2F65A

Solution structure of hppk in complex with inhibitor analog ampcpp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of HPPK in complex with inhibitor analog AMPCPP
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
total genus 18
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2005-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 2f65A00
1TMMA 1HKAA 4M5NA 5ETOA 3UD5A 4CYUB 3MCMA 5ETPA 3ILOA 4M5GA 3HD2A 1RU2A 3HT0A 3ILJA 3MCNA 4M5HA 1EX8A 1Q0NA 4M5IA 5ETTA 5ETKA 1CBKA 3HSZA 4M5JA 5ETSA 5ETQA 1DY3A 3ILLA 1EQ0A 1RU1A 3HD1A 4M5KA 4PZVA 2BMBA 3HCXA 4CRJA 4CYUA 1RB0A 5ETRA 1IM6A 3UDEA 4F7VA 1RAOA 5ETMA 2F63A 3KUHA 3HSJA 3IP0A 3ILIA 3HSDA 1KBRA 2F65A 3KUEA 4M5MA 5ETLA 3UDVA 2CG8A 3HSGA 5ETVA 4CWBA 1RTZA 2QX0A 1G4CA 1HQ2A 5ETNA 3MCOA 1F9HA 1TMJA 4AD6A 3QBCA 1EQMA 3KUGA 4M5LA
chains in the Genus database with same CATH superfamily
1VHFA 1RTJB 2FZGB 1PKUA 2WSCC 1HNIB 2YBVA 3FEYB 4IDKB 4W4MA 4Y3CA 4OHXA 4YS2A 3BJYA 1RYSA 2VQFF 2N3OA 1Q95G 2P5VA 5HQ8A 4Y2KA 4B9VA 2NXNA 1CEZA 2XM3A 3LAMA 5H1SV 1J5OB 3A1YG 2XS7A 2QA4G 5BR8J 3TNVA 4QCLA 1KOOA 2CJAA 2FGCA 1UWAA 3VAGA 3RBEA 1O6XA 1YJUA 4LMZA 2R9LA 4CLUA 4CQ1A 4RUAA 1VK3A 5C5JA 3M9NB 3Q8SB 1I6JA 1OQ6A 4ZJOA 2GQQA 4QJVA 4DLEA 2IBOA 1R6YA 2UUTA 3M2RB 2R7VA 2O66A 3CDBA 2YKNA 4KGXB 3PR4A 3GJSB 3IWLA 1CG2A 3CDEA 1XNRJ 1NSQA 4RNFA 2V2ZA 2PEBA 1XR7A 2V8PA 2CQ4A 2E1CA 4RNHA 3NKYA 1X8DA 3BN7A 2M0GB 2K06A 4NRTA 1RWMB 5IZHA 2CRLA 2Q79A 2MY8A 1GXTA 1MG7A 2CIMA 3QFHA 5D15A 1BGXT 1PYSB 2ZBCA 4ZPDA 2G13A 1KD1T 4YB1P 3K5PA 2BMBA 4ZPBA 2IFXA 3LP0B 3O44A 2Z4PA 3S8SA 1UPPA 4PRFA 3OXGA 4YR2A 2DHGA 1NKEA 5T41A 1FTCA 1WHVA 2HWIA 3MM7A 3W2WA 1SI9A 2Z2LA 1T3NA 2J0WA 3M32B 3FMWA 1RAAB 5HO4A 4QBUA 2WOMA 3BGUA 2M3DA 2LKZA 1S4FA 4CDIA 1Q81T 4A8KA 1X5TA 2HFVA 4ZVSB 3VAJA 2J0QD 3EGZA 4O4GB 5K5MA 4CRJA 3V81B 5L1JA 3U7JA 3KXDA 1B7FA 3QQCD 1P1TA 4C3MA 3MCMA 2CJ9A 2FQQB 2OKQA 2BJ1A 4DCJB 1SJFA 4FF4A 1VQYA 2ADBA 2EFGA 3GE9A 3DLKB 2NZ4A 2IYGA 3KK2A 4KHPJ 2DNKA 3LA0A 4ZP9A 1GTHA 1KFDA 4F67A 4PQUA 5CYMB 5FLXY 2B8QA 4QU6A 2A18A 4X4RA 1JWWA 5F9NA 1RHJB 2HQ3A 1VQ5S 2JC1A 1WHWA 1ZAWA 1KONA 2RVJA 1Y00A 1S1VA 3DMJB 3HMJG 3CCZA 5KFOA 2B3TB 1BUXA 2DCUB 5GVQA 2JLGA 4NCGB 3C6TA 1S0VA 1YITS 4JV5J 2IC3B 2K8GA 4ZVQB 4U95A 1IBMJ 4GVBA 4ZP8A 4OZNA 4TKTA 2DXEA 3DU6A 2PMZD 1SJ3P 4ECSA 3IWXA 2AX0A 2R7UA 2JJ4D 3M30A 3MFIA 1HNVB 2KRRA 4RLEA 4ZVFA 1YG0A 4DF4A 2FZKB 1DTQA 3I96A 1KTVA 4HH0A 4KIAA 4ZA1A 2ASJA 2OGUA 3QT7A 3TQEA 3M8QA 5GMKa 3F56A 2OELA 1Q0NA 2UVVA 4OZ3A 3FSXA 4F2SA 3PIOQ 1IJFB 4OYOA 1B0VA 3BPSP 4DQIA 1X4EA 3VVUA 4L74A 3TOQA 2HHHF 2CZVC 3LGHA 1X9SA 4JI1F 2ZOGA 3NG8A 4H4OB 1FK9A 1D09B 4N5SA 1IJEB 3DOMB 2XI3A 3CC7S 4LF8F 3TVYA 3FUYA 4ZLNA 4FS1A 2FD2A 3HI9A 3M6UA 5AJ3F 4XPCA 3NGDA 4DUZF 1RKIA 5ETNA 1HQUB 6FD1A 2JVRA 4FNIA 3RW7A 1QUVA 1NXIA 1UMJA 1IWGA 2MTLA 2MZTA 5D4NA 1S9EB 2YNGA 5D4PA 4X4SA 4OZ2A 3OL6A 3QWPA 1T05B 4UY85 2GZOA 2F9JA 1XNQJ 5KT7A 3G2XA 2RRAA 5K8PA 1K47A 1RTHA 2PD1A 2PIIA 2G2OA 3SMZA 3UCZP 4O3OA 4BBYA 4DQQA 3ITHA 4WBFA 2ILYA 3G87A 4O0NA 3R7SB 3ZZTA 2BQUA 3BV8A 2XYHB 2VASA 3MMAB 4LF6J 3HK2A 3RRKA 3OXFA 3AD9C 1TKZB 1CJTB 2VHGA 1RDRA 3N5FA 3D4JA 2FHJA 3HSDA 3KUEA 2CXEA 1H7WA 2J5AA 4LF9F 1G4CA 4OI2A 4X4VA 1RXOB 1M5HA 2Y1JA 2D9PA 3M30B 3R1HA 1K8AT 3PW4A 4Q5VA 4OX9F 2CJKA 4QQBA 3TVZA 2CQHA 3MURP 1GMWD 5LXRA 4Y2IA 4IG3B 5A8KB 4R8UB 4PWWA 1AZSB 2DHSA 1KQFB 5KFFA 4HACA 4ECYA 1S1VB 2HRTA 3DMJA 4DFMA 4DFJA 2GGPB 3GJQB 4H4KC 3E2EA 2AZ3A 5DDQC 3WBZA 4TU7A 2GMHA 3KLIA 1O0PA 4G1PA 3TEGA 1W25A 2RRBA 1DBDA 4FP9A 1D8ZA 4NLXA 1F2GA 4DR7F 1RGVA 5KT4A 2BBEA 2VKRA 3DOLA 4C4WA 2HSEB 5E41A 1FDAA 4UTGA 3LW5C 3W60A 4RW8B 1T02A 3DLKA 4M5MA 5DM6Q 3WC0A 3TW0A 2DGXA 2B7CB 2NS1B 2CNNB 3C15A 4U96A 3WHIA 2WVEA 4UOGA 5F8LA 1JNRB 3OL7A 2CQ1A 3NS7B 3V6KA 1U25A 2VOPA 1U0SA 4NEYA 3C16B 3ETOA 3L3CA 2Z2MA 3MM5A 4YUDA 2HK2A 1Y3KA 4KE5A 4M5NA 4EO6A 4DG1B 4DX5A 1SIWB 2M8HA 3BQ1A 1IKVB 3EGVA 3MMJA 3EGNA 4P7VA 5A2QU 4IRDA 3DU5A 1FDDA 1JLGA 2RF2B 2CPFA 1AYEA 3IG1B 4Y2CA 4CO3A 5I42B 5T14A 1R8AA 2RILA 4ALZA 2P9EA 1OJ4A 3RYLA 1FFSB 4WCEQ 3UR0A 2HBQB 2OPSB 3GSDA 2DNRA 4ZP6A 1TQLA 4P73A 4ANCA 2AW0A 1X0PA 4ZPVR 4X62J 2WSFC 1MMDA 4RNNA 2UXCJ 3VAHA 3RRGA 2BANA 5KG1A 3MEEB 3HSJA 4ELTA 2E5IA 1VC5A 4K4VA 2KO1A 3Q8QB 1RT1B 3ZC4A 2B4OA 5DG8A 1S57A 4LR7A 4OJ3A 4USJC 1FDBA 2EFPA 3KDOA 2XC9A 3T1YJ 2ASLA 1N36J 1Q8KA 2GIFA 2HPUA 4P6QA 1VQMS 4M94A 1IBMF 3CJRA 2B6AA 4DOZA 4OYBA 3CGIA 2E44A 4NEZA 4ED6A 3UQSA 1TFWA 1RCXB 3CF5Q 3PVXA 3GJTB 3KHRA 3IAS9 1U8SA 2BRKA 4J7CA 1U26A 3BSAA 3MWBA 3QGIA 4NWBA 3BKFA 3FKBA 1IXKA 3ILJA 4RW7A 1VR6A 4RPFA 1UEVA 2Z30B 3IG1A 4YDDB 3T1HF 3P49B 5A8WB 1C1CA 1H72C 3IMQJ 3QNWB 5LMNJ 1TTHB 4A8FA 4B3RF 3QAEA 2QA4S 1JNZB 2LXIA 1IUJA 2QLJB 3K5OA 3QO9B 1RAOA 1TUVA 2JL9A 2AT1B 1NZAA 2HAFA 4F25A 5SZTA 3EXCX 2I5JB 2HFZA 3KHLA 4DUYJ 2ZH2A 5ETLA 3C15B 4PG6A 1Q5VA 4ZVGA 1GX6A 3M7VA 1HBUB 5D0GA 2DR9A 2KFNA 1RAHB 1WD6A 4FF3A 1CPZA 2M8DB 1OMSA 3QATA 1X5SA 2BJ8A 1RZMA 2C1EB 2QMWA 4RBUA 4MTPA 1RT3A 1G6BA 2WONB 4NYZA 3V6JA 3T1AA 2ZH5A 2W2MP 4K4TA 2IRUA 2FJEB 4PR6A 2XQCA 1X5OA 4FBUA 3G9CA 2ZH1A 4DQPA 4DV4J 3K2YA 3G8TA 1C0UB 1HBMB 1TK0A 3QJLA 3I6PA 1YQHA 1QSYA 1Q8BA 5DRKA 5B0BA 1HD0A 2MSTA 3UVJB 5GAGI 5E33A 2QA1A 4USWA 2DRDA 1XC9A 5LJ5Y 4EK2A 4LF6F 4UZCA 1IKWA 5F8IA 1QJHA 1KQSR 1UVIA 2R8GA 2U1AA 1FI4A 4ZITA 2XCPA 2I2YA 3NMAA 2KG0A 2OSRA 3OLAA 1V5IB 4IR9A 3H98A 2G0CA 4DPXA 3TAPA 1L3TA 4GO5X 3ZZUA 4LSLA 3RRHA 3VAKA 1IR2A 4K59A 3MTJA 3MMAA 2X1AA 1X7VA 4CYUB 3GIJA 4X4NA 1IKYA 1NHUA 4JV0A 4U6PA 2G9OA 1WEZA 1DRZA 2FVQA 2IY5B 4Z37A 3PEJA 2HNZA 2J0SD 4DEZA 3JSBA 2VFVA 1VRUA 2HMIA 2QYCA 1U02A 1ZTWA 3KHHA 3BSCA 2F40A 3MEKA 1TKDA 2V4JB 4M63A 2AYGA 1K0VA 4IOAQ 1S9EA 2B43A 2YNGB 2VZ9A 1CLFA 2JFKA 4M1KA 2HBYB 3RUBL 2BXJA 1QTNB 3MI7X 1RHUB 1QSSA 4N41A 1C0TA 1S76D 4KRWA 2XLIA 2CQ3A 1H2TZ 3OXLA 2DHHA 3EPIA 5GAGU 3DKDA 3R5GA 4ITSA 4UZBA 1UCNA 2V4RA 2P8IA 1RT2A 4KB7A 2UXDJ 2CDQA 4Z2XA 2UU9F 3EE3A 2V8GA 1Y4ZB 3LGMA 4NA2A 3KMQA 1M90T 1ACMB 1AW0A 1KVKA 1FEHA 2Z2ZA 5DGAA 2J7UA 3R2DJ 1VLYA 3CEDA 4KFBB 3R9LA 2KXNB 2W7AA 2Z0GA 4JI6J 3GILA 5KOXA 5L1KA 3HKZD 3M9OB 2WVDA 2FJXA 3HVRA 5HQMA 2WW8A 1VJWA 1A7GE 4LRFA 4B9TA 3FFIA 4LJMA 3MDFA 5M2UA 2YPYA 1DY3A 4EZ9A 2FHOB 3KNGA 4LRCA 1UVLA 3BS9A 2ZZTA 3HHLA 1RHMB 4Q44A 5D3GA 1PC5A 3HO1A 4WKYA 2MKCA 4C2MA 3CD7A 3EYZA 1S0OA 4FYYB 5CYQA 1S99A 5DDPC 3J81U 3BKUA 4PWUA 4B02A 2CNKB 1BHNA 2ZJPQ 2VONA 2YWWA 2PI4A 1NZ8A 3AT1B 4JI0J 2ZJRQ 2XYPB 1S6PB 2F8HA 3DDNA 3MAHA 2RDIA 4F4AA 3GIKA 3KWMA 5IM0A 1S12A 2IMOA 3ICLA 1FNOA 4DV5J 2ZFHA 3DYAB 4ZPTR 1WC1A 3IS9A 4USVA 5KT6A 1L3VA 4C11B 1JLAA 3O2IA 1MU2A 1NDCA 4TNOA 1L5UA 3RW6A 4NLWA 2EWHA 4KYZA 3LPYA 2KJVA 4DSEA 2CWXA 2AGQA 4NL5A 1NB7A 2YWEA 2BZ2A 4O44A 1OYDA 2EVZA 2BE9B 3AODA 4HKQA 2KI2A 4ZCIA 2Q1LA 4C11A 5LMUJ 4PAAA 1HNZJ 2E66A 4TXSA 2GIQA 5DLGA 2A2CA 3K57A 1XMOF 1KSPA 5KFKA 2UUBF 2RU9A 2V67A 4YR3A 2B8PA 4IOCQ 2GA7A 1XR6A 2SXLA 3NWRA 5KG0A 4OHYA 1NEEA 2XULA 3MAQA 2B56A 4NYPA 2H54B 1BQMB 2NSCA 1N33J 1A0OB 2JRSA 1YJWS 4PXBA 4YY3J 1K73T 5HMZA 4CT8A 2ACMA 1BY9A 1F1BB 1RBAA 3T6JA 3M05A 1VOMA 4KAIA 1CQNA 1J5EF 2R2TA 1RT5A 4KGZB 4WU3A 1TVRA 5IFMA 3O3LA 4JV2A 3P8BB 2HQDA 3CCJS 1NSPA 1TAQA 4JYAF 1N5SA 1RK8A 4Y28C 1SQFA 4MYTA 4OFZA 2ZM6F 2C42A 2C3UA 2E1AA 3I82A 4NA1A 3VQSA 4LF5F 4R8UA 5CYQB 4WZMA 3V6DB 1PYOB 2IJNA 2LYVA 3K8VA 4OLOA 2W9CB 3K59A 5KFTA 3Q23A 4H54A 3PO4A 1YK9A 2YQ1A 5D8HB 4XPEA 3LF0A 3RJMB 4ECTA 1RCOB 4USKA 3A8IA 1P8GA 5DG9A 3LAKA 4NLTA 3JQKA 4GC7A 2RUSA 4CO5A 1HLWA 2AX1A 3T5HA 2ZC4A 3GFXA 3W64A 1CJTA 3S1TA 4AQYF 2Q3PA 4HHHA 3B82A 2JNJA 2CVEA 2L48A 2XHCA 4QIGA 2UXBF 1F5BA 1P9QC 2E9TA 3ZTOA 2W9BA 3CE8A 2VJVA 1KQKA 1KEKA 3OTDA 2RAQA 4LVOP 1UFKA 1WOOA 3CJ4A 3I5CA 3IR6B 1OS5A 1X31C 2R42A 2YX4A 4KPYA 1ZM3A 1I51B 4CLSA 4IRCA 1CJKB 5IS2A 2V8DA 3KJNB 4FXWA 4DLGA 4DWIA 2BR0A 4JI2J 2OPQA 4DCPB 4F4ZA 1GXUA 2L08A 1VGYA 5AJ3J 3A12A 1TKTB 3AAWB 4C0BA 4EEYA 1NK5A 3B8HA 2W8KA 3R5BA 2CDRB 3SEOA 4QIVA 2YKOA 3THTA 4DPUA 2OSQA 3R7BB 2VUGA 2DNYA 3CCUS 1S10A 4MKYA 4PUOA 2MQQA 1Z2ZA 4CNZA 3BEGB 3PFEA 1D1UA 3M6VA 1KC8T 4ELUA 1UVMA 1TAUA 4CLKA 1U49A 3CSKA 3DN9A 4LSLB 2L3MA 4KHMA 4N8OA 3CJ5A 4O3RA 1B3TA 2YKQA 3R2CJ 2W1BA 1ZETA 4FF2A 1RWOB 2O01C 3CTRA 4ZVOB 2A6MA 4HHUA 3BO2A 3QRPA 1T3OA 3T41A 1DJ0A 4S0MA 4LQ9A 2C2MB 2A1BA 4A48A 4B3TJ 3D5MA 1IBKJ 4JV1A 3P6YC 3J7Z5 2WBRA 3FJ2A 5K14A 4AD6A 5RUBA 3OJSA 2VIHA 3RB4A 2G1DA 2MHNA 1FX4A 1UJ5A 3ENQA 2OD6A 2XYGB 4AYBD 4DZ6A 4HYKA 4K0KF 1HWJA 1HMVB 1HNXF 3N9UC 3PRVA 1WDTA 4L72B 3OTOJ 1H2UX 2ALZA 4OYAA 1WTBA 3LGNA 2MLXA 4Y00A 1S9GB 1EQ0A 4M5DA 4LF2A 1C1BB 2HWHA 1SVDA 4BHQA 5K8NA 4F0MA 1ZZFA 1BQMA 3A8JA 3HFZB 5KG4A 4BLGA 2QLXA 3H0PA 4RJVA 1Q82T 3NWGA 4C7QA 2ZD1B 1U45A 7FDRA 2NSBA 1S6QA 5DQGA 3EGWB 2VDIA 5HJXA 1U6ZA 5DLFA 4K5SA 4IQXA 2PGCA 4NRUA 1JJCB 2WHOA 3HVWA 2B6AB 1Q5YA 2DGVA 4JBCA 3QT5A 4F0HA 2Q6CA 1Y11A 2V2KA 2XZWA 4DV7J 2GQ2A 2HIYA 1S1XA 1D0EA 1VLOA 2R7QA 4UUWA 4OHWA 4PEOA 1TUGB 2MMYA 1BWEA 2W01A 1OY6A 5EX3A 2VDHA 1WOSA 3H4DA 2RKIB 1EP4A 1FD8A 3BN4A 2D69A 2EI5A 2B9YA 1FRHA 4EBEA 4IUFA 4OZ0A 3SCJE 3M8SA 5IM0B 2MQMA 3HF5A 4USTA 1ZM2A 2LDIA 4V1Ak 4DPTA 5F8GA 2EEYA 3J81j 2YKPA 2VB6A 3ILIA 2HFSA 3MM8A 8RUCA 2BEFA 3M2UA 4URGA 5HVHA 3HPOA 2AYBA 2LDYA 4GC6A 1QSLA 2VD3A 1ROFA 2YKNB 2CPYA 3KLHB 5H9EJ 4TLRA 1N36F 2DBBA 2DK2A 1NK9A 1SJRA 5CHCB 3OUYA 4QWCA 1PG5B 2FJDB 2AV5A 2YY3A 3L95X 5F8HA 1ITPA 2V50A 4F4YA 3TJAA 4DL7A 5KFQA 1FJ7A 2LEPA 1GH8A 1RU2A 2CUYA 3J7ZT 3VGVA 2OIHA 2LQ8A 1LW0B 3MAAA 4RKUC 1RI7A 1S9GA 3OBIA 1SPBP 4LF1A 2VC0A 3C16A 3V4IA 5F0UA 4NPOA 4N77A 4CM2A 3RGIA 1I1GA 4D3GA 4NX9A 1WTFA 3Q86A 5JJBA 1GT8A 1B0TA 4RW8A 3PRBA 1YX2A 1LKZA 2HVDA 4DDFA 1HYSA 2PMWA 3AA9A 4ZN1A 2Y8YA 2Y1RI 2UUWA 1EETB 2QYGA 1PC4A 2DVIA 3KLIB 8ATCB 3NNAA 4LBPA 2E5LJ 2QLWA 4TYBA 1H74A 2JVOA 2QIFA 3ZO7A 2DNOA 1NO8A 2C3MA 3DGVA 3LANA 5GMDA 3QJJA 3PJXA 1T03B 5IT9Y 4OJHA 4ZKAA 2KZMA 1AZSA 3J80Y 3GJRB 4UQTA 3RZAA 3W9HA 3KJQB 4IG0B 5A8RA 1U48A 4LF7F 3HSZA 2W24A 2XCAA 1YRXA 4N8NA 1NPRA 3RAXA 1KHVA 3ZZPA 1QAXA 2KT5A 3C8YA 4ZS6A 1IKYB 5IT4A 3V4MA 4CYUA 5D6GA 1N5YB 2FVPA 2VBXA 3QGPA 2CA9A 2HFUA 4ZOSA 3CUNA 4B9SA 3G71S 3U02A 1NKBA 4GRSA 2LQBA 4XDCA 4NMLA 1UPMB 2R8JA 4OYZA 3QSIA 3BZQA 3JTPA 4B3TF 3RAMA 3MD3A 3RTVA 3QLHB 2ZJQQ 2ROPA 4DV1F 1H0HB 1S6UA 2K3IA 4Q7AA 4HDHA 4DUTA 5CQGA 3QIDA 3D6TB 4K0KJ 2HGMA 3I0RB 2KVIA 2P6TA 3M8WA 1PIEA 3X3UA 3K5NA 2ZH6A 2MJUA 1B0PA 3AA8A 2W7OA 3ISNC 1HQUA 1SCJB 2X3GA 3HHLC 3PYGA 5B08A 1E6VA 1HNWJ 2M5YA 2XB2D 1SJ1A 1EKSA 5EWGA 3T3FA 1N6QB 3A13A 4ZHRB 2GFFA 2XNRA 2ZOFA 5KFLA 3ZZRA 3FQKA 1EARA 1M5PC 4YDXA 3KYLA 1OIAA 2BKPA 5LSOA 4F26A 2YWHA 5HSPA 2J9DA 1UVKA 2QMUB 3FRZA 1N34F 1X4HA 4F04B 2EW9A 3W66A 3M9MB 1SUQA 1SJ4P 2J7KA 2P9CA 2DIVA 4ZIVA 1N5TA 1WI8A 4FYVB 4K8RA 4R0JA 2R7TA 1LWCA 1WG5A 4QIWD 4KY3A 4C3LA 2IIHA 3ET6B 4DQSA 1XTZA 2LQ5A 3CDWA 1TVRB 4IYQA 3CC4S 4ZP7A 1JLFB 2KKHA 5LOQA 3VAMA 5B0GA 4DS5A 4W92B 4PQUB 3OT9A 5CD4A 4K4XA 1DAXA 1ZA1B 2F9DA 1R0AA 1JLBB 1MLAA 1S0NA 1HHTP 1WC4A 2OMOA 2WVCA 5JVHQ 4F4WA 4DFPA 2C2DA 5J1EA 3NMRA 3K58A 3KK3B 1TFYA 4EUVA 1ZAXA 1TV6A 1WC0A 1RT1A 1Q8IA 4EMDA 2BJDA 2DGTA 2ZE2B 3CJKA 1SB6A 2MKHA 2NPIA 2RDDA 1U47A 2KVQE 3AFGA 5LSLA 3PX0A 2D74B 3VHQA 1IQTA 1ZA2B 4DV3J 4DL2A 3FRYA 2CZ4A 3W63A 2V4QA 4I7FB 2DGWA 1E6YB 3VZIA 1PYTA 2ZDOA 3EDRB 4ZLJA 1VQOS 3RR8A 4UOHA 2DH8A 4NYOA 1FTRA 2B7BB 2BX6A 2DR6A 1RWUA 2ZE2A 1XWLA 4P2XA 2MKYA 1Y5IB 2QSWA 4WJBA 1U1QA 3K89A 4PQAA 3CVKA 3CD5A 2AD9A 1T9TA 4DPWA 4DV2J 3N6LA 3Q2SC 5DO2A 5L8RC 3AXKA 3BDPA 4RUCA 3OVSA 1TP7A 2AF6A 2Y0SD 3H5YA 3SFGA 3CJKB 1R0AB 4LFAF 1VIOA 4DR6J 1GMVA 3UW1A 4ZLPA 2LECA 2W2OP 4X4OA 1RWWB 2ACYA 2IDEA 2OPPA 1QAYA 2C3OA 5HVFA 4F3QA 3MCNA 1LWCB 3UO0A 3TZYA 3KLGB 3AQPA 5CH7B 1LK5A 2GGPA 3QJPA 5KG6A 3MEDA 3U1MA 4F50A 4GKJJ 4IRKA 2AEFA 2MKJA 3AOAA 2HVZA 3W65A 3MXHP 1JLFA 3FK4A 4OZ1A 4WFZA 4EGLA 5JXSA 2W9AA 1HI1A 4USMA 2QFJA 5I3QA 1PO6A 3D2WA 4K4ZA 1Q79A 4O3QA 1QM9A 3I5BA 4HI2A 1S72S 2L9WA 5HI7A 1AA1B 3EZOA 2OAUA 3VV2B 3MM6A 1EAYC 2OEJA 4HEA9 3SSRA 5J2QB 2UUCF 2DIUA 2QN6B 2BOAA 1SV5A 3S6EA 3KLVA 1WUUA 2WVBA 3B6BA 5DS7A 4YQWA 4KHRA 5E5NA 1Z4UA 4QIFA 1H3DA 2PEHA 1VQPS 5MLCV 3AJDA 2YPZA 3PW7A 1NJWA 2E29A 4WFAQ 4LUBA 1FO1A 1TU0B 1VRUB 3MD1A 5A76A 3OL8A 3R27A 3JB9k 1WWHA 2HMIB 1LXNA 4MT1A 3SQOP 2VQEJ 3T5LA 4DF8A 3IBFB 3MMBB 1B7YB 5AXNA 5KG2A 2E1RA 1RAJA 4N76A 1V3ZA 2HWTA 5SUHA 3JSMB 1RT6A 4F8RA 1RT4A 3EVOA 4N47A 1LFWA 2CVIA 1WORA 3TAMB 3VWSA 2PO4A 1X4BA 3CCTA 1R43A 3QLHA 1HWKA 1Y0HA 1FFGB 1YBTA 4WTOB 5L1IA 1N5YA 2IVMA 3PTWA 2RNEA 2IM3A 2KJWA 2W2PP 3AB4B 3VGUA 4DSKA 2QMXA 1RWXB 1KDNA 2DH9A 3W5ZA 5B0EA 5A6PA 1NM2A 1Z2LA 4JP8A 3AXMA 3VAFA 2PA3A 5IQQA 1FWLA 2GO8A 2E5HA 2J9EA 1SKWA 5C24A 4BDPA 2RU3A 7AT1B 2MZ1A 1RACB 2C2EA 2D41A 1UJ4A 1S5ZA 5ETRA 5THWA 2ZWOA 1XQIA 5EGYA 4I6YA 2CZ9A 2HGLA 1U1KA 1KLMA 1LWEA 3CJQA 4FXVA 2R7XA 1UTAA 3R97A 3I9V9 1V3RA 2D3UA 1UA1A 2IBKA 1IQZA 3NL0A 2VV5A 3IRXA 2A6OA 1AXQA 2O5DA 2XMKA 2XBPA 3EWGA 4RW9A 4RNOA 1GK8A 3F73A 5KFIA 3I4HX 4DHVA 1HA1A 2JH3A 1JJHA 5IWAJ 1FF2A 2DGUA 2DNMA 4DV5F 1HIYA 5I3UB 3ELHA 1YWXA 2ZOMA 4HL9A 5E0OA 3Q2TC 2QFIA 2DY1A 2QTWA 3BDEA 3DI6B 4PPDA 5G0RB 3TRGA 4ATNA 3MR3A 1RBOB 5JVGQ 1HNXJ 4WK1A 1VRTB 3W9JA 3NGRA 2R2RA 3GONA 2HNYB 1DHMA 2DNHA 2ZH7A 1M5SA 1F5CA 3D0IE 5CAAA 1K9MT 1VQNS 4LT6A 3GCWP 1XIQA 2C3YA 3OFGA 3T9ZA 3D7SB 3H5UA 3ENWA 3ETMA 3FBFA 1HL6A 2BM0A 1FXRA 2CADA 4ZPAA 1XBWA 1NJIT 1K1QA 1FRJA 2YNHB 4TY8A 2K3KA 3SIPB 4NE9C 4XO0A 2CQ0A 2EG2A 4Z7YA 2UUBJ 2GMJA 2V8VA 2F4VF 2CQGA 3H59A 3KHGA 3TUZC 1TMJA 2ZBPA 3HHEA 4K2XA 3W5YA 3PW0A 3NS6A 2FHMA 2E9ZA 1LXJA 3NOGA 4LQ3A 2ZBRA 3MUMP 2BANB 1XR5A 5KAKA 2FC8A 3EZ5A 4JI7J 2HHVA 5GADI 3EDQB 4B9NA 4BC7A 4CO0A 4CTAB 3M8ZA 1KN6A 3M2UB 4AL5A 1K1SA 4KGVB 3OR2B 4Y2MA 3FSIA 2VQFJ 3LTOA 4DV0J 2ADCA 4E98A 5K9FA 1LWXA 4NXMF 1BC6A 3HULA 2HZVA 1MW7A 5MAOA 2FVCA 4DS4A 1J2VA 2IPOB 2Z58B 2CG4A 4DG1A 1BWVA 1FKPB 1TKXA 3T1YF 1AB8A 1JXVA 2HKEA 3ISND 5IOLA 4RUHA 4Q0BB 3DOKB 2QX0A 4FS2A 2EFQA 3GPAA 4PXCA 3CCWA 2QSFA 2D3OR 4IH7A 2ASDA 3PXGa 3RB6A 3NNCA 3HZEA 3LO3A 2RH3A 3R5CA 1SH2A 4B08A 2HIQA 3KNAA 1ZPWX 1N8RT 3GB0A 2MZQA 4H4KA 2J6SA 2WK4A 3DI6A 1S6QB 1SKSA 2UUAF 3AHPA 2DNZA 1FCAA 1FRLA 3G8SA 3H40A 2QL9B 2I9SA 2PC6A 2IA6A 3G6YA 5LMNF 4KV8A 3PX6A 3TEHB 4DSIA 1G2EA 2JSXA 4QWAA 3VGTA 1IKXA 3POTB 4HT7A 2DHXA 1KLMB 4JI3J 2GVDB 1MN9A 3GV5B 4LIRA 3FVYA 4U8YA 4OYXA 2X1BA 1OSCA 5LJ3Y 3IWNC 1EB0A 2CJYB 2M4MA 4K2JA 5C24B 2R3VA 4UW2A 2GC8A 1FE4A 2CPXA 4X65J 5AXLA 1LOUA 1NPPA 2CYYA 3BYRA 3O1LA 1RSCA 4GMKA 4MFBB 5CD4H 3OW2R 2FY1A 1T11A 1RWPB 3EM1A 3UD3P 4CLPA 2LU1A 1RTIA 2YX7A 5GMEA 1CULB 1UVJA 4DV4F 1UEUA 1KKHA 4J37A 1S1WB 1JQGA 4M5HA 4E2FB 1VQ6S 3CMQA 2JEIA 4PUOB 2PT0A 2UVUA 3M6WA 2PSZA 3UPFA 3ZXWA 3CJ0A 4KHPF 2R8KA 1UETA 2R8IA 4HR2A 2O67A 3M4XA 3FEXB 4HH1A 4ILMA 1AUSL 3QGHA 1C4CA 3L09A 4C0OC 1T05A 4B3OB 2QZ8A 3FEZA 3SCLE 2XO6A 3J7AN 2ZWPA 3OTEA 4KBIA 5KT2A 5C2CA 3A3OB 1FRIA 3ITHB 2MYFA 2VPWB 2K1RB 2W8LA 2N4DA 2D1CA 3G82A 1TL1A 4YN3B 1JLEB 2KU7A 4Y2AA 5KFBA 1NDLA 4HVZA 4ZN3A 1RTDB 5KFWA 4V19X 2Q66A 2E5GA 3DOMA 4CH7A 5FJ4A 3W8GA 1RT6B 3JSMA 1SKRA 1CJVB 1WF2A 4MH8A 2BUNA 2AEMA 4YHHF 1YBAA 1PJ5A 2EFNA 1U1PA 1ZH5A 1HHSA 5FDLA 3J7YU 3LP1A 3OHAA 1YLXA 2DYAA 4DL6A 2KFZA 2EFVA 4OV1A 4U8VA 5F8JA 3BQ2A 3K5LA 3MM6B 5J2QA 2DGQA 2JEJA 1AT1B 1LQ9A 3PHEA 2KDOA 4I6AA 4F7VA 3PKYA 1X60A 3H25A 1NJZA 4C8KA 4JI1J 3JSYA 1VQLS 3E8OA 1S1WA 3TR5A 3UWTA 4OHVA 1KBRA 3R5JB 1J27A 2F3JA 2XMMA 2ATCB 2CFXA 2E1MC 3TAQA 3CMES 1XMBA 2EBEA 2VPXB 1UP1A 5F41A 1RA7A 5L46A 3M2VB 2Y9HA 4ZJQA 2H5JB 4URQU 4JI6F 4C48A 4Z7CA 2YQ3A 4NASA 4DI6A 5G4DA 4ECZA 4Y0FA 1ZTTA 3E01B 1W2IA 1VBZA 2HNDA 4ID5B 3H20A 5HLFB 1U1NA 3MR2A 3QAUA 1T9XA 1RT5B 1KWMA 3D0HE 4CP5A 4I1TA 5IV4A 3SI8A 1FJGJ 4GVBB 3NOCA 2YVSA 1R89A 3NGTA 2E9RX 2GMLA 3D28A 4WIQA 2KM8B 2XWYA 3CIMA 3HHKA 4P7TA 3W8PA 1C2PA 2DXDA 5KFCA 1CVJA 1SH0A 1HQEA 3I5AA 4DR4J 2B0GA 4LRAA 2BV3A 3CT9A 3B4MA 5FLXU 3FQLA 4EWTA 1OWXA 4Q8FA 1UVNA 4QW8A 4DN9A 3KK2B 2A3JA 3MCOA 3QT8A 2NYIA 2HBZB 1G7CB 2OPRA 3H8YA 2YNIA 4NLUA 4O44B 4ZMMA 3GV8B 1WHYA 1YJNS 1N48A 2X1FA 4LR8A 2HLUA 2OI2A 4NXNJ 1YHQS 1U1MA 2O1PA 3DHWC 2D3O1 2Y3YA 1TKXB 3TA1A 1FKPA 2HRYA 2DISA 2WOMB 4RBVA 4ZPCA 2AGPA 1WG4A 4G1QA 2M7SA 2XMUA 2IHR1 3LALA 4UF4A 2OTJS 1VS3A 1CJUB 4R0EA 1NU4A 1M5OC 3MZIA 1HQEB 5KFHA 2YKAA 3N0VA 2IAJB 2YH0A 3NGKA 3WX8A 2XMJA 5KFEA 4C8LA 4LF4J 3KK3A 4OZLA 2G2ZA 2RS8A 4RU2A 1FWPA 1JLAB 3TYTA 2CG8A 2VA3A 1I94J 2BACA 4J9PA 4JI4F 4CLFA 3M2RA 2M2BA 1IWAA 3AD8C 4CLLA 4B9UA 2HHQA 1QE1B 2R2UA 1ZAVA 2CPJA 1O51A 4GKKF 4EBCA 2KM8C 1YVFA 4XAKA 4BC9A 5LT5A 1DQ8A 4CLWA 3KG4A 3OPKA 5J1EB 4B9LA 4DR6F 1N33F 1XK8A 2QE5A 2UZAA 1RA6A 2MJNA 5J1PA 1NK0A 1D9FA 1CBKA 2BKOA 2CNLB 2WB1D 4Q2MA 1IN0A 4J9QA 1J5EJ 4B9MA 4JYAJ 4MKBA 5ITHA 1TL7B 3HD1A 3SSSA 3FGVA 1RE1B 2H4YB 3ZZYA 4C8NA 2MGZA 5KFVA 3Q8RB 1D8YA 5C2GA 2BE7D 3BR9A 1FT8A 1HNIA 2FTRA 4IDKA 3MOZA 4MK9A 5DZ7A 2HBRB 5HMXA 1HBOA 3PACA 2BA9A 1Q4RA 1FERA 1N5QA 2EXUA 3BQ0A 1T9YA 1APSA 5KT5A 2JZ5A 4CLYA 2CQCA 1E6VB 4E0DA 3AB2B 3ZTPA 4DV1J 4BS2A 3MGJA 2UUCJ 5IQ6A 2ATLA 1RTJA 3AY0A 2V34A 2WTFA 2KTQA 4AUKA 4ED5A 1SL2A 3CDUA 3QSYB 1YJVA 1LWEB 3LP1B 2EC2A 3IM8A 3ZTRA 4AL7A 2IMWP 2C2KB 3MM9A 4U67Q 3T1HJ 2XS5A 3AOBA 4AFFA 4IOBA 2IJFA 5E3PA 1WNEA 5KFXA 1RTDA 2R7SA 5AE1A 4JI5F 4ECUA 2MB0B 4CLTA 2MQLA 1FA0A 3GFHA 4CH0S 4MKVA 4NA3A 4ETZA 1U4BA 4ERDA 4A4JA 2RS2A 3NLCA 2GNKA 4I2QB 1WG1A 3D68A 1HPZB 3AD7C 4JI2F 3WX4A 1YZ6A 1R8PA 4I2QA 5EDWA 1F3VA 3CW2C 2HHWA 1UZHA 2RQMA 4DR5F 2V68A 2FVSA 4MK8A 5DETA 5KT3A 3DRPB 1MSWD 3CO0P 1U1OA 1K44A 3JQJA 2KB2A 4MFBA 1NDKA 2N7CA 3CMAS 4TU8A 4UOCA 2Y8WA 2ZZNA 1NLKL 2JC0A 2W2QP 5BYRA 3QRRA 1MROB 1U0HB 4FYWB 2GS8A 2QLBB 2ZUGA 4G1IA 4L3NA 4MK7A 1IBCB 4W98A 3D1QA 1R27B 4NI2B 4WP3A 4QW9A 2Y1IA 3R6GB 2MQOA 4OL8A 2J8AA 5DG7A 1RT3B 6AT1B 3POTA 4C8OA 5KFMA 4WE1A 3SFUA 4TLQA 2HYIB 4B3SJ 4P72A 1H38A 1U1RA 2C2NA 3FCWA 4J9NA 2VBYA 2VG5B 3NCPA 3KMSA 2H5EA 1VBKA 2WONA 3BF4A 2XGPA 3MCSA 1IKXB 1WSVA 5FD1A 2DGOA 1VIXA 1AUDA 4C8YA 1KVIA 4DV3F 2H48B 1QDUB 3OTCA 4UUXA 4OZJA 3VR1A 4DCOB 4M95A 5J1NA 5ETSA 1FKOB 3SDEB 4Q45A 1FRXA 4UY8T 3Q22A 3V4IB 3BGRB 3LP2B 2ZH8A 3KLHA 5FIIA 1JIHA 1R8HA 2DB1A 4KKOB 4TQRA 3RR7A 2FDNA 2MQ8A 5HP1B 2IJRA 4O3NA 2FHKA 3DRRA 3CD0A 3UCGA 3PIPQ 4X66J 4DV2F 4RZRA 3GZ7A 4RW7B 3L7PA 2J6UA 5HVGA 2HHTA 2PI5A 1REVA 3NAHA 2JDJA 2DPIA 3S01A 5E3CA 3DC2A 3H7HB 3TWZA 5KFZA 2X3DA 3L7OA 3C14B 2BE2A 2EKYA 3GU0A 1X4CA 3NBPA 1REGX 2F5GA 2DO0A 1SH3A 2V63A 5ETOA 4A47A 4RW4B 2U2FA 3KLEB 2IAJA 1Y5NB 4FDFA 3SQGA 3TI0A 2H65B 1M0SA 2DCLA 4CM0A 2G4BA 3BBBA 4QWDA 2XLJA 2RF2A 2V69A 4G6VB 3MPUB 3F0NA 4U7UD 4ICLA 4NLPA 1NRKA 2JFDA 2OHDA 2DPJA 1K0TA 3GIMA 1JLQB 3K7RA 3W9IA 2G1HA 3QFWA 1RT7A 5JUMA 1S1XB 2DGSA 3Q8VA 4L76A 2XGQA 3HM9A 4CLZA 1JLGB 2BJ7A 4WZQA 2IRYA 1CSJA 2AJ0A 2XMWA 1Q7YT 3C6UA 4PG4A 2XZTB 4JV5F 3IGNA 4TYAA 1KR4A 3KFWX 3PHTA 2LP4A 3PDNA 1SJQA 4FYXB 4JI0F 4NLQA 2HS3A 2RT3A 1HWIA 4A46A 3NRBA 2ZD1A 3QGGA 1KTQA 2AIRB 2C2RA 1FXDA 3EVWA 1HMVA 3DHXA 2KXHA 2MY7A 2JX2A 4YOEA 5C42A 1HBNA 2WCXA 3JTOA 4OI4A 3CCES 2QGFB 4CZCA 4M5DB 5D0RA 5DDOC 1TL3B 1UWBB 2RRNA 2V5HG 3DLGA 3R3TA 2DTJA 2QL7B 2HVEA 4ID5A 4J9LA 1UA0A 2AJ2A 2VC1A 2ZBIA 3I0SB 3IFEA 4OJ1A 4CO2A 2IDLA 4EO8A 3PX4A 3C46A 3CD6S 4N56A 4ANEA 1HI0P 1KRPA 3GLJA 4JI3F 4DPOA 4DU8A 1UAWA 2XZDB 3M2VA 3ZNUA 1BQNA 2RUGA 1XMOJ 3M6XA 4QIEA 1TK5A 4XIUA 1YI2S 4ZVPB 4LSNB 3HVTA 5C25A 2B4PA 3HT3A 3KUGA 1Q78A 3NGUA 4R25A 3DFEA 4HI1A 3DGPB 1UL3A 2XEXA 2KXFA 3DLEB 3AJ2A 3HZGA 2NCKL 1N4LA 1JX4A 1VQKS 4LF7J 1HD1A 4A8YA 2C28A 4NZ6A 2W4PA 1EZZB 4B3MF 4LRDA 3WQPA 2VKZG 1Q8LA 2GAGC 3QYYA 5ETTA 1YJRA 5GAEI 5LSRA 3UD4P 4DR2J 2BQ3A 2C2ZB 2ABYA 4D3HA 1I3OB 3IGVA 1LWFA 3OVAA 4LVNP 4QR1A 1WF1A 1WKLA 5D78A 3UCUP 2K7JA 4CH1A 1W7WA 3JYTA 2UVRA 3MMBA 3HKWA 4WP9A 3H42A 3KLFA 4G3IA 2E7XA 1WC6A 3I0RA 1FVQA 1XEZA 4ED4A 4LFCF 2CQ2A 4B3SF 2K1RA 1RAGB 1RTZA 2J9DE 4I6WA 3SCKE 1VQSA 5J2MB 3TVKA 4ES1A 5B09A 5A6WA 1IVZA 4H4OA 5HN0A 1U6FA 1EJ7L 1MWYA 2PDAA 2H3EB 4X64J 1Q7LB 1F0XA 4DL0C 3BGLA 1T7PA 2ZZMA 1QD1A 4PWDB 4O0IA 3CJTA 1N52B 3GG1A 1XMQJ 1SL0A 1TUWA 3I9ZA 4AXJA 1SKUB 3DM2B 3NCRA 3U1NA 1YJ9S 2B9XA 2LXFA 4I64A 3RBXA 3UDCA 2E1PA 5F8NA 4O23A 1OY8A 2E7WA 3D3CJ 1SV5B 5L1LA 1RTIB 2QL5B 4G65A 2R8HA 3W1YC 2I8EA 3BREA 5B0FA 4IG0A 5F3TA 5CZVA 4UOFA 3V6DA 4NCGA 4P9SA 3D9BA 3PY8A 2UP1A 3MEDB 3I87A 2I6WA 1VBXA 1SQEA 5KFAA 1NJYA 3TA2A 1A6LA 1RLCL 1U24A 1U8WA 3IR7B 1XERA 2AYMA 3NY0A 5KG3A 4CO1A 2ZHBA 4ED7A 4USHA 1U2FA 4K4YA 3SV4A 5L39A 3G8QA 1WKKA 1VI7A 2AJQA 2PFDA 4I67A 1D9DA 3HT0A 4YY3F 1F5AA 1VDHA 2VU5A 2WBMA 3ULHA 2F7VA 3PZPA 3MR5A 3GMGA 3Q89A 4IH5A 1M1GA 4EFAC 3MR7A 4BWJA 1RP5A 2N7YA 2MPUA 4OJGA 4O4GA 3V81A 1QVFR 5DM7Q 5E7OB 3UFCX 4I2PB 2ZM6J 1S79A 4TY9A 2ZC3A 2ZNYA 4LF5J 4I4BA 4WFYA 1S7IA 2BABA 4ZVHA 4DSLA 4QYRA 1ULRA 3DOKA 4NLYA 1N32J 3TZZA 2JOQA 4U9RA 2CJBA 2IVYA 1JLQA 2EK1A 3NCQA 3FC9A 3IM9A 3U27A 1HW9A 3M32A 3HFKA 3Q8UA 2X1GA 2KN4A 3VTIA 1VBYA 2DR8A 3KOAA 4RBTA 1NHVA 3M1VA 3D66A 1PGZA 3WZ0A 5CYJA 4J9KA 4LRBA 5AE2A 3DLJA 1S6PA 3LP0A 3OFFA 1FEEA 3VCDA 2NLWA 3NBPB 3K8WA 2B5JB 3MEGA 3FNNA 4B3RJ 1JLBA 1PAUB 1W26A 4TVAB 1RHKB 3ZFVA 4QWEA 3GQCA 4ECWA 3T5KA 3C19A 2ERRA 4JUZA 3V2UC 1IBLF 5LXYA 1REVB 1WOPA 4DUYF 4X4TA 4QYZK 4C0HA 1TV6B 1ELOA 2DEJA 1KNZA 3UE2A 2HW3A 2NPFA 4DN0A 1F9HA 1FHTA 1X4DA 3CCLS 2C2OB 2CQPA 3NS5A 2N82B 2AQ4A 1SUQB 1NUEA 4QOTA 4DV6J 3ILOA 4DSJA 3IR5B 3H90A 2J0XA 1D3WA 2GHPA 2NYHA 4LR9A 5HATA 4C3KA 1X4GA 2FGOA 4J91A 4M5JA 2MXYA 3P96A 2H5IB 3PFOA 5L9XA 3WDOA 1DARA 3LUYA 3MMCA 1RU1A 3PW5A 3A3NB 3ADAC 4X62F 1C1BA 1T0TV 1FNMA 1BMQB 2P6SA 2KFYA 1UW4A 4WWSA 1RYRA 3GWCA 5KFDA 3TX0A 1GMUA 2H4WB 2HS0A 5I3PA 3UN2A 1FRKA 1S1TA 5F9LA 3OFHA 2V9WA 2AZ1A 4PWDA 2XTJP 1KQGB 1MNEA 2DNPA 2YX1A 1NH8A 5T7LA 1VQ9S 1NB2A 4EYHB 1EKRA 1AFJA 4CWBA 2PA8D 2HZAA 1SC1B 1JJ2R 2V4JA 1UW9A 4DL4A 2OTLS 2M52A 2RE1A 4RU9A 1IBKF 5M2PA 3W2VA 3ZZOA 1TL1B 2B4UA 2YQ0A 4ZHRA 4OV6A 3EPGA 3GSIA 2YH1A 4AQYJ 1N6QA 4QU7A 3R6LB 3GIRA 2W7PA 3K5MA 2Z56B 5D0HA 3MOJB 1MROA 2FLOA 3HX9A 1DTTB 2HAIA 3RG6A 2IVFB 4DR3F 2DJWA 4QWBA 1S1UB 1BQXA 2ZNZA 2BOPA 4P10A 1WC5A 4YEAA 4DR1J 2J76E 2HLTA 3D0GE 1URNA 4K4SA 1FVSA 2LVWA 3UDVA 3N4WA 2V2QA 3ZZZA 3E3XA 5LM7E 4WIIA 1MWZA 3PYEA 2NR0A 4C9DA 3VQTA 3NNHA 1JLCB 4IFVB 3TAMA 5EX0A 2F8MA 1QLNA 3FCVA 2D3ZA 2AHOB 1TKTA 1X4FA 3I32A 2LA4A 1NK7A 1T03A 4RW6B 2E5LF 3DRSB 3TZXA 4P2SA 1IKWB 3L9ZA 4PYAA 1FJGF 4RUBA 1FD2A 2E7VA 1NDPA 1XN9A 2CQDA 5T7LB 5AXMA 3MPVA 2FLLA 1F9EB 4Y34A 1DLOA 7FD1A 4F36A 1PBAA 5HROB 3MFHA 1U1LA 2BDPA 1Z1ZA 4WTYA 2ZH9A 1S49A 4KV8B 4WYWA 2BJEA 4ID8A 2YKMB 4JI8F 3IC1A 3MECA 2A10A 3CC2S 6FDRA 1M5KC 1F3FA 1UJ6A 3FSYA 2ROEA 2QJ3A 4ER8A 4OI6A 5B0CA 3CCSS 3OVBA 2DRAA 3RBDA 2QV6A 2OO4A 3EVMA 4KPCA 3DLBA 3WC2A 3TUPA 3VGSA 1T9WA 2AKWB 1M1KT 3NXZA 5D0EA 1U2RA 1YZ7A 4HT5A 5IWAF 1XNRF 1OQ3A 4E8UA 3KK1B 2DD8S 1N32F 3PYDA 2AEJA 3B78A 4DXLA 3OJUA 2Z8QA 4BCAA 2DRBA 3CCMS 3UN3A 2A2DA 2EK6A 2KT2A 3EICA 2W9CA 3DXBA 2FUG9 3TJ8A 3H4BA 1W2BR 3X1LB 2BW7A 4QYZJ 4H4MB 1WDDA 3BH7B 1LW0A 4AE5A 1Q16B 4J5OA 3C66A 3ZZ0A 5KOWA 4ICLB 4A8OA 2Y1LB 3KDNA 2NREA 4Y65A 4KGKA 4LF4F 4K7QA 1G1XA 3OUYB 3SQGB 2DNNA 3MEEA 2Y0BB 5U47A 1RABB 1JKHA 5J2NA 2F4VJ 1EP4B 3HSGA 3I55S 2RKIA 1GXLA 2HGNA 2XSJB 3BPDA 4ES3A 5LMUF 1AFIA 2OPSA 2HZCA 4LBHA 1FRMA 3W7BA 4OYPA 1VRQC 3N6MA 3R1LA 4DX8H 2FYXA 1CJUA 2DKOB 3D6FB 4DFKA 2JEFA 4ED8A 4IH6A 1IR1A 2FB0A 3CO9A 3DLHA 2DHAA 2G2YA 4ENOA 1IKVA 2MQNA 3N28A 5HBMA 4DV6F 1D9AA 2AWZA 3KJVB 1JXLA 2J8SA 1LK7A 4DV0F 4ECRA 2CKWA 3BGRA 2VFSA 3LP2A 2OD4A 3PJ9A 1RHQB 1HW8A 3NP5A 4HTJA 4ES2A 2CJQA 3TO8A 2R7OA 3RB3A 4NXMJ 4NCBA 1KP6A 2ASYA 2GW8A 2HQIA 2QG9B 3UDEA 3OV7A 3PJWA 4X2BA 3OL9A 1MU2B 2W4DA 2ZUAA 4XTTA 1VRTA 1MWQA 4YB5A 1KVJA 4ZVTB 2MZRA 3DDKA 3E51A 3QT6A 4FPIA 2C22A 4P74A 1LV5A 1TELA 3S7RA 1T8EA 1TL5A 3DXSX 1EQMA 2VFUA 2ZHAA 3TARA 4KT0C 5EWFA 3D67A 2BM1A 4F3MA 4FVCA 5F8MA 3PR5B 4QPXA 2BRLA 4WE1B 1F9FA 2FJBB 1GX5A 3HD2A 2GIRA 3EUNA 4MIAA 3JAMU 2MDAA 1ZM9A 1CC7A 2IM1A 4XK8C 1DLOB 4OI0A 3ET6A 4ELVA 1R31A 2VL1A 3ENVA 2KL8A 1KFSA 2EC0A 4CT9A 1YBUA 3E01A 3DRSA 2V0NA 4LF8J 5M2RA 3Q8PB 1DFDA 3D3BJ 2GVZB 3P3DA 1U6BA 4IG3A 4DSFA 1TK8A 2OH2A 3OQ2A 4JB8B 3R8YA 3SSQA 3SV3A 5IT9U 1OSDA 1VMBA 2L9NA 4J9OA 3GYXB 3HLUA 1RKJA 2W2NP 3I31A 2VF3A 3C2PA 2KHCA 1H6KX 4IFYA 1B99A 3M8PB 4KQZA 4PXEA 2EG1A 4USUA 2CWKA 2ZH3A 1GFWB 1NCLA 1FFWB 4YR0A 1XNQF 1FWKA 1HR0F 1RTHB 4AXIA 2ZVSA 1M1HA 5CCLA 5HJYA 5K8OA 2LMIA 2GJFA 2IM0A 4U7CA 1C4AA 4I56A 3NAIA 1Y5LB 4NOHA 4ECVA 3C3LA 3IBCB 4NLGA 4RX6A 4DZDA 1Y10A 1FESA 4KTQA 3QRQA 4TQSA 4NMXA 4C8MA 1NJXA 5DQIA 2GX8A 3BO4A 3M8RA 1R0BG 1P1LA 2VFTA 1HWLA 1VYAA 4WU2A 1PCAA 4JI8J 2RJZA 1SC4B 2HNZB 2HRUA 2YTCA 3RU0A 2KG1A 3LWLA 2AJ1A 2EPIA 2LLZA 2OFHX 2I0XA 2OPQB 1RWKB 2VG6B 4ZDNA 1RADB 5KFPA 1OY9A 4LFBJ 1LWFB 2RQ4A 1NBEB 2GCFA 2MLYA 3HHLD 3HVTB 4LSNA 4PYDA 5C25B 3TQ1A 2DR7A 2HHPA 3PRDA 3BO3A 4OX9J 2DH7A 2HEKA 3G6XA 3QWUA 4ILLA 3N79A 3LQVA 2F8EX 4X64F 4EBDA 2FY8A 1NSKL 1G3OA 5BXIA 4NCAA 2OUGA 3DLGB 4MIWA 2EBGA 2VBWA 5DQHA 1TL3A 1UWBA 4KSEB 3H2LA 1FDNA 2ALYB 3B4DA 2GVZA 3PG9A 3Q8YA 2GO9A 2VICA 2VPYB 1HNZF 2V9KA 3V5RA 3I0SA 2KHDA 3KLGA 2KYZA 3ZTQA 2RHSB 4O3PA 3QPIA 4J90A 3TUJC 3CJ2A 2P2CB 4P52A 1M5VC 5IV3A 4DX7A 1MN7A 1WF0A 1EETA 1SBRA 1N34J 5KG7A 3JAMY 4A8XA 1CS4A 2RDJA 1RLDA 2V2VA 1H73A 3IN5A 2B5JA 3MEGB 1FJCA 1UFWA 4DMZA 1JK9B 4YP3A 4DQRA 1LNQA 2XNQA 1JMTA 2HVIA 2YWFA 5ETKA 2I5JA 4CIOA 3KJFB 3M1VB 2BKNA 5ETQA 3IAM9 5H9EK 5CYMA 1BE4A 2V94A 1CC8A 1DQ9A 3HHNB 3US5A 5H9FK 2CQIA 5BR8F 4ED2A 1KOHA 4J9VA 3M8YA 5L38A 1ZPVA 1YSJA 2NXUA 2VPZB 3GR1A 4IO1A 4B17A 3MM7B 3P4UB 3IP0A 1RT7B 3W2WB 4A8MP 2OEKA 1H98A 2M9KA 2PMHA 3OSNA 2JHEA 2CQBA 4LIWA 1WEYA 5ETVA 4Q0BA 4V19J 3KJVA 2W4CA 9RUBA 4GVLA 1F2HA 2BE2B 2ZITA 4P2FA 3W61A 5DDRC 4RL1A 4DL3A 2MEWA 1NPKA 2FHJD 1QAIA 3KTQA 5EN1A 1X0FA 1QAJA 4YFUA 4M5IA 4USIA 1NMEB 5IC4B 3OR2A 1QY7A 1SC6A 2XSJA 4A8SA 1DZ5A 2XWXA 3K17A 4FF1A 1N56A 3J81Y 3C14A 1N0UA 4KKOA 4CO4A 3HCXA 2VFRA 1OPZA 2UXCF 3QIPB 1RJJA 1MMNA 3LOUA 2XMTA 2JWNA 5KFSA 3PYFA 2LCWA 1YTYA 1NAQA 3W62A 2JEGA 3NEKA 2ZHOA 2OLWA 3HHDA 2WAQD 4O4RA 1WC3A 4YB6A 4P71A 5I42A 2K2PA 5C7PA 5E3AA 2IYIA 2LQJA 5KG5A 2FJVA 2NUHA 1RBLA 2RMLA 2HS4A 4H4MA 2Z2YB 4ILRA 4XDDA 3P5TL 4JI4J 4I69A 4RWWA 3CJ8A 3R5DA 1HI8A 2RIJA 3BBFA 4ZVRB 2F1FA 1P6TA 5HL7Q 2BQRA 5EWEA 2CPDA 3L7UA 1XJWB 2RD5C 1YGYA 4CCHA 4KO0A 3H5XA 1RHRB 2GHVC 1HR0J 1GMWA 2DEIA 5F0WA 1LFPA 1RWNB 3R5AA 3CJ3A 3FFIB 3UR3C 3U1LA 2H1YA 3Q24A 2YXLA 3DCAA 4FKXA 1JB0C 1GEHA 4LSZB 4W90B 1J5OA 3FZBA 5I3UA 4NI2A 1R7IA 4KFBA 1B70B 1T94A 4OX6A 1VCTA 2FIUA 3MECB 2I1RA 3SBMA 5BYQA 1JJ4A 2GHWA 2KZZA 4HACB 4ANDA 1UZDA 3TJ9A 4EZ6A 1R8CA 3EXYA 3IRXB 4QR2A 1S77D 1Q86T 2QA2A 4WXOA 3IRWP 1IR0A 1PAEX 1RT2B 3IBWA 5HROA 1JLCA 1R6VA 2WZ1A 4IFVA 3UDLA 5CABA 3J7YI 5HANA 1VQ7S 3K0JA 2HHXA 4L75A 3NGSA 8AT1B 2F4FA 4LFBF 3MHYA 3HJFA 1P27B 3CWJA 5H9FJ 5GAEU 3JYTB 3JXOA 4OI3A 4RW6A 1KS2A 2AP6A 4YMEA 4ED1A 2FJWA 4KR0B 2PFFB 1WI6A 1B4SA 3PM9A 5LL6d 3THPA 2DNLA 2GAHC 4WFXA 3FBCA 1BD6A 4C6AA 4MYUA 3OFEA 1ZYQA 4OX7A 3FMBA 3ZNJ1 4DR3J 4RR5A 3O5TB 5KFNA 2J6TA 3CXCR 2NQPA 1TR0A 3VZHA 2FZCB 5JMNA 4EI2A 1WACA 2CPIA 1YDLA 2C3PA 3HDSA 4PPZA 1CULA 5DJBA 2F63A 2BJ3A 3F41A 4FBTA 4FXDA 3Q0AA 2APOA 4AT1B 5A8RB 1S9FA 3V6HA 2UU9J 2LEAA 2COLA 4WFNQ 1YRTA 1C0UA 1O8BA 3B54A 3N01A 1WSRA 1ZM4A 5A0YB 3TA0A 4R5PA 1H7XA 1O5JA 2EFOA 3SCIE 1EHWA 1V6HA 2HQFA 4FN5A 4F4KA 2KRBA 2QT7A 4MKAA 2RB7A 1HKAA 2OP5A 4LFAJ 4DR5J 4MAKA 4KC5A 5B7WA 2N4CA 4JI7F 3CNQP 4WYLA 1HBOB 4UT4A 1SL1A 2MKSA 2XMAA 2CNOB 1PJ7A 1HYSB 4I0WA 3CJSA 2DXFA 5C42B 3MMCB 2OFGX 2WW4A 4WPAA 2DR5A 1HBUA 2W9BB 2R7RA 1VFJA 4HLBA 1YIJS 1RAIB 1NK4A 2VODA 2N3LA 1VQ4S 1KLNA 4DPYA 1TL7A 2BJ9A 3IO1A 1S1TB 1IM6A 2VA2A 2HVHA 5ETMA 2V8HA 3DRYA 3FDSA 3D54A 3GP9A 3T6BA 3M8QB 3MAAB 3EJMA 2XSFA 2ZH4A 2UVWA 4BWMA 1SIZA 1ZOTA 3C6UB 4KO0B 9ATCB 2HQGA 1A9NB 2UV8A 2POKA 3GYGA 4ZK7M 1S6OA 3WIVA 4K5RA 3GIIA 4FZVA 3H2VE 1QVGR 4DR7J 1NSAA 1B64A 3QO9A 2QC3A 2XMVA 1RWVB 1S7HA 3TP2A 3DRXA 2AGOA 3J7A1 1N0VC 5E2QA 3GFZA 4PG5A 4ZPWR 1DURA 2VH7A 1S0MA 1OYEA 2G0JA 5A8WA 3MM8B 4Q43A 2HHSA 1UFLA 3CCQS 2AU0A 2UUAJ 3HFVA 2L41A 4CNYA 1QUPA 1QE1A 4C8ZA 2GV1A 2IA0A 3QIPA 2DY9A 1S59A 1RAFB 2LA6A 3OHBA 2DT9A 5IC6B 4CTAA 1VC0A 1Q53A 3MPDA 1RUSA 2ZKTA 3L4BC 3GG0A 2H9ZA 2WRMA 5K8MA 2B9WA 2F65A 3LH2S 2KYXA 5KFJA 2DITA 3D1OA 3UN5A 4QPTA 1OO0B 3IXQA 2YNIB 4G1QB 2MKKA 2OPRB 4HDGA 2HG4A 1GNKA 1YJ7A 2Q43A 1GTEA 2CPHA 4N7TA 4PABA 5A2QY 2WB4A 4A8WA 5HP1A 3RB0A 4I2PA 2YWKA 1R8BA 3EZUA 3G86A 4MJKA 5E3QA 3OR1B 3BGOP 4FYDA 1E6YA 1WEXA 4I7FA 4ZVUB 3TX8A 4ZJLA 5KFGA 1HARA 1PBUA 2VOOA 2M70A 2HNYA 2VBZA 4PZVA 4K4WA 1WJ9A 4L73A 2AJ4A 3W5XA 2ROGA 2XI2A 1CS4B 2NXCA 3IS9B 3MM5B 4NZ0A 3DYAA 3FCHA 4OYIA 1URRA 5GAHU 4K4UA 3LPEA 4NLVA 2VG7A 3OSPA 2E5JA 2R7WA 2MZSA 2QO3A 2X7IA 1X9MA 3N5BA 3MF5A 3CCVS 2WVFA 4RW9B 4OYMA 3BSOA 4Q2LA 4C97A 3DOLB 5K14B 3G6VA 3PO5A 2GQCA 1QTMA 1X4AA 4KH0B 1LW2A 2LXUA 3HHLB 4MMOA 4ZCLA 3MUVP 1N5VA 5HLFA 2CJXB 5D3GB 1NK6A 5GADU 4NXNF 2FVRA 2UXBJ 2EKNA 4YHHJ 4URSA 2LFVA 3HP6A 5KFRA 2PE8A 4KGMA 3A8KA 2HHHJ 2RQCA 2OMLA 1KHWA 2NZCA 4OLPA 3LWMA 4M8LA 1VC6A 4K50A 1X5PA 1H2VZ 4ED0A 1FE0A 4ED3A 2V6AA 1JXEA 1U7LA 3PEHA 1CJVA 4DUZJ 4DL5A 3KG0A 3BYPA 4C98A 2VG6A 5BYSA 5DGBA 2I38A 2Q6BA 3DM2A 1NH7A 1SC3B 4JOUA 3JSRA 4KJIA 1JLEA 1R3NA 1ZBTA 1TMMA 3HJVA 3Q83A 1X9WA 4OMFG 1Y3JA 1C0TB 1HHQA 3OD2A 1YJTA 4HTIA 2RSQA 2W25A 3CIZA 2MKIA 4RWXA 1ZZNA 5BJRA 1FKAF 4OX8A 5F3ZA 1CJKA 3FBEA 5J2MA 4B3MJ 2IRXA 1V9OA 1IM4A 3A8EA 3G82B 4DR2F 2XY6A 3RAQA 4RO0A 1UEKA 3KLFB 2A0FB 1FK9B 5KTQA 3KG1A 4O3SA 1T95A 2HQCA 5CXTA 3CPWR 1L3KA 2L9DA 3AQOA 3GYNA 4DR4F 4LFCJ 4F02A 4B3OA 2HHUA 5AXKA 4F0KA 2B51A 4LF9J 1I5OB 4Y6IA 5E3RA 4J9UE 5AE3A 2ZEJA 4QR0A 1FXLA 3TANA 3A4TA 1Q1KA 3BBCA 4IQMA 3M8PA 4M5LA 2AJFE 1DTQB 5CCMA 4EYIB 4L3KA 2MGZB 1N88A 3DGPA 3DLEA 3BGFA 3MTKA 3GV7B 3H2UB 2MZJA 1CQMA 4M5GA 5AT1B 2G0IA 2XY5A 4P2MA 4UQGA 3MPYA 4MIBA 1BQNB 1L3UA 2IC3A 1HBMA 1FJEB 4ZCKA 3OTOF 2MHEA 2VQEF 3PKMA 2J7WA 1GQEA 5HAOA 3T9NA 1VISA 2M88A 3DNCA 3UI3A 4DU7A 4DBQA 1TZ0A 4WF9Q 1HNVA 2B9EA 5KFYA 4WXWA 2OPPB 3PCOB 2XY7A 2GVDA 4P75A 1LW2B 1UKUA 2H51B 2VG7B 1PSDA 3CDAA 1PJ6A 2JLFA 3BB5A 4CI0B 4ECQA 4QZVB 4ECXA 4JI5J 1F60B 4ZVEA 3GCXP 1FNXH 2NXEA 3C6TB 3BR8A 3P5BP 4YB7A 1HBNB 1HQ2A 2UV8G 2UXDF 3QMQA 1V5VA 5IT0A 2D7SA 3JQMA 3MUTP 1SXLA 2LEBA 1RQ0A 1PILA 2ZDPA 4NLOA 2LQ9A 4GKKJ 3UNGC 2OEMA 4NLRA 3GTYX 3OR1A 2R4FA 4DV7F 3WIUA 4ZIWA 4J9SA 1Y9OA 3FZ2A 2FLPA 4GKJF 2RHQB 5HBMB 3CCRS 4PKDB 5D4OA 1BLUA 1C1CB 1S97A 3AJ1A 2OJ3A 1VJQA 4J9MA 4M5KA 3ISZA 5HMWA 5EHHA 1N54B 1RISA 1T9VA 2ZVIA 3F44A 4FPRA 4DJBA 4F4XA 4RW4A 4L6V3 4NZ7A 3KUHA 4X84A 3KLEA 2YNFA 2DO4A 1XMQF 1LEOA 1WKJA 2QEXS 2CPEA 3MPWA 1T9UA 1YKWA 5J2NB 1WHXA 2IM2A 5CA5A 1ZS6A 4FNHA 2XO7A 2ZBQA 4FKYA 3IA0A 3G6ES 1EIYB 1HWUA 3QBCA 4Q8EA 2HURA 1WELA 2HFOA 5B0AA 4WP8A 1FX2A 2AYEA 1OPIA 4I68A 5ETPA 3O8WA 1GAOA 4NLDA 3G4SS 4TY8B 3SYZA 2NXJA 2YNHA 1R0CB 2FPHX 1L3SA 1JKHB 4IR1A 2GJ2A 1EX8A 2YNFB 4RNMA 1HFEL 2J9CA 1MMLA 3ILLA 2HFNA 5HK4A 5HQLA 3P45B 3I56S 5EUHA 5HMYA 2CAJA 2HNDB 4WKRA 1DQAA 3DRRB 4GO7X 4OIXA 5B0DA 5IXUA 1NNDA 4F2RA 3VAIA 2FC9A 2BW2A 3I4PA 3ONQA 3HVAA 1I94F 5G0RA 2XG8A 3OLBA 5I4MA 1IBLJ 4X66F 1AROP 2XHWA 2KH9A 2GJIA 5L9NA 2VG5A 1FKOA 3SDEA 3BH6B 2MQPA 4NLSA 2Z57B 2PN6A 4X65F 3EMTA 2YKMA 4OQJA 4U7UK 1S48A 3UNYA 1S4EA 4DX6A 2K7KA 3KK1A 2R2SA 3PNIA 4TN2A 5K20B 3FBBA 4ZCMA 2MLZA 3D1HA 2DNGA 3R7NB 3D6MB 3VVTA 3JS9A 1U09A 4X4QA 3MR6A 4J9RA 3A3PB 3OTBA 4PXDA 5FDLB 2XLKA 2BYCA 1ICEB 3ZTSA 2LU2A 1SQGA 3DDIA 3T5JA 1VHIA 3CB4A 4HHJA 2YWGA 3N6NA 1BXNA 2RQKA 4OYWA 4LREA 4IFYB 3QZ7A 5A8KA 4OHZA 3HXMA 2VJUA 4LBIA 4A8QA 3GFYA 2WSEC 3G96A 1NKCA 3ENAA 2O3DA 2AMCB 3T19A 3VF0B 5J2PB 2B4VA 3AH6A 3PW2A 4ZLLA 1U0HA 1HPZA 4OZ5A 4R5PB 5A0YA 3CULA 3BKTA 3TUIC 3SXLA 3EX7B 2MSSA 1YRUA 3BM7A 1F6TA 2HK3A 5KFUA 3UD5A 3DLLQ 2JLEA 3DRPA 2FJAB 1TKZA 2QRRA 1VQ8S 3J80U 3KKFA 4IKAA 2XS2A 1DTTA 2BVZA 3RBZA 3BSNA 2FLNA 2ILZA 1P9YA 3GR0A 4AL6A 1HNWF 4X4PA 3MM9B 5CZXA 4KH1B 4WK3A 4WFBQ 3W3SA 2X51A 4TU9A 4PCQA 2DNQA 4OI1A 3UVJA 3QZ8A 2P9GA 1S1UA 3W2VB 4X4UA 1RB0A 4IO9Q 4DR1F 1NK8A 2NUUG 5DZ6A 1RT4B 2KT3A 1RAEB 2ZKUA 5D4LA 3VALA 3H5SA 4F3OA 3AOCA 3O6QA 4ETXA 3PV8A 4PG7A 5GAHI 2D9OA 4FVMA 5J2PA 5D77A 1TL4A 3TZWA 3THVA 5ADZA 2QLFB 4EU0A 1V3SA 3SZ2A 2CPZA 1VK8A 1U2CA 4PG8A 3D6HB 1NHKL 1Y7PA 3JTNA
chains in the Genus database with same CATH topology
1TMMA 1HKAA 4M5NA 5ETOA 3UD5A 4CYUB 3MCMA 5ETPA 3ILOA 4M5GA 3HD2A 1RU2A 3HT0A 3ILJA 3MCNA 4M5HA 1EX8A 1Q0NA 4M5IA 5ETTA 5ETKA 1CBKA 3HSZA 4M5JA 5ETSA 5ETQA 1DY3A 3ILLA 1EQ0A 1RU1A 3HD1A 4M5KA 4PZVA 2BMBA 3HCXA 4CRJA 4CYUA 1RB0A 5ETRA 1IM6A 3UDEA 4F7VA 1RAOA 5ETMA 2F63A 3KUHA 3HSJA 3IP0A 3ILIA 3HSDA 1KBRA 2F65A 3KUEA 4M5MA 5ETLA 3UDVA 2CG8A 3HSGA 5ETVA 4CWBA 1RTZA 2QX0A 1G4CA 1HQ2A 5ETNA 3MCOA 1F9HA 1TMJA 4AD6A 3QBCA 1EQMA 3KUGA 4M5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TMM A;  1HKA A;  4M5N A;  5ETO A;  3UD5 A;  4CYU B;  3MCM A;  5ETP A;  3ILO A;  4M5G A;  3HD2 A;  1RU2 A;  3HT0 A;  3ILJ A;  3MCN A;  4M5H A;  1EX8 A;  1Q0N A;  4M5I A;  5ETT A;  5ETK A;  1CBK A;  3HSZ A;  4M5J A;  5ETS A;  5ETQ A;  1DY3 A;  3ILL A;  1EQ0 A;  1RU1 A;  3HD1 A;  4M5K A;  4PZV A;  2BMB A;  3HCX A;  4CRJ A;  4CYU A;  1RB0 A;  5ETR A;  1IM6 A;  3UDE A;  4F7V A;  1RAO A;  5ETM A;  2F63 A;  3KUH A;  3HSJ A;  3IP0 A;  3ILI A;  3HSD A;  1KBR A;  2F65 A;  3KUE A;  4M5M A;  5ETL A;  3UDV A;  2CG8 A;  3HSG A;  5ETV A;  4CWB A;  1RTZ A;  2QX0 A;  1G4C A;  1HQ2 A;  5ETN A;  3MCO A;  1F9H A;  1TMJ A;  4AD6 A;  3QBC A;  1EQM A;  3KUG A;  4M5L A; 
#chains in the Genus database with same CATH topology
 1VHF A;  1RTJ B;  2FZG B;  1PKU A;  2WSC C;  1HNI B;  2YBV A;  3FEY B;  4IDK B;  4W4M A;  4Y3C A;  4OHX A;  4YS2 A;  3BJY A;  1RYS A;  2VQF F;  2N3O A;  1Q95 G;  2P5V A;  5HQ8 A;  4Y2K A;  4B9V A;  2NXN A;  1CEZ A;  2XM3 A;  3LAM A;  5H1S V;  1J5O B;  3A1Y G;  2XS7 A;  2QA4 G;  5BR8 J;  3TNV A;  4QCL A;  1KOO A;  2CJA A;  2FGC A;  1UWA A;  3VAG A;  3RBE A;  1O6X A;  1YJU A;  4LMZ A;  2R9L A;  4CLU A;  4CQ1 A;  4RUA A;  1VK3 A;  5C5J A;  3M9N B;  3Q8S B;  1I6J A;  1OQ6 A;  4ZJO A;  2GQQ A;  4QJV A;  4DLE A;  2IBO A;  1R6Y A;  2UUT A;  3M2R B;  2R7V A;  2O66 A;  3CDB A;  2YKN A;  4KGX B;  3PR4 A;  3GJS B;  3IWL A;  1CG2 A;  3CDE A;  1XNR J;  1NSQ A;  4RNF A;  2V2Z A;  2PEB A;  1XR7 A;  2V8P A;  2CQ4 A;  2E1C A;  4RNH A;  3NKY A;  1X8D A;  3BN7 A;  2M0G B;  2K06 A;  4NRT A;  1RWM B;  5IZH A;  2CRL A;  2Q79 A;  2MY8 A;  1GXT A;  1MG7 A;  2CIM A;  3QFH A;  5D15 A;  1BGX T;  1PYS B;  2ZBC A;  4ZPD A;  2G13 A;  1KD1 T;  4YB1 P;  3K5P A;  2BMB A;  4ZPB A;  2IFX A;  3LP0 B;  3O44 A;  2Z4P A;  3S8S A;  1UPP A;  4PRF A;  3OXG A;  4YR2 A;  2DHG A;  1NKE A;  5T41 A;  1FTC A;  1WHV A;  2HWI A;  3MM7 A;  3W2W A;  1SI9 A;  2Z2L A;  1T3N A;  2J0W A;  3M32 B;  3FMW A;  1RAA B;  5HO4 A;  4QBU A;  2WOM A;  3BGU A;  2M3D A;  2LKZ A;  1S4F A;  4CDI A;  1Q81 T;  4A8K A;  1X5T A;  2HFV A;  4ZVS B;  3VAJ A;  2J0Q D;  3EGZ A;  4O4G B;  5K5M A;  4CRJ A;  3V81 B;  5L1J A;  3U7J A;  3KXD A;  1B7F A;  3QQC D;  1P1T A;  4C3M A;  3MCM A;  2CJ9 A;  2FQQ B;  2OKQ A;  2BJ1 A;  4DCJ B;  1SJF A;  4FF4 A;  1VQY A;  2ADB A;  2EFG A;  3GE9 A;  3DLK B;  2NZ4 A;  2IYG A;  3KK2 A;  4KHP J;  2DNK A;  3LA0 A;  4ZP9 A;  1GTH A;  1KFD A;  4F67 A;  4PQU A;  5CYM B;  5FLX Y;  2B8Q A;  4QU6 A;  2A18 A;  4X4R A;  1JWW A;  5F9N A;  1RHJ B;  2HQ3 A;  1VQ5 S;  2JC1 A;  1WHW A;  1ZAW A;  1KON A;  2RVJ A;  1Y00 A;  1S1V A;  3DMJ B;  3HMJ G;  3CCZ A;  5KFO A;  2B3T B;  1BUX A;  2DCU B;  5GVQ A;  2JLG A;  4NCG B;  3C6T A;  1S0V A;  1YIT S;  4JV5 J;  2IC3 B;  2K8G A;  4ZVQ B;  4U95 A;  1IBM J;  4GVB A;  4ZP8 A;  4OZN A;  4TKT A;  2DXE A;  3DU6 A;  2PMZ D;  1SJ3 P;  4ECS A;  3IWX A;  2AX0 A;  2R7U A;  2JJ4 D;  3M30 A;  3MFI A;  1HNV B;  2KRR A;  4RLE A;  4ZVF A;  1YG0 A;  4DF4 A;  2FZK B;  1DTQ A;  3I96 A;  1KTV A;  4HH0 A;  4KIA A;  4ZA1 A;  2ASJ A;  2OGU A;  3QT7 A;  3TQE A;  3M8Q A;  5GMK a;  3F56 A;  2OEL A;  1Q0N A;  2UVV A;  4OZ3 A;  3FSX A;  4F2S A;  3PIO Q;  1IJF B;  4OYO A;  1B0V A;  3BPS P;  4DQI A;  1X4E A;  3VVU A;  4L74 A;  3TOQ A;  2HHH F;  2CZV C;  3LGH A;  1X9S A;  4JI1 F;  2ZOG A;  3NG8 A;  4H4O B;  1FK9 A;  1D09 B;  4N5S A;  1IJE B;  3DOM B;  2XI3 A;  3CC7 S;  4LF8 F;  3TVY A;  3FUY A;  4ZLN A;  4FS1 A;  2FD2 A;  3HI9 A;  3M6U A;  5AJ3 F;  4XPC A;  3NGD A;  4DUZ F;  1RKI A;  5ETN A;  1HQU B;  6FD1 A;  2JVR A;  4FNI A;  3RW7 A;  1QUV A;  1NXI A;  1UMJ A;  1IWG A;  2MTL A;  2MZT A;  5D4N A;  1S9E B;  2YNG A;  5D4P A;  4X4S A;  4OZ2 A;  3OL6 A;  3QWP A;  1T05 B;  4UY8 5;  2GZO A;  2F9J A;  1XNQ J;  5KT7 A;  3G2X A;  2RRA A;  5K8P A;  1K47 A;  1RTH A;  2PD1 A;  2PII A;  2G2O A;  3SMZ A;  3UCZ P;  4O3O A;  4BBY A;  4DQQ A;  3ITH A;  4WBF A;  2ILY A;  3G87 A;  4O0N A;  3R7S B;  3ZZT A;  2BQU A;  3BV8 A;  2XYH B;  2VAS A;  3MMA B;  4LF6 J;  3HK2 A;  3RRK A;  3OXF A;  3AD9 C;  1TKZ B;  1CJT B;  2VHG A;  1RDR A;  3N5F A;  3D4J A;  2FHJ A;  3HSD A;  3KUE A;  2CXE A;  1H7W A;  2J5A A;  4LF9 F;  1G4C A;  4OI2 A;  4X4V A;  1RXO B;  1M5H A;  2Y1J A;  2D9P A;  3M30 B;  3R1H A;  1K8A T;  3PW4 A;  4Q5V A;  4OX9 F;  2CJK A;  4QQB A;  3TVZ A;  2CQH A;  3MUR P;  1GMW D;  5LXR A;  4Y2I A;  4IG3 B;  5A8K B;  4R8U B;  4PWW A;  1AZS B;  2DHS A;  1KQF B;  5KFF A;  4HAC A;  4ECY A;  1S1V B;  2HRT A;  3DMJ A;  4DFM A;  4DFJ A;  2GGP B;  3GJQ B;  4H4K C;  3E2E A;  2AZ3 A;  5DDQ C;  3WBZ A;  4TU7 A;  2GMH A;  3KLI A;  1O0P A;  4G1P A;  3TEG A;  1W25 A;  2RRB A;  1DBD A;  4FP9 A;  1D8Z A;  4NLX A;  1F2G A;  4DR7 F;  1RGV A;  5KT4 A;  2BBE A;  2VKR A;  3DOL A;  4C4W A;  2HSE B;  5E41 A;  1FDA A;  4UTG A;  3LW5 C;  3W60 A;  4RW8 B;  1T02 A;  3DLK A;  4M5M A;  5DM6 Q;  3WC0 A;  3TW0 A;  2DGX A;  2B7C B;  2NS1 B;  2CNN B;  3C15 A;  4U96 A;  3WHI A;  2WVE A;  4UOG A;  5F8L A;  1JNR B;  3OL7 A;  2CQ1 A;  3NS7 B;  3V6K A;  1U25 A;  2VOP A;  1U0S A;  4NEY A;  3C16 B;  3ETO A;  3L3C A;  2Z2M A;  3MM5 A;  4YUD A;  2HK2 A;  1Y3K A;  4KE5 A;  4M5N A;  4EO6 A;  4DG1 B;  4DX5 A;  1SIW B;  2M8H A;  3BQ1 A;  1IKV B;  3EGV A;  3MMJ A;  3EGN A;  4P7V A;  5A2Q U;  4IRD A;  3DU5 A;  1FDD A;  1JLG A;  2RF2 B;  2CPF A;  1AYE A;  3IG1 B;  4Y2C A;  4CO3 A;  5I42 B;  5T14 A;  1R8A A;  2RIL A;  4ALZ A;  2P9E A;  1OJ4 A;  3RYL A;  1FFS B;  4WCE Q;  3UR0 A;  2HBQ B;  2OPS B;  3GSD A;  2DNR A;  4ZP6 A;  1TQL A;  4P73 A;  4ANC A;  2AW0 A;  1X0P A;  4ZPV R;  4X62 J;  2WSF C;  1MMD A;  4RNN A;  2UXC J;  3VAH A;  3RRG A;  2BAN A;  5KG1 A;  3MEE B;  3HSJ A;  4ELT A;  2E5I A;  1VC5 A;  4K4V A;  2KO1 A;  3Q8Q B;  1RT1 B;  3ZC4 A;  2B4O A;  5DG8 A;  1S57 A;  4LR7 A;  4OJ3 A;  4USJ C;  1FDB A;  2EFP A;  3KDO A;  2XC9 A;  3T1Y J;  2ASL A;  1N36 J;  1Q8K A;  2GIF A;  2HPU A;  4P6Q A;  1VQM S;  4M94 A;  1IBM F;  3CJR A;  2B6A A;  4DOZ A;  4OYB A;  3CGI A;  2E44 A;  4NEZ A;  4ED6 A;  3UQS A;  1TFW A;  1RCX B;  3CF5 Q;  3PVX A;  3GJT B;  3KHR A;  3IAS 9;  1U8S A;  2BRK A;  4J7C A;  1U26 A;  3BSA A;  3MWB A;  3QGI A;  4NWB A;  3BKF A;  3FKB A;  1IXK A;  3ILJ A;  4RW7 A;  1VR6 A;  4RPF A;  1UEV A;  2Z30 B;  3IG1 A;  4YDD B;  3T1H F;  3P49 B;  5A8W B;  1C1C A;  1H72 C;  3IMQ J;  3QNW B;  5LMN J;  1TTH B;  4A8F A;  4B3R F;  3QAE A;  2QA4 S;  1JNZ B;  2LXI A;  1IUJ A;  2QLJ B;  3K5O A;  3QO9 B;  1RAO A;  1TUV A;  2JL9 A;  2AT1 B;  1NZA A;  2HAF A;  4F25 A;  5SZT A;  3EXC X;  2I5J B;  2HFZ A;  3KHL A;  4DUY J;  2ZH2 A;  5ETL A;  3C15 B;  4PG6 A;  1Q5V A;  4ZVG A;  1GX6 A;  3M7V A;  1HBU B;  5D0G A;  2DR9 A;  2KFN A;  1RAH B;  1WD6 A;  4FF3 A;  1CPZ A;  2M8D B;  1OMS A;  3QAT A;  1X5S A;  2BJ8 A;  1RZM A;  2C1E B;  2QMW A;  4RBU A;  4MTP A;  1RT3 A;  1G6B A;  2WON B;  4NYZ A;  3V6J A;  3T1A A;  2ZH5 A;  2W2M P;  4K4T A;  2IRU A;  2FJE B;  4PR6 A;  2XQC A;  1X5O A;  4FBU A;  3G9C A;  2ZH1 A;  4DQP A;  4DV4 J;  3K2Y A;  3G8T A;  1C0U B;  1HBM B;  1TK0 A;  3QJL A;  3I6P A;  1YQH A;  1QSY A;  1Q8B A;  5DRK A;  5B0B A;  1HD0 A;  2MST A;  3UVJ B;  5GAG I;  5E33 A;  2QA1 A;  4USW A;  2DRD A;  1XC9 A;  5LJ5 Y;  4EK2 A;  4LF6 F;  4UZC A;  1IKW A;  5F8I A;  1QJH A;  1KQS R;  1UVI A;  2R8G A;  2U1A A;  1FI4 A;  4ZIT A;  2XCP A;  2I2Y A;  3NMA A;  2KG0 A;  2OSR A;  3OLA A;  1V5I B;  4IR9 A;  3H98 A;  2G0C A;  4DPX A;  3TAP A;  1L3T A;  4GO5 X;  3ZZU A;  4LSL A;  3RRH A;  3VAK A;  1IR2 A;  4K59 A;  3MTJ A;  3MMA A;  2X1A A;  1X7V A;  4CYU B;  3GIJ A;  4X4N A;  1IKY A;  1NHU A;  4JV0 A;  4U6P A;  2G9O A;  1WEZ A;  1DRZ A;  2FVQ A;  2IY5 B;  4Z37 A;  3PEJ A;  2HNZ A;  2J0S D;  4DEZ A;  3JSB A;  2VFV A;  1VRU A;  2HMI A;  2QYC A;  1U02 A;  1ZTW A;  3KHH A;  3BSC A;  2F40 A;  3MEK A;  1TKD A;  2V4J B;  4M63 A;  2AYG A;  1K0V A;  4IOA Q;  1S9E A;  2B43 A;  2YNG B;  2VZ9 A;  1CLF A;  2JFK A;  4M1K A;  2HBY B;  3RUB L;  2BXJ A;  1QTN B;  3MI7 X;  1RHU B;  1QSS A;  4N41 A;  1C0T A;  1S76 D;  4KRW A;  2XLI A;  2CQ3 A;  1H2T Z;  3OXL A;  2DHH A;  3EPI A;  5GAG U;  3DKD A;  3R5G A;  4ITS A;  4UZB A;  1UCN A;  2V4R A;  2P8I A;  1RT2 A;  4KB7 A;  2UXD J;  2CDQ A;  4Z2X A;  2UU9 F;  3EE3 A;  2V8G A;  1Y4Z B;  3LGM A;  4NA2 A;  3KMQ A;  1M90 T;  1ACM B;  1AW0 A;  1KVK A;  1FEH A;  2Z2Z A;  5DGA A;  2J7U A;  3R2D J;  1VLY A;  3CED A;  4KFB B;  3R9L A;  2KXN B;  2W7A A;  2Z0G A;  4JI6 J;  3GIL A;  5KOX A;  5L1K A;  3HKZ D;  3M9O B;  2WVD A;  2FJX A;  3HVR A;  5HQM A;  2WW8 A;  1VJW A;  1A7G E;  4LRF A;  4B9T A;  3FFI A;  4LJM A;  3MDF A;  5M2U A;  2YPY A;  1DY3 A;  4EZ9 A;  2FHO B;  3KNG A;  4LRC A;  1UVL A;  3BS9 A;  2ZZT A;  3HHL A;  1RHM B;  4Q44 A;  5D3G A;  1PC5 A;  3HO1 A;  4WKY A;  2MKC A;  4C2M A;  3CD7 A;  3EYZ A;  1S0O A;  4FYY B;  5CYQ A;  1S99 A;  5DDP C;  3J81 U;  3BKU A;  4PWU A;  4B02 A;  2CNK B;  1BHN A;  2ZJP Q;  2VON A;  2YWW A;  2PI4 A;  1NZ8 A;  3AT1 B;  4JI0 J;  2ZJR Q;  2XYP B;  1S6P B;  2F8H A;  3DDN A;  3MAH A;  2RDI A;  4F4A A;  3GIK A;  3KWM A;  5IM0 A;  1S12 A;  2IMO A;  3ICL A;  1FNO A;  4DV5 J;  2ZFH A;  3DYA B;  4ZPT R;  1WC1 A;  3IS9 A;  4USV A;  5KT6 A;  1L3V A;  4C11 B;  1JLA A;  3O2I A;  1MU2 A;  1NDC A;  4TNO A;  1L5U A;  3RW6 A;  4NLW A;  2EWH A;  4KYZ A;  3LPY A;  2KJV A;  4DSE A;  2CWX A;  2AGQ A;  4NL5 A;  1NB7 A;  2YWE A;  2BZ2 A;  4O44 A;  1OYD A;  2EVZ A;  2BE9 B;  3AOD A;  4HKQ A;  2KI2 A;  4ZCI A;  2Q1L A;  4C11 A;  5LMU J;  4PAA A;  1HNZ J;  2E66 A;  4TXS A;  2GIQ A;  5DLG A;  2A2C A;  3K57 A;  1XMO F;  1KSP A;  5KFK A;  2UUB F;  2RU9 A;  2V67 A;  4YR3 A;  2B8P A;  4IOC Q;  2GA7 A;  1XR6 A;  2SXL A;  3NWR A;  5KG0 A;  4OHY A;  1NEE A;  2XUL A;  3MAQ A;  2B56 A;  4NYP A;  2H54 B;  1BQM B;  2NSC A;  1N33 J;  1A0O B;  2JRS A;  1YJW S;  4PXB A;  4YY3 J;  1K73 T;  5HMZ A;  4CT8 A;  2ACM A;  1BY9 A;  1F1B B;  1RBA A;  3T6J A;  3M05 A;  1VOM A;  4KAI A;  1CQN A;  1J5E F;  2R2T A;  1RT5 A;  4KGZ B;  4WU3 A;  1TVR A;  5IFM A;  3O3L A;  4JV2 A;  3P8B B;  2HQD A;  3CCJ S;  1NSP A;  1TAQ A;  4JYA F;  1N5S A;  1RK8 A;  4Y28 C;  1SQF A;  4MYT A;  4OFZ A;  2ZM6 F;  2C42 A;  2C3U A;  2E1A A;  3I82 A;  4NA1 A;  3VQS A;  4LF5 F;  4R8U A;  5CYQ B;  4WZM A;  3V6D B;  1PYO B;  2IJN A;  2LYV A;  3K8V A;  4OLO A;  2W9C B;  3K59 A;  5KFT A;  3Q23 A;  4H54 A;  3PO4 A;  1YK9 A;  2YQ1 A;  5D8H B;  4XPE A;  3LF0 A;  3RJM B;  4ECT A;  1RCO B;  4USK A;  3A8I A;  1P8G A;  5DG9 A;  3LAK A;  4NLT A;  3JQK A;  4GC7 A;  2RUS A;  4CO5 A;  1HLW A;  2AX1 A;  3T5H A;  2ZC4 A;  3GFX A;  3W64 A;  1CJT A;  3S1T A;  4AQY F;  2Q3P A;  4HHH A;  3B82 A;  2JNJ A;  2CVE A;  2L48 A;  2XHC A;  4QIG A;  2UXB F;  1F5B A;  1P9Q C;  2E9T A;  3ZTO A;  2W9B A;  3CE8 A;  2VJV A;  1KQK A;  1KEK A;  3OTD A;  2RAQ A;  4LVO P;  1UFK A;  1WOO A;  3CJ4 A;  3I5C A;  3IR6 B;  1OS5 A;  1X31 C;  2R42 A;  2YX4 A;  4KPY A;  1ZM3 A;  1I51 B;  4CLS A;  4IRC A;  1CJK B;  5IS2 A;  2V8D A;  3KJN B;  4FXW A;  4DLG A;  4DWI A;  2BR0 A;  4JI2 J;  2OPQ A;  4DCP B;  4F4Z A;  1GXU A;  2L08 A;  1VGY A;  5AJ3 J;  3A12 A;  1TKT B;  3AAW B;  4C0B A;  4EEY A;  1NK5 A;  3B8H A;  2W8K A;  3R5B A;  2CDR B;  3SEO A;  4QIV A;  2YKO A;  3THT A;  4DPU A;  2OSQ A;  3R7B B;  2VUG A;  2DNY A;  3CCU S;  1S10 A;  4MKY A;  4PUO A;  2MQQ A;  1Z2Z A;  4CNZ A;  3BEG B;  3PFE A;  1D1U A;  3M6V A;  1KC8 T;  4ELU A;  1UVM A;  1TAU A;  4CLK A;  1U49 A;  3CSK A;  3DN9 A;  4LSL B;  2L3M A;  4KHM A;  4N8O A;  3CJ5 A;  4O3R A;  1B3T A;  2YKQ A;  3R2C J;  2W1B A;  1ZET A;  4FF2 A;  1RWO B;  2O01 C;  3CTR A;  4ZVO B;  2A6M A;  4HHU A;  3BO2 A;  3QRP A;  1T3O A;  3T41 A;  1DJ0 A;  4S0M A;  4LQ9 A;  2C2M B;  2A1B A;  4A48 A;  4B3T J;  3D5M A;  1IBK J;  4JV1 A;  3P6Y C;  3J7Z 5;  2WBR A;  3FJ2 A;  5K14 A;  4AD6 A;  5RUB A;  3OJS A;  2VIH A;  3RB4 A;  2G1D A;  2MHN A;  1FX4 A;  1UJ5 A;  3ENQ A;  2OD6 A;  2XYG B;  4AYB D;  4DZ6 A;  4HYK A;  4K0K F;  1HWJ A;  1HMV B;  1HNX F;  3N9U C;  3PRV A;  1WDT A;  4L72 B;  3OTO J;  1H2U X;  2ALZ A;  4OYA A;  1WTB A;  3LGN A;  2MLX A;  4Y00 A;  1S9G B;  1EQ0 A;  4M5D A;  4LF2 A;  1C1B B;  2HWH A;  1SVD A;  4BHQ A;  5K8N A;  4F0M A;  1ZZF A;  1BQM A;  3A8J A;  3HFZ B;  5KG4 A;  4BLG A;  2QLX A;  3H0P A;  4RJV A;  1Q82 T;  3NWG A;  4C7Q A;  2ZD1 B;  1U45 A;  7FDR A;  2NSB A;  1S6Q A;  5DQG A;  3EGW B;  2VDI A;  5HJX A;  1U6Z A;  5DLF A;  4K5S A;  4IQX A;  2PGC A;  4NRU A;  1JJC B;  2WHO A;  3HVW A;  2B6A B;  1Q5Y A;  2DGV A;  4JBC A;  3QT5 A;  4F0H A;  2Q6C A;  1Y11 A;  2V2K A;  2XZW A;  4DV7 J;  2GQ2 A;  2HIY A;  1S1X A;  1D0E A;  1VLO A;  2R7Q A;  4UUW A;  4OHW A;  4PEO A;  1TUG B;  2MMY A;  1BWE A;  2W01 A;  1OY6 A;  5EX3 A;  2VDH A;  1WOS A;  3H4D A;  2RKI B;  1EP4 A;  1FD8 A;  3BN4 A;  2D69 A;  2EI5 A;  2B9Y A;  1FRH A;  4EBE A;  4IUF A;  4OZ0 A;  3SCJ E;  3M8S A;  5IM0 B;  2MQM A;  3HF5 A;  4UST A;  1ZM2 A;  2LDI A;  4V1A k;  4DPT A;  5F8G A;  2EEY A;  3J81 j;  2YKP A;  2VB6 A;  3ILI A;  2HFS A;  3MM8 A;  8RUC A;  2BEF A;  3M2U A;  4URG A;  5HVH A;  3HPO A;  2AYB A;  2LDY A;  4GC6 A;  1QSL A;  2VD3 A;  1ROF A;  2YKN B;  2CPY A;  3KLH B;  5H9E J;  4TLR A;  1N36 F;  2DBB A;  2DK2 A;  1NK9 A;  1SJR A;  5CHC B;  3OUY A;  4QWC A;  1PG5 B;  2FJD B;  2AV5 A;  2YY3 A;  3L95 X;  5F8H A;  1ITP A;  2V50 A;  4F4Y A;  3TJA A;  4DL7 A;  5KFQ A;  1FJ7 A;  2LEP A;  1GH8 A;  1RU2 A;  2CUY A;  3J7Z T;  3VGV A;  2OIH A;  2LQ8 A;  1LW0 B;  3MAA A;  4RKU C;  1RI7 A;  1S9G A;  3OBI A;  1SPB P;  4LF1 A;  2VC0 A;  3C16 A;  3V4I A;  5F0U A;  4NPO A;  4N77 A;  4CM2 A;  3RGI A;  1I1G A;  4D3G A;  4NX9 A;  1WTF A;  3Q86 A;  5JJB A;  1GT8 A;  1B0T A;  4RW8 A;  3PRB A;  1YX2 A;  1LKZ A;  2HVD A;  4DDF A;  1HYS A;  2PMW A;  3AA9 A;  4ZN1 A;  2Y8Y A;  2Y1R I;  2UUW A;  1EET B;  2QYG A;  1PC4 A;  2DVI A;  3KLI B;  8ATC B;  3NNA A;  4LBP A;  2E5L J;  2QLW A;  4TYB A;  1H74 A;  2JVO A;  2QIF A;  3ZO7 A;  2DNO A;  1NO8 A;  2C3M A;  3DGV A;  3LAN A;  5GMD A;  3QJJ A;  3PJX A;  1T03 B;  5IT9 Y;  4OJH A;  4ZKA A;  2KZM A;  1AZS A;  3J80 Y;  3GJR B;  4UQT A;  3RZA A;  3W9H A;  3KJQ B;  4IG0 B;  5A8R A;  1U48 A;  4LF7 F;  3HSZ A;  2W24 A;  2XCA A;  1YRX A;  4N8N A;  1NPR A;  3RAX A;  1KHV A;  3ZZP A;  1QAX A;  2KT5 A;  3C8Y A;  4ZS6 A;  1IKY B;  5IT4 A;  3V4M A;  4CYU A;  5D6G A;  1N5Y B;  2FVP A;  2VBX A;  3QGP A;  2CA9 A;  2HFU A;  4ZOS A;  3CUN A;  4B9S A;  3G71 S;  3U02 A;  1NKB A;  4GRS A;  2LQB A;  4XDC A;  4NML A;  1UPM B;  2R8J A;  4OYZ A;  3QSI A;  3BZQ A;  3JTP A;  4B3T F;  3RAM A;  3MD3 A;  3RTV A;  3QLH B;  2ZJQ Q;  2ROP A;  4DV1 F;  1H0H B;  1S6U A;  2K3I A;  4Q7A A;  4HDH A;  4DUT A;  5CQG A;  3QID A;  3D6T B;  4K0K J;  2HGM A;  3I0R B;  2KVI A;  2P6T A;  3M8W A;  1PIE A;  3X3U A;  3K5N A;  2ZH6 A;  2MJU A;  1B0P A;  3AA8 A;  2W7O A;  3ISN C;  1HQU A;  1SCJ B;  2X3G A;  3HHL C;  3PYG A;  5B08 A;  1E6V A;  1HNW J;  2M5Y A;  2XB2 D;  1SJ1 A;  1EKS A;  5EWG A;  3T3F A;  1N6Q B;  3A13 A;  4ZHR B;  2GFF A;  2XNR A;  2ZOF A;  5KFL A;  3ZZR A;  3FQK A;  1EAR A;  1M5P C;  4YDX A;  3KYL A;  1OIA A;  2BKP A;  5LSO A;  4F26 A;  2YWH A;  5HSP A;  2J9D A;  1UVK A;  2QMU B;  3FRZ A;  1N34 F;  1X4H A;  4F04 B;  2EW9 A;  3W66 A;  3M9M B;  1SUQ A;  1SJ4 P;  2J7K A;  2P9C A;  2DIV A;  4ZIV A;  1N5T A;  1WI8 A;  4FYV B;  4K8R A;  4R0J A;  2R7T A;  1LWC A;  1WG5 A;  4QIW D;  4KY3 A;  4C3L A;  2IIH A;  3ET6 B;  4DQS A;  1XTZ A;  2LQ5 A;  3CDW A;  1TVR B;  4IYQ A;  3CC4 S;  4ZP7 A;  1JLF B;  2KKH A;  5LOQ A;  3VAM A;  5B0G A;  4DS5 A;  4W92 B;  4PQU B;  3OT9 A;  5CD4 A;  4K4X A;  1DAX A;  1ZA1 B;  2F9D A;  1R0A A;  1JLB B;  1MLA A;  1S0N A;  1HHT P;  1WC4 A;  2OMO A;  2WVC A;  5JVH Q;  4F4W A;  4DFP A;  2C2D A;  5J1E A;  3NMR A;  3K58 A;  3KK3 B;  1TFY A;  4EUV A;  1ZAX A;  1TV6 A;  1WC0 A;  1RT1 A;  1Q8I A;  4EMD A;  2BJD A;  2DGT A;  2ZE2 B;  3CJK A;  1SB6 A;  2MKH A;  2NPI A;  2RDD A;  1U47 A;  2KVQ E;  3AFG A;  5LSL A;  3PX0 A;  2D74 B;  3VHQ A;  1IQT A;  1ZA2 B;  4DV3 J;  4DL2 A;  3FRY A;  2CZ4 A;  3W63 A;  2V4Q A;  4I7F B;  2DGW A;  1E6Y B;  3VZI A;  1PYT A;  2ZDO A;  3EDR B;  4ZLJ A;  1VQO S;  3RR8 A;  4UOH A;  2DH8 A;  4NYO A;  1FTR A;  2B7B B;  2BX6 A;  2DR6 A;  1RWU A;  2ZE2 A;  1XWL A;  4P2X A;  2MKY A;  1Y5I B;  2QSW A;  4WJB A;  1U1Q A;  3K89 A;  4PQA A;  3CVK A;  3CD5 A;  2AD9 A;  1T9T A;  4DPW A;  4DV2 J;  3N6L A;  3Q2S C;  5DO2 A;  5L8R C;  3AXK A;  3BDP A;  4RUC A;  3OVS A;  1TP7 A;  2AF6 A;  2Y0S D;  3H5Y A;  3SFG A;  3CJK B;  1R0A B;  4LFA F;  1VIO A;  4DR6 J;  1GMV A;  3UW1 A;  4ZLP A;  2LEC A;  2W2O P;  4X4O A;  1RWW B;  2ACY A;  2IDE A;  2OPP A;  1QAY A;  2C3O A;  5HVF A;  4F3Q A;  3MCN A;  1LWC B;  3UO0 A;  3TZY A;  3KLG B;  3AQP A;  5CH7 B;  1LK5 A;  2GGP A;  3QJP A;  5KG6 A;  3MED A;  3U1M A;  4F50 A;  4GKJ J;  4IRK A;  2AEF A;  2MKJ A;  3AOA A;  2HVZ A;  3W65 A;  3MXH P;  1JLF A;  3FK4 A;  4OZ1 A;  4WFZ A;  4EGL A;  5JXS A;  2W9A A;  1HI1 A;  4USM A;  2QFJ A;  5I3Q A;  1PO6 A;  3D2W A;  4K4Z A;  1Q79 A;  4O3Q A;  1QM9 A;  3I5B A;  4HI2 A;  1S72 S;  2L9W A;  5HI7 A;  1AA1 B;  3EZO A;  2OAU A;  3VV2 B;  3MM6 A;  1EAY C;  2OEJ A;  4HEA 9;  3SSR A;  5J2Q B;  2UUC F;  2DIU A;  2QN6 B;  2BOA A;  1SV5 A;  3S6E A;  3KLV A;  1WUU A;  2WVB A;  3B6B A;  5DS7 A;  4YQW A;  4KHR A;  5E5N A;  1Z4U A;  4QIF A;  1H3D A;  2PEH A;  1VQP S;  5MLC V;  3AJD A;  2YPZ A;  3PW7 A;  1NJW A;  2E29 A;  4WFA Q;  4LUB A;  1FO1 A;  1TU0 B;  1VRU B;  3MD1 A;  5A76 A;  3OL8 A;  3R27 A;  3JB9 k;  1WWH A;  2HMI B;  1LXN A;  4MT1 A;  3SQO P;  2VQE J;  3T5L A;  4DF8 A;  3IBF B;  3MMB B;  1B7Y B;  5AXN A;  5KG2 A;  2E1R A;  1RAJ A;  4N76 A;  1V3Z A;  2HWT A;  5SUH A;  3JSM B;  1RT6 A;  4F8R A;  1RT4 A;  3EVO A;  4N47 A;  1LFW A;  2CVI A;  1WOR A;  3TAM B;  3VWS A;  2PO4 A;  1X4B A;  3CCT A;  1R43 A;  3QLH A;  1HWK A;  1Y0H A;  1FFG B;  1YBT A;  4WTO B;  5L1I A;  1N5Y A;  2IVM A;  3PTW A;  2RNE A;  2IM3 A;  2KJW A;  2W2P P;  3AB4 B;  3VGU A;  4DSK A;  2QMX A;  1RWX B;  1KDN A;  2DH9 A;  3W5Z A;  5B0E A;  5A6P A;  1NM2 A;  1Z2L A;  4JP8 A;  3AXM A;  3VAF A;  2PA3 A;  5IQQ A;  1FWL A;  2GO8 A;  2E5H A;  2J9E A;  1SKW A;  5C24 A;  4BDP A;  2RU3 A;  7AT1 B;  2MZ1 A;  1RAC B;  2C2E A;  2D41 A;  1UJ4 A;  1S5Z A;  5ETR A;  5THW A;  2ZWO A;  1XQI A;  5EGY A;  4I6Y A;  2CZ9 A;  2HGL A;  1U1K A;  1KLM A;  1LWE A;  3CJQ A;  4FXV A;  2R7X A;  1UTA A;  3R97 A;  3I9V 9;  1V3R A;  2D3U A;  1UA1 A;  2IBK A;  1IQZ A;  3NL0 A;  2VV5 A;  3IRX A;  2A6O A;  1AXQ A;  2O5D A;  2XMK A;  2XBP A;  3EWG A;  4RW9 A;  4RNO A;  1GK8 A;  3F73 A;  5KFI A;  3I4H X;  4DHV A;  1HA1 A;  2JH3 A;  1JJH A;  5IWA J;  1FF2 A;  2DGU A;  2DNM A;  4DV5 F;  1HIY A;  5I3U B;  3ELH A;  1YWX A;  2ZOM A;  4HL9 A;  5E0O A;  3Q2T C;  2QFI A;  2DY1 A;  2QTW A;  3BDE A;  3DI6 B;  4PPD A;  5G0R B;  3TRG A;  4ATN A;  3MR3 A;  1RBO B;  5JVG Q;  1HNX J;  4WK1 A;  1VRT B;  3W9J A;  3NGR A;  2R2R A;  3GON A;  2HNY B;  1DHM A;  2DNH A;  2ZH7 A;  1M5S A;  1F5C A;  3D0I E;  5CAA A;  1K9M T;  1VQN S;  4LT6 A;  3GCW P;  1XIQ A;  2C3Y A;  3OFG A;  3T9Z A;  3D7S B;  3H5U A;  3ENW A;  3ETM A;  3FBF A;  1HL6 A;  2BM0 A;  1FXR A;  2CAD A;  4ZPA A;  1XBW A;  1NJI T;  1K1Q A;  1FRJ A;  2YNH B;  4TY8 A;  2K3K A;  3SIP B;  4NE9 C;  4XO0 A;  2CQ0 A;  2EG2 A;  4Z7Y A;  2UUB J;  2GMJ A;  2V8V A;  2F4V F;  2CQG A;  3H59 A;  3KHG A;  3TUZ C;  1TMJ A;  2ZBP A;  3HHE A;  4K2X A;  3W5Y A;  3PW0 A;  3NS6 A;  2FHM A;  2E9Z A;  1LXJ A;  3NOG A;  4LQ3 A;  2ZBR A;  3MUM P;  2BAN B;  1XR5 A;  5KAK A;  2FC8 A;  3EZ5 A;  4JI7 J;  2HHV A;  5GAD I;  3EDQ B;  4B9N A;  4BC7 A;  4CO0 A;  4CTA B;  3M8Z A;  1KN6 A;  3M2U B;  4AL5 A;  1K1S A;  4KGV B;  3OR2 B;  4Y2M A;  3FSI A;  2VQF J;  3LTO A;  4DV0 J;  2ADC A;  4E98 A;  5K9F A;  1LWX A;  4NXM F;  1BC6 A;  3HUL A;  2HZV A;  1MW7 A;  5MAO A;  2FVC A;  4DS4 A;  1J2V A;  2IPO B;  2Z58 B;  2CG4 A;  4DG1 A;  1BWV A;  1FKP B;  1TKX A;  3T1Y F;  1AB8 A;  1JXV A;  2HKE A;  3ISN D;  5IOL A;  4RUH A;  4Q0B B;  3DOK B;  2QX0 A;  4FS2 A;  2EFQ A;  3GPA A;  4PXC A;  3CCW A;  2QSF A;  2D3O R;  4IH7 A;  2ASD A;  3PXG a;  3RB6 A;  3NNC A;  3HZE A;  3LO3 A;  2RH3 A;  3R5C A;  1SH2 A;  4B08 A;  2HIQ A;  3KNA A;  1ZPW X;  1N8R T;  3GB0 A;  2MZQ A;  4H4K A;  2J6S A;  2WK4 A;  3DI6 A;  1S6Q B;  1SKS A;  2UUA F;  3AHP A;  2DNZ A;  1FCA A;  1FRL A;  3G8S A;  3H40 A;  2QL9 B;  2I9S A;  2PC6 A;  2IA6 A;  3G6Y A;  5LMN F;  4KV8 A;  3PX6 A;  3TEH B;  4DSI A;  1G2E A;  2JSX A;  4QWA A;  3VGT A;  1IKX A;  3POT B;  4HT7 A;  2DHX A;  1KLM B;  4JI3 J;  2GVD B;  1MN9 A;  3GV5 B;  4LIR A;  3FVY A;  4U8Y A;  4OYX A;  2X1B A;  1OSC A;  5LJ3 Y;  3IWN C;  1EB0 A;  2CJY B;  2M4M A;  4K2J A;  5C24 B;  2R3V A;  4UW2 A;  2GC8 A;  1FE4 A;  2CPX A;  4X65 J;  5AXL A;  1LOU A;  1NPP A;  2CYY A;  3BYR A;  3O1L A;  1RSC A;  4GMK A;  4MFB B;  5CD4 H;  3OW2 R;  2FY1 A;  1T11 A;  1RWP B;  3EM1 A;  3UD3 P;  4CLP A;  2LU1 A;  1RTI A;  2YX7 A;  5GME A;  1CUL B;  1UVJ A;  4DV4 F;  1UEU A;  1KKH A;  4J37 A;  1S1W B;  1JQG A;  4M5H A;  4E2F B;  1VQ6 S;  3CMQ A;  2JEI A;  4PUO B;  2PT0 A;  2UVU A;  3M6W A;  2PSZ A;  3UPF A;  3ZXW A;  3CJ0 A;  4KHP F;  2R8K A;  1UET A;  2R8I A;  4HR2 A;  2O67 A;  3M4X A;  3FEX B;  4HH1 A;  4ILM A;  1AUS L;  3QGH A;  1C4C A;  3L09 A;  4C0O C;  1T05 A;  4B3O B;  2QZ8 A;  3FEZ A;  3SCL E;  2XO6 A;  3J7A N;  2ZWP A;  3OTE A;  4KBI A;  5KT2 A;  5C2C A;  3A3O B;  1FRI A;  3ITH B;  2MYF A;  2VPW B;  2K1R B;  2W8L A;  2N4D A;  2D1C A;  3G82 A;  1TL1 A;  4YN3 B;  1JLE B;  2KU7 A;  4Y2A A;  5KFB A;  1NDL A;  4HVZ A;  4ZN3 A;  1RTD B;  5KFW A;  4V19 X;  2Q66 A;  2E5G A;  3DOM A;  4CH7 A;  5FJ4 A;  3W8G A;  1RT6 B;  3JSM A;  1SKR A;  1CJV B;  1WF2 A;  4MH8 A;  2BUN A;  2AEM A;  4YHH F;  1YBA A;  1PJ5 A;  2EFN A;  1U1P A;  1ZH5 A;  1HHS A;  5FDL A;  3J7Y U;  3LP1 A;  3OHA A;  1YLX A;  2DYA A;  4DL6 A;  2KFZ A;  2EFV A;  4OV1 A;  4U8V A;  5F8J A;  3BQ2 A;  3K5L A;  3MM6 B;  5J2Q A;  2DGQ A;  2JEJ A;  1AT1 B;  1LQ9 A;  3PHE A;  2KDO A;  4I6A A;  4F7V A;  3PKY A;  1X60 A;  3H25 A;  1NJZ A;  4C8K A;  4JI1 J;  3JSY A;  1VQL S;  3E8O A;  1S1W A;  3TR5 A;  3UWT A;  4OHV A;  1KBR A;  3R5J B;  1J27 A;  2F3J A;  2XMM A;  2ATC B;  2CFX A;  2E1M C;  3TAQ A;  3CME S;  1XMB A;  2EBE A;  2VPX B;  1UP1 A;  5F41 A;  1RA7 A;  5L46 A;  3M2V B;  2Y9H A;  4ZJQ A;  2H5J B;  4URQ U;  4JI6 F;  4C48 A;  4Z7C A;  2YQ3 A;  4NAS A;  4DI6 A;  5G4D A;  4ECZ A;  4Y0F A;  1ZTT A;  3E01 B;  1W2I A;  1VBZ A;  2HND A;  4ID5 B;  3H20 A;  5HLF B;  1U1N A;  3MR2 A;  3QAU A;  1T9X A;  1RT5 B;  1KWM A;  3D0H E;  4CP5 A;  4I1T A;  5IV4 A;  3SI8 A;  1FJG J;  4GVB B;  3NOC A;  2YVS A;  1R89 A;  3NGT A;  2E9R X;  2GML A;  3D28 A;  4WIQ A;  2KM8 B;  2XWY A;  3CIM A;  3HHK A;  4P7T A;  3W8P A;  1C2P A;  2DXD A;  5KFC A;  1CVJ A;  1SH0 A;  1HQE A;  3I5A A;  4DR4 J;  2B0G A;  4LRA A;  2BV3 A;  3CT9 A;  3B4M A;  5FLX U;  3FQL A;  4EWT A;  1OWX A;  4Q8F A;  1UVN A;  4QW8 A;  4DN9 A;  3KK2 B;  2A3J A;  3MCO A;  3QT8 A;  2NYI A;  2HBZ B;  1G7C B;  2OPR A;  3H8Y A;  2YNI A;  4NLU A;  4O44 B;  4ZMM A;  3GV8 B;  1WHY A;  1YJN S;  1N48 A;  2X1F A;  4LR8 A;  2HLU A;  2OI2 A;  4NXN J;  1YHQ S;  1U1M A;  2O1P A;  3DHW C;  2D3O 1;  2Y3Y A;  1TKX B;  3TA1 A;  1FKP A;  2HRY A;  2DIS A;  2WOM B;  4RBV A;  4ZPC A;  2AGP A;  1WG4 A;  4G1Q A;  2M7S A;  2XMU A;  2IHR 1;  3LAL A;  4UF4 A;  2OTJ S;  1VS3 A;  1CJU B;  4R0E A;  1NU4 A;  1M5O C;  3MZI A;  1HQE B;  5KFH A;  2YKA A;  3N0V A;  2IAJ B;  2YH0 A;  3NGK A;  3WX8 A;  2XMJ A;  5KFE A;  4C8L A;  4LF4 J;  3KK3 A;  4OZL A;  2G2Z A;  2RS8 A;  4RU2 A;  1FWP A;  1JLA B;  3TYT A;  2CG8 A;  2VA3 A;  1I94 J;  2BAC A;  4J9P A;  4JI4 F;  4CLF A;  3M2R A;  2M2B A;  1IWA A;  3AD8 C;  4CLL A;  4B9U A;  2HHQ A;  1QE1 B;  2R2U A;  1ZAV A;  2CPJ A;  1O51 A;  4GKK F;  4EBC A;  2KM8 C;  1YVF A;  4XAK A;  4BC9 A;  5LT5 A;  1DQ8 A;  4CLW A;  3KG4 A;  3OPK A;  5J1E B;  4B9L A;  4DR6 F;  1N33 F;  1XK8 A;  2QE5 A;  2UZA A;  1RA6 A;  2MJN A;  5J1P A;  1NK0 A;  1D9F A;  1CBK A;  2BKO A;  2CNL B;  2WB1 D;  4Q2M A;  1IN0 A;  4J9Q A;  1J5E J;  4B9M A;  4JYA J;  4MKB A;  5ITH A;  1TL7 B;  3HD1 A;  3SSS A;  3FGV A;  1RE1 B;  2H4Y B;  3ZZY A;  4C8N A;  2MGZ A;  5KFV A;  3Q8R B;  1D8Y A;  5C2G A;  2BE7 D;  3BR9 A;  1FT8 A;  1HNI A;  2FTR A;  4IDK A;  3MOZ A;  4MK9 A;  5DZ7 A;  2HBR B;  5HMX A;  1HBO A;  3PAC A;  2BA9 A;  1Q4R A;  1FER A;  1N5Q A;  2EXU A;  3BQ0 A;  1T9Y A;  1APS A;  5KT5 A;  2JZ5 A;  4CLY A;  2CQC A;  1E6V B;  4E0D A;  3AB2 B;  3ZTP A;  4DV1 J;  4BS2 A;  3MGJ A;  2UUC J;  5IQ6 A;  2ATL A;  1RTJ A;  3AY0 A;  2V34 A;  2WTF A;  2KTQ A;  4AUK A;  4ED5 A;  1SL2 A;  3CDU A;  3QSY B;  1YJV A;  1LWE B;  3LP1 B;  2EC2 A;  3IM8 A;  3ZTR A;  4AL7 A;  2IMW P;  2C2K B;  3MM9 A;  4U67 Q;  3T1H J;  2XS5 A;  3AOB A;  4AFF A;  4IOB A;  2IJF A;  5E3P A;  1WNE A;  5KFX A;  1RTD A;  2R7S A;  5AE1 A;  4JI5 F;  4ECU A;  2MB0 B;  4CLT A;  2MQL A;  1FA0 A;  3GFH A;  4CH0 S;  4MKV A;  4NA3 A;  4ETZ A;  1U4B A;  4ERD A;  4A4J A;  2RS2 A;  3NLC A;  2GNK A;  4I2Q B;  1WG1 A;  3D68 A;  1HPZ B;  3AD7 C;  4JI2 F;  3WX4 A;  1YZ6 A;  1R8P A;  4I2Q A;  5EDW A;  1F3V A;  3CW2 C;  2HHW A;  1UZH A;  2RQM A;  4DR5 F;  2V68 A;  2FVS A;  4MK8 A;  5DET A;  5KT3 A;  3DRP B;  1MSW D;  3CO0 P;  1U1O A;  1K44 A;  3JQJ A;  2KB2 A;  4MFB A;  1NDK A;  2N7C A;  3CMA S;  4TU8 A;  4UOC A;  2Y8W A;  2ZZN A;  1NLK L;  2JC0 A;  2W2Q P;  5BYR A;  3QRR A;  1MRO B;  1U0H B;  4FYW B;  2GS8 A;  2QLB B;  2ZUG A;  4G1I A;  4L3N A;  4MK7 A;  1IBC B;  4W98 A;  3D1Q A;  1R27 B;  4NI2 B;  4WP3 A;  4QW9 A;  2Y1I A;  3R6G B;  2MQO A;  4OL8 A;  2J8A A;  5DG7 A;  1RT3 B;  6AT1 B;  3POT A;  4C8O A;  5KFM A;  4WE1 A;  3SFU A;  4TLQ A;  2HYI B;  4B3S J;  4P72 A;  1H38 A;  1U1R A;  2C2N A;  3FCW A;  4J9N A;  2VBY A;  2VG5 B;  3NCP A;  3KMS A;  2H5E A;  1VBK A;  2WON A;  3BF4 A;  2XGP A;  3MCS A;  1IKX B;  1WSV A;  5FD1 A;  2DGO A;  1VIX A;  1AUD A;  4C8Y A;  1KVI A;  4DV3 F;  2H48 B;  1QDU B;  3OTC A;  4UUX A;  4OZJ A;  3VR1 A;  4DCO B;  4M95 A;  5J1N A;  5ETS A;  1FKO B;  3SDE B;  4Q45 A;  1FRX A;  4UY8 T;  3Q22 A;  3V4I B;  3BGR B;  3LP2 B;  2ZH8 A;  3KLH A;  5FII A;  1JIH A;  1R8H A;  2DB1 A;  4KKO B;  4TQR A;  3RR7 A;  2FDN A;  2MQ8 A;  5HP1 B;  2IJR A;  4O3N A;  2FHK A;  3DRR A;  3CD0 A;  3UCG A;  3PIP Q;  4X66 J;  4DV2 F;  4RZR A;  3GZ7 A;  4RW7 B;  3L7P A;  2J6U A;  5HVG A;  2HHT A;  2PI5 A;  1REV A;  3NAH A;  2JDJ A;  2DPI A;  3S01 A;  5E3C A;  3DC2 A;  3H7H B;  3TWZ A;  5KFZ A;  2X3D A;  3L7O A;  3C14 B;  2BE2 A;  2EKY A;  3GU0 A;  1X4C A;  3NBP A;  1REG X;  2F5G A;  2DO0 A;  1SH3 A;  2V63 A;  5ETO A;  4A47 A;  4RW4 B;  2U2F A;  3KLE B;  2IAJ A;  1Y5N B;  4FDF A;  3SQG A;  3TI0 A;  2H65 B;  1M0S A;  2DCL A;  4CM0 A;  2G4B A;  3BBB A;  4QWD A;  2XLJ A;  2RF2 A;  2V69 A;  4G6V B;  3MPU B;  3F0N A;  4U7U D;  4ICL A;  4NLP A;  1NRK A;  2JFD A;  2OHD A;  2DPJ A;  1K0T A;  3GIM A;  1JLQ B;  3K7R A;  3W9I A;  2G1H A;  3QFW A;  1RT7 A;  5JUM A;  1S1X B;  2DGS A;  3Q8V A;  4L76 A;  2XGQ A;  3HM9 A;  4CLZ A;  1JLG B;  2BJ7 A;  4WZQ A;  2IRY A;  1CSJ A;  2AJ0 A;  2XMW A;  1Q7Y T;  3C6U A;  4PG4 A;  2XZT B;  4JV5 F;  3IGN A;  4TYA A;  1KR4 A;  3KFW X;  3PHT A;  2LP4 A;  3PDN A;  1SJQ A;  4FYX B;  4JI0 F;  4NLQ A;  2HS3 A;  2RT3 A;  1HWI A;  4A46 A;  3NRB A;  2ZD1 A;  3QGG A;  1KTQ A;  2AIR B;  2C2R A;  1FXD A;  3EVW A;  1HMV A;  3DHX A;  2KXH A;  2MY7 A;  2JX2 A;  4YOE A;  5C42 A;  1HBN A;  2WCX A;  3JTO A;  4OI4 A;  3CCE S;  2QGF B;  4CZC A;  4M5D B;  5D0R A;  5DDO C;  1TL3 B;  1UWB B;  2RRN A;  2V5H G;  3DLG A;  3R3T A;  2DTJ A;  2QL7 B;  2HVE A;  4ID5 A;  4J9L A;  1UA0 A;  2AJ2 A;  2VC1 A;  2ZBI A;  3I0S B;  3IFE A;  4OJ1 A;  4CO2 A;  2IDL A;  4EO8 A;  3PX4 A;  3C46 A;  3CD6 S;  4N56 A;  4ANE A;  1HI0 P;  1KRP A;  3GLJ A;  4JI3 F;  4DPO A;  4DU8 A;  1UAW A;  2XZD B;  3M2V A;  3ZNU A;  1BQN A;  2RUG A;  1XMO J;  3M6X A;  4QIE A;  1TK5 A;  4XIU A;  1YI2 S;  4ZVP B;  4LSN B;  3HVT A;  5C25 A;  2B4P A;  3HT3 A;  3KUG A;  1Q78 A;  3NGU A;  4R25 A;  3DFE A;  4HI1 A;  3DGP B;  1UL3 A;  2XEX A;  2KXF A;  3DLE B;  3AJ2 A;  3HZG A;  2NCK L;  1N4L A;  1JX4 A;  1VQK S;  4LF7 J;  1HD1 A;  4A8Y A;  2C28 A;  4NZ6 A;  2W4P A;  1EZZ B;  4B3M F;  4LRD A;  3WQP A;  2VKZ G;  1Q8L A;  2GAG C;  3QYY A;  5ETT A;  1YJR A;  5GAE I;  5LSR A;  3UD4 P;  4DR2 J;  2BQ3 A;  2C2Z B;  2ABY A;  4D3H A;  1I3O B;  3IGV A;  1LWF A;  3OVA A;  4LVN P;  4QR1 A;  1WF1 A;  1WKL A;  5D78 A;  3UCU P;  2K7J A;  4CH1 A;  1W7W A;  3JYT A;  2UVR A;  3MMB A;  3HKW A;  4WP9 A;  3H42 A;  3KLF A;  4G3I A;  2E7X A;  1WC6 A;  3I0R A;  1FVQ A;  1XEZ A;  4ED4 A;  4LFC F;  2CQ2 A;  4B3S F;  2K1R A;  1RAG B;  1RTZ A;  2J9D E;  4I6W A;  3SCK E;  1VQS A;  5J2M B;  3TVK A;  4ES1 A;  5B09 A;  5A6W A;  1IVZ A;  4H4O A;  5HN0 A;  1U6F A;  1EJ7 L;  1MWY A;  2PDA A;  2H3E B;  4X64 J;  1Q7L B;  1F0X A;  4DL0 C;  3BGL A;  1T7P A;  2ZZM A;  1QD1 A;  4PWD B;  4O0I A;  3CJT A;  1N52 B;  3GG1 A;  1XMQ J;  1SL0 A;  1TUW A;  3I9Z A;  4AXJ A;  1SKU B;  3DM2 B;  3NCR A;  3U1N A;  1YJ9 S;  2B9X A;  2LXF A;  4I64 A;  3RBX A;  3UDC A;  2E1P A;  5F8N A;  4O23 A;  1OY8 A;  2E7W A;  3D3C J;  1SV5 B;  5L1L A;  1RTI B;  2QL5 B;  4G65 A;  2R8H A;  3W1Y C;  2I8E A;  3BRE A;  5B0F A;  4IG0 A;  5F3T A;  5CZV A;  4UOF A;  3V6D A;  4NCG A;  4P9S A;  3D9B A;  3PY8 A;  2UP1 A;  3MED B;  3I87 A;  2I6W A;  1VBX A;  1SQE A;  5KFA A;  1NJY A;  3TA2 A;  1A6L A;  1RLC L;  1U24 A;  1U8W A;  3IR7 B;  1XER A;  2AYM A;  3NY0 A;  5KG3 A;  4CO1 A;  2ZHB A;  4ED7 A;  4USH A;  1U2F A;  4K4Y A;  3SV4 A;  5L39 A;  3G8Q A;  1WKK A;  1VI7 A;  2AJQ A;  2PFD A;  4I67 A;  1D9D A;  3HT0 A;  4YY3 F;  1F5A A;  1VDH A;  2VU5 A;  2WBM A;  3ULH A;  2F7V A;  3PZP A;  3MR5 A;  3GMG A;  3Q89 A;  4IH5 A;  1M1G A;  4EFA C;  3MR7 A;  4BWJ A;  1RP5 A;  2N7Y A;  2MPU A;  4OJG A;  4O4G A;  3V81 A;  1QVF R;  5DM7 Q;  5E7O B;  3UFC X;  4I2P B;  2ZM6 J;  1S79 A;  4TY9 A;  2ZC3 A;  2ZNY A;  4LF5 J;  4I4B A;  4WFY A;  1S7I A;  2BAB A;  4ZVH A;  4DSL A;  4QYR A;  1ULR A;  3DOK A;  4NLY A;  1N32 J;  3TZZ A;  2JOQ A;  4U9R A;  2CJB A;  2IVY A;  1JLQ A;  2EK1 A;  3NCQ A;  3FC9 A;  3IM9 A;  3U27 A;  1HW9 A;  3M32 A;  3HFK A;  3Q8U A;  2X1G A;  2KN4 A;  3VTI A;  1VBY A;  2DR8 A;  3KOA A;  4RBT A;  1NHV A;  3M1V A;  3D66 A;  1PGZ A;  3WZ0 A;  5CYJ A;  4J9K A;  4LRB A;  5AE2 A;  3DLJ A;  1S6P A;  3LP0 A;  3OFF A;  1FEE A;  3VCD A;  2NLW A;  3NBP B;  3K8W A;  2B5J B;  3MEG A;  3FNN A;  4B3R J;  1JLB A;  1PAU B;  1W26 A;  4TVA B;  1RHK B;  3ZFV A;  4QWE A;  3GQC A;  4ECW A;  3T5K A;  3C19 A;  2ERR A;  4JUZ A;  3V2U C;  1IBL F;  5LXY A;  1REV B;  1WOP A;  4DUY F;  4X4T A;  4QYZ K;  4C0H A;  1TV6 B;  1ELO A;  2DEJ A;  1KNZ A;  3UE2 A;  2HW3 A;  2NPF A;  4DN0 A;  1F9H A;  1FHT A;  1X4D A;  3CCL S;  2C2O B;  2CQP A;  3NS5 A;  2N82 B;  2AQ4 A;  1SUQ B;  1NUE A;  4QOT A;  4DV6 J;  3ILO A;  4DSJ A;  3IR5 B;  3H90 A;  2J0X A;  1D3W A;  2GHP A;  2NYH A;  4LR9 A;  5HAT A;  4C3K A;  1X4G A;  2FGO A;  4J91 A;  4M5J A;  2MXY A;  3P96 A;  2H5I B;  3PFO A;  5L9X A;  3WDO A;  1DAR A;  3LUY A;  3MMC A;  1RU1 A;  3PW5 A;  3A3N B;  3ADA C;  4X62 F;  1C1B A;  1T0T V;  1FNM A;  1BMQ B;  2P6S A;  2KFY A;  1UW4 A;  4WWS A;  1RYR A;  3GWC A;  5KFD A;  3TX0 A;  1GMU A;  2H4W B;  2HS0 A;  5I3P A;  3UN2 A;  1FRK A;  1S1T A;  5F9L A;  3OFH A;  2V9W A;  2AZ1 A;  4PWD A;  2XTJ P;  1KQG B;  1MNE A;  2DNP A;  2YX1 A;  1NH8 A;  5T7L A;  1VQ9 S;  1NB2 A;  4EYH B;  1EKR A;  1AFJ A;  4CWB A;  2PA8 D;  2HZA A;  1SC1 B;  1JJ2 R;  2V4J A;  1UW9 A;  4DL4 A;  2OTL S;  2M52 A;  2RE1 A;  4RU9 A;  1IBK F;  5M2P A;  3W2V A;  3ZZO A;  1TL1 B;  2B4U A;  2YQ0 A;  4ZHR A;  4OV6 A;  3EPG A;  3GSI A;  2YH1 A;  4AQY J;  1N6Q A;  4QU7 A;  3R6L B;  3GIR A;  2W7P A;  3K5M A;  2Z56 B;  5D0H A;  3MOJ B;  1MRO A;  2FLO A;  3HX9 A;  1DTT B;  2HAI A;  3RG6 A;  2IVF B;  4DR3 F;  2DJW A;  4QWB A;  1S1U B;  1BQX A;  2ZNZ A;  2BOP A;  4P10 A;  1WC5 A;  4YEA A;  4DR1 J;  2J76 E;  2HLT A;  3D0G E;  1URN A;  4K4S A;  1FVS A;  2LVW A;  3UDV A;  3N4W A;  2V2Q A;  3ZZZ A;  3E3X A;  5LM7 E;  4WII A;  1MWZ A;  3PYE A;  2NR0 A;  4C9D A;  3VQT A;  3NNH A;  1JLC B;  4IFV B;  3TAM A;  5EX0 A;  2F8M A;  1QLN A;  3FCV A;  2D3Z A;  2AHO B;  1TKT A;  1X4F A;  3I32 A;  2LA4 A;  1NK7 A;  1T03 A;  4RW6 B;  2E5L F;  3DRS B;  3TZX A;  4P2S A;  1IKW B;  3L9Z A;  4PYA A;  1FJG F;  4RUB A;  1FD2 A;  2E7V A;  1NDP A;  1XN9 A;  2CQD A;  5T7L B;  5AXM A;  3MPV A;  2FLL A;  1F9E B;  4Y34 A;  1DLO A;  7FD1 A;  4F36 A;  1PBA A;  5HRO B;  3MFH A;  1U1L A;  2BDP A;  1Z1Z A;  4WTY A;  2ZH9 A;  1S49 A;  4KV8 B;  4WYW A;  2BJE A;  4ID8 A;  2YKM B;  4JI8 F;  3IC1 A;  3MEC A;  2A10 A;  3CC2 S;  6FDR A;  1M5K C;  1F3F A;  1UJ6 A;  3FSY A;  2ROE A;  2QJ3 A;  4ER8 A;  4OI6 A;  5B0C A;  3CCS S;  3OVB A;  2DRA A;  3RBD A;  2QV6 A;  2OO4 A;  3EVM A;  4KPC A;  3DLB A;  3WC2 A;  3TUP A;  3VGS A;  1T9W A;  2AKW B;  1M1K T;  3NXZ A;  5D0E A;  1U2R A;  1YZ7 A;  4HT5 A;  5IWA F;  1XNR F;  1OQ3 A;  4E8U A;  3KK1 B;  2DD8 S;  1N32 F;  3PYD A;  2AEJ A;  3B78 A;  4DXL A;  3OJU A;  2Z8Q A;  4BCA A;  2DRB A;  3CCM S;  3UN3 A;  2A2D A;  2EK6 A;  2KT2 A;  3EIC A;  2W9C A;  3DXB A;  2FUG 9;  3TJ8 A;  3H4B A;  1W2B R;  3X1L B;  2BW7 A;  4QYZ J;  4H4M B;  1WDD A;  3BH7 B;  1LW0 A;  4AE5 A;  1Q16 B;  4J5O A;  3C66 A;  3ZZ0 A;  5KOW A;  4ICL B;  4A8O A;  2Y1L B;  3KDN A;  2NRE A;  4Y65 A;  4KGK A;  4LF4 F;  4K7Q A;  1G1X A;  3OUY B;  3SQG B;  2DNN A;  3MEE A;  2Y0B B;  5U47 A;  1RAB B;  1JKH A;  5J2N A;  2F4V J;  1EP4 B;  3HSG A;  3I55 S;  2RKI A;  1GXL A;  2HGN A;  2XSJ B;  3BPD A;  4ES3 A;  5LMU F;  1AFI A;  2OPS A;  2HZC A;  4LBH A;  1FRM A;  3W7B A;  4OYP A;  1VRQ C;  3N6M A;  3R1L A;  4DX8 H;  2FYX A;  1CJU A;  2DKO B;  3D6F B;  4DFK A;  2JEF A;  4ED8 A;  4IH6 A;  1IR1 A;  2FB0 A;  3CO9 A;  3DLH A;  2DHA A;  2G2Y A;  4ENO A;  1IKV A;  2MQN A;  3N28 A;  5HBM A;  4DV6 F;  1D9A A;  2AWZ A;  3KJV B;  1JXL A;  2J8S A;  1LK7 A;  4DV0 F;  4ECR A;  2CKW A;  3BGR A;  2VFS A;  3LP2 A;  2OD4 A;  3PJ9 A;  1RHQ B;  1HW8 A;  3NP5 A;  4HTJ A;  4ES2 A;  2CJQ A;  3TO8 A;  2R7O A;  3RB3 A;  4NXM J;  4NCB A;  1KP6 A;  2ASY A;  2GW8 A;  2HQI A;  2QG9 B;  3UDE A;  3OV7 A;  3PJW A;  4X2B A;  3OL9 A;  1MU2 B;  2W4D A;  2ZUA A;  4XTT A;  1VRT A;  1MWQ A;  4YB5 A;  1KVJ A;  4ZVT B;  2MZR A;  3DDK A;  3E51 A;  3QT6 A;  4FPI A;  2C22 A;  4P74 A;  1LV5 A;  1TEL A;  3S7R A;  1T8E A;  1TL5 A;  3DXS X;  1EQM A;  2VFU A;  2ZHA A;  3TAR A;  4KT0 C;  5EWF A;  3D67 A;  2BM1 A;  4F3M A;  4FVC A;  5F8M A;  3PR5 B;  4QPX A;  2BRL A;  4WE1 B;  1F9F A;  2FJB B;  1GX5 A;  3HD2 A;  2GIR A;  3EUN A;  4MIA A;  3JAM U;  2MDA A;  1ZM9 A;  1CC7 A;  2IM1 A;  4XK8 C;  1DLO B;  4OI0 A;  3ET6 A;  4ELV A;  1R31 A;  2VL1 A;  3ENV A;  2KL8 A;  1KFS A;  2EC0 A;  4CT9 A;  1YBU A;  3E01 A;  3DRS A;  2V0N A;  4LF8 J;  5M2R A;  3Q8P B;  1DFD A;  3D3B J;  2GVZ B;  3P3D A;  1U6B A;  4IG3 A;  4DSF A;  1TK8 A;  2OH2 A;  3OQ2 A;  4JB8 B;  3R8Y A;  3SSQ A;  3SV3 A;  5IT9 U;  1OSD A;  1VMB A;  2L9N A;  4J9O A;  3GYX B;  3HLU A;  1RKJ A;  2W2N P;  3I31 A;  2VF3 A;  3C2P A;  2KHC A;  1H6K X;  4IFY A;  1B99 A;  3M8P B;  4KQZ A;  4PXE A;  2EG1 A;  4USU A;  2CWK A;  2ZH3 A;  1GFW B;  1NCL A;  1FFW B;  4YR0 A;  1XNQ F;  1FWK A;  1HR0 F;  1RTH B;  4AXI A;  2ZVS A;  1M1H A;  5CCL A;  5HJY A;  5K8O A;  2LMI A;  2GJF A;  2IM0 A;  4U7C A;  1C4A A;  4I56 A;  3NAI A;  1Y5L B;  4NOH A;  4ECV A;  3C3L A;  3IBC B;  4NLG A;  4RX6 A;  4DZD A;  1Y10 A;  1FES A;  4KTQ A;  3QRQ A;  4TQS A;  4NMX A;  4C8M A;  1NJX A;  5DQI A;  2GX8 A;  3BO4 A;  3M8R A;  1R0B G;  1P1L A;  2VFT A;  1HWL A;  1VYA A;  4WU2 A;  1PCA A;  4JI8 J;  2RJZ A;  1SC4 B;  2HNZ B;  2HRU A;  2YTC A;  3RU0 A;  2KG1 A;  3LWL A;  2AJ1 A;  2EPI A;  2LLZ A;  2OFH X;  2I0X A;  2OPQ B;  1RWK B;  2VG6 B;  4ZDN A;  1RAD B;  5KFP A;  1OY9 A;  4LFB J;  1LWF B;  2RQ4 A;  1NBE B;  2GCF A;  2MLY A;  3HHL D;  3HVT B;  4LSN A;  4PYD A;  5C25 B;  3TQ1 A;  2DR7 A;  2HHP A;  3PRD A;  3BO3 A;  4OX9 J;  2DH7 A;  2HEK A;  3G6X A;  3QWU A;  4ILL A;  3N79 A;  3LQV A;  2F8E X;  4X64 F;  4EBD A;  2FY8 A;  1NSK L;  1G3O A;  5BXI A;  4NCA A;  2OUG A;  3DLG B;  4MIW A;  2EBG A;  2VBW A;  5DQH A;  1TL3 A;  1UWB A;  4KSE B;  3H2L A;  1FDN A;  2ALY B;  3B4D A;  2GVZ A;  3PG9 A;  3Q8Y A;  2GO9 A;  2VIC A;  2VPY B;  1HNZ F;  2V9K A;  3V5R A;  3I0S A;  2KHD A;  3KLG A;  2KYZ A;  3ZTQ A;  2RHS B;  4O3P A;  3QPI A;  4J90 A;  3TUJ C;  3CJ2 A;  2P2C B;  4P52 A;  1M5V C;  5IV3 A;  4DX7 A;  1MN7 A;  1WF0 A;  1EET A;  1SBR A;  1N34 J;  5KG7 A;  3JAM Y;  4A8X A;  1CS4 A;  2RDJ A;  1RLD A;  2V2V A;  1H73 A;  3IN5 A;  2B5J A;  3MEG B;  1FJC A;  1UFW A;  4DMZ A;  1JK9 B;  4YP3 A;  4DQR A;  1LNQ A;  2XNQ A;  1JMT A;  2HVI A;  2YWF A;  5ETK A;  2I5J A;  4CIO A;  3KJF B;  3M1V B;  2BKN A;  5ETQ A;  3IAM 9;  5H9E K;  5CYM A;  1BE4 A;  2V94 A;  1CC8 A;  1DQ9 A;  3HHN B;  3US5 A;  5H9F K;  2CQI A;  5BR8 F;  4ED2 A;  1KOH A;  4J9V A;  3M8Y A;  5L38 A;  1ZPV A;  1YSJ A;  2NXU A;  2VPZ B;  3GR1 A;  4IO1 A;  4B17 A;  3MM7 B;  3P4U B;  3IP0 A;  1RT7 B;  3W2W B;  4A8M P;  2OEK A;  1H98 A;  2M9K A;  2PMH A;  3OSN A;  2JHE A;  2CQB A;  4LIW A;  1WEY A;  5ETV A;  4Q0B A;  4V19 J;  3KJV A;  2W4C A;  9RUB A;  4GVL A;  1F2H A;  2BE2 B;  2ZIT A;  4P2F A;  3W61 A;  5DDR C;  4RL1 A;  4DL3 A;  2MEW A;  1NPK A;  2FHJ D;  1QAI A;  3KTQ A;  5EN1 A;  1X0F A;  1QAJ A;  4YFU A;  4M5I A;  4USI A;  1NME B;  5IC4 B;  3OR2 A;  1QY7 A;  1SC6 A;  2XSJ A;  4A8S A;  1DZ5 A;  2XWX A;  3K17 A;  4FF1 A;  1N56 A;  3J81 Y;  3C14 A;  1N0U A;  4KKO A;  4CO4 A;  3HCX A;  2VFR A;  1OPZ A;  2UXC F;  3QIP B;  1RJJ A;  1MMN A;  3LOU A;  2XMT A;  2JWN A;  5KFS A;  3PYF A;  2LCW A;  1YTY A;  1NAQ A;  3W62 A;  2JEG A;  3NEK A;  2ZHO A;  2OLW A;  3HHD A;  2WAQ D;  4O4R A;  1WC3 A;  4YB6 A;  4P71 A;  5I42 A;  2K2P A;  5C7P A;  5E3A A;  2IYI A;  2LQJ A;  5KG5 A;  2FJV A;  2NUH A;  1RBL A;  2RML A;  2HS4 A;  4H4M A;  2Z2Y B;  4ILR A;  4XDD A;  3P5T L;  4JI4 J;  4I69 A;  4RWW A;  3CJ8 A;  3R5D A;  1HI8 A;  2RIJ A;  3BBF A;  4ZVR B;  2F1F A;  1P6T A;  5HL7 Q;  2BQR A;  5EWE A;  2CPD A;  3L7U A;  1XJW B;  2RD5 C;  1YGY A;  4CCH A;  4KO0 A;  3H5X A;  1RHR B;  2GHV C;  1HR0 J;  1GMW A;  2DEI A;  5F0W A;  1LFP A;  1RWN B;  3R5A A;  3CJ3 A;  3FFI B;  3UR3 C;  3U1L A;  2H1Y A;  3Q24 A;  2YXL A;  3DCA A;  4FKX A;  1JB0 C;  1GEH A;  4LSZ B;  4W90 B;  1J5O A;  3FZB A;  5I3U A;  4NI2 A;  1R7I A;  4KFB A;  1B70 B;  1T94 A;  4OX6 A;  1VCT A;  2FIU A;  3MEC B;  2I1R A;  3SBM A;  5BYQ A;  1JJ4 A;  2GHW A;  2KZZ A;  4HAC B;  4AND A;  1UZD A;  3TJ9 A;  4EZ6 A;  1R8C A;  3EXY A;  3IRX B;  4QR2 A;  1S77 D;  1Q86 T;  2QA2 A;  4WXO A;  3IRW P;  1IR0 A;  1PAE X;  1RT2 B;  3IBW A;  5HRO A;  1JLC A;  1R6V A;  2WZ1 A;  4IFV A;  3UDL A;  5CAB A;  3J7Y I;  5HAN A;  1VQ7 S;  3K0J A;  2HHX A;  4L75 A;  3NGS A;  8AT1 B;  2F4F A;  4LFB F;  3MHY A;  3HJF A;  1P27 B;  3CWJ A;  5H9F J;  5GAE U;  3JYT B;  3JXO A;  4OI3 A;  4RW6 A;  1KS2 A;  2AP6 A;  4YME A;  4ED1 A;  2FJW A;  4KR0 B;  2PFF B;  1WI6 A;  1B4S A;  3PM9 A;  5LL6 d;  3THP A;  2DNL A;  2GAH C;  4WFX A;  3FBC A;  1BD6 A;  4C6A A;  4MYU A;  3OFE A;  1ZYQ A;  4OX7 A;  3FMB A;  3ZNJ 1;  4DR3 J;  4RR5 A;  3O5T B;  5KFN A;  2J6T A;  3CXC R;  2NQP A;  1TR0 A;  3VZH A;  2FZC B;  5JMN A;  4EI2 A;  1WAC A;  2CPI A;  1YDL A;  2C3P A;  3HDS A;  4PPZ A;  1CUL A;  5DJB A;  2F63 A;  2BJ3 A;  3F41 A;  4FBT A;  4FXD A;  3Q0A A;  2APO A;  4AT1 B;  5A8R B;  1S9F A;  3V6H A;  2UU9 J;  2LEA A;  2COL A;  4WFN Q;  1YRT A;  1C0U A;  1O8B A;  3B54 A;  3N01 A;  1WSR A;  1ZM4 A;  5A0Y B;  3TA0 A;  4R5P A;  1H7X A;  1O5J A;  2EFO A;  3SCI E;  1EHW A;  1V6H A;  2HQF A;  4FN5 A;  4F4K A;  2KRB A;  2QT7 A;  4MKA A;  2RB7 A;  1HKA A;  2OP5 A;  4LFA J;  4DR5 J;  4MAK A;  4KC5 A;  5B7W A;  2N4C A;  4JI7 F;  3CNQ P;  4WYL A;  1HBO B;  4UT4 A;  1SL1 A;  2MKS A;  2XMA A;  2CNO B;  1PJ7 A;  1HYS B;  4I0W A;  3CJS A;  2DXF A;  5C42 B;  3MMC B;  2OFG X;  2WW4 A;  4WPA A;  2DR5 A;  1HBU A;  2W9B B;  2R7R A;  1VFJ A;  4HLB A;  1YIJ S;  1RAI B;  1NK4 A;  2VOD A;  2N3L A;  1VQ4 S;  1KLN A;  4DPY A;  1TL7 A;  2BJ9 A;  3IO1 A;  1S1T B;  1IM6 A;  2VA2 A;  2HVH A;  5ETM A;  2V8H A;  3DRY A;  3FDS A;  3D54 A;  3GP9 A;  3T6B A;  3M8Q B;  3MAA B;  3EJM A;  2XSF A;  2ZH4 A;  2UVW A;  4BWM A;  1SIZ A;  1ZOT A;  3C6U B;  4KO0 B;  9ATC B;  2HQG A;  1A9N B;  2UV8 A;  2POK A;  3GYG A;  4ZK7 M;  1S6O A;  3WIV A;  4K5R A;  3GII A;  4FZV A;  3H2V E;  1QVG R;  4DR7 J;  1NSA A;  1B64 A;  3QO9 A;  2QC3 A;  2XMV A;  1RWV B;  1S7H A;  3TP2 A;  3DRX A;  2AGO A;  3J7A 1;  1N0V C;  5E2Q A;  3GFZ A;  4PG5 A;  4ZPW R;  1DUR A;  2VH7 A;  1S0M A;  1OYE A;  2G0J A;  5A8W A;  3MM8 B;  4Q43 A;  2HHS A;  1UFL A;  3CCQ S;  2AU0 A;  2UUA J;  3HFV A;  2L41 A;  4CNY A;  1QUP A;  1QE1 A;  4C8Z A;  2GV1 A;  2IA0 A;  3QIP A;  2DY9 A;  1S59 A;  1RAF B;  2LA6 A;  3OHB A;  2DT9 A;  5IC6 B;  4CTA A;  1VC0 A;  1Q53 A;  3MPD A;  1RUS A;  2ZKT A;  3L4B C;  3GG0 A;  2H9Z A;  2WRM A;  5K8M A;  2B9W A;  2F65 A;  3LH2 S;  2KYX A;  5KFJ A;  2DIT A;  3D1O A;  3UN5 A;  4QPT A;  1OO0 B;  3IXQ A;  2YNI B;  4G1Q B;  2MKK A;  2OPR B;  4HDG A;  2HG4 A;  1GNK A;  1YJ7 A;  2Q43 A;  1GTE A;  2CPH A;  4N7T A;  4PAB A;  5A2Q Y;  2WB4 A;  4A8W A;  5HP1 A;  3RB0 A;  4I2P A;  2YWK A;  1R8B A;  3EZU A;  3G86 A;  4MJK A;  5E3Q A;  3OR1 B;  3BGO P;  4FYD A;  1E6Y A;  1WEX A;  4I7F A;  4ZVU B;  3TX8 A;  4ZJL A;  5KFG A;  1HAR A;  1PBU A;  2VOO A;  2M70 A;  2HNY A;  2VBZ A;  4PZV A;  4K4W A;  1WJ9 A;  4L73 A;  2AJ4 A;  3W5X A;  2ROG A;  2XI2 A;  1CS4 B;  2NXC A;  3IS9 B;  3MM5 B;  4NZ0 A;  3DYA A;  3FCH A;  4OYI A;  1URR A;  5GAH U;  4K4U A;  3LPE A;  4NLV A;  2VG7 A;  3OSP A;  2E5J A;  2R7W A;  2MZS A;  2QO3 A;  2X7I A;  1X9M A;  3N5B A;  3MF5 A;  3CCV S;  2WVF A;  4RW9 B;  4OYM A;  3BSO A;  4Q2L A;  4C97 A;  3DOL B;  5K14 B;  3G6V A;  3PO5 A;  2GQC A;  1QTM A;  1X4A A;  4KH0 B;  1LW2 A;  2LXU A;  3HHL B;  4MMO A;  4ZCL A;  3MUV P;  1N5V A;  5HLF A;  2CJX B;  5D3G B;  1NK6 A;  5GAD U;  4NXN F;  2FVR A;  2UXB J;  2EKN A;  4YHH J;  4URS A;  2LFV A;  3HP6 A;  5KFR A;  2PE8 A;  4KGM A;  3A8K A;  2HHH J;  2RQC A;  2OML A;  1KHW A;  2NZC A;  4OLP A;  3LWM A;  4M8L A;  1VC6 A;  4K50 A;  1X5P A;  1H2V Z;  4ED0 A;  1FE0 A;  4ED3 A;  2V6A A;  1JXE A;  1U7L A;  3PEH A;  1CJV A;  4DUZ J;  4DL5 A;  3KG0 A;  3BYP A;  4C98 A;  2VG6 A;  5BYS A;  5DGB A;  2I38 A;  2Q6B A;  3DM2 A;  1NH7 A;  1SC3 B;  4JOU A;  3JSR A;  4KJI A;  1JLE A;  1R3N A;  1ZBT A;  1TMM A;  3HJV A;  3Q83 A;  1X9W A;  4OMF G;  1Y3J A;  1C0T B;  1HHQ A;  3OD2 A;  1YJT A;  4HTI A;  2RSQ A;  2W25 A;  3CIZ A;  2MKI A;  4RWX A;  1ZZN A;  5BJR A;  1FKA F;  4OX8 A;  5F3Z A;  1CJK A;  3FBE A;  5J2M A;  4B3M J;  2IRX A;  1V9O A;  1IM4 A;  3A8E A;  3G82 B;  4DR2 F;  2XY6 A;  3RAQ A;  4RO0 A;  1UEK A;  3KLF B;  2A0F B;  1FK9 B;  5KTQ A;  3KG1 A;  4O3S A;  1T95 A;  2HQC A;  5CXT A;  3CPW R;  1L3K A;  2L9D A;  3AQO A;  3GYN A;  4DR4 F;  4LFC J;  4F02 A;  4B3O A;  2HHU A;  5AXK A;  4F0K A;  2B51 A;  4LF9 J;  1I5O B;  4Y6I A;  5E3R A;  4J9U E;  5AE3 A;  2ZEJ A;  4QR0 A;  1FXL A;  3TAN A;  3A4T A;  1Q1K A;  3BBC A;  4IQM A;  3M8P A;  4M5L A;  2AJF E;  1DTQ B;  5CCM A;  4EYI B;  4L3K A;  2MGZ B;  1N88 A;  3DGP A;  3DLE A;  3BGF A;  3MTK A;  3GV7 B;  3H2U B;  2MZJ A;  1CQM A;  4M5G A;  5AT1 B;  2G0I A;  2XY5 A;  4P2M A;  4UQG A;  3MPY A;  4MIB A;  1BQN B;  1L3U A;  2IC3 A;  1HBM A;  1FJE B;  4ZCK A;  3OTO F;  2MHE A;  2VQE F;  3PKM A;  2J7W A;  1GQE A;  5HAO A;  3T9N A;  1VIS A;  2M88 A;  3DNC A;  3UI3 A;  4DU7 A;  4DBQ A;  1TZ0 A;  4WF9 Q;  1HNV A;  2B9E A;  5KFY A;  4WXW A;  2OPP B;  3PCO B;  2XY7 A;  2GVD A;  4P75 A;  1LW2 B;  1UKU A;  2H51 B;  2VG7 B;  1PSD A;  3CDA A;  1PJ6 A;  2JLF A;  3BB5 A;  4CI0 B;  4ECQ A;  4QZV B;  4ECX A;  4JI5 J;  1F60 B;  4ZVE A;  3GCX P;  1FNX H;  2NXE A;  3C6T B;  3BR8 A;  3P5B P;  4YB7 A;  1HBN B;  1HQ2 A;  2UV8 G;  2UXD F;  3QMQ A;  1V5V A;  5IT0 A;  2D7S A;  3JQM A;  3MUT P;  1SXL A;  2LEB A;  1RQ0 A;  1PIL A;  2ZDP A;  4NLO A;  2LQ9 A;  4GKK J;  3UNG C;  2OEM A;  4NLR A;  3GTY X;  3OR1 A;  2R4F A;  4DV7 F;  3WIU A;  4ZIW A;  4J9S A;  1Y9O A;  3FZ2 A;  2FLP A;  4GKJ F;  2RHQ B;  5HBM B;  3CCR S;  4PKD B;  5D4O A;  1BLU A;  1C1C B;  1S97 A;  3AJ1 A;  2OJ3 A;  1VJQ A;  4J9M A;  4M5K A;  3ISZ A;  5HMW A;  5EHH A;  1N54 B;  1RIS A;  1T9V A;  2ZVI A;  3F44 A;  4FPR A;  4DJB A;  4F4X A;  4RW4 A;  4L6V 3;  4NZ7 A;  3KUH A;  4X84 A;  3KLE A;  2YNF A;  2DO4 A;  1XMQ F;  1LEO A;  1WKJ A;  2QEX S;  2CPE A;  3MPW A;  1T9U A;  1YKW A;  5J2N B;  1WHX A;  2IM2 A;  5CA5 A;  1ZS6 A;  4FNH A;  2XO7 A;  2ZBQ A;  4FKY A;  3IA0 A;  3G6E S;  1EIY B;  1HWU A;  3QBC A;  4Q8E A;  2HUR A;  1WEL A;  2HFO A;  5B0A A;  4WP8 A;  1FX2 A;  2AYE A;  1OPI A;  4I68 A;  5ETP A;  3O8W A;  1GAO A;  4NLD A;  3G4S S;  4TY8 B;  3SYZ A;  2NXJ A;  2YNH A;  1R0C B;  2FPH X;  1L3S A;  1JKH B;  4IR1 A;  2GJ2 A;  1EX8 A;  2YNF B;  4RNM A;  1HFE L;  2J9C A;  1MML A;  3ILL A;  2HFN A;  5HK4 A;  5HQL A;  3P45 B;  3I56 S;  5EUH A;  5HMY A;  2CAJ A;  2HND B;  4WKR A;  1DQA A;  3DRR B;  4GO7 X;  4OIX A;  5B0D A;  5IXU A;  1NND A;  4F2R A;  3VAI A;  2FC9 A;  2BW2 A;  3I4P A;  3ONQ A;  3HVA A;  1I94 F;  5G0R A;  2XG8 A;  3OLB A;  5I4M A;  1IBL J;  4X66 F;  1ARO P;  2XHW A;  2KH9 A;  2GJI A;  5L9N A;  2VG5 A;  1FKO A;  3SDE A;  3BH6 B;  2MQP A;  4NLS A;  2Z57 B;  2PN6 A;  4X65 F;  3EMT A;  2YKM A;  4OQJ A;  4U7U K;  1S48 A;  3UNY A;  1S4E A;  4DX6 A;  2K7K A;  3KK1 A;  2R2S A;  3PNI A;  4TN2 A;  5K20 B;  3FBB A;  4ZCM A;  2MLZ A;  3D1H A;  2DNG A;  3R7N B;  3D6M B;  3VVT A;  3JS9 A;  1U09 A;  4X4Q A;  3MR6 A;  4J9R A;  3A3P B;  3OTB A;  4PXD A;  5FDL B;  2XLK A;  2BYC A;  1ICE B;  3ZTS A;  2LU2 A;  1SQG A;  3DDI A;  3T5J A;  1VHI A;  3CB4 A;  4HHJ A;  2YWG A;  3N6N A;  1BXN A;  2RQK A;  4OYW A;  4LRE A;  4IFY B;  3QZ7 A;  5A8K A;  4OHZ A;  3HXM A;  2VJU A;  4LBI A;  4A8Q A;  3GFY A;  2WSE C;  3G96 A;  1NKC A;  3ENA A;  2O3D A;  2AMC B;  3T19 A;  3VF0 B;  5J2P B;  2B4V A;  3AH6 A;  3PW2 A;  4ZLL A;  1U0H A;  1HPZ A;  4OZ5 A;  4R5P B;  5A0Y A;  3CUL A;  3BKT A;  3TUI C;  3SXL A;  3EX7 B;  2MSS A;  1YRU A;  3BM7 A;  1F6T A;  2HK3 A;  5KFU A;  3UD5 A;  3DLL Q;  2JLE A;  3DRP A;  2FJA B;  1TKZ A;  2QRR A;  1VQ8 S;  3J80 U;  3KKF A;  4IKA A;  2XS2 A;  1DTT A;  2BVZ A;  3RBZ A;  3BSN A;  2FLN A;  2ILZ A;  1P9Y A;  3GR0 A;  4AL6 A;  1HNW F;  4X4P A;  3MM9 B;  5CZX A;  4KH1 B;  4WK3 A;  4WFB Q;  3W3S A;  2X51 A;  4TU9 A;  4PCQ A;  2DNQ A;  4OI1 A;  3UVJ A;  3QZ8 A;  2P9G A;  1S1U A;  3W2V B;  4X4U A;  1RB0 A;  4IO9 Q;  4DR1 F;  1NK8 A;  2NUU G;  5DZ6 A;  1RT4 B;  2KT3 A;  1RAE B;  2ZKU A;  5D4L A;  3VAL A;  3H5S A;  4F3O A;  3AOC A;  3O6Q A;  4ETX A;  3PV8 A;  4PG7 A;  5GAH I;  2D9O A;  4FVM A;  5J2P A;  5D77 A;  1TL4 A;  3TZW A;  3THV A;  5ADZ A;  2QLF B;  4EU0 A;  1V3S A;  3SZ2 A;  2CPZ A;  1VK8 A;  1U2C A;  4PG8 A;  3D6H B;  1NHK L;  1Y7P A;  3JTN A; 
#chains in the Genus database with same CATH homology
 1TMM A;  1HKA A;  4M5N A;  5ETO A;  3UD5 A;  4CYU B;  3MCM A;  5ETP A;  3ILO A;  4M5G A;  3HD2 A;  1RU2 A;  3HT0 A;  3ILJ A;  3MCN A;  4M5H A;  1EX8 A;  1Q0N A;  4M5I A;  5ETT A;  5ETK A;  1CBK A;  3HSZ A;  4M5J A;  5ETS A;  5ETQ A;  1DY3 A;  3ILL A;  1EQ0 A;  1RU1 A;  3HD1 A;  4M5K A;  4PZV A;  2BMB A;  3HCX A;  4CRJ A;  4CYU A;  1RB0 A;  5ETR A;  1IM6 A;  3UDE A;  4F7V A;  1RAO A;  5ETM A;  2F63 A;  3KUH A;  3HSJ A;  3IP0 A;  3ILI A;  3HSD A;  1KBR A;  2F65 A;  3KUE A;  4M5M A;  5ETL A;  3UDV A;  2CG8 A;  3HSG A;  5ETV A;  4CWB A;  1RTZ A;  2QX0 A;  1G4C A;  1HQ2 A;  5ETN A;  3MCO A;  1F9H A;  1TMJ A;  4AD6 A;  3QBC A;  1EQM A;  3KUG A;  4M5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...