2F5WA

Cross-linked barnase soaked in 3 m thiourea
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title On the edge of the denaturation process: Application of X-ray diffraction to barnase and lysozyme cross-linked crystals with denaturants in molar concentrations.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 32
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2005-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2f5wA00
1I2FA 3HOHA 1RGFA 1BSEA 1BIRA 1RSNA 1B20A 1GMRA 1TRQA 2BIRA 2KAAA 1BRSA 1GOUA 1BNRA 2KF3A 1HYFA 3SYUA 1Q9EA 1B2ZA 3D5GA 1LOVA 2ZA4A 1X1WA 1BGSA 1BSAA 1UCIA 1R4YA 4GSPA 2F5MA 7RNTA 1B2UA 1BNSA 6GSPA 1JBRA 1GMPA 2HOHA 3RNTA 1RGLA 2BU4A 1FUSA 1BAOA 1GSPA 1YVSA 1RGKA 2KF4A 4J5KA 1BUJA 1T2HA 2F5WA 3D4AA 2AAEA 1I2EA 2C4BA 1BRHA 1B2SA 5GSPA 1GMQA 7GSPA 1BRIA 1GOVA 4GHOA 1RCKA 1JBSA 4BIRA 1I2GA 1RGCA 1BNEA 1CH0A 1BOXA 1I0VA 1LRAA 1RMSA 3Q3FA 1TRPA 1DE3A 1FUTA 1BNGA 1BSDA 1BRJA 1AQZA 3URPA 2RBIA 1BNIA 5RNTA 1BRNL 3AGNA 2GSPA 1UCKA 2KF6A 1RNTA 3BIRA 1MGRA 1PYLA 3AGOA 1FW7A 1BSCA 3WHOA 1BVIA 4RNTA 2AADA 2RNTA 1X1XA 1BNFA 1YNVX 1YGWA 1I0XA 1ZGXA 1UCLA 1AY7A 1RGEA 8RNTA 3DH2A 3KCHA 1SARA 3GSPA 1B27A 1HZ1A 1T2IA 1BRGA 1B21A 4HOHA 1X1YA 3WR2A 9RNTA 3AHSA 1FZUA 1UCJA 1JBTA 1BNJA 1RLSA 1BSBA 1G02A 1BU4A 1RHLA 2SARA 1I70A 4BU4A 1RN1A 1RGGA 1B2MA 1I3FA 1PY3A 3AHWA 1I3IA 6RNTA 1LOWA 1TTOA 3A5EA 5BU4A 1RTUA 1I8VA 1B2XA 3BU4A 2F56A 1X1UA 1A2PA 1FYSA 5BIRA 1IYYA 1RGAA 1MGWA 1RGHA 1RN4A 2F4YA 1C54A 1BRKA 1B3SA 3DGYA 1DETA 1LNIA 5HOHA 3D5IA 4J5GA 1RDSA 1BANA 1GOYA 1RNBA 1RCLA 1LOYA 4HAAA 2KF5A
chains in the Genus database with same CATH superfamily
1I2FA 1JKGB 3OW22 1IQ8A 1FGMA 1VQ83 2PNCA 1DMNA 2BMRB 3OWSA 5D82A 4K1UA 1YJN3 2E2VA 2KAAA 1BRSA 3BB9A 3LZAA 4HBRA 1MWUA 5KP1A 1GOUA 1S723 1CYUA 3PS8A 3ROBA 4HVNA 1C7HA 5JPUA 1LXEA 2XFSA 1HYFA 3NBJA 1Q824 4N6OB 5AIFA 3WOEB 4OK0A 2O3OA 3NHXA 5D83A 4N6TA 1NB5I 1ROVA 1RRHA 2YFIB 5FGOA 1VQ43 3G6E3 1CQSA 1UCIA 3E99A 4HKVB 2CWTA 4HM3B 4IT7A 3FG4A 1EKMA 1R4YA 2C11A 3DUKA 4FMBA 3UNLA 3HX8A 1BNSA 3SLUA 2CG0A 1SIHA 6GSPA 6STDA 1W6YA 1RKYA 2HOHA 1TFKA 1FUSA 1S5AA 3I0YA 2XGNA 5IW9A 1YVSA 1RGKA 4J5KA 2IUJA 1IVUA 1T2HA 2F5WA 2C4BA 1JZOA 4O02B 4OUQA 5FW5A 2J8XB 1A90A 1A67A 1N5PA 3NQZA 1M1XB 4EC6A 5CF2A 2GU3A 1MWRA 4XBXA 1YI23 5AIHA 3M8CA 2R4IA 4BIRA 5IERA 1RGCA 1NJI4 2XFTA 1OF5A 3EBYA 3FG3A 3KIIA 1I0VA 1RMSA 2GXFA 3LT9A 4ORLA 3SEDA 1IV9A 1GD4A 3CCR3 3F14A 1U5OA 2HMOB 2Y73A 3ZFZA 3LTDA 4TX4A 1BRJA 5AEWB 2H0HA 1UI7A 5IG4A 1BRNL 2IMJA 1IVXA 1UCKA 2KF6A 1A2KA 5D81A 4CCVA 1FW7A 1DMMA 1BSCA 4BTWA 3H51A 1GD3A 1UI8A 2RNTA 1IV7A 1EUIC 3IJEB 1BNFA 3OV4A 3SOAA 2RFRA 3NUVA 2K3DA 2W56A 3FSDA 1OUNA 1RGEA 2CC3A 4LYLB 8RNTA 4R80A 1N8R4 3DH2A 3N54B 3B7CA 3LTAA 1YJ93 1FGRA 1HZ1A 3CC23 3SOYA 2H0GA 1B21A 3WR2A 3D79A 1D6YA 5G1KA 2Z6BA 3A76A 2XEPA 1RLSA 4KFFA 3CXC2 1K8A4 2XH9A 1N5HA 3FF0A 3K5TA 4HM7B 5IEPA 5IF6A 5IG5A 4Q53A 3NV0A 3MSOA 1IVWA 2XSHB 4AEQA 3LH4A 1RGGA 3MG3A 5DRVA 4HM6B 1OPYA 3GZRA 3Q1CA 3HIIA 1NDOB 3A5EA 1E97A 3HK4A 3CNXA 1NO3A 3F8XA 5HGRA 3S5CA 2GBWB 4RNZA 5CF1A 1O7WB 2CH9A 2Q07A 1JNQA 3LTCA 1FYSA 1VZZA 4BTXA 3CCQ3 1MGWA 1DYUA 2IA7A 4WYKA 2O9UX 4X2HA 3DGYA 4I4KA 1DETA 1QVG2 1LNIA 3Q2PA 4HM0B 1OACA 2QGUA 4GL6A 1T3BA 3D5IA 3T8NA 3FKAA 1RDSA 2BO9B 2XGLA 5G1LA 5KP3A 2OOVA 3UJMA 4WFOA 4HAAA 5BVBA 2FGTA 3CPW2 3HOHA 1KD14 1RGFA 3IPTA 3VGNA 1B20A 3DMCA 5LC6A 1HU9A 1UDII 1QVF2 3PYJA 3ALAA 3LT8A 5CXOA 3EX9A 3X40A 3CU3A 1O7PB 2KF3A 3PCSA 2L4VA 3D5GA 3WODG 2HMMB 3KN4A 1M904 1VQK3 1EA2A 1W4NA 2B24B 2ZA4A 3DZLA 2W9PA 1WNHA 3GRDA 4EYCA 3DGOA 4GSPA 1ISKA 1K28A 1ROAA 2F5MA 1UUGB 2MF7A 5I97A 1B2UA 3RGAA 3TDGA 3CPOA 3RGRA 3WA2X 1VQ63 2K0MA 1ZX2A 1T5YA 2CW9A 4STDA 2R41A 3SVAA 2XR8B 2W0QA 2CFGA 2KF4A 3MG2A 3L0RA 2BT3A 2CKFB 2UGIA 3U1WA 3NXJA 2AAEA 2CX1A 2UUGC 2Z7AA 4NPBA 1JB4A 5ELJA 2RGQA 1J2BA 1M1K4 2H0IA 1GMQA 1W01A 7GSPA 1OGXA 3PXMA 4GHOA 1YJW3 4CJNA 1FGQA 1I2GA 5EQLA 1DMQA 1ULJB 1GY6A 1BOXA 1LRAA 2UX0A 1YIT3 4NREA 3Q3FA 3KSPA 1DE3A 1FGOA 1FUTA 2W03A 5IG3A 1BNIA 2HMNB 3VSYA 2ZL8A 3MPHA 4MMZB 1RNTA 2WOFA 1OF5B 1W02A 3DGNA 3EJVA 2W9QA 3ZG0A 3GZBA 3LYGA 4FMAA 3B4PA 3CCU3 1Q7Y4 3K9MC 4K1VA 3T0UA 3CC43 4EW5A 1SARA 1UUVB 3BLZA 1NB3I 4L8OA 3K7CA 1NWWA 3HZPA 3G713 1ZO2A 1IVVA 1X1YA 9RNTA 4JRFA 3EF8A 2KXGA 1JBTA 1WMPA 1ZS7A 2STDA 1BSBA 3B4OA 2W56B 5LC7A 4LGQA 1EQKA 2SARA 2WO0A 1I70A 4N6V0 2OWPA 1RN1A 1UGIA 4U13A 3LOYA 1I3FA 1PY3A 1I3IA 1V57A 2FNQA 2KRTA 3K0ZA 2A15A 1YHQ3 1N9EA 3F7XA 5CK6A 5BU4A 1RTUA 2CWVA 4BTYA 1M9GA 1FA3A 1X1UA 1OHPA 4BL2A 1JN5A 1A2PA 1QAFA 1LQGC 2CHCA 3NV0B 5EVHA 3EBTA 5BIRA 1VQL3 1RN4A 1N9JA 1TUHA 1RRLA 1W5ZA 4HM1B 3HI7A 4KT3B 3N8BA 2L1SA 3F40A 2CFLA 1BANA 1GOYA 4EXRA 3G8ZA 4XBYA 1L5GB 1G96A 4HM5B 3CD63 2KF5A 3FCSB 4FCMA 3SXXA 1AR0A 1GMRA 5AEUB 1OCVA 1TRQA 3CCM3 3S67A 4WYKB 1MOLA 1GYBA 3Q90A 4HM8B 5ELUA 3UB1A 3CCS3 3NM2A 1OHSA 2C10A 3NX0A 1UGHI 1V58A 4J8TA 2JDIH 3X3ZA 1BNRA 7STDA 4N6MA 3SYUA 4QWTA 2E2TA 4I5QA 1Q9EA 2OCTA 2P0MA 3I563 1AVLA 2XF3A 3X41A 3FZWA 4HM4B 1X1WA 3KSED 4RZMA 1Q40B 2P0XA 3MWZA 3O8YA 4LSOA 3MG1A 3UL6A 3X3XA 2K54A 4KFDA 3STDA 3CME3 3EC9A 4DKIA 1LOXA 2GBXB 3F9SA 3KZTA 1DVDA 3JUNA 3KKGA 1VQP3 1Q7HA 2F98A 3LXUX 3H3HA 2XSOB 4O2HA 2BU4A 4HZBB 4RBNA 1BAOA 1GSPA 1D6UA 2PZVA 4EV2A 2E2UA 1BUJA 3BNBA 3EN8A 1HKXA 5TGNA 3EQQB 4KFEA 5JBSA 4EBGA 1QMAA 1BRIA 2LQVA 3G0KA 3IMAB 1RCKA 1STFI 4WHAA 1JBSA 1E3RA 2OQEC 3CMA3 4WP5A 1BNEA 1CH0A 1NNVA 3EE1A 3DY5A 5JPPA 1G0TA 1TRPA 2BHMA 2D1WA 1FUWA 4L8PA 1N8QA 3FH1A 3ECFA 3CCV3 3PCRA 2CWUA 4OVMA 2IY2A 4LMIA 3BNDA 2Z77A 3RDEA 4PEJA 3CC73 3OXAA 3F7SA 3V99A 3DGMA 2QEX3 1R4CA 3BIRA 4R9LA 2ZDJA 1IT7A 2WGOA 3AGOA 1JV2B 3WHOA 1IT8A 1RN7A 2CFDA 4RNTA 2HMJB 1X1XA 2CK3H 1VQ53 1E3VA 1RJOA 1YNVX 1I0XA 1ZGXA 1VQO3 1UCLA 3NQYA 5IG0A 3WA3A 2CIUA 1WTHA 5BXQA 1W6GA 1LNHA 2HMLB 4FCJA 3GSPA 1B27A 3B8LA 4N6UA 1Q42A 4H61A 5KP4A 1YGEA 3EN1B 3QK9A 4O3VA 1IQXA 2YFLB 4R4KA 3S29A 3ZG5A 4CDLA 3AHSA 1FZUA 4G1MB 1UCJA 2P09A 3GZXB 1BNJA 1O7HB 1W6CA 2MC8A 3T8UA 4ILFA 3AMOA 1G02A 3CCJ3 1Z1SA 1UUWB 3K63A 3VF1A 4BU4A 1K41A 2P38A 1O7NB 2I9WA 3N9HA 4LEHA 5STDA 1JJ22 2LYXA 4FR9A 1B2MA 3AHWA 3X42A 3FLJA 6RNTA 4R1KA 1QALA 1O7MB 1JRQA 1TTOA 2F99A 2ML6A 1I8VA 5AIGA 8CHOA 3CCE3 3G16A 1JKGA 3U97A 2KCDA 1C54A 3WMDA 4CPKA 1TP6A 3OWYA 1PFPA 1BRKA 1B3SA 1MNLA 5HOHA 3PZWA 3JUOA 3X3YA 1CYVA 1US1A 4J5GA 1JB5A 1CEWI 1LQMB 1STDA 2W04A 3LMLA 2IYJA 3F8HA 3JUMA 1RNBA 4XBTA 4MMXB 1JN5B 1BSEA 1KWIA 1BIRA 1RSNA 2W2CA 2BIRA 2HMKB 4FMCA 1AVKA 3DGLA 3UL5A 1KSIA 2B1XB 4AKYA 3GAXA 3GWRA 5IEOA 3I553 3CNMA 1K734 4J9AA 1B2ZA 3CCL3 2GEYA 1LOVA 1Q864 3OX9A 1NU3A 4FCZA 1QAKA 1QJGA 5IENA 1VQN3 1BGSA 1BUQA 2FXTA 3JUPA 1BSAA 1SJWA 1VQQA 2GEXA 4HYZA 1SQWA 1YIJ3 3ER7A 1OGZA 4FMDA 3DXOA 7RNTA 1JZDA 1O7GB 5EEOA 4R9KA 5M1AA 1W00A 4JF8A 5AIIA 3BNEA 1JBRA 3PGBA 1GMPA 1KC84 3RNTA 4MMYB 1RGLA 4IIAA 4MEIA 4XDVA 1EEJA 3HIGA 4WWUC 3V98A 3D4AA 2OTL3 1IQYA 1W7CA 1I2EA 1BRHA 1B2SA 4O8SA 5GSPA 1GS3A 3BNCA 1F8NA 2D42A 1GOVA 3S28A 1ULIB 4XB5A 2RCDA 4GB5A 3GZYB 4L7KA 1WMNA 4K90B 5G2GA 2OTJ3 2SBLA 2WOHA 3NBBA 1ASKA 1D6ZA 3MKIA 2WGQA 2JQ5A 1MWTA 1TIJA 3DM8A 3FG1A 4N6LA 1BNGA 1LVNA 1BSDA 3FGYA 1AQZA 3V92A 4HM2B 2Z76A 1Y4KA 4XDWA 2RBIA 4IPBA 3URPA 1EG9B 1TFOA 4K61A 4MJDA 5RNTA 2V1LA 4N3VA 4ZM8A 3AGNA 3MHEA 2CX0A 2GSPA 2RSXA 3G4S3 5AYRB 1W2B2 1IK3A 1UW1A 1MGRA 1PYLA 1YVBI 1SPUA 2ZHXB 4LZIA 1BVIA 2BMOB 2AADA 3SX1A 4RNYA 1Q814 1OHOA 1YGWA 3KFQC 3EB8A 1W2ZA 1AY7A 5CLKA 2XRXB 3S27A 3J7Yd 2BNGA 2OQEA 4H3UA 3KCHA 2IUKA 1K9M4 1KQS2 2W6JH 4XM4A 2INXA 2CFKA 5A0OB 1T2IA 2CFWA 1BRGA 4NHFA 5AYSC 4HOHA 3LTBA 1VQ93 3D3LA 3EHCA 1VQ73 3QRDA 2OOVC 2CG1A 1IU7A 2YX9A 3D9RA 1GY7A 2YFJB 4KVHA 1BU4A 1GY5A 1MWSA 2F86B 1RHLA 1Q40A 2Y74A 1PU4A 3NBRA 3WDGB 2GU1A 4BL3A 1SIIA 3MYTA 2QIYA 1VQM3 1V74A 1LOWA 3FF2A 1TJDA 1TU5A 1A2VA 1AV4A 2BMQB 2ML5A 3OWUA 2M7OA 1B2XA 3BU4A 4N6NB 4HJLB 2F56A 3AMOB 3WOFB 2QA43 1IYYA 1RGAA 1RGHA 2F4YA 4EV5A 2P05A 1JB2A 1OH0A 5AI1A 5M19A 1FGTA 1DVCA 5DREA 3NM7A 4HZ9B 4KZ1A 1WMOA 1IDPA 1WQLB 3KE7A 4X2OA 5M18A 3JUQA 4AKZA 1RCLA 1LOYA 1U8CB 3JVCA
chains in the Genus database with same CATH topology
1I2FA 3HOHA 1RGFA 1BSEA 1BIRA 1RSNA 1B20A 1GMRA 1TRQA 2BIRA 2KAAA 1BRSA 1GOUA 1BNRA 2KF3A 1HYFA 3SYUA 1Q9EA 1B2ZA 3D5GA 1LOVA 2ZA4A 1X1WA 1BGSA 1BSAA 1UCIA 1R4YA 4GSPA 2F5MA 7RNTA 1B2UA 1BNSA 6GSPA 1JBRA 1GMPA 2HOHA 3RNTA 1RGLA 2BU4A 1FUSA 1BAOA 1GSPA 1YVSA 1RGKA 2KF4A 4J5KA 1BUJA 1T2HA 2F5WA 3D4AA 2AAEA 1I2EA 2C4BA 1BRHA 1B2SA 5GSPA 1GMQA 7GSPA 1BRIA 1GOVA 4GHOA 1RCKA 1JBSA 4BIRA 1I2GA 1RGCA 1BNEA 1CH0A 1BOXA 1I0VA 1LRAA 1RMSA 3Q3FA 1TRPA 1DE3A 1FUTA 1BNGA 1BSDA 1BRJA 1AQZA 3URPA 2RBIA 1BNIA 5RNTA 1BRNL 3AGNA 2GSPA 1UCKA 2KF6A 1RNTA 3BIRA 1MGRA 1PYLA 3AGOA 1FW7A 1BSCA 3WHOA 1BVIA 4RNTA 2AADA 2RNTA 1X1XA 1BNFA 1YNVX 1YGWA 1I0XA 1ZGXA 1UCLA 1AY7A 1RGEA 8RNTA 3DH2A 3KCHA 1SARA 3GSPA 1B27A 1HZ1A 1T2IA 1BRGA 1B21A 4HOHA 1X1YA 3WR2A 9RNTA 3AHSA 1FZUA 1UCJA 1JBTA 1BNJA 1RLSA 1BSBA 1G02A 1BU4A 1RHLA 2SARA 1I70A 4BU4A 1RN1A 1RGGA 1B2MA 1I3FA 1PY3A 3AHWA 1I3IA 6RNTA 1LOWA 1TTOA 3A5EA 5BU4A 1RTUA 1I8VA 1B2XA 3BU4A 2F56A 1X1UA 1A2PA 1FYSA 5BIRA 1IYYA 1RGAA 1MGWA 1RGHA 1RN4A 2F4YA 1C54A 1BRKA 1B3SA 3DGYA 1DETA 1LNIA 5HOHA 3D5IA 4J5GA 1RDSA 1BANA 1GOYA 1RNBA 1RCLA 1LOYA 4HAAA 2KF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I2F A;  3HOH A;  1RGF A;  1BSE A;  1BIR A;  1RSN A;  1B20 A;  1GMR A;  1TRQ A;  2BIR A;  2KAA A;  1BRS A;  1GOU A;  1BNR A;  2KF3 A;  1HYF A;  3SYU A;  1Q9E A;  1B2Z A;  3D5G A;  1LOV A;  2ZA4 A;  1X1W A;  1BGS A;  1BSA A;  1UCI A;  1R4Y A;  4GSP A;  2F5M A;  7RNT A;  1B2U A;  1BNS A;  6GSP A;  1JBR A;  1GMP A;  2HOH A;  3RNT A;  1RGL A;  2BU4 A;  1FUS A;  1BAO A;  1GSP A;  1YVS A;  1RGK A;  2KF4 A;  4J5K A;  1BUJ A;  1T2H A;  2F5W A;  3D4A A;  2AAE A;  1I2E A;  2C4B A;  1BRH A;  1B2S A;  5GSP A;  1GMQ A;  7GSP A;  1BRI A;  1GOV A;  4GHO A;  1RCK A;  1JBS A;  4BIR A;  1I2G A;  1RGC A;  1BNE A;  1CH0 A;  1BOX A;  1I0V A;  1LRA A;  1RMS A;  3Q3F A;  1TRP A;  1DE3 A;  1FUT A;  1BNG A;  1BSD A;  1BRJ A;  1AQZ A;  3URP A;  2RBI A;  1BNI A;  5RNT A;  1BRN L;  3AGN A;  2GSP A;  1UCK A;  2KF6 A;  1RNT A;  3BIR A;  1MGR A;  1PYL A;  3AGO A;  1FW7 A;  1BSC A;  3WHO A;  1BVI A;  4RNT A;  2AAD A;  2RNT A;  1X1X A;  1BNF A;  1YNV X;  1YGW A;  1I0X A;  1ZGX A;  1UCL A;  1AY7 A;  1RGE A;  8RNT A;  3DH2 A;  3KCH A;  1SAR A;  3GSP A;  1B27 A;  1HZ1 A;  1T2I A;  1BRG A;  1B21 A;  4HOH A;  1X1Y A;  3WR2 A;  9RNT A;  3AHS A;  1FZU A;  1UCJ A;  1JBT A;  1BNJ A;  1RLS A;  1BSB A;  1G02 A;  1BU4 A;  1RHL A;  2SAR A;  1I70 A;  4BU4 A;  1RN1 A;  1RGG A;  1B2M A;  1I3F A;  1PY3 A;  3AHW A;  1I3I A;  6RNT A;  1LOW A;  1TTO A;  3A5E A;  5BU4 A;  1RTU A;  1I8V A;  1B2X A;  3BU4 A;  2F56 A;  1X1U A;  1A2P A;  1FYS A;  5BIR A;  1IYY A;  1RGA A;  1MGW A;  1RGH A;  1RN4 A;  2F4Y A;  1C54 A;  1BRK A;  1B3S A;  3DGY A;  1DET A;  1LNI A;  5HOH A;  3D5I A;  4J5G A;  1RDS A;  1BAN A;  1GOY A;  1RNB A;  1RCL A;  1LOY A;  4HAA A;  2KF5 A; 
#chains in the Genus database with same CATH topology
 1I2F A;  1JKG B;  3OW2 2;  1IQ8 A;  1FGM A;  1VQ8 3;  2PNC A;  1DMN A;  2BMR B;  3OWS A;  5D82 A;  4K1U A;  1YJN 3;  2E2V A;  2KAA A;  1BRS A;  3BB9 A;  3LZA A;  4HBR A;  1MWU A;  5KP1 A;  1GOU A;  1S72 3;  1CYU A;  3PS8 A;  3ROB A;  4HVN A;  1C7H A;  5JPU A;  1LXE A;  2XFS A;  1HYF A;  3NBJ A;  1Q82 4;  4N6O B;  5AIF A;  3WOE B;  4OK0 A;  2O3O A;  3NHX A;  5D83 A;  4N6T A;  1NB5 I;  1ROV A;  1RRH A;  2YFI B;  5FGO A;  1VQ4 3;  3G6E 3;  1CQS A;  1UCI A;  3E99 A;  4HKV B;  2CWT A;  4HM3 B;  4IT7 A;  3FG4 A;  1EKM A;  1R4Y A;  2C11 A;  3DUK A;  4FMB A;  3UNL A;  3HX8 A;  1BNS A;  3SLU A;  2CG0 A;  1SIH A;  6GSP A;  6STD A;  1W6Y A;  1RKY A;  2HOH A;  1TFK A;  1FUS A;  1S5A A;  3I0Y A;  2XGN A;  5IW9 A;  1YVS A;  1RGK A;  4J5K A;  2IUJ A;  1IVU A;  1T2H A;  2F5W A;  2C4B A;  1JZO A;  4O02 B;  4OUQ A;  5FW5 A;  2J8X B;  1A90 A;  1A67 A;  1N5P A;  3NQZ A;  1M1X B;  4EC6 A;  5CF2 A;  2GU3 A;  1MWR A;  4XBX A;  1YI2 3;  5AIH A;  3M8C A;  2R4I A;  4BIR A;  5IER A;  1RGC A;  1NJI 4;  2XFT A;  1OF5 A;  3EBY A;  3FG3 A;  3KII A;  1I0V A;  1RMS A;  2GXF A;  3LT9 A;  4ORL A;  3SED A;  1IV9 A;  1GD4 A;  3CCR 3;  3F14 A;  1U5O A;  2HMO B;  2Y73 A;  3ZFZ A;  3LTD A;  4TX4 A;  1BRJ A;  5AEW B;  2H0H A;  1UI7 A;  5IG4 A;  1BRN L;  2IMJ A;  1IVX A;  1UCK A;  2KF6 A;  1A2K A;  5D81 A;  4CCV A;  1FW7 A;  1DMM A;  1BSC A;  4BTW A;  3H51 A;  1GD3 A;  1UI8 A;  2RNT A;  1IV7 A;  1EUI C;  3IJE B;  1BNF A;  3OV4 A;  3SOA A;  2RFR A;  3NUV A;  2K3D A;  2W56 A;  3FSD A;  1OUN A;  1RGE A;  2CC3 A;  4LYL B;  8RNT A;  4R80 A;  1N8R 4;  3DH2 A;  3N54 B;  3B7C A;  3LTA A;  1YJ9 3;  1FGR A;  1HZ1 A;  3CC2 3;  3SOY A;  2H0G A;  1B21 A;  3WR2 A;  3D79 A;  1D6Y A;  5G1K A;  2Z6B A;  3A76 A;  2XEP A;  1RLS A;  4KFF A;  3CXC 2;  1K8A 4;  2XH9 A;  1N5H A;  3FF0 A;  3K5T A;  4HM7 B;  5IEP A;  5IF6 A;  5IG5 A;  4Q53 A;  3NV0 A;  3MSO A;  1IVW A;  2XSH B;  4AEQ A;  3LH4 A;  1RGG A;  3MG3 A;  5DRV A;  4HM6 B;  1OPY A;  3GZR A;  3Q1C A;  3HII A;  1NDO B;  3A5E A;  1E97 A;  3HK4 A;  3CNX A;  1NO3 A;  3F8X A;  5HGR A;  3S5C A;  2GBW B;  4RNZ A;  5CF1 A;  1O7W B;  2CH9 A;  2Q07 A;  1JNQ A;  3LTC A;  1FYS A;  1VZZ A;  4BTX A;  3CCQ 3;  1MGW A;  1DYU A;  2IA7 A;  4WYK A;  2O9U X;  4X2H A;  3DGY A;  4I4K A;  1DET A;  1QVG 2;  1LNI A;  3Q2P A;  4HM0 B;  1OAC A;  2QGU A;  4GL6 A;  1T3B A;  3D5I A;  3T8N A;  3FKA A;  1RDS A;  2BO9 B;  2XGL A;  5G1L A;  5KP3 A;  2OOV A;  3UJM A;  4WFO A;  4HAA A;  5BVB A;  2FGT A;  3CPW 2;  3HOH A;  1KD1 4;  1RGF A;  3IPT A;  3VGN A;  1B20 A;  3DMC A;  5LC6 A;  1HU9 A;  1UDI I;  1QVF 2;  3PYJ A;  3ALA A;  3LT8 A;  5CXO A;  3EX9 A;  3X40 A;  3CU3 A;  1O7P B;  2KF3 A;  3PCS A;  2L4V A;  3D5G A;  3WOD G;  2HMM B;  3KN4 A;  1M90 4;  1VQK 3;  1EA2 A;  1W4N A;  2B24 B;  2ZA4 A;  3DZL A;  2W9P A;  1WNH A;  3GRD A;  4EYC A;  3DGO A;  4GSP A;  1ISK A;  1K28 A;  1ROA A;  2F5M A;  1UUG B;  2MF7 A;  5I97 A;  1B2U A;  3RGA A;  3TDG A;  3CPO A;  3RGR A;  3WA2 X;  1VQ6 3;  2K0M A;  1ZX2 A;  1T5Y A;  2CW9 A;  4STD A;  2R41 A;  3SVA A;  2XR8 B;  2W0Q A;  2CFG A;  2KF4 A;  3MG2 A;  3L0R A;  2BT3 A;  2CKF B;  2UGI A;  3U1W A;  3NXJ A;  2AAE A;  2CX1 A;  2UUG C;  2Z7A A;  4NPB A;  1JB4 A;  5ELJ A;  2RGQ A;  1J2B A;  1M1K 4;  2H0I A;  1GMQ A;  1W01 A;  7GSP A;  1OGX A;  3PXM A;  4GHO A;  1YJW 3;  4CJN A;  1FGQ A;  1I2G A;  5EQL A;  1DMQ A;  1ULJ B;  1GY6 A;  1BOX A;  1LRA A;  2UX0 A;  1YIT 3;  4NRE A;  3Q3F A;  3KSP A;  1DE3 A;  1FGO A;  1FUT A;  2W03 A;  5IG3 A;  1BNI A;  2HMN B;  3VSY A;  2ZL8 A;  3MPH A;  4MMZ B;  1RNT A;  2WOF A;  1OF5 B;  1W02 A;  3DGN A;  3EJV A;  2W9Q A;  3ZG0 A;  3GZB A;  3LYG A;  4FMA A;  3B4P A;  3CCU 3;  1Q7Y 4;  3K9M C;  4K1V A;  3T0U A;  3CC4 3;  4EW5 A;  1SAR A;  1UUV B;  3BLZ A;  1NB3 I;  4L8O A;  3K7C A;  1NWW A;  3HZP A;  3G71 3;  1ZO2 A;  1IVV A;  1X1Y A;  9RNT A;  4JRF A;  3EF8 A;  2KXG A;  1JBT A;  1WMP A;  1ZS7 A;  2STD A;  1BSB A;  3B4O A;  2W56 B;  5LC7 A;  4LGQ A;  1EQK A;  2SAR A;  2WO0 A;  1I70 A;  4N6V 0;  2OWP A;  1RN1 A;  1UGI A;  4U13 A;  3LOY A;  1I3F A;  1PY3 A;  1I3I A;  1V57 A;  2FNQ A;  2KRT A;  3K0Z A;  2A15 A;  1YHQ 3;  1N9E A;  3F7X A;  5CK6 A;  5BU4 A;  1RTU A;  2CWV A;  4BTY A;  1M9G A;  1FA3 A;  1X1U A;  1OHP A;  4BL2 A;  1JN5 A;  1A2P A;  1QAF A;  1LQG C;  2CHC A;  3NV0 B;  5EVH A;  3EBT A;  5BIR A;  1VQL 3;  1RN4 A;  1N9J A;  1TUH A;  1RRL A;  1W5Z A;  4HM1 B;  3HI7 A;  4KT3 B;  3N8B A;  2L1S A;  3F40 A;  2CFL A;  1BAN A;  1GOY A;  4EXR A;  3G8Z A;  4XBY A;  1L5G B;  1G96 A;  4HM5 B;  3CD6 3;  2KF5 A;  3FCS B;  4FCM A;  3SXX A;  1AR0 A;  1GMR A;  5AEU B;  1OCV A;  1TRQ A;  3CCM 3;  3S67 A;  4WYK B;  1MOL A;  1GYB A;  3Q90 A;  4HM8 B;  5ELU A;  3UB1 A;  3CCS 3;  3NM2 A;  1OHS A;  2C10 A;  3NX0 A;  1UGH I;  1V58 A;  4J8T A;  2JDI H;  3X3Z A;  1BNR A;  7STD A;  4N6M A;  3SYU A;  4QWT A;  2E2T A;  4I5Q A;  1Q9E A;  2OCT A;  2P0M A;  3I56 3;  1AVL A;  2XF3 A;  3X41 A;  3FZW A;  4HM4 B;  1X1W A;  3KSE D;  4RZM A;  1Q40 B;  2P0X A;  3MWZ A;  3O8Y A;  4LSO A;  3MG1 A;  3UL6 A;  3X3X A;  2K54 A;  4KFD A;  3STD A;  3CME 3;  3EC9 A;  4DKI A;  1LOX A;  2GBX B;  3F9S A;  3KZT A;  1DVD A;  3JUN A;  3KKG A;  1VQP 3;  1Q7H A;  2F98 A;  3LXU X;  3H3H A;  2XSO B;  4O2H A;  2BU4 A;  4HZB B;  4RBN A;  1BAO A;  1GSP A;  1D6U A;  2PZV A;  4EV2 A;  2E2U A;  1BUJ A;  3BNB A;  3EN8 A;  1HKX A;  5TGN A;  3EQQ B;  4KFE A;  5JBS A;  4EBG A;  1QMA A;  1BRI A;  2LQV A;  3G0K A;  3IMA B;  1RCK A;  1STF I;  4WHA A;  1JBS A;  1E3R A;  2OQE C;  3CMA 3;  4WP5 A;  1BNE A;  1CH0 A;  1NNV A;  3EE1 A;  3DY5 A;  5JPP A;  1G0T A;  1TRP A;  2BHM A;  2D1W A;  1FUW A;  4L8P A;  1N8Q A;  3FH1 A;  3ECF A;  3CCV 3;  3PCR A;  2CWU A;  4OVM A;  2IY2 A;  4LMI A;  3BND A;  2Z77 A;  3RDE A;  4PEJ A;  3CC7 3;  3OXA A;  3F7S A;  3V99 A;  3DGM A;  2QEX 3;  1R4C A;  3BIR A;  4R9L A;  2ZDJ A;  1IT7 A;  2WGO A;  3AGO A;  1JV2 B;  3WHO A;  1IT8 A;  1RN7 A;  2CFD A;  4RNT A;  2HMJ B;  1X1X A;  2CK3 H;  1VQ5 3;  1E3V A;  1RJO A;  1YNV X;  1I0X A;  1ZGX A;  1VQO 3;  1UCL A;  3NQY A;  5IG0 A;  3WA3 A;  2CIU A;  1WTH A;  5BXQ A;  1W6G A;  1LNH A;  2HML B;  4FCJ A;  3GSP A;  1B27 A;  3B8L A;  4N6U A;  1Q42 A;  4H61 A;  5KP4 A;  1YGE A;  3EN1 B;  3QK9 A;  4O3V A;  1IQX A;  2YFL B;  4R4K A;  3S29 A;  3ZG5 A;  4CDL A;  3AHS A;  1FZU A;  4G1M B;  1UCJ A;  2P09 A;  3GZX B;  1BNJ A;  1O7H B;  1W6C A;  2MC8 A;  3T8U A;  4ILF A;  3AMO A;  1G02 A;  3CCJ 3;  1Z1S A;  1UUW B;  3K63 A;  3VF1 A;  4BU4 A;  1K41 A;  2P38 A;  1O7N B;  2I9W A;  3N9H A;  4LEH A;  5STD A;  1JJ2 2;  2LYX A;  4FR9 A;  1B2M A;  3AHW A;  3X42 A;  3FLJ A;  6RNT A;  4R1K A;  1QAL A;  1O7M B;  1JRQ A;  1TTO A;  2F99 A;  2ML6 A;  1I8V A;  5AIG A;  8CHO A;  3CCE 3;  3G16 A;  1JKG A;  3U97 A;  2KCD A;  1C54 A;  3WMD A;  4CPK A;  1TP6 A;  3OWY A;  1PFP A;  1BRK A;  1B3S A;  1MNL A;  5HOH A;  3PZW A;  3JUO A;  3X3Y A;  1CYV A;  1US1 A;  4J5G A;  1JB5 A;  1CEW I;  1LQM B;  1STD A;  2W04 A;  3LML A;  2IYJ A;  3F8H A;  3JUM A;  1RNB A;  4XBT A;  4MMX B;  1JN5 B;  1BSE A;  1KWI A;  1BIR A;  1RSN A;  2W2C A;  2BIR A;  2HMK B;  4FMC A;  1AVK A;  3DGL A;  3UL5 A;  1KSI A;  2B1X B;  4AKY A;  3GAX A;  3GWR A;  5IEO A;  3I55 3;  3CNM A;  1K73 4;  4J9A A;  1B2Z A;  3CCL 3;  2GEY A;  1LOV A;  1Q86 4;  3OX9 A;  1NU3 A;  4FCZ A;  1QAK A;  1QJG A;  5IEN A;  1VQN 3;  1BGS A;  1BUQ A;  2FXT A;  3JUP A;  1BSA A;  1SJW A;  1VQQ A;  2GEX A;  4HYZ A;  1SQW A;  1YIJ 3;  3ER7 A;  1OGZ A;  4FMD A;  3DXO A;  7RNT A;  1JZD A;  1O7G B;  5EEO A;  4R9K A;  5M1A A;  1W00 A;  4JF8 A;  5AII A;  3BNE A;  1JBR A;  3PGB A;  1GMP A;  1KC8 4;  3RNT A;  4MMY B;  1RGL A;  4IIA A;  4MEI A;  4XDV A;  1EEJ A;  3HIG A;  4WWU C;  3V98 A;  3D4A A;  2OTL 3;  1IQY A;  1W7C A;  1I2E A;  1BRH A;  1B2S A;  4O8S A;  5GSP A;  1GS3 A;  3BNC A;  1F8N A;  2D42 A;  1GOV A;  3S28 A;  1ULI B;  4XB5 A;  2RCD A;  4GB5 A;  3GZY B;  4L7K A;  1WMN A;  4K90 B;  5G2G A;  2OTJ 3;  2SBL A;  2WOH A;  3NBB A;  1ASK A;  1D6Z A;  3MKI A;  2WGQ A;  2JQ5 A;  1MWT A;  1TIJ A;  3DM8 A;  3FG1 A;  4N6L A;  1BNG A;  1LVN A;  1BSD A;  3FGY A;  1AQZ A;  3V92 A;  4HM2 B;  2Z76 A;  1Y4K A;  4XDW A;  2RBI A;  4IPB A;  3URP A;  1EG9 B;  1TFO A;  4K61 A;  4MJD A;  5RNT A;  2V1L A;  4N3V A;  4ZM8 A;  3AGN A;  3MHE A;  2CX0 A;  2GSP A;  2RSX A;  3G4S 3;  5AYR B;  1W2B 2;  1IK3 A;  1UW1 A;  1MGR A;  1PYL A;  1YVB I;  1SPU A;  2ZHX B;  4LZI A;  1BVI A;  2BMO B;  2AAD A;  3SX1 A;  4RNY A;  1Q81 4;  1OHO A;  1YGW A;  3KFQ C;  3EB8 A;  1W2Z A;  1AY7 A;  5CLK A;  2XRX B;  3S27 A;  3J7Y d;  2BNG A;  2OQE A;  4H3U A;  3KCH A;  2IUK A;  1K9M 4;  1KQS 2;  2W6J H;  4XM4 A;  2INX A;  2CFK A;  5A0O B;  1T2I A;  2CFW A;  1BRG A;  4NHF A;  5AYS C;  4HOH A;  3LTB A;  1VQ9 3;  3D3L A;  3EHC A;  1VQ7 3;  3QRD A;  2OOV C;  2CG1 A;  1IU7 A;  2YX9 A;  3D9R A;  1GY7 A;  2YFJ B;  4KVH A;  1BU4 A;  1GY5 A;  1MWS A;  2F86 B;  1RHL A;  1Q40 A;  2Y74 A;  1PU4 A;  3NBR A;  3WDG B;  2GU1 A;  4BL3 A;  1SII A;  3MYT A;  2QIY A;  1VQM 3;  1V74 A;  1LOW A;  3FF2 A;  1TJD A;  1TU5 A;  1A2V A;  1AV4 A;  2BMQ B;  2ML5 A;  3OWU A;  2M7O A;  1B2X A;  3BU4 A;  4N6N B;  4HJL B;  2F56 A;  3AMO B;  3WOF B;  2QA4 3;  1IYY A;  1RGA A;  1RGH A;  2F4Y A;  4EV5 A;  2P05 A;  1JB2 A;  1OH0 A;  5AI1 A;  5M19 A;  1FGT A;  1DVC A;  5DRE A;  3NM7 A;  4HZ9 B;  4KZ1 A;  1WMO A;  1IDP A;  1WQL B;  3KE7 A;  4X2O A;  5M18 A;  3JUQ A;  4AKZ A;  1RCL A;  1LOY A;  1U8C B;  3JVC A; 
#chains in the Genus database with same CATH homology
 1I2F A;  3HOH A;  1RGF A;  1BSE A;  1BIR A;  1RSN A;  1B20 A;  1GMR A;  1TRQ A;  2BIR A;  2KAA A;  1BRS A;  1GOU A;  1BNR A;  2KF3 A;  1HYF A;  3SYU A;  1Q9E A;  1B2Z A;  3D5G A;  1LOV A;  2ZA4 A;  1X1W A;  1BGS A;  1BSA A;  1UCI A;  1R4Y A;  4GSP A;  2F5M A;  7RNT A;  1B2U A;  1BNS A;  6GSP A;  1JBR A;  1GMP A;  2HOH A;  3RNT A;  1RGL A;  2BU4 A;  1FUS A;  1BAO A;  1GSP A;  1YVS A;  1RGK A;  2KF4 A;  4J5K A;  1BUJ A;  1T2H A;  2F5W A;  3D4A A;  2AAE A;  1I2E A;  2C4B A;  1BRH A;  1B2S A;  5GSP A;  1GMQ A;  7GSP A;  1BRI A;  1GOV A;  4GHO A;  1RCK A;  1JBS A;  4BIR A;  1I2G A;  1RGC A;  1BNE A;  1CH0 A;  1BOX A;  1I0V A;  1LRA A;  1RMS A;  3Q3F A;  1TRP A;  1DE3 A;  1FUT A;  1BNG A;  1BSD A;  1BRJ A;  1AQZ A;  3URP A;  2RBI A;  1BNI A;  5RNT A;  1BRN L;  3AGN A;  2GSP A;  1UCK A;  2KF6 A;  1RNT A;  3BIR A;  1MGR A;  1PYL A;  3AGO A;  1FW7 A;  1BSC A;  3WHO A;  1BVI A;  4RNT A;  2AAD A;  2RNT A;  1X1X A;  1BNF A;  1YNV X;  1YGW A;  1I0X A;  1ZGX A;  1UCL A;  1AY7 A;  1RGE A;  8RNT A;  3DH2 A;  3KCH A;  1SAR A;  3GSP A;  1B27 A;  1HZ1 A;  1T2I A;  1BRG A;  1B21 A;  4HOH A;  1X1Y A;  3WR2 A;  9RNT A;  3AHS A;  1FZU A;  1UCJ A;  1JBT A;  1BNJ A;  1RLS A;  1BSB A;  1G02 A;  1BU4 A;  1RHL A;  2SAR A;  1I70 A;  4BU4 A;  1RN1 A;  1RGG A;  1B2M A;  1I3F A;  1PY3 A;  3AHW A;  1I3I A;  6RNT A;  1LOW A;  1TTO A;  3A5E A;  5BU4 A;  1RTU A;  1I8V A;  1B2X A;  3BU4 A;  2F56 A;  1X1U A;  1A2P A;  1FYS A;  5BIR A;  1IYY A;  1RGA A;  1MGW A;  1RGH A;  1RN4 A;  2F4Y A;  1C54 A;  1BRK A;  1B3S A;  3DGY A;  1DET A;  1LNI A;  5HOH A;  3D5I A;  4J5G A;  1RDS A;  1BAN A;  1GOY A;  1RNB A;  1RCL A;  1LOY A;  4HAA A;  2KF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...