2F5CA

Bacillus subtilis manganese transport regulator (mntr) bound to manganese, hexagonal crystal form
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
140
structure length
140
Chain Sequence
TPSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKKTEHHNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator mntR
publication title Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 54
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2f5cA01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2f5cA02
4KNYA 1P6RA 1XCBA 4KFCA 1B4AA 5LHGA 1FP2A 1J59A 2RNJA 5CYVA 1K78B 2W57A 1YG2A 2IRFG 3E5UA 3I4PA 1FSHA 4M9XA 2BBYA 2GZWA 2F5FA 1W5SA 3RPUA 3MZYA 5E8IA 1VTNC 5CVJA 1KA8A 2P8TA 1U8RA 2KIFA 1XGNA 1S3JA 4MEYF 4YIFA 2MH2A 3CLOA 3BWGA 2O3FA 4BXUA 5FLXZ 3KP3A 3I5UA 2P5LC 1YTYA 2ZMEA 4UUVA 3GLXA 1F9NA 1AWCA 1Z1DA 3GO5A 1Z6TA 1LVAA 2Y48A 5FFZA 5A2QZ 2P6SA 3LA2A 4UV8A 5D8KB 4MQVA 1W4MA 4IXAA 3VOEA 3JTHA 3LA3A 1BI0A 1ON1A 4HBLA 5AIPA 3O6BB 4A5NA 4PCQA 4LLNA 3TOBA 3RIRA 2YX4A 3FM3A 1G6NA 4M6XA 4YFKF 4B8XA 2VOPA 1IAWA 3P9IA 5DYMA 2BYVE 1R7JA 2ESNA 1WSUA 3JAMZ 3I64A 3EQLF 2BE5F 2NS0A 3L09A 3PQKA 3J80K 4CYDA 4LG0A 2FBKA 3EETA 2ADUA 2PMUA 3TQNA 5L3EA 1Z7UA 3DKWA 1H9TA 4L18B 4YFNF 3HRTA 3E97A 5HDGA 4L9NA 2DI3A 2DLLA 1J75A 3F6OA 2CWEA 4I02A 1IW7F 4RB0A 4HQEA 4DNCA 1YO5C 1IN8A 4HAMA 5AIQA 3I59B 1KU3A 1F1ZA 4Q47A 1BC8C 4M9SA 1IN5A 1W5TA 4U0YA 3E6DA 2PFBA 1QGPA 1DPRA 2H09A 3HSFA 2CQKA 2PBIA 1ZH5A 4RAYA 4LGWA 4BAYA 1UFMA 5CVIA 1AOYA 2FOKA 3DXJF 2YX7A 3CO7C 2OZ6A 3LQQA 2Z99A 2RDPA 3ELKA 4IRGA 3D0SA 1XSVA 3K1MA 4WCGA 2XV4S 3RKWA 3F8NA 3IWZA 3E6CC 1P4AA 1KGSA 4MTDA 3K1NA 4CHUA 3BOQA 2PI0A 4TV7A 3W6JB 3G73A 3QU3A 4P9FA 1O57A 2VC0A 3LQRA 3SZPA 3T8RA 1WI9A 5CVUA 1KYWA 3FMSA 2DK5A 3I0TA 4PGHA 2XKPA 1TLHB 3LSTA 1G3TA 3HSRA 2M5WA 2EK5A 3MEXA 1XD7A 3QOPA 5BOXA 3AAFA 5ICEA 3E6BA 1U3EM 3IC7A 3MQ0A 1ZARA 1W7PA 4WXCA 4KN7X 1ZGAA 2OQRA 1ZLJA 3J81Z 4AWXB 2KKOA 1FZPB 1S7AA 3MCZA 2XAHA 4EJTA 4XBFA 2L01A 1LNWA 2QENA 2VN2A 4I0AA 3DF8A 5H6RA 5JHUA 3OV8A 3RDIA 3HRSA 2M30A 5E18F 3WU0A 2DAOA 4IJAA 5DUIA 1V4RA 1LB2A 2WC2A 4O6JA 3ZMSA 3K1PA 2RGVA 1R58A 1TW3A 3EYIA 1EH6A 3U1DA 1R5GA 3REOA 2RKHA 4M74A 1EH7A 2MBFA 3P9KA 3R0JA 4UVAA 4PGGA 5DCMA 3TO6A 2H94A 3PFIA 1FP1D 3H3ZA 4L5JA 2IA1A 4N9HA 1L0OC 5FB2A 4A0ZA 2GWRA 2XIGA 1XCVA 2FE3A 4EJOA 4O5VA 2DFIA 2AS5F 2HZTA 4L0YB 2UZKA 5AONA 3F72A 2STWA 1YFHA 4PDKA 2HTSA 5H6QA 1FBSA 2P7VB 2K4JA 3TGNA 4N9IA 4RB1A 1FBUA 2HYFA 1I27A 4EM0B 2CGPA 5DCFA 1SD7A 2M8EA 3FXUA 3HYIA 2P5VA 4FT8A 5L3GA 2JRTA 2JZYA 2JT1A 4HLYA 2JSCA 2ISYA 4D0PA 3GX4X 1U6GA 1SMTA 2ACJA 2L4AA 4OMZA 4AD9A 2DPUA 1W7PD 2H6BA 3K69A 4A0XA 1R1UA 4MGRA 2QBYB 3CDHA 4P55A 1T38A 5F64A 4OINF 1CF7A 5HS8A 2ZNYA 2EFQA 3BJAA 2YR2A 1BM9A 1Z6RA 2OZUA 1MZBA 1TQMA 1FT9A 1V3FA 5K5QA 2OQGA 1U78A 3T5XA 3HIFA 2IA2A 4IF4A 1ZHFA 1U5TA 1KU2A 3CJNA 3ERED 4I09A 3B02A 2F2EA 2NRAC 5J8FA 3FHZA 2IJLA 2VONA 1FWZA 2V1DA 2PLYA 2GXBA 3ZMDA 3V8JA 3F23A 4ENNA 2C6YA 3SFZA 1SFXA 2VXZA 1MDMA 3ECHA 3CUQA 3SZTA 3KP2A 4HX4A 2P7CB 1XDSA 2DO7A 4JQFA 3R4KA 1BC7C 1IN7A 4KICA 4RAZA 1FYKA 5LEKA 2XKOA 5FGMA 1XGSA 6PAXA 3WTXC 1FC3A 3GVAA 3F21A 1E2XA 3U9GA 2PJPA 1P2FA 5E1WA 3GFJA 2ISZA 1DDNA 2H6CA 1QNTA 2K86A 5HS9A 4WK8F 1R22A 3WGGA 3WU1B 5ILVA 1RNLA 4U7BA 4ETSA 5E1XA 4L0ZB 2O61A 5ICFA 1SFEA 4EQQA 1BJAA 4GYGA 4QWQA 3TDZC 2V79A 2GA2A 5TJJA 4WF2A 1FLIA 4M72A 4ZZDA 1YW9A 1QZYA 3GXOA 2VBXA 2OD5A 2ZMEB 2XRNA 3WE3A 4MEXF 2D2WA 4HOBA 2QWWA 3RYPA 5CJ9A 4XLNF 2X4HA 2TDXA 4HLXA 1ZN2A 3I54A 2G9WA 2MH9A 3GZ6A 2D1HA 1LEBA 2VT2A 3F3XA 3IKVA 2M1BA 1I6XA 3HRUA 3PQJA 3LFKA 1EV7A 3Q5FA 4HYEA 3DEUA 4LJZF 1OYIA 1I1GA 3KP6A 5DD8A 3TOAA 3V8KA 3C18A 2MD5A 1J0RA 5LGUA 1K7AA 2CSOA 2P4WA 1DUXC 1JE8A 2M87A 2RQPA 2PN6A 4BYYA 5H20A 2D45A 2QUFA 4HV5A 2G7UA 1BOAA 4CZZA 5F6FA 2Q2EA 2MA3A 1YLFA 4MTEA 1KU9A 4LG0B 4GO1A 5KK1A 1UCRA 2HFHA 4A2UA 3V7RA 1OR7A 1P4WA 4UHTA 5CVVA 3T1BA 2ZO4A 1YIOA 2XVCA 1E17A 1KQ8A 5DD4A 1LDKB 2MLGA 3FXRA 2VBYA 1U2WA 1S6LA 1STZA 4PZJA 4KT5C 2QQBA 3WTUC 4IHTA 4ESFA 1LDJA 5LLQA 3C7JA 2HQRA 4LK1F 1G3WA 3WG9A 1O3QA 4BNCA 2GQQA 1LQ1A 3LAPA 3HUGA 1RZ4A 3RKYA 2K27A 3MFKA 2A6HF 4S05A 1K6OA 3BROA 2QQAA 3BJ6A 5HVQC 4LLGF 2W85A 4G7OF 2HR3A 3EUHA 1JGSA 1ZG5A 4UXNA 2K7LA 2XAFA 3ZP5A 1DPUA 3JW4A 1BI3A 3NEUA 3QRFF 3M1EA 4A12A 3KZZA 4G6DA 3HRMA 4ENKA 4NHJA 3NRVA 3QPTA 1CGPA 3KEQA 1F5TA 3KP7A 1D5VA 3R60A 4EJWA 3FZVA 2ETHA 4ZZLA 4HF2A 3F8BA 2OA4A 5E8GA 2VC1A 2IW5A 3QP5A 1ULYA 2Z9OA 2LF7A 1O3SA 4RGRA 4CICA 1WWXA 2WWYA 4CXFA 2A5YB 2FU4A 4M73A 4KA4A 3ZMZA 1REPC 4BHBA 1UHMA 5IT9K 1QQIA 1FBQA 1FSEA 5LRSA 3M9AA 5D8LB 1UHWA 1PP7U 2GXGA 2HKXA 3V7SA 4HV6A 3ZN0A 1YS7A 3J80Z 4GCVA 3ABUA 2H27A 3OOPA 3FF5A 3K2ZA 2EFOA 2RV8A 2BEOA 2ZCWA 3RPQA 2A61A 2KJBA 2HOEA 1MKMA 4HA8A 1YQAA 3WGIA 4U7DA 5BQTA 1I5ZA 3RYRA 1TNTA 3WE2A 2A6EF 2EFPA 5DCMB 1HW5A 1XDUA 4CO8A 5L3CA 5J6XA 5HLIA 4G7HF 1XN7A 2VODA 3DP7A 4MHGA 5FFXA 3RJPA 4ENJA 4HZFA 1J2XA 1TQIA 4LB5A 3NQOA 3ZMVA 5HS7A 1B59A 3WTVC 5HLHA 2NNNA 2YSRA 1FY7A 2PEXA 3IL2A 2W25A 2NYXA 1BIAA 1P4XA 3T0YA 5DUKA 1QPMA 1XMKA 1DP7P 3I53A 2ZXJA 3C3WA 3ROUA 2FXAA 2JPBA 2K02A 5JR3A 3MZHA 3DFGA 1O7FA 2VBWA 2XGXA 1U5TC 2QYOA 1WRJA 4AIJA 1IN4A 3P9CA 3ZN1A 4P96A 3KZYA 1UB9A 4OIQF 4KYWA 4H0EA 1ZAOA 3GFIA 2FMYA 3BPXA 5F1RA 2HTJA 3WTZA 3F6VA 3CUQC 1FYMA 3KEOA 4KIFA 2IP2A 3BPVA 4ESJA 1S7OA 2R7FA 2PQ8A 4U0WA 2LDUA 1RUOA 1R36A 3DQVC 2P5KA 3L2CA 4NB5A 2RC4A 1ZRDA 4FX4A 1LEAA 4A5MA 3FM5A 1FYLA 4OIRF 4A0YA 1ON2A 1U5TB 4F7ZA 3G3ZA 1J9IA 1H9GA 1L3LA 4MQ9F 4G94A 1IF1A 4EV0A 5JI6A 1MGTA 3E3VA 4Q5SF 3WTWC 1MDMB 1ONVA 1IUYA 5CLSA 1H0MA 4L9JA 3U2RA 5E1ZB 2RN7A 5LGNA 5ILUA 1O7LA 2FF4A 1X3UA 2YU3A 3F22A 2W84A 2R3SA 5ILSA 2Y75A 4M71A 5HLGA 3HTUA 3LWFA 1ZLKA 5E20A 4I01A 4IVNA 3F8MA 4LFUA 3H3UA 3VEPA 2AXLA 3CTAA 2KJCA 3RKXA 3JSOA 3L9FA 3JSPA 4FX0A 4K2EA 3TO9A 1KYZA 2EB7A 2J5OA 2DBBA 2ZBKA 4A6EA 3QAHA 4Q48A 3ML6A 2LNBA 3KE2A 4CGZA 1HSTA 1HW2A 5D5UB 2IVMA 5D6EA 3ZPLA 1HW1A 1HQCA 3I58A 4BH9A 3V7CA 2F5EA 5FD5A 2Z3YA 3DPLC 4Z2YA 3K0LA 1TTYA 2WV0A 5K5OA 4L9TA 5JVTA 3LAJA 4EJUA 3P7NA 2G7HA 1RUNA 2VT3A 4RGXA 3F8CA 3GWZA 4OOIA 2JPCA 1MJ9A 1OMIA 3Q9VA 4XSZF 3L7WA 4LLLA 3IRQA 2EA2A 2FEZA 5FLXK 4EMSA 4R79A 2O8XA 1SMYF 2L3DA 4A6DA 2OBPA 3BDDA 1YS6A 3DV8A 4Q4ZF 2JTVA 2E1NA 4HX8A 4P9UA 1BI1A 1R23A 3RTRA 5D4RA 2HWVA 5A2QK 4WXHA 4OIPF 4BHCA 1IXSB 1HSJA 1HKTA 2DW4A 3ZMTA 3KCCA 3FWEA 5EEHA 2UXXA 1MJAA 4I98B 4E70A 4IRHA 5J8CA 1G3SA 3ECOA 2F5DA 4G6QA 1FNNA 1GHCA 1O3RA 3TKYA 2STTA 4HW0A 4HX7A 2P6TA 3SQNA 3WTYC 2QM3A 2HDCA 4I0BA 4LMYA 3HOTA 4LD5A 1D3YA 5D5WB 3JAMK 2DK8A 3GYHX 1T98A 4ESBA 3HTSB 2E7XA 1MJBA 1R1TA 3ULQB 1HXDA 3ISPA 3LA7A 2W24A 5LBQA 2LKPA 5BMZA 2BGCA 5D5VB 5HDKA 4KN4X 2DU9A 4QLCU 1T2KA 2Z5UA 3HHGA 4KMFA 5FD6A 1PP8F 1QZZA 2QQ9A 3BJOA 4DQ2A 4EJVA 1IZ1A 1WKMA 4R1HA 4GXOA 2CG4A 2A68F 4GYIA 1K78A 1Q1HA 4P5OA 3FMRA 2XHKA 2NAZA 4RS8A 1R00A 3IKTA 5BPIA 3RI4A 3COAC 2GIVA 3M8EA 1IXRC 1ZYRF 2J5PA 3DPTA 2GA1A 2EA4A 2RVCA 5ERIA 1GVJA 3MAJA 1B9NA 2F5CA 2IPQX 1Y0UA 1BN5A 1ZRCA 1XGOA 2FA5A 2PG4A 5DDGA 4G8XA 3WGHA 2EFWA 1T6SA 1XB4A 2LF8A 1FOKA 2KRFA 1GXQA 4JK1X 1IRFA 1USTA 2UXNA 1IRGA 4IHSA 4BHPA 2HGCA 4YG2F 3KP5A 4RB3C 4U88A 1R5HA 1QO0D 1NHAA 4YIIA 2VBZA 3I71A 2L02A 1SD4A 2O0YA 1YW8A 3D5LA 1MD0A 2EV0A 2VE9A 1RIOH 4M9ZA 3V4GA 2ZJ2A 2HS5A 4AIHA 3CUOA 2L54A 4U0VA 3J81K 4HF0A 5JFRA 2QZ8A 1KU7A 1C0WA 1OKRA 1ZG1A 1FPQA 2XAQA 2D1VA 3R61A 4ZYEA 1T39A 2CFXA 1SFUA 2FRHA 5LEJA 2LSOA 3SXYA 1OPCA 2IT0A 3N97A 3E6MA 2FSWA 2EV5A 4I7HA 4UNOA 2UWMA 1EH8A 1Z91A 2QLZA 4IPAA 3WTTC 3TDUC 1SD5A 1W7PB 4M6YA 4WXDA 1B6AA 5ICCA 1YYVA 3I59A 1P92A 1Z05A 4HDUA 1ZREA 4WWCA 3EYYA 5E17F 4HF1A 4LB6B 2GAUA 2EFNA 3GF2A 2HKOA 1OYWA 5BPDA 1IXCA 1XSXA 3QP6A 3ABTA 2R7DA 3Q9SA 1SAXA 3HSEA 2KIUA 3EDPA 4G9YA 3JTGA 1F4KA 4KIBA 4UVBA 2HYGD 2KIMA 3IHUA 4KUMA 2DPDA 4EM2A 3F8FA 2Z33A 2WTEA 2K4BA 2VOOA 2V1XA 2XUBA 4MNUA 5HDNA 1TNSA 2X0LA 3K9TA 3W6KB 4I2OA 3M8FA 1G4DA 2E1CA 4IRIA 1QBJA 4RGSA 4YFXF 2ESHA 4WX9A 1JHFA 1TQPA 2NNYA 3MWMA 5LRRA 1KQ9A 4EVIA 4XLPF 2EWNA 3GW2A 2FNAA 2E7WA 1BBYA 4XRFA 1J5YA 3KP4A 2V6CA 1HBXG 3O2PE 5D5XB 1XGMA 1PUEE 1R1VA 4ZYDA 2BV6A 5IT9Z 2Q8KA 4B09A 2YPRA 3IWFA 1ODDA 1BIBA 3E5QA 3CO6C 5LHIA 5BS6A 2XAJA 5CVRA 3KLOA 1S8NA 1GXPA 2DQLA 1G3YA 1JHHA 1B1BA 5D4SA 4S04A 2CYYA 3O3KA 5DEQA 4JBAA 5HOOA 4RB2C 2FMLA 1WQ2A 4CDGA 1CF7B 3FMQA 4KIGA 2CO5A 4XSXF 2QVOA 2DQRA 1TBXA 1K79A 1S29A 2ZNZA 2FBHA 3L00A 4Y15A 3GFLA 3HHHA 3BZ6A 5L3BA 4L5IA 2HEOA 2HQNA 2MLKA 1ZG3A 1J7KA 1O3TA 2MC3A 2O03A 5K1YA 2DT5A 3BY6A 3FX3A 4ZH4F 3E5XA 1HKSA 5LHHA 3QU6A 3S2WA 3GUDA 2FNPA 4UV9A 4G7ZF 1OYYA 5LGTA 3CUQB 2VE8A 3WODF 1Z9CA 3KFWX 3ZQ7A 2O6GE 1YW7A 2V1UA 1ZGJA 4ZYGA 3N4MA 5KVRA 1LDDA 4GGGA 2CW0F 3H92A 1ZRFA 5FO5A 1KQ0A 2L4MA 2Y0MA 4KMUX 5D6FA 3GEZA 4KDPA 3KETA 5TRDA 1T0FA 4ENMA 3J7AO 3HOSA 2COMA 2DTRA 4OIOF 4EGYA 3V8LA 2ELHA 2IA0A 2EJRA 1RI7A 3VB2A 2PMHA 1XSDA 1HKQA 3GFMA 2B0LA 1BI2A 5L3FA 1FX7A 2V9VA 4OMYA 2OU2A 3B73A 1B9MA 2M45A 1IN6A 5ICGA 2XROA 2QBYA 1JXSA 2Q0OA 4ZYHA 3R0AA 4N0BA 4EM1A 5IT3A 1USSA 1LJ9A 1SD6A 3QPHA 5DV5A 1I1SA 3KLNA 1PDNC 5L3DA 4AVPA 4LK0F 2A69F 2ZFWA 2EV6A 4RGUA 3TO7A 3FXQA 3M7GA 4Y13A 3SHFA 1XMAA 5K5RA 3T8TA 4BQAA 2A3SA 5EEGA 3VFZA 1D8JA 2XASA 3ZMUA 4OU0A 1TW2A 4FHTA 5ED4A 2OAZA 3R6SA 3IRRA 4ON0A 3WTSC 2ZKZA 4Y17A 3BP8A 4NQWA 2FBIA 4HDVA 4AIKA 3C1DA 4ASNA 4O3MA 4R8HA 4L9VA 1D8KA 2XAGA 1A04A 2A07F 4EGZA 2FQ3A 3GZ5A 3VODA 4HQMA 4UVCA
chains in the Genus database with same CATH superfamily
2DA3A 1V5GA 4KNYA 3I56I 4E7ZA 2DYRH 2NVQJ 1P6RA 4X0GA 2KZVA 3BG9A 1XCBA 4KFCA 1B4AA 5LHGA 1FP2A 5FKOA 2P0TA 1V5FA 3HEFA 1J59A 1UJ8A 2RNJA 5CYVA 1SVOA 4B3AA 2K5CA 4XRMA 2Q2EB 3IH3A 2EZIA 3LSHA 2X6XA 2BXZA 1MMNA 1GT0C 1K78B 2W57A 3ERMA 1NTCA 2ICWG 1YG2A 1YJ9I 1YRNA 4BQQA 2L9RA 1R49A 2IRFG 3E5UA 3I4PA 5KHDA 3UNGC 2R7WA 3HB9A 1FSHA 2VKEA 5DM7F 4M9XA 2BBYA 1UAAA 2GZWA 3MD2A 2F5FA 1U9OA 1SANA 2KFDA 1W5SA 3GMEA 3RPUA 3MZYA 5F04A 1A6QA 5E8IA 3EUHC 1VTNC 2ZXIA 4KT6A 3S1MJ 5CVJA 4XMYA 1IV6A 1KA8A 4DBRA 1P9QC 3ONQA 2P8TA 1U8RA 2KIFA 1XGNA 4AM3A 1S3JA 1TWHJ 4MEYF 4YIFA 2MH2A 3CLOA 3BWGA 3MZ8A 4W97A 2O3FA 3JRBA 3GTLJ 4BXUA 5FLXZ 1R71A 3KP3A 3I5UA 2P5LC 1YTYA 1TT0A 2ZMEA 4DYRA 1ITYA 4UUVA 3GTPJ 5E3NA 4F91B 4XLFA 3K6GA 3GLXA 4G6TB 3F9KA 4YRVA 1F9NA 2K3PA 4U87A 1AWCA 4BBRJ 2E2JJ 3HOUJ 1Z1DA 3VSKA 2O5RA 5TGTA 3GO5A 1T56A 2I8DA 1Z6TA 1LVAA 2M8GX 2Y48A 3HUGB 5FFZA 5E3MA 5A2QZ 2P6SA 3LA2A 4UV8A 5D8KB 1HCRA 4MQVA 4ZTFA 1W4MA 3S1RJ 2BVLA 4IXAA 2JWTA 1VQKI 3VOEA 4M3FA 4BXFA 1MBJA 1TZLA 2IGOA 3JTHA 3OR1C 3LA3A 1BI0A 1ON1A 4HBLA 5KAIC 2I5UA 2V7FA 2LKXA 5AIPA 3O6BB 5BNGA 1VZ0A 4A5NA 4PCQA 3W2AA 4LLNA 3TOBA 3QODA 1DU0A 3RIRA 2V9PA 2YX4A 3BR3A 1G6NA 3FM3A 4M6XA 3D1NI 5M3MJ 4YFKF 4IX7A 3DEWA 1RRJA 4B8XA 2VOPA 1IAWA 4MFDA 3P9IA 5DYMA 3HKZN 2BYVE 4DYCA 1TP4A 3HBLA 2KISA 1P7IA 2V9KA 1R7JA 2ESNA 2Q1ZB 1WSUA 3JAMZ 3I64A 3EQLF 4A3CJ 2BE5F 2NS0A 3L1PA 3QYEA 3L09A 3TP0A 1ZQ3P 2DYSH 2OUMA 1Y1WJ 3PQKA 3J80K 3I55I 3S1NJ 4C2MJ 4CYDA 4LG0A 5E79C 4HNUA 2FBKA 5EG0A 3EETA 1VQ9I 2ADUA 1FTTA 2PMUA 3S3OA 1D0XA 1MSFC 1YJWI 2HVSA 1LUJB 3TQNA 2E1MC 5L3EA 1Z7UA 3DKWA 2HPIA 1H9TA 4L18B 2MGQA 9ANTA 4YFNF 3HRTA 2HYJA 3E97A 5HDGA 1X19A 4L9NA 1TL8A 2DI3A 5M5WJ 2DLLA 1J75A 3F6OA 2CWEA 2L5QA 3GCMA 1VFCA 4I02A 1PUFA 3RQ4A 1IW7F 2AQEA 4RB0A 3PUBA 4IKFA 2LY9A 3E7LA 4HQEA 4DNCA 2M4KA 1YO5C 1IN8A 3DEEA 2RAEA 4HAMA 4XICA 5AIQA 3GTJJ 5FLXR 3I59B 1NG6A 1GV5A 3RPUD 1KU3A 4FISA 3FISA 1F1ZA 4B4CA 2ID6A 4Q47A 3ABKH 1BC8C 4M9SA 5CPRB 1RC9A 1IN5A 1W5TA 3LSPA 4U0YA 3E6DA 2LFBA 1BA5A 4ZJZA 2PFBA 1QGPA 1DPRA 2H09A 3G2BA 3HSFA 2CQQA 1VQOI 2CQKA 2R5ZB 2PBIA 2FUG2 1ZH5A 2EZKA 3HOZJ 2E1MB 5A2QR 4RAYA 3LSGA 2VB6A 3QYBA 4LGWA 4BAYA 1UFMA 5CVIA 1AOYA 2FOKA 1P7JA 3DXJF 5B1AH 2YX7A 3CO7C 2V6EA 2HVQA 2OZ6A 3LQQA 2JA7J 2LC2A 2Z99A 3SFIA 1UMQA 5B3SH 1WPKA 2XB0X 3HPHA 2RDPA 3CP2A 2XGDA 2JMWA 3ELKA 4IRGA 1FTZA 3H1CA 2XF7A 1XSVA 3D0SA 3K1MA 2NS8A 4DOZA 3OYMA 4WCGA 2XV4S 3RKWA 4DBQA 3VYRB 4BACA 2ELKA 3VWBA 1K61A 3F8NA 3IWZA 3CJTB 1CQTA 2G0EA 3E6CC 3X2QH 1P4AA 3FKIJ 1E3OC 1KGSA 1MBEA 3CP8A 4AU7A 4MTDA 1GDTA 1JT0A 3S3MA 3K1NA 3VSLA 2M9HA 3BOQA 4CHUA 2PI0A 2L7KA 4TV7A 3W6JB 1MNDA 3PFYA 4QIWN 3QPSA 3G73A 2VJ4A 3QU3A 3OYLA 4P9FA 1FJLA 1O57A 2VC0A 3LQRA 2A5WA 2R92J 3SZPA 3K4BA 4RM3A 5B5EC 3T8RA 4LITA 1VQPI 1WI9A 1EJ9A 5CVUA 3OYDA 1KYWA 4BDYA 3FMSA 5FJ8J 2DK5A 3I0TA 4PGHA 1ETXA 2XKPA 1TLHB 3LSTA 4NC6A 1Y6IA 1Z0XA 1G3TA 2DFEA 3HSRA 4RLFA 2M5WA 2FJ1A 2DMNA 2EK5A 3MEXA 1XD7A 3QOPA 4BEHA 5BOXA 2L2OA 3AAFA 5ICEA 1VF9A 3E6BA 3QWLA 3IC7A 5HNHA 1U3EM 1TWCJ 3OYFA 4M3GA 3MQ0A 2DJIA 1ZARA 4UUSA 1W7PA 4WXCA 3PNVA 1N77A 4KN7X 1ZGAA 2M4GA 2OQRA 1ZLJA 4AYBN 4A93J 3J81Z 4AWXB 1B8IB 2KKOA 3BG5A 1FZPB 1ENHA 3Q0VA 1S7AA 1RPWA 2DJNA 3MCZA 1ZKGA 1JKOC 2XAHA 2JUGA 4EJTA 4XBFA 2L01A 2HXOA 2HNHA 1LNWA 2QENA 2VN2A 4MIMA 2OJED 3A4CA 5GAEJ 1OCRH 3DF8A 4I0AA 5H6RA 4S0HB 1EKEA 5JHUA 3OV8A 3EUKL 2MD0A 3BCBA 3HRSA 2M30A 3RDIA 5E18F 4XR6A 3OS1A 3WU0A 2DAOA 3H0GJ 4IJAA 5DUIA 1V4RA 1LB2A 2WC2A 4O6JA 3ZMSA 4IQJA 3K1PA 5J3LA 1LPQA 2RGVA 3BTLA 1R58A 2OF7A 2LG4A 1TW3A 4NDLA 2F6CA 3EYIA 2DDBA 1EH6A 3U1DA 1R5GA 3HGYA 3REOA 1JUMA 2LOOA 2RKHA 3DU5A 1IGNA 4M74A 2VKVA 2MW8A 3JRIA 2HI3A 1W1WE 2L9NA 2BZTA 2LYCA 1EH7A 2BOLA 2M35A 2MBFA 2DA2A 1YJNI 4Y7NJ 3P9KA 1SVLA 3RKQA 3R0JA 4B48A 2BW3A 2E71A 1T0FC 4UVAA 4PGGA 5DCMA 2OCEA 3TO6A 1AA7A 2H94A 3PFIA 3CD6I 3OYNA 5EF6A 1RR7A 3ASNH 2JJ7A 1H89C 1FP1D 3H3ZA 2HOAA 4L5JA 2IA1A 1R4MB 4N9HA 3SJMA 3HZJA 3UR3C 1L0OC 4RM2A 5FB2A 4A0ZA 4YIRX 1HDDC 2GWRA 4IZZA 3BZCA 2XIGA 3ZR8X 1XCVA 3SDBA 2LKSA 2FE3A 2XPUA 4O5VA 2DFIA 4EJOA 1XS9A 2HZTA 3SYTA 2XC7A 2UZKA 2AS5F 4L0YB 4BJ5C 5AONA 3F72A 2STWA 3NWTA 1TWGJ 1YFHA 3HPGA 1APLC 4PDKA 2HTSA 5H6QA 1FBSA 1MH4A 4HSRA 4JP0A 5IOYA 2P7VB 2CV1A 3LSIA 4IOAF 4DIQA 5J1RA 2H1KA 4IOCF 2GXAA 2CUJA 2K4JA 3TGNA 4N9IA 4RDUA 2ZFUA 2O8KA 3PM1A 4RB1A 4FTHA 1FBUA 1N78A 4QSHA 2BY0A 1I27A 2HYFA 4D7MA 3RCOA 5GPCA 4ABZA 4EM0B 2CGPA 3VYTB 5DCFA 3JREA 4PFOA 1SD7A 2M8EA 3BTJA 1SAUA 3FXUA 2VI6A 3HYIA 2P5VA 2LMDA 4FT8A 5L3GA 2JRTA 3JRGA 1B72B 2A05A 2JZYA 4B44A 2JT1A 4HLYA 4V19K 2JSCA 1ETYA 3HXLA 2ISYA 2DODA 4D0PA 1U6GA 2X6OA 4XORA 3GX4X 1SMTA 1LKXA 2ACJA 3A02A 2WADA 5M3FJ 1OFCX 2L4AA 1BW5A 4OMZA 4AD9A 3LL7A 2DPUA 1W7PD 4ANJA 2DTZA 3TW6A 2H6BA 3K69A 4A0XA 1GUUA 1R1UA 4MGRA 2QBYB 2IS1A 3FXOA 2K9MA 3CDHA 4P55A 1T38A 2WAQN 5F64A 2BVMA 3FXJA 2CW8A 4OINF 1CF7A 5HS8A 2ZNYA 2EFQA 2ID3A 2N8GA 3BJAA 2YR2A 1V55H 3S32A 3J7ZI 3RZOJ 3KYDB 4B47A 3Q0WA 3IUOA 2H8RA 2K85A 1BM9A 1Z6RA 2OZUA 1PJRA 1MZBA 1TQMA 3L2VA 1FT9A 1V3FA 5K5QA 5IT9R 4AUXA 2OQGA 1U78A 5B66C 3T5XA 1N25A 1MIJA 3HG9A 2VQLA 3HIFA 4B3XA 2IA2A 2PJRA 4IF4A 1ZHFA 1U5TA 1KU2A 3CJNA 3ERED 4I09A 3B02A 2F2EA 2NRAC 5J8FA 3FHZA 2IJLA 1M1EB 1H88C 3MKLA 1FOWA 1EA3A 5EDNA 2VONA 1FWZA 2V1DA 4XLCA 2PLYA 3WG7H 2GXBA 3ZMDA 3V8JA 3IH2A 3F23A 5DM6F 4ENNA 2R7OA 4EATA 2EQRA 2C6YA 2TCTA 5J1UA 4UB6C 4ZDLA 3OYEA 3SFZA 2FOWA 1SFXA 2VXZA 4BDZA 1MDMA 3ECHA 3CUQA 4NNJA 3SZTA 3KP2A 4HX4A 3CJQB 3BG3A 3JRAA 2P7CB 4II3A 3JRFA 1XDSA 2XPVA 2L0KA 2DO7A 2LBFA 4JQFA 3GTQJ 2DFHA 3R4KA 1BC7C 1IN7A 4KICA 3TEDA 1R9TJ 4RAZA 2HOSA 5JLWA 3OYIA 3U1KA 3HDDA 1FYKA 2R7SA 1I39A 1D1BA 2NS7A 1RKWA 2O7OA 2LK2A 2R5YA 5LEKA 2XKOA 5FGMA 1XGSA 2CFOA 6PAXA 1Z21A 3WTXC 1FC3A 1OISA 2E19A 5GAHJ 5B1BH 3GVAA 2XB5A 3F21A 1QA6A 1E2XA 3KZIC 3U9GA 3AL0C 2PJPA 1P2FA 4W1UA 5E1WA 3GFJA 4FE7A 2ISZA 3QOEA 1E0EA 2KIQA 3ZXSA 1DDNA 2H6CA 2ZMEC 4F92B 3OOUA 3BG6A 1QNTA 2K86A 3AFHA 5HS9A 1D1AA 2BY3A 2PX9A 1YHQI 2LH9A 4WK8F 2F4OB 2KP6A 1R22A 2WB1N 3S3NA 3WGGA 3WU1B 5ILVA 1RNLA 5F0HA 5EYRA 4U7BA 1W5CC 4ETSA 3BCAA 2GLOA 5E1XA 4L0ZB 2O61A 2DA1A 1S9HA 5ICFA 1A35A 1SFEA 4EQQA 2X1EA 1BJAA 4XRSA 3SEQA 1HDPA 3DTEA 4BL0B 2HXIA 4GYGA 1R5ID 4QWQA 4KITB 2VL8A 4CA0A 4PUSA 1OCPA 2W1OA 3TDZC 2M3AA 2V79A 3AL0B 2GA2A 5TJJA 4WF2A 1X1PA 1FLIA 2LTPA 4M72A 4ZZDA 4I76A 2LY2A 3K4KA 3A0HC 2M34A 1YW9A 3CMYA 4A3EJ 4IL6C 4IQ4A 3KYLA 1QZYA 3GXOA 2VBXA 2OD5A 3CMAI 2ZMEB 2XRNA 4E4HA 3WE3A 5M5XJ 1IG7A 2VQGA 4MEXF 2D2WA 3BQYA 4HOBA 2QWWA 3RYPA 1HA8A 2WBMA 2BHZA 3BR2A 2DOAA 5IPAA 5CJ9A 4XLNF 2X4HA 2TDXA 4HLXA 4BU2A 3CJRB 2COBA 3SEZA 1ZN2A 2E5ZA 3I54A 1BR4A 2G9WA 1XC5A 2KPMA 1ETWA 2MH9A 3GZ6A 1VQ6I 2D1HA 1WJFA 2CUFA 4XKCA 2V26A 2JA5J 1WJCA 1LEBA 3HOWJ 3A52A 2VT2A 3F3XA 1WH7A 3JRHA 1Q1VA 3IKVA 4G12A 2M1BA 1I6XA 3HRUA 2X9DA 3PQJA 3LFKA 2XSJC 1EV7A 4UUTA 3Q5FA 2OTLI 1FOYA 5EZGA 3JR9A 4PJNA 4HYEA 3DEUA 4J01A 2ELJA 5GAGJ 2EIJH 4LJZF 2VKDA 2W7NA 4C2TA 4HNVA 1OYIA 1I1GA 2HQ5A 3KP6A 5DD8A 3TOAA 1G8XA 1F43A 3ESWB 3V8KA 3C18A 2MD5A 1J0RA 5LGUA 1K7AA 2CSOA 4XLAA 5DTDA 4GDFA 3VPRA 1VQMI 3K70D 2FX0A 2VKHA 2P4WA 1DUXC 1Y8QB 3DKYA 1JE8A 2M87A 2AXTC 2RQPA 2PN6A 3J7AW 4DGWB 4BYYA 2QF7A 4Y52J 1WH5A 5H20A 2D45A 2QUFA 2DMUA 3MMYB 3BZKA 4YELA 1WGXA 2JN6A 1UELB 4HV5A 2G7UA 4ZDPA 4GFBA 2QSFX 1BOAA 1A31A 2QGUA 4CZZA 3H9GA 3ZQLA 5F6FA 4C3JJ 5E3OA 2Q2EA 2MA3A 3AG4H 2DFFA 4E6KG 1YLFA 4MTEA 1KU9A 3LMMA 4LG0B 3DTIA 1LVKA 4GO1A 5KK1A 2HDDA 1UCRA 2TRTA 2HFHA 4A2UA 3V7RA 1OR7A 1P4WA 4UHTA 1NG7A 5CVVA 1ETKA 1MNEA 4B1RA 3T1BA 2ZO4A 1YIOA 2XVCA 3KEYA 3S14J 1E17A 4HSTA 1KQ8A 3GBGA 3HKZA 4FCYA 5DD4A 1LDKB 2MLGA 2V1NA 1PUFB 3FXRA 2VBYA 5IYCJ 1U2WA 1S6LA 1Y0NA 2X1DA 2UUZA 1STZA 4PZJA 3GLLA 3C2GA 4ZC3A 4KT5C 1IUFA 2QQBA 3WTUC 4IHTA 4D5CA 3CCLI 3FXMA 3OL3A 4ESFA 1LDJA 5LLQA 3C7JA 5J40A 3F0CA 3OYBA 2HQRA 1TWFJ 4LK1F 1T33A 1G3WA 5FKMA 2CRGA 2QKMB 3WG9A 1O3QA 2NVXJ 2KHMA 4ZYAA 4BNCA 2CH0A 2DT7B 2GQQA 3PIPF 3LSRA 1LQ1A 4LG3A 3LAPA 3HUGA 1RZ4A 3RKYA 1O4XA 2L7ZA 2K27A 3MFKA 1QVTA 2A6HF 4D9JA 4S05A 1K6OA 3BROA 2QQAA 5J4VA 1HC8A 2VPRA 2LP0A 3BJ6A 5HVQC 4LLGF 2QSHX 2RNGA 2W85A 4G7OF 4Y3OA 2HR3A 3EUHA 4BGDA 1JGSA 4XQFA 3CC4I 4XKVA 1ZG5A 4UXNA 2QCOA 2K7LA 2XAFA 5LD2C 2IS2A 3ZP5A 1WJEA 3JW4A 1BI3A 1DPUA 3IV5A 3JCUC 2JSPA 3NEUA 3QRFF 2K9NA 3M1EA 2KDOA 4A12A 4XOTA 3KZZA 4G6DA 3HRMA 2JQ7A 4ENKA 4NHJA 1ZELA 1OCOH 1AKHA 3NRVA 2R4GA 3NWSA 2BY1A 3QPTA 2DA4A 1CGPA 3KEQA 1ETOA 2OV7A 4HEA2 1ACIA 2QQ8A 2CV0A 1F5TA 3KP7A 1D5VA 3R60A 1Z3YA 3FZVA 4EJWA 2ETHA 1A36A 2LLKA 1ORKA 1VQ7I 4ZZLA 3OYHA 4HF2A 3F8BA 2OA4A 1D5YA 3FKJA 1AU7A 3PSIA 5E8GA 2VC1A 2IW5A 1HLVA 2OPTA 3QP5A 1ULYA 3B6CA 4JX4A 2Z9OA 2LF7A 1O3SA 2Y69H 2YUSA 4CCLA 4ZDOA 1DU6A 3PUFA 4RGRA 4CICA 3BLYA 2P0WA 4IHYA 3BT9A 1WWXA 3OYJA 4F93B 2WWYA 4CXFA 4BEHB 2A5YB 1AHDP 1JGGA 2FU4A 4M73A 4KA4A 3ZMZA 1REPC 3N05A 1X1BA 4BHBA 1IRZA 1UHMA 5IT9K 4UUSB 4XK4A 2KT0A 1QQIA 1FBQA 1FSEA 1V54H 2VJIA 5LRSA 3M3YJ 3P5JA 3M9AA 4PK4A 5D8LB 4DYQA 1UHWA 1XX5A 3IP4B 3DBLB 4XNFA 1PP7U 2GXGA 2HKXA 3V7SA 3I4MJ 3JAMR 4HV6A 3ZN0A 1YS7A 2VASA 4GCVA 3J80Z 3HM5A 3ABUA 1YE9A 1A5JA 3O8HA 4NC8A 3CCMI 1OCTC 4BQNA 3ZOBA 2H27A 2BY2A 4OWRB 1JTYA 3OOPA 3FF5A 3K2ZA 2EFOA 4CCJA 1XMXA 2RV8A 5EGOA 2BEOA 5FKKA 2ZCWA 2EINH 3RPQA 2A61A 2KJBA 2ZXWH 3K4JA 2HOEA 2R5ZA 1MKMA 4M3DA 3VDXA 4HA8A 3DCFA 1T8IA 2X98A 2X6WA 3PSFA 1YQAA 1JJ8C 3WGIA 3Q0UA 3S1QJ 4U7DA 3ZCOA 5BQTA 4AYBA 2YU9J 1I5ZA 2IEKA 3RYRA 3L2UA 3M4OJ 1TNTA 2MG4A 1G2HA 3WE2A 3G4SI 2A6EF 3PNTA 4A3IJ 2EFPA 2W48A 4XN0A 1HW5A 5DCMB 1Z7LA 4RAFA 4CYCA 3A01A 3HJEA 5GPAA 3K4NA 3K7AJ 1XDUA 5K7HA 5H2FC 4CO8A 4KISA 5L3CA 1IC8A 5J6XA 1JKRC 5HLIA 1J09A 4G7HF 3GTKJ 1XN7A 3ZQIA 2VODA 3DP7A 4MHGA 2AHQA 3CF5F 5FFXA 3RJPA 4FASD 4ENJA 4HZFA 1J2XA 1TQIA 4LB5A 3NQOA 3ZMVA 5HS7A 1B59A 3WTVC 4QPOA 5HLHA 3CQZJ 2NNNA 5CQGA 1MBKA 2YSRA 2MZ4A 1FY7A 2PEXA 2ME0A 3IL2A 2E2IJ 1WJBA 2W25A 2NYXA 5IY5H 5KCMA 1BIAA 1P4XA 3T0YA 3BQZA 5DUKA 1QPMA 1XMKA 4XOPA 4AIDA 3HC7A 1DP7P 5K7ZA 3I53A 2ZXJA 3RZDJ 2ZB9A 3C3WA 5GTHC 1QZEA 2BXYA 4PJJA 3CCJI 3ROUA 3ZGKA 2XAUA 2FXAA 4NBQA 4V2GA 5C4XJ 2JPBA 2K02A 5JR3A 1WFXA 2LY1A 3K10A 3MZHA 1FIAA 3HOYJ 4II2A 3DFGA 1O7FA 4FE4A 4BE1A 1IRXA 1I50J 4QTRA 2VBWA 2XGXA 5HNFA 1U5TC 1SFKA 2QYOA 2HVRA 4M6VA 1WJDA 1WRJA 1X2MA 1ETQA 2KLOA 4MO7A 4RAGA 3G1OA 2CW7A 2PMZA 4AIJA 1IN4A 4RMNA 1MBGA 1S5LC 3P9CA 3ZN1A 4P96A 5EEAA 3H3VK 2I10A 3VYSB 3KZYA 1UB9A 4OIQF 4I99C 1X2NA 1VQ4I 3MKYB 5J1YA 3HL2A 4KYWA 4H0EA 1ZAOA 4Z6YA 3GFIA 1NK3P 2FMYA 3BPXA 5F1RA 2HTJA 3WTZA 3J80R 3F6VA 3CUQC 1FYMA 3J7YJ 1OJLA 2JVGA 4RBOA 3KEOA 3HOVJ 4C3HJ 4KIFA 2IP2A 3BPVA 2QA4I 4ESJA 3RQIA 1S7OA 1VQ8I 5FKNA 4OAYA 2R7FA 2PQ8A 4U0WA 2LDUA 1RUOA 1R36A 4CUGA 4C3IJ 3DQVC 5F1JA 2P5KA 3L2CA 5IP7J 4NB5A 2LD5A 2RC4A 3K70C 1ZRDA 2OTJI 4FX4A 1Z67A 4Y4RA 3M8JA 1LEAA 1UHSA 3DLAA 3BR0A 3FM5A 2GOMA 3OWTA 4A5MA 1FYLA 4OIRF 4A0YA 1LFUP 2CS3A 1ON2A 1JT6A 1U5TB 4N4NB 3J81R 2XF5A 5F27A 4F7ZA 3G3ZA 2Y2ZA 1J9IA 4F3QA 1H9GA 1L3LA 2AO9A 4XL9A 4MQ9F 4G94A 1Y39A 3ZRGA 2VJ5A 1IF1A 4EV0A 1SC7A 5JI6A 1MGTA 2WA0A 2X48A 3E3VA 4H4KC 4Q5SF 3CMEI 2IGKA 2OC6A 3WTWC 1WJAA 1HOMA 1OCZH 2EILH 1ONVA 1MDMB 1IUYA 1JUSA 5CLSA 2R93J 3JRDA 1H0MA 4L9JA 4PJMA 2L7MP 2A6TA 3FXKA 3JRCA 5C4JJ 4XN3A 3OYGA 4C2UA 2MABA 3EUAA 3MKZA 3U2RA 5E1ZB 2RN7A 5LGNA 5E3LA 5ILUA 3BR1A 1MMSA 1O7LA 2LR8A 2FF4A 2ME6A 2Y0SN 1X3UA 2YU3A 3F22A 2W84A 1A6IA 2E60A 2R3SA 2MC4A 5ILSA 2Y75A 2HDWA 1DGRM 4M71A 4AC0A 3W2VA 1NH3A 5HLGA 3S2HJ 1FOXA 3HTUA 2H8WA 5FROA 3LWFA 1QVUA 1ZLKA 5E20A 2DMPA 2V4JC 4I01A 4IVNA 1X58A 3F8MA 4F55A 1SFOJ 4V2FA 2VPLA 1FMVA 3PNYA 4JX5A 1MMDA 2DOFA 4LFUA 3H3UA 2CMPA 5GP9A 3VEPA 2AXLA 3CTAA 5FLMJ 3OYCA 2KJCA 1B72A 3ZQGA 5K7FA 3RKXA 4UB8C 3W6VA 1MBHA 1JKPC 4CCNA 3JSOA 1GVDA 3L9FA 3JSPA 4FX0A 3K4CA 4K2EA 3TO9A 4MFEA 2JA8J 1KYZA 2EB7A 2KRHA 3AKZA 2J5OA 2AQFA 3Q3SA 4F52A 2DBBA 2ZBKA 4A6EA 3QAHA 2NOJB 5FKLA 4Q48A 3ML6A 2LNBA 3KE2A 4CGZA 1HSTA 4NQWB 4BBSJ 1HW2A 5D5UB 2IGMA 2IVMA 5D6EA 1V5EA 2ZJRF 4E7JA 3OS0A 1HW1A 3QYFA 4XLHA 3ZPLA 5TISC 1HQCA 4DZJA 3I58A 4BH9A 3V7CA 2F5EA 5FD5A 1WHUA 2Z3YA 2EZLA 2JA6J 1BR1A 3DPLC 3U21A 4Z2YA 3K0LA 3KPHA 3D5SC 1TTYA 1LFBA 2WV0A 5K5OA 3S8PA 4L9TA 5JVTA 3CC7I 3LAJA 1QU3A 2IGNA 3BC8A 4EJUA 3K2AA 2HU9A 3P7NA 2G7HA 3NARA 1RUNA 2VT3A 4RGXA 3ABLH 3A03A 3F8CA 2JUCA 3GWZA 4OOIA 2JPCA 1MJ9A 2JK3A 4YEJA 1OMIA 3Q9VA 4XSZF 3L7WA 2R7VA 2CQXA 4LLLA 1I3AA 3IRQA 2EA2A 2FEZA 5FLXK 4C30A 3G71I 4EMSA 1ZTRA 4BKXA 4R79A 2O8XA 3OSFA 1I3QJ 1SMYF 2L3DA 2MYSA 2WV1A 4A6DA 5IOZA 2ZJPF 2OBPA 2B7EA 3BDDA 1YS6A 1YRNB 3CCRI 1UG2A 2DA5A 3DV8A 4Q4ZF 2JTVA 2CU7A 2E1NA 2M0MA 4HX8A 3HOXJ 3DU6A 4MLOA 4P9UA 5DS9A 1BI1A 1R23A 3RTRA 1XTAA 5D4RA 2NVUB 4PJ0C 1BW6A 3S17J 3E1SA 2HWVA 5A2QK 4WXHA 4OIPF 4BHCA 2EBIA 1IXSB 2M2EA 1HSJA 4XIDA 4BXXJ 2Y9YA 4BY7J 1OCCH 3I9V2 1OR7C 3W2WA 1RESA 1HKTA 4J00A 1U0JA 5GADJ 1DQUA 2DW4A 1VQ5I 5KAFC 1EF4A 3ZMTA 3KCCA 3FWEA 1X3WB 1LE8A 5EEHA 2UXXA 1MJAA 1UZCA 4I98B 3B6AA 4E70A 4IRHA 3J7AY 4A3GJ 5J8CA 1G3SA 3ECOA 2F5DA 4G6QA 1FNNA 4JYKA 3FK6A 1GHCA 2H1LA 5J47A 1F36A 5EJCA 2F5VA 1O3RA 2B63J 3TKYA 3GTOJ 2Y30A 2STTA 4A3LJ 5FRNA 4HW0A 4HX7A 4LIVA 5JVGF 2P6TA 2CJJA 3SQNA 3WTYC 1K4TA 2K9QA 2QM3A 4P1WA 4DZPA 4LOCA 2HDCA 1R4NB 4B43A 4I0BA 1VI0A 3FDYA 4LMYA 3HOTA 4LD5A 4EEFG 1D3YA 1Y56A 5D5WB 3C2HA 3JAMK 2DK8A 3GYHX 3UKGA 1T98A 4ESBA 3HTSB 2JRMA 3RSNA 2E7XA 3WHBA 1MJBA 1R1TA 1X4PA 3ULQB 3L2RA 1MMAA 1HXDA 3ISPA 3LA7A 2W24A 5LBQA 3I4NJ 2FQ4A 2LKPA 5BMZA 3TMOA 2D5VA 2BGCA 5D5VB 1JI8A 4HNTA 2RQQA 4BY1J 4XKBA 5HDKA 1T95A 4KN4X 2UV1A 3A0BC 4XM3A 2IXSA 1RQ6A 3DPUA 3WU2C 2DU9A 4A3BJ 1MMGA 4QLCU 1YITI 1T2KA 1FMWA 1PYVA 2Z5UA 3HHGA 4KMFA 2DN0A 2ECBA 2KDZA 1E3HA 5FD6A 1ZK8A 3FBIB 2IS6A 1PP8F 1QZZA 2QQ9A 2R7ZJ 3BJOA 4DQ2A 1BR2A 4EJVA 1IZ1A 1WKMA 4D7NA 3CLQA 4R1HA 4GXOA 2CG4A 3SZGA 2A68F 4GYIA 2CUZA 3G1LA 2CV2A 2E35A 3QQAA 1K78A 2EIKH 2RREA 5EG0B 1YI2I 4BE0A 4A3MJ 1Q1HA 3OYAA 1BJZA 3OY9A 3I3LA 3H36A 1DP3A 4P5OA 3FMRA 2L9VA 2QEXI 2XHKA 3VYUB 2NAZA 4RS8A 5JLXA 3ZQCA 1R00A 2KZGA 2ZXHA 3IKTA 5BPIA 3RI4A 3COAC 2DA7A 2GIVA 3CESA 3M8EA 1IXRC 3OS2A 2CQ7A 1ZYRF 2J5PA 2K9LA 3DPTA 2R7XA 2GA1A 2GBYA 2EA4A 2RVCA 3OMYA 1KZHA 1NK2P 5ERIA 1MBFA 1ZGWA 1GVJA 3IAM2 3MAJA 1B9NA 1WCMJ 4IHXA 2F5CA 2IPQX 1Y0UA 2Z2SB 1BN5A 2WY8Q 1ZRCA 1BOBA 4C9YA 1XGOA 3LOCA 2HZDA 2ECCA 3LSKA 2FA5A 2PG4A 1WZ2A 5DDGA 4FETA 1VQLI 1XG1A 2MUNA 4G8XA 1AKHB 2DMQA 4E7IA 3WGHA 2EFWA 2VQHA 1T6SA 1XB4A 3SDGA 4BQOA 3CCQI 4A3JJ 2LF8A 1FOKA 2KRFA 1GXQA 1DGWY 1W0UA 2XSDC 2EPFA 4JK1X 2DXIA 1IRFA 1USTA 2UXNA 3BG7A 1IJWC 3K4LA 1IRGA 2IBDA 4IHSA 2MFZA 4BHPA 2HGCA 4YG2F 1XPXA 3KP5A 4E7SA 3PL8A 4RB3C 4U88A 3MN2A 1TT5B 1R5HA 3K4MA 1QO0D 1NHAA 4YIIA 2F4IA 2VBZA 3I71A 2L02A 3A2KA 1GLNA 1KONA 4ITVA 2KL4A 5KNLA 1JKQC 1SD4A 2O0YA 1YW8A 4BJTA 4BUPA 1FEXA 3D5LA 1MD0A 2EV0A 2EZHA 1MSEC 5HLTA 2VE9A 3PJRA 1QHGA 1RIOH 2LVSA 3KIOA 4M9ZA 3V4GA 3CDIA 2ZJ2A 2K40A 2KQRA 2DA6A 3FIWA 4A3KJ 1FIPA 2R7QA 2HS5A 4AIHA 3OYKA 5FRMA 1VQNI 1PVEA 1BL0A 3CUOA 2L54A 4XKWA 4U0VA 3J81K 4HF0A 1IO2A 5JFRA 3AG3H 4Y33A 1YX3A 3BR5A 2W4SA 5IYDJ 2QZ8A 3PO2J 1KU7A 1C0WA 1OKRA 4CH7A 1ZG1A 1FPQA 3FBNB 2XAQA 2D1VA 2R0QC 4A3FJ 3R61A 4ZYEA 4RLQA 3PIOF 2CFXA 1SFUA 2YS9A 1ETVA 4PFPA 1T39A 1MNMC 2FRHA 5LEJA 2LSOA 3H9JA 1GV2A 5EGOB 1R6RA 2ZSIB 3SXYA 1OPCA 2X6YA 3ASOH 3IH4A 3N97A 2IT0A 3E6MA 5F0CA 2FSWA 2EV5A 4I7HA 2HQAA 4UNOA 2UWMA 2R7TA 2DDAA 1EH8A 4XRSG 3TW7A 1IV8A 1Z91A 2QLZA 2ZJQF 4IPAA 3WTTC 2WY7Q 3TDUC 4E7KA 1SD5A 4IEJA 3PO3J 4X1EA 3AG2H 2E2HJ 1W7PB 4M6YA 4A69C 1X1DA 5C3EJ 1T08B 2VQCA 3S15J 4WXDA 5IP9J 1WJ5A 1JTXA 1OQYA 2X1CA 1B6AA 5ICCA 1YYVA 4CYCB 1K4SA 3I59A 1P92A 1Z05A 3A01B 3CF2A 3M1CA 3OIOA 2CQNA 4HDUA 1ZREA 4WWCA 3EYYA 1VNDA 4PJLA 2F48A 5E17F 1W36D 4HF1A 4LB6B 2GAUA 1Z77A 2EFNA 3GF2A 2HKOA 1OYWA 5BPDA 1IXCA 1XSXA 3QP6A 2NVTJ 3ABTA 2R7DA 2F4MB 5CQEA 1YIJI 3S93A 3Q9SA 1SAXA 3H35A 3HSEA 3FK7A 2KIUA 3CC2I 3EDPA 4G9YA 3ABMH 4LIUA 3JTGA 1F4KA 2L7FP 4KIBA 4UVBA 2HYGD 2DCEA 1IDZA 4XLEA 2KIMA 4NUBA 3IHUA 4UY8I 4KUMA 3HGGA 2DPDA 4EM2A 3DWLE 4GRIA 3S2DJ 2IAIA 3F8FA 2BW3B 2GM4A 1D1CA 2Z33A 2WTEA 2K4BA 2VOOA 2V1XA 2VJJA 5JHFA 1Z3XA 2MSYA 2P81A 2XUBA 1TNSA 3H5NA 4MNUA 1SVMA 5HDNA 5F0FA 4J19A 2X0LA 3K9TA 2CUEA 3W6KB 4I2OA 3M8FA 1G4DA 1TC3C 2M0CA 2E1CA 4IRIA 1QBJA 2QSGX 1H8AC 4RGSA 5GTIC 2Z1DA 4M3EA 3OSGA 4YFXF 3M07A 1X3ZB 4AVZA 1ZR4A 4JOMA 4IHWA 2E36A 2ESHA 4WX9A 1JHFA 2R7UA 1TQPA 2NNYA 3MWMA 3GTGJ 5LRRA 1KQ9A 1POGA 4EVIA 4XLPF 2EWNA 3GW2A 2FNAA 2E7WA 1Y8RB 4E7HA 1BBYA 4XRFA 1J5YA 5CKTA 2GIZA 1IDYA 3KP4A 2VXDA 2LRDA 4HPQA 2V6CA 1HBXG 2XGCA 4PSWA 3BTIA 3O2PE 1XGMA 5D5XB 4L5EA 3EPZA 1RR8C 4HG2A 1PUEE 1QHHD 1R1VA 2BV6A 4ZYDA 1QPIA 5IT9Z 5J4YA 4CCKA 5FLVA 2Q8KA 4B09A 2YPRA 2K9SA 3IWFA 2IS4A 1ODDA 1BIBA 3E5QA 3D5RC 3WHCA 3CO6C 1B8IA 5LHIA 5BS6A 4X6AJ 2XAJA 5CVRA 3KLOA 2NVYJ 3AG1H 4HRIA 5C44J 1X1CA 2XF6A 1S8NA 1GXPA 1OLTA 2DQLA 2M7AA 1K83J 1G3YA 1JHHA 1B1BA 5D4SA 1RETA 2W82A 4S04A 2CYYA 3O3KA 5DEQA 4JBAA 5HOOA 1K6YA 4RB2C 2FMLA 1WQ2A 4CDGA 1CF7B 3FMQA 4KIGA 2CO5A 2VLAA 2ZSHB 2B9SA 2PMZN 4IO9F 3CCUI 3DTKA 4XSXF 2QVOA 3MVPA 4ZTJA 2DQRA 3TL4X 4DJAA 1TBXA 1K79A 1S29A 2XDVA 2ZNZA 2FBHA 3L00A 4Y15A 1YOVB 3DKXA 3GFLA 3DBHB 3HHHA 3BZ6A 3CMMA 5L3BA 3FXLA 4L5IA 3ZQHA 2HEOA 1TWAJ 2PJRB 3OIPA 2HQNA 2E1OA 2Z16A 2MLKA 1ZG3A 3CCSI 2OCCH 1J7KA 2BHYA 3OIQA 1YX5A 2MC3A 2O03A 4BJ6C 5K1YA 1O3TA 2DT5A 5EZHA 3BY6A 3FX3A 4ZH4F 1S72I 3E5XA 1HKSA 1ZR2A 3QPLA 2JVHA 5LHHA 2WAQA 3QU6A 3S2WA 3GUDA 3CZ6A 2FNPA 4UV9A 2DMTA 4G7ZF 1OYYA 3NAUA 1E3PA 3E0JB 3CUQB 5LGTA 2R7RA 1S7EA 5F08A 3TP3A 3LSJA 2O9LA 2VE8A 3WODF 1Z9CA 4PSXA 1UG0A 3KFWX 3ZQ7A 1WI3A 2LBFB 2O6GE 2MVTA 1YW7A 1RKTA 2XGEA 2Y9ZA 1QRYA 2V1UA 1ZGJA 2Y0SA 4ZYGA 3ZQQA 3N4MA 5KVRA 1LDDA 4FQGA 3OL4A 4GGGA 5HODA 2CW0F 1U8BA 1HF0A 3H92A 1G59A 1WVRA 1ZRFA 2HPMA 5FO5A 3TBIA 4DW6A 3KX2A 2R5YB 1KQ0A 2K3FA 2L4MA 2Y0MA 4KMUX 5D6FA 4IHVA 2E34A 4BE2A 4JX6A 3A1YA 3GEZA 4KDPA 2EIMH 3KETA 2FD5A 3LSMA 3CCEI 4D5FA 1T0FA 4ENMA 5TRDA 3J7AO 3HOSA 2COMA 2DTRA 2M7BA 2Y31A 4OIOF 4EGYA 2VUMJ 3V8LA 2ELHA 2IA0A 2X85A 2EJRA 1RI7A 2XPWA 3VB2A 2PMHA 3GTMJ 1XSDA 1X4OA 1HKQA 3GFMA 2B0LA 1BI2A 2GOXB 3O8GA 4A3DJ 3G6EI 3BR6A 5L3FA 1D0YA 3MKWB 1U9NA 2XRLA 2E5NA 2L9SA 1FX7A 2V9VA 4OMYA 2OU2A 3B73A 3H5RA 1B9MA 2M45A 1IN6A 5ICGA 2XROA 1ERDA 2QBYA 1JXSA 2Q0OA 3CDLA 4ZYHA 3R0AA 4N0BA 4EM1A 3H9QA 5IT3A 3DLLF 3GZNB 1USSA 3FHNA 3BTCA 1LJ9A 1SD6A 3QPHA 5DV5A 4CCOA 1SEUA 1I1SA 3KLNA 1PDNC 5IP6A 5L3DA 4AVPA 2NOGA 4LK0F 2A69F 2ZFWA 2EV6A 4RGUA 4OAZA 3W3CA 3TO7A 2JA2A 3FXQA 4CZCA 5IYBJ 3M7GA 4Y13A 3SHFA 2WAFA 1XMAA 1N75A 5K5RA 1LE8B 2HOTA 1MH3A 3T8TA 3DBRB 2WB1A 2QKLB 4D1QA 4BQAA 1W0TA 3IAS2 3OR2C 2X51A 2A3SA 4I6ZA 3V42A 5EEGA 1LFPA 3VFZA 3CCYA 3KYCB 3CCVI 4KJZA 1D8JA 3H5AA 4XONA 2XASA 3ZMUA 4OU0A 2DOEA 2VIXA 5M5YJ 1TW2A 2EH3A 4CCMA 4FHTA 3S16J 3L2QA 4N4OB 5ED4A 2ZC2A 2OAZA 2KRCA 3H0DA 3C2BA 3R6SA 2WAEA 3IRRA 3LNQA 4CSWA 4ON0A 3WTSC 2ZKZA 3L2WA 1MW7A 3LFUA 4Y17A 1JUPA 1D0ZA 3BP8A 4M3BA 4NQWA 2FBIA 4HDVA 4AIKA 3C1DA 4ASNA 1Y1VJ 4O3MA 4R8HA 4RA2A 4L9VA 3ZQFA 1D8KA 2XAGA 1I6HJ 1A04A 5LFAA 2DT6A 2A07F 4BS9A 2W00A 4NC7A 3G1MA 1JJ6C 4QPQA 2NXNB 2LREA 4EGZA 4E7LA 2KMUA 2FQ3A 1W36C 1X1AA 3GZ5A 3VODA 4HQMA 4UVCA
chains in the Genus database with same CATH topology
4KNYA 1P6RA 1XCBA 4KFCA 1B4AA 5LHGA 1FP2A 1J59A 2RNJA 5CYVA 1K78B 2W57A 1YG2A 2IRFG 3E5UA 3I4PA 1FSHA 4M9XA 2BBYA 2GZWA 2F5FA 1W5SA 3RPUA 3MZYA 5E8IA 1VTNC 5CVJA 1KA8A 2P8TA 1U8RA 2KIFA 1XGNA 1S3JA 4MEYF 4YIFA 2MH2A 3CLOA 3BWGA 2O3FA 4BXUA 5FLXZ 3KP3A 3I5UA 2P5LC 1YTYA 2ZMEA 4UUVA 3GLXA 1F9NA 1AWCA 1Z1DA 3GO5A 1Z6TA 1LVAA 2Y48A 5FFZA 5A2QZ 2P6SA 3LA2A 4UV8A 5D8KB 4MQVA 1W4MA 4IXAA 3VOEA 3JTHA 3LA3A 1BI0A 1ON1A 4HBLA 5AIPA 3O6BB 4A5NA 4PCQA 4LLNA 3TOBA 3RIRA 2YX4A 3FM3A 1G6NA 4M6XA 4YFKF 4B8XA 2VOPA 1IAWA 3P9IA 5DYMA 2BYVE 1R7JA 2ESNA 1WSUA 3JAMZ 3I64A 3EQLF 2BE5F 2NS0A 3L09A 3PQKA 3J80K 4CYDA 4LG0A 2FBKA 3EETA 2ADUA 2PMUA 3TQNA 5L3EA 1Z7UA 3DKWA 1H9TA 4L18B 4YFNF 3HRTA 3E97A 5HDGA 4L9NA 2DI3A 2DLLA 1J75A 3F6OA 2CWEA 4I02A 1IW7F 4RB0A 4HQEA 4DNCA 1YO5C 1IN8A 4HAMA 5AIQA 3I59B 1KU3A 1F1ZA 4Q47A 1BC8C 4M9SA 1IN5A 1W5TA 4U0YA 3E6DA 2PFBA 1QGPA 1DPRA 2H09A 3HSFA 2CQKA 2PBIA 1ZH5A 4RAYA 4LGWA 4BAYA 1UFMA 5CVIA 1AOYA 2FOKA 3DXJF 2YX7A 3CO7C 2OZ6A 3LQQA 2Z99A 2RDPA 3ELKA 4IRGA 3D0SA 1XSVA 3K1MA 4WCGA 2XV4S 3RKWA 3F8NA 3IWZA 3E6CC 1P4AA 1KGSA 4MTDA 3K1NA 4CHUA 3BOQA 2PI0A 4TV7A 3W6JB 3G73A 3QU3A 4P9FA 1O57A 2VC0A 3LQRA 3SZPA 3T8RA 1WI9A 5CVUA 1KYWA 3FMSA 2DK5A 3I0TA 4PGHA 2XKPA 1TLHB 3LSTA 1G3TA 3HSRA 2M5WA 2EK5A 3MEXA 1XD7A 3QOPA 5BOXA 3AAFA 5ICEA 3E6BA 1U3EM 3IC7A 3MQ0A 1ZARA 1W7PA 4WXCA 4KN7X 1ZGAA 2OQRA 1ZLJA 3J81Z 4AWXB 2KKOA 1FZPB 1S7AA 3MCZA 2XAHA 4EJTA 4XBFA 2L01A 1LNWA 2QENA 2VN2A 4I0AA 3DF8A 5H6RA 5JHUA 3OV8A 3RDIA 3HRSA 2M30A 5E18F 3WU0A 2DAOA 4IJAA 5DUIA 1V4RA 1LB2A 2WC2A 4O6JA 3ZMSA 3K1PA 2RGVA 1R58A 1TW3A 3EYIA 1EH6A 3U1DA 1R5GA 3REOA 2RKHA 4M74A 1EH7A 2MBFA 3P9KA 3R0JA 4UVAA 4PGGA 5DCMA 3TO6A 2H94A 3PFIA 1FP1D 3H3ZA 4L5JA 2IA1A 4N9HA 1L0OC 5FB2A 4A0ZA 2GWRA 2XIGA 1XCVA 2FE3A 4EJOA 4O5VA 2DFIA 2AS5F 2HZTA 4L0YB 2UZKA 5AONA 3F72A 2STWA 1YFHA 4PDKA 2HTSA 5H6QA 1FBSA 2P7VB 2K4JA 3TGNA 4N9IA 4RB1A 1FBUA 2HYFA 1I27A 4EM0B 2CGPA 5DCFA 1SD7A 2M8EA 3FXUA 3HYIA 2P5VA 4FT8A 5L3GA 2JRTA 2JZYA 2JT1A 4HLYA 2JSCA 2ISYA 4D0PA 3GX4X 1U6GA 1SMTA 2ACJA 2L4AA 4OMZA 4AD9A 2DPUA 1W7PD 2H6BA 3K69A 4A0XA 1R1UA 4MGRA 2QBYB 3CDHA 4P55A 1T38A 5F64A 4OINF 1CF7A 5HS8A 2ZNYA 2EFQA 3BJAA 2YR2A 1BM9A 1Z6RA 2OZUA 1MZBA 1TQMA 1FT9A 1V3FA 5K5QA 2OQGA 1U78A 3T5XA 3HIFA 2IA2A 4IF4A 1ZHFA 1U5TA 1KU2A 3CJNA 3ERED 4I09A 3B02A 2F2EA 2NRAC 5J8FA 3FHZA 2IJLA 2VONA 1FWZA 2V1DA 2PLYA 2GXBA 3ZMDA 3V8JA 3F23A 4ENNA 2C6YA 3SFZA 1SFXA 2VXZA 1MDMA 3ECHA 3CUQA 3SZTA 3KP2A 4HX4A 2P7CB 1XDSA 2DO7A 4JQFA 3R4KA 1BC7C 1IN7A 4KICA 4RAZA 1FYKA 5LEKA 2XKOA 5FGMA 1XGSA 6PAXA 3WTXC 1FC3A 3GVAA 3F21A 1E2XA 3U9GA 2PJPA 1P2FA 5E1WA 3GFJA 2ISZA 1DDNA 2H6CA 1QNTA 2K86A 5HS9A 4WK8F 1R22A 3WGGA 3WU1B 5ILVA 1RNLA 4U7BA 4ETSA 5E1XA 4L0ZB 2O61A 5ICFA 1SFEA 4EQQA 1BJAA 4GYGA 4QWQA 3TDZC 2V79A 2GA2A 5TJJA 4WF2A 1FLIA 4M72A 4ZZDA 1YW9A 1QZYA 3GXOA 2VBXA 2OD5A 2ZMEB 2XRNA 3WE3A 4MEXF 2D2WA 4HOBA 2QWWA 3RYPA 5CJ9A 4XLNF 2X4HA 2TDXA 4HLXA 1ZN2A 3I54A 2G9WA 2MH9A 3GZ6A 2D1HA 1LEBA 2VT2A 3F3XA 3IKVA 2M1BA 1I6XA 3HRUA 3PQJA 3LFKA 1EV7A 3Q5FA 4HYEA 3DEUA 4LJZF 1OYIA 1I1GA 3KP6A 5DD8A 3TOAA 3V8KA 3C18A 2MD5A 1J0RA 5LGUA 1K7AA 2CSOA 2P4WA 1DUXC 1JE8A 2M87A 2RQPA 2PN6A 4BYYA 5H20A 2D45A 2QUFA 4HV5A 2G7UA 1BOAA 4CZZA 5F6FA 2Q2EA 2MA3A 1YLFA 4MTEA 1KU9A 4LG0B 4GO1A 5KK1A 1UCRA 2HFHA 4A2UA 3V7RA 1OR7A 1P4WA 4UHTA 5CVVA 3T1BA 2ZO4A 1YIOA 2XVCA 1E17A 1KQ8A 5DD4A 1LDKB 2MLGA 3FXRA 2VBYA 1U2WA 1S6LA 1STZA 4PZJA 4KT5C 2QQBA 3WTUC 4IHTA 4ESFA 1LDJA 5LLQA 3C7JA 2HQRA 4LK1F 1G3WA 3WG9A 1O3QA 4BNCA 2GQQA 1LQ1A 3LAPA 3HUGA 1RZ4A 3RKYA 2K27A 3MFKA 2A6HF 4S05A 1K6OA 3BROA 2QQAA 3BJ6A 5HVQC 4LLGF 2W85A 4G7OF 2HR3A 3EUHA 1JGSA 1ZG5A 4UXNA 2K7LA 2XAFA 3ZP5A 1DPUA 3JW4A 1BI3A 3NEUA 3QRFF 3M1EA 4A12A 3KZZA 4G6DA 3HRMA 4ENKA 4NHJA 3NRVA 3QPTA 1CGPA 3KEQA 1F5TA 3KP7A 1D5VA 3R60A 4EJWA 3FZVA 2ETHA 4ZZLA 4HF2A 3F8BA 2OA4A 5E8GA 2VC1A 2IW5A 3QP5A 1ULYA 2Z9OA 2LF7A 1O3SA 4RGRA 4CICA 1WWXA 2WWYA 4CXFA 2A5YB 2FU4A 4M73A 4KA4A 3ZMZA 1REPC 4BHBA 1UHMA 5IT9K 1QQIA 1FBQA 1FSEA 5LRSA 3M9AA 5D8LB 1UHWA 1PP7U 2GXGA 2HKXA 3V7SA 4HV6A 3ZN0A 1YS7A 3J80Z 4GCVA 3ABUA 2H27A 3OOPA 3FF5A 3K2ZA 2EFOA 2RV8A 2BEOA 2ZCWA 3RPQA 2A61A 2KJBA 2HOEA 1MKMA 4HA8A 1YQAA 3WGIA 4U7DA 5BQTA 1I5ZA 3RYRA 1TNTA 3WE2A 2A6EF 2EFPA 5DCMB 1HW5A 1XDUA 4CO8A 5L3CA 5J6XA 5HLIA 4G7HF 1XN7A 2VODA 3DP7A 4MHGA 5FFXA 3RJPA 4ENJA 4HZFA 1J2XA 1TQIA 4LB5A 3NQOA 3ZMVA 5HS7A 1B59A 3WTVC 5HLHA 2NNNA 2YSRA 1FY7A 2PEXA 3IL2A 2W25A 2NYXA 1BIAA 1P4XA 3T0YA 5DUKA 1QPMA 1XMKA 1DP7P 3I53A 2ZXJA 3C3WA 3ROUA 2FXAA 2JPBA 2K02A 5JR3A 3MZHA 3DFGA 1O7FA 2VBWA 2XGXA 1U5TC 2QYOA 1WRJA 4AIJA 1IN4A 3P9CA 3ZN1A 4P96A 3KZYA 1UB9A 4OIQF 4KYWA 4H0EA 1ZAOA 3GFIA 2FMYA 3BPXA 5F1RA 2HTJA 3WTZA 3F6VA 3CUQC 1FYMA 3KEOA 4KIFA 2IP2A 3BPVA 4ESJA 1S7OA 2R7FA 2PQ8A 4U0WA 2LDUA 1RUOA 1R36A 3DQVC 2P5KA 3L2CA 4NB5A 2RC4A 1ZRDA 4FX4A 1LEAA 4A5MA 3FM5A 1FYLA 4OIRF 4A0YA 1ON2A 1U5TB 4F7ZA 3G3ZA 1J9IA 1H9GA 1L3LA 4MQ9F 4G94A 1IF1A 4EV0A 5JI6A 1MGTA 3E3VA 4Q5SF 3WTWC 1MDMB 1ONVA 1IUYA 5CLSA 1H0MA 4L9JA 3U2RA 5E1ZB 2RN7A 5LGNA 5ILUA 1O7LA 2FF4A 1X3UA 2YU3A 3F22A 2W84A 2R3SA 5ILSA 2Y75A 4M71A 5HLGA 3HTUA 3LWFA 1ZLKA 5E20A 4I01A 4IVNA 3F8MA 4LFUA 3H3UA 3VEPA 2AXLA 3CTAA 2KJCA 3RKXA 3JSOA 3L9FA 3JSPA 4FX0A 4K2EA 3TO9A 1KYZA 2EB7A 2J5OA 2DBBA 2ZBKA 4A6EA 3QAHA 4Q48A 3ML6A 2LNBA 3KE2A 4CGZA 1HSTA 1HW2A 5D5UB 2IVMA 5D6EA 3ZPLA 1HW1A 1HQCA 3I58A 4BH9A 3V7CA 2F5EA 5FD5A 2Z3YA 3DPLC 4Z2YA 3K0LA 1TTYA 2WV0A 5K5OA 4L9TA 5JVTA 3LAJA 4EJUA 3P7NA 2G7HA 1RUNA 2VT3A 4RGXA 3F8CA 3GWZA 4OOIA 2JPCA 1MJ9A 1OMIA 3Q9VA 4XSZF 3L7WA 4LLLA 3IRQA 2EA2A 2FEZA 5FLXK 4EMSA 4R79A 2O8XA 1SMYF 2L3DA 4A6DA 2OBPA 3BDDA 1YS6A 3DV8A 4Q4ZF 2JTVA 2E1NA 4HX8A 4P9UA 1BI1A 1R23A 3RTRA 5D4RA 2HWVA 5A2QK 4WXHA 4OIPF 4BHCA 1IXSB 1HSJA 1HKTA 2DW4A 3ZMTA 3KCCA 3FWEA 5EEHA 2UXXA 1MJAA 4I98B 4E70A 4IRHA 5J8CA 1G3SA 3ECOA 2F5DA 4G6QA 1FNNA 1GHCA 1O3RA 3TKYA 2STTA 4HW0A 4HX7A 2P6TA 3SQNA 3WTYC 2QM3A 2HDCA 4I0BA 4LMYA 3HOTA 4LD5A 1D3YA 5D5WB 3JAMK 2DK8A 3GYHX 1T98A 4ESBA 3HTSB 2E7XA 1MJBA 1R1TA 3ULQB 1HXDA 3ISPA 3LA7A 2W24A 5LBQA 2LKPA 5BMZA 2BGCA 5D5VB 5HDKA 4KN4X 2DU9A 4QLCU 1T2KA 2Z5UA 3HHGA 4KMFA 5FD6A 1PP8F 1QZZA 2QQ9A 3BJOA 4DQ2A 4EJVA 1IZ1A 1WKMA 4R1HA 4GXOA 2CG4A 2A68F 4GYIA 1K78A 1Q1HA 4P5OA 3FMRA 2XHKA 2NAZA 4RS8A 1R00A 3IKTA 5BPIA 3RI4A 3COAC 2GIVA 3M8EA 1IXRC 1ZYRF 2J5PA 3DPTA 2GA1A 2EA4A 2RVCA 5ERIA 1GVJA 3MAJA 1B9NA 2F5CA 2IPQX 1Y0UA 1BN5A 1ZRCA 1XGOA 2FA5A 2PG4A 5DDGA 4G8XA 3WGHA 2EFWA 1T6SA 1XB4A 2LF8A 1FOKA 2KRFA 1GXQA 4JK1X 1IRFA 1USTA 2UXNA 1IRGA 4IHSA 4BHPA 2HGCA 4YG2F 3KP5A 4RB3C 4U88A 1R5HA 1QO0D 1NHAA 4YIIA 2VBZA 3I71A 2L02A 1SD4A 2O0YA 1YW8A 3D5LA 1MD0A 2EV0A 2VE9A 1RIOH 4M9ZA 3V4GA 2ZJ2A 2HS5A 4AIHA 3CUOA 2L54A 4U0VA 3J81K 4HF0A 5JFRA 2QZ8A 1KU7A 1C0WA 1OKRA 1ZG1A 1FPQA 2XAQA 2D1VA 3R61A 4ZYEA 1T39A 2CFXA 1SFUA 2FRHA 5LEJA 2LSOA 3SXYA 1OPCA 2IT0A 3N97A 3E6MA 2FSWA 2EV5A 4I7HA 4UNOA 2UWMA 1EH8A 1Z91A 2QLZA 4IPAA 3WTTC 3TDUC 1SD5A 1W7PB 4M6YA 4WXDA 1B6AA 5ICCA 1YYVA 3I59A 1P92A 1Z05A 4HDUA 1ZREA 4WWCA 3EYYA 5E17F 4HF1A 4LB6B 2GAUA 2EFNA 3GF2A 2HKOA 1OYWA 5BPDA 1IXCA 1XSXA 3QP6A 3ABTA 2R7DA 3Q9SA 1SAXA 3HSEA 2KIUA 3EDPA 4G9YA 3JTGA 1F4KA 4KIBA 4UVBA 2HYGD 2KIMA 3IHUA 4KUMA 2DPDA 4EM2A 3F8FA 2Z33A 2WTEA 2K4BA 2VOOA 2V1XA 2XUBA 4MNUA 5HDNA 1TNSA 2X0LA 3K9TA 3W6KB 4I2OA 3M8FA 1G4DA 2E1CA 4IRIA 1QBJA 4RGSA 4YFXF 2ESHA 4WX9A 1JHFA 1TQPA 2NNYA 3MWMA 5LRRA 1KQ9A 4EVIA 4XLPF 2EWNA 3GW2A 2FNAA 2E7WA 1BBYA 4XRFA 1J5YA 3KP4A 2V6CA 1HBXG 3O2PE 5D5XB 1XGMA 1PUEE 1R1VA 4ZYDA 2BV6A 5IT9Z 2Q8KA 4B09A 2YPRA 3IWFA 1ODDA 1BIBA 3E5QA 3CO6C 5LHIA 5BS6A 2XAJA 5CVRA 3KLOA 1S8NA 1GXPA 2DQLA 1G3YA 1JHHA 1B1BA 5D4SA 4S04A 2CYYA 3O3KA 5DEQA 4JBAA 5HOOA 4RB2C 2FMLA 1WQ2A 4CDGA 1CF7B 3FMQA 4KIGA 2CO5A 4XSXF 2QVOA 2DQRA 1TBXA 1K79A 1S29A 2ZNZA 2FBHA 3L00A 4Y15A 3GFLA 3HHHA 3BZ6A 5L3BA 4L5IA 2HEOA 2HQNA 2MLKA 1ZG3A 1J7KA 1O3TA 2MC3A 2O03A 5K1YA 2DT5A 3BY6A 3FX3A 4ZH4F 3E5XA 1HKSA 5LHHA 3QU6A 3S2WA 3GUDA 2FNPA 4UV9A 4G7ZF 1OYYA 5LGTA 3CUQB 2VE8A 3WODF 1Z9CA 3KFWX 3ZQ7A 2O6GE 1YW7A 2V1UA 1ZGJA 4ZYGA 3N4MA 5KVRA 1LDDA 4GGGA 2CW0F 3H92A 1ZRFA 5FO5A 1KQ0A 2L4MA 2Y0MA 4KMUX 5D6FA 3GEZA 4KDPA 3KETA 5TRDA 1T0FA 4ENMA 3J7AO 3HOSA 2COMA 2DTRA 4OIOF 4EGYA 3V8LA 2ELHA 2IA0A 2EJRA 1RI7A 3VB2A 2PMHA 1XSDA 1HKQA 3GFMA 2B0LA 1BI2A 5L3FA 1FX7A 2V9VA 4OMYA 2OU2A 3B73A 1B9MA 2M45A 1IN6A 5ICGA 2XROA 2QBYA 1JXSA 2Q0OA 4ZYHA 3R0AA 4N0BA 4EM1A 5IT3A 1USSA 1LJ9A 1SD6A 3QPHA 5DV5A 1I1SA 3KLNA 1PDNC 5L3DA 4AVPA 4LK0F 2A69F 2ZFWA 2EV6A 4RGUA 3TO7A 3FXQA 3M7GA 4Y13A 3SHFA 1XMAA 5K5RA 3T8TA 4BQAA 2A3SA 5EEGA 3VFZA 1D8JA 2XASA 3ZMUA 4OU0A 1TW2A 4FHTA 5ED4A 2OAZA 3R6SA 3IRRA 4ON0A 3WTSC 2ZKZA 4Y17A 3BP8A 4NQWA 2FBIA 4HDVA 4AIKA 3C1DA 4ASNA 4O3MA 4R8HA 4L9VA 1D8KA 2XAGA 1A04A 2A07F 4EGZA 2FQ3A 3GZ5A 3VODA 4HQMA 4UVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KNY A;  1P6R A;  1XCB A;  4KFC A;  1B4A A;  5LHG A;  1FP2 A;  1J59 A;  2RNJ A;  5CYV A;  1K78 B;  2W57 A;  1YG2 A;  2IRF G;  3E5U A;  3I4P A;  1FSH A;  4M9X A;  2BBY A;  2GZW A;  2F5F A;  1W5S A;  3RPU A;  3MZY A;  5E8I A;  1VTN C;  5CVJ A;  1KA8 A;  2P8T A;  1U8R A;  2KIF A;  1XGN A;  1S3J A;  4MEY F;  4YIF A;  2MH2 A;  3CLO A;  3BWG A;  2O3F A;  4BXU A;  5FLX Z;  3KP3 A;  3I5U A;  2P5L C;  1YTY A;  2ZME A;  4UUV A;  3GLX A;  1F9N A;  1AWC A;  1Z1D A;  3GO5 A;  1Z6T A;  1LVA A;  2Y48 A;  5FFZ A;  5A2Q Z;  2P6S A;  3LA2 A;  4UV8 A;  5D8K B;  4MQV A;  1W4M A;  4IXA A;  3VOE A;  3JTH A;  3LA3 A;  1BI0 A;  1ON1 A;  4HBL A;  5AIP A;  3O6B B;  4A5N A;  4PCQ A;  4LLN A;  3TOB A;  3RIR A;  2YX4 A;  3FM3 A;  1G6N A;  4M6X A;  4YFK F;  4B8X A;  2VOP A;  1IAW A;  3P9I A;  5DYM A;  2BYV E;  1R7J A;  2ESN A;  1WSU A;  3JAM Z;  3I64 A;  3EQL F;  2BE5 F;  2NS0 A;  3L09 A;  3PQK A;  3J80 K;  4CYD A;  4LG0 A;  2FBK A;  3EET A;  2ADU A;  2PMU A;  3TQN A;  5L3E A;  1Z7U A;  3DKW A;  1H9T A;  4L18 B;  4YFN F;  3HRT A;  3E97 A;  5HDG A;  4L9N A;  2DI3 A;  2DLL A;  1J75 A;  3F6O A;  2CWE A;  4I02 A;  1IW7 F;  4RB0 A;  4HQE A;  4DNC A;  1YO5 C;  1IN8 A;  4HAM A;  5AIQ A;  3I59 B;  1KU3 A;  1F1Z A;  4Q47 A;  1BC8 C;  4M9S A;  1IN5 A;  1W5T A;  4U0Y A;  3E6D A;  2PFB A;  1QGP A;  1DPR A;  2H09 A;  3HSF A;  2CQK A;  2PBI A;  1ZH5 A;  4RAY A;  4LGW A;  4BAY A;  1UFM A;  5CVI A;  1AOY A;  2FOK A;  3DXJ F;  2YX7 A;  3CO7 C;  2OZ6 A;  3LQQ A;  2Z99 A;  2RDP A;  3ELK A;  4IRG A;  3D0S A;  1XSV A;  3K1M A;  4WCG A;  2XV4 S;  3RKW A;  3F8N A;  3IWZ A;  3E6C C;  1P4A A;  1KGS A;  4MTD A;  3K1N A;  4CHU A;  3BOQ A;  2PI0 A;  4TV7 A;  3W6J B;  3G73 A;  3QU3 A;  4P9F A;  1O57 A;  2VC0 A;  3LQR A;  3SZP A;  3T8R A;  1WI9 A;  5CVU A;  1KYW A;  3FMS A;  2DK5 A;  3I0T A;  4PGH A;  2XKP A;  1TLH B;  3LST A;  1G3T A;  3HSR A;  2M5W A;  2EK5 A;  3MEX A;  1XD7 A;  3QOP A;  5BOX A;  3AAF A;  5ICE A;  3E6B A;  1U3E M;  3IC7 A;  3MQ0 A;  1ZAR A;  1W7P A;  4WXC A;  4KN7 X;  1ZGA A;  2OQR A;  1ZLJ A;  3J81 Z;  4AWX B;  2KKO A;  1FZP B;  1S7A A;  3MCZ A;  2XAH A;  4EJT A;  4XBF A;  2L01 A;  1LNW A;  2QEN A;  2VN2 A;  4I0A A;  3DF8 A;  5H6R A;  5JHU A;  3OV8 A;  3RDI A;  3HRS A;  2M30 A;  5E18 F;  3WU0 A;  2DAO A;  4IJA A;  5DUI A;  1V4R A;  1LB2 A;  2WC2 A;  4O6J A;  3ZMS A;  3K1P A;  2RGV A;  1R58 A;  1TW3 A;  3EYI A;  1EH6 A;  3U1D A;  1R5G A;  3REO A;  2RKH A;  4M74 A;  1EH7 A;  2MBF A;  3P9K A;  3R0J A;  4UVA A;  4PGG A;  5DCM A;  3TO6 A;  2H94 A;  3PFI A;  1FP1 D;  3H3Z A;  4L5J A;  2IA1 A;  4N9H A;  1L0O C;  5FB2 A;  4A0Z A;  2GWR A;  2XIG A;  1XCV A;  2FE3 A;  4EJO A;  4O5V A;  2DFI A;  2AS5 F;  2HZT A;  4L0Y B;  2UZK A;  5AON A;  3F72 A;  2STW A;  1YFH A;  4PDK A;  2HTS A;  5H6Q A;  1FBS A;  2P7V B;  2K4J A;  3TGN A;  4N9I A;  4RB1 A;  1FBU A;  2HYF A;  1I27 A;  4EM0 B;  2CGP A;  5DCF A;  1SD7 A;  2M8E A;  3FXU A;  3HYI A;  2P5V A;  4FT8 A;  5L3G A;  2JRT A;  2JZY A;  2JT1 A;  4HLY A;  2JSC A;  2ISY A;  4D0P A;  3GX4 X;  1U6G A;  1SMT A;  2ACJ A;  2L4A A;  4OMZ A;  4AD9 A;  2DPU A;  1W7P D;  2H6B A;  3K69 A;  4A0X A;  1R1U A;  4MGR A;  2QBY B;  3CDH A;  4P55 A;  1T38 A;  5F64 A;  4OIN F;  1CF7 A;  5HS8 A;  2ZNY A;  2EFQ A;  3BJA A;  2YR2 A;  1BM9 A;  1Z6R A;  2OZU A;  1MZB A;  1TQM A;  1FT9 A;  1V3F A;  5K5Q A;  2OQG A;  1U78 A;  3T5X A;  3HIF A;  2IA2 A;  4IF4 A;  1ZHF A;  1U5T A;  1KU2 A;  3CJN A;  3ERE D;  4I09 A;  3B02 A;  2F2E A;  2NRA C;  5J8F A;  3FHZ A;  2IJL A;  2VON A;  1FWZ A;  2V1D A;  2PLY A;  2GXB A;  3ZMD A;  3V8J A;  3F23 A;  4ENN A;  2C6Y A;  3SFZ A;  1SFX A;  2VXZ A;  1MDM A;  3ECH A;  3CUQ A;  3SZT A;  3KP2 A;  4HX4 A;  2P7C B;  1XDS A;  2DO7 A;  4JQF A;  3R4K A;  1BC7 C;  1IN7 A;  4KIC A;  4RAZ A;  1FYK A;  5LEK A;  2XKO A;  5FGM A;  1XGS A;  6PAX A;  3WTX C;  1FC3 A;  3GVA A;  3F21 A;  1E2X A;  3U9G A;  2PJP A;  1P2F A;  5E1W A;  3GFJ A;  2ISZ A;  1DDN A;  2H6C A;  1QNT A;  2K86 A;  5HS9 A;  4WK8 F;  1R22 A;  3WGG A;  3WU1 B;  5ILV A;  1RNL A;  4U7B A;  4ETS A;  5E1X A;  4L0Z B;  2O61 A;  5ICF A;  1SFE A;  4EQQ A;  1BJA A;  4GYG A;  4QWQ A;  3TDZ C;  2V79 A;  2GA2 A;  5TJJ A;  4WF2 A;  1FLI A;  4M72 A;  4ZZD A;  1YW9 A;  1QZY A;  3GXO A;  2VBX A;  2OD5 A;  2ZME B;  2XRN A;  3WE3 A;  4MEX F;  2D2W A;  4HOB A;  2QWW A;  3RYP A;  5CJ9 A;  4XLN F;  2X4H A;  2TDX A;  4HLX A;  1ZN2 A;  3I54 A;  2G9W A;  2MH9 A;  3GZ6 A;  2D1H A;  1LEB A;  2VT2 A;  3F3X A;  3IKV A;  2M1B A;  1I6X A;  3HRU A;  3PQJ A;  3LFK A;  1EV7 A;  3Q5F A;  4HYE A;  3DEU A;  4LJZ F;  1OYI A;  1I1G A;  3KP6 A;  5DD8 A;  3TOA A;  3V8K A;  3C18 A;  2MD5 A;  1J0R A;  5LGU A;  1K7A A;  2CSO A;  2P4W A;  1DUX C;  1JE8 A;  2M87 A;  2RQP A;  2PN6 A;  4BYY A;  5H20 A;  2D45 A;  2QUF A;  4HV5 A;  2G7U A;  1BOA A;  4CZZ A;  5F6F A;  2Q2E A;  2MA3 A;  1YLF A;  4MTE A;  1KU9 A;  4LG0 B;  4GO1 A;  5KK1 A;  1UCR A;  2HFH A;  4A2U A;  3V7R A;  1OR7 A;  1P4W A;  4UHT A;  5CVV A;  3T1B A;  2ZO4 A;  1YIO A;  2XVC A;  1E17 A;  1KQ8 A;  5DD4 A;  1LDK B;  2MLG A;  3FXR A;  2VBY A;  1U2W A;  1S6L A;  1STZ A;  4PZJ A;  4KT5 C;  2QQB A;  3WTU C;  4IHT A;  4ESF A;  1LDJ A;  5LLQ A;  3C7J A;  2HQR A;  4LK1 F;  1G3W A;  3WG9 A;  1O3Q A;  4BNC A;  2GQQ A;  1LQ1 A;  3LAP A;  3HUG A;  1RZ4 A;  3RKY A;  2K27 A;  3MFK A;  2A6H F;  4S05 A;  1K6O A;  3BRO A;  2QQA A;  3BJ6 A;  5HVQ C;  4LLG F;  2W85 A;  4G7O F;  2HR3 A;  3EUH A;  1JGS A;  1ZG5 A;  4UXN A;  2K7L A;  2XAF A;  3ZP5 A;  1DPU A;  3JW4 A;  1BI3 A;  3NEU A;  3QRF F;  3M1E A;  4A12 A;  3KZZ A;  4G6D A;  3HRM A;  4ENK A;  4NHJ A;  3NRV A;  3QPT A;  1CGP A;  3KEQ A;  1F5T A;  3KP7 A;  1D5V A;  3R60 A;  4EJW A;  3FZV A;  2ETH A;  4ZZL A;  4HF2 A;  3F8B A;  2OA4 A;  5E8G A;  2VC1 A;  2IW5 A;  3QP5 A;  1ULY A;  2Z9O A;  2LF7 A;  1O3S A;  4RGR A;  4CIC A;  1WWX A;  2WWY A;  4CXF A;  2A5Y B;  2FU4 A;  4M73 A;  4KA4 A;  3ZMZ A;  1REP C;  4BHB A;  1UHM A;  5IT9 K;  1QQI A;  1FBQ A;  1FSE A;  5LRS A;  3M9A A;  5D8L B;  1UHW A;  1PP7 U;  2GXG A;  2HKX A;  3V7S A;  4HV6 A;  3ZN0 A;  1YS7 A;  3J80 Z;  4GCV A;  3ABU A;  2H27 A;  3OOP A;  3FF5 A;  3K2Z A;  2EFO A;  2RV8 A;  2BEO A;  2ZCW A;  3RPQ A;  2A61 A;  2KJB A;  2HOE A;  1MKM A;  4HA8 A;  1YQA A;  3WGI A;  4U7D A;  5BQT A;  1I5Z A;  3RYR A;  1TNT A;  3WE2 A;  2A6E F;  2EFP A;  5DCM B;  1HW5 A;  1XDU A;  4CO8 A;  5L3C A;  5J6X A;  5HLI A;  4G7H F;  1XN7 A;  2VOD A;  3DP7 A;  4MHG A;  5FFX A;  3RJP A;  4ENJ A;  4HZF A;  1J2X A;  1TQI A;  4LB5 A;  3NQO A;  3ZMV A;  5HS7 A;  1B59 A;  3WTV C;  5HLH A;  2NNN A;  2YSR A;  1FY7 A;  2PEX A;  3IL2 A;  2W25 A;  2NYX A;  1BIA A;  1P4X A;  3T0Y A;  5DUK A;  1QPM A;  1XMK A;  1DP7 P;  3I53 A;  2ZXJ A;  3C3W A;  3ROU A;  2FXA A;  2JPB A;  2K02 A;  5JR3 A;  3MZH A;  3DFG A;  1O7F A;  2VBW A;  2XGX A;  1U5T C;  2QYO A;  1WRJ A;  4AIJ A;  1IN4 A;  3P9C A;  3ZN1 A;  4P96 A;  3KZY A;  1UB9 A;  4OIQ F;  4KYW A;  4H0E A;  1ZAO A;  3GFI A;  2FMY A;  3BPX A;  5F1R A;  2HTJ A;  3WTZ A;  3F6V A;  3CUQ C;  1FYM A;  3KEO A;  4KIF A;  2IP2 A;  3BPV A;  4ESJ A;  1S7O A;  2R7F A;  2PQ8 A;  4U0W A;  2LDU A;  1RUO A;  1R36 A;  3DQV C;  2P5K A;  3L2C A;  4NB5 A;  2RC4 A;  1ZRD A;  4FX4 A;  1LEA A;  4A5M A;  3FM5 A;  1FYL A;  4OIR F;  4A0Y A;  1ON2 A;  1U5T B;  4F7Z A;  3G3Z A;  1J9I A;  1H9G A;  1L3L A;  4MQ9 F;  4G94 A;  1IF1 A;  4EV0 A;  5JI6 A;  1MGT A;  3E3V A;  4Q5S F;  3WTW C;  1MDM B;  1ONV A;  1IUY A;  5CLS A;  1H0M A;  4L9J A;  3U2R A;  5E1Z B;  2RN7 A;  5LGN A;  5ILU A;  1O7L A;  2FF4 A;  1X3U A;  2YU3 A;  3F22 A;  2W84 A;  2R3S A;  5ILS A;  2Y75 A;  4M71 A;  5HLG A;  3HTU A;  3LWF A;  1ZLK A;  5E20 A;  4I01 A;  4IVN A;  3F8M A;  4LFU A;  3H3U A;  3VEP A;  2AXL A;  3CTA A;  2KJC A;  3RKX A;  3JSO A;  3L9F A;  3JSP A;  4FX0 A;  4K2E A;  3TO9 A;  1KYZ A;  2EB7 A;  2J5O A;  2DBB A;  2ZBK A;  4A6E A;  3QAH A;  4Q48 A;  3ML6 A;  2LNB A;  3KE2 A;  4CGZ A;  1HST A;  1HW2 A;  5D5U B;  2IVM A;  5D6E A;  3ZPL A;  1HW1 A;  1HQC A;  3I58 A;  4BH9 A;  3V7C A;  2F5E A;  5FD5 A;  2Z3Y A;  3DPL C;  4Z2Y A;  3K0L A;  1TTY A;  2WV0 A;  5K5O A;  4L9T A;  5JVT A;  3LAJ A;  4EJU A;  3P7N A;  2G7H A;  1RUN A;  2VT3 A;  4RGX A;  3F8C A;  3GWZ A;  4OOI A;  2JPC A;  1MJ9 A;  1OMI A;  3Q9V A;  4XSZ F;  3L7W A;  4LLL A;  3IRQ A;  2EA2 A;  2FEZ A;  5FLX K;  4EMS A;  4R79 A;  2O8X A;  1SMY F;  2L3D A;  4A6D A;  2OBP A;  3BDD A;  1YS6 A;  3DV8 A;  4Q4Z F;  2JTV A;  2E1N A;  4HX8 A;  4P9U A;  1BI1 A;  1R23 A;  3RTR A;  5D4R A;  2HWV A;  5A2Q K;  4WXH A;  4OIP F;  4BHC A;  1IXS B;  1HSJ A;  1HKT A;  2DW4 A;  3ZMT A;  3KCC A;  3FWE A;  5EEH A;  2UXX A;  1MJA A;  4I98 B;  4E70 A;  4IRH A;  5J8C A;  1G3S A;  3ECO A;  2F5D A;  4G6Q A;  1FNN A;  1GHC A;  1O3R A;  3TKY A;  2STT A;  4HW0 A;  4HX7 A;  2P6T A;  3SQN A;  3WTY C;  2QM3 A;  2HDC A;  4I0B A;  4LMY A;  3HOT A;  4LD5 A;  1D3Y A;  5D5W B;  3JAM K;  2DK8 A;  3GYH X;  1T98 A;  4ESB A;  3HTS B;  2E7X A;  1MJB A;  1R1T A;  3ULQ B;  1HXD A;  3ISP A;  3LA7 A;  2W24 A;  5LBQ A;  2LKP A;  5BMZ A;  2BGC A;  5D5V B;  5HDK A;  4KN4 X;  2DU9 A;  4QLC U;  1T2K A;  2Z5U A;  3HHG A;  4KMF A;  5FD6 A;  1PP8 F;  1QZZ A;  2QQ9 A;  3BJO A;  4DQ2 A;  4EJV A;  1IZ1 A;  1WKM A;  4R1H A;  4GXO A;  2CG4 A;  2A68 F;  4GYI A;  1K78 A;  1Q1H A;  4P5O A;  3FMR A;  2XHK A;  2NAZ A;  4RS8 A;  1R00 A;  3IKT A;  5BPI A;  3RI4 A;  3COA C;  2GIV A;  3M8E A;  1IXR C;  1ZYR F;  2J5P A;  3DPT A;  2GA1 A;  2EA4 A;  2RVC A;  5ERI A;  1GVJ A;  3MAJ A;  1B9N A;  2F5C A;  2IPQ X;  1Y0U A;  1BN5 A;  1ZRC A;  1XGO A;  2FA5 A;  2PG4 A;  5DDG A;  4G8X A;  3WGH A;  2EFW A;  1T6S A;  1XB4 A;  2LF8 A;  1FOK A;  2KRF A;  1GXQ A;  4JK1 X;  1IRF A;  1UST A;  2UXN A;  1IRG A;  4IHS A;  4BHP A;  2HGC A;  4YG2 F;  3KP5 A;  4RB3 C;  4U88 A;  1R5H A;  1QO0 D;  1NHA A;  4YII A;  2VBZ A;  3I71 A;  2L02 A;  1SD4 A;  2O0Y A;  1YW8 A;  3D5L A;  1MD0 A;  2EV0 A;  2VE9 A;  1RIO H;  4M9Z A;  3V4G A;  2ZJ2 A;  2HS5 A;  4AIH A;  3CUO A;  2L54 A;  4U0V A;  3J81 K;  4HF0 A;  5JFR A;  2QZ8 A;  1KU7 A;  1C0W A;  1OKR A;  1ZG1 A;  1FPQ A;  2XAQ A;  2D1V A;  3R61 A;  4ZYE A;  1T39 A;  2CFX A;  1SFU A;  2FRH A;  5LEJ A;  2LSO A;  3SXY A;  1OPC A;  2IT0 A;  3N97 A;  3E6M A;  2FSW A;  2EV5 A;  4I7H A;  4UNO A;  2UWM A;  1EH8 A;  1Z91 A;  2QLZ A;  4IPA A;  3WTT C;  3TDU C;  1SD5 A;  1W7P B;  4M6Y A;  4WXD A;  1B6A A;  5ICC A;  1YYV A;  3I59 A;  1P92 A;  1Z05 A;  4HDU A;  1ZRE A;  4WWC A;  3EYY A;  5E17 F;  4HF1 A;  4LB6 B;  2GAU A;  2EFN A;  3GF2 A;  2HKO A;  1OYW A;  5BPD A;  1IXC A;  1XSX A;  3QP6 A;  3ABT A;  2R7D A;  3Q9S A;  1SAX A;  3HSE A;  2KIU A;  3EDP A;  4G9Y A;  3JTG A;  1F4K A;  4KIB A;  4UVB A;  2HYG D;  2KIM A;  3IHU A;  4KUM A;  2DPD A;  4EM2 A;  3F8F A;  2Z33 A;  2WTE A;  2K4B A;  2VOO A;  2V1X A;  2XUB A;  4MNU A;  5HDN A;  1TNS A;  2X0L A;  3K9T A;  3W6K B;  4I2O A;  3M8F A;  1G4D A;  2E1C A;  4IRI A;  1QBJ A;  4RGS A;  4YFX F;  2ESH A;  4WX9 A;  1JHF A;  1TQP A;  2NNY A;  3MWM A;  5LRR A;  1KQ9 A;  4EVI A;  4XLP F;  2EWN A;  3GW2 A;  2FNA A;  2E7W A;  1BBY A;  4XRF A;  1J5Y A;  3KP4 A;  2V6C A;  1HBX G;  3O2P E;  5D5X B;  1XGM A;  1PUE E;  1R1V A;  4ZYD A;  2BV6 A;  5IT9 Z;  2Q8K A;  4B09 A;  2YPR A;  3IWF A;  1ODD A;  1BIB A;  3E5Q A;  3CO6 C;  5LHI A;  5BS6 A;  2XAJ A;  5CVR A;  3KLO A;  1S8N A;  1GXP A;  2DQL A;  1G3Y A;  1JHH A;  1B1B A;  5D4S A;  4S04 A;  2CYY A;  3O3K A;  5DEQ A;  4JBA A;  5HOO A;  4RB2 C;  2FML A;  1WQ2 A;  4CDG A;  1CF7 B;  3FMQ A;  4KIG A;  2CO5 A;  4XSX F;  2QVO A;  2DQR A;  1TBX A;  1K79 A;  1S29 A;  2ZNZ A;  2FBH A;  3L00 A;  4Y15 A;  3GFL A;  3HHH A;  3BZ6 A;  5L3B A;  4L5I A;  2HEO A;  2HQN A;  2MLK A;  1ZG3 A;  1J7K A;  1O3T A;  2MC3 A;  2O03 A;  5K1Y A;  2DT5 A;  3BY6 A;  3FX3 A;  4ZH4 F;  3E5X A;  1HKS A;  5LHH A;  3QU6 A;  3S2W A;  3GUD A;  2FNP A;  4UV9 A;  4G7Z F;  1OYY A;  5LGT A;  3CUQ B;  2VE8 A;  3WOD F;  1Z9C A;  3KFW X;  3ZQ7 A;  2O6G E;  1YW7 A;  2V1U A;  1ZGJ A;  4ZYG A;  3N4M A;  5KVR A;  1LDD A;  4GGG A;  2CW0 F;  3H92 A;  1ZRF A;  5FO5 A;  1KQ0 A;  2L4M A;  2Y0M A;  4KMU X;  5D6F A;  3GEZ A;  4KDP A;  3KET A;  5TRD A;  1T0F A;  4ENM A;  3J7A O;  3HOS A;  2COM A;  2DTR A;  4OIO F;  4EGY A;  3V8L A;  2ELH A;  2IA0 A;  2EJR A;  1RI7 A;  3VB2 A;  2PMH A;  1XSD A;  1HKQ A;  3GFM A;  2B0L A;  1BI2 A;  5L3F A;  1FX7 A;  2V9V A;  4OMY A;  2OU2 A;  3B73 A;  1B9M A;  2M45 A;  1IN6 A;  5ICG A;  2XRO A;  2QBY A;  1JXS A;  2Q0O A;  4ZYH A;  3R0A A;  4N0B A;  4EM1 A;  5IT3 A;  1USS A;  1LJ9 A;  1SD6 A;  3QPH A;  5DV5 A;  1I1S A;  3KLN A;  1PDN C;  5L3D A;  4AVP A;  4LK0 F;  2A69 F;  2ZFW A;  2EV6 A;  4RGU A;  3TO7 A;  3FXQ A;  3M7G A;  4Y13 A;  3SHF A;  1XMA A;  5K5R A;  3T8T A;  4BQA A;  2A3S A;  5EEG A;  3VFZ A;  1D8J A;  2XAS A;  3ZMU A;  4OU0 A;  1TW2 A;  4FHT A;  5ED4 A;  2OAZ A;  3R6S A;  3IRR A;  4ON0 A;  3WTS C;  2ZKZ A;  4Y17 A;  3BP8 A;  4NQW A;  2FBI A;  4HDV A;  4AIK A;  3C1D A;  4ASN A;  4O3M A;  4R8H A;  4L9V A;  1D8K A;  2XAG A;  1A04 A;  2A07 F;  4EGZ A;  2FQ3 A;  3GZ5 A;  3VOD A;  4HQM A;  4UVC A; 
#chains in the Genus database with same CATH topology
 2DA3 A;  1V5G A;  4KNY A;  3I56 I;  4E7Z A;  2DYR H;  2NVQ J;  1P6R A;  4X0G A;  2KZV A;  3BG9 A;  1XCB A;  4KFC A;  1B4A A;  5LHG A;  1FP2 A;  5FKO A;  2P0T A;  1V5F A;  3HEF A;  1J59 A;  1UJ8 A;  2RNJ A;  5CYV A;  1SVO A;  4B3A A;  2K5C A;  4XRM A;  2Q2E B;  3IH3 A;  2EZI A;  3LSH A;  2X6X A;  2BXZ A;  1MMN A;  1GT0 C;  1K78 B;  2W57 A;  3ERM A;  1NTC A;  2ICW G;  1YG2 A;  1YJ9 I;  1YRN A;  4BQQ A;  2L9R A;  1R49 A;  2IRF G;  3E5U A;  3I4P A;  5KHD A;  3UNG C;  2R7W A;  3HB9 A;  1FSH A;  2VKE A;  5DM7 F;  4M9X A;  2BBY A;  1UAA A;  2GZW A;  3MD2 A;  2F5F A;  1U9O A;  1SAN A;  2KFD A;  1W5S A;  3GME A;  3RPU A;  3MZY A;  5F04 A;  1A6Q A;  5E8I A;  3EUH C;  1VTN C;  2ZXI A;  4KT6 A;  3S1M J;  5CVJ A;  4XMY A;  1IV6 A;  1KA8 A;  4DBR A;  1P9Q C;  3ONQ A;  2P8T A;  1U8R A;  2KIF A;  1XGN A;  4AM3 A;  1S3J A;  1TWH J;  4MEY F;  4YIF A;  2MH2 A;  3CLO A;  3BWG A;  3MZ8 A;  4W97 A;  2O3F A;  3JRB A;  3GTL J;  4BXU A;  5FLX Z;  1R71 A;  3KP3 A;  3I5U A;  2P5L C;  1YTY A;  1TT0 A;  2ZME A;  4DYR A;  1ITY A;  4UUV A;  3GTP J;  5E3N A;  4F91 B;  4XLF A;  3K6G A;  3GLX A;  4G6T B;  3F9K A;  4YRV A;  1F9N A;  2K3P A;  4U87 A;  1AWC A;  4BBR J;  2E2J J;  3HOU J;  1Z1D A;  3VSK A;  2O5R A;  5TGT A;  3GO5 A;  1T56 A;  2I8D A;  1Z6T A;  1LVA A;  2M8G X;  2Y48 A;  3HUG B;  5FFZ A;  5E3M A;  5A2Q Z;  2P6S A;  3LA2 A;  4UV8 A;  5D8K B;  1HCR A;  4MQV A;  4ZTF A;  1W4M A;  3S1R J;  2BVL A;  4IXA A;  2JWT A;  1VQK I;  3VOE A;  4M3F A;  4BXF A;  1MBJ A;  1TZL A;  2IGO A;  3JTH A;  3OR1 C;  3LA3 A;  1BI0 A;  1ON1 A;  4HBL A;  5KAI C;  2I5U A;  2V7F A;  2LKX A;  5AIP A;  3O6B B;  5BNG A;  1VZ0 A;  4A5N A;  4PCQ A;  3W2A A;  4LLN A;  3TOB A;  3QOD A;  1DU0 A;  3RIR A;  2V9P A;  2YX4 A;  3BR3 A;  1G6N A;  3FM3 A;  4M6X A;  3D1N I;  5M3M J;  4YFK F;  4IX7 A;  3DEW A;  1RRJ A;  4B8X A;  2VOP A;  1IAW A;  4MFD A;  3P9I A;  5DYM A;  3HKZ N;  2BYV E;  4DYC A;  1TP4 A;  3HBL A;  2KIS A;  1P7I A;  2V9K A;  1R7J A;  2ESN A;  2Q1Z B;  1WSU A;  3JAM Z;  3I64 A;  3EQL F;  4A3C J;  2BE5 F;  2NS0 A;  3L1P A;  3QYE A;  3L09 A;  3TP0 A;  1ZQ3 P;  2DYS H;  2OUM A;  1Y1W J;  3PQK A;  3J80 K;  3I55 I;  3S1N J;  4C2M J;  4CYD A;  4LG0 A;  5E79 C;  4HNU A;  2FBK A;  5EG0 A;  3EET A;  1VQ9 I;  2ADU A;  1FTT A;  2PMU A;  3S3O A;  1D0X A;  1MSF C;  1YJW I;  2HVS A;  1LUJ B;  3TQN A;  2E1M C;  5L3E A;  1Z7U A;  3DKW A;  2HPI A;  1H9T A;  4L18 B;  2MGQ A;  9ANT A;  4YFN F;  3HRT A;  2HYJ A;  3E97 A;  5HDG A;  1X19 A;  4L9N A;  1TL8 A;  2DI3 A;  5M5W J;  2DLL A;  1J75 A;  3F6O A;  2CWE A;  2L5Q A;  3GCM A;  1VFC A;  4I02 A;  1PUF A;  3RQ4 A;  1IW7 F;  2AQE A;  4RB0 A;  3PUB A;  4IKF A;  2LY9 A;  3E7L A;  4HQE A;  4DNC A;  2M4K A;  1YO5 C;  1IN8 A;  3DEE A;  2RAE A;  4HAM A;  4XIC A;  5AIQ A;  3GTJ J;  5FLX R;  3I59 B;  1NG6 A;  1GV5 A;  3RPU D;  1KU3 A;  4FIS A;  3FIS A;  1F1Z A;  4B4C A;  2ID6 A;  4Q47 A;  3ABK H;  1BC8 C;  4M9S A;  5CPR B;  1RC9 A;  1IN5 A;  1W5T A;  3LSP A;  4U0Y A;  3E6D A;  2LFB A;  1BA5 A;  4ZJZ A;  2PFB A;  1QGP A;  1DPR A;  2H09 A;  3G2B A;  3HSF A;  2CQQ A;  1VQO I;  2CQK A;  2R5Z B;  2PBI A;  2FUG 2;  1ZH5 A;  2EZK A;  3HOZ J;  2E1M B;  5A2Q R;  4RAY A;  3LSG A;  2VB6 A;  3QYB A;  4LGW A;  4BAY A;  1UFM A;  5CVI A;  1AOY A;  2FOK A;  1P7J A;  3DXJ F;  5B1A H;  2YX7 A;  3CO7 C;  2V6E A;  2HVQ A;  2OZ6 A;  3LQQ A;  2JA7 J;  2LC2 A;  2Z99 A;  3SFI A;  1UMQ A;  5B3S H;  1WPK A;  2XB0 X;  3HPH A;  2RDP A;  3CP2 A;  2XGD A;  2JMW A;  3ELK A;  4IRG A;  1FTZ A;  3H1C A;  2XF7 A;  1XSV A;  3D0S A;  3K1M A;  2NS8 A;  4DOZ A;  3OYM A;  4WCG A;  2XV4 S;  3RKW A;  4DBQ A;  3VYR B;  4BAC A;  2ELK A;  3VWB A;  1K61 A;  3F8N A;  3IWZ A;  3CJT B;  1CQT A;  2G0E A;  3E6C C;  3X2Q H;  1P4A A;  3FKI J;  1E3O C;  1KGS A;  1MBE A;  3CP8 A;  4AU7 A;  4MTD A;  1GDT A;  1JT0 A;  3S3M A;  3K1N A;  3VSL A;  2M9H A;  3BOQ A;  4CHU A;  2PI0 A;  2L7K A;  4TV7 A;  3W6J B;  1MND A;  3PFY A;  4QIW N;  3QPS A;  3G73 A;  2VJ4 A;  3QU3 A;  3OYL A;  4P9F A;  1FJL A;  1O57 A;  2VC0 A;  3LQR A;  2A5W A;  2R92 J;  3SZP A;  3K4B A;  4RM3 A;  5B5E C;  3T8R A;  4LIT A;  1VQP I;  1WI9 A;  1EJ9 A;  5CVU A;  3OYD A;  1KYW A;  4BDY A;  3FMS A;  5FJ8 J;  2DK5 A;  3I0T A;  4PGH A;  1ETX A;  2XKP A;  1TLH B;  3LST A;  4NC6 A;  1Y6I A;  1Z0X A;  1G3T A;  2DFE A;  3HSR A;  4RLF A;  2M5W A;  2FJ1 A;  2DMN A;  2EK5 A;  3MEX A;  1XD7 A;  3QOP A;  4BEH A;  5BOX A;  2L2O A;  3AAF A;  5ICE A;  1VF9 A;  3E6B A;  3QWL A;  3IC7 A;  5HNH A;  1U3E M;  1TWC J;  3OYF A;  4M3G A;  3MQ0 A;  2DJI A;  1ZAR A;  4UUS A;  1W7P A;  4WXC A;  3PNV A;  1N77 A;  4KN7 X;  1ZGA A;  2M4G A;  2OQR A;  1ZLJ A;  4AYB N;  4A93 J;  3J81 Z;  4AWX B;  1B8I B;  2KKO A;  3BG5 A;  1FZP B;  1ENH A;  3Q0V A;  1S7A A;  1RPW A;  2DJN A;  3MCZ A;  1ZKG A;  1JKO C;  2XAH A;  2JUG A;  4EJT A;  4XBF A;  2L01 A;  2HXO A;  2HNH A;  1LNW A;  2QEN A;  2VN2 A;  4MIM A;  2OJE D;  3A4C A;  5GAE J;  1OCR H;  3DF8 A;  4I0A A;  5H6R A;  4S0H B;  1EKE A;  5JHU A;  3OV8 A;  3EUK L;  2MD0 A;  3BCB A;  3HRS A;  2M30 A;  3RDI A;  5E18 F;  4XR6 A;  3OS1 A;  3WU0 A;  2DAO A;  3H0G J;  4IJA A;  5DUI A;  1V4R A;  1LB2 A;  2WC2 A;  4O6J A;  3ZMS A;  4IQJ A;  3K1P A;  5J3L A;  1LPQ A;  2RGV A;  3BTL A;  1R58 A;  2OF7 A;  2LG4 A;  1TW3 A;  4NDL A;  2F6C A;  3EYI A;  2DDB A;  1EH6 A;  3U1D A;  1R5G A;  3HGY A;  3REO A;  1JUM A;  2LOO A;  2RKH A;  3DU5 A;  1IGN A;  4M74 A;  2VKV A;  2MW8 A;  3JRI A;  2HI3 A;  1W1W E;  2L9N A;  2BZT A;  2LYC A;  1EH7 A;  2BOL A;  2M35 A;  2MBF A;  2DA2 A;  1YJN I;  4Y7N J;  3P9K A;  1SVL A;  3RKQ A;  3R0J A;  4B48 A;  2BW3 A;  2E71 A;  1T0F C;  4UVA A;  4PGG A;  5DCM A;  2OCE A;  3TO6 A;  1AA7 A;  2H94 A;  3PFI A;  3CD6 I;  3OYN A;  5EF6 A;  1RR7 A;  3ASN H;  2JJ7 A;  1H89 C;  1FP1 D;  3H3Z A;  2HOA A;  4L5J A;  2IA1 A;  1R4M B;  4N9H A;  3SJM A;  3HZJ A;  3UR3 C;  1L0O C;  4RM2 A;  5FB2 A;  4A0Z A;  4YIR X;  1HDD C;  2GWR A;  4IZZ A;  3BZC A;  2XIG A;  3ZR8 X;  1XCV A;  3SDB A;  2LKS A;  2FE3 A;  2XPU A;  4O5V A;  2DFI A;  4EJO A;  1XS9 A;  2HZT A;  3SYT A;  2XC7 A;  2UZK A;  2AS5 F;  4L0Y B;  4BJ5 C;  5AON A;  3F72 A;  2STW A;  3NWT A;  1TWG J;  1YFH A;  3HPG A;  1APL C;  4PDK A;  2HTS A;  5H6Q A;  1FBS A;  1MH4 A;  4HSR A;  4JP0 A;  5IOY A;  2P7V B;  2CV1 A;  3LSI A;  4IOA F;  4DIQ A;  5J1R A;  2H1K A;  4IOC F;  2GXA A;  2CUJ A;  2K4J A;  3TGN A;  4N9I A;  4RDU A;  2ZFU A;  2O8K A;  3PM1 A;  4RB1 A;  4FTH A;  1FBU A;  1N78 A;  4QSH A;  2BY0 A;  1I27 A;  2HYF A;  4D7M A;  3RCO A;  5GPC A;  4ABZ A;  4EM0 B;  2CGP A;  3VYT B;  5DCF A;  3JRE A;  4PFO A;  1SD7 A;  2M8E A;  3BTJ A;  1SAU A;  3FXU A;  2VI6 A;  3HYI A;  2P5V A;  2LMD A;  4FT8 A;  5L3G A;  2JRT A;  3JRG A;  1B72 B;  2A05 A;  2JZY A;  4B44 A;  2JT1 A;  4HLY A;  4V19 K;  2JSC A;  1ETY A;  3HXL A;  2ISY A;  2DOD A;  4D0P A;  1U6G A;  2X6O A;  4XOR A;  3GX4 X;  1SMT A;  1LKX A;  2ACJ A;  3A02 A;  2WAD A;  5M3F J;  1OFC X;  2L4A A;  1BW5 A;  4OMZ A;  4AD9 A;  3LL7 A;  2DPU A;  1W7P D;  4ANJ A;  2DTZ A;  3TW6 A;  2H6B A;  3K69 A;  4A0X A;  1GUU A;  1R1U A;  4MGR A;  2QBY B;  2IS1 A;  3FXO A;  2K9M A;  3CDH A;  4P55 A;  1T38 A;  2WAQ N;  5F64 A;  2BVM A;  3FXJ A;  2CW8 A;  4OIN F;  1CF7 A;  5HS8 A;  2ZNY A;  2EFQ A;  2ID3 A;  2N8G A;  3BJA A;  2YR2 A;  1V55 H;  3S32 A;  3J7Z I;  3RZO J;  3KYD B;  4B47 A;  3Q0W A;  3IUO A;  2H8R A;  2K85 A;  1BM9 A;  1Z6R A;  2OZU A;  1PJR A;  1MZB A;  1TQM A;  3L2V A;  1FT9 A;  1V3F A;  5K5Q A;  5IT9 R;  4AUX A;  2OQG A;  1U78 A;  5B66 C;  3T5X A;  1N25 A;  1MIJ A;  3HG9 A;  2VQL A;  3HIF A;  4B3X A;  2IA2 A;  2PJR A;  4IF4 A;  1ZHF A;  1U5T A;  1KU2 A;  3CJN A;  3ERE D;  4I09 A;  3B02 A;  2F2E A;  2NRA C;  5J8F A;  3FHZ A;  2IJL A;  1M1E B;  1H88 C;  3MKL A;  1FOW A;  1EA3 A;  5EDN A;  2VON A;  1FWZ A;  2V1D A;  4XLC A;  2PLY A;  3WG7 H;  2GXB A;  3ZMD A;  3V8J A;  3IH2 A;  3F23 A;  5DM6 F;  4ENN A;  2R7O A;  4EAT A;  2EQR A;  2C6Y A;  2TCT A;  5J1U A;  4UB6 C;  4ZDL A;  3OYE A;  3SFZ A;  2FOW A;  1SFX A;  2VXZ A;  4BDZ A;  1MDM A;  3ECH A;  3CUQ A;  4NNJ A;  3SZT A;  3KP2 A;  4HX4 A;  3CJQ B;  3BG3 A;  3JRA A;  2P7C B;  4II3 A;  3JRF A;  1XDS A;  2XPV A;  2L0K A;  2DO7 A;  2LBF A;  4JQF A;  3GTQ J;  2DFH A;  3R4K A;  1BC7 C;  1IN7 A;  4KIC A;  3TED A;  1R9T J;  4RAZ A;  2HOS A;  5JLW A;  3OYI A;  3U1K A;  3HDD A;  1FYK A;  2R7S A;  1I39 A;  1D1B A;  2NS7 A;  1RKW A;  2O7O A;  2LK2 A;  2R5Y A;  5LEK A;  2XKO A;  5FGM A;  1XGS A;  2CFO A;  6PAX A;  1Z21 A;  3WTX C;  1FC3 A;  1OIS A;  2E19 A;  5GAH J;  5B1B H;  3GVA A;  2XB5 A;  3F21 A;  1QA6 A;  1E2X A;  3KZI C;  3U9G A;  3AL0 C;  2PJP A;  1P2F A;  4W1U A;  5E1W A;  3GFJ A;  4FE7 A;  2ISZ A;  3QOE A;  1E0E A;  2KIQ A;  3ZXS A;  1DDN A;  2H6C A;  2ZME C;  4F92 B;  3OOU A;  3BG6 A;  1QNT A;  2K86 A;  3AFH A;  5HS9 A;  1D1A A;  2BY3 A;  2PX9 A;  1YHQ I;  2LH9 A;  4WK8 F;  2F4O B;  2KP6 A;  1R22 A;  2WB1 N;  3S3N A;  3WGG A;  3WU1 B;  5ILV A;  1RNL A;  5F0H A;  5EYR A;  4U7B A;  1W5C C;  4ETS A;  3BCA A;  2GLO A;  5E1X A;  4L0Z B;  2O61 A;  2DA1 A;  1S9H A;  5ICF A;  1A35 A;  1SFE A;  4EQQ A;  2X1E A;  1BJA A;  4XRS A;  3SEQ A;  1HDP A;  3DTE A;  4BL0 B;  2HXI A;  4GYG A;  1R5I D;  4QWQ A;  4KIT B;  2VL8 A;  4CA0 A;  4PUS A;  1OCP A;  2W1O A;  3TDZ C;  2M3A A;  2V79 A;  3AL0 B;  2GA2 A;  5TJJ A;  4WF2 A;  1X1P A;  1FLI A;  2LTP A;  4M72 A;  4ZZD A;  4I76 A;  2LY2 A;  3K4K A;  3A0H C;  2M34 A;  1YW9 A;  3CMY A;  4A3E J;  4IL6 C;  4IQ4 A;  3KYL A;  1QZY A;  3GXO A;  2VBX A;  2OD5 A;  3CMA I;  2ZME B;  2XRN A;  4E4H A;  3WE3 A;  5M5X J;  1IG7 A;  2VQG A;  4MEX F;  2D2W A;  3BQY A;  4HOB A;  2QWW A;  3RYP A;  1HA8 A;  2WBM A;  2BHZ A;  3BR2 A;  2DOA A;  5IPA A;  5CJ9 A;  4XLN F;  2X4H A;  2TDX A;  4HLX A;  4BU2 A;  3CJR B;  2COB A;  3SEZ A;  1ZN2 A;  2E5Z A;  3I54 A;  1BR4 A;  2G9W A;  1XC5 A;  2KPM A;  1ETW A;  2MH9 A;  3GZ6 A;  1VQ6 I;  2D1H A;  1WJF A;  2CUF A;  4XKC A;  2V26 A;  2JA5 J;  1WJC A;  1LEB A;  3HOW J;  3A52 A;  2VT2 A;  3F3X A;  1WH7 A;  3JRH A;  1Q1V A;  3IKV A;  4G12 A;  2M1B A;  1I6X A;  3HRU A;  2X9D A;  3PQJ A;  3LFK A;  2XSJ C;  1EV7 A;  4UUT A;  3Q5F A;  2OTL I;  1FOY A;  5EZG A;  3JR9 A;  4PJN A;  4HYE A;  3DEU A;  4J01 A;  2ELJ A;  5GAG J;  2EIJ H;  4LJZ F;  2VKD A;  2W7N A;  4C2T A;  4HNV A;  1OYI A;  1I1G A;  2HQ5 A;  3KP6 A;  5DD8 A;  3TOA A;  1G8X A;  1F43 A;  3ESW B;  3V8K A;  3C18 A;  2MD5 A;  1J0R A;  5LGU A;  1K7A A;  2CSO A;  4XLA A;  5DTD A;  4GDF A;  3VPR A;  1VQM I;  3K70 D;  2FX0 A;  2VKH A;  2P4W A;  1DUX C;  1Y8Q B;  3DKY A;  1JE8 A;  2M87 A;  2AXT C;  2RQP A;  2PN6 A;  3J7A W;  4DGW B;  4BYY A;  2QF7 A;  4Y52 J;  1WH5 A;  5H20 A;  2D45 A;  2QUF A;  2DMU A;  3MMY B;  3BZK A;  4YEL A;  1WGX A;  2JN6 A;  1UEL B;  4HV5 A;  2G7U A;  4ZDP A;  4GFB A;  2QSF X;  1BOA A;  1A31 A;  2QGU A;  4CZZ A;  3H9G A;  3ZQL A;  5F6F A;  4C3J J;  5E3O A;  2Q2E A;  2MA3 A;  3AG4 H;  2DFF A;  4E6K G;  1YLF A;  4MTE A;  1KU9 A;  3LMM A;  4LG0 B;  3DTI A;  1LVK A;  4GO1 A;  5KK1 A;  2HDD A;  1UCR A;  2TRT A;  2HFH A;  4A2U A;  3V7R A;  1OR7 A;  1P4W A;  4UHT A;  1NG7 A;  5CVV A;  1ETK A;  1MNE A;  4B1R A;  3T1B A;  2ZO4 A;  1YIO A;  2XVC A;  3KEY A;  3S14 J;  1E17 A;  4HST A;  1KQ8 A;  3GBG A;  3HKZ A;  4FCY A;  5DD4 A;  1LDK B;  2MLG A;  2V1N A;  1PUF B;  3FXR A;  2VBY A;  5IYC J;  1U2W A;  1S6L A;  1Y0N A;  2X1D A;  2UUZ A;  1STZ A;  4PZJ A;  3GLL A;  3C2G A;  4ZC3 A;  4KT5 C;  1IUF A;  2QQB A;  3WTU C;  4IHT A;  4D5C A;  3CCL I;  3FXM A;  3OL3 A;  4ESF A;  1LDJ A;  5LLQ A;  3C7J A;  5J40 A;  3F0C A;  3OYB A;  2HQR A;  1TWF J;  4LK1 F;  1T33 A;  1G3W A;  5FKM A;  2CRG A;  2QKM B;  3WG9 A;  1O3Q A;  2NVX J;  2KHM A;  4ZYA A;  4BNC A;  2CH0 A;  2DT7 B;  2GQQ A;  3PIP F;  3LSR A;  1LQ1 A;  4LG3 A;  3LAP A;  3HUG A;  1RZ4 A;  3RKY A;  1O4X A;  2L7Z A;  2K27 A;  3MFK A;  1QVT A;  2A6H F;  4D9J A;  4S05 A;  1K6O A;  3BRO A;  2QQA A;  5J4V A;  1HC8 A;  2VPR A;  2LP0 A;  3BJ6 A;  5HVQ C;  4LLG F;  2QSH X;  2RNG A;  2W85 A;  4G7O F;  4Y3O A;  2HR3 A;  3EUH A;  4BGD A;  1JGS A;  4XQF A;  3CC4 I;  4XKV A;  1ZG5 A;  4UXN A;  2QCO A;  2K7L A;  2XAF A;  5LD2 C;  2IS2 A;  3ZP5 A;  1WJE A;  3JW4 A;  1BI3 A;  1DPU A;  3IV5 A;  3JCU C;  2JSP A;  3NEU A;  3QRF F;  2K9N A;  3M1E A;  2KDO A;  4A12 A;  4XOT A;  3KZZ A;  4G6D A;  3HRM A;  2JQ7 A;  4ENK A;  4NHJ A;  1ZEL A;  1OCO H;  1AKH A;  3NRV A;  2R4G A;  3NWS A;  2BY1 A;  3QPT A;  2DA4 A;  1CGP A;  3KEQ A;  1ETO A;  2OV7 A;  4HEA 2;  1ACI A;  2QQ8 A;  2CV0 A;  1F5T A;  3KP7 A;  1D5V A;  3R60 A;  1Z3Y A;  3FZV A;  4EJW A;  2ETH A;  1A36 A;  2LLK A;  1ORK A;  1VQ7 I;  4ZZL A;  3OYH A;  4HF2 A;  3F8B A;  2OA4 A;  1D5Y A;  3FKJ A;  1AU7 A;  3PSI A;  5E8G A;  2VC1 A;  2IW5 A;  1HLV A;  2OPT A;  3QP5 A;  1ULY A;  3B6C A;  4JX4 A;  2Z9O A;  2LF7 A;  1O3S A;  2Y69 H;  2YUS A;  4CCL A;  4ZDO A;  1DU6 A;  3PUF A;  4RGR A;  4CIC A;  3BLY A;  2P0W A;  4IHY A;  3BT9 A;  1WWX A;  3OYJ A;  4F93 B;  2WWY A;  4CXF A;  4BEH B;  2A5Y B;  1AHD P;  1JGG A;  2FU4 A;  4M73 A;  4KA4 A;  3ZMZ A;  1REP C;  3N05 A;  1X1B A;  4BHB A;  1IRZ A;  1UHM A;  5IT9 K;  4UUS B;  4XK4 A;  2KT0 A;  1QQI A;  1FBQ A;  1FSE A;  1V54 H;  2VJI A;  5LRS A;  3M3Y J;  3P5J A;  3M9A A;  4PK4 A;  5D8L B;  4DYQ A;  1UHW A;  1XX5 A;  3IP4 B;  3DBL B;  4XNF A;  1PP7 U;  2GXG A;  2HKX A;  3V7S A;  3I4M J;  3JAM R;  4HV6 A;  3ZN0 A;  1YS7 A;  2VAS A;  4GCV A;  3J80 Z;  3HM5 A;  3ABU A;  1YE9 A;  1A5J A;  3O8H A;  4NC8 A;  3CCM I;  1OCT C;  4BQN A;  3ZOB A;  2H27 A;  2BY2 A;  4OWR B;  1JTY A;  3OOP A;  3FF5 A;  3K2Z A;  2EFO A;  4CCJ A;  1XMX A;  2RV8 A;  5EGO A;  2BEO A;  5FKK A;  2ZCW A;  2EIN H;  3RPQ A;  2A61 A;  2KJB A;  2ZXW H;  3K4J A;  2HOE A;  2R5Z A;  1MKM A;  4M3D A;  3VDX A;  4HA8 A;  3DCF A;  1T8I A;  2X98 A;  2X6W A;  3PSF A;  1YQA A;  1JJ8 C;  3WGI A;  3Q0U A;  3S1Q J;  4U7D A;  3ZCO A;  5BQT A;  4AYB A;  2YU9 J;  1I5Z A;  2IEK A;  3RYR A;  3L2U A;  3M4O J;  1TNT A;  2MG4 A;  1G2H A;  3WE2 A;  3G4S I;  2A6E F;  3PNT A;  4A3I J;  2EFP A;  2W48 A;  4XN0 A;  1HW5 A;  5DCM B;  1Z7L A;  4RAF A;  4CYC A;  3A01 A;  3HJE A;  5GPA A;  3K4N A;  3K7A J;  1XDU A;  5K7H A;  5H2F C;  4CO8 A;  4KIS A;  5L3C A;  1IC8 A;  5J6X A;  1JKR C;  5HLI A;  1J09 A;  4G7H F;  3GTK J;  1XN7 A;  3ZQI A;  2VOD A;  3DP7 A;  4MHG A;  2AHQ A;  3CF5 F;  5FFX A;  3RJP A;  4FAS D;  4ENJ A;  4HZF A;  1J2X A;  1TQI A;  4LB5 A;  3NQO A;  3ZMV A;  5HS7 A;  1B59 A;  3WTV C;  4QPO A;  5HLH A;  3CQZ J;  2NNN A;  5CQG A;  1MBK A;  2YSR A;  2MZ4 A;  1FY7 A;  2PEX A;  2ME0 A;  3IL2 A;  2E2I J;  1WJB A;  2W25 A;  2NYX A;  5IY5 H;  5KCM A;  1BIA A;  1P4X A;  3T0Y A;  3BQZ A;  5DUK A;  1QPM A;  1XMK A;  4XOP A;  4AID A;  3HC7 A;  1DP7 P;  5K7Z A;  3I53 A;  2ZXJ A;  3RZD J;  2ZB9 A;  3C3W A;  5GTH C;  1QZE A;  2BXY A;  4PJJ A;  3CCJ I;  3ROU A;  3ZGK A;  2XAU A;  2FXA A;  4NBQ A;  4V2G A;  5C4X J;  2JPB A;  2K02 A;  5JR3 A;  1WFX A;  2LY1 A;  3K10 A;  3MZH A;  1FIA A;  3HOY J;  4II2 A;  3DFG A;  1O7F A;  4FE4 A;  4BE1 A;  1IRX A;  1I50 J;  4QTR A;  2VBW A;  2XGX A;  5HNF A;  1U5T C;  1SFK A;  2QYO A;  2HVR A;  4M6V A;  1WJD A;  1WRJ A;  1X2M A;  1ETQ A;  2KLO A;  4MO7 A;  4RAG A;  3G1O A;  2CW7 A;  2PMZ A;  4AIJ A;  1IN4 A;  4RMN A;  1MBG A;  1S5L C;  3P9C A;  3ZN1 A;  4P96 A;  5EEA A;  3H3V K;  2I10 A;  3VYS B;  3KZY A;  1UB9 A;  4OIQ F;  4I99 C;  1X2N A;  1VQ4 I;  3MKY B;  5J1Y A;  3HL2 A;  4KYW A;  4H0E A;  1ZAO A;  4Z6Y A;  3GFI A;  1NK3 P;  2FMY A;  3BPX A;  5F1R A;  2HTJ A;  3WTZ A;  3J80 R;  3F6V A;  3CUQ C;  1FYM A;  3J7Y J;  1OJL A;  2JVG A;  4RBO A;  3KEO A;  3HOV J;  4C3H J;  4KIF A;  2IP2 A;  3BPV A;  2QA4 I;  4ESJ A;  3RQI A;  1S7O A;  1VQ8 I;  5FKN A;  4OAY A;  2R7F A;  2PQ8 A;  4U0W A;  2LDU A;  1RUO A;  1R36 A;  4CUG A;  4C3I J;  3DQV C;  5F1J A;  2P5K A;  3L2C A;  5IP7 J;  4NB5 A;  2LD5 A;  2RC4 A;  3K70 C;  1ZRD A;  2OTJ I;  4FX4 A;  1Z67 A;  4Y4R A;  3M8J A;  1LEA A;  1UHS A;  3DLA A;  3BR0 A;  3FM5 A;  2GOM A;  3OWT A;  4A5M A;  1FYL A;  4OIR F;  4A0Y A;  1LFU P;  2CS3 A;  1ON2 A;  1JT6 A;  1U5T B;  4N4N B;  3J81 R;  2XF5 A;  5F27 A;  4F7Z A;  3G3Z A;  2Y2Z A;  1J9I A;  4F3Q A;  1H9G A;  1L3L A;  2AO9 A;  4XL9 A;  4MQ9 F;  4G94 A;  1Y39 A;  3ZRG A;  2VJ5 A;  1IF1 A;  4EV0 A;  1SC7 A;  5JI6 A;  1MGT A;  2WA0 A;  2X48 A;  3E3V A;  4H4K C;  4Q5S F;  3CME I;  2IGK A;  2OC6 A;  3WTW C;  1WJA A;  1HOM A;  1OCZ H;  2EIL H;  1ONV A;  1MDM B;  1IUY A;  1JUS A;  5CLS A;  2R93 J;  3JRD A;  1H0M A;  4L9J A;  4PJM A;  2L7M P;  2A6T A;  3FXK A;  3JRC A;  5C4J J;  4XN3 A;  3OYG A;  4C2U A;  2MAB A;  3EUA A;  3MKZ A;  3U2R A;  5E1Z B;  2RN7 A;  5LGN A;  5E3L A;  5ILU A;  3BR1 A;  1MMS A;  1O7L A;  2LR8 A;  2FF4 A;  2ME6 A;  2Y0S N;  1X3U A;  2YU3 A;  3F22 A;  2W84 A;  1A6I A;  2E60 A;  2R3S A;  2MC4 A;  5ILS A;  2Y75 A;  2HDW A;  1DGR M;  4M71 A;  4AC0 A;  3W2V A;  1NH3 A;  5HLG A;  3S2H J;  1FOX A;  3HTU A;  2H8W A;  5FRO A;  3LWF A;  1QVU A;  1ZLK A;  5E20 A;  2DMP A;  2V4J C;  4I01 A;  4IVN A;  1X58 A;  3F8M A;  4F55 A;  1SFO J;  4V2F A;  2VPL A;  1FMV A;  3PNY A;  4JX5 A;  1MMD A;  2DOF A;  4LFU A;  3H3U A;  2CMP A;  5GP9 A;  3VEP A;  2AXL A;  3CTA A;  5FLM J;  3OYC A;  2KJC A;  1B72 A;  3ZQG A;  5K7F A;  3RKX A;  4UB8 C;  3W6V A;  1MBH A;  1JKP C;  4CCN A;  3JSO A;  1GVD A;  3L9F A;  3JSP A;  4FX0 A;  3K4C A;  4K2E A;  3TO9 A;  4MFE A;  2JA8 J;  1KYZ A;  2EB7 A;  2KRH A;  3AKZ A;  2J5O A;  2AQF A;  3Q3S A;  4F52 A;  2DBB A;  2ZBK A;  4A6E A;  3QAH A;  2NOJ B;  5FKL A;  4Q48 A;  3ML6 A;  2LNB A;  3KE2 A;  4CGZ A;  1HST A;  4NQW B;  4BBS J;  1HW2 A;  5D5U B;  2IGM A;  2IVM A;  5D6E A;  1V5E A;  2ZJR F;  4E7J A;  3OS0 A;  1HW1 A;  3QYF A;  4XLH A;  3ZPL A;  5TIS C;  1HQC A;  4DZJ A;  3I58 A;  4BH9 A;  3V7C A;  2F5E A;  5FD5 A;  1WHU A;  2Z3Y A;  2EZL A;  2JA6 J;  1BR1 A;  3DPL C;  3U21 A;  4Z2Y A;  3K0L A;  3KPH A;  3D5S C;  1TTY A;  1LFB A;  2WV0 A;  5K5O A;  3S8P A;  4L9T A;  5JVT A;  3CC7 I;  3LAJ A;  1QU3 A;  2IGN A;  3BC8 A;  4EJU A;  3K2A A;  2HU9 A;  3P7N A;  2G7H A;  3NAR A;  1RUN A;  2VT3 A;  4RGX A;  3ABL H;  3A03 A;  3F8C A;  2JUC A;  3GWZ A;  4OOI A;  2JPC A;  1MJ9 A;  2JK3 A;  4YEJ A;  1OMI A;  3Q9V A;  4XSZ F;  3L7W A;  2R7V A;  2CQX A;  4LLL A;  1I3A A;  3IRQ A;  2EA2 A;  2FEZ A;  5FLX K;  4C30 A;  3G71 I;  4EMS A;  1ZTR A;  4BKX A;  4R79 A;  2O8X A;  3OSF A;  1I3Q J;  1SMY F;  2L3D A;  2MYS A;  2WV1 A;  4A6D A;  5IOZ A;  2ZJP F;  2OBP A;  2B7E A;  3BDD A;  1YS6 A;  1YRN B;  3CCR I;  1UG2 A;  2DA5 A;  3DV8 A;  4Q4Z F;  2JTV A;  2CU7 A;  2E1N A;  2M0M A;  4HX8 A;  3HOX J;  3DU6 A;  4MLO A;  4P9U A;  5DS9 A;  1BI1 A;  1R23 A;  3RTR A;  1XTA A;  5D4R A;  2NVU B;  4PJ0 C;  1BW6 A;  3S17 J;  3E1S A;  2HWV A;  5A2Q K;  4WXH A;  4OIP F;  4BHC A;  2EBI A;  1IXS B;  2M2E A;  1HSJ A;  4XID A;  4BXX J;  2Y9Y A;  4BY7 J;  1OCC H;  3I9V 2;  1OR7 C;  3W2W A;  1RES A;  1HKT A;  4J00 A;  1U0J A;  5GAD J;  1DQU A;  2DW4 A;  1VQ5 I;  5KAF C;  1EF4 A;  3ZMT A;  3KCC A;  3FWE A;  1X3W B;  1LE8 A;  5EEH A;  2UXX A;  1MJA A;  1UZC A;  4I98 B;  3B6A A;  4E70 A;  4IRH A;  3J7A Y;  4A3G J;  5J8C A;  1G3S A;  3ECO A;  2F5D A;  4G6Q A;  1FNN A;  4JYK A;  3FK6 A;  1GHC A;  2H1L A;  5J47 A;  1F36 A;  5EJC A;  2F5V A;  1O3R A;  2B63 J;  3TKY A;  3GTO J;  2Y30 A;  2STT A;  4A3L J;  5FRN A;  4HW0 A;  4HX7 A;  4LIV A;  5JVG F;  2P6T A;  2CJJ A;  3SQN A;  3WTY C;  1K4T A;  2K9Q A;  2QM3 A;  4P1W A;  4DZP A;  4LOC A;  2HDC A;  1R4N B;  4B43 A;  4I0B A;  1VI0 A;  3FDY A;  4LMY A;  3HOT A;  4LD5 A;  4EEF G;  1D3Y A;  1Y56 A;  5D5W B;  3C2H A;  3JAM K;  2DK8 A;  3GYH X;  3UKG A;  1T98 A;  4ESB A;  3HTS B;  2JRM A;  3RSN A;  2E7X A;  3WHB A;  1MJB A;  1R1T A;  1X4P A;  3ULQ B;  3L2R A;  1MMA A;  1HXD A;  3ISP A;  3LA7 A;  2W24 A;  5LBQ A;  3I4N J;  2FQ4 A;  2LKP A;  5BMZ A;  3TMO A;  2D5V A;  2BGC A;  5D5V B;  1JI8 A;  4HNT A;  2RQQ A;  4BY1 J;  4XKB A;  5HDK A;  1T95 A;  4KN4 X;  2UV1 A;  3A0B C;  4XM3 A;  2IXS A;  1RQ6 A;  3DPU A;  3WU2 C;  2DU9 A;  4A3B J;  1MMG A;  4QLC U;  1YIT I;  1T2K A;  1FMW A;  1PYV A;  2Z5U A;  3HHG A;  4KMF A;  2DN0 A;  2ECB A;  2KDZ A;  1E3H A;  5FD6 A;  1ZK8 A;  3FBI B;  2IS6 A;  1PP8 F;  1QZZ A;  2QQ9 A;  2R7Z J;  3BJO A;  4DQ2 A;  1BR2 A;  4EJV A;  1IZ1 A;  1WKM A;  4D7N A;  3CLQ A;  4R1H A;  4GXO A;  2CG4 A;  3SZG A;  2A68 F;  4GYI A;  2CUZ A;  3G1L A;  2CV2 A;  2E35 A;  3QQA A;  1K78 A;  2EIK H;  2RRE A;  5EG0 B;  1YI2 I;  4BE0 A;  4A3M J;  1Q1H A;  3OYA A;  1BJZ A;  3OY9 A;  3I3L A;  3H36 A;  1DP3 A;  4P5O A;  3FMR A;  2L9V A;  2QEX I;  2XHK A;  3VYU B;  2NAZ A;  4RS8 A;  5JLX A;  3ZQC A;  1R00 A;  2KZG A;  2ZXH A;  3IKT A;  5BPI A;  3RI4 A;  3COA C;  2DA7 A;  2GIV A;  3CES A;  3M8E A;  1IXR C;  3OS2 A;  2CQ7 A;  1ZYR F;  2J5P A;  2K9L A;  3DPT A;  2R7X A;  2GA1 A;  2GBY A;  2EA4 A;  2RVC A;  3OMY A;  1KZH A;  1NK2 P;  5ERI A;  1MBF A;  1ZGW A;  1GVJ A;  3IAM 2;  3MAJ A;  1B9N A;  1WCM J;  4IHX A;  2F5C A;  2IPQ X;  1Y0U A;  2Z2S B;  1BN5 A;  2WY8 Q;  1ZRC A;  1BOB A;  4C9Y A;  1XGO A;  3LOC A;  2HZD A;  2ECC A;  3LSK A;  2FA5 A;  2PG4 A;  1WZ2 A;  5DDG A;  4FET A;  1VQL I;  1XG1 A;  2MUN A;  4G8X A;  1AKH B;  2DMQ A;  4E7I A;  3WGH A;  2EFW A;  2VQH A;  1T6S A;  1XB4 A;  3SDG A;  4BQO A;  3CCQ I;  4A3J J;  2LF8 A;  1FOK A;  2KRF A;  1GXQ A;  1DGW Y;  1W0U A;  2XSD C;  2EPF A;  4JK1 X;  2DXI A;  1IRF A;  1UST A;  2UXN A;  3BG7 A;  1IJW C;  3K4L A;  1IRG A;  2IBD A;  4IHS A;  2MFZ A;  4BHP A;  2HGC A;  4YG2 F;  1XPX A;  3KP5 A;  4E7S A;  3PL8 A;  4RB3 C;  4U88 A;  3MN2 A;  1TT5 B;  1R5H A;  3K4M A;  1QO0 D;  1NHA A;  4YII A;  2F4I A;  2VBZ A;  3I71 A;  2L02 A;  3A2K A;  1GLN A;  1KON A;  4ITV A;  2KL4 A;  5KNL A;  1JKQ C;  1SD4 A;  2O0Y A;  1YW8 A;  4BJT A;  4BUP A;  1FEX A;  3D5L A;  1MD0 A;  2EV0 A;  2EZH A;  1MSE C;  5HLT A;  2VE9 A;  3PJR A;  1QHG A;  1RIO H;  2LVS A;  3KIO A;  4M9Z A;  3V4G A;  3CDI A;  2ZJ2 A;  2K40 A;  2KQR A;  2DA6 A;  3FIW A;  4A3K J;  1FIP A;  2R7Q A;  2HS5 A;  4AIH A;  3OYK A;  5FRM A;  1VQN I;  1PVE A;  1BL0 A;  3CUO A;  2L54 A;  4XKW A;  4U0V A;  3J81 K;  4HF0 A;  1IO2 A;  5JFR A;  3AG3 H;  4Y33 A;  1YX3 A;  3BR5 A;  2W4S A;  5IYD J;  2QZ8 A;  3PO2 J;  1KU7 A;  1C0W A;  1OKR A;  4CH7 A;  1ZG1 A;  1FPQ A;  3FBN B;  2XAQ A;  2D1V A;  2R0Q C;  4A3F J;  3R61 A;  4ZYE A;  4RLQ A;  3PIO F;  2CFX A;  1SFU A;  2YS9 A;  1ETV A;  4PFP A;  1T39 A;  1MNM C;  2FRH A;  5LEJ A;  2LSO A;  3H9J A;  1GV2 A;  5EGO B;  1R6R A;  2ZSI B;  3SXY A;  1OPC A;  2X6Y A;  3ASO H;  3IH4 A;  3N97 A;  2IT0 A;  3E6M A;  5F0C A;  2FSW A;  2EV5 A;  4I7H A;  2HQA A;  4UNO A;  2UWM A;  2R7T A;  2DDA A;  1EH8 A;  4XRS G;  3TW7 A;  1IV8 A;  1Z91 A;  2QLZ A;  2ZJQ F;  4IPA A;  3WTT C;  2WY7 Q;  3TDU C;  4E7K A;  1SD5 A;  4IEJ A;  3PO3 J;  4X1E A;  3AG2 H;  2E2H J;  1W7P B;  4M6Y A;  4A69 C;  1X1D A;  5C3E J;  1T08 B;  2VQC A;  3S15 J;  4WXD A;  5IP9 J;  1WJ5 A;  1JTX A;  1OQY A;  2X1C A;  1B6A A;  5ICC A;  1YYV A;  4CYC B;  1K4S A;  3I59 A;  1P92 A;  1Z05 A;  3A01 B;  3CF2 A;  3M1C A;  3OIO A;  2CQN A;  4HDU A;  1ZRE A;  4WWC A;  3EYY A;  1VND A;  4PJL A;  2F48 A;  5E17 F;  1W36 D;  4HF1 A;  4LB6 B;  2GAU A;  1Z77 A;  2EFN A;  3GF2 A;  2HKO A;  1OYW A;  5BPD A;  1IXC A;  1XSX A;  3QP6 A;  2NVT J;  3ABT A;  2R7D A;  2F4M B;  5CQE A;  1YIJ I;  3S93 A;  3Q9S A;  1SAX A;  3H35 A;  3HSE A;  3FK7 A;  2KIU A;  3CC2 I;  3EDP A;  4G9Y A;  3ABM H;  4LIU A;  3JTG A;  1F4K A;  2L7F P;  4KIB A;  4UVB A;  2HYG D;  2DCE A;  1IDZ A;  4XLE A;  2KIM A;  4NUB A;  3IHU A;  4UY8 I;  4KUM A;  3HGG A;  2DPD A;  4EM2 A;  3DWL E;  4GRI A;  3S2D J;  2IAI A;  3F8F A;  2BW3 B;  2GM4 A;  1D1C A;  2Z33 A;  2WTE A;  2K4B A;  2VOO A;  2V1X A;  2VJJ A;  5JHF A;  1Z3X A;  2MSY A;  2P81 A;  2XUB A;  1TNS A;  3H5N A;  4MNU A;  1SVM A;  5HDN A;  5F0F A;  4J19 A;  2X0L A;  3K9T A;  2CUE A;  3W6K B;  4I2O A;  3M8F A;  1G4D A;  1TC3 C;  2M0C A;  2E1C A;  4IRI A;  1QBJ A;  2QSG X;  1H8A C;  4RGS A;  5GTI C;  2Z1D A;  4M3E A;  3OSG A;  4YFX F;  3M07 A;  1X3Z B;  4AVZ A;  1ZR4 A;  4JOM A;  4IHW A;  2E36 A;  2ESH A;  4WX9 A;  1JHF A;  2R7U A;  1TQP A;  2NNY A;  3MWM A;  3GTG J;  5LRR A;  1KQ9 A;  1POG A;  4EVI A;  4XLP F;  2EWN A;  3GW2 A;  2FNA A;  2E7W A;  1Y8R B;  4E7H A;  1BBY A;  4XRF A;  1J5Y A;  5CKT A;  2GIZ A;  1IDY A;  3KP4 A;  2VXD A;  2LRD A;  4HPQ A;  2V6C A;  1HBX G;  2XGC A;  4PSW A;  3BTI A;  3O2P E;  1XGM A;  5D5X B;  4L5E A;  3EPZ A;  1RR8 C;  4HG2 A;  1PUE E;  1QHH D;  1R1V A;  2BV6 A;  4ZYD A;  1QPI A;  5IT9 Z;  5J4Y A;  4CCK A;  5FLV A;  2Q8K A;  4B09 A;  2YPR A;  2K9S A;  3IWF A;  2IS4 A;  1ODD A;  1BIB A;  3E5Q A;  3D5R C;  3WHC A;  3CO6 C;  1B8I A;  5LHI A;  5BS6 A;  4X6A J;  2XAJ A;  5CVR A;  3KLO A;  2NVY J;  3AG1 H;  4HRI A;  5C44 J;  1X1C A;  2XF6 A;  1S8N A;  1GXP A;  1OLT A;  2DQL A;  2M7A A;  1K83 J;  1G3Y A;  1JHH A;  1B1B A;  5D4S A;  1RET A;  2W82 A;  4S04 A;  2CYY A;  3O3K A;  5DEQ A;  4JBA A;  5HOO A;  1K6Y A;  4RB2 C;  2FML A;  1WQ2 A;  4CDG A;  1CF7 B;  3FMQ A;  4KIG A;  2CO5 A;  2VLA A;  2ZSH B;  2B9S A;  2PMZ N;  4IO9 F;  3CCU I;  3DTK A;  4XSX F;  2QVO A;  3MVP A;  4ZTJ A;  2DQR A;  3TL4 X;  4DJA A;  1TBX A;  1K79 A;  1S29 A;  2XDV A;  2ZNZ A;  2FBH A;  3L00 A;  4Y15 A;  1YOV B;  3DKX A;  3GFL A;  3DBH B;  3HHH A;  3BZ6 A;  3CMM A;  5L3B A;  3FXL A;  4L5I A;  3ZQH A;  2HEO A;  1TWA J;  2PJR B;  3OIP A;  2HQN A;  2E1O A;  2Z16 A;  2MLK A;  1ZG3 A;  3CCS I;  2OCC H;  1J7K A;  2BHY A;  3OIQ A;  1YX5 A;  2MC3 A;  2O03 A;  4BJ6 C;  5K1Y A;  1O3T A;  2DT5 A;  5EZH A;  3BY6 A;  3FX3 A;  4ZH4 F;  1S72 I;  3E5X A;  1HKS A;  1ZR2 A;  3QPL A;  2JVH A;  5LHH A;  2WAQ A;  3QU6 A;  3S2W A;  3GUD A;  3CZ6 A;  2FNP A;  4UV9 A;  2DMT A;  4G7Z F;  1OYY A;  3NAU A;  1E3P A;  3E0J B;  3CUQ B;  5LGT A;  2R7R A;  1S7E A;  5F08 A;  3TP3 A;  3LSJ A;  2O9L A;  2VE8 A;  3WOD F;  1Z9C A;  4PSX A;  1UG0 A;  3KFW X;  3ZQ7 A;  1WI3 A;  2LBF B;  2O6G E;  2MVT A;  1YW7 A;  1RKT A;  2XGE A;  2Y9Z A;  1QRY A;  2V1U A;  1ZGJ A;  2Y0S A;  4ZYG A;  3ZQQ A;  3N4M A;  5KVR A;  1LDD A;  4FQG A;  3OL4 A;  4GGG A;  5HOD A;  2CW0 F;  1U8B A;  1HF0 A;  3H92 A;  1G59 A;  1WVR A;  1ZRF A;  2HPM A;  5FO5 A;  3TBI A;  4DW6 A;  3KX2 A;  2R5Y B;  1KQ0 A;  2K3F A;  2L4M A;  2Y0M A;  4KMU X;  5D6F A;  4IHV A;  2E34 A;  4BE2 A;  4JX6 A;  3A1Y A;  3GEZ A;  4KDP A;  2EIM H;  3KET A;  2FD5 A;  3LSM A;  3CCE I;  4D5F A;  1T0F A;  4ENM A;  5TRD A;  3J7A O;  3HOS A;  2COM A;  2DTR A;  2M7B A;  2Y31 A;  4OIO F;  4EGY A;  2VUM J;  3V8L A;  2ELH A;  2IA0 A;  2X85 A;  2EJR A;  1RI7 A;  2XPW A;  3VB2 A;  2PMH A;  3GTM J;  1XSD A;  1X4O A;  1HKQ A;  3GFM A;  2B0L A;  1BI2 A;  2GOX B;  3O8G A;  4A3D J;  3G6E I;  3BR6 A;  5L3F A;  1D0Y A;  3MKW B;  1U9N A;  2XRL A;  2E5N A;  2L9S A;  1FX7 A;  2V9V A;  4OMY A;  2OU2 A;  3B73 A;  3H5R A;  1B9M A;  2M45 A;  1IN6 A;  5ICG A;  2XRO A;  1ERD A;  2QBY A;  1JXS A;  2Q0O A;  3CDL A;  4ZYH A;  3R0A A;  4N0B A;  4EM1 A;  3H9Q A;  5IT3 A;  3DLL F;  3GZN B;  1USS A;  3FHN A;  3BTC A;  1LJ9 A;  1SD6 A;  3QPH A;  5DV5 A;  4CCO A;  1SEU A;  1I1S A;  3KLN A;  1PDN C;  5IP6 A;  5L3D A;  4AVP A;  2NOG A;  4LK0 F;  2A69 F;  2ZFW A;  2EV6 A;  4RGU A;  4OAZ A;  3W3C A;  3TO7 A;  2JA2 A;  3FXQ A;  4CZC A;  5IYB J;  3M7G A;  4Y13 A;  3SHF A;  2WAF A;  1XMA A;  1N75 A;  5K5R A;  1LE8 B;  2HOT A;  1MH3 A;  3T8T A;  3DBR B;  2WB1 A;  2QKL B;  4D1Q A;  4BQA A;  1W0T A;  3IAS 2;  3OR2 C;  2X51 A;  2A3S A;  4I6Z A;  3V42 A;  5EEG A;  1LFP A;  3VFZ A;  3CCY A;  3KYC B;  3CCV I;  4KJZ A;  1D8J A;  3H5A A;  4XON A;  2XAS A;  3ZMU A;  4OU0 A;  2DOE A;  2VIX A;  5M5Y J;  1TW2 A;  2EH3 A;  4CCM A;  4FHT A;  3S16 J;  3L2Q A;  4N4O B;  5ED4 A;  2ZC2 A;  2OAZ A;  2KRC A;  3H0D A;  3C2B A;  3R6S A;  2WAE A;  3IRR A;  3LNQ A;  4CSW A;  4ON0 A;  3WTS C;  2ZKZ A;  3L2W A;  1MW7 A;  3LFU A;  4Y17 A;  1JUP A;  1D0Z A;  3BP8 A;  4M3B A;  4NQW A;  2FBI A;  4HDV A;  4AIK A;  3C1D A;  4ASN A;  1Y1V J;  4O3M A;  4R8H A;  4RA2 A;  4L9V A;  3ZQF A;  1D8K A;  2XAG A;  1I6H J;  1A04 A;  5LFA A;  2DT6 A;  2A07 F;  4BS9 A;  2W00 A;  4NC7 A;  3G1M A;  1JJ6 C;  4QPQ A;  2NXN B;  2LRE A;  4EGZ A;  4E7L A;  2KMU A;  2FQ3 A;  1W36 C;  1X1A A;  3GZ5 A;  3VOD A;  4HQM A;  4UVC A; 
#chains in the Genus database with same CATH homology
 4KNY A;  1P6R A;  1XCB A;  4KFC A;  1B4A A;  5LHG A;  1FP2 A;  1J59 A;  2RNJ A;  5CYV A;  1K78 B;  2W57 A;  1YG2 A;  2IRF G;  3E5U A;  3I4P A;  1FSH A;  4M9X A;  2BBY A;  2GZW A;  2F5F A;  1W5S A;  3RPU A;  3MZY A;  5E8I A;  1VTN C;  5CVJ A;  1KA8 A;  2P8T A;  1U8R A;  2KIF A;  1XGN A;  1S3J A;  4MEY F;  4YIF A;  2MH2 A;  3CLO A;  3BWG A;  2O3F A;  4BXU A;  5FLX Z;  3KP3 A;  3I5U A;  2P5L C;  1YTY A;  2ZME A;  4UUV A;  3GLX A;  1F9N A;  1AWC A;  1Z1D A;  3GO5 A;  1Z6T A;  1LVA A;  2Y48 A;  5FFZ A;  5A2Q Z;  2P6S A;  3LA2 A;  4UV8 A;  5D8K B;  4MQV A;  1W4M A;  4IXA A;  3VOE A;  3JTH A;  3LA3 A;  1BI0 A;  1ON1 A;  4HBL A;  5AIP A;  3O6B B;  4A5N A;  4PCQ A;  4LLN A;  3TOB A;  3RIR A;  2YX4 A;  3FM3 A;  1G6N A;  4M6X A;  4YFK F;  4B8X A;  2VOP A;  1IAW A;  3P9I A;  5DYM A;  2BYV E;  1R7J A;  2ESN A;  1WSU A;  3JAM Z;  3I64 A;  3EQL F;  2BE5 F;  2NS0 A;  3L09 A;  3PQK A;  3J80 K;  4CYD A;  4LG0 A;  2FBK A;  3EET A;  2ADU A;  2PMU A;  3TQN A;  5L3E A;  1Z7U A;  3DKW A;  1H9T A;  4L18 B;  4YFN F;  3HRT A;  3E97 A;  5HDG A;  4L9N A;  2DI3 A;  2DLL A;  1J75 A;  3F6O A;  2CWE A;  4I02 A;  1IW7 F;  4RB0 A;  4HQE A;  4DNC A;  1YO5 C;  1IN8 A;  4HAM A;  5AIQ A;  3I59 B;  1KU3 A;  1F1Z A;  4Q47 A;  1BC8 C;  4M9S A;  1IN5 A;  1W5T A;  4U0Y A;  3E6D A;  2PFB A;  1QGP A;  1DPR A;  2H09 A;  3HSF A;  2CQK A;  2PBI A;  1ZH5 A;  4RAY A;  4LGW A;  4BAY A;  1UFM A;  5CVI A;  1AOY A;  2FOK A;  3DXJ F;  2YX7 A;  3CO7 C;  2OZ6 A;  3LQQ A;  2Z99 A;  2RDP A;  3ELK A;  4IRG A;  3D0S A;  1XSV A;  3K1M A;  4WCG A;  2XV4 S;  3RKW A;  3F8N A;  3IWZ A;  3E6C C;  1P4A A;  1KGS A;  4MTD A;  3K1N A;  4CHU A;  3BOQ A;  2PI0 A;  4TV7 A;  3W6J B;  3G73 A;  3QU3 A;  4P9F A;  1O57 A;  2VC0 A;  3LQR A;  3SZP A;  3T8R A;  1WI9 A;  5CVU A;  1KYW A;  3FMS A;  2DK5 A;  3I0T A;  4PGH A;  2XKP A;  1TLH B;  3LST A;  1G3T A;  3HSR A;  2M5W A;  2EK5 A;  3MEX A;  1XD7 A;  3QOP A;  5BOX A;  3AAF A;  5ICE A;  3E6B A;  1U3E M;  3IC7 A;  3MQ0 A;  1ZAR A;  1W7P A;  4WXC A;  4KN7 X;  1ZGA A;  2OQR A;  1ZLJ A;  3J81 Z;  4AWX B;  2KKO A;  1FZP B;  1S7A A;  3MCZ A;  2XAH A;  4EJT A;  4XBF A;  2L01 A;  1LNW A;  2QEN A;  2VN2 A;  4I0A A;  3DF8 A;  5H6R A;  5JHU A;  3OV8 A;  3RDI A;  3HRS A;  2M30 A;  5E18 F;  3WU0 A;  2DAO A;  4IJA A;  5DUI A;  1V4R A;  1LB2 A;  2WC2 A;  4O6J A;  3ZMS A;  3K1P A;  2RGV A;  1R58 A;  1TW3 A;  3EYI A;  1EH6 A;  3U1D A;  1R5G A;  3REO A;  2RKH A;  4M74 A;  1EH7 A;  2MBF A;  3P9K A;  3R0J A;  4UVA A;  4PGG A;  5DCM A;  3TO6 A;  2H94 A;  3PFI A;  1FP1 D;  3H3Z A;  4L5J A;  2IA1 A;  4N9H A;  1L0O C;  5FB2 A;  4A0Z A;  2GWR A;  2XIG A;  1XCV A;  2FE3 A;  4EJO A;  4O5V A;  2DFI A;  2AS5 F;  2HZT A;  4L0Y B;  2UZK A;  5AON A;  3F72 A;  2STW A;  1YFH A;  4PDK A;  2HTS A;  5H6Q A;  1FBS A;  2P7V B;  2K4J A;  3TGN A;  4N9I A;  4RB1 A;  1FBU A;  2HYF A;  1I27 A;  4EM0 B;  2CGP A;  5DCF A;  1SD7 A;  2M8E A;  3FXU A;  3HYI A;  2P5V A;  4FT8 A;  5L3G A;  2JRT A;  2JZY A;  2JT1 A;  4HLY A;  2JSC A;  2ISY A;  4D0P A;  3GX4 X;  1U6G A;  1SMT A;  2ACJ A;  2L4A A;  4OMZ A;  4AD9 A;  2DPU A;  1W7P D;  2H6B A;  3K69 A;  4A0X A;  1R1U A;  4MGR A;  2QBY B;  3CDH A;  4P55 A;  1T38 A;  5F64 A;  4OIN F;  1CF7 A;  5HS8 A;  2ZNY A;  2EFQ A;  3BJA A;  2YR2 A;  1BM9 A;  1Z6R A;  2OZU A;  1MZB A;  1TQM A;  1FT9 A;  1V3F A;  5K5Q A;  2OQG A;  1U78 A;  3T5X A;  3HIF A;  2IA2 A;  4IF4 A;  1ZHF A;  1U5T A;  1KU2 A;  3CJN A;  3ERE D;  4I09 A;  3B02 A;  2F2E A;  2NRA C;  5J8F A;  3FHZ A;  2IJL A;  2VON A;  1FWZ A;  2V1D A;  2PLY A;  2GXB A;  3ZMD A;  3V8J A;  3F23 A;  4ENN A;  2C6Y A;  3SFZ A;  1SFX A;  2VXZ A;  1MDM A;  3ECH A;  3CUQ A;  3SZT A;  3KP2 A;  4HX4 A;  2P7C B;  1XDS A;  2DO7 A;  4JQF A;  3R4K A;  1BC7 C;  1IN7 A;  4KIC A;  4RAZ A;  1FYK A;  5LEK A;  2XKO A;  5FGM A;  1XGS A;  6PAX A;  3WTX C;  1FC3 A;  3GVA A;  3F21 A;  1E2X A;  3U9G A;  2PJP A;  1P2F A;  5E1W A;  3GFJ A;  2ISZ A;  1DDN A;  2H6C A;  1QNT A;  2K86 A;  5HS9 A;  4WK8 F;  1R22 A;  3WGG A;  3WU1 B;  5ILV A;  1RNL A;  4U7B A;  4ETS A;  5E1X A;  4L0Z B;  2O61 A;  5ICF A;  1SFE A;  4EQQ A;  1BJA A;  4GYG A;  4QWQ A;  3TDZ C;  2V79 A;  2GA2 A;  5TJJ A;  4WF2 A;  1FLI A;  4M72 A;  4ZZD A;  1YW9 A;  1QZY A;  3GXO A;  2VBX A;  2OD5 A;  2ZME B;  2XRN A;  3WE3 A;  4MEX F;  2D2W A;  4HOB A;  2QWW A;  3RYP A;  5CJ9 A;  4XLN F;  2X4H A;  2TDX A;  4HLX A;  1ZN2 A;  3I54 A;  2G9W A;  2MH9 A;  3GZ6 A;  2D1H A;  1LEB A;  2VT2 A;  3F3X A;  3IKV A;  2M1B A;  1I6X A;  3HRU A;  3PQJ A;  3LFK A;  1EV7 A;  3Q5F A;  4HYE A;  3DEU A;  4LJZ F;  1OYI A;  1I1G A;  3KP6 A;  5DD8 A;  3TOA A;  3V8K A;  3C18 A;  2MD5 A;  1J0R A;  5LGU A;  1K7A A;  2CSO A;  2P4W A;  1DUX C;  1JE8 A;  2M87 A;  2RQP A;  2PN6 A;  4BYY A;  5H20 A;  2D45 A;  2QUF A;  4HV5 A;  2G7U A;  1BOA A;  4CZZ A;  5F6F A;  2Q2E A;  2MA3 A;  1YLF A;  4MTE A;  1KU9 A;  4LG0 B;  4GO1 A;  5KK1 A;  1UCR A;  2HFH A;  4A2U A;  3V7R A;  1OR7 A;  1P4W A;  4UHT A;  5CVV A;  3T1B A;  2ZO4 A;  1YIO A;  2XVC A;  1E17 A;  1KQ8 A;  5DD4 A;  1LDK B;  2MLG A;  3FXR A;  2VBY A;  1U2W A;  1S6L A;  1STZ A;  4PZJ A;  4KT5 C;  2QQB A;  3WTU C;  4IHT A;  4ESF A;  1LDJ A;  5LLQ A;  3C7J A;  2HQR A;  4LK1 F;  1G3W A;  3WG9 A;  1O3Q A;  4BNC A;  2GQQ A;  1LQ1 A;  3LAP A;  3HUG A;  1RZ4 A;  3RKY A;  2K27 A;  3MFK A;  2A6H F;  4S05 A;  1K6O A;  3BRO A;  2QQA A;  3BJ6 A;  5HVQ C;  4LLG F;  2W85 A;  4G7O F;  2HR3 A;  3EUH A;  1JGS A;  1ZG5 A;  4UXN A;  2K7L A;  2XAF A;  3ZP5 A;  1DPU A;  3JW4 A;  1BI3 A;  3NEU A;  3QRF F;  3M1E A;  4A12 A;  3KZZ A;  4G6D A;  3HRM A;  4ENK A;  4NHJ A;  3NRV A;  3QPT A;  1CGP A;  3KEQ A;  1F5T A;  3KP7 A;  1D5V A;  3R60 A;  4EJW A;  3FZV A;  2ETH A;  4ZZL A;  4HF2 A;  3F8B A;  2OA4 A;  5E8G A;  2VC1 A;  2IW5 A;  3QP5 A;  1ULY A;  2Z9O A;  2LF7 A;  1O3S A;  4RGR A;  4CIC A;  1WWX A;  2WWY A;  4CXF A;  2A5Y B;  2FU4 A;  4M73 A;  4KA4 A;  3ZMZ A;  1REP C;  4BHB A;  1UHM A;  5IT9 K;  1QQI A;  1FBQ A;  1FSE A;  5LRS A;  3M9A A;  5D8L B;  1UHW A;  1PP7 U;  2GXG A;  2HKX A;  3V7S A;  4HV6 A;  3ZN0 A;  1YS7 A;  3J80 Z;  4GCV A;  3ABU A;  2H27 A;  3OOP A;  3FF5 A;  3K2Z A;  2EFO A;  2RV8 A;  2BEO A;  2ZCW A;  3RPQ A;  2A61 A;  2KJB A;  2HOE A;  1MKM A;  4HA8 A;  1YQA A;  3WGI A;  4U7D A;  5BQT A;  1I5Z A;  3RYR A;  1TNT A;  3WE2 A;  2A6E F;  2EFP A;  5DCM B;  1HW5 A;  1XDU A;  4CO8 A;  5L3C A;  5J6X A;  5HLI A;  4G7H F;  1XN7 A;  2VOD A;  3DP7 A;  4MHG A;  5FFX A;  3RJP A;  4ENJ A;  4HZF A;  1J2X A;  1TQI A;  4LB5 A;  3NQO A;  3ZMV A;  5HS7 A;  1B59 A;  3WTV C;  5HLH A;  2NNN A;  2YSR A;  1FY7 A;  2PEX A;  3IL2 A;  2W25 A;  2NYX A;  1BIA A;  1P4X A;  3T0Y A;  5DUK A;  1QPM A;  1XMK A;  1DP7 P;  3I53 A;  2ZXJ A;  3C3W A;  3ROU A;  2FXA A;  2JPB A;  2K02 A;  5JR3 A;  3MZH A;  3DFG A;  1O7F A;  2VBW A;  2XGX A;  1U5T C;  2QYO A;  1WRJ A;  4AIJ A;  1IN4 A;  3P9C A;  3ZN1 A;  4P96 A;  3KZY A;  1UB9 A;  4OIQ F;  4KYW A;  4H0E A;  1ZAO A;  3GFI A;  2FMY A;  3BPX A;  5F1R A;  2HTJ A;  3WTZ A;  3F6V A;  3CUQ C;  1FYM A;  3KEO A;  4KIF A;  2IP2 A;  3BPV A;  4ESJ A;  1S7O A;  2R7F A;  2PQ8 A;  4U0W A;  2LDU A;  1RUO A;  1R36 A;  3DQV C;  2P5K A;  3L2C A;  4NB5 A;  2RC4 A;  1ZRD A;  4FX4 A;  1LEA A;  4A5M A;  3FM5 A;  1FYL A;  4OIR F;  4A0Y A;  1ON2 A;  1U5T B;  4F7Z A;  3G3Z A;  1J9I A;  1H9G A;  1L3L A;  4MQ9 F;  4G94 A;  1IF1 A;  4EV0 A;  5JI6 A;  1MGT A;  3E3V A;  4Q5S F;  3WTW C;  1MDM B;  1ONV A;  1IUY A;  5CLS A;  1H0M A;  4L9J A;  3U2R A;  5E1Z B;  2RN7 A;  5LGN A;  5ILU A;  1O7L A;  2FF4 A;  1X3U A;  2YU3 A;  3F22 A;  2W84 A;  2R3S A;  5ILS A;  2Y75 A;  4M71 A;  5HLG A;  3HTU A;  3LWF A;  1ZLK A;  5E20 A;  4I01 A;  4IVN A;  3F8M A;  4LFU A;  3H3U A;  3VEP A;  2AXL A;  3CTA A;  2KJC A;  3RKX A;  3JSO A;  3L9F A;  3JSP A;  4FX0 A;  4K2E A;  3TO9 A;  1KYZ A;  2EB7 A;  2J5O A;  2DBB A;  2ZBK A;  4A6E A;  3QAH A;  4Q48 A;  3ML6 A;  2LNB A;  3KE2 A;  4CGZ A;  1HST A;  1HW2 A;  5D5U B;  2IVM A;  5D6E A;  3ZPL A;  1HW1 A;  1HQC A;  3I58 A;  4BH9 A;  3V7C A;  2F5E A;  5FD5 A;  2Z3Y A;  3DPL C;  4Z2Y A;  3K0L A;  1TTY A;  2WV0 A;  5K5O A;  4L9T A;  5JVT A;  3LAJ A;  4EJU A;  3P7N A;  2G7H A;  1RUN A;  2VT3 A;  4RGX A;  3F8C A;  3GWZ A;  4OOI A;  2JPC A;  1MJ9 A;  1OMI A;  3Q9V A;  4XSZ F;  3L7W A;  4LLL A;  3IRQ A;  2EA2 A;  2FEZ A;  5FLX K;  4EMS A;  4R79 A;  2O8X A;  1SMY F;  2L3D A;  4A6D A;  2OBP A;  3BDD A;  1YS6 A;  3DV8 A;  4Q4Z F;  2JTV A;  2E1N A;  4HX8 A;  4P9U A;  1BI1 A;  1R23 A;  3RTR A;  5D4R A;  2HWV A;  5A2Q K;  4WXH A;  4OIP F;  4BHC A;  1IXS B;  1HSJ A;  1HKT A;  2DW4 A;  3ZMT A;  3KCC A;  3FWE A;  5EEH A;  2UXX A;  1MJA A;  4I98 B;  4E70 A;  4IRH A;  5J8C A;  1G3S A;  3ECO A;  2F5D A;  4G6Q A;  1FNN A;  1GHC A;  1O3R A;  3TKY A;  2STT A;  4HW0 A;  4HX7 A;  2P6T A;  3SQN A;  3WTY C;  2QM3 A;  2HDC A;  4I0B A;  4LMY A;  3HOT A;  4LD5 A;  1D3Y A;  5D5W B;  3JAM K;  2DK8 A;  3GYH X;  1T98 A;  4ESB A;  3HTS B;  2E7X A;  1MJB A;  1R1T A;  3ULQ B;  1HXD A;  3ISP A;  3LA7 A;  2W24 A;  5LBQ A;  2LKP A;  5BMZ A;  2BGC A;  5D5V B;  5HDK A;  4KN4 X;  2DU9 A;  4QLC U;  1T2K A;  2Z5U A;  3HHG A;  4KMF A;  5FD6 A;  1PP8 F;  1QZZ A;  2QQ9 A;  3BJO A;  4DQ2 A;  4EJV A;  1IZ1 A;  1WKM A;  4R1H A;  4GXO A;  2CG4 A;  2A68 F;  4GYI A;  1K78 A;  1Q1H A;  4P5O A;  3FMR A;  2XHK A;  2NAZ A;  4RS8 A;  1R00 A;  3IKT A;  5BPI A;  3RI4 A;  3COA C;  2GIV A;  3M8E A;  1IXR C;  1ZYR F;  2J5P A;  3DPT A;  2GA1 A;  2EA4 A;  2RVC A;  5ERI A;  1GVJ A;  3MAJ A;  1B9N A;  2F5C A;  2IPQ X;  1Y0U A;  1BN5 A;  1ZRC A;  1XGO A;  2FA5 A;  2PG4 A;  5DDG A;  4G8X A;  3WGH A;  2EFW A;  1T6S A;  1XB4 A;  2LF8 A;  1FOK A;  2KRF A;  1GXQ A;  4JK1 X;  1IRF A;  1UST A;  2UXN A;  1IRG A;  4IHS A;  4BHP A;  2HGC A;  4YG2 F;  3KP5 A;  4RB3 C;  4U88 A;  1R5H A;  1QO0 D;  1NHA A;  4YII A;  2VBZ A;  3I71 A;  2L02 A;  1SD4 A;  2O0Y A;  1YW8 A;  3D5L A;  1MD0 A;  2EV0 A;  2VE9 A;  1RIO H;  4M9Z A;  3V4G A;  2ZJ2 A;  2HS5 A;  4AIH A;  3CUO A;  2L54 A;  4U0V A;  3J81 K;  4HF0 A;  5JFR A;  2QZ8 A;  1KU7 A;  1C0W A;  1OKR A;  1ZG1 A;  1FPQ A;  2XAQ A;  2D1V A;  3R61 A;  4ZYE A;  1T39 A;  2CFX A;  1SFU A;  2FRH A;  5LEJ A;  2LSO A;  3SXY A;  1OPC A;  2IT0 A;  3N97 A;  3E6M A;  2FSW A;  2EV5 A;  4I7H A;  4UNO A;  2UWM A;  1EH8 A;  1Z91 A;  2QLZ A;  4IPA A;  3WTT C;  3TDU C;  1SD5 A;  1W7P B;  4M6Y A;  4WXD A;  1B6A A;  5ICC A;  1YYV A;  3I59 A;  1P92 A;  1Z05 A;  4HDU A;  1ZRE A;  4WWC A;  3EYY A;  5E17 F;  4HF1 A;  4LB6 B;  2GAU A;  2EFN A;  3GF2 A;  2HKO A;  1OYW A;  5BPD A;  1IXC A;  1XSX A;  3QP6 A;  3ABT A;  2R7D A;  3Q9S A;  1SAX A;  3HSE A;  2KIU A;  3EDP A;  4G9Y A;  3JTG A;  1F4K A;  4KIB A;  4UVB A;  2HYG D;  2KIM A;  3IHU A;  4KUM A;  2DPD A;  4EM2 A;  3F8F A;  2Z33 A;  2WTE A;  2K4B A;  2VOO A;  2V1X A;  2XUB A;  4MNU A;  5HDN A;  1TNS A;  2X0L A;  3K9T A;  3W6K B;  4I2O A;  3M8F A;  1G4D A;  2E1C A;  4IRI A;  1QBJ A;  4RGS A;  4YFX F;  2ESH A;  4WX9 A;  1JHF A;  1TQP A;  2NNY A;  3MWM A;  5LRR A;  1KQ9 A;  4EVI A;  4XLP F;  2EWN A;  3GW2 A;  2FNA A;  2E7W A;  1BBY A;  4XRF A;  1J5Y A;  3KP4 A;  2V6C A;  1HBX G;  3O2P E;  5D5X B;  1XGM A;  1PUE E;  1R1V A;  4ZYD A;  2BV6 A;  5IT9 Z;  2Q8K A;  4B09 A;  2YPR A;  3IWF A;  1ODD A;  1BIB A;  3E5Q A;  3CO6 C;  5LHI A;  5BS6 A;  2XAJ A;  5CVR A;  3KLO A;  1S8N A;  1GXP A;  2DQL A;  1G3Y A;  1JHH A;  1B1B A;  5D4S A;  4S04 A;  2CYY A;  3O3K A;  5DEQ A;  4JBA A;  5HOO A;  4RB2 C;  2FML A;  1WQ2 A;  4CDG A;  1CF7 B;  3FMQ A;  4KIG A;  2CO5 A;  4XSX F;  2QVO A;  2DQR A;  1TBX A;  1K79 A;  1S29 A;  2ZNZ A;  2FBH A;  3L00 A;  4Y15 A;  3GFL A;  3HHH A;  3BZ6 A;  5L3B A;  4L5I A;  2HEO A;  2HQN A;  2MLK A;  1ZG3 A;  1J7K A;  1O3T A;  2MC3 A;  2O03 A;  5K1Y A;  2DT5 A;  3BY6 A;  3FX3 A;  4ZH4 F;  3E5X A;  1HKS A;  5LHH A;  3QU6 A;  3S2W A;  3GUD A;  2FNP A;  4UV9 A;  4G7Z F;  1OYY A;  5LGT A;  3CUQ B;  2VE8 A;  3WOD F;  1Z9C A;  3KFW X;  3ZQ7 A;  2O6G E;  1YW7 A;  2V1U A;  1ZGJ A;  4ZYG A;  3N4M A;  5KVR A;  1LDD A;  4GGG A;  2CW0 F;  3H92 A;  1ZRF A;  5FO5 A;  1KQ0 A;  2L4M A;  2Y0M A;  4KMU X;  5D6F A;  3GEZ A;  4KDP A;  3KET A;  5TRD A;  1T0F A;  4ENM A;  3J7A O;  3HOS A;  2COM A;  2DTR A;  4OIO F;  4EGY A;  3V8L A;  2ELH A;  2IA0 A;  2EJR A;  1RI7 A;  3VB2 A;  2PMH A;  1XSD A;  1HKQ A;  3GFM A;  2B0L A;  1BI2 A;  5L3F A;  1FX7 A;  2V9V A;  4OMY A;  2OU2 A;  3B73 A;  1B9M A;  2M45 A;  1IN6 A;  5ICG A;  2XRO A;  2QBY A;  1JXS A;  2Q0O A;  4ZYH A;  3R0A A;  4N0B A;  4EM1 A;  5IT3 A;  1USS A;  1LJ9 A;  1SD6 A;  3QPH A;  5DV5 A;  1I1S A;  3KLN A;  1PDN C;  5L3D A;  4AVP A;  4LK0 F;  2A69 F;  2ZFW A;  2EV6 A;  4RGU A;  3TO7 A;  3FXQ A;  3M7G A;  4Y13 A;  3SHF A;  1XMA A;  5K5R A;  3T8T A;  4BQA A;  2A3S A;  5EEG A;  3VFZ A;  1D8J A;  2XAS A;  3ZMU A;  4OU0 A;  1TW2 A;  4FHT A;  5ED4 A;  2OAZ A;  3R6S A;  3IRR A;  4ON0 A;  3WTS C;  2ZKZ A;  4Y17 A;  3BP8 A;  4NQW A;  2FBI A;  4HDV A;  4AIK A;  3C1D A;  4ASN A;  4O3M A;  4R8H A;  4L9V A;  1D8K A;  2XAG A;  1A04 A;  2A07 F;  4EGZ A;  2FQ3 A;  3GZ5 A;  3VOD A;  4HQM A;  4UVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...