2F65A

Solution structure of hppk in complex with inhibitor analog ampcpp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
158
structure length
158
Chain Sequence
b'TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Solution structure of HPPK in complex with inhibitor analog AMPCPP
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 18
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2005-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 2f65A00
1Q0NA 3HCXA 3ILOA 4M5GA 5ETRA 3KUEA 3ILJA 3ILLA 5ETTA 1RTZA 1RU2A 5ETLA 4M5MA 4CRJA 3HSZA 3ILIA 5ETMA 3HSJA 3KUGA 1F9HA 3MCOA 5ETQA 3MCNA 1G4CA 1HQ2A 1EX8A 4M5LA 2BMBA 2CG8A 4M5JA 1KBRA 1RU1A 2QX0A 3HD2A 5ETSA 3UDEA 4CYUA 4M5KA 4CWBA 1TMJA 3KUHA 3HSGA 4M5HA 5ETKA 3IP0A 1DY3A 1IM6A 3MCMA 4M5NA 4PZVA 4F7VA 1RB0A 5ETNA 5ETPA 1CBKA 4M5IA 4CYUB 3UD5A 1RAOA 2F63A 1EQ0A 3HT0A 5ETVA 1EQMA 1HKAA 3HSDA 3HD1A 5ETOA 3UDVA 4AD6A 3QBCA 2F65A 1TMMA
chains in the Genus database with same CATH superfamily
1B64A 2MDAA 2KZMA 3M9OB 2VQEJ 2VDIA 2FLOA 3UD4P 4DV2F 1WWHA 2R7QA 2RF2B 2G4BA 4LRBA 4I7FA 2Q6CA 3C15B 5E3QA 3N6LA 4LR9A 3MMAB 4P9SA 2EXUA 1IBLF 3QIPA 2XLJA 4U8YA 2KM8C 3T5HA 4K4UA 1F9EB 5A8WA 1LWFB 3U7JA 2DNOA 4Y3CA 1TVRB 4M63A 4R8UA 3TO8A 5KT4A 2CJBA 3CJ3A 1S0VA 4KKOA 1NCLA 2OPSB 3KK1B 3M8WA 3UD5A 2M4MA 4ERDA 4YR2A 3DRXA 3HDSA 5KG2A 4NYZA 3CNQP 4A8YA 4B3SF 1EKSA 4DSKA 4DQSA 5KFJA 1S6QA 3CULA 1S1XB 3CSKA 4LF5J 4OYAA 5E33A 1S6PB 1QDUB 3UFCX 4CLZA 4ETXA 5AXNA 2GAGC 1Q86T 1AFJA 4TYBA 1X4DA 3W2WB 4GKKF 1DTQA 4P71A 4P52A 5HSPA 4O3SA 2GMHA 2DEIA 1XERA 3M8SA 2JZ5A 3O1LA 2L3MA 3DMJA 3VAGA 1NHKL 5B0BA 3IG1A 4H4KC 4KGMA 4O0IA 4NYPA 3M6VA 2ZKUA 2OD4A 1EAYC 1F3VA 4G65A 5GADI 3DLJA 1RTDB 4N56A 2GO9A 3SQGA 3CJTA 4DJBA 1XMBA 3NEKA 5KOXA 4C0OC 1IKVB 3PYEA 1WOSA 1S1TA 5K14A 3AY0A 4YDDB 1Y0HA 3LWLA 4DR2F 1FKOB 1NSPA 2V8PA 1WHYA 1HHSA 5EWFA 4ZN1A 3LWMA 3HHLB 5JXSA 3KKFA 1LWEB 4NMLA 4ED4A 4Y2KA 2U1AA 3F0NA 4MYUA 2X1GA 1UPMB 2MXYA 1NDLA 3HI9A 2HLUA 1TKDA 1SKWA 4KHPJ 3T6BA 4GRSA 4K0KJ 4AL5A 4DFJA 5EUHA 5KFFA 1TL7A 3C6TB 4YFUA 3D0GE 5B09A 3M2RB 4IKAA 3C15A 3ZZUA 3MMBB 3GV8B 3MMAA 3NRBA 3GB0A 5CHCB 2GCFA 2EPIA 3DFEA 2B9YA 3ZZYA 2WVCA 1LEOA 1LWFA 2A10A 2BYCA 1DLOB 1TVRA 5LMNF 1RCXB 2POKA 2RUGA 3TEGA 2CADA 3M4XA 4KH1B 5JVGQ 2OPSA 3KK1A 2EFGA 2IDLA 4CYUB 3B4MA 5T7LA 3S7RA 1KOHA 4ZLPA 3PR4A 4KGXB 1X5SA 2FVQA 4WPAA 1UFLA 3CWJA 1B0VA 4TKTA 4DSLA 2DNRA 3P96A 3DLEB 3OTCA 4EYHB 5HQLA 1S1XA 2Z2LA 3BKFA 2M7SA 2K8GA 4DQIA 2RHQB 1Q7LB 1S6PA 3H40A 2XBPA 2KH9A 3IWXA 3HKZD 2P9EA 3W2WA 3K5OA 2DNLA 1VQ8S 2FVSA 2NZCA 1JJ4A 3GFXA 4EGLA 5IV4A 3GV5B 1V3RA 1YBAA 4RBUA 4F50A 1X9WA 4JI1J 1RTDA 1VQ5S 3FFIA 3ENVA 2Q43A 3D67A 2M88A 4KHRA 4EBCA 4DQQA 2HQGA 5F8GA 3IBWA 2R9LA 1IKVA 8ATCB 2DNPA 3EZUA 1T3OA 2Z2ZA 3V5RA 1HI0P 1NB7A 3AJ1A 3Q89A 2UU9F 3TX8A 1FKOA 3DI6B 1HW8A 4B3MJ 3G6VA 1ULRA 2H5IB 1OO0B 4AD6A 2GFFA 4OHZA 5EHHA 2KVIA 3HHLA 2YWHA 3EWGA 2QL7B 2ZBIA 4LQ9A 1SXLA 2YY3A 1SL1A 2CPJA 5E5NA 4KYZA 1ELOA 2PI4A 3IM8A 4DL5A 3FBEA 3ENWA 2K3KA 3H4BA 1RWUA 2ILYA 5HQ8A 2W9AA 2ZC4A 1FNXH 2DNZA 3C6TA 2ACMA 1HYSB 2FVRA 3M2RA 4LVOP 3MMBA 4RW6A 2WVDA 1Q0NA 1WC0A 3VAHA 4BDPA 4WFNQ 2IM1A 2FGCA 4K4TA 2EC0A 4LFAJ 3DC2A 4UOFA 2AIRB 2KRRA 3SSQA 2F7VA 2UVRA 2OKQA 3R8YA 1XC9A 1EZZB 4ED7A 4LF8J 1IUJA 5B08A 5B0GA 5HP1B 4ZVQB 2FLPA 4CYUA 4P2SA 1LXJA 3CB4A 3BZQA 4Y6IA 3LA0A 4DV1F 4Q5VA 1IVZA 2W2MP 5LSOA 2XEXA 4DHVA 1RAGB 2J0SD 3PEHA 3DLEA 3ZZOA 1F9HA 2VFVA 3JAMY 4X4SA 1VIOA 1OY6A 3P4UB 3C2PA 3BKTA 1KSPA 2IC3A 4IR9A 2RIJA 3IR7B 1UW4A 3ADAC 2J7UA 3HULA 4WP3A 6AT1B 1TQLA 2OGUA 3WC2A 4EU0A 1GEHA 1I5OB 3W7BA 2E1MC 4O4GB 2XGQA 2B5JB 2HKEA 2XNQA 3CJSA 3KDNA 4X62J 3FK4A 5J2PA 3RR8A 1TMJA 4OZJA 1DJ0A 5B0DA 1NH8A 2JEIA 1MWZA 3R5AA 4I0WA 1U8WA 2YWKA 5DQIA 3P3DA 2OEKA 2IJFA 3PW4A 2XI2A 2WVEA 1PIEA 3UN3A 1FNMA 5GAEI 3LPYA 3FEZA 4QW9A 3QQCD 1TK0A 2AJ2A 2VODA 3J7A1 1S4FA 1U6FA 4C3LA 2HURA 1NJYA 3IM9A 1LW0B 1YLXA 2HQCA 2L41A 1H7XA 2HFSA 2XCAA 2QV6A 2ZH7A 2C3OA 3OHBA 3DRYA 2W2NP 4J9LA 4ED5A 2FDNA 1SQGA 3Q22A 1FEEA 3PW5A 4K50A 1MROB 5DGBA 1CJKB 2OHDA 4M5JA 1HYSA 2GIFA 2UUAF 4P6QA 3R7BB 1S4EA 1NEEA 4ZVEA 2IRUA 4C8NA 1RLDA 1RWKB 2RJZA 3HJVA 1YZ6A 1RGVA 1TZ0A 3KNAA 5E3RA 2FQQB 1HNXF 2AHOB 1W7WA 1NK5A 2MKKA 1DARA 1O0PA 2JHEA 4E0DA 4ED8A 4GC7A 4WE1B 5I3QA 2FJWA 3AQOA 3JTOA 4OZLA 1YJ7A 3PHEA 5D0GA 5HP1A 3ILLA 1RU2A 5AJ3J 1XMOF 5LSLA 2I2YA 2EWHA 2IJNA 1IR0A 3LAKA 5BYQA 1N4LA 1ZTTA 2HVHA 1U6ZA 1KRPA 1KLMB 1GTHA 1UZHA 4O0NA 1R6VA 5C24B 3G87A 2M8HA 5KG5A 4C8KA 1WF1A 2CQ1A 3H8YA 3IR6B 2QMUB 3SCIE 4WZMA 1WHWA 3FCWA 5G0RB 3J81j 2WW4A 1QAIA 1WKKA 1RYRA 1UETA 1F3FA 1UEKA 4W98A 3C16B 4O4GA 4A8OA 2B5JA 2ADBA 3VHQA 4JI7J 1Z1ZA 4DPOA 5F8JA 3EYZA 1VIXA 2MKIA 1RHRB 1KONA 2EFQA 5GVQA 1TR0A 3A8IA 4LJMA 2RRNA 3MR6A 1ZAXA 4HACB 4FYWB 4DQPA 3ONQA 4WP9A 1GMUA 4KPYA 3W60A 4EZ9A 2X3DA 2EBGA 3K5PA 4DV6J 1FE0A 3LO3A 3BGFA 4QPTA 3DXSX 1X4FA 2QTWA 2RQ4A 2MZQA 2V8VA 2ZUAA 1FWPA 1MROA 3F56A 3R27A 4RLEA 1W25A 2Q79A 4DN0A 3D6MB 5HVFA 1HR0F 4AT1B 2AGPA 2QLFB 3SDEB 2V68A 5DG7A 1VQ6S 2J8AA 3F44A 4DR6F 4UZBA 2UVVA 2U2FA 3MAHA 2E66A 2HNDB 4K4WA 2SXLA 2DEJA 4RBTA 5GAGU 4M94A 2X1AA 5EGYA 4PXDA 1AT1B 4HT7A 3QT8A 4IRDA 1KVIA 3J7Z5 3UDEA 5D4PA 3Q24A 4QWDA 1XMQF 1T3NA 2A1BA 2F63A 2M2BA 3K5MA 4DV4J 4JI3F 1P9QC 3QJJA 5C24A 2IVFB 2ZKTA 2HAIA 1DHMA 4ICLB 2BOPA 2DY1A 3OQ2A 1BWEA 5ETNA 1GNKA 3QJPA 2ADCA 5G0RA 5C2GA 2Z0GA 1N5TA 3BYRA 3FCHA 2VQEF 4WFBQ 3C16A 3LP0B 1FXLA 2FD2A 2AEFA 1MLAA 3P45B 3EICA 5KFQA 1IBCB 1IJFB 4JOUA 3UNYA 1RK8A 2IRYA 4OZ0A 2KT5A 4DX5A 4F67A 4LSLB 1Y5NB 1FA0A 2DVIA 2KL8A 2VBZA 3NKYA 3KMSA 4RNNA 1UEVA 4N77A 4F4ZA 2CQBA 3MOZA 2UUBJ 5A2QU 4HACA 2AD9A 3W1YC 4OI2A 1WACA 5KFPA 4IH5A 3ZO7A 3TZXA 3CCVS 4PKDB 4X65J 2FIUA 3H5YA 3RTVA 3OPKA 2LYVA 5CXTA 2ZJQQ 4DL3A 3OT9A 3OL6A 4M5DB 2P9CA 5K5MA 5AT1B 2AJ1A 2YKQA 1O5JA 3ZTSA 2DR6A 3D68A 2CQHA 3QWUA 2HWHA 2N7YA 5KG0A 5DDRC 2EVZA 2CQ3A 1S1WB 1UFWA 1DQAA 4MAKA 4FXDA 3MM9B 5EDWA 2AYMA 4DX6A 2FJVA 3GP9A 2D3OR 3Q86A 3A1YG 2KFZA 4RNHA 1GMWA 4WP8A 3HSZA 1T0TV 1Q1KA 3FBFA 4I2PB 2HNDA 4FVCA 2NUHA 5HMZA 3CCZA 3O2IA 2HAFA 2KXHA 2E29A 3EJMA 2AZ1A 1FRHA 3MMCB 4V19X 2QLWA 2C2ZB 3VQTA 2WBMA 3KJFB 3VGTA 3UE2A 2HQIA 1RB0A 3N5BA 4LF6J 3BGRA 3QSYB 4EZ6A 3CC2S 3HSDA 4FBTA 4LRDA 3GR1A 3A8JA 3OTBA 4ICLA 1HARA 3I9V9 1BQMB 2A2CA 3GE9A 1GX5A 3ZTPA 4BLGA 3DDKA 3OSNA 3TVKA 2DGWA 1BD6A 1TK8A 3QAEA 4A8QA 4ZA1A 2P5VA 3LP0A 5HJYA 3PX0A 2O1PA 4KHPF 2L48A 4OJHA 4K0KF 5DG9A 3NWRA 2F40A 3OLAA 3MURP 2ZM6J 4CLWA 1MMLA 2FHKA 2RKIB 1X7VA 1XNQJ 1FVSA 2YPYA 4UT4A 1RT5A 5I4MA 1IR2A 4C48A 1DFDA 2D3UA 3K0JA 2F8EX 3TANA 3CD5A 2J6SA 1YIJS 2D9PA 3AFGA 4L72B 2JX2A 1VC0A 4RKUC 4W4MA 3KLEB 2F5GA 3W8GA 4M5DA 2HRUA 4ZPWR 3HM9A 4DLEA 3TZZA 1IBMJ 1FFWB 4PG4A 4RW7A 1RI7A 4PPDA 4X4OA 2RRBA 2J8SA 4PWDB 1D3WA 4HI1A 2RU9A 1H2UX 3ETOA 4N7TA 1SC3B 2BJ8A 4NOHA 3ZTOA 3W61A 2C2NA 3MM9A 4X64J 1FD8A 1SIZA 2UUWA 2LDIA 4LRCA 3KHRA 2C2EA 2BE9B 5KOWA 3DLKB 1XWLA 4V19J 2JEGA 2Y1JA 1MG7A 5M2PA 2GNKA 5ETQA 1RBAA 2CKWA 4I2PA 4BHQA 2UXBJ 4JI1F 1UVMA 3ITHB 1N32J 2R7XA 3H25A 4UUWA 3Q8SB 2D69A 2CXEA 1FRKA 3FMWA 2BQ3A 3MMCA 4DL0C 3TYTA 1T95A 2CRLA 1NMEB 1AZSB 5U47A 3OJUA 2JLFA 1M5VC 2BBEA 3PACA 3SXLA 2XMTA 1SL2A 3K58A 1BQMA 1XIQA 3G2XA 1MWYA 2FVPA 2ERRA 1I3OB 1RHQB 3QZ7A 2OPRB 5HMXA 2JH3A 2AU0A 2X51A 3QGHA 2DIUA 2DGOA 3UN2A 2YPZA 2ASJA 1S0OA 3FJ2A 2EFVA 3O8WA 3LTOA 4WTYA 2FC8A 5EX0A 1KFDA 1HBOB 2LXUA 3LGHA 2YH0A 3OL8A 1TFWA 4QOTA 3H5SA 3V6JA 1SPBP 5DGAA 5KFSA 1VK3A 4RBVA 2CNNB 2OP5A 4LT6A 4RUHA 2RKIA 3ILOA 2W9CB 1BC6A 2WHOA 2MQMA 2HGLA 4K59A 3MCNA 2CQCA 4LFAF 1YJVA 2G0JA 1SIWB 2ZVSA 4K2XA 2XSJB 3E8OA 4ED2A 4LF8F 2FC9A 4ANDA 1AB8A 2B7BB 3HVAA 3KLEA 4AL6A 1U2RA 1J5EJ 2OPPB 3T1AA 3W62A 4NZ7A 4Q7AA 4DU8A 3TVZA 2PMHA 1WNEA 3C6UB 3TA1A 3EDRB 4PWDA 3KLIA 4RNFA 2CJYB 1TAQA 1NLKL 4L3NA 1CQNA 4KRWA 4WFYA 3TJ8A 4P2MA 1RXOB 3BR9A 4WCEQ 2WTFA 2GJIA 4Y28C 3DLKA 3TJAA 2KTQA 1YK9A 5EWGA 2CPDA 3AAWB 4YN3B 1B0PA 1BE4A 4ZIWA 1VDHA 4X62F 2PD1A 4QIFA 3BPSP 3QGIA 3MEEA 3TA2A 1RHUB 1VRQC 3BBBA 3BYPA 1S72S 4L3KA 3IRXB 1Y3KA 3DXBA 4CDIA 4XDCA 1D9DA 2JFKA 3BPDA 3MI7X 1C0UB 4Z7CA 1L3KA 4DF8A 2C3MA 4R25A 2FY1A 3U1LA 3CC7S 3D6FB 2BX6A 2ASYA 3WIVA 1S1UB 2OPRA 1L3VA 4O3OA 3UDCA 2HHSA 4PAAA 4CO5A 3OW2R 4DR3J 3QGPA 2DO0A 3IP0A 3Q8QB 1VQYA 5HO4A 3MF5A 4UUXA 4P7TA 2DHXA 3HVRA 3KUEA 2W2PP 1HBOA 3N5FA 4H54A 2JVRA 2MTLA 2GQQA 4BBYA 4OV6A 4ZIVA 2VFTA 1FDBA 2B4VA 2W9CA 2VHGA 4EBEA 2M52A 2E1RA 5DQGA 3EGVA 2PO4A 2NYHA 1FDAA 2IY5B 4ZVTB 1NZ8A 5KFRA 2XSJA 1J5OB 5LJ5Y 4C3KA 3BSOA 2X3GA 1F2HA 1NDPA 2JDJA 4OHYA 4CT8A 1JX4A 1AUDA 3RG6A 2JNJA 3RBZA 1OSDA 2HMIB 4WZQA 1JLBB 3DM2A 3TQ1A 2WZ1A 4ZP8A 3GIIA 1NK6A 1KQKA 5JMNA 4ECRA 3T9NA 1YITS 3QJLA 4ECZA 4KGVB 3OVSA 1RAFB 5GAHU 2OTLS 2B4UA 3C6UA 3W9JA 1N33F 4B9MA 3VGSA 2CPFA 4PPZA 2F3JA 1UP1A 5GMKa 4DR7J 1JNRB 2KO1A 1U48A 3LALA 3Q2SC 4ZPTR 2BQUA 2MLXA 4ZVRB 2R8HA 3CF5Q 5CYQB 2V4QA 1U1KA 4CLFA 4LSNB 4F02A 4B17A 2VG5A 4ENOA 2I38A 3W9HA 2CJ9A 2KI2A 2GAHC 3B6BA 4IRCA 2E1PA 3R97A 3CGIA 3OTEA 1B3TA 1HQUB 2PFDA 1HNWJ 2LECA 4JI7F 3GSDA 1KBRA 2XS5A 2GJFA 4ZITA 1JXEA 1PAUB 3J7ZT 3IRXA 4ZP7A 3MM5B 3MCSA 2ZDOA 2MZTA 4XPEA 2CPEA 5L1LA 1C0UA 2J6UA 4X4UA 3ILIA 4KGZB 1EX8A 5IT9U 2ZHAA 5DRKA 4L74A 5KFHA 1PC4A 2FJBB 3I6PA 4OZ5A 1S1UA 3RAMA 3L3CA 1LWXA 4DV6F 2CVIA 2RS2A 4R0JA 3SV4A 5A6PA 2V94A 1PAEX 3MCMA 3JSMB 5J2QB 2P9GA 2Y8WA 3AD7C 2O5DA 1UVIA 4QYZK 4P10A 2PIIA 1TL3B 1VJQA 3D1OA 4NASA 3AXMA 5BXIA 3BO4A 3HHNB 4YB1P 2ROGA 1BQXA 3I9ZA 4J37A 3MFIA 2WK4A 5I3UB 3RW6A 1IKYB 3EPGA 1S5ZA 2AJ0A 3H5XA 1JWWA 2KVQE 1YG0A 3TQEA 2BEFA 1CJVB 5CCMA 3GR0A 1WC5A 1J5OA 1UAWA 2CNLB 2V0NA 2XNRA 1ICEB 1SL0A 1TKXB 2R42A 5DM6Q 2BVZA 2HMIA 1JLBA 1KOOA 4QCLA 1YI2S 3BKUA 1OQ6A 2V5HG 3AOBA 4DR1J 4OI0A 2MHEA 2JC1A 4DV4F 4DL4A 4BWMA 4MTPA 4Z2XA 2GGPB 2V2KA 4EYIB 3MCOA 4EUVA 1ZM2A 1WHVA 1LWCA 5CYQA 1Q16B 3KJVB 2R7SA 1RBOB 2ZZTA 2YKAA 4LMZA 2LQ5A 5JUMA 4KO0B 5KFOA 2DNMA 4DU7A 2DGSA 2NCKL 1WD6A 4OYWA 5IV3A 3CXCR 2FHJD 5D4NA 4OYOA 3CD7A 4NL5A 2CQ2A 1R27B 4C7QA 5MLCV 4O44B 1GXUA 1YJUA 1K1SA 3KLHB 1PJ6A 3THPA 1LK7A 1DTTB 3MM5A 2DXDA 2HIQA 3DLGB 4PABA 2UUBF 3MUMP 2MY8A 4LF7J 1TV6A 2JEJA 4ZMMA 1R3NA 4I64A 1WSRA 1SH3A 1IKXB 4DPUA 5CQGA 2YWFA 3JTNA 4X65F 4B9VA 3LANA 2PE8A 2KZZA 3PZPA 3CJ4A 2DT9A 4DN9A 3D0HE 1U1RA 2QMXA 1WOPA 1VRTB 4RUBA 2PSZA 3JSMA 5J2QA 2WCXA 2BOAA 4LBHA 1JLQB 1TL3A 4ED6A 1RWXB 1M5HA 8AT1B 4NA1A 4KFBB 1VRUB 3RUBL 3SYZA 2DHSA 4PXEA 5DZ6A 4B9SA 1IKYA 5FDLB 2WBRA 3FVYA 3H20A 5A2QY 2HZCA 2NZ4A 3P5TL 2N4CA 3MUTP 1ZS6A 3BH7B 1FERA 4L75A 5F0UA 4BC9A 2HFVA 5LSRA 5HROB 1TKXA 3VGVA 3GG1A 5C2CA 3I5AA 1REVB 1RHJB 3G4SS 1UJ5A 4QZVB 4F26A 1RCOB 3Q8UA 3D4JA 3OXLA 4DXLA 2XZTB 2BJ9A 2CDRB 1WEYA 5D4OA 2GGPA 4LF6F 2YKNB 2MJUA 1XR6A 4DSIA 5GMDA 4ZN3A 1B7YB 3K57A 2IA6A 4ZS6A 1XR5A 3KJVA 2BRLA 4Q2MA 1PO6A 3AOCA 4P72A 2DRDA 4KO0A 1CLFA 3AA8A 4KSEB 2MQQA 1ROFA 5K8MA 4IQMA 4MIBA 3G6YA 2YTCA 2VC1A 4QR2A 4JI5J 2Z2MA 4O44A 1HNVB 1RACB 3KLHA 4MKYA 1FJGJ 5C5JA 3PIPQ 1Q4RA 1DTTA 1ZZNA 2HS3A 1V5VA 2IAJB 4JV5J 3LAMA 3K2YA 3K59A 3DLGA 2MKCA 4H4OB 4KB7A 1U1MA 2BDPA 4NLQA 2ZUGA 1EARA 1T9UA 1IKXA 4X66J 1RT1B 2XY6A 1Q8KA 5FLXU 5JJBA 2Q6BA 5C25B 3AJ2A 3JTPA 3PJXA 9ATCB 4X4RA 3LP2B 2MQPA 1YJTA 1VRTA 1IBMF 2RE1A 1HLWA 5HLFB 4B3TJ 3TRGA 4F25A 1JJCB 5THWA 1JLQA 2GC8A 4WWSA 3FEYB 2XS7A 2HFOA 2HFNA 3LF0A 3JQMA 1VRUA 4ATNA 1Q53A 3TW0A 1FDNA 1Q8LA 2OLWA 2K1RB 2V9KA 4NI2B 4BCAA 4X64F 1Y5IB 2YKMA 2Z2YB 3E3XA 5FDLA 2W7PA 3GJSB 3VTIA 2H65B 1X4CA 4DR5J 3MHYA 2GMLA 2GVDB 4E2FB 2QA2A 1VK8A 2NLWA 4YY3J 3DRRB 5HROA 1S10A 4ECXA 3TP2A 2K7JA 3WZ0A 3KG1A 3C14B 4G3IA 2XLKA 3DRPB 3EXYA 1N32F 4P7VA 4RJVA 1RT6B 2RDDA 4QWBA 1ZPVA 1REVA 1Y10A 1QAXA 1X5OA 1FFSB 1LK5A 5L46A 4WTOB 2DH9A 2YKNA 1LXNA 5FIIA 1P9YA 4FKXA 3CO9A 2MLZA 1T9WA 4DDFA 4DUYJ 5A76A 2VV5A 4F36A 2CPZA 5IM0B 2JWNA 5H9EK 1KTQA 3L9ZA 2OO4A 1U25A 1RQ0A 2O67A 2HIYA 1M5SA 2VBYA 4OQJA 1IWAA 3KUHA 1VC5A 1P6TA 2HQFA 3AOAA 4A46A 1NHVA 4R0EA 1UJ6A 2B9XA 4ZDNA 2IAJA 1U45A 3AODA 3MEDB 1DY3A 4LF2A 3IMQJ 2W2QP 1QUVA 1URRA 1RWPB 1Q79A 2YNIB 2Y1RI 1QTNB 4WFXA 1RT1A 3P5BP 3HLUA 1WOOA 5C25A 3BM7A 3G9CA 3PXGa 4HKQA 4TU9A 1J5EF 1OS5A 3LP2A 2K3IA 3CCJS 1N0VC 3WBZA 1JLAB 2DGUA 5HLFA 1NK0A 2AKWB 4OJGA 2GZOA 2P6TA 3IBFB 1RU1A 3D28A 3A4TA 3ISND 4KV8B 2EFOA 2VPYB 2ZEJA 2NXNA 1ZA1B 1TKZB 2HK2A 2ZE2A 4P75A 4ES2A 1KHVA 3MEGB 2K1RA 2QIFA 4DCOB 1UA1A 1FT8A 4LIRA 1HW9A 3I96A 3GV7B 5F3ZA 2R7VA 4XDDA 1GTEA 5IXUA 2F9JA 3MPVA 3M2UB 2Y8YA 2BE2B 2HQDA 4LRAA 2XS2A 2GVDA 3R5DA 1HWIA 1C1CB 4OI3A 1YRXA 3PRBA 3DRRA 3I5CA 2YX7A 3ISZA 4NYOA 1LW2B 3C14A 4DI6A 3DRPA 4JI8J 1RT6A 2AYGA 3QGGA 3LW5C 3PTWA 2EEYA 3KOAA 1D09B 1N5YB 2VIHA 1G2EA 2A18A 1VQNS 1R43A 4LVNP 3M6UA 2J76E 3KK3B 2D7SA 2DKOB 2DR5A 5DO2A 4DL6A 4P74A 1WC4A 2H5EA 3N9UC 4C0BA 3FGVA 1P27B 1HNZJ 3NCPA 2OIHA 2MQLA 5IC4B 5IM0A 3MZIA 5D8HB 4DR3F 1O6XA 3Q0AA 3FQLA 2Z57B 4ED3A 4DZDA 3D54A 3OFHA 4O23A 4RO0A 5A6WA 3PKMA 2LP4A 5E0OA 2DGXA 4LUBA 2XHCA 3NXZA 1L3UA 3TZWA 2VH7A 1T9XA 3MPYA 4UOCA 2WSFC 4ZVUB 2IYIA 5HMWA 3NAIA 3DDNA 2MEWA 4HT5A 5KFAA 4FKYA 2ZC3A 4D3HA 4XIUA 3SSSA 5RUBA 5ETPA 4C8YA 3W65A 2YNIA 5KAKA 2QO3A 1YX2A 4MK7A 4CO1A 4B02A 1YHQS 2NSCA 1OY8A 1IQTA 3HSJA 5D15A 3K8VA 5JVHQ 3THTA 5KFIA 3VVTA 1JLAA 3H4DA 2CJQA 1J27A 5CZVA 3KTQA 1HWJA 1RAAB 1YRUA 1IJEB 1DQ9A 4DR7F 1TKZA 3TEHB 3QRQA 3LUYA 4URQU 3H7HB 4F3OA 4N5SA 3FSYA 4B9NA 2FYXA 1X8DA 3M2UA 2BE2A 2XLIA 2LU2A 2H48B 2CPHA 1R89A 2PN6A 1R8AA 1C1CA 2EG2A 2HRYA 2MY7A 4F0MA 2UUCJ 2UVWA 1T03B 1TKTB 2HFUA 2W4CA 2HZAA 3IFEA 1MU2B 3DOMB 3T1HJ 1Q81T 4NCBA 1WF2A 3VF0B 1FO1A 1N5YA 1FWLA 2IM2A 3POTB 4F8RA 3KK3A 2AF6A 5CZXA 2HNYB 3KNGA 1JXLA 4FF2A 4MYTA 1RADB 4A8XA 1WKLA 1F5CA 1EHWA 2IVYA 4EI2A 4RPFA 3SV3A 3RYLA 3CVKA 2JC0A 1LFPA 2R8JA 4WJBA 3ULHA 2EC2A 1NSAA 3BR8A 2W1BA 3EMTA 4DF4A 2VASA 3JQKA 4WK1A 2B6AB 2ROEA 2V69A 2W9BB 2H5JB 4C8LA 5GAGI 3EM1A 3ET6B 4NLRA 1FX2A 1T02A 2EW9A 3SCLE 4I4BA 1CC7A 4FYDA 4QR1A 1BHNA 1VBZA 1MWQA 1WELA 4CLKA 2XC9A 5I42B 1BUXA 1N8RT 2B4PA 4F3QA 2DCUB 4WKRA 1VQPS 3KJNB 5IT9Y 5KFMA 7AT1B 1CULB 5HVGA 1K73T 1X4BA 1VQLS 2QJ3A 2GW8A 2OFHX 4DFKA 2XSFA 3NS7B 2RT3A 1FX4A 4NLDA 2E9RX 3QZ8A 2BABA 4DZ6A 5F9NA 4DR1F 4CO2A 3AB4B 1UPPA 4TVAB 1K44A 4K2JA 2CWKA 4ZP6A 3E2EA 2V2ZA 2C2KB 2MLYA 4FYVB 1HBMB 4V1Ak 3PHTA 2AQ4A 3R6LB 1RISA 2QSFA 2KJVA 1NSKL 2BW2A 4P73A 4CLSA 2DY9A 3TNVA 4C8ZA 4URGA 2H4WB 4ZK7M 1TKTA 4DSJA 1PG5B 3RAQA 5ETMA 1QE1A 1GMVA 2RDIA 3QO9B 1MW7A 2XMVA 3POTA 2E9ZA 4P2FA 4LF7F 2HNYA 3VR1A 3OTOF 1NKBA 3CO0P 4ZKAA 2DJWA 2XZDB 3NBPA 4C0HA 4MK9A 1NH7A 1BXNA 2NXCA 3EPIA 3GLJA 1SKSA 3JXOA 5LJ3Y 2B6AA 4PZVA 3HMJG 2W9BA 3RB6A 4E8UA 3M32B 2CPXA 2BM0A 1EQMA 3ET6A 1P1TA 4WFAQ 4B3RJ 2K7KA 3R9LA 3M7VA 1JQGA 1KQGB 4CM2A 2H9ZA 1URNA 2VQFJ 1D1UA 1RAIB 3M9NB 1XQIA 1FRLA 3T1YJ 4UZCA 2QA4G 4PEOA 4F2RA 3CDUA 2Z58B 3QATA 4NEYA 2R8GA 3GCWP 5E3PA 2VB6A 1WG4A 1X60A 3IXQA 4GO5X 3GSIA 1H73A 3C19A 4DPTA 2ZOMA 4OI1A 1CULA 4N8OA 2RQKA 4QWEA 2X7IA 2QLXA 1MN7A 2ILZA 2QYGA 2VPWB 4M5MA 1SQEA 1F60B 1ZPWX 2G2OA 2MZRA 8RUCA 3FBBA 4Y2CA 3VAKA 1NJXA 1T94A 1HBMA 1LNQA 1GX6A 2RF2A 1R8BA 1OJ4A 1N36J 4CH7A 2NXUA 2NR0A 3NP5A 2AV5A 1QUPA 2XCPA 1CEZA 2XWYA 3UCZP 2LXIA 3CMAS 3GIRA 4WIIA 4GO7X 4B3SJ 4EMDA 2B9WA 3MGJA 4USJC 1F0XA 3BB5A 3OVBA 1R0CB 2PA8D 5K8OA 4NA2A 2DYAA 3Q8VA 5KFBA 2ZBCA 4ECWA 3TUPA 1GAOA 4LBPA 1Q78A 2ZITA 2Y3YA 4IRKA 3NNHA 4OIXA 2YNGB 4PYAA 3HHLC 3HZEA 1PBAA 3QO9A 5L39A 1FJGF 1MMDA 1CPZA 2YX1A 3GZ7A 3VAIA 4JV5F 2RQMA 4RNOA 3WIUA 4Y2MA 5K20B 2H4YB 5ETOA 1OYEA 3Q83A 3BSAA 5K8PA 2BJDA 3B54A 4JV1A 1NJIT 3GIMA 2MZJA 4TU7A 1WDTA 3MECB 4X66F 4J9PA 1GXTA 4BS2A 2OD6A 1F5BA 2Y1LB 4HDHA 1RLCL 1IXKA 3CC4S 4Q0BB 2C3PA 4B3TF 2E5GA 3M32A 5HN0A 3TARA 1SB6A 4DR2J 3UCUP 1ITPA 3KK2B 1FDDA 5L9NA 3ETMA 2DNKA 4DV3J 1M5OC 3D3BJ 1K0VA 2ZDPA 5KG4A 1RWOB 4TYAA 2MQ8A 2E5LJ 2P6SA 3IWNC 4DR5F 4CLTA 3CMES 4PG5A 2D41A 2G1DA 2ZZMA 2ACYA 1VQ4S 3M05A 2FZKB 4CT9A 1U4BA 2JLEA 4X4TA 3D1HA 1CJUB 1RAOA 3PW0A 5FLXY 2DO4A 4I6AA 1G6BA 3VAJA 2C3YA 4CLYA 3US5A 1KTVA 1LWEA 3HHKA 1OQ3A 3BSNA 4C6AA 1SJQA 5E7OB 1BLUA 1SKRA 1NKEA 2FVCA 2JJ4D 1NUEA 4FF3A 3W8PA 5EN1A 5L1JA 3OLBA 4KE5A 3CT9A 1Q5VA 5KG1A 5I3PA 4URSA 1SJ1A 1NPRA 3N0VA 3TAMB 4DUYF 2OSQA 1Y4ZB 5E41A 3M30B 2HGNA 3H98A 4DUTA 4DFMA 2GMJA 2V67A 4J9OA 4JI0F 4A4JA 1DLOA 1UVLA 3N01A 4QYZJ 2I1RA 2DHGA 3KDOA 1TU0B 4PG6A 1R8HA 2RH3A 2V34A 3ZXWA 2DGTA 2YNGA 5DDPC 2ZFHA 3CIZA 1PGZA 1Q95G 3I0SB 2VBXA 5B0FA 2ASDA 1U49A 5HK4A 2GHVC 4ECVA 4MJKA 4DCJB 1FKAF 2CNKB 3JB9k 1UA0A 1KVKA 2BJEA 2RQCA 3MECA 4OZNA 2LA4A 3PIOQ 2YWEA 3FRYA 4RW4B 1JB0C 4ZPCA 3HF5A 1TMMA 2HVZA 3FZBA 1FI4A 2B4OA 3DNCA 2UU9J 3I5BA 3GFYA 3KK2A 3CDBA 3QPIA 4ZCKA 3UVJB 5KT7A 2QZ8A 3CW2C 3CUNA 4A47A 4JI6J 4XPCA 2XYPB 4I69A 2KYZA 2R4FA 2P2CB 3BO2A 2YBVA 2B8QA 2QA1A 1T05B 2E7WA 4KQZA 2VG6B 4B08A 4DSEA 1RKIA 4USMA 3QSIA 4F4YA 1V3ZA 2MQOA 2BE7D 2GIQA 3HZGA 3PJWA 2XMAA 1VQ7S 3DI6A 1DRZA 3CD0A 4WBFA 1CJUA 1PBUA 2BJ7A 2QFIA 2BXJA 4JI8F 3C46A 3V2UC 2DIVA 3D1QA 4NXNJ 3PVXA 2KFYA 4OYMA 4EK2A 3G96A 3R2CJ 2VA3A 2ZOFA 3W5YA 4C4WA 3SIPB 2GHWA 3TR5A 3OSPA 2WB1D 1KFSA 4ZCIA 3ZTQA 4Y2IA 4U9RA 3CMQA 4KPCA 2R2RA 3RB4A 1OPZA 3TAMA 1IBKF 3EX7B 3M30A 2KYXA 4YB5A 5IZHA 4GC6A 3HVWA 2AZ3A 1NKCA 2VL1A 1GMWD 3NOGA 2RB7A 1PJ5A 3CCLS 2ZZNA 4QJVA 2UV8G 5D0HA 3IC1A 1HI1A 4AQYJ 1FNOA 4DLGA 4DBQA 3SCJE 3I0SA 1HBNB 4ZLJA 1R0AB 3L7PA 4NCGB 2ZH3A 1FESA 5KG3A 3MM8B 2IA0A 4ETZA 2CWXA 3D9BA 2CYYA 1U2FA 4F4WA 2VJVA 1W26A 2W24A 7FDRA 1M5PC 3IS9B 2K06A 4JYAJ 4IFVB 5IT0A 3VVUA 4RW4A 3CCTA 3CJRA 3SCKE 4DL2A 4JP8A 4X4PA 2HHVA 4CQ1A 1H2VZ 2M5YA 1M1HA 1DQ8A 1HHQA 3OVAA 3UVJA 4N41A 4U7CA 4U6PA 2IHR1 1S9GB 1J2VA 5HMYA 1N56A 3HCXA 4OL8A 3UR0A 5H9FK 5HANA 3KLVA 4FP9A 2EKYA 4I1TA 3GJTB 1QSLA 2KXNB 2R7RA 1HQEB 4DCPB 4O3PA 1CBKA 2VG6A 1X4HA 4C97A 2V8GA 1Q8IA 1SC6A 3NS5A 3DHWC 1YJNS 5KFGA 1B99A 3ILJA 3MM7B 2UUCF 4Y00A 4X4QA 4PUOB 4CLLA 1RT3B 4J7CA 4ZHRB 3MPWA 2J0QD 2YQ3A 1LW0A 2FJDB 5HL7Q 3SQOP 1Q8BA 2BANB 3MXHP 1RT4B 3PDNA 1B70B 2KDOA 1D9FA 4PRFA 3B8HA 1CJKA 4YB6A 3DDIA 1HFEL 1PYTA 2W4DA 4LFCJ 1S6OA 4CNZA 3PYGA 2HS0A 3HT3A 3LP1B 2BA9A 3CTRA 2AT1B 2CAJA 4M1KA 4KAIA 2PT0A 4U67Q 4WE1A 1RZMA 1VCTA 4OZ3A 3H2UB 1PYSB 1HBNA 4P2XA 4OYIA 1R0AA 2ZNYA 4FN5A 1YJWS 4QR0A 4I6WA 4NCGA 2PEBA 1NSQA 3KLGB 1WTBA 2DPJA 1TUVA 2J9EA 1KLMA 3KG0A 3MM8A 1S99A 3EXCX 3DOLB 2BW7A 3L4BC 2GV1A 1F9FA 2ZOGA 3OV7A 4I7FB 1LQ9A 3IS9A 3D3CJ 1VC6A 4W90B 4ZCLA 2XWXA 4A8WA 4OI4A 3MWBA 2QRRA 3J7AN 3QIPB 5KFUA 2G13A 3VGUA 2VFUA 1Y5LB 1EB0A 3F41A 2DR8A 4J9SA 2O01C 1VQMS 2VKZG 1RT2B 2CQPA 3HKWA 2MJNA 3IGNA 4TY8B 3BQ2A 4QW8A 1S9GA 1R8CA 4K4SA 5D77A 3OXFA 1V9OA 1WHXA 3E01B 3FKBA 2VBWA 4F04B 3VAMA 4CNYA 2MZ1A 2VICA 2W25A 2B43A 1HQEA 5H9EJ 4IOBA 1TK5A 2MYFA 5LMUJ 2F4VJ 3CCMS 1YRTA 1JJHA 1HKAA 2V8DA 3MM7A 4OYPA 4X84A 3V6HA 2HW3A 2HGMA 3BDPA 4OFZA 4LQ3A 4J9QA 2DRAA 1KQSR 5KT5A 4PUOA 3G82B 1RT3A 2QFJA 4ZHRA 2R8KA 3BQ1A 4LFBJ 2W8KA 4OYXA 3OL9A 5EX3A 3OD2A 4HDGA 1LFWA 4J91A 4YB7A 2KG0A 3D6TB 1SBRA 2BANA 5DLGA 1RT4A 1UMJA 3PM9A 1BY9A 3QT7A 4USHA 1A9NB 2QE5A 1JMTA 2CZ4A 3G8QA 1O8BA 4LF5F 2WAQD 1HIYA 2Z4PA 1XMQJ 2OFGX 4PYDA 1FWKA 2KM8B 3QLHB 5K14B 1NJZA 4QWCA 3SDEA 1H0HB 2ZH6A 3LP1A 4M5GA 4B3RF 2BRKA 3NY0A 2HYIB 3CE8A 3O3LA 4CWBA 2R2TA 4DWIA 4G1IA 1XK8A 2MB0B 3ENAA 1QVGR 4ID5B 3BSCA 1SC1B 3KLGA 3RZAA 4WYWA 3EVWA 2W01A 3DOLA 4IQXA 3TUJC 1T7PA 3MAAB 1TL7B 2IMOA 5KT2A 1JNZB 3QRRA 3DGPB 4CM0A 3R2DJ 1HHTP 3P8BB 3WC0A 1AXQA 1SJFA 2RRAA 2G2ZA 4ZLLA 1HWKA 4O4RA 3HHEA 2K2PA 2VG7B 3QIDA 2VD3A 5AE3A 1RT2A 2BKOA 2I9SA 4TY8A 4K5RA 4M8LA 3ZZTA 3HSGA 1VLYA 3E01A 1N36F 1UZDA 5ETVA 2ZHBA 2XTJP 4LSLA 2UXDJ 5T7LB 2MSTA 5DJBA 4NZ0A 2YXLA 1B4SA 3MTJA 5FD1A 1CS4B 1RHMB 4CH1A 1X4EA 3G82A 3GMGA 4OLOA 5LM7E 2NS1B 4O3NA 4QBUA 4DS5A 1JKHB 1SH2A 3V6KA 5D4LA 3JQJA 4WXOA 3W5ZA 4DPWA 2HHWA 1AW0A 1VR6A 4WF9Q 3OR2B 4LF9J 3I32A 4DQRA 3CJ2A 3FFIB 4Q8EA 1NPKA 4L73A 1FJCA 4IOAQ 3MOJB 3W3SA 1S1WA 1U7LA 2AMCB 3OJSA 1OYDA 2ABYA 3QLHA 4HEA9 6FDRA 1T11A 3MM6B 1UCNA 3OFFA 1TP7A 2BKNA 4OJ1A 4TY9A 4DV3F 3T9ZA 2QLBB 3HPOA 2CUYA 2I5JB 1YZ7A 4ID5A 1XNRJ 2KB2A 4NLPA 1NB2A 2N3LA 3PX4A 2MPUA 2FPHX 2DHHA 1O51A 2E5LF 5IWAJ 4ILLA 3NGTA 3NL0A 1G4CA 3DLHA 3NMAA 3MAAA 2OUGA 4IR1A 4B3MF 4PCQA 3BN4A 3DGPA 1NK9A 1YTYA 1RA6A 2FZGB 1D8YA 4RW6B 2O66A 2MSSA 6FD1A 3GFZA 2IVMA 2D3O1 4HTIA 3Q8RB 1Y7PA 2OELA 2VG7A 3M8RA 2OI2A 4H4KA 3H2LA 2NXJA 1QAJA 4FF1A 3NAHA 2IBKA 2CFXA 1C1BB 5J1EB 4YDXA 2J7WA 3GTYX 3A12A 2KG1A 3HP6A 4A48A 3BJYA 2ZH9A 3RRGA 4F4AA 3HK2A 5E3AA 3CD6S 1WC1A 4LF1A 2H51B 4PQAA 2WVBA 1U1OA 2CPYA 2DR7A 1C0TB 3NWGA 3SZ2A 4OHVA 4NLWA 4KJIA 2FB0A 3GG0A 3H2VE 1RA7A 3PFOA 4YOEA 1IN0A 3U1MA 1CS4A 1VLOA 3O6QA 3KFWX 1G1XA 4ZPAA 1TL5A 2KT3A 5DLFA 4EO6A 2IC3B 1JKHA 2XI3A 3U1NA 4RR5A 1WG5A 3QNWB 3UR3C 1YBTA 3OR2A 4HH1A 3ZC4A 4J9NA 1MN9A 5J2PB 5B0CA 3MTKA 2AX1A 4TN2A 3OTDA 1RWWB 5D3GB 1CSJA 2RNEA 4QIGA 1UVNA 3MM6A 5L9XA 3WX8A 3LGMA 4ILMA 4L76A 1VQ9S 1X5PA 3K17A 3GYXB 4KBIA 2M8DB 1CC8A 3GIJA 1PYOB 1WG1A 1ZH5A 2KJWA 3IAM9 4WIQA 4JI6F 5KT3A 4FNIA 3ITHA 2I5JA 1HWUA 3NGSA 5DDQC 1U02A 3CCQS 4Q43A 5KG7A 3QAUA 1JJ2R 1FTRA 1F1BB 4NLTA 4I2QB 3C8YA 2PA3A 2B0GA 1RTZA 1TELA 1AZSA 2EFNA 4ZVSB 1KQFB 3N6NA 2VFSA 3X3UA 1OIAA 2W7OA 1LV5A 1NU4A 4XAKA 2ROPA 5F9LA 1V3SA 2IMWP 2ZVIA 1YWXA 1R8PA 4NXNF 4OYZA 1BWVA 1RKJA 4ZOSA 1RABB 3AT1B 1ZAVA 2GQCA 4OX7A 1KKHA 1FFGB 1QM9A 3NOCA 1RAEB 2G1HA 1FF2A 5ETLA 4IG0B 1C1BA 1OWXA 4FXWA 5J1EA 1UKUA 4IUFA 3B4DA 3PW2A 5F8NA 1YJ9S 2WRMA 1APSA 4XK8C 4USIA 4PR6A 1HQ2A 1C0TA 1UWAA 2F8MA 4WFZA 4AQYF 1RT7B 2ZNZA 4PG7A 4R5PB 1QTMA 1RUSA 2JOQA 1XTZA 2OPPA 3SI8A 5AJ3F 1YDLA 4H4MB 2NYIA 1ZAWA 1P1LA 2CG4A 2XGPA 3NGRA 5DM7Q 2PMWA 4Z7YA 3TA0A 3DN9A 4YR3A 2Y0SD 1Q5YA 2HWTA 2DR9A 3VALA 3NGDA 1C4CA 2Z8QA 5CD4A 2HPUA 4JYAF 1Y3JA 1X4AA 1ZA2B 4G6VB 5D3GA 3PCOB 2WVFA 4HL9A 4ELTA 1VJWA 4ELVA 1RP5A 4JI2J 2ASLA 1Q82T 4ANCA 2AWZA 4QIEA 1AA1B 2R2SA 1PILA 2CZ9A 4NZ6A 4PQUB 2HFZA 3TVYA 2XQCA 3DHXA 3EGWB 1LOUA 1AFIA 1QY7A 3UN5A 1FVQA 5LL6d 2G0IA 4ECUA 1Z2ZA 3WDOA 4UY85 2DITA 1TUWA 3J81U 3A8EA 5IT4A 1N52B 1WORA 2JVOA 4I2QA 4OHXA 3K5NA 4Y34A 1UFKA 4JV0A 1EJ7L 1RWMB 5KFVA 1AYEA 3ZZ0A 3AXKA 2DISA 3W2VB 4RU2A 5IQ6A 4RWWA 5KFTA 2IPOB 1V6HA 4NXMJ 2YNHB 2B3TB 1KD1T 4C9DA 1VYAA 3M1VB 4NPOA 3GYGA 2MKJA 3HFVA 2LFVA 1IM6A 4M5NA 1VQKS 4IG0A 4K4YA 4B3OB 4HI2A 3EE3A 5ETSA 1TL4A 4K8RA 2L9DA 3GFHA 1VHIA 3FRZA 2LXFA 1RAJA 4LFCF 2AX0A 1N33J 1REGX 1U26A 2JEFA 2DNYA 4EWTA 4KC5A 2AGOA 4WXWA 2XMJA 2BJ3A 4NE9C 1RT7A 3J7YU 2HNZB 1KP6A 2EG1A 4UTGA 4R5PA 4DV5J 2NQPA 2XYHB 4IYQA 2L9NA 2Z56B 3CPWR 1X31C 2FUG9 2W7AA 2OEJA 4H4MA 3H0PA 1H7WA 2LQJA 1X9SA 4DOZA 5AE2A 4AE5A 3IAS9 1EP4B 5K9FA 5BYRA 4DR4J 1WC6A 4OX8A 1NO8A 1UW9A 3MR7A 4DX8H 4ZCMA 5L1IA 1ACMB 4PXCA 5AXKA 3ZTRA 4E98A 3OFGA 4AYBD 1SJRA 2HK3A 4LSNA 3JYTB 3NNAA 3FUYA 4PWWA 2VA2A 3PX6A 5KFNA 2AP6A 4NX9A 4F0KA 3G6ES 1QVFR 4OI6A 2F8HA 3GWCA 2VPZB 3DYAB 4PQUA 4QIWD 3T6JA 3UPFA 4F0HA 2R2UA 3FC9A 2DGQA 1T9VA 3HVTB 3HO1A 4UQTA 1HQUA 2HQ3A 1N88A 2FHOB 2HHPA 2HHHJ 1RJJA 1NHUA 2KKHA 3T5JA 1M90T 2HLTA 2ZH4A 3HHDA 1HNIB 3PV8A 1OMSA 5LMUF 2F4VF 3FEXB 3BREA 2B56A 3GQCA 4AL7A 1NK4A 2I8EA 4HLBA 3W2VA 4ED1A 5CABA 1FE4A 4CO3A 4EEYA 5F8HA 4CH0S 1Z4UA 3SMZA 2CNOB 3CJKB 2YNHA 2J9CA 3V6DB 4D3GA 3M1VA 5C42B 1YVFA 5KFWA 2YWWA 1NNDA 1RTJB 3C3LA 4LFBF 1FK9B 1S49A 4Q44A 3EZ5A 3OFEA 3V4IB 4GVLA 3UWTA 3DRSB 3KG4A 3L7OA 2N3OA 2YQ0A 4Q8FA 3ICLA 1EQ0A 3K89A 5KFYA 2R7UA 3UNGC 4AUKA 4B3OA 3O44A 2ZBQA 1SJ4P 4LR8A 5DZ7A 3OHAA 4GVBB 2P8IA 4QU6A 1K9MT 2LEPA 1H2TZ 3Q8PB 5I3UA 3D7SB 2V9WA 1D9AA 4U95A 4IO9Q 5FJ4A 2PMZD 1T8EA 4UW2A 2E5JA 3BGRB 2CVEA 1CJVA 4J9RA 2VU5A 3GCXP 5E3CA 3T3FA 2DD8S 4I56A 2V63A 4NLXA 2HNZA 5SZTA 2DB1A 3HX9A 2HVDA 3JSYA 4FYXB 2GHPA 4KIAA 3G86A 2IRXA 4B9TA 1RAHB 1R0BG 4GMKA 2DNHA 1EP4A 2UXCJ 4ES3A 5B7WA 1R7IA 1AROP 2RUSA 4ZJLA 3HD1A 1SKUB 2YX4A 4DV7J 2QN6B 2ZWPA 2PI5A 3TZYA 1Y11A 1FXDA 1N34J 2O3DA 1I51B 2PEHA 3S6EA 4RW8B 3SFGA 4M5HA 3JYTA 1KNZA 2H54B 3PFEA 2CJAA 1RT5B 2E44A 3LQVA 3BBCA 1BQNB 4ED0A 3HXMA 4NLUA 2BR0A 1FD2A 4K5SA 3DYAA 3DLLQ 2FJEB 2Y1IA 2WW8A 3HVTA 2PDAA 2VJUA 2ZHOA 4IO1A 3PO4A 2A6OA 2ZM6F 3UW1A 1C4AA 1EKRA 1H74A 2RSQA 5F0WA 4ZVPB 2UXDF 2BM1A 3PR5B 1WSVA 1HNIA 2CJKA 1WEXA 4M95A 1XNQF 1XEZA 4RW7B 3FNNA 2DNQA 5AXLA 2C1EB 2HZVA 1UVKA 4HR2A 3KHGA 3RBXA 3NS6A 3FQKA 4C3MA 2OJ3A 2E7XA 1B0TA 1RTHB 3DKDA 3EDQB 3CJKA 3V6DA 4A8KA 4RX6A 3R1HA 4USKA 3VQSA 5C42A 3AHPA 1RTJA 1PSDA 1WI6A 1CJTB 1FK9A 3NCRA 2LA6A 1I6JA 3V4IA 4O3RA 5DQHA 2DXEA 5CD4H 3DRSA 3IRWP 1S9FA 1IWGA 4K4XA 3M9MB 2EKNA 2YNFB 3AB2B 1VBYA 1N5QA 2Q66A 5KFCA 4LF9F 2E5HA 1OY9A 2ATLA 4KFBA 2CDQA 3QBCA 1M1KT 4GVBA 2HVEA 4G1QB 2LQ8A 4ZJQA 3RJMB 3N4WA 2RAQA 4OX9J 4JUZA 5LOQA 2B9EA 4NLSA 1VBXA 5GADU 2WOMB 1VQSA 1NM2A 5T14A 1WDDA 1FCAA 4IG3B 3D0IE 1TFYA 2KRBA 3BBFA 3R3TA 2COLA 2C3UA 3CCRS 1HL6A 3QMQA 1F5AA 1U1QA 2UXBF 2JLGA 1TUGB 5H9FJ 1XNRF 4I68A 4HVZA 4B9LA 1WF0A 5IWAF 2LDYA 2LEBA 1S7IA 4LREA 3S8SA 4ZVHA 2MZSA 2RD5C 3N79A 1VFJA 3IWLA 4OHWA 1BGXT 3NNCA 2XMMA 2UV8A 4RL1A 4RW8A 3TAPA 2FJAB 2EBEA 2AEJA 3BDEA 5LXRA 1UJ4A 1VHFA 2AYEA 3M6WA 3N28A 3BN7A 3SSRA 1BQNA 4HH0A 5T41A 1WUUA 4KY3A 5BR8J 2QC3A 2F4FA 1ZM4A 4KTQA 1HBUB 2D3ZA 2ZH8A 3CCUS 3GPAA 1G7CB 4OZ1A 4C11B 3HD2A 1M0SA 2FLLA 4QWAA 4MT1A 1KVJA 2XM3A 3M8QB 1HNVA 4Q45A 1L5UA 4LF4J 2L9WA 3WHIA 2HBRB 4QYRA 3CCWA 2RDJA 3X1LB 5CAAA 1S9EB 1JK9B 2E1AA 4DX7A 4Z37A 3AH6A 4H4OA 5KFEA 2F1FA 3KLIB 5F8LA 4USWA 3I4PA 2GA7A 2H3EB 4OJ3A 1RSCA 1UVJA 2WSCC 4NLYA 1RTHA 3VV2B 2MGZB 5M2UA 3D6HB 2DCLA 5J2NB 1DURA 4ES1A 2HBQB 2QSWA 2OSRA 5CA5A 3BH6B 4YP3A 4S0MA 2QEXS 3QRPA 1CJTA 2ZJRQ 1CQMA 4Q2LA 3R7NB 2LLZA 2QL5B 1YSJA 3GILA 2RILA 2W8LA 3CDAA 1ZM3A 2KN4A 3TAQA 2ATCB 4DPYA 5KT6A 2YNFA 2GVZB 1DZ5A 3MEEB 2PC6A 2FY8A 4PG8A 4GKJJ 4G1QA 1H98A 5J1NA 1U0SA 4NI2A 4KGKA 3ZZPA 1CVJA 1TL1B 4HTJA 1UEUA 2JRSA 4J5OA 1IM4A 2A0FB 4CI0B 1FHTA 1S6UA 2WOMA 2KT2A 3S1TA 4EBDA 4IG3A 2KHDA 5D0RA 3EVOA 1KEKA 2OAUA 5ETRA 2AYBA 5CYMB 1GFWB 2LCWA 1JLEB 2XYGB 3M8PB 1S57A 4MIAA 3I56S 3O5TB 3VCDA 4DV0J 2MKSA 3ZZRA 2G0CA 2APOA 4CRJA 1RTIB 2FGOA 3D5MA 4EO8A 4J9MA 1HD1A 4MH8A 2ZH2A 4NMXA 3W66A 1KN6A 4FF4A 3DOKB 4ILRA 4WU3A 2V4RA 2EI5A 2J6TA 1XBWA 1EIYB 3FMBA 3KYLA 3ZZZA 1HBUA 2WSEC 5DETA 2YQ1A 4C11A 1NK8A 1SJ3P 3IBCB 4ZLNA 2I6WA 1N5VA 4UY8T 1VMBA 4MKBA 3DM2B 3M8QA 2NPFA 4PXBA 3R5CA 1S9EA 2AJ4A 5ETTA 2JSXA 2QL9B 2C2OB 4N8NA 2KFNA 3MEDA 1JLGB 2IDEA 2GX8A 3KHHA 4FYYB 5IC6B 2A3JA 1UWBB 1SUQB 2MGZA 4FNHA 3KLFB 4NA3A 5J2NA 4A8SA 5HATA 2JL9A 2VG5B 4YMEA 3MDFA 4YHHJ 4YEAA 3P49B 3VWSA 2FLNA 1WC3A 3BGLA 4CZCA 1H72C 1H38A 2D9OA 2UVUA 3DLBA 1FRXA 1H6KX 2M3DA 2GVZA 1ZETA 1GH8A 3K7RA 4KV8A 1NBEB 1S12A 5DDOC 2RMLA 3K8WA 2B51A 4M5IA 2QG9B 3FSIA 3L95X 4NCAA 3FZ2A 3MEGA 4LIWA 2V6AA 1TL1A 2LVWA 1U6BA 1L3SA 3DGVA 1S79A 3RW7A 1MMNA 4JI2F 2BMBA 1YGYA 4FPRA 2BQRA 4TQSA 3DCAA 3J80U 3N6MA 4ZPDA 4UOHA 1FRJA 5CYMA 2HHQA 3EVMA 1X4GA 1S97A 1JLEA 1LW2A 1HNWF 3M8PA 2V2VA 4O3QA 3OL7A 4FS2A 4I67A 3MEKA 1WTFA 2F9DA 5GAEU 2OTJS 1F6TA 5GMEA 5L38A 1E6VB 1I94J 3ENQA 1RTIA 1N54B 4WU2A 3ISNC 3BEGB 4ITSA 2V8HA 3I0RB 4AFFA 3LH2S 3TI0A 3HFKA 2AEMA 3UDVA 2VOPA 3DOKA 3KWMA 4NXMF 3CJ5A 2GS8A 2KU7A 4CCHA 2RU3A 2Q1LA 5M2RA 4M5LA 4M5KA 1AUSL 4N76A 4USVA 5IFMA 1S59A 1N48A 5DS7A 1W2IA 5LXYA 4XO0A 3OR1B 4QPXA 4CTAB 4YQWA 2V4JB 4ER8A 3FDSA 1V5IB 4DUZJ 5A8KB 3J81Y 3CCES 1JLFB 4ECSA 3L7UA 3A3NB 1S0MA 1JLGA 5SUHA 2EFPA 3JS9A 1UWBA 1SUQA 1LWCB 1NK7A 3KLFA 3MR2A 4DV5F 3Q23A 5DG8A 3B82A 1LKZA 3T19A 1JIHA 5KFKA 1NRKA 2R7TA 3R5GA 4ECYA 3F73A 4MIWA 3BO3A 3CDWA 1GK8A 2L08A 1XN9A 4DR4F 1NZAA 2CZVC 5CYJA 3CDEA 1SVDA 4DFPA 4IDKB 4YR0A 2LQ9A 3C66A 4F2SA 2DNNA 3PG9A 3PY8A 2VKRA 4ANEA 4KR0B 2QGFB 4NLVA 4UF4A 1SCJB 3A8KA 2XHWA 3T41A 1GXLA 3CCSS 1TV6B 4CIOA 1GT8A 4JI4J 3OXGA 5K8NA 5L1KA 1HWLA 2GO8A 5HAOA 1T03A 3KXDA 4F4KA 2VDHA 4RU9A 1MU2A 3RRKA 2UZAA 2HHHF 1MSWD 3DOMA 3MD1A 2XMKA 1E6VA 1KWMA 3SFUA 4Y0FA 4AXJA 3BQ0A 4KH0B 2J9DE 3OBIA 2RVJA 2OPQB 2HRTA 4HHHA 2RHSB 2QMWA 3I0RA 3CJQA 2VF3A 1VGYA 2UUTA 1Z2LA 5A0YB 4TLRA 2WB4A 2Z30B 1A6LA 3HFZB 2E5IA 3AD8C 5KG6A 2DHAA 3PEJA 1OSCA 4U8VA 2D74B 1Q7YT 2MQNA 5HVHA 3UCGA 2LKZA 2E7VA 5C7PA 2R7OA 3I87A 3OR1A 3M8YA 4OX6A 3H90A 4CTAA 2BACA 2DH8A 2V4JA 2EK6A 3PKYA 3Q2TC 4F3MA 5A8KA 1JLFA 2VPXB 5I42A 2C28A 4WK3A 2HEKA 2IBOA 3TWZA 3HJFA 4DV2J 3V4MA 1S0NA 2BV3A 3BF4A 2OH2A 3EGZA 2FHMA 1IBLJ 2XZWA 1HA1A 1F2GA 4A8MP 3RR7A 2UXCF 3G71S 2YH1A 4C8OA 2WONB 3EGNA 2ALZA 4IH6A 3BGUA 2Q3PA 1RBLA 2VC0A 1NDCA 4OYBA 4G1PA 4DV7F 3GYNA 3R5JB 1HPZB 4IDKA 1N34F 1WKJA 5KTQA 5G4DA 2HG4A 3OUYB 4IOCQ 2NUUG 2HS4A 3IGVA 3FSXA 1ZTWA 2CQGA 2XULA 1K0TA 3OTOJ 3PW7A 5IOLA 2AW0A 4X4NA 1FKPB 1ZOTA 2CQIA 5KFLA 4RWXA 2V2QA 4JI5F 2HVIA 1KR4A 1BMQB 1SQFA 4ZPBA 3V81B 3WQPA 4GKKJ 4WYLA 4C98A 2BUNA 3H5UA 3EZOA 3R5BA 4ECQA 2OPQA 5KFZA 4MMOA 3RB0A 4RZRA 3ZFVA 5HQMA 4U7UD 5MAOA 4ALZA 3MD3A 2YKPA 2AJFE 5BJRA 3TUZC 4K4VA 4DS4A 1KHWA 3HT0A 5A0YA 3W9IA 2YKMB 3MR5A 4A8FA 2AJQA 1U47A 2HSEB 4ZVOB 1ZM9A 1EETB 4NRUA 1PJ7A 1QAYA 4IFYB 2QX0A 2C2RA 1VISA 1YQHA 3TOQA 4HYKA 2VUGA 2IM3A 1SV5B 2MKYA 3W63A 2ZD1B 3BV8A 4YS2A 1KC8T 3KHLA 1M5KC 1X5TA 3T5KA 4QQBA 3CIMA 1MNEA 2VZ9A 4OX9F 3TJ9A 3UO0A 4DPXA 1HD0A 3BS9A 3M6XA 1JLCB 4ZPVR 5D78A 5EWEA 4FBUA 3RRHA 5B0AA 4RNMA 2A2DA 4YY3F 1RYSA 2R3VA 2XB2D 4LRFA 3D66A 1FRIA 3UI3A 3IA0A 4F4XA 1DAXA 3I82A 2YKOA 1GQEA 3RAXA 2N4DA 4ZVGA 2WONA 2DK2A 4W92B 2NSBA 3H42A 1Y00A 2XY5A 2X1BA 5LMNJ 2ZH1A 2IFXA 1HPZA 2GIRA 2DXFA 3VZHA 4U96A 3OUYA 5ITHA 1FJ7A 3H59A 3JSRA 4CO0A 2UP1A 5BR8F 3UDLA 3MAQA 1HI8A 4DSFA 4NLOA 3W64A 1FKPA 4JB8B 3AQPA 2PGCA 3A3PB 4DG1B 5F3TA 1R6YA 2A6MA 4USUA 1UTAA 5L8RC 2G9OA 4YUDA 3CJ8A 2FZCB 3U02A 4MKVA 3VZIA 4FDFA 3V81A 3QWPA 2C2DA 4LF4F 3IN5A 4RUCA 2J7KA 3RGIA 2Y9HA 3QYYA 2Y0BB 4MK8A 1RDRA 4C8MA 5A8RB 3KJQB 2XMWA 2B7CB 2PFFB 2ZE2B 1JXVA 3G8TA 1T9TA 2D1CA 1S77D 3M2VB 2VONA 1S48A 2E1CA 4RUAA 4F7VA 2CJXB 5J2MB 2B8PA 2ALYB 3AD9C 4CLPA 3PO5A 4Q0BA 1EETA 3D2WA 4NRTA 3R6GB 3AA9A 1SH0A 1E6YB 4IFYA 1NAQA 3AJDA 1XJWB 1ZBTA 2E9TA 4IH7A 1DBDA 1U1PA 1SV5A 2GJ2A 1U09A 1VS3A 1K8AT 2ZD1A 4X2BA 3IR5B 4GKJF 3EUNA 2CIMA 4CO4A 1TAUA 4HHJA 1QD1A 1CG2A 2VOOA 2IJRA 5ETKA 4CP5A 5KFXA 2MKHA 1JLCA 4RW9B 2DGVA 3QFHA 3KUGA 3JAMU 4K4ZA 1NJWA 3GIKA 3NGKA 7FD1A 4DMZA 1IR1A 2CG8A 4USTA 1U0HB 4C2MA 4TLQA 1QJHA 2XO6A 3RBDA 2X1FA 2C2MB 3QFWA 4OV1A 5CCLA 2M9KA 2IM0A 3Q8YA 4DV0F 3A13A 2ZH5A 4JI0J 4KT0C 2J0WA 4ZJOA 2FHJA 2NREA 4FPIA 1FTCA 5IQQA 3SBMA 5F8IA 2H1YA 2VFRA 2N82B 1X9MA 2DBBA 1HNZF 1U2CA 4DV1J 1YKWA 1RE1B 3FCVA 1S7HA 2QLJB 3TX0A 2OMOA 1YJRA 2ZJPQ 5F41A 3I55S 2XG8A 4PWUA 2MHNA 3FBCA 1RHKB 1M1GA 4DG1A 2FJXA 2HBZB 1XR7A 2CA9A 4LR7A 3NLCA 3WX4A 4B9UA 5GAHI 1L3TA 4NLGA 1H3DA 2HHUA 1UL3A 4ID8A 1S1VB 3GJQB 5LT5A 2OMLA 5J1PA 4KHMA 2CQDA 1VOMA 5A8RA 1FRMA 4QU7A 4I6YA 5CH7B 2DPIA 3MPDA 1FEHA 1PC5A 3QT5A 1NDKA 3LOUA 3M2VA 3G8SA 1PCAA 2ZBRA 2DH7A 3U27A 1Y9OA 5J2MA 1N5SA 5F8MA 3VAFA 3T5LA 3PJ9A 4YHHF 2HHXA 5HBMB 5KFDA 4FXVA 3ELHA 3RBEA 1E6YA 2YWGA 5D0EA 1N6QB 1IKWB 3NMRA 1U1NA 4BC7A 1ZZFA 3W5XA 3CEDA 4MFBB 2OEMA 3B78A 2JFDA 4QIVA 3I31A 4MKAA 3GJRB 1T05A 2XO7A 1ZYQA 3NG8A 1T9YA 4Y65A 2DRBA 2ZBPA 4RW9A 3I4HX 1A7GE 1VI7A 4ECTA 2HHTA 1VQOS 4JBCA 1P8GA 2N7CA 4HHUA 2DTJA 5AXMA 1IBKJ 3MUVP 1WEZA 4CLUA 1D0EA 1U0HA 2UUAJ 1RWNB 1G3OA 5D6GA 3NGUA 3ZNJ1 3T1HF 1HMVB 2F65A 2IYGA 1I94F 2G2YA 1HNXJ 3BGOP 2W4PA 1U1LA 2W2OP 3LPEA 3QT6A 3PYDA 1S76D 2I0XA 3DU5A 3L09A 1I1GA 4ZVFA 5IS2A 4K7QA 3GU0A 5E2QA 1XMOJ 3KMQA 1VBKA 3PRDA 5AE1A 1FJEB 3IO1A 4TNOA 3NCQA 2IIHA 2KXFA 3J7YI 2CQ0A 3UQSA 4OMFG 3UD3P 2NPIA 3J80Y 3JSBA 3MR3A 3A3OB 5HJXA 2BJ1A 1U24A 2C42A 3SEOA 4OZ2A 4L6V3 9RUBA 3PYFA 4DL7A 4FVMA 1QLNA 4U7UK 3R1LA 3MMJA 4DUZF 3M8ZA 4BWJA 1NPPA 4AXIA 1S1VA 2EK1A 3LGNA 2RS8A 4JV2A 4J9KA 2DNGA 1X0PA 3MFHA 3RU0A 1C2PA 2NXEA 4ELUA 4J9UE 1KLNA 3GONA 2XY7A 4TXSA 4IFVA 2LMIA 2J9DA 2HBYB 5HBMA 3P6YC 2GQ2A 1SC4B 4UQGA 3S01A 2BKPA 4WKYA 1N6QA 5A8WB 3RB3A 1IKWA 4LSZB 1X0FA 1NXIA 3G6XA 2V50A 1TTHB 4X4VA 2LU1A 4MFBA 4R8UB 1WJ9A 1QE1B 3CJ0A 2M70A 1U8SA 4J90A 4KKOB 2J0XA 1PKUA 2R8IA 1B7FA 1W2BR 2R7WA 1QSSA 1IQZA 4DEZA 3PNIA 1YBUA 4JI4F 5HI7A 2BZ2A 2M0GB 1S6QB 4TQRA 1R31A 3ZNUA 4Y2AA 4FS1A 1N0UA 2AGQA 3NBPB 5H1SV 2ZWOA 1QSYA 3TUIC 4OLPA 4FZVA 1HR0J 2LEAA 1HMVA 5BYSA 2FTRA 3MPUB 1DTQB 3R7SB 2J5AA 2LQBA 3E51A 2CQ4A 3DMJB 4DR6J 1SI9A 3IG1B 1KDNA 4UOGA 2HWIA 4XTTA 1KS2A 4NEZA 2MMYA 4N47A 1WI8A 1FXRA 3SQGB 4ZP9A 2CPIA 1RWVB 3PRVA 3THVA 3K5LA 2C22A 1K47A 4JI3J 1S1TB 2XMUA 3DU6A 1A0OB 4EFAC 4LBIA 5ADZA 2QYCA 2KHCA 2YVSA 4J9VA 3HHLD 2VQFF 4NWBA 1K1QA 1D8ZA 2QA4S 1OPIA 5B0EA 3T1YF 2QT7A 4TU8A
chains in the Genus database with same CATH topology
1Q0NA 3HCXA 3ILOA 4M5GA 5ETRA 3KUEA 3ILJA 3ILLA 5ETTA 1RTZA 1RU2A 5ETLA 4M5MA 4CRJA 3HSZA 3ILIA 5ETMA 3HSJA 3KUGA 1F9HA 3MCOA 5ETQA 3MCNA 1G4CA 1HQ2A 1EX8A 4M5LA 2BMBA 2CG8A 4M5JA 1KBRA 1RU1A 2QX0A 3HD2A 5ETSA 3UDEA 4CYUA 4M5KA 4CWBA 1TMJA 3KUHA 3HSGA 4M5HA 5ETKA 3IP0A 1DY3A 1IM6A 3MCMA 4M5NA 4PZVA 4F7VA 1RB0A 5ETNA 5ETPA 1CBKA 4M5IA 4CYUB 3UD5A 1RAOA 2F63A 1EQ0A 3HT0A 5ETVA 1EQMA 1HKAA 3HSDA 3HD1A 5ETOA 3UDVA 4AD6A 3QBCA 2F65A 1TMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0N A;  3HCX A;  3ILO A;  4M5G A;  5ETR A;  3KUE A;  3ILJ A;  3ILL A;  5ETT A;  1RTZ A;  1RU2 A;  5ETL A;  4M5M A;  4CRJ A;  3HSZ A;  3ILI A;  5ETM A;  3HSJ A;  3KUG A;  1F9H A;  3MCO A;  5ETQ A;  3MCN A;  1G4C A;  1HQ2 A;  1EX8 A;  4M5L A;  2BMB A;  2CG8 A;  4M5J A;  1KBR A;  1RU1 A;  2QX0 A;  3HD2 A;  5ETS A;  3UDE A;  4CYU A;  4M5K A;  4CWB A;  1TMJ A;  3KUH A;  3HSG A;  4M5H A;  5ETK A;  3IP0 A;  1DY3 A;  1IM6 A;  3MCM A;  4M5N A;  4PZV A;  4F7V A;  1RB0 A;  5ETN A;  5ETP A;  1CBK A;  4M5I A;  4CYU B;  3UD5 A;  1RAO A;  2F63 A;  1EQ0 A;  3HT0 A;  5ETV A;  1EQM A;  1HKA A;  3HSD A;  3HD1 A;  5ETO A;  3UDV A;  4AD6 A;  3QBC A;  2F65 A;  1TMM A; 
#chains in the Genus database with same CATH topology
 1B64 A;  2MDA A;  2KZM A;  3M9O B;  2VQE J;  2VDI A;  2FLO A;  3UD4 P;  4DV2 F;  1WWH A;  2R7Q A;  2RF2 B;  2G4B A;  4LRB A;  4I7F A;  2Q6C A;  3C15 B;  5E3Q A;  3N6L A;  4LR9 A;  3MMA B;  4P9S A;  2EXU A;  1IBL F;  3QIP A;  2XLJ A;  4U8Y A;  2KM8 C;  3T5H A;  4K4U A;  1F9E B;  5A8W A;  1LWF B;  3U7J A;  2DNO A;  4Y3C A;  1TVR B;  4M63 A;  4R8U A;  3TO8 A;  5KT4 A;  2CJB A;  3CJ3 A;  1S0V A;  4KKO A;  1NCL A;  2OPS B;  3KK1 B;  3M8W A;  3UD5 A;  2M4M A;  4ERD A;  4YR2 A;  3DRX A;  3HDS A;  5KG2 A;  4NYZ A;  3CNQ P;  4A8Y A;  4B3S F;  1EKS A;  4DSK A;  4DQS A;  5KFJ A;  1S6Q A;  3CUL A;  1S1X B;  3CSK A;  4LF5 J;  4OYA A;  5E33 A;  1S6P B;  1QDU B;  3UFC X;  4CLZ A;  4ETX A;  5AXN A;  2GAG C;  1Q86 T;  1AFJ A;  4TYB A;  1X4D A;  3W2W B;  4GKK F;  1DTQ A;  4P71 A;  4P52 A;  5HSP A;  4O3S A;  2GMH A;  2DEI A;  1XER A;  3M8S A;  2JZ5 A;  3O1L A;  2L3M A;  3DMJ A;  3VAG A;  1NHK L;  5B0B A;  3IG1 A;  4H4K C;  4KGM A;  4O0I A;  4NYP A;  3M6V A;  2ZKU A;  2OD4 A;  1EAY C;  1F3V A;  4G65 A;  5GAD I;  3DLJ A;  1RTD B;  4N56 A;  2GO9 A;  3SQG A;  3CJT A;  4DJB A;  1XMB A;  3NEK A;  5KOX A;  4C0O C;  1IKV B;  3PYE A;  1WOS A;  1S1T A;  5K14 A;  3AY0 A;  4YDD B;  1Y0H A;  3LWL A;  4DR2 F;  1FKO B;  1NSP A;  2V8P A;  1WHY A;  1HHS A;  5EWF A;  4ZN1 A;  3LWM A;  3HHL B;  5JXS A;  3KKF A;  1LWE B;  4NML A;  4ED4 A;  4Y2K A;  2U1A A;  3F0N A;  4MYU A;  2X1G A;  1UPM B;  2MXY A;  1NDL A;  3HI9 A;  2HLU A;  1TKD A;  1SKW A;  4KHP J;  3T6B A;  4GRS A;  4K0K J;  4AL5 A;  4DFJ A;  5EUH A;  5KFF A;  1TL7 A;  3C6T B;  4YFU A;  3D0G E;  5B09 A;  3M2R B;  4IKA A;  3C15 A;  3ZZU A;  3MMB B;  3GV8 B;  3MMA A;  3NRB A;  3GB0 A;  5CHC B;  2GCF A;  2EPI A;  3DFE A;  2B9Y A;  3ZZY A;  2WVC A;  1LEO A;  1LWF A;  2A10 A;  2BYC A;  1DLO B;  1TVR A;  5LMN F;  1RCX B;  2POK A;  2RUG A;  3TEG A;  2CAD A;  3M4X A;  4KH1 B;  5JVG Q;  2OPS A;  3KK1 A;  2EFG A;  2IDL A;  4CYU B;  3B4M A;  5T7L A;  3S7R A;  1KOH A;  4ZLP A;  3PR4 A;  4KGX B;  1X5S A;  2FVQ A;  4WPA A;  1UFL A;  3CWJ A;  1B0V A;  4TKT A;  4DSL A;  2DNR A;  3P96 A;  3DLE B;  3OTC A;  4EYH B;  5HQL A;  1S1X A;  2Z2L A;  3BKF A;  2M7S A;  2K8G A;  4DQI A;  2RHQ B;  1Q7L B;  1S6P A;  3H40 A;  2XBP A;  2KH9 A;  3IWX A;  3HKZ D;  2P9E A;  3W2W A;  3K5O A;  2DNL A;  1VQ8 S;  2FVS A;  2NZC A;  1JJ4 A;  3GFX A;  4EGL A;  5IV4 A;  3GV5 B;  1V3R A;  1YBA A;  4RBU A;  4F50 A;  1X9W A;  4JI1 J;  1RTD A;  1VQ5 S;  3FFI A;  3ENV A;  2Q43 A;  3D67 A;  2M88 A;  4KHR A;  4EBC A;  4DQQ A;  2HQG A;  5F8G A;  3IBW A;  2R9L A;  1IKV A;  8ATC B;  2DNP A;  3EZU A;  1T3O A;  2Z2Z A;  3V5R A;  1HI0 P;  1NB7 A;  3AJ1 A;  3Q89 A;  2UU9 F;  3TX8 A;  1FKO A;  3DI6 B;  1HW8 A;  4B3M J;  3G6V A;  1ULR A;  2H5I B;  1OO0 B;  4AD6 A;  2GFF A;  4OHZ A;  5EHH A;  2KVI A;  3HHL A;  2YWH A;  3EWG A;  2QL7 B;  2ZBI A;  4LQ9 A;  1SXL A;  2YY3 A;  1SL1 A;  2CPJ A;  5E5N A;  4KYZ A;  1ELO A;  2PI4 A;  3IM8 A;  4DL5 A;  3FBE A;  3ENW A;  2K3K A;  3H4B A;  1RWU A;  2ILY A;  5HQ8 A;  2W9A A;  2ZC4 A;  1FNX H;  2DNZ A;  3C6T A;  2ACM A;  1HYS B;  2FVR A;  3M2R A;  4LVO P;  3MMB A;  4RW6 A;  2WVD A;  1Q0N A;  1WC0 A;  3VAH A;  4BDP A;  4WFN Q;  2IM1 A;  2FGC A;  4K4T A;  2EC0 A;  4LFA J;  3DC2 A;  4UOF A;  2AIR B;  2KRR A;  3SSQ A;  2F7V A;  2UVR A;  2OKQ A;  3R8Y A;  1XC9 A;  1EZZ B;  4ED7 A;  4LF8 J;  1IUJ A;  5B08 A;  5B0G A;  5HP1 B;  4ZVQ B;  2FLP A;  4CYU A;  4P2S A;  1LXJ A;  3CB4 A;  3BZQ A;  4Y6I A;  3LA0 A;  4DV1 F;  4Q5V A;  1IVZ A;  2W2M P;  5LSO A;  2XEX A;  4DHV A;  1RAG B;  2J0S D;  3PEH A;  3DLE A;  3ZZO A;  1F9H A;  2VFV A;  3JAM Y;  4X4S A;  1VIO A;  1OY6 A;  3P4U B;  3C2P A;  3BKT A;  1KSP A;  2IC3 A;  4IR9 A;  2RIJ A;  3IR7 B;  1UW4 A;  3ADA C;  2J7U A;  3HUL A;  4WP3 A;  6AT1 B;  1TQL A;  2OGU A;  3WC2 A;  4EU0 A;  1GEH A;  1I5O B;  3W7B A;  2E1M C;  4O4G B;  2XGQ A;  2B5J B;  2HKE A;  2XNQ A;  3CJS A;  3KDN A;  4X62 J;  3FK4 A;  5J2P A;  3RR8 A;  1TMJ A;  4OZJ A;  1DJ0 A;  5B0D A;  1NH8 A;  2JEI A;  1MWZ A;  3R5A A;  4I0W A;  1U8W A;  2YWK A;  5DQI A;  3P3D A;  2OEK A;  2IJF A;  3PW4 A;  2XI2 A;  2WVE A;  1PIE A;  3UN3 A;  1FNM A;  5GAE I;  3LPY A;  3FEZ A;  4QW9 A;  3QQC D;  1TK0 A;  2AJ2 A;  2VOD A;  3J7A 1;  1S4F A;  1U6F A;  4C3L A;  2HUR A;  1NJY A;  3IM9 A;  1LW0 B;  1YLX A;  2HQC A;  2L41 A;  1H7X A;  2HFS A;  2XCA A;  2QV6 A;  2ZH7 A;  2C3O A;  3OHB A;  3DRY A;  2W2N P;  4J9L A;  4ED5 A;  2FDN A;  1SQG A;  3Q22 A;  1FEE A;  3PW5 A;  4K50 A;  1MRO B;  5DGB A;  1CJK B;  2OHD A;  4M5J A;  1HYS A;  2GIF A;  2UUA F;  4P6Q A;  3R7B B;  1S4E A;  1NEE A;  4ZVE A;  2IRU A;  4C8N A;  1RLD A;  1RWK B;  2RJZ A;  3HJV A;  1YZ6 A;  1RGV A;  1TZ0 A;  3KNA A;  5E3R A;  2FQQ B;  1HNX F;  2AHO B;  1W7W A;  1NK5 A;  2MKK A;  1DAR A;  1O0P A;  2JHE A;  4E0D A;  4ED8 A;  4GC7 A;  4WE1 B;  5I3Q A;  2FJW A;  3AQO A;  3JTO A;  4OZL A;  1YJ7 A;  3PHE A;  5D0G A;  5HP1 A;  3ILL A;  1RU2 A;  5AJ3 J;  1XMO F;  5LSL A;  2I2Y A;  2EWH A;  2IJN A;  1IR0 A;  3LAK A;  5BYQ A;  1N4L A;  1ZTT A;  2HVH A;  1U6Z A;  1KRP A;  1KLM B;  1GTH A;  1UZH A;  4O0N A;  1R6V A;  5C24 B;  3G87 A;  2M8H A;  5KG5 A;  4C8K A;  1WF1 A;  2CQ1 A;  3H8Y A;  3IR6 B;  2QMU B;  3SCI E;  4WZM A;  1WHW A;  3FCW A;  5G0R B;  3J81 j;  2WW4 A;  1QAI A;  1WKK A;  1RYR A;  1UET A;  1F3F A;  1UEK A;  4W98 A;  3C16 B;  4O4G A;  4A8O A;  2B5J A;  2ADB A;  3VHQ A;  4JI7 J;  1Z1Z A;  4DPO A;  5F8J A;  3EYZ A;  1VIX A;  2MKI A;  1RHR B;  1KON A;  2EFQ A;  5GVQ A;  1TR0 A;  3A8I A;  4LJM A;  2RRN A;  3MR6 A;  1ZAX A;  4HAC B;  4FYW B;  4DQP A;  3ONQ A;  4WP9 A;  1GMU A;  4KPY A;  3W60 A;  4EZ9 A;  2X3D A;  2EBG A;  3K5P A;  4DV6 J;  1FE0 A;  3LO3 A;  3BGF A;  4QPT A;  3DXS X;  1X4F A;  2QTW A;  2RQ4 A;  2MZQ A;  2V8V A;  2ZUA A;  1FWP A;  1MRO A;  3F56 A;  3R27 A;  4RLE A;  1W25 A;  2Q79 A;  4DN0 A;  3D6M B;  5HVF A;  1HR0 F;  4AT1 B;  2AGP A;  2QLF B;  3SDE B;  2V68 A;  5DG7 A;  1VQ6 S;  2J8A A;  3F44 A;  4DR6 F;  4UZB A;  2UVV A;  2U2F A;  3MAH A;  2E66 A;  2HND B;  4K4W A;  2SXL A;  2DEJ A;  4RBT A;  5GAG U;  4M94 A;  2X1A A;  5EGY A;  4PXD A;  1AT1 B;  4HT7 A;  3QT8 A;  4IRD A;  1KVI A;  3J7Z 5;  3UDE A;  5D4P A;  3Q24 A;  4QWD A;  1XMQ F;  1T3N A;  2A1B A;  2F63 A;  2M2B A;  3K5M A;  4DV4 J;  4JI3 F;  1P9Q C;  3QJJ A;  5C24 A;  2IVF B;  2ZKT A;  2HAI A;  1DHM A;  4ICL B;  2BOP A;  2DY1 A;  3OQ2 A;  1BWE A;  5ETN A;  1GNK A;  3QJP A;  2ADC A;  5G0R A;  5C2G A;  2Z0G A;  1N5T A;  3BYR A;  3FCH A;  2VQE F;  4WFB Q;  3C16 A;  3LP0 B;  1FXL A;  2FD2 A;  2AEF A;  1MLA A;  3P45 B;  3EIC A;  5KFQ A;  1IBC B;  1IJF B;  4JOU A;  3UNY A;  1RK8 A;  2IRY A;  4OZ0 A;  2KT5 A;  4DX5 A;  4F67 A;  4LSL B;  1Y5N B;  1FA0 A;  2DVI A;  2KL8 A;  2VBZ A;  3NKY A;  3KMS A;  4RNN A;  1UEV A;  4N77 A;  4F4Z A;  2CQB A;  3MOZ A;  2UUB J;  5A2Q U;  4HAC A;  2AD9 A;  3W1Y C;  4OI2 A;  1WAC A;  5KFP A;  4IH5 A;  3ZO7 A;  3TZX A;  3CCV S;  4PKD B;  4X65 J;  2FIU A;  3H5Y A;  3RTV A;  3OPK A;  2LYV A;  5CXT A;  2ZJQ Q;  4DL3 A;  3OT9 A;  3OL6 A;  4M5D B;  2P9C A;  5K5M A;  5AT1 B;  2AJ1 A;  2YKQ A;  1O5J A;  3ZTS A;  2DR6 A;  3D68 A;  2CQH A;  3QWU A;  2HWH A;  2N7Y A;  5KG0 A;  5DDR C;  2EVZ A;  2CQ3 A;  1S1W B;  1UFW A;  1DQA A;  4MAK A;  4FXD A;  3MM9 B;  5EDW A;  2AYM A;  4DX6 A;  2FJV A;  3GP9 A;  2D3O R;  3Q86 A;  3A1Y G;  2KFZ A;  4RNH A;  1GMW A;  4WP8 A;  3HSZ A;  1T0T V;  1Q1K A;  3FBF A;  4I2P B;  2HND A;  4FVC A;  2NUH A;  5HMZ A;  3CCZ A;  3O2I A;  2HAF A;  2KXH A;  2E29 A;  3EJM A;  2AZ1 A;  1FRH A;  3MMC B;  4V19 X;  2QLW A;  2C2Z B;  3VQT A;  2WBM A;  3KJF B;  3VGT A;  3UE2 A;  2HQI A;  1RB0 A;  3N5B A;  4LF6 J;  3BGR A;  3QSY B;  4EZ6 A;  3CC2 S;  3HSD A;  4FBT A;  4LRD A;  3GR1 A;  3A8J A;  3OTB A;  4ICL A;  1HAR A;  3I9V 9;  1BQM B;  2A2C A;  3GE9 A;  1GX5 A;  3ZTP A;  4BLG A;  3DDK A;  3OSN A;  3TVK A;  2DGW A;  1BD6 A;  1TK8 A;  3QAE A;  4A8Q A;  4ZA1 A;  2P5V A;  3LP0 A;  5HJY A;  3PX0 A;  2O1P A;  4KHP F;  2L48 A;  4OJH A;  4K0K F;  5DG9 A;  3NWR A;  2F40 A;  3OLA A;  3MUR P;  2ZM6 J;  4CLW A;  1MML A;  2FHK A;  2RKI B;  1X7V A;  1XNQ J;  1FVS A;  2YPY A;  4UT4 A;  1RT5 A;  5I4M A;  1IR2 A;  4C48 A;  1DFD A;  2D3U A;  3K0J A;  2F8E X;  3TAN A;  3CD5 A;  2J6S A;  1YIJ S;  2D9P A;  3AFG A;  4L72 B;  2JX2 A;  1VC0 A;  4RKU C;  4W4M A;  3KLE B;  2F5G A;  3W8G A;  4M5D A;  2HRU A;  4ZPW R;  3HM9 A;  4DLE A;  3TZZ A;  1IBM J;  1FFW B;  4PG4 A;  4RW7 A;  1RI7 A;  4PPD A;  4X4O A;  2RRB A;  2J8S A;  4PWD B;  1D3W A;  4HI1 A;  2RU9 A;  1H2U X;  3ETO A;  4N7T A;  1SC3 B;  2BJ8 A;  4NOH A;  3ZTO A;  3W61 A;  2C2N A;  3MM9 A;  4X64 J;  1FD8 A;  1SIZ A;  2UUW A;  2LDI A;  4LRC A;  3KHR A;  2C2E A;  2BE9 B;  5KOW A;  3DLK B;  1XWL A;  4V19 J;  2JEG A;  2Y1J A;  1MG7 A;  5M2P A;  2GNK A;  5ETQ A;  1RBA A;  2CKW A;  4I2P A;  4BHQ A;  2UXB J;  4JI1 F;  1UVM A;  3ITH B;  1N32 J;  2R7X A;  3H25 A;  4UUW A;  3Q8S B;  2D69 A;  2CXE A;  1FRK A;  3FMW A;  2BQ3 A;  3MMC A;  4DL0 C;  3TYT A;  1T95 A;  2CRL A;  1NME B;  1AZS B;  5U47 A;  3OJU A;  2JLF A;  1M5V C;  2BBE A;  3PAC A;  3SXL A;  2XMT A;  1SL2 A;  3K58 A;  1BQM A;  1XIQ A;  3G2X A;  1MWY A;  2FVP A;  2ERR A;  1I3O B;  1RHQ B;  3QZ7 A;  2OPR B;  5HMX A;  2JH3 A;  2AU0 A;  2X51 A;  3QGH A;  2DIU A;  2DGO A;  3UN2 A;  2YPZ A;  2ASJ A;  1S0O A;  3FJ2 A;  2EFV A;  3O8W A;  3LTO A;  4WTY A;  2FC8 A;  5EX0 A;  1KFD A;  1HBO B;  2LXU A;  3LGH A;  2YH0 A;  3OL8 A;  1TFW A;  4QOT A;  3H5S A;  3V6J A;  1SPB P;  5DGA A;  5KFS A;  1VK3 A;  4RBV A;  2CNN B;  2OP5 A;  4LT6 A;  4RUH A;  2RKI A;  3ILO A;  2W9C B;  1BC6 A;  2WHO A;  2MQM A;  2HGL A;  4K59 A;  3MCN A;  2CQC A;  4LFA F;  1YJV A;  2G0J A;  1SIW B;  2ZVS A;  4K2X A;  2XSJ B;  3E8O A;  4ED2 A;  4LF8 F;  2FC9 A;  4AND A;  1AB8 A;  2B7B B;  3HVA A;  3KLE A;  4AL6 A;  1U2R A;  1J5E J;  2OPP B;  3T1A A;  3W62 A;  4NZ7 A;  4Q7A A;  4DU8 A;  3TVZ A;  2PMH A;  1WNE A;  3C6U B;  3TA1 A;  3EDR B;  4PWD A;  3KLI A;  4RNF A;  2CJY B;  1TAQ A;  1NLK L;  4L3N A;  1CQN A;  4KRW A;  4WFY A;  3TJ8 A;  4P2M A;  1RXO B;  3BR9 A;  4WCE Q;  2WTF A;  2GJI A;  4Y28 C;  3DLK A;  3TJA A;  2KTQ A;  1YK9 A;  5EWG A;  2CPD A;  3AAW B;  4YN3 B;  1B0P A;  1BE4 A;  4ZIW A;  1VDH A;  4X62 F;  2PD1 A;  4QIF A;  3BPS P;  3QGI A;  3MEE A;  3TA2 A;  1RHU B;  1VRQ C;  3BBB A;  3BYP A;  1S72 S;  4L3K A;  3IRX B;  1Y3K A;  3DXB A;  4CDI A;  4XDC A;  1D9D A;  2JFK A;  3BPD A;  3MI7 X;  1C0U B;  4Z7C A;  1L3K A;  4DF8 A;  2C3M A;  4R25 A;  2FY1 A;  3U1L A;  3CC7 S;  3D6F B;  2BX6 A;  2ASY A;  3WIV A;  1S1U B;  2OPR A;  1L3V A;  4O3O A;  3UDC A;  2HHS A;  4PAA A;  4CO5 A;  3OW2 R;  4DR3 J;  3QGP A;  2DO0 A;  3IP0 A;  3Q8Q B;  1VQY A;  5HO4 A;  3MF5 A;  4UUX A;  4P7T A;  2DHX A;  3HVR A;  3KUE A;  2W2P P;  1HBO A;  3N5F A;  4H54 A;  2JVR A;  2MTL A;  2GQQ A;  4BBY A;  4OV6 A;  4ZIV A;  2VFT A;  1FDB A;  2B4V A;  2W9C A;  2VHG A;  4EBE A;  2M52 A;  2E1R A;  5DQG A;  3EGV A;  2PO4 A;  2NYH A;  1FDA A;  2IY5 B;  4ZVT B;  1NZ8 A;  5KFR A;  2XSJ A;  1J5O B;  5LJ5 Y;  4C3K A;  3BSO A;  2X3G A;  1F2H A;  1NDP A;  2JDJ A;  4OHY A;  4CT8 A;  1JX4 A;  1AUD A;  3RG6 A;  2JNJ A;  3RBZ A;  1OSD A;  2HMI B;  4WZQ A;  1JLB B;  3DM2 A;  3TQ1 A;  2WZ1 A;  4ZP8 A;  3GII A;  1NK6 A;  1KQK A;  5JMN A;  4ECR A;  3T9N A;  1YIT S;  3QJL A;  4ECZ A;  4KGV B;  3OVS A;  1RAF B;  5GAH U;  2OTL S;  2B4U A;  3C6U A;  3W9J A;  1N33 F;  4B9M A;  3VGS A;  2CPF A;  4PPZ A;  2F3J A;  1UP1 A;  5GMK a;  4DR7 J;  1JNR B;  2KO1 A;  1U48 A;  3LAL A;  3Q2S C;  4ZPT R;  2BQU A;  2MLX A;  4ZVR B;  2R8H A;  3CF5 Q;  5CYQ B;  2V4Q A;  1U1K A;  4CLF A;  4LSN B;  4F02 A;  4B17 A;  2VG5 A;  4ENO A;  2I38 A;  3W9H A;  2CJ9 A;  2KI2 A;  2GAH C;  3B6B A;  4IRC A;  2E1P A;  3R97 A;  3CGI A;  3OTE A;  1B3T A;  1HQU B;  2PFD A;  1HNW J;  2LEC A;  4JI7 F;  3GSD A;  1KBR A;  2XS5 A;  2GJF A;  4ZIT A;  1JXE A;  1PAU B;  3J7Z T;  3IRX A;  4ZP7 A;  3MM5 B;  3MCS A;  2ZDO A;  2MZT A;  4XPE A;  2CPE A;  5L1L A;  1C0U A;  2J6U A;  4X4U A;  3ILI A;  4KGZ B;  1EX8 A;  5IT9 U;  2ZHA A;  5DRK A;  4L74 A;  5KFH A;  1PC4 A;  2FJB B;  3I6P A;  4OZ5 A;  1S1U A;  3RAM A;  3L3C A;  1LWX A;  4DV6 F;  2CVI A;  2RS2 A;  4R0J A;  3SV4 A;  5A6P A;  2V94 A;  1PAE X;  3MCM A;  3JSM B;  5J2Q B;  2P9G A;  2Y8W A;  3AD7 C;  2O5D A;  1UVI A;  4QYZ K;  4P10 A;  2PII A;  1TL3 B;  1VJQ A;  3D1O A;  4NAS A;  3AXM A;  5BXI A;  3BO4 A;  3HHN B;  4YB1 P;  2ROG A;  1BQX A;  3I9Z A;  4J37 A;  3MFI A;  2WK4 A;  5I3U B;  3RW6 A;  1IKY B;  3EPG A;  1S5Z A;  2AJ0 A;  3H5X A;  1JWW A;  2KVQ E;  1YG0 A;  3TQE A;  2BEF A;  1CJV B;  5CCM A;  3GR0 A;  1WC5 A;  1J5O A;  1UAW A;  2CNL B;  2V0N A;  2XNR A;  1ICE B;  1SL0 A;  1TKX B;  2R42 A;  5DM6 Q;  2BVZ A;  2HMI A;  1JLB A;  1KOO A;  4QCL A;  1YI2 S;  3BKU A;  1OQ6 A;  2V5H G;  3AOB A;  4DR1 J;  4OI0 A;  2MHE A;  2JC1 A;  4DV4 F;  4DL4 A;  4BWM A;  4MTP A;  4Z2X A;  2GGP B;  2V2K A;  4EYI B;  3MCO A;  4EUV A;  1ZM2 A;  1WHV A;  1LWC A;  5CYQ A;  1Q16 B;  3KJV B;  2R7S A;  1RBO B;  2ZZT A;  2YKA A;  4LMZ A;  2LQ5 A;  5JUM A;  4KO0 B;  5KFO A;  2DNM A;  4DU7 A;  2DGS A;  2NCK L;  1WD6 A;  4OYW A;  5IV3 A;  3CXC R;  2FHJ D;  5D4N A;  4OYO A;  3CD7 A;  4NL5 A;  2CQ2 A;  1R27 B;  4C7Q A;  5MLC V;  4O44 B;  1GXU A;  1YJU A;  1K1S A;  3KLH B;  1PJ6 A;  3THP A;  1LK7 A;  1DTT B;  3MM5 A;  2DXD A;  2HIQ A;  3DLG B;  4PAB A;  2UUB F;  3MUM P;  2MY8 A;  4LF7 J;  1TV6 A;  2JEJ A;  4ZMM A;  1R3N A;  4I64 A;  1WSR A;  1SH3 A;  1IKX B;  4DPU A;  5CQG A;  2YWF A;  3JTN A;  4X65 F;  4B9V A;  3LAN A;  2PE8 A;  2KZZ A;  3PZP A;  3CJ4 A;  2DT9 A;  4DN9 A;  3D0H E;  1U1R A;  2QMX A;  1WOP A;  1VRT B;  4RUB A;  2PSZ A;  3JSM A;  5J2Q A;  2WCX A;  2BOA A;  4LBH A;  1JLQ B;  1TL3 A;  4ED6 A;  1RWX B;  1M5H A;  8AT1 B;  4NA1 A;  4KFB B;  1VRU B;  3RUB L;  3SYZ A;  2DHS A;  4PXE A;  5DZ6 A;  4B9S A;  1IKY A;  5FDL B;  2WBR A;  3FVY A;  3H20 A;  5A2Q Y;  2HZC A;  2NZ4 A;  3P5T L;  2N4C A;  3MUT P;  1ZS6 A;  3BH7 B;  1FER A;  4L75 A;  5F0U A;  4BC9 A;  2HFV A;  5LSR A;  5HRO B;  1TKX A;  3VGV A;  3GG1 A;  5C2C A;  3I5A A;  1REV B;  1RHJ B;  3G4S S;  1UJ5 A;  4QZV B;  4F26 A;  1RCO B;  3Q8U A;  3D4J A;  3OXL A;  4DXL A;  2XZT B;  2BJ9 A;  2CDR B;  1WEY A;  5D4O A;  2GGP A;  4LF6 F;  2YKN B;  2MJU A;  1XR6 A;  4DSI A;  5GMD A;  4ZN3 A;  1B7Y B;  3K57 A;  2IA6 A;  4ZS6 A;  1XR5 A;  3KJV A;  2BRL A;  4Q2M A;  1PO6 A;  3AOC A;  4P72 A;  2DRD A;  4KO0 A;  1CLF A;  3AA8 A;  4KSE B;  2MQQ A;  1ROF A;  5K8M A;  4IQM A;  4MIB A;  3G6Y A;  2YTC A;  2VC1 A;  4QR2 A;  4JI5 J;  2Z2M A;  4O44 A;  1HNV B;  1RAC B;  3KLH A;  4MKY A;  1FJG J;  5C5J A;  3PIP Q;  1Q4R A;  1DTT A;  1ZZN A;  2HS3 A;  1V5V A;  2IAJ B;  4JV5 J;  3LAM A;  3K2Y A;  3K59 A;  3DLG A;  2MKC A;  4H4O B;  4KB7 A;  1U1M A;  2BDP A;  4NLQ A;  2ZUG A;  1EAR A;  1T9U A;  1IKX A;  4X66 J;  1RT1 B;  2XY6 A;  1Q8K A;  5FLX U;  5JJB A;  2Q6B A;  5C25 B;  3AJ2 A;  3JTP A;  3PJX A;  9ATC B;  4X4R A;  3LP2 B;  2MQP A;  1YJT A;  1VRT A;  1IBM F;  2RE1 A;  1HLW A;  5HLF B;  4B3T J;  3TRG A;  4F25 A;  1JJC B;  5THW A;  1JLQ A;  2GC8 A;  4WWS A;  3FEY B;  2XS7 A;  2HFO A;  2HFN A;  3LF0 A;  3JQM A;  1VRU A;  4ATN A;  1Q53 A;  3TW0 A;  1FDN A;  1Q8L A;  2OLW A;  2K1R B;  2V9K A;  4NI2 B;  4BCA A;  4X64 F;  1Y5I B;  2YKM A;  2Z2Y B;  3E3X A;  5FDL A;  2W7P A;  3GJS B;  3VTI A;  2H65 B;  1X4C A;  4DR5 J;  3MHY A;  2GML A;  2GVD B;  4E2F B;  2QA2 A;  1VK8 A;  2NLW A;  4YY3 J;  3DRR B;  5HRO A;  1S10 A;  4ECX A;  3TP2 A;  2K7J A;  3WZ0 A;  3KG1 A;  3C14 B;  4G3I A;  2XLK A;  3DRP B;  3EXY A;  1N32 F;  4P7V A;  4RJV A;  1RT6 B;  2RDD A;  4QWB A;  1ZPV A;  1REV A;  1Y10 A;  1QAX A;  1X5O A;  1FFS B;  1LK5 A;  5L46 A;  4WTO B;  2DH9 A;  2YKN A;  1LXN A;  5FII A;  1P9Y A;  4FKX A;  3CO9 A;  2MLZ A;  1T9W A;  4DDF A;  4DUY J;  5A76 A;  2VV5 A;  4F36 A;  2CPZ A;  5IM0 B;  2JWN A;  5H9E K;  1KTQ A;  3L9Z A;  2OO4 A;  1U25 A;  1RQ0 A;  2O67 A;  2HIY A;  1M5S A;  2VBY A;  4OQJ A;  1IWA A;  3KUH A;  1VC5 A;  1P6T A;  2HQF A;  3AOA A;  4A46 A;  1NHV A;  4R0E A;  1UJ6 A;  2B9X A;  4ZDN A;  2IAJ A;  1U45 A;  3AOD A;  3MED B;  1DY3 A;  4LF2 A;  3IMQ J;  2W2Q P;  1QUV A;  1URR A;  1RWP B;  1Q79 A;  2YNI B;  2Y1R I;  1QTN B;  4WFX A;  1RT1 A;  3P5B P;  3HLU A;  1WOO A;  5C25 A;  3BM7 A;  3G9C A;  3PXG a;  4HKQ A;  4TU9 A;  1J5E F;  1OS5 A;  3LP2 A;  2K3I A;  3CCJ S;  1N0V C;  3WBZ A;  1JLA B;  2DGU A;  5HLF A;  1NK0 A;  2AKW B;  4OJG A;  2GZO A;  2P6T A;  3IBF B;  1RU1 A;  3D28 A;  3A4T A;  3ISN D;  4KV8 B;  2EFO A;  2VPY B;  2ZEJ A;  2NXN A;  1ZA1 B;  1TKZ B;  2HK2 A;  2ZE2 A;  4P75 A;  4ES2 A;  1KHV A;  3MEG B;  2K1R A;  2QIF A;  4DCO B;  1UA1 A;  1FT8 A;  4LIR A;  1HW9 A;  3I96 A;  3GV7 B;  5F3Z A;  2R7V A;  4XDD A;  1GTE A;  5IXU A;  2F9J A;  3MPV A;  3M2U B;  2Y8Y A;  2BE2 B;  2HQD A;  4LRA A;  2XS2 A;  2GVD A;  3R5D A;  1HWI A;  1C1C B;  4OI3 A;  1YRX A;  3PRB A;  3DRR A;  3I5C A;  2YX7 A;  3ISZ A;  4NYO A;  1LW2 B;  3C14 A;  4DI6 A;  3DRP A;  4JI8 J;  1RT6 A;  2AYG A;  3QGG A;  3LW5 C;  3PTW A;  2EEY A;  3KOA A;  1D09 B;  1N5Y B;  2VIH A;  1G2E A;  2A18 A;  1VQN S;  1R43 A;  4LVN P;  3M6U A;  2J76 E;  3KK3 B;  2D7S A;  2DKO B;  2DR5 A;  5DO2 A;  4DL6 A;  4P74 A;  1WC4 A;  2H5E A;  3N9U C;  4C0B A;  3FGV A;  1P27 B;  1HNZ J;  3NCP A;  2OIH A;  2MQL A;  5IC4 B;  5IM0 A;  3MZI A;  5D8H B;  4DR3 F;  1O6X A;  3Q0A A;  3FQL A;  2Z57 B;  4ED3 A;  4DZD A;  3D54 A;  3OFH A;  4O23 A;  4RO0 A;  5A6W A;  3PKM A;  2LP4 A;  5E0O A;  2DGX A;  4LUB A;  2XHC A;  3NXZ A;  1L3U A;  3TZW A;  2VH7 A;  1T9X A;  3MPY A;  4UOC A;  2WSF C;  4ZVU B;  2IYI A;  5HMW A;  3NAI A;  3DDN A;  2MEW A;  4HT5 A;  5KFA A;  4FKY A;  2ZC3 A;  4D3H A;  4XIU A;  3SSS A;  5RUB A;  5ETP A;  4C8Y A;  3W65 A;  2YNI A;  5KAK A;  2QO3 A;  1YX2 A;  4MK7 A;  4CO1 A;  4B02 A;  1YHQ S;  2NSC A;  1OY8 A;  1IQT A;  3HSJ A;  5D15 A;  3K8V A;  5JVH Q;  3THT A;  5KFI A;  3VVT A;  1JLA A;  3H4D A;  2CJQ A;  1J27 A;  5CZV A;  3KTQ A;  1HWJ A;  1RAA B;  1YRU A;  1IJE B;  1DQ9 A;  4DR7 F;  1TKZ A;  3TEH B;  3QRQ A;  3LUY A;  4URQ U;  3H7H B;  4F3O A;  4N5S A;  3FSY A;  4B9N A;  2FYX A;  1X8D A;  3M2U A;  2BE2 A;  2XLI A;  2LU2 A;  2H48 B;  2CPH A;  1R89 A;  2PN6 A;  1R8A A;  1C1C A;  2EG2 A;  2HRY A;  2MY7 A;  4F0M A;  2UUC J;  2UVW A;  1T03 B;  1TKT B;  2HFU A;  2W4C A;  2HZA A;  3IFE A;  1MU2 B;  3DOM B;  3T1H J;  1Q81 T;  4NCB A;  1WF2 A;  3VF0 B;  1FO1 A;  1N5Y A;  1FWL A;  2IM2 A;  3POT B;  4F8R A;  3KK3 A;  2AF6 A;  5CZX A;  2HNY B;  3KNG A;  1JXL A;  4FF2 A;  4MYT A;  1RAD B;  4A8X A;  1WKL A;  1F5C A;  1EHW A;  2IVY A;  4EI2 A;  4RPF A;  3SV3 A;  3RYL A;  3CVK A;  2JC0 A;  1LFP A;  2R8J A;  4WJB A;  3ULH A;  2EC2 A;  1NSA A;  3BR8 A;  2W1B A;  3EMT A;  4DF4 A;  2VAS A;  3JQK A;  4WK1 A;  2B6A B;  2ROE A;  2V69 A;  2W9B B;  2H5J B;  4C8L A;  5GAG I;  3EM1 A;  3ET6 B;  4NLR A;  1FX2 A;  1T02 A;  2EW9 A;  3SCL E;  4I4B A;  1CC7 A;  4FYD A;  4QR1 A;  1BHN A;  1VBZ A;  1MWQ A;  1WEL A;  4CLK A;  2XC9 A;  5I42 B;  1BUX A;  1N8R T;  2B4P A;  4F3Q A;  2DCU B;  4WKR A;  1VQP S;  3KJN B;  5IT9 Y;  5KFM A;  7AT1 B;  1CUL B;  5HVG A;  1K73 T;  1X4B A;  1VQL S;  2QJ3 A;  2GW8 A;  2OFH X;  4DFK A;  2XSF A;  3NS7 B;  2RT3 A;  1FX4 A;  4NLD A;  2E9R X;  3QZ8 A;  2BAB A;  4DZ6 A;  5F9N A;  4DR1 F;  4CO2 A;  3AB4 B;  1UPP A;  4TVA B;  1K44 A;  4K2J A;  2CWK A;  4ZP6 A;  3E2E A;  2V2Z A;  2C2K B;  2MLY A;  4FYV B;  1HBM B;  4V1A k;  3PHT A;  2AQ4 A;  3R6L B;  1RIS A;  2QSF A;  2KJV A;  1NSK L;  2BW2 A;  4P73 A;  4CLS A;  2DY9 A;  3TNV A;  4C8Z A;  4URG A;  2H4W B;  4ZK7 M;  1TKT A;  4DSJ A;  1PG5 B;  3RAQ A;  5ETM A;  1QE1 A;  1GMV A;  2RDI A;  3QO9 B;  1MW7 A;  2XMV A;  3POT A;  2E9Z A;  4P2F A;  4LF7 F;  2HNY A;  3VR1 A;  3OTO F;  1NKB A;  3CO0 P;  4ZKA A;  2DJW A;  2XZD B;  3NBP A;  4C0H A;  4MK9 A;  1NH7 A;  1BXN A;  2NXC A;  3EPI A;  3GLJ A;  1SKS A;  3JXO A;  5LJ3 Y;  2B6A A;  4PZV A;  3HMJ G;  2W9B A;  3RB6 A;  4E8U A;  3M32 B;  2CPX A;  2BM0 A;  1EQM A;  3ET6 A;  1P1T A;  4WFA Q;  4B3R J;  2K7K A;  3R9L A;  3M7V A;  1JQG A;  1KQG B;  4CM2 A;  2H9Z A;  1URN A;  2VQF J;  1D1U A;  1RAI B;  3M9N B;  1XQI A;  1FRL A;  3T1Y J;  4UZC A;  2QA4 G;  4PEO A;  4F2R A;  3CDU A;  2Z58 B;  3QAT A;  4NEY A;  2R8G A;  3GCW P;  5E3P A;  2VB6 A;  1WG4 A;  1X60 A;  3IXQ A;  4GO5 X;  3GSI A;  1H73 A;  3C19 A;  4DPT A;  2ZOM A;  4OI1 A;  1CUL A;  4N8O A;  2RQK A;  4QWE A;  2X7I A;  2QLX A;  1MN7 A;  2ILZ A;  2QYG A;  2VPW B;  4M5M A;  1SQE A;  1F60 B;  1ZPW X;  2G2O A;  2MZR A;  8RUC A;  3FBB A;  4Y2C A;  3VAK A;  1NJX A;  1T94 A;  1HBM A;  1LNQ A;  1GX6 A;  2RF2 A;  1R8B A;  1OJ4 A;  1N36 J;  4CH7 A;  2NXU A;  2NR0 A;  3NP5 A;  2AV5 A;  1QUP A;  2XCP A;  1CEZ A;  2XWY A;  3UCZ P;  2LXI A;  3CMA S;  3GIR A;  4WII A;  4GO7 X;  4B3S J;  4EMD A;  2B9W A;  3MGJ A;  4USJ C;  1F0X A;  3BB5 A;  3OVB A;  1R0C B;  2PA8 D;  5K8O A;  4NA2 A;  2DYA A;  3Q8V A;  5KFB A;  2ZBC A;  4ECW A;  3TUP A;  1GAO A;  4LBP A;  1Q78 A;  2ZIT A;  2Y3Y A;  4IRK A;  3NNH A;  4OIX A;  2YNG B;  4PYA A;  3HHL C;  3HZE A;  1PBA A;  3QO9 A;  5L39 A;  1FJG F;  1MMD A;  1CPZ A;  2YX1 A;  3GZ7 A;  3VAI A;  4JV5 F;  2RQM A;  4RNO A;  3WIU A;  4Y2M A;  5K20 B;  2H4Y B;  5ETO A;  1OYE A;  3Q83 A;  3BSA A;  5K8P A;  2BJD A;  3B54 A;  4JV1 A;  1NJI T;  3GIM A;  2MZJ A;  4TU7 A;  1WDT A;  3MEC B;  4X66 F;  4J9P A;  1GXT A;  4BS2 A;  2OD6 A;  1F5B A;  2Y1L B;  4HDH A;  1RLC L;  1IXK A;  3CC4 S;  4Q0B B;  2C3P A;  4B3T F;  2E5G A;  3M32 A;  5HN0 A;  3TAR A;  1SB6 A;  4DR2 J;  3UCU P;  1ITP A;  3KK2 B;  1FDD A;  5L9N A;  3ETM A;  2DNK A;  4DV3 J;  1M5O C;  3D3B J;  1K0V A;  2ZDP A;  5KG4 A;  1RWO B;  4TYA A;  2MQ8 A;  2E5L J;  2P6S A;  3IWN C;  4DR5 F;  4CLT A;  3CME S;  4PG5 A;  2D41 A;  2G1D A;  2ZZM A;  2ACY A;  1VQ4 S;  3M05 A;  2FZK B;  4CT9 A;  1U4B A;  2JLE A;  4X4T A;  3D1H A;  1CJU B;  1RAO A;  3PW0 A;  5FLX Y;  2DO4 A;  4I6A A;  1G6B A;  3VAJ A;  2C3Y A;  4CLY A;  3US5 A;  1KTV A;  1LWE A;  3HHK A;  1OQ3 A;  3BSN A;  4C6A A;  1SJQ A;  5E7O B;  1BLU A;  1SKR A;  1NKE A;  2FVC A;  2JJ4 D;  1NUE A;  4FF3 A;  3W8P A;  5EN1 A;  5L1J A;  3OLB A;  4KE5 A;  3CT9 A;  1Q5V A;  5KG1 A;  5I3P A;  4URS A;  1SJ1 A;  1NPR A;  3N0V A;  3TAM B;  4DUY F;  2OSQ A;  1Y4Z B;  5E41 A;  3M30 B;  2HGN A;  3H98 A;  4DUT A;  4DFM A;  2GMJ A;  2V67 A;  4J9O A;  4JI0 F;  4A4J A;  1DLO A;  1UVL A;  3N01 A;  4QYZ J;  2I1R A;  2DHG A;  3KDO A;  1TU0 B;  4PG6 A;  1R8H A;  2RH3 A;  2V34 A;  3ZXW A;  2DGT A;  2YNG A;  5DDP C;  2ZFH A;  3CIZ A;  1PGZ A;  1Q95 G;  3I0S B;  2VBX A;  5B0F A;  2ASD A;  1U49 A;  5HK4 A;  2GHV C;  4ECV A;  4MJK A;  4DCJ B;  1FKA F;  2CNK B;  3JB9 k;  1UA0 A;  1KVK A;  2BJE A;  2RQC A;  3MEC A;  4OZN A;  2LA4 A;  3PIO Q;  2YWE A;  3FRY A;  4RW4 B;  1JB0 C;  4ZPC A;  3HF5 A;  1TMM A;  2HVZ A;  3FZB A;  1FI4 A;  2B4O A;  3DNC A;  2UU9 J;  3I5B A;  3GFY A;  3KK2 A;  3CDB A;  3QPI A;  4ZCK A;  3UVJ B;  5KT7 A;  2QZ8 A;  3CW2 C;  3CUN A;  4A47 A;  4JI6 J;  4XPC A;  2XYP B;  4I69 A;  2KYZ A;  2R4F A;  2P2C B;  3BO2 A;  2YBV A;  2B8Q A;  2QA1 A;  1T05 B;  2E7W A;  4KQZ A;  2VG6 B;  4B08 A;  4DSE A;  1RKI A;  4USM A;  3QSI A;  4F4Y A;  1V3Z A;  2MQO A;  2BE7 D;  2GIQ A;  3HZG A;  3PJW A;  2XMA A;  1VQ7 S;  3DI6 A;  1DRZ A;  3CD0 A;  4WBF A;  1CJU A;  1PBU A;  2BJ7 A;  2QFI A;  2BXJ A;  4JI8 F;  3C46 A;  3V2U C;  2DIV A;  3D1Q A;  4NXN J;  3PVX A;  2KFY A;  4OYM A;  4EK2 A;  3G96 A;  3R2C J;  2VA3 A;  2ZOF A;  3W5Y A;  4C4W A;  3SIP B;  2GHW A;  3TR5 A;  3OSP A;  2WB1 D;  1KFS A;  4ZCI A;  3ZTQ A;  4Y2I A;  4U9R A;  3CMQ A;  4KPC A;  2R2R A;  3RB4 A;  1OPZ A;  3TAM A;  1IBK F;  3EX7 B;  3M30 A;  2KYX A;  4YB5 A;  5IZH A;  4GC6 A;  3HVW A;  2AZ3 A;  1NKC A;  2VL1 A;  1GMW D;  3NOG A;  2RB7 A;  1PJ5 A;  3CCL S;  2ZZN A;  4QJV A;  2UV8 G;  5D0H A;  3IC1 A;  1HI1 A;  4AQY J;  1FNO A;  4DLG A;  4DBQ A;  3SCJ E;  3I0S A;  1HBN B;  4ZLJ A;  1R0A B;  3L7P A;  4NCG B;  2ZH3 A;  1FES A;  5KG3 A;  3MM8 B;  2IA0 A;  4ETZ A;  2CWX A;  3D9B A;  2CYY A;  1U2F A;  4F4W A;  2VJV A;  1W26 A;  2W24 A;  7FDR A;  1M5P C;  3IS9 B;  2K06 A;  4JYA J;  4IFV B;  5IT0 A;  3VVU A;  4RW4 A;  3CCT A;  3CJR A;  3SCK E;  4DL2 A;  4JP8 A;  4X4P A;  2HHV A;  4CQ1 A;  1H2V Z;  2M5Y A;  1M1H A;  1DQ8 A;  1HHQ A;  3OVA A;  3UVJ A;  4N41 A;  4U7C A;  4U6P A;  2IHR 1;  1S9G B;  1J2V A;  5HMY A;  1N56 A;  3HCX A;  4OL8 A;  3UR0 A;  5H9F K;  5HAN A;  3KLV A;  4FP9 A;  2EKY A;  4I1T A;  3GJT B;  1QSL A;  2KXN B;  2R7R A;  1HQE B;  4DCP B;  4O3P A;  1CBK A;  2VG6 A;  1X4H A;  4C97 A;  2V8G A;  1Q8I A;  1SC6 A;  3NS5 A;  3DHW C;  1YJN S;  5KFG A;  1B99 A;  3ILJ A;  3MM7 B;  2UUC F;  4Y00 A;  4X4Q A;  4PUO B;  4CLL A;  1RT3 B;  4J7C A;  4ZHR B;  3MPW A;  2J0Q D;  2YQ3 A;  1LW0 A;  2FJD B;  5HL7 Q;  3SQO P;  1Q8B A;  2BAN B;  3MXH P;  1RT4 B;  3PDN A;  1B70 B;  2KDO A;  1D9F A;  4PRF A;  3B8H A;  1CJK A;  4YB6 A;  3DDI A;  1HFE L;  1PYT A;  2W4D A;  4LFC J;  1S6O A;  4CNZ A;  3PYG A;  2HS0 A;  3HT3 A;  3LP1 B;  2BA9 A;  3CTR A;  2AT1 B;  2CAJ A;  4M1K A;  4KAI A;  2PT0 A;  4U67 Q;  4WE1 A;  1RZM A;  1VCT A;  4OZ3 A;  3H2U B;  1PYS B;  1HBN A;  4P2X A;  4OYI A;  1R0A A;  2ZNY A;  4FN5 A;  1YJW S;  4QR0 A;  4I6W A;  4NCG A;  2PEB A;  1NSQ A;  3KLG B;  1WTB A;  2DPJ A;  1TUV A;  2J9E A;  1KLM A;  3KG0 A;  3MM8 A;  1S99 A;  3EXC X;  3DOL B;  2BW7 A;  3L4B C;  2GV1 A;  1F9F A;  2ZOG A;  3OV7 A;  4I7F B;  1LQ9 A;  3IS9 A;  3D3C J;  1VC6 A;  4W90 B;  4ZCL A;  2XWX A;  4A8W A;  4OI4 A;  3MWB A;  2QRR A;  3J7A N;  3QIP B;  5KFU A;  2G13 A;  3VGU A;  2VFU A;  1Y5L B;  1EB0 A;  3F41 A;  2DR8 A;  4J9S A;  2O01 C;  1VQM S;  2VKZ G;  1RT2 B;  2CQP A;  3HKW A;  2MJN A;  3IGN A;  4TY8 B;  3BQ2 A;  4QW8 A;  1S9G A;  1R8C A;  4K4S A;  5D77 A;  3OXF A;  1V9O A;  1WHX A;  3E01 B;  3FKB A;  2VBW A;  4F04 B;  3VAM A;  4CNY A;  2MZ1 A;  2VIC A;  2W25 A;  2B43 A;  1HQE A;  5H9E J;  4IOB A;  1TK5 A;  2MYF A;  5LMU J;  2F4V J;  3CCM S;  1YRT A;  1JJH A;  1HKA A;  2V8D A;  3MM7 A;  4OYP A;  4X84 A;  3V6H A;  2HW3 A;  2HGM A;  3BDP A;  4OFZ A;  4LQ3 A;  4J9Q A;  2DRA A;  1KQS R;  5KT5 A;  4PUO A;  3G82 B;  1RT3 A;  2QFJ A;  4ZHR A;  2R8K A;  3BQ1 A;  4LFB J;  2W8K A;  4OYX A;  3OL9 A;  5EX3 A;  3OD2 A;  4HDG A;  1LFW A;  4J91 A;  4YB7 A;  2KG0 A;  3D6T B;  1SBR A;  2BAN A;  5DLG A;  1RT4 A;  1UMJ A;  3PM9 A;  1BY9 A;  3QT7 A;  4USH A;  1A9N B;  2QE5 A;  1JMT A;  2CZ4 A;  3G8Q A;  1O8B A;  4LF5 F;  2WAQ D;  1HIY A;  2Z4P A;  1XMQ J;  2OFG X;  4PYD A;  1FWK A;  2KM8 B;  3QLH B;  5K14 B;  1NJZ A;  4QWC A;  3SDE A;  1H0H B;  2ZH6 A;  3LP1 A;  4M5G A;  4B3R F;  2BRK A;  3NY0 A;  2HYI B;  3CE8 A;  3O3L A;  4CWB A;  2R2T A;  4DWI A;  4G1I A;  1XK8 A;  2MB0 B;  3ENA A;  1QVG R;  4ID5 B;  3BSC A;  1SC1 B;  3KLG A;  3RZA A;  4WYW A;  3EVW A;  2W01 A;  3DOL A;  4IQX A;  3TUJ C;  1T7P A;  3MAA B;  1TL7 B;  2IMO A;  5KT2 A;  1JNZ B;  3QRR A;  3DGP B;  4CM0 A;  3R2D J;  1HHT P;  3P8B B;  3WC0 A;  1AXQ A;  1SJF A;  2RRA A;  2G2Z A;  4ZLL A;  1HWK A;  4O4R A;  3HHE A;  2K2P A;  2VG7 B;  3QID A;  2VD3 A;  5AE3 A;  1RT2 A;  2BKO A;  2I9S A;  4TY8 A;  4K5R A;  4M8L A;  3ZZT A;  3HSG A;  1VLY A;  3E01 A;  1N36 F;  1UZD A;  5ETV A;  2ZHB A;  2XTJ P;  4LSL A;  2UXD J;  5T7L B;  2MST A;  5DJB A;  4NZ0 A;  2YXL A;  1B4S A;  3MTJ A;  5FD1 A;  1CS4 B;  1RHM B;  4CH1 A;  1X4E A;  3G82 A;  3GMG A;  4OLO A;  5LM7 E;  2NS1 B;  4O3N A;  4QBU A;  4DS5 A;  1JKH B;  1SH2 A;  3V6K A;  5D4L A;  3JQJ A;  4WXO A;  3W5Z A;  4DPW A;  2HHW A;  1AW0 A;  1VR6 A;  4WF9 Q;  3OR2 B;  4LF9 J;  3I32 A;  4DQR A;  3CJ2 A;  3FFI B;  4Q8E A;  1NPK A;  4L73 A;  1FJC A;  4IOA Q;  3MOJ B;  3W3S A;  1S1W A;  1U7L A;  2AMC B;  3OJS A;  1OYD A;  2ABY A;  3QLH A;  4HEA 9;  6FDR A;  1T11 A;  3MM6 B;  1UCN A;  3OFF A;  1TP7 A;  2BKN A;  4OJ1 A;  4TY9 A;  4DV3 F;  3T9Z A;  2QLB B;  3HPO A;  2CUY A;  2I5J B;  1YZ7 A;  4ID5 A;  1XNR J;  2KB2 A;  4NLP A;  1NB2 A;  2N3L A;  3PX4 A;  2MPU A;  2FPH X;  2DHH A;  1O51 A;  2E5L F;  5IWA J;  4ILL A;  3NGT A;  3NL0 A;  1G4C A;  3DLH A;  3NMA A;  3MAA A;  2OUG A;  4IR1 A;  4B3M F;  4PCQ A;  3BN4 A;  3DGP A;  1NK9 A;  1YTY A;  1RA6 A;  2FZG B;  1D8Y A;  4RW6 B;  2O66 A;  2MSS A;  6FD1 A;  3GFZ A;  2IVM A;  2D3O 1;  4HTI A;  3Q8R B;  1Y7P A;  2OEL A;  2VG7 A;  3M8R A;  2OI2 A;  4H4K A;  3H2L A;  2NXJ A;  1QAJ A;  4FF1 A;  3NAH A;  2IBK A;  2CFX A;  1C1B B;  5J1E B;  4YDX A;  2J7W A;  3GTY X;  3A12 A;  2KG1 A;  3HP6 A;  4A48 A;  3BJY A;  2ZH9 A;  3RRG A;  4F4A A;  3HK2 A;  5E3A A;  3CD6 S;  1WC1 A;  4LF1 A;  2H51 B;  4PQA A;  2WVB A;  1U1O A;  2CPY A;  2DR7 A;  1C0T B;  3NWG A;  3SZ2 A;  4OHV A;  4NLW A;  4KJI A;  2FB0 A;  3GG0 A;  3H2V E;  1RA7 A;  3PFO A;  4YOE A;  1IN0 A;  3U1M A;  1CS4 A;  1VLO A;  3O6Q A;  3KFW X;  1G1X A;  4ZPA A;  1TL5 A;  2KT3 A;  5DLF A;  4EO6 A;  2IC3 B;  1JKH A;  2XI3 A;  3U1N A;  4RR5 A;  1WG5 A;  3QNW B;  3UR3 C;  1YBT A;  3OR2 A;  4HH1 A;  3ZC4 A;  4J9N A;  1MN9 A;  5J2P B;  5B0C A;  3MTK A;  2AX1 A;  4TN2 A;  3OTD A;  1RWW B;  5D3G B;  1CSJ A;  2RNE A;  4QIG A;  1UVN A;  3MM6 A;  5L9X A;  3WX8 A;  3LGM A;  4ILM A;  4L76 A;  1VQ9 S;  1X5P A;  3K17 A;  3GYX B;  4KBI A;  2M8D B;  1CC8 A;  3GIJ A;  1PYO B;  1WG1 A;  1ZH5 A;  2KJW A;  3IAM 9;  4WIQ A;  4JI6 F;  5KT3 A;  4FNI A;  3ITH A;  2I5J A;  1HWU A;  3NGS A;  5DDQ C;  1U02 A;  3CCQ S;  4Q43 A;  5KG7 A;  3QAU A;  1JJ2 R;  1FTR A;  1F1B B;  4NLT A;  4I2Q B;  3C8Y A;  2PA3 A;  2B0G A;  1RTZ A;  1TEL A;  1AZS A;  2EFN A;  4ZVS B;  1KQF B;  3N6N A;  2VFS A;  3X3U A;  1OIA A;  2W7O A;  1LV5 A;  1NU4 A;  4XAK A;  2ROP A;  5F9L A;  1V3S A;  2IMW P;  2ZVI A;  1YWX A;  1R8P A;  4NXN F;  4OYZ A;  1BWV A;  1RKJ A;  4ZOS A;  1RAB B;  3AT1 B;  1ZAV A;  2GQC A;  4OX7 A;  1KKH A;  1FFG B;  1QM9 A;  3NOC A;  1RAE B;  2G1H A;  1FF2 A;  5ETL A;  4IG0 B;  1C1B A;  1OWX A;  4FXW A;  5J1E A;  1UKU A;  4IUF A;  3B4D A;  3PW2 A;  5F8N A;  1YJ9 S;  2WRM A;  1APS A;  4XK8 C;  4USI A;  4PR6 A;  1HQ2 A;  1C0T A;  1UWA A;  2F8M A;  4WFZ A;  4AQY F;  1RT7 B;  2ZNZ A;  4PG7 A;  4R5P B;  1QTM A;  1RUS A;  2JOQ A;  1XTZ A;  2OPP A;  3SI8 A;  5AJ3 F;  1YDL A;  4H4M B;  2NYI A;  1ZAW A;  1P1L A;  2CG4 A;  2XGP A;  3NGR A;  5DM7 Q;  2PMW A;  4Z7Y A;  3TA0 A;  3DN9 A;  4YR3 A;  2Y0S D;  1Q5Y A;  2HWT A;  2DR9 A;  3VAL A;  3NGD A;  1C4C A;  2Z8Q A;  5CD4 A;  2HPU A;  4JYA F;  1Y3J A;  1X4A A;  1ZA2 B;  4G6V B;  5D3G A;  3PCO B;  2WVF A;  4HL9 A;  4ELT A;  1VJW A;  4ELV A;  1RP5 A;  4JI2 J;  2ASL A;  1Q82 T;  4ANC A;  2AWZ A;  4QIE A;  1AA1 B;  2R2S A;  1PIL A;  2CZ9 A;  4NZ6 A;  4PQU B;  2HFZ A;  3TVY A;  2XQC A;  3DHX A;  3EGW B;  1LOU A;  1AFI A;  1QY7 A;  3UN5 A;  1FVQ A;  5LL6 d;  2G0I A;  4ECU A;  1Z2Z A;  3WDO A;  4UY8 5;  2DIT A;  1TUW A;  3J81 U;  3A8E A;  5IT4 A;  1N52 B;  1WOR A;  2JVO A;  4I2Q A;  4OHX A;  3K5N A;  4Y34 A;  1UFK A;  4JV0 A;  1EJ7 L;  1RWM B;  5KFV A;  1AYE A;  3ZZ0 A;  3AXK A;  2DIS A;  3W2V B;  4RU2 A;  5IQ6 A;  4RWW A;  5KFT A;  2IPO B;  1V6H A;  4NXM J;  2YNH B;  2B3T B;  1KD1 T;  4C9D A;  1VYA A;  3M1V B;  4NPO A;  3GYG A;  2MKJ A;  3HFV A;  2LFV A;  1IM6 A;  4M5N A;  1VQK S;  4IG0 A;  4K4Y A;  4B3O B;  4HI2 A;  3EE3 A;  5ETS A;  1TL4 A;  4K8R A;  2L9D A;  3GFH A;  1VHI A;  3FRZ A;  2LXF A;  1RAJ A;  4LFC F;  2AX0 A;  1N33 J;  1REG X;  1U26 A;  2JEF A;  2DNY A;  4EWT A;  4KC5 A;  2AGO A;  4WXW A;  2XMJ A;  2BJ3 A;  4NE9 C;  1RT7 A;  3J7Y U;  2HNZ B;  1KP6 A;  2EG1 A;  4UTG A;  4R5P A;  4DV5 J;  2NQP A;  2XYH B;  4IYQ A;  2L9N A;  2Z56 B;  3CPW R;  1X31 C;  2FUG 9;  2W7A A;  2OEJ A;  4H4M A;  3H0P A;  1H7W A;  2LQJ A;  1X9S A;  4DOZ A;  5AE2 A;  4AE5 A;  3IAS 9;  1EP4 B;  5K9F A;  5BYR A;  4DR4 J;  1WC6 A;  4OX8 A;  1NO8 A;  1UW9 A;  3MR7 A;  4DX8 H;  4ZCM A;  5L1I A;  1ACM B;  4PXC A;  5AXK A;  3ZTR A;  4E98 A;  3OFG A;  4AYB D;  1SJR A;  2HK3 A;  4LSN A;  3JYT B;  3NNA A;  3FUY A;  4PWW A;  2VA2 A;  3PX6 A;  5KFN A;  2AP6 A;  4NX9 A;  4F0K A;  3G6E S;  1QVF R;  4OI6 A;  2F8H A;  3GWC A;  2VPZ B;  3DYA B;  4PQU A;  4QIW D;  3T6J A;  3UPF A;  4F0H A;  2R2U A;  3FC9 A;  2DGQ A;  1T9V A;  3HVT B;  3HO1 A;  4UQT A;  1HQU A;  2HQ3 A;  1N88 A;  2FHO B;  2HHP A;  2HHH J;  1RJJ A;  1NHU A;  2KKH A;  3T5J A;  1M90 T;  2HLT A;  2ZH4 A;  3HHD A;  1HNI B;  3PV8 A;  1OMS A;  5LMU F;  2F4V F;  3FEX B;  3BRE A;  2B56 A;  3GQC A;  4AL7 A;  1NK4 A;  2I8E A;  4HLB A;  3W2V A;  4ED1 A;  5CAB A;  1FE4 A;  4CO3 A;  4EEY A;  5F8H A;  4CH0 S;  1Z4U A;  3SMZ A;  2CNO B;  3CJK B;  2YNH A;  2J9C A;  3V6D B;  4D3G A;  3M1V A;  5C42 B;  1YVF A;  5KFW A;  2YWW A;  1NND A;  1RTJ B;  3C3L A;  4LFB F;  1FK9 B;  1S49 A;  4Q44 A;  3EZ5 A;  3OFE A;  3V4I B;  4GVL A;  3UWT A;  3DRS B;  3KG4 A;  3L7O A;  2N3O A;  2YQ0 A;  4Q8F A;  3ICL A;  1EQ0 A;  3K89 A;  5KFY A;  2R7U A;  3UNG C;  4AUK A;  4B3O A;  3O44 A;  2ZBQ A;  1SJ4 P;  4LR8 A;  5DZ7 A;  3OHA A;  4GVB B;  2P8I A;  4QU6 A;  1K9M T;  2LEP A;  1H2T Z;  3Q8P B;  5I3U A;  3D7S B;  2V9W A;  1D9A A;  4U95 A;  4IO9 Q;  5FJ4 A;  2PMZ D;  1T8E A;  4UW2 A;  2E5J A;  3BGR B;  2CVE A;  1CJV A;  4J9R A;  2VU5 A;  3GCX P;  5E3C A;  3T3F A;  2DD8 S;  4I56 A;  2V63 A;  4NLX A;  2HNZ A;  5SZT A;  2DB1 A;  3HX9 A;  2HVD A;  3JSY A;  4FYX B;  2GHP A;  4KIA A;  3G86 A;  2IRX A;  4B9T A;  1RAH B;  1R0B G;  4GMK A;  2DNH A;  1EP4 A;  2UXC J;  4ES3 A;  5B7W A;  1R7I A;  1ARO P;  2RUS A;  4ZJL A;  3HD1 A;  1SKU B;  2YX4 A;  4DV7 J;  2QN6 B;  2ZWP A;  2PI5 A;  3TZY A;  1Y11 A;  1FXD A;  1N34 J;  2O3D A;  1I51 B;  2PEH A;  3S6E A;  4RW8 B;  3SFG A;  4M5H A;  3JYT A;  1KNZ A;  2H54 B;  3PFE A;  2CJA A;  1RT5 B;  2E44 A;  3LQV A;  3BBC A;  1BQN B;  4ED0 A;  3HXM A;  4NLU A;  2BR0 A;  1FD2 A;  4K5S A;  3DYA A;  3DLL Q;  2FJE B;  2Y1I A;  2WW8 A;  3HVT A;  2PDA A;  2VJU A;  2ZHO A;  4IO1 A;  3PO4 A;  2A6O A;  2ZM6 F;  3UW1 A;  1C4A A;  1EKR A;  1H74 A;  2RSQ A;  5F0W A;  4ZVP B;  2UXD F;  2BM1 A;  3PR5 B;  1WSV A;  1HNI A;  2CJK A;  1WEX A;  4M95 A;  1XNQ F;  1XEZ A;  4RW7 B;  3FNN A;  2DNQ A;  5AXL A;  2C1E B;  2HZV A;  1UVK A;  4HR2 A;  3KHG A;  3RBX A;  3NS6 A;  3FQK A;  4C3M A;  2OJ3 A;  2E7X A;  1B0T A;  1RTH B;  3DKD A;  3EDQ B;  3CJK A;  3V6D A;  4A8K A;  4RX6 A;  3R1H A;  4USK A;  3VQS A;  5C42 A;  3AHP A;  1RTJ A;  1PSD A;  1WI6 A;  1CJT B;  1FK9 A;  3NCR A;  2LA6 A;  1I6J A;  3V4I A;  4O3R A;  5DQH A;  2DXE A;  5CD4 H;  3DRS A;  3IRW P;  1S9F A;  1IWG A;  4K4X A;  3M9M B;  2EKN A;  2YNF B;  3AB2 B;  1VBY A;  1N5Q A;  2Q66 A;  5KFC A;  4LF9 F;  2E5H A;  1OY9 A;  2ATL A;  4KFB A;  2CDQ A;  3QBC A;  1M1K T;  4GVB A;  2HVE A;  4G1Q B;  2LQ8 A;  4ZJQ A;  3RJM B;  3N4W A;  2RAQ A;  4OX9 J;  4JUZ A;  5LOQ A;  2B9E A;  4NLS A;  1VBX A;  5GAD U;  2WOM B;  1VQS A;  1NM2 A;  5T14 A;  1WDD A;  1FCA A;  4IG3 B;  3D0I E;  1TFY A;  2KRB A;  3BBF A;  3R3T A;  2COL A;  2C3U A;  3CCR S;  1HL6 A;  3QMQ A;  1F5A A;  1U1Q A;  2UXB F;  2JLG A;  1TUG B;  5H9F J;  1XNR F;  4I68 A;  4HVZ A;  4B9L A;  1WF0 A;  5IWA F;  2LDY A;  2LEB A;  1S7I A;  4LRE A;  3S8S A;  4ZVH A;  2MZS A;  2RD5 C;  3N79 A;  1VFJ A;  3IWL A;  4OHW A;  1BGX T;  3NNC A;  2XMM A;  2UV8 A;  4RL1 A;  4RW8 A;  3TAP A;  2FJA B;  2EBE A;  2AEJ A;  3BDE A;  5LXR A;  1UJ4 A;  1VHF A;  2AYE A;  3M6W A;  3N28 A;  3BN7 A;  3SSR A;  1BQN A;  4HH0 A;  5T41 A;  1WUU A;  4KY3 A;  5BR8 J;  2QC3 A;  2F4F A;  1ZM4 A;  4KTQ A;  1HBU B;  2D3Z A;  2ZH8 A;  3CCU S;  3GPA A;  1G7C B;  4OZ1 A;  4C11 B;  3HD2 A;  1M0S A;  2FLL A;  4QWA A;  4MT1 A;  1KVJ A;  2XM3 A;  3M8Q B;  1HNV A;  4Q45 A;  1L5U A;  4LF4 J;  2L9W A;  3WHI A;  2HBR B;  4QYR A;  3CCW A;  2RDJ A;  3X1L B;  5CAA A;  1S9E B;  1JK9 B;  2E1A A;  4DX7 A;  4Z37 A;  3AH6 A;  4H4O A;  5KFE A;  2F1F A;  3KLI B;  5F8L A;  4USW A;  3I4P A;  2GA7 A;  2H3E B;  4OJ3 A;  1RSC A;  1UVJ A;  2WSC C;  4NLY A;  1RTH A;  3VV2 B;  2MGZ B;  5M2U A;  3D6H B;  2DCL A;  5J2N B;  1DUR A;  4ES1 A;  2HBQ B;  2QSW A;  2OSR A;  5CA5 A;  3BH6 B;  4YP3 A;  4S0M A;  2QEX S;  3QRP A;  1CJT A;  2ZJR Q;  1CQM A;  4Q2L A;  3R7N B;  2LLZ A;  2QL5 B;  1YSJ A;  3GIL A;  2RIL A;  2W8L A;  3CDA A;  1ZM3 A;  2KN4 A;  3TAQ A;  2ATC B;  4DPY A;  5KT6 A;  2YNF A;  2GVZ B;  1DZ5 A;  3MEE B;  2PC6 A;  2FY8 A;  4PG8 A;  4GKJ J;  4G1Q A;  1H98 A;  5J1N A;  1U0S A;  4NI2 A;  4KGK A;  3ZZP A;  1CVJ A;  1TL1 B;  4HTJ A;  1UEU A;  2JRS A;  4J5O A;  1IM4 A;  2A0F B;  4CI0 B;  1FHT A;  1S6U A;  2WOM A;  2KT2 A;  3S1T A;  4EBD A;  4IG3 A;  2KHD A;  5D0R A;  3EVO A;  1KEK A;  2OAU A;  5ETR A;  2AYB A;  5CYM B;  1GFW B;  2LCW A;  1JLE B;  2XYG B;  3M8P B;  1S57 A;  4MIA A;  3I56 S;  3O5T B;  3VCD A;  4DV0 J;  2MKS A;  3ZZR A;  2G0C A;  2APO A;  4CRJ A;  1RTI B;  2FGO A;  3D5M A;  4EO8 A;  4J9M A;  1HD1 A;  4MH8 A;  2ZH2 A;  4NMX A;  3W66 A;  1KN6 A;  4FF4 A;  3DOK B;  4ILR A;  4WU3 A;  2V4R A;  2EI5 A;  2J6T A;  1XBW A;  1EIY B;  3FMB A;  3KYL A;  3ZZZ A;  1HBU A;  2WSE C;  5DET A;  2YQ1 A;  4C11 A;  1NK8 A;  1SJ3 P;  3IBC B;  4ZLN A;  2I6W A;  1N5V A;  4UY8 T;  1VMB A;  4MKB A;  3DM2 B;  3M8Q A;  2NPF A;  4PXB A;  3R5C A;  1S9E A;  2AJ4 A;  5ETT A;  2JSX A;  2QL9 B;  2C2O B;  4N8N A;  2KFN A;  3MED A;  1JLG B;  2IDE A;  2GX8 A;  3KHH A;  4FYY B;  5IC6 B;  2A3J A;  1UWB B;  1SUQ B;  2MGZ A;  4FNH A;  3KLF B;  4NA3 A;  5J2N A;  4A8S A;  5HAT A;  2JL9 A;  2VG5 B;  4YME A;  3MDF A;  4YHH J;  4YEA A;  3P49 B;  3VWS A;  2FLN A;  1WC3 A;  3BGL A;  4CZC A;  1H72 C;  1H38 A;  2D9O A;  2UVU A;  3DLB A;  1FRX A;  1H6K X;  2M3D A;  2GVZ A;  1ZET A;  1GH8 A;  3K7R A;  4KV8 A;  1NBE B;  1S12 A;  5DDO C;  2RML A;  3K8W A;  2B51 A;  4M5I A;  2QG9 B;  3FSI A;  3L95 X;  4NCA A;  3FZ2 A;  3MEG A;  4LIW A;  2V6A A;  1TL1 A;  2LVW A;  1U6B A;  1L3S A;  3DGV A;  1S79 A;  3RW7 A;  1MMN A;  4JI2 F;  2BMB A;  1YGY A;  4FPR A;  2BQR A;  4TQS A;  3DCA A;  3J80 U;  3N6M A;  4ZPD A;  4UOH A;  1FRJ A;  5CYM A;  2HHQ A;  3EVM A;  1X4G A;  1S97 A;  1JLE A;  1LW2 A;  1HNW F;  3M8P A;  2V2V A;  4O3Q A;  3OL7 A;  4FS2 A;  4I67 A;  3MEK A;  1WTF A;  2F9D A;  5GAE U;  2OTJ S;  1F6T A;  5GME A;  5L38 A;  1E6V B;  1I94 J;  3ENQ A;  1RTI A;  1N54 B;  4WU2 A;  3ISN C;  3BEG B;  4ITS A;  2V8H A;  3I0R B;  4AFF A;  3LH2 S;  3TI0 A;  3HFK A;  2AEM A;  3UDV A;  2VOP A;  3DOK A;  3KWM A;  4NXM F;  3CJ5 A;  2GS8 A;  2KU7 A;  4CCH A;  2RU3 A;  2Q1L A;  5M2R A;  4M5L A;  4M5K A;  1AUS L;  4N76 A;  4USV A;  5IFM A;  1S59 A;  1N48 A;  5DS7 A;  1W2I A;  5LXY A;  4XO0 A;  3OR1 B;  4QPX A;  4CTA B;  4YQW A;  2V4J B;  4ER8 A;  3FDS A;  1V5I B;  4DUZ J;  5A8K B;  3J81 Y;  3CCE S;  1JLF B;  4ECS A;  3L7U A;  3A3N B;  1S0M A;  1JLG A;  5SUH A;  2EFP A;  3JS9 A;  1UWB A;  1SUQ A;  1LWC B;  1NK7 A;  3KLF A;  3MR2 A;  4DV5 F;  3Q23 A;  5DG8 A;  3B82 A;  1LKZ A;  3T19 A;  1JIH A;  5KFK A;  1NRK A;  2R7T A;  3R5G A;  4ECY A;  3F73 A;  4MIW A;  3BO3 A;  3CDW A;  1GK8 A;  2L08 A;  1XN9 A;  4DR4 F;  1NZA A;  2CZV C;  5CYJ A;  3CDE A;  1SVD A;  4DFP A;  4IDK B;  4YR0 A;  2LQ9 A;  3C66 A;  4F2S A;  2DNN A;  3PG9 A;  3PY8 A;  2VKR A;  4ANE A;  4KR0 B;  2QGF B;  4NLV A;  4UF4 A;  1SCJ B;  3A8K A;  2XHW A;  3T41 A;  1GXL A;  3CCS S;  1TV6 B;  4CIO A;  1GT8 A;  4JI4 J;  3OXG A;  5K8N A;  5L1K A;  1HWL A;  2GO8 A;  5HAO A;  1T03 A;  3KXD A;  4F4K A;  2VDH A;  4RU9 A;  1MU2 A;  3RRK A;  2UZA A;  2HHH F;  1MSW D;  3DOM A;  3MD1 A;  2XMK A;  1E6V A;  1KWM A;  3SFU A;  4Y0F A;  4AXJ A;  3BQ0 A;  4KH0 B;  2J9D E;  3OBI A;  2RVJ A;  2OPQ B;  2HRT A;  4HHH A;  2RHS B;  2QMW A;  3I0R A;  3CJQ A;  2VF3 A;  1VGY A;  2UUT A;  1Z2L A;  5A0Y B;  4TLR A;  2WB4 A;  2Z30 B;  1A6L A;  3HFZ B;  2E5I A;  3AD8 C;  5KG6 A;  2DHA A;  3PEJ A;  1OSC A;  4U8V A;  2D74 B;  1Q7Y T;  2MQN A;  5HVH A;  3UCG A;  2LKZ A;  2E7V A;  5C7P A;  2R7O A;  3I87 A;  3OR1 A;  3M8Y A;  4OX6 A;  3H90 A;  4CTA A;  2BAC A;  2DH8 A;  2V4J A;  2EK6 A;  3PKY A;  3Q2T C;  4F3M A;  5A8K A;  1JLF A;  2VPX B;  5I42 A;  2C28 A;  4WK3 A;  2HEK A;  2IBO A;  3TWZ A;  3HJF A;  4DV2 J;  3V4M A;  1S0N A;  2BV3 A;  3BF4 A;  2OH2 A;  3EGZ A;  2FHM A;  1IBL J;  2XZW A;  1HA1 A;  1F2G A;  4A8M P;  3RR7 A;  2UXC F;  3G71 S;  2YH1 A;  4C8O A;  2WON B;  3EGN A;  2ALZ A;  4IH6 A;  3BGU A;  2Q3P A;  1RBL A;  2VC0 A;  1NDC A;  4OYB A;  4G1P A;  4DV7 F;  3GYN A;  3R5J B;  1HPZ B;  4IDK A;  1N34 F;  1WKJ A;  5KTQ A;  5G4D A;  2HG4 A;  3OUY B;  4IOC Q;  2NUU G;  2HS4 A;  3IGV A;  3FSX A;  1ZTW A;  2CQG A;  2XUL A;  1K0T A;  3OTO J;  3PW7 A;  5IOL A;  2AW0 A;  4X4N A;  1FKP B;  1ZOT A;  2CQI A;  5KFL A;  4RWX A;  2V2Q A;  4JI5 F;  2HVI A;  1KR4 A;  1BMQ B;  1SQF A;  4ZPB A;  3V81 B;  3WQP A;  4GKK J;  4WYL A;  4C98 A;  2BUN A;  3H5U A;  3EZO A;  3R5B A;  4ECQ A;  2OPQ A;  5KFZ A;  4MMO A;  3RB0 A;  4RZR A;  3ZFV A;  5HQM A;  4U7U D;  5MAO A;  4ALZ A;  3MD3 A;  2YKP A;  2AJF E;  5BJR A;  3TUZ C;  4K4V A;  4DS4 A;  1KHW A;  3HT0 A;  5A0Y A;  3W9I A;  2YKM B;  3MR5 A;  4A8F A;  2AJQ A;  1U47 A;  2HSE B;  4ZVO B;  1ZM9 A;  1EET B;  4NRU A;  1PJ7 A;  1QAY A;  4IFY B;  2QX0 A;  2C2R A;  1VIS A;  1YQH A;  3TOQ A;  4HYK A;  2VUG A;  2IM3 A;  1SV5 B;  2MKY A;  3W63 A;  2ZD1 B;  3BV8 A;  4YS2 A;  1KC8 T;  3KHL A;  1M5K C;  1X5T A;  3T5K A;  4QQB A;  3CIM A;  1MNE A;  2VZ9 A;  4OX9 F;  3TJ9 A;  3UO0 A;  4DPX A;  1HD0 A;  3BS9 A;  3M6X A;  1JLC B;  4ZPV R;  5D78 A;  5EWE A;  4FBU A;  3RRH A;  5B0A A;  4RNM A;  2A2D A;  4YY3 F;  1RYS A;  2R3V A;  2XB2 D;  4LRF A;  3D66 A;  1FRI A;  3UI3 A;  3IA0 A;  4F4X A;  1DAX A;  3I82 A;  2YKO A;  1GQE A;  3RAX A;  2N4D A;  4ZVG A;  2WON A;  2DK2 A;  4W92 B;  2NSB A;  3H42 A;  1Y00 A;  2XY5 A;  2X1B A;  5LMN J;  2ZH1 A;  2IFX A;  1HPZ A;  2GIR A;  2DXF A;  3VZH A;  4U96 A;  3OUY A;  5ITH A;  1FJ7 A;  3H59 A;  3JSR A;  4CO0 A;  2UP1 A;  5BR8 F;  3UDL A;  3MAQ A;  1HI8 A;  4DSF A;  4NLO A;  3W64 A;  1FKP A;  4JB8 B;  3AQP A;  2PGC A;  3A3P B;  4DG1 B;  5F3T A;  1R6Y A;  2A6M A;  4USU A;  1UTA A;  5L8R C;  2G9O A;  4YUD A;  3CJ8 A;  2FZC B;  3U02 A;  4MKV A;  3VZI A;  4FDF A;  3V81 A;  3QWP A;  2C2D A;  4LF4 F;  3IN5 A;  4RUC A;  2J7K A;  3RGI A;  2Y9H A;  3QYY A;  2Y0B B;  4MK8 A;  1RDR A;  4C8M A;  5A8R B;  3KJQ B;  2XMW A;  2B7C B;  2PFF B;  2ZE2 B;  1JXV A;  3G8T A;  1T9T A;  2D1C A;  1S77 D;  3M2V B;  2VON A;  1S48 A;  2E1C A;  4RUA A;  4F7V A;  2CJX B;  5J2M B;  2B8P A;  2ALY B;  3AD9 C;  4CLP A;  3PO5 A;  4Q0B A;  1EET A;  3D2W A;  4NRT A;  3R6G B;  3AA9 A;  1SH0 A;  1E6Y B;  4IFY A;  1NAQ A;  3AJD A;  1XJW B;  1ZBT A;  2E9T A;  4IH7 A;  1DBD A;  1U1P A;  1SV5 A;  2GJ2 A;  1U09 A;  1VS3 A;  1K8A T;  2ZD1 A;  4X2B A;  3IR5 B;  4GKJ F;  3EUN A;  2CIM A;  4CO4 A;  1TAU A;  4HHJ A;  1QD1 A;  1CG2 A;  2VOO A;  2IJR A;  5ETK A;  4CP5 A;  5KFX A;  2MKH A;  1JLC A;  4RW9 B;  2DGV A;  3QFH A;  3KUG A;  3JAM U;  4K4Z A;  1NJW A;  3GIK A;  3NGK A;  7FD1 A;  4DMZ A;  1IR1 A;  2CG8 A;  4UST A;  1U0H B;  4C2M A;  4TLQ A;  1QJH A;  2XO6 A;  3RBD A;  2X1F A;  2C2M B;  3QFW A;  4OV1 A;  5CCL A;  2M9K A;  2IM0 A;  3Q8Y A;  4DV0 F;  3A13 A;  2ZH5 A;  4JI0 J;  4KT0 C;  2J0W A;  4ZJO A;  2FHJ A;  2NRE A;  4FPI A;  1FTC A;  5IQQ A;  3SBM A;  5F8I A;  2H1Y A;  2VFR A;  2N82 B;  1X9M A;  2DBB A;  1HNZ F;  1U2C A;  4DV1 J;  1YKW A;  1RE1 B;  3FCV A;  1S7H A;  2QLJ B;  3TX0 A;  2OMO A;  1YJR A;  2ZJP Q;  5F41 A;  3I55 S;  2XG8 A;  4PWU A;  2MHN A;  3FBC A;  1RHK B;  1M1G A;  4DG1 A;  2FJX A;  2HBZ B;  1XR7 A;  2CA9 A;  4LR7 A;  3NLC A;  3WX4 A;  4B9U A;  5GAH I;  1L3T A;  4NLG A;  1H3D A;  2HHU A;  1UL3 A;  4ID8 A;  1S1V B;  3GJQ B;  5LT5 A;  2OML A;  5J1P A;  4KHM A;  2CQD A;  1VOM A;  5A8R A;  1FRM A;  4QU7 A;  4I6Y A;  5CH7 B;  2DPI A;  3MPD A;  1FEH A;  1PC5 A;  3QT5 A;  1NDK A;  3LOU A;  3M2V A;  3G8S A;  1PCA A;  2ZBR A;  2DH7 A;  3U27 A;  1Y9O A;  5J2M A;  1N5S A;  5F8M A;  3VAF A;  3T5L A;  3PJ9 A;  4YHH F;  2HHX A;  5HBM B;  5KFD A;  4FXV A;  3ELH A;  3RBE A;  1E6Y A;  2YWG A;  5D0E A;  1N6Q B;  1IKW B;  3NMR A;  1U1N A;  4BC7 A;  1ZZF A;  3W5X A;  3CED A;  4MFB B;  2OEM A;  3B78 A;  2JFD A;  4QIV A;  3I31 A;  4MKA A;  3GJR B;  1T05 A;  2XO7 A;  1ZYQ A;  3NG8 A;  1T9Y A;  4Y65 A;  2DRB A;  2ZBP A;  4RW9 A;  3I4H X;  1A7G E;  1VI7 A;  4ECT A;  2HHT A;  1VQO S;  4JBC A;  1P8G A;  2N7C A;  4HHU A;  2DTJ A;  5AXM A;  1IBK J;  3MUV P;  1WEZ A;  4CLU A;  1D0E A;  1U0H A;  2UUA J;  1RWN B;  1G3O A;  5D6G A;  3NGU A;  3ZNJ 1;  3T1H F;  1HMV B;  2F65 A;  2IYG A;  1I94 F;  2G2Y A;  1HNX J;  3BGO P;  2W4P A;  1U1L A;  2W2O P;  3LPE A;  3QT6 A;  3PYD A;  1S76 D;  2I0X A;  3DU5 A;  3L09 A;  1I1G A;  4ZVF A;  5IS2 A;  4K7Q A;  3GU0 A;  5E2Q A;  1XMO J;  3KMQ A;  1VBK A;  3PRD A;  5AE1 A;  1FJE B;  3IO1 A;  4TNO A;  3NCQ A;  2IIH A;  2KXF A;  3J7Y I;  2CQ0 A;  3UQS A;  4OMF G;  3UD3 P;  2NPI A;  3J80 Y;  3JSB A;  3MR3 A;  3A3O B;  5HJX A;  2BJ1 A;  1U24 A;  2C42 A;  3SEO A;  4OZ2 A;  4L6V 3;  9RUB A;  3PYF A;  4DL7 A;  4FVM A;  1QLN A;  4U7U K;  3R1L A;  3MMJ A;  4DUZ F;  3M8Z A;  4BWJ A;  1NPP A;  4AXI A;  1S1V A;  2EK1 A;  3LGN A;  2RS8 A;  4JV2 A;  4J9K A;  2DNG A;  1X0P A;  3MFH A;  3RU0 A;  1C2P A;  2NXE A;  4ELU A;  4J9U E;  1KLN A;  3GON A;  2XY7 A;  4TXS A;  4IFV A;  2LMI A;  2J9D A;  2HBY B;  5HBM A;  3P6Y C;  2GQ2 A;  1SC4 B;  4UQG A;  3S01 A;  2BKP A;  4WKY A;  1N6Q A;  5A8W B;  3RB3 A;  1IKW A;  4LSZ B;  1X0F A;  1NXI A;  3G6X A;  2V50 A;  1TTH B;  4X4V A;  2LU1 A;  4MFB A;  4R8U B;  1WJ9 A;  1QE1 B;  3CJ0 A;  2M70 A;  1U8S A;  4J90 A;  4KKO B;  2J0X A;  1PKU A;  2R8I A;  1B7F A;  1W2B R;  2R7W A;  1QSS A;  1IQZ A;  4DEZ A;  3PNI A;  1YBU A;  4JI4 F;  5HI7 A;  2BZ2 A;  2M0G B;  1S6Q B;  4TQR A;  1R31 A;  3ZNU A;  4Y2A A;  4FS1 A;  1N0U A;  2AGQ A;  3NBP B;  5H1S V;  2ZWO A;  1QSY A;  3TUI C;  4OLP A;  4FZV A;  1HR0 J;  2LEA A;  1HMV A;  5BYS A;  2FTR A;  3MPU B;  1DTQ B;  3R7S B;  2J5A A;  2LQB A;  3E51 A;  2CQ4 A;  3DMJ B;  4DR6 J;  1SI9 A;  3IG1 B;  1KDN A;  4UOG A;  2HWI A;  4XTT A;  1KS2 A;  4NEZ A;  2MMY A;  4N47 A;  1WI8 A;  1FXR A;  3SQG B;  4ZP9 A;  2CPI A;  1RWV B;  3PRV A;  3THV A;  3K5L A;  2C22 A;  1K47 A;  4JI3 J;  1S1T B;  2XMU A;  3DU6 A;  1A0O B;  4EFA C;  4LBI A;  5ADZ A;  2QYC A;  2KHC A;  2YVS A;  4J9V A;  3HHL D;  2VQF F;  4NWB A;  1K1Q A;  1D8Z A;  2QA4 S;  1OPI A;  5B0E A;  3T1Y F;  2QT7 A;  4TU8 A; 
#chains in the Genus database with same CATH homology
 1Q0N A;  3HCX A;  3ILO A;  4M5G A;  5ETR A;  3KUE A;  3ILJ A;  3ILL A;  5ETT A;  1RTZ A;  1RU2 A;  5ETL A;  4M5M A;  4CRJ A;  3HSZ A;  3ILI A;  5ETM A;  3HSJ A;  3KUG A;  1F9H A;  3MCO A;  5ETQ A;  3MCN A;  1G4C A;  1HQ2 A;  1EX8 A;  4M5L A;  2BMB A;  2CG8 A;  4M5J A;  1KBR A;  1RU1 A;  2QX0 A;  3HD2 A;  5ETS A;  3UDE A;  4CYU A;  4M5K A;  4CWB A;  1TMJ A;  3KUH A;  3HSG A;  4M5H A;  5ETK A;  3IP0 A;  1DY3 A;  1IM6 A;  3MCM A;  4M5N A;  4PZV A;  4F7V A;  1RB0 A;  5ETN A;  5ETP A;  1CBK A;  4M5I A;  4CYU B;  3UD5 A;  1RAO A;  2F63 A;  1EQ0 A;  3HT0 A;  5ETV A;  1EQM A;  1HKA A;  3HSD A;  3HD1 A;  5ETO A;  3UDV A;  4AD6 A;  3QBC A;  2F65 A;  1TMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...