA 2C96A 2C98A 3FHOA 4LK2A 4KCGA 3PEWA 3KL4A 1XTKA 1ZYUA 4LZZA 4A36A 1XCMA 2NPIA 4M1SA 2GEVA 1WA5A 4FW9A 2JATA 3SU8A 1G8YA 5C2JB 4HI0E 2IS2A 4D26A 2JAQA 6Q21A 4Q4AB 4HSEA 2A5JA 1OH8A 4ZCMA 1KI6A 2Q21A 1OH6A 2C5LA 4GI7A 2O0HA 2QL6A 3E70C 3BFKA 1E4VA 1TU4A 4GOJA 1FL9A 3DMNA 4JSYA 5IRCD 4C0HA 4DSNA 2VP6A 1W0JD 3C16C 2LKDA 1P4SA 3D8BA 1AS0A 1E0KA 421PA 4ZKEA 4B34A 5HZHA 3BAFA 3RS5A 2ZJAA 4Q7KA 1Z0FA 3TSZA 1ZP6A 1VIAA 1G3RA 1JXOA 3RRMA 3TMKA 2VP4A 4II7A 4OK3A 4KBFA 2XJ9A 4HAZA 4DDTA 1N6IA 2ANBA 3MJRA 5JWHA 1QHHA 3PUWA 1UBGA 4HYYA 4JYCA 2QMHA 5E3HA 1G8GA 2AX4A 1AGPA 2IHBA 3BH0A 4A8JB 4K8OA 4CGZA 2LCFA 4M53A 3KKNA 5DYIA 5SZKB 2PMDA 1OXSC 4P4TA 2AR7A 1IY0A 2NGRA 1Q20A 1CJMA 5AUQA 1SQ5A 1RJ9A 2GXUA 1ZJ6A 4A6PA 3FKSA 5FOVA 3PUYA 3SNHA 3T1TA 1L2TA 5LD2B 2DFLA 621PA 3LV8A 3K0AB 3TVDA 2OBLA 3IBGA 4KI0A 3V4FA 1N3BA 3BS4A 1EX6A 1TX4B 4IW3B 2JJ2D 4NYJQ 1DOAA 3QBTA 4BFUA 4DLTA 2YV5A 5AJWA 4DLSA 2K5UA 3MWYW 1S9HA 1GKYA 4C7OA 2ZRKA 5P21A 1DARA 2XTZA 5AUOB 1AKEA 2ZIAA 1PVOA 2JIZA 2RKOA 4X8LA 3TUZC 3JVUA 1OFIA 1E9DA 5J4VA 3WY9A 1XEWY 3GD7A 1FX0B 5FBQB 1H65A 3TUJC 4M9ZA 1X1RA 4MRVA 2I1VB 3D31A 4X8MA 3ADBA 4OL0A 1HE1C 2C78A 4IXNA 4UXHA 1P61B 1UEIA 5CDFE 1G7CA 1R5BA 1Z6XA 5BWMA 5G3ZA 4A9AA 4TT3D 2IYXA 3WNDA 4KODA 2NQ2C 3AVQA 4DB2A 4LX0A 4ERNA 4JLJA 1TTTA 1JR3D 2ZE5A 1GVNB 3KTAA 3SJAA 4NYMR 4RD4A 4PQYA 2AXNA 1T0HB 5EE0A 2FPKA 1XJQA 1UKEA 5KO2A 1GITA 5KDDA 1DO0A 3KXLA 3ZZTA 2D7DA 3BFXA 4HB4A 4OI1A 2WHXA
chains in the Genus database with same CATH superfamily
5JLAA 1JRLA 5CPBA 4YROA 4OKIA 1Y6FA 5LB4A 4X64B 1RQPA 4HNSA 4IOKA 3DBRB 1KZGB 3B3AA 4L9WA 2NMVA 2H8GA 3OCZA 5IJAA 2FW9A 3FNGA 3T9DA 4FSXA 3ZQUA 4DJTA 4X45A 2PCLA 3BC1A 4FMDB 4NS4A 4XDYA 1AJEA 1M2EA 5KHLB 4FHEA 4JJIA 4QZVA 4A16A 5GTDA 2A9QA 1AS2A 1HT0A 4IDOA 3SQOA 1NBEA 3U4DA 4ETNA 2JFFA 1QU2A 1EZZA 4HZUB 4KQHA 3H8WA 4RGQA 4L9RA 5CLQA 1F8GA 1PFVA 4JCCA 5C5IA 4YAIA 4F5YA 2I2WA 5CHYA 2HLPA 2NZJA 3ZGNA 2EYQA 1U3TA 2QTLA 4CTNA 4C0WA 3NVDA 4AJKA 3D2BA 4E31A 3ZX4A 1D2HA 1E2QA 1SVKA 1UWLA 2R11A 3RODA 3UFBA 3WLEA 1IDN1 3R7BA 4LXIA 3BE8A 1MZPA 3GVCA 8LDHA 2PKWA 1A69A 2X1VA 3IOYA 2DFNA 4KRFA 3QA3E 1W73A 3COSA 1AZTA 4MQEA 2ZYGA 1Q6ZA 3L2OB 1HYEA 3JYNA 2ZM5A 4ZAZA 3LP8A 2QNBA 4KPEC 1YZVA 4WUTA 4MV1A 2FMXA 2I2AA 3PCTA 4Q4HB 4JC0A 4N49A 4URUR 2YWJA 3R6GA 5L3SA 5IM4F 5IKXA 3QPVA 4C7JA 1PWEA 1UINA 1V45E 2NTJA 4NZPA 1YZUA 3OOWA 3SDZA 1DIOB 2YNMA 4X7RA 2C9BA 1X7DA 2VNJA 4K46A 2XCQA 2GGSA 1KDYA 4C03A 4K9DA 3M1LA 1YVUA 4G5HA 1NV9A 4UXJA 4R7GA 5D5QA 4AWBA 5EKTA 1E1LA 2FMTA 1G5PA 1UXIA 4G23A 4N40A 4PAQA 5DLPA 4A92A 2BH9A 4US1R 2CLHB 1KAEA 5J5VA 2IV2X 1PJQA 4UZFA 1CS4C 3EF0A 4URWR 1W25A 1KBZA 1ZDMA 4W82A 1DQNA 4REMA 5EKUA 4LZPA 5L3QB 3REQB 1YE5A 3ZWOA 2AX3A 4ZO4A 3U9TA 3LHIA 1Q2UA 4ZXFA 2YHAA 1C0LA 3BCHA 1GSHA 2JAWA 1CJKC 4BNMA 2F9MA 2IOFK 2J3KA 3DW1X 1BC5A 1TIPA 1WL8A 1L5KA 2JRCA 3UK7A 3EXFB 2BFBA 1QG4A 2GBGA 4HNQA 4DHEA 4YJ2A 1L7MA 3KEQA 1A27A 2YC2C 3PTZA 3TFQA 1OYVA 4MDHA 3TAXA 3FOWA 2ZK7A 2XAUA 1TUBB 3CE6A 1TYCA 2OESA 1SD2A 3IUPA 1B73A 1G6OA 1YKSA 3EFOB 2IIQA 3KSBC 2HWKA 3I2FA 1Y7LA 4PLHA 2JGRA 2WKPA 3EAGA 4RVGA 1B15A 3RYHB 4UZSA 1XUOA 4JB3A 3WRWA 5IAJA 1GOTA 3EBOA 4P83A 1P0PA 3WSWA 2WAOA 4F4DA 3AW9A 4DV1B 2JJQA 1WZEA 3DL4A 4FUQA 3ETJA 3FTPA 2J5XA 3K9FC 1GTVA 3N8GA 1WSBA 3DHWC 1EXWA 1IHPA 4LVUA 3WWYA 1C0IA 3JV7A 1EU1A 2ACEA 4RHYA 3R77A 4AJEA 4ZYLA 1TZMA 2PRZA 3MC1A 1OJLA 1DG9A 2HV8A 4W1RA 1L7OA 1QP0A 3Q9LA 4QFCA 1QFJA 1J06A 1DKNA 2XQGA 3F1KA 1GUDA 3GJ0A 4U2EA 4XLLA 3VHLB 3I45A 4MW9A 1YJQA 4BBZA 1QS0A 1EJ2A 1EX7A 1JQEA 3DFIA 3M6WA 3ODGA 2DGDA 3IH5A 4YQYA 3GLFB 3G5TA 3P5SA 1KYXA 1M1ZA 1P2VA 2B20A 4Y0VA 4E5NA 5KOIA 1RJFA 1Z8FA 3A0RB 1VI6A 4C14A 1KA9H 3QYPA 4Z0HO 5CA1A 3HO6A 1GCUA 3O4RA 2QUHA 1I01A 5FTMA 4ND4A 4EA7A 3OZRA 2UYYA 2WFAA 4IY1A 4ZOLB 5HQTA 5CIQA 2GBIA 1PR5A 3OU6A 4PRYA 3SXPA 2BKAA 3E35A 2X1MA 4MGKR 3SBOA 5JT1A 1R0CA 3H1EA 5G0TA 4DKXA 1MAAA 3H4MA 2OAQ1 1PEAA 1NLFA 1Q91A 2I6XA 4Q3CA 1Z8HA 2JNWA 3N8DA 3B9RA 3K15A 3N2NA 2HK8A 2V55B 4UMEA 2YWDA 4BNDA 4E2WA 5DBHX 1G16A 2QP3A 2VQSA 2DH6A 1B00A 2OOKA 2DT8A 3WMFA 1YZYA 2ZVDA 3D0KA 1ENPA 2RCNA 4ZVUA 2AZMA 1SKUA 3FJOA 4FHCA 3QMPA 1CS0A 2Z1NA 3N2LA 3ZE6A 3KXDA 4EI7A 5BYKA 1RI3A 3M6AA 1L4MA 2HXSA 1MO6A 4QUIA 2YFYA 3QMWA 3UOWA 3V2UA 1NW6A 2G77B 2VSYA 1LLFA 2VBGA 3JAWB 4AUKA 3B20A 4BN4A 2I1LA 3LOQA 3NXKA 1A9QA 2E18A 2FPLA 1ANKA 2IY8A 1N5OX 4JI3B 2CD7A 2YINC 3LF2A 1SVSA 2CW5A 3DE1X 3RIYA 3G0GA 1J5EB 2IYRA 1ZJZA 2JKZA 4DBVO 4YACA 2PMEA 1G4HA 1N6OA 1JI0A 1QIMA 1N5LA 1GQSA 2H48A 4MV0A 1GL3A 3RS3A 3JALA 1SA0B 1SOVA 3IIMA 4Y8VA 2BEVA 3B8EA 1N2SA 3AV3A 4I14A 2BC9A 3KEGA 3G0CA 3P45A 4U7HA 3D6JA 3GBVA 2R1VA 4JODA 3DMGA 4UFOA 2WPDD 1JR3A 2C1EA 3BIFA 3NM4A 3N0XA 1WW3A 4AS2A 4DIUA 2XRFA 2QE6A 2OCGA 2CDNA 1HT2E 3GNLA 4E2FA 2CT8A 2EFYA 3RADC 3L3BA 5KVCA 2WKWA 1YCDA 3LUDA 3NTOA 4BGUA 3QZUA 1UODA 3CLTD 3NAZA 3GA7A 4HNAB 2VJDA 1DWUA 2UYGA 1BMQA 1S8FA 4FYMA 4TGLA 4YJHA 3HZZA 5IJXA 2HC9A 2BM9A 3BFPA 1TMOA 3BXZA 3IMGA 4R01A 3TLZA 4KI7A 5KSYA 1M2OB 3AF1A 2Z30A 4TSFA 4CKBB 2ZAMA 1Z07A 3F2IA 1BHJA 1WEHA 5SY6A 1P8JA 2Z3VA 5CVDA 4M36A 5I7HA 4UOQA 2HYIC 1NVKA 3ZCXA 1AK9A 3DM5A 1DAKA 4WBSA 1JN0A 2A88A 1NOJA 2C82A 2ID7A 2PFSA 3D9QX 3F67A 3MTEA 3ND8A 4B3DA 1Y5RA 1ONOA 2VJMB 2Q4DA 2ZBQA 3CWCA 3F3KA 3IA7A 3WK4A 3MLAA 3O73A 2KW5A 3DOOA 1USUA 3OZWA 4XDGA 1MJFA 1RZVA 4GBJA 4NJMB 1M2HA 1TCAA 1CRQA 4F3TA 3HB5X 4B6EA 3M0EA 5CP8A 2VHTA 1LUAA 1FSZA 1J8QA 1R3DA 3JWIA 4W9NA 6YASA 5I8WA 4Z7OB 4AKGA 1QE0A 4RNDB 1II8B 1Y3AA 3I0MA 5BPFA 4MW2A 1U5CA 1FSSA 1GPDG 5JBQA 3STVA 1CJVC 1XZMA 2QV7A 1OT3A 1L5ZA 1Y1QA 5JJCA 3DBHA 3GH3A 2ENWA 4TQAA 4IIJA 4PVDA 1KK0A 1JA1A 1CIPA 1GEEA 2BKUA 2WF9A 1WMBA 3GJ7A 3L0PA 3EZXA 1TRHA 3X1YA 5AUNB 2VNKA 5K0FA 1XFDA 3KCNA 3OTWA 1TI7A 2YVQA 3P4XA 3U0VA 1X94A 3MWGA 4WCDA 1KO4A 4D9FA 5CAEB 2IS4A 3LDAA 4OGWA 4UVDA 1Z08A 4OQXA 2YWEA 5G0SA 4LXUA 5HS6A 4ZCTA 4G0XA 1DFGA 1CUIA 2ODBA 5JZVA 2PT5A 2W11A 1HQCA 1TYBE 3OQJA 4D4MA 1MA3A 3OF5A 5JNSA 3EOZA 1UL1X 4KYIB 3JVVA 1XF1A 1NIPA 4OQFA 2BELA 3T9EA 4II2A 1J1IA 2RBGA 5HKOA 1Y1TA 2AE2A 4C4OA 2VDWA 4FONA 5E0KB 4JA0A 2HHLA 3DLAA 2JLCA 2ZSEA 1XU7A 4MWBA 5IK2D 3BFVA 1JIXA 1IYZA 1NJ6A 3QF7A 4PV7A 4QASA 1YNOA 1VHDA 2PRJA 2ZWOA 1G0NA 2TSYB 2H16A 4BTLA 3OQNA 1R88A 2EBFX 2ZDQA 3BSWA 3MS7A 2JBHA 4CNQA 1ZJYA 4G97A 4J91A 1O94D 1E79D 1YCHA 1R8QA 2AC2A 4CW7A 2PGDA 5AM1A 3T3EA 3H11B 3KELA 4MOWA 1XN1A 4OQNA 3EPRA 3HR7A 4H1UA 1N6RA 2WJ4A 4C5AA 4CTJA 3CSDA 1AGXA 1Z83A 4F84A 2WABA 4WLVA 1YVDA 3PT5A 5LKRA 4W9MC 1Q15A 2BGGA 1USKA 3ER6A 1SWWA 4OQZA 5BRNA 3T9AA 4LHWA 1OWOA 2H1SA 4HDCA 5C37A 3QU5A 2Q41A 2OQ2A 3L6RA 3HA5A 4E6PA 1KZ6A 3UVEA 3T95A 3Q6IA 4HNTA 5E6SA 3GLQA 1VJDA 4J6EA 4TUYA 4YMWA 2Q6LA 5G4LA 5CH8A 1Q92A 5GGYA 4KEAA 4ZU6X 1VOTA 3CPEA 5E6RA 3SJZA 5A9RA 5AI0A 1XYGA 4O4LF 2FG5A 4DNXA 2IV3A 2R66A 3F0TA 3UKDA 3V7NA 1TM3E 2HSDA 3FYSA 2EJVA 5EC8A 1DQPA 1S3SA 1V71A 2M1XA 2PDAA 2ZJ7A 1YULA 1CY6A 4Q9JA 5F9MA 4QFBA 1LTQA 4CKYA 3HXQA 1YS6A 1NBMD 1MKYA 3I04A 2CUTA 3CF2A 1XRMA 3IE0A 2PPVA 5HVNA 1YI8A 4JUCA 5TX7A 1PYOA 1A9OA 3QEKA 3QWFA 3NGXA 2D13A 1W52X 1AO0A 1GG2A 2WUWE 3LLSA 1G7TA 2I7XA 4UREA 4XEHA 2NVUB 3RLIA 3T35A 4C0XA 4ILEA 4DZZA 4OL9A 1J0CA 3ZNPA 5L4LA 5DGDA 2HF8A 1M10A 1I2MA 2LIPA 2ODAA 5JRDS 1N2CA 1RRFA 1AUPA 2GK3A 3L8EA 4R84A 3DQPA 5DTIA 1FLAA 3SBDA 4CMEC 5BV2P 2O8CB 3K30A 1YAJA 2WYHA 3K16A 5ALEA 1SR8A 3GRFA 4ZARA 1S8OA 1KHTA 5CDGA 2YYSA 4IIGA 4BMXA 5IF3A 2W6MA 2FMKA 1XLWA 4Y2SA 4KQ9A 4BHTA 5F1OA 1RHJA 3CE9A 1NWCA 1KNXA 2XKBA 1ZM3A 3LC7O 3QEJA 4FILA 4ZP1A 2AL7A 3UICA 1NXOA 3WX0A 3UK1A 1KI7A 1QPGA 2OM2A 3M3HA 1HNWB 1CYEA 1OQAA 4GOMD 3RRBA 4ATNA 1FQJA 3P27A 2R6JA 1JBKA 1SUWA 4D9GA 3IV6A 4HMQA 3D6UA 4X91A 3OTGA 1K2WA 1G9XA 1QZTA 2Z2IA 4KW7A 5JNTA 3OKCA 2HRRA 4S24A 4E5SA 3R8FA 4MP6A 1T9HA 4CMIB 1E98A 2IYVA 1IWOA 3KTAB 1IB6A 4RK6A 1YZQA 4TTVA 3IULA 4HZIA 1T36B 3C3DA 3WIEA 4E70A 3IT2A 1V9CA 4UHJA 2W4MA 5SV2A 5LOVA 2G4LA 4WA8A 1G19A 4YV1A 4F93B 4ZTZB 2FOIA 3C1OA 2H2WA 5A3QA 1P72A 3N3BC 4O6VA 3KWFA 3L1UA 2EJCA 4S0XA 2C59A 1JEYB 3J7TA 1SEVA 3NB0A 1XRLA 2O2YA 1EVJA 4LJ8A 3N0RA 1QU3A 5HW0A 5JY6A 2EU8A 2H2FA 1F14A 1WWKA 1RZ3A 4M9UA 5DYTA 5GPBA 2NP6A 3HY4A 5CT6A 2DJ5A 4E5UA 5LQUA 2M32A 4MWEA 1Z7YA 3IHWA 4OHPA 2OV6A 1KBQA 1Z0IA 3JAKA 3NONA 4MW7A 4NBSA 2Z5VA 3PVSA 5IJWA 3A6FA 4S1NA 1E7SA 4CV2A 4K9QA 4OIFA 3Q1LA 4TVOA 2ILVA 2JA2A 3L05A 1PGPA 2X77A 2Q3CA 3KKKA 3PXAA 1VHJA 5ENDA 5F1YA 4YMHA 5EERA 3WLJA 1NLZA 5IZCA 5KAPA 5A62A 4JOSA 4CEHB 5KWSA 1JMKC 5FFNA 4K03A 3UV3A 1TQ2A 1DKPA 1W1WA 3IP7A 1X87A 1PWHA 1YJ8A 3SVTA 2BMJA 3FPGA 2E4UA 1QFXA 2ONKA 3FCAA 4RK1A 3HP7A 1DC7A 1C7ZA 2RGWA 5LXTF 2PO7A 3RRYA 2XOXA 3SZGA 5F2KA 3QPCA 4AS1A 5JRJA 1QGUB 2QORA 1ZAKA 4X1YA 3FIUA 4P4GA 3JQ9C 1MR3F 2KB0A 3RWBA 1NUAA 4DDMA 1P2GA 4J90A 2XYGA 4OAQA 3AHDA 3UBTA 2ZETA 3HPRA 4H0NA 4P36A 1D7OA 3C6XA 3NVAA 4TMTA 1O7JA 5CT5A 5LIRA 4D46A 2Y1OA 5A06A 3BD6A 3F6PA 3HZOA 3C5EA 5CYGA 1WETA 3EZNA 4C4ZA 2R6R1 1IZ9A 3BL6A 1I4LD 1VYTA 3MD9A 4ROTA 1ECPA 1YDWA 1G42A 4UVHA 2Y99A 2B83A 4L07A 3RIMA 3BEOA 1JKIA 3N7AA 3ROPA 4DY4A 5LKAA 3SLRA 3QLUC 1H8EA 3DBIA 3FAZA 4MWOA 3G6KA 4D4LA 3TTSA 3WQBA 2VHQA 3GXOA 3IPYA 4JUIA 4LUCA 3C3JA 1XAJA 4F2GA 4A2QA 5C9ZA 1G21B 3CLRC 2BTEA 2RAFA 4P2BA 3SYKA 2WHEA 1R0WA 2RH5A 2FWAA 1CUJA 3MMPA 4YJFA 1WW8A 4YCDA 2OO3A 5EQJB 4ALLA 4C2BA 3X1WA 2QJTA 5KINB 2DHDA 2IBMA 3FM9A 2JJYA 3JQFC 4I6GA 4R8KA 4N3BA 3A3OA 4I5FA 2QD4A 1XJWA 3BRQA 3H1PA 4MVJF 1JFFB 1XO1A 2QAGB 3ANYB 3R0VA 2OGSA 4BVEA 3UAXA 1EE2A 1KDPA 3H7IA 1JFSA 3E5HA 3HKEB 3NIDB 5HBGA 4FS3A 1CU1A 2A0XA 3IOBA 3GFSA 4PU0A 3EXFA 3VU9B 4BEBA 5BV8A 1VPWA 1AD2A 2QSYA 4PLCA 2F67A 2OPBA 1VCIA 3HK2A 2EP5A 4HT3B 1MABA 3OF2A 1GQQA 3DAFA 2DVMA 4PLVA 3T9CA 3A8TA 3NTUA 4EATA 3H2KA 3HCEA 3IDQA 5KCZA 3NOQA 5AKYA 1HDZA 2X9LA 4PRZA 5CB4A 1POWA 1W47A 5GV8A 4GLBA 4MCHA 2DWQA 3OJEA 3PZBA 3I9NA 2CMFA 2AHRA 3BA6A 2C61A 4JUFA 1YMUA 4E2ZA 1SXHA 2ZRNA 1PT7A 2ZU0C 4B2YA 8ATCA 1E6WA 4K86A 3RJMA 4BZXA 2WWGA 1Q14A 1JKXA 3FMOB 3A7DA 2NXJA 4UNQA 4MKXA 4HQKA 1EA5A 1NNLA 2YCLA 4JLAA 4DW8A 1KFCB 2QRQA 1IQRA 1L5YA 1UPUA 2FFBA 1H66A 2FZ4A 3ONDA 2P5SA 3TLYA 4EG1A 4Q7QA 5CRIA 4RTPA 3FRJA 2EF1A 3NHRA 1FW6A 2FPIA 3QE2A 2X0NA 2OT3B 2QR2A 3QUCA 3PWZA 2X4DA 4ZV9A 3RRXA 3TW8B 4D44A 3LTNC 4CFSA 2XQFA 4CJXA 4TS3A 3L07A 2QY9A 4RTKA 4QTUB 3SFZA 4JKYA 5J5CA 2L69A 3JQ6A 2O3SA 1EWTA 2CNKA 5BN4A 1KY4A 3C15C 4Q9IA 3BMNA 1FDOA 3EQZA 5JJLA 2DBVO 2ZTLA 3Q7IA 4L0DA 1DXYA 1EFDN 2YYAA 4K40A 1Z0KA 1CERA 5ABPA 3H3FA 1RIFA 1KBOA 2RGCA 3S2GA 4X66B 2OK7A 1QZXA 1F06A 3FCYA 1OI2A 4FUTA 4JI5B 4BUCA 3T12A 4YPOA 4KR6A 3GJTA 3NBZC 1T9BA 4FIDA 4W5NA 4EB3A 3NCTA 3UNXA 3RG8A 1A4IA 2OFXA 2P41A 3MJEA 3NORA 4BJHB 1M8KA 1HGXA 1NW5A 4BX0A 4BP9A 2GD0A 1GGFA 2O3JA 3BQ9A 3PI6A 1KE1A 2QT9A 5TMDA 4DMUB 1E3DA 3IMKA 3QI7A 4EJMA 4P54A 521PA 4L57A 1GUAA 3DAPA 2XDWA 5THQA 1EXNA 2DKOA 2OD9A 4DG8A 2FE4A 1F8YA 3AU8A 3ISTA 5JCXA 3FE2A 1T5SA 3O4HA 3QBEA 5JNLA 2WWWA 1EAYA 3V97A 1AKYA 2GFIA 2RGEA 2C7RA 1TGVA 1GM5A 4IFBA 5GONF 2WWXA 1NVVQ 4MHOA 1KEWA 1GKKA 3PFKA 1TD9A 5EHXA 3ESYA 1U2SA 2D6FA 1T3TA 4JLOA 3K1ZA 4E15A 5FUBA 2AXQA 5G4KA 2K2QB 2Q3LA 4BP3A 3WK9A 4E22A 1Y3DE 2AV6A 3K2QA 4CHTA 1RHKA 4KO3S 1XC7A 2P69A 2Z8ZA 3H0KA 2B2NA 3BBPA 1G8HA 2BEVB 3SJCA 4TWBA 4BIIA 2VDNB 1CYDA 3QVVA 5K6TA 4WJZA 3ASUA 2XNDA 3W1VA 1B0AA 1VRVA 5ELLA 2IP1A 3JD3A 3VDMA 4U2CA 4B5LA 4X85A 1XPRA 2CLEB 1QJCA 3MT8A 1WXWA 3X1XA 5AOCA 5AW3A 3QHAA 4JUBA 3VU8A 1U8CB 1UKVY 2HCFA 4HKTA 4E14A 3SWWA 3PUIA 1WG8A 1WUHS 2NZXA 1YZFA 4WEOA 4C7BA 3U4QA 1NU6A 3PGA1 4UCFA 1SVLA 4IJVA 2OZKA 3LCMA 3WJAA 1T8WA 4HAVA 4R54A 2BY4A 3PGVA 4IL5A 1HFJA 1N5IA 1H1LB 4G0YA 5DXFA 2PX4A 4EGSA 1XEFA 3C7KA 3KLPX 1QF9A 1RAIA 4HS4A 3F3MA 2WWFA 1PI3A 4GH5A 5BN1A 3KJZA 1DQZA 3PQ2A 4E88A 4PHCA 4QQRA 2BBWA 4IHJB 4QG7A 1D07A 1W7AA 1ZKMA 3I8XA 1GLNA 4YRPA 1YO6A 2MSWA 5K0GA 1X8KA 1KDVA 1V8OA 2NADA 1ADJA 2OAEA 3OQIB 1VXOA 1FU7A 2CFCA 4QX6A 1Z5ZA 2VJMA 1D3AA 4BJ5A 3I37X 4RD6A 1IUPA 1R8SA 1RYEA 2UZ1B 3CX6A 2I1WA 4HADA 2LE0A 2RHRA 1DT3A 3USCS 1RJWA 4RHTA 4CF6A 2C84A 3KJFA 1CV2A 4D9BA 1L8QA 3EDRA 2AN5A 1KI4A 2DCUA 2HOQA 4HMOA 3FUWA 3RLFA 2PUBA 2Z6UA 4OHYA 1KOJA 4IGFA 2LGJA 4IKPA 2P0AA 2QJWA 3EA0A 1AKMA 3IOMA 1AV7A 2CJWB 2GN4A 4MHTA 1QTRA 5TIIA 4PICA 5EHQA 2HK7A 1A7AA 2JFGA 2YWCA 4G85A 4OHKA 1KPGA 1KJYA 1T8RA 1ZBDA 2O2EA 1ONSA 2AK3A 2FQXA 1V8DA 5ERYA 4WBNA 1MPTA 3GLGA 2O57A 3C45A 4C76A 1Q7CA 1FX0A 1QDLB 4JB8A 3L92A 1T9CA 3PDUA 5E9AA 5CDSA 3NBAA 2E89A 3HB7A 13PKA 3BQMB 3SQDA 1NVVR 3ONWA 4HGNA 3IXQA 4N47A 2GF2A 4TRMA 4JYZA 3CRW1 3MILA 5HZGA 5AJYA 1C29B 3EUAA 5J2TB 4DLVA 4GLLA 1EX9A 1P5RA 1N2HA 3A2LA 3KKLA 4HPWA 4AD8A 2HQSA 4LY6A 4JASB 2O0MA 1JXMA 1ES9A 5J1TB 2VOEA 1KYIA 1I7LA 3RYFB 3PQDA 1ZK0A 4GWGA 2Q4BA 2YDYA 4KAXA 5AK6A 1IN8A 1IOVA 3HKCA 3QWAA 1ZO8A 4KV7A 2CVFA 2DU8A 3S28A 1JB9A 2XDQB 4IZIA 4INPA 3SBEA 4CQLB 4MICA 3EC2A 1XDSA 3COYA 3DH0A 4YJ3B 4TXHA 4KR7A 1JQ3A 3AONB 5FA5A 4CDRA 4X71A 5HX7A 1AGRA 2QRVA 2ZBEA 4H35A 3L7DA 3KALA 3BD9A 2O8FB 1J9EA 2WNIA 1UZUA 3H11A 2B1RA 4A15A 1AN0A 1LNQA 4YJGB 2ORIA 1AHPA 4W8OA 3THOA 5EJ2A 4XX1A 1AGNA 4GSLA 3CR8A 1LF0A 2OOSA 3UBMA 4KLRA 3RSFA 5IBCA 1SU6A 1UDAA 1L5SA 4Z4EA 1D0VA 4NU5A 1ZEJA 4B2LA 2R86A 5F5NA 3GT4A 4PG6A 2BFPA 3A1UA 1CG6A 4JXJA 3MT0A 2CFTA 1NUHA 4YRCA 4C7VA 1NMYA 1E8DA 1XCJA 2XKJE 2QN2A 3OE5A 1U2EA 1J90A 4KGVA 4LC9A 2GD2A 1M1UA 3ROMA 5KYVA 1GA6A 1Q1ZA 3QVKA 4UATA 2AQHA 2OV4A 5E9JA 1UAYA 1L7DA 2X0FA 4RA9A 1BVHA 2GI4A 1NRIA 1R6VA 2GPTA 2ZSBA 3MUOA 3CXRA 4WZBE 4KQXA 3H2JA 5EPEA 5KYYB 4X7MA 2BFNA 3OSZA 5DHSA 2EFHB 4OB7A 4ENWA 4A91A 5H4GA 3CWZA 2IEIA 2FGKA 3CMMA 4NHEA 2JLWA 5K8LA 3GAAA 1HM5A 1XLTA 2UVPB 2AKAB 4DV4B 4HN2A 2YUIA 1GRRA 1R6AA 1V2GA 3VISA 2VP5A 1W36C 3E1GA 3GPCA 2D1QA 2Q3JA 3JQBA 3PI7A 2X41A 4RO0A 3MM4A 4J0CA 5ALFA 3DP7A 3RGWS 3SX2A 5EPOA 4E3WA 1NW9B 3EXG2 5JS2A 2FSHA 4JVOA 1CDOA 1XEAA 4C0AC 3U3OA 2DWPA 3JYHA 5KC8A 4HLCA 4AULA 2YY6A 1SOMA 1SZJG 3A1EA 3CW2A 4RA6B 4YLYA 3WI7A 3WSTA 3NOOA 4E1AA 1ZESA 3A6DA 1O87A 2X9NA 3RYCB 2A5DA 3BIOA 4ZDWA 2F64A 3PTAA 3ZVNA 3TMAA 3Q2IA 3LDHA 4OOEA 2XUOA 1USGA 3HJBA 4WIAA 3U3MA 3VX3A 5C7LO 2WILA 3BN3A 3OCCA 5BVHB 5LDDC 2ES4A 3I32A 4OHFA 5DHTA 5E3IA 4EKEA 1E1RA 3FYHA 4HH4A 1GPYA 4TL6A 1DRKA 3IXMA 3RDPA 3AOEA 4UCWA 1VJ1A 1JEOA 1CJBA 3LQYA 2FPOA 4C6TB 1VHTA 1E6EA 3MWDA 2OBFA 3HEAA 3LY7A 3PJGA 3RF6A 3ZY5A 4CMIA 4YRSA 2P8JA 5GP1A 4IMIB 1WY7A 5BNFA 4TWIA 4YYZA 4X6UA 3TGWA 5L51A 1J24A 4IIDA 1PNRA 3QYJA 4Q3EA 2D1SA 4OI2A 1HE4A 4DMRA 1M72A 1Q22A 5D01A 5THKA 4RVOA 3YASA 1GYQA 1U0HC 1NP6A 5I5EA 3ZE8A 2H0RA 5EIEA 4MWSA 4F5EA 5C35A 2OO7A 4HGQA 1UJ2A 2XMGA 5DGXA 2I1QA 1VMIA 1WXFA 1RZRD 4UARA 4L0CA 4ZAWA 5LMUB 1KMNA 3RT7A 4E94A 1K5PA 2JVJA 4QUBA 4UTZA 4A1FA 1E18A 4B3BA 1QTIA 4GS5A 3QU7A 4UNSA 1U7HA 4G8BA 4X63A 4EFLA 4BFYA 1K3TA 1V7CA 1VSVA 1OV4A 4JXXA 4I1IA 1E0DA 3A27A 1YBVA 3FLEA 2Q4OA 4G3XA 4MYUA 3BXEA 3KXKA 5AVVA 1R8XA 4EK9A 1BCRB 1F8UA 3AOEC 3NWEA 2F8TA 3IVRA 2E85A 2P7IA 3FHTA 3ACBA 4OXNA 5SZIA 3UHPA 3I6QA 1RFLA 1XTBA 3GCDA 4N82A 2ZM6B 4LE0A 3H2BA 1LTHR 3HU5A 4KDFA 3WFIA 4UOZA 2AEJA 1UBJS 1L1QA 3OM8A 2XWSA 1T8TA 3CPJB 2SKEA 5CD1A 4QO8A 5DBOA 1F6BA 1GAJA 2C0PA 5DMXA 5LYJA 4NMWA 3ED5A 2OBNA 1R4NB 1DJOA 3OCYA 1M6HA 4IJMA 1QX4A 5TMEA 4KIJA 3DEFA 4P98A 4BDTA 4AKIA 1US8A 4EVRA 4QTXA 4HHEA 2XYHA 4LRQA 4FDUA 4Q47A 1CUAA 3PC3A 1U80A 3TZHA 2IU6A 4JR1A 4TLLB 5HKKD 1S7GA 1FOEB 3D7LA 3ND5A 4LNUB 2PY6A 4JGIA 1XRRA 3BGWA 2Q8NA 3W4KA 4G01B 1UK8A 2ZT6A 1NYLA 4MMXB 1YUBA 4WMLA 1M1YE 1XTVA 3G8AA 3TTWA 4D4JA 2FZLA 4EZBA 5K45A 3UAZA 4HSGA 1RPAA 2AJCA 3BULA 4Q6WA 1BDIA 2W6JA 1W4BA 4FXOA 5ADWA 1KZ1A 3SS8A 1B23P 2EERA 4CT5A 3KTFA 3SF8A 1WE2A 1PNQA 1BJTA 4B0OA 3CLVA 1Y3IA 3QFFA 3ZVKA 4ZRDA 3QQPA 1D2AA 3IRUA 4Q1BA 1UOQA 1VRCA 5G1NA 2ATXA 2H4FA 4GZLA 2WDPA 3CT6A 3OZAA 3BQNB 3WMXA 3TBKA 1BGXT 3F4BA 4QXRA 1R6DA 4WKBA 1U3VA 1XRPA 3PHIA 4A0SA 4B75A 2H2IA 2IYYA 3LT4A 2VXCA 3CCCA 4RNCA 2GNPA 5IDXA 4K8RB 1RU3A 4UUNA 5MGBA 3DD5A 3EXHC 2OO5C 1J7JA 1KFEB 1FUEA 4IRMA 3TEMA 5K3OA 1K88A 4GFDA 2XBUA 2H7VA 1B42A 2VYNA 4BLQA 2PUFA 1KOLA 3PL1A 1MHPA 1A8UA 2HYDA 2Y0BA 1ZMXA 2VJNA 1KAOA 4NEQA 4BVAA 4EMTA 2H52A 5IF9A 5K2OA 3ET4A 2F90A 1ZIYA 1ACLA 4BNYA 2QRZA 1MFZA 2AHOA 5CA0F 3GAFA 2G9UA 3NFYA 4DR4B 3H18A 5EIFA 4EARA 1MAWA 5JDIC 3S29A 2RGXA 5FEUA 3FZYA 1KZ4A 2HJSA 2R8PA 3WL5A 1KSJA 3FFWA 5DP2A 3IUNA 4BBAA 1GRQA 3G5AA 5K1ZA 3EX7C 2ONZA 2YZKA 2EIXA 2ZZMA 4RHCA 1U8EA 2O4CA 1EFCA 4MUXA 3ZLVA 2VA9A 3GRVA 4B84A 3OTIA 4B6FA 1GZ5A 3KHTA 3TW8A 5HFAA 5KTSA 1RQXA 4Q82A 2C9ZA 1B8NA 4BLSA 3BHJA 3C97A 3TSYA 1D2RA 1A9SA 3IQZA 4EABA 5DSTA 1E1QA 1GP2A 4PTZA 2BE9A 2K2WA 5FYQA 3STHA 1YRQA 4R1SA 3SJUA 4C3UA 3IMEA 3U7GA 1EM6A 1WU7A 4N8EA 2H5IA 1V6SA 2W6NA 3GI1A 3RYTC 4YMGA 3BXHA 4ZI2A 2OK8A 1MO2A 4BAZA 2GDZA 3IUYA 4OK5A 1X1AA 1Z56C 3S2EA 3S55A 1PG0A 4DCJA 1L3BA 5JNUA 2FDCA 4EFMA 1A82A 3D64A 1ZY2A 4L9SA 1ND5A 5AI6A 3LNCA 3TH5A 1Y6JA 1TQ6A 3WK5A 4GKAA 2YKGA 3ZUPA 1Y1PA 4UUPA 1XNRB 3WHKA 1VA4A 5HRAA 1FTGA 3KXIA 1NN3A 5HF5A 1ZQ1A 2ZBPA 1YB5A 4GWKA 4JB2A 3BJRA 3NU1A 2VKQA 1C9DB 1ZMTA 4B6JA 1H85A 9GPBA 4PBTA 2KJQA 2O8VA 3GEPA 3B9BA 3F3YA 4M54A 2WA1A 5AXDA 3JQGA 4AXXA 1A8IA 1YOBA 1UXHA 3PFHA 2VQDA 2ZFUA 2XUDA 3K9WA 1VG1A 3IAUA 5B4UA 4GE3A 2DUNA 3BDAA 1HEIA 5ETJA 3V32A 5B2FA 1GQOA 1U1EA 1Y82A 2QD1A 4K6GA 4ZODA 1IN1A 1W5AA 3U80A 4TMZA 5EUMA 5H9VA 2AQ8A 2CXSA 2P62A 4QSHA 5HTOA 1JH9A 1VPDA 3NXSA 4PC1A 3FJ1A 5HQ3A 1E2MA 1C8BA 1OHHD 1OJ7A 3IDZA 3OFJA 5KTYA 3CPHA 4I50B 1FYFA 5LPNA 4RJ2A 4FQ8A 3R4VA 5B7PA 1D4ZA 1SVOA 1F2TA 4CT4B 2WIAA 4BO2A 1CIJA 1A9RA 4CR8A 5KDOA 3KEMA 1NKSA 3TGLA 2OD2A 3RK4A 2W2QA 2W8ZA 3PNKA 3PU6A 1AQYA 3WWPA 2A84A 1NVEA 2CXTA 4PLTA 4BNWA 4C30A 2J4DA 3WAGA 3FCXA 4Z7NB 1DSSG 1SBNE 3KL2A 3BFJA 3WLIA 4DVJA 2OCBA 2XMCA 1KQNA 1MZVA 5TC4A 3FPSA 2C5EA 3QITA 2QEQA 4ER3A 3Q3HA 3AF5A 4TN5A 1T26A 4EVSA 1RBZA 1ZHFA 2P9QA 4Q3LA 2FHPA 1N8TA 4MUGA 4RZIA 3DDZX 4Y1EA 2ZRCA 3S99A 2OBXA 2ZJ2A 2ZWAA 3AHGA 2ODNA 3GGDA 4JZKA 4KN6A 4DJFC 4HNUA 4I5IA 3TIGA 3LZDA 4D2IA 2GWRA 3PXUA 2XXAA 4JT4A 4W7SA 1KO8A 1PYDA 2H2GA 4Z4QA 3DE7X 1ZMBA 3P2JA 3PP8A 3EDYA 4LV8B 3V1LA 1N7HA 1FDIA 1G8MA 4W1QA 2HGZA 5J40A 2BEWA 1ODCA 3NCHA 3FDJA 4GI5A 2BDEA 3G2PA 1N9GA 4GP7A 4EFKA 4GD3Q 1C1YA 2BLLA 4LK3A 1WY5A 3WJ7A 4HO1X 4WRRA 4B32A 5JADA 3A3PA 5ALOA 1G17A 1Z0DA 3I3OA 3O82A 1Z2PX 4OSEA 3J80A 2CLSA 1GTSA 4AJIA 3MFQA 3UUGA 5TR9A 3T4XA 4UMFA 5T4BA 5CFQA 4M9XA 2XB6A 1JHQA 3M9LA 1NI4A 1SC6A 2WKQA 2O06A 1UT5A 1SY7A 2HJWA 3KLBA 4JEIA 2OGZA 5FLEX 1MB0A 4WAUA 3UA4A 3ZGXA 4RM3A 4QOFA 5EGNA 1SD1A 2IUFA 3LWNA 1RHRA 3S6JA 4BQQA 3E7FA 2G06A 2I34A 3CV3A 4WBNB 4HB0A 4ZYZA 2DUJA 5K99A 4R2LA 1M6EX 2EQBA 2Z2JA 4IDDA 2Z08A 3FKSD 1T3ZA 2AF3C 4K88A 4OJKA 5U4XA 7REQA 5MFZA 5TVGA 1E3EA 3LW8A 3NP7A 4NZYA 5FIUA 1CF2O 4KVFA 2NZUG 4L9AA 1ZGHA 1IIBA 1RCUA 1QUFA 2WJIA 1NYTA 3JALB 3KHUA 4IJWA 3M6FA 5EJIA 1P3JA 4AF8A 1U81A 2F7SA 1SBYA 5IDWA 4MS1A 1J9ZA 4CUJA 3P0FA 2NSDA 2XSZD 2YN0A 3I72A 3HDQA 5LZ7A 4LYAA 4CIDA 3P32A 1T1GA 5D7BA 4KKVA 1WXEA 5B64A 3W5IA 1H05A 5AQEA 2C42A 2C0CA 4B2PA 4CQLA 1TDJA 1X1SA 3SDBA 1L7RA 4YRLA 3LC1O 5JXGA 3UMYA 2R8RA 5KAMA 4MDFA 2HHCA 1A2QA 3N0TA 1SVUA 2I3DA 2PK3A 4YH1A 1PP4A 3D0RA 1LVGA 1E1CA 4FJ1A 1YC5A 5G2OA 2OBBA 2HCTA 3A4MA 3L4SO 3T61A 1Y63A 3VDRA 4DLKA 4PN7A 1A96A 4RSGA 1RKUA 1TJPB 2AMYA 1UR5A 3A2NA 3QWIA 3UXEA 4B8YA