2F65A

Solution structure of hppk in complex with inhibitor analog ampcpp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
158
structure length
158
Chain Sequence
b'TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Solution structure of HPPK in complex with inhibitor analog AMPCPP
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 18
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2005-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 2f65A00
4PZVA 1CBKA 4M5KA 4M5GA 1RAOA 5ETRA 3MCNA 1F9HA 3HSDA 4M5JA 4F7VA 3HT0A 3ILOA 4CYUA 5ETQA 1HQ2A 2BMBA 2F65A 3QBCA 4M5HA 1KBRA 5ETSA 5ETNA 3UDVA 3HD1A 1Q0NA 1RB0A 3KUHA 4CYUB 2F63A 1DY3A 3IP0A 1G4CA 4M5LA 1RU2A 1TMJA 5ETPA 4AD6A 5ETMA 3UDEA 1TMMA 4CRJA 3MCOA 3HCXA 1HKAA 1RU1A 2CG8A 3HSJA 3ILLA 5ETOA 3MCMA 1EX8A 4M5IA 1IM6A 3KUEA 2QX0A 4M5MA 5ETLA 5ETTA 5ETKA 3UD5A 3ILJA 4CWBA 3ILIA 1EQMA 1RTZA 3HD2A 1EQ0A 3HSGA 3HSZA 3KUGA 5ETVA 4M5NA
chains in the Genus database with same CATH superfamily
4EZ9A 5IS2A 3OTEA 3KK3B 1RADB 2ZJPQ 2FGOA 3T1YJ 4LFCF 2XMVA 3GYXB 3IO1A 4CRJA 2E5HA 4IG3A 4TVAB 4I68A 2RE1A 5J2MA 1GFWB 1FXLA 1HNWF 4CLTA 3T41A 5AE3A 3OVSA 4H4OB 4DUYF 2LDIA 5D6GA 1SBRA 3T9ZA 2BW7A 2MZQA 2FHMA 2UXDF 1Y9OA 1F1BB 2Z4PA 4LBPA 4F25A 4DL3A 2DD8S 2EFPA 1RYRA 4Y0FA 2QTWA 2MKSA 5CH7B 2FLOA 4KH0B 5KFCA 1HYSA 2O1PA 3D2WA 2LQ8A 3FFIA 4NZ7A 1KLMA 4KGXB 2IYGA 1TL4A 4ZN3A 2EPIA 4Y2AA 4N5SA 1N36F 4EO6A 2QSWA 2LECA 1JLBB 1VISA 4F04B 1DTQB 4XDDA 4DR4J 2W8KA 2HVZA 2ZZNA 2KB2A 1RTIA 1KOHA 3NP5A 1UVKA 2Q79A 2HNZA 2OO4A 4J7CA 3W64A 5HMZA 2ZUAA 4KGMA 4FZVA 1D09B 2CFXA 3JTOA 4QW9A 2GIQA 3R5JB 4OYZA 4DX7A 1V3ZA 1TV6A 1S0NA 2YX7A 4ZIVA 2KHCA 3KG1A 4ILMA 4YN3B 2C2DA 2QA2A 4L3NA 2GHPA 2MJUA 1TL7A 1OY9A 1F9EB 3DGPA 3OL9A 5H9FJ 4FYDA 2CJAA 4GC7A 1PJ5A 4PQUB 2PDAA 1S77D 1S9FA 2AEMA 4HLBA 3DRSB 4EWTA 1RT3A 1RTHB 1TVRB 4PWDB 3IM9A 2HK2A 3D68A 1NH8A 4WFXA 3ISND 4U7CA 2MKJA 2VC0A 3VAMA 4M5HA 1RYSA 1YJ7A 4YMEA 2HG4A 2YNGA 4RLEA 4EGLA 3P8BB 3PW5A 3ZFVA 1T9XA 1TR0A 2FHOB 2WVBA 1EQMA 2OD4A 4OHWA 4U95A 2F65A 4RBVA 2N4CA 2EG1A 1VHIA 1T05A 4YQWA 2FLPA 2CQPA 5C24A 3GV8B 3DMJA 3CCQS 4OZLA 4TY8A 1AUSL 3DRXA 2EBEA 4YB5A 1DAXA 4U7UD 4J9NA 1IXKA 1S1TA 3WQPA 1B7YB 5ADZA 2YNFB 3R97A 5HMYA 3A8IA 2DYAA 2W9CB 4Q8EA 4LF4J 3VAKA 3ILIA 2GVDA 2OUGA 3HP6A 4K50A 3QRRA 3OR2B 3Q8YA 3ISZA 3CJ4A 3MM7A 3R5AA 5HVFA 1F3VA 4CYUB 3G71S 2AT1B 2B56A 4MYTA 5HATA 3PV8A 1Q7YT 1T03A 4DQQA 3QNWB 2W01A 2GNKA 3OUYB 1R3NA 5CAAA 1U48A 5DM7Q 2XG8A 3ETMA 4LSNA 1RT5B 3LA0A 4B3OA 2QSFA 4ENOA 4DV4F 4I4BA 3VCDA 3J7YI 2Q3PA 3DOLB 4WK3A 2DRDA 1TKZB 4XIUA 1RHUB 3PFEA 3C14A 4PZVA 2AJ0A 1PBUA 3OFEA 3M6VA 4NEYA 3S7RA 1S10A 2EK1A 4DV6J 3OHBA 1EARA 1REVB 4AFFA 3MEEA 4DR1F 1WTFA 5J1EB 2QYGA 4LRDA 1LW2A 1KFDA 5C2CA 3GTYX 4DR5F 3VTIA 3GFZA 3ZXWA 4FNHA 2VPXB 1LFWA 3NGKA 2V6AA 4RW6A 2DO0A 2B4OA 4OX9J 3RTVA 4KFBA 1HWIA 2K2PA 3I5CA 4DG1A 4WYWA 2WW4A 1N4LA 2L3MA 2XYGB 5I3UA 2WVDA 4QQBA 1D8ZA 4X65J 3V4IA 2BVZA 3FSYA 4DV2J 1MG7A 1Y5IB 3CO9A 4HL9A 2N7CA 4CP5A 4C8MA 3BGRB 4CZCA 1N5QA 3FUYA 4NLYA 4WE1A 3TEHB 2Y1RI 3L95X 4IH5A 2JOQA 3RU0A 2V2VA 1SPBP 3Q8PB 4CO5A 2DEIA 5DZ6A 3W2WA 3MM8B 5FIIA 3QLHB 3CE8A 2PA3A 5F3ZA 5C25A 3N28A 4FYXB 1IM6A 4DN0A 3M1VA 2G2YA 1C0TB 4UOFA 4NOHA 4E98A 2EKNA 3LP0A 2J7KA 5ETSA 4ZA1A 4ZVHA 4K5RA 1QSYA 1ZM2A 3U27A 4CM0A 3Q86A 4B9NA 2RU3A 3IN5A 2IA0A 2IM1A 3POTB 2GQQA 1S76D 2FC8A 3JSRA 1UEUA 3GU0A 2IA6A 5AXKA 5HLFA 4R0EA 4DSLA 1SL1A 4QU7A 4IRDA 3CT9A 4NYOA 3OJUA 2R7XA 3ZTPA 3EGZA 1RT7B 2E5IA 3UQSA 1U6ZA 3ZZYA 1SKWA 5KG2A 1E6YA 1K0TA 1ITPA 2R2UA 1U2RA 2YWGA 2C28A 5D3GB 2L9NA 3BO4A 1SL2A 1YIJS 3DXBA 1IJFB 4TYBA 3R8YA 1Y11A 2C2NA 3RW7A 2LXUA 3V6DA 4PYAA 2CJQA 1U1MA 2MLXA 3PDNA 4HHHA 4IR1A 5D0HA 1IQTA 1YK9A 4V1Ak 5GAGU 3UW1A 2YKQA 2ZH7A 3QIPA 2XSFA 3OVBA 1JB0C 2JEFA 4NXNF 4JI3F 3D0IE 2I5JA 2JLFA 2ZZMA 4NLSA 1RI7A 5T7LB 4WP9A 3U7JA 4JUZA 1JLEA 1QE1B 2AX0A 3TUZC 5DGBA 3H20A 1RJJA 3D4JA 3LGNA 3RBDA 2E7VA 4NYPA 3KLHA 2DNGA 2R2TA 4H4MB 3JQKA 2PFDA 3SYZA 4RL1A 2NQPA 2LKZA 1N0UA 1U1KA 4JI6J 2QMWA 1O5JA 2QFIA 1IJEB 3OTCA 1NSPA 3MEDA 2OD6A 1X4HA 2OKQA 1L3TA 1DLOB 2ROPA 1KDNA 5EN1A 1TL3A 1MROB 2JJ4D 1S7HA 4KKOB 4CLLA 1U02A 3KUEA 3OW2R 4DR7F 5B0DA 2V2QA 4CLWA 1GMVA 4YB6A 2HHWA 3X3UA 1N48A 4DSEA 2E1PA 4CIOA 1KN6A 1ICEB 4GVBB 4KO0B 4Y00A 3GIJA 3QFHA 4B3MF 1IKVA 2D3ZA 2E29A 5J1PA 1C1CA 2K1RA 2ZVIA 1JLFB 3ICLA 5KG5A 4ZP9A 1SB6A 4QOTA 5DO2A 1K1SA 1HW9A 2HHXA 5MAOA 1SJQA 1ZAWA 1C1BA 1JX4A 3H90A 4QZVB 4M95A 3TP2A 3D3BJ 4L74A 4NPOA 5AJ3F 1TMMA 3LGHA 3ZNUA 2DR9A 5LMUF 3OL6A 3TAMA 2VA2A 1FT8A 2MZRA 2RIJA 2AZ3A 1S7IA 3CCES 2CPHA 1VGYA 1UVNA 2MPUA 3AH6A 5BYSA 3DYAA 3DI6B 4P10A 2XZDB 2GS8A 1H2VZ 3NAIA 4PUOA 1WOOA 1X4GA 2U1AA 5E3PA 4F3OA 4LF5F 5G0RB 3T5LA 3QAEA 2DEJA 4XPCA 1OY8A 1FFSB 3KLIA 1NZ8A 2FVSA 3N0VA 1RLCL 1IUJA 1FE4A 3MTKA 2NXJA 1S4EA 4K4WA 3LWLA 4YP3A 1HR0J 1K44A 3QO9B 3GJTB 3AJ1A 4J9KA 5F8MA 1KTQA 3H8YA 3EXYA 3ISNC 4ED7A 5HQLA 4OI4A 2BKPA 1HWLA 2KH9A 3S1TA 2DT9A 2VASA 3NS6A 2ZBPA 4OJHA 3MMAA 1FWPA 2Z30B 4NXMJ 2HFSA 4OYXA 3QT5A 4ZLLA 1TQLA 3DU6A 3R7BB 2V4JA 5GMEA 2HLUA 3R2CJ 1JWWA 2OPRA 4J9LA 3TARA 2HS3A 2EWHA 3PX4A 1WKLA 4V19J 2HURA 2AZ1A 2F40A 4JYAJ 4TQRA 3H59A 4RX6A 3TVZA 4IG0A 4X4VA 2E7WA 1NM2A 2DY1A 3MZIA 1MN7A 1NKBA 3M8YA 1NSKL 3K5OA 2QG9B 5AT1B 2VONA 3CMQA 3PVXA 4U67Q 4NCGA 5JXSA 3MECA 1TL1A 2YH0A 3P3DA 2JDJA 4DFPA 1VQ4S 5F3TA 4I67A 1U7LA 4LREA 4GKKF 2FJDB 3O1LA 1CULA 2LYVA 4DZDA 3UCUP 3BPDA 3IMQJ 1X5PA 3BBFA 2DIUA 3WHIA 4DPOA 1TK5A 5EUHA 3KNAA 3U02A 4TQSA 2IFXA 1PKUA 3MUVP 1I1GA 3BR9A 2WSCC 4C8OA 2RILA 3MD1A 1YX2A 3VQSA 3OSNA 3UN3A 3PZPA 3IR5B 2GAHC 6FDRA 2LEAA 3O44A 1WTBA 2ZOMA 3MM9A 2M2BA 3ELHA 3T5JA 3UVJB 3T1YF 1HBMB 2WOMA 5E3RA 1TU0B 4M1KA 2F5GA 3ILJA 4UOCA 1EETA 2H4WB 3ITHA 1DTTB 1UWBB 2D69A 3KLGA 2CA9A 4TYAA 3CD5A 3GZ7A 2KO1A 4B9MA 1NPPA 4CO3A 4G1QA 3M9NB 1MMNA 3FMWA 4QJVA 1XR7A 1HHQA 1GNKA 4P2FA 4ES1A 2K3KA 4KT0C 3UDVA 4HEA9 1K1QA 1U0HB 4A46A 1ZTWA 4S0MA 1HD1A 2ABYA 2YKMA 1LWCA 4RUHA 1NDKA 1HL6A 1NRKA 2BKOA 4PWWA 4IRKA 5GADU 5HO4A 4JI2J 4TU7A 1NJZA 1K73T 2JEIA 2HMIA 1VYAA 1SVDA 3IR7B 4ED8A 3M7VA 5KT7A 5DQHA 2ZHBA 5CYQA 1FXRA 4DR4F 1LEOA 3GMGA 2J0XA 2OPPB 1X9SA 4OYMA 4OZJA 1JLCB 4U7UK 3CJKB 2YX4A 2KDOA 3HHEA 1D9DA 2AJ4A 3M9MB 2GC8A 3U1MA 3R9LA 2E1CA 1PAEX 2Z57B 3IWXA 1S9EA 2IMOA 3W9JA 3MR6A 3PCOB 2ZOFA 1DQ9A 1IR0A 3FKBA 1VQOS 1MWZA 1NK9A 3WIUA 2EFGA 2EC2A 3P5TL 1X5SA 2C3PA 4JV5J 5B08A 3QFWA 1YJWS 3KOAA 4JI7J 2W7AA 3DOMA 1U09A 3IAS9 3MAQA 4ZLJA 1VBXA 2DITA 2RU9A 2CRLA 2ALYB 3HHLD 2H54B 1F2HA 2NXUA 2B43A 2UUCJ 1DHMA 1P6TA 4H4KC 3M2VB 4YOEA 3M32A 1J27A 1V5VA 2FC9A 1L3KA 4P6QA 2LQBA 1N6QB 5BR8J 4NLGA 3RR7A 2F4VJ 2Z58B 1VQSA 1KQFB 5LL6d 1GMWA 3G2XA 1HBOA 3CJRA 3A3NB 3W65A 2AYEA 1S9GA 4ELVA 4RWXA 2D9PA 4CT9A 3MR3A 1FF2A 2IJRA 4NRTA 2VH7A 2FJVA 2NREA 3KK1A 2GO8A 5K14B 4FKXA 5GAEI 4F50A 3KK2A 3QT6A 1LWXA 1RA6A 3OT9A 4A8WA 3PR4A 2DR8A 2F9JA 4F4XA 3ZZZA 1WUUA 5K5MA 4TNOA 4CI0B 1QTMA 3ZTQA 2YH1A 2ZM6J 2C3OA 2APOA 3LUYA 2AEFA 4E0DA 4ICLB 2AQ4A 3LO3A 1ZPWX 3PX0A 3M8ZA 1RT2B 5B09A 4LF4F 2CQHA 1RAOA 2Z2YB 3CCUS 1FERA 2O67A 1U45A 1A7GE 2H5JB 2K7KA 1Y5LB 5IM0A 3LAKA 2UVRA 2K7JA 1YSJA 4CTAB 3FCWA 4CLZA 4DCOB 1HQEA 5F0WA 3N4WA 5HQMA 2KT5A 1R27B 4DL2A 2YNHB 3TR5A 1GK8A 2MKYA 3KUHA 3RBEA 2B8PA 4DSKA 3GIIA 3K59A 8RUCA 1B99A 2B0GA 5KG6A 3L09A 3BM7A 2EFNA 4P52A 3KJVA 4HT5A 1FXDA 2LU1A 1AW0A 3E3XA 4UQGA 3F41A 5DGAA 4LF1A 2XY5A 5HMXA 2OH2A 1W25A 2VG6B 4B3TJ 2MKCA 3IRXA 2RHSB 4PXDA 5F0UA 1NJYA 1U25A 1Q5YA 4USVA 1A9NB 2C3YA 1YHQS 2CWXA 4KPYA 1S12A 4R25A 4B02A 2BEFA 2ZDPA 4IDKA 3KLFB 2C2RA 2VFSA 2LXFA 4DV6F 2B7CB 3VALA 1RWKB 3GJRB 5D4NA 2NXEA 1U8WA 4ANEA 1CC7A 1LW0B 1N5TA 1RAJA 2N3LA 2KVQE 3DRSA 1S0OA 3IS9B 1KQSR 5KFBA 1XK8A 4RNFA 1TVRA 4A4JA 3WC2A 4CDIA 1M5OC 2MZTA 3ZZ0A 1IKXA 4AD6A 4YDXA 4WBFA 5HI7A 4OX9F 4W90B 2EI5A 2M5YA 4X84A 1RTZA 3OD2A 1SJFA 2VG5A 3G8QA 4ED0A 3DLKB 4X65F 4HHUA 1WG4A 5A8KB 3G6VA 4O3RA 3CJ8A 4OL8A 3FJ2A 4DV2F 4WZQA 5J2NB 2JZ5A 4FPRA 1K9MT 3HD2A 4L76A 3KFWX 3JTPA 1F0XA 2KHDA 4ER8A 5JUMA 4MKYA 4G3IA 1X31C 3CJSA 4O4GB 2XHCA 3NEKA 1SUQA 1Q4RA 2N82B 2A6OA 2DNMA 3DLEA 3HDSA 4EEYA 4WKYA 1EQ0A 2HQGA 4ANCA 2DNNA 4E2FB 2CDRB 1UAWA 1XMOJ 3GSDA 2FJXA 2KRBA 1OQ6A 1IVZA 2XMKA 1S99A 4PYDA 1UJ6A 2CDQA 2BZ2A 2YNFA 3M30B 4KV8A 3P45B 2BMBA 1QTNB 2IM0A 1HBNB 2H9ZA 4R0JA 4J9QA 4J9UE 2XGQA 1UVLA 3HVRA 1VQ7S 4JV0A 2DY9A 2RRBA 4F0HA 2R7VA 3CW2C 4Z7YA 3GCXP 4N56A 2F7VA 3EJMA 3CEDA 5GAHI 1OJ4A 2WONB 1UW9A 2A6MA 2QFJA 3OTDA 5HAOA 3K57A 3FEXB 2UV8G 5H9EK 2AYBA 2LDYA 1VJQA 3PY8A 2VDHA 2W24A 1S97A 3BYPA 2M52A 1FNXH 2QT7A 4N8OA 2P2CB 2ZD1A 2VC1A 2VOOA 4EYIB 3MEKA 3CULA 1WC5A 2HHHJ 2V8DA 2HBQB 4YHHJ 4WXWA 1BLUA 1FKOA 1HNIB 4DSFA 1VQYA 4CH0S 3CCJS 2G2ZA 4ED3A 1FEHA 3V6HA 1RAEB 2DH9A 2O3DA 2I1RA 3J81Y 3SEOA 5HBMB 2XSJA 2FIUA 2COLA 1KVIA 2NXNA 4M5DA 3D1HA 4DDFA 4Y2MA 1RHRB 1XTZA 5DDOC 1X5TA 4ECQA 1BQMB 4RW4A 4X4QA 1Y0HA 3H4DA 3VAGA 4DV7J 4L3KA 3EX7B 3THPA 4KC5A 3G9CA 2O01C 3RRKA 1KHVA 1QUPA 5L38A 3RB6A 3CCVS 4NLUA 2K3IA 1UW4A 5B0AA 4WF9Q 4JI6F 1VRUA 1Y3JA 3G82B 2A18A 2W4PA 3K0JA 3BGRA 2V8VA 1RCOB 2RH3A 2G2OA 4C8LA 2OMOA 5D15A 4GMKA 4W92B 3MUMP 3KXDA 2OPQA 4OYPA 2PMHA 1JK9B 1VIOA 1VR6A 3NAHA 2FHKA 2BJ7A 2RDIA 2MQPA 4P72A 1UFKA 4Y3CA 5B0CA 3MPDA 3B6BA 2AJ1A 4W98A 4HACA 3PEHA 3BN4A 1VK3A 1WDTA 3Q8SB 4KIAA 4RW8B 3R5GA 3QJJA 3WX4A 3R1LA 1JLAA 5H1SV 1I5OB 4LSLA 2IBOA 2IY5B 2RQ4A 4QWBA 2GHVC 1PYSB 3SXLA 1MW7A 4ZPAA 1FRKA 4UY85 2WCXA 3KHLA 4HH1A 4GO7X 1T3OA 3NGTA 1GX5A 2DGWA 1AB8A 4OLPA 1RABB 3DRPA 4ED6A 4CLKA 3KG0A 2WSFC 2KRRA 3PKMA 3AAWB 4DQRA 3K17A 1GTEA 5KFUA 2YQ3A 4MT1A 2W9BA 4JI1J 2JRSA 2GA7A 4IO1A 2ZHOA 4M5LA 2ZVSA 4ZJOA 2ZH3A 2H4YB 3OR1A 2VA3A 4OI3A 2V9WA 1MSWD 3HHLC 3HVTA 1HR0F 1P9QC 3C6UB 2AYMA 1JXVA 2QC3A 4ERDA 1RBAA 3RGIA 4AQYJ 2HS0A 5A0YB 4ZVEA 1H3DA 1U1NA 1R8PA 1N52B 2MMYA 4QIFA 2HQFA 1TUWA 2FZCB 2XNQA 1UFLA 2VBWA 5HN0A 3H5SA 3AXMA 5GVQA 1RTDA 2BM0A 5K8NA 3MCSA 1GMUA 3KLEA 3CCRS 1N5YB 2UXBJ 1BD6A 4Y2IA 4DOZA 1YLXA 4NXMF 2VD3A 5HJXA 3G6XA 3L7PA 1DY3A 3MEGB 3BSAA 2WAQD 1MWYA 3TZXA 1EKRA 2JEJA 1TAQA 1RT6A 5KFSA 4PG8A 1GMWD 4ID5B 4JYAF 2J6SA 1PYOB 2YVSA 1TKXB 1YBAA 2GO9A 3TJ9A 3PJXA 1NSQA 1Q16B 2MJNA 1MROA 3BGOP 4IO9Q 1XNQF 3VF0B 2DGOA 3UCZP 3QGGA 1RU2A 3D6MB 3GFYA 3GP9A 2W8LA 3E51A 2XZTB 2XMTA 4Q7AA 4X62J 1SQFA 3MM6A 3K5NA 3SQGB 1Q8BA 1O0PA 2Y0SD 3NCPA 3QRPA 4MTPA 2LEBA 1LWEA 1XJWB 2FZGB 2HQIA 1TMJA 3LP2A 4ZP7A 4Z7CA 4TXSA 3VVTA 1FVSA 3GLJA 4P73A 3A13A 3DLBA 1FEEA 1X4BA 5E0OA 2EW9A 2R8GA 3SMZA 4BS2A 2BE2A 2MGZA 4C6AA 3QWUA 4XTTA 4ZKAA 3LTOA 3JAMY 2OSRA 2QE5A 4I64A 2NUUG 4I69A 1R7IA 5I3QA 3GCWP 4KBIA 1Z1ZA 2ADCA 5DJBA 5EWGA 2G0JA 4DFJA 1IR2A 4C3KA 3V81B 3I0RA 3N5BA 4D3GA 4ZK7M 4PXEA 3QZ8A 2YBVA 5AXMA 1LWFB 1KVKA 4P7TA 5CXTA 4MH8A 2GJFA 2VKZG 1U1OA 2ILYA 3DI6A 3C6TB 3HO1A 4O4RA 3QGHA 1X4DA 2VPWB 4ZITA 1ACMB 4HT7A 1RWNB 2L48A 4CQ1A 2ADBA 2AV5A 3NNCA 2KXHA 1B4SA 1JJHA 2H51B 2BYCA 2DIVA 2XLJA 4IFVA 4DBQA 3EM1A 4P7VA 3QQCD 2ZBRA 2DB1A 3J7ZT 1UVMA 4KJIA 2K8GA 3V2UC 2JVRA 1H2UX 1SJRA 1YJUA 1AFJA 3M8WA 1HWUA 2MLZA 1S72S 1NJXA 4PCQA 1XIQA 4HI2A 3QSIA 4F4WA 5A2QU 1F2GA 4PPDA 4JI2F 2MTLA 2M9KA 2UVWA 4CCHA 2A1BA 3BBCA 2VG7B 2QEXS 1HQUA 4RUCA 4LF9J 5E33A 1NHKL 4A48A 1VS3A 3AOCA 3CJ3A 1SC6A 2WBMA 4B9TA 2HRUA 3KLVA 1AT1B 5B0GA 2UZAA 3PTWA 1OYEA 2FJBB 2MQOA 4USTA 5SZTA 1WELA 2C3MA 2VL1A 1SXLA 3CD7A 1LXNA 4QU6A 1H0HB 1X9MA 1OY6A 1PJ7A 4M5NA 3UO0A 5C42A 1JNZB 2Y9HA 2M8HA 4ZJQA 4K4UA 1Y7PA 3L4BC 2B6AB 4AXIA 3W3SA 4JV5F 1WJ9A 1FWLA 4N77A 3MCOA 4JI7F 4LBIA 2XHWA 2BW2A 2CQBA 3DGVA 1F9HA 2HNYB 1WEXA 1ZPVA 3EDRB 1HNXJ 1YJRA 1JLGB 3DLGB 3IWLA 1S0VA 2UUCF 1SQGA 5DLFA 2A2CA 2CPEA 3VQTA 1IWGA 3UNGC 3BR8A 2ZH4A 3BB5A 5BR8F 2YNIB 2F4VF 2GX8A 3GB0A 3QAUA 3VR1A 1X8DA 4NLOA 4R8UA 2VDIA 4NI2A 2DNRA 2MHEA 1AA1B 4NMXA 3BQ0A 3MURP 5GMDA 2FVCA 4QPTA 4PEOA 1KWMA 1S6OA 2CJBA 3H42A 2HEKA 1ROFA 2V5HG 2VPYB 3G8TA 1UWBA 2R8IA 4ZHRB 4DL7A 4Q2MA 4LRCA 4BHQA 2IC3B 2C22A 4DN9A 3ZZOA 3IBCB 3SFUA 4N76A 2ASJA 2ZKTA 2BJEA 1W2IA 3N6LA 3NL0A 3GSIA 3TWZA 3WBZA 3C2PA 2NZ4A 3G96A 3J7YU 1QJHA 1UJ5A 2XMAA 2KJVA 2ZM6F 3OQ2A 3LPYA 8ATCB 2BDPA 2JLEA 4LT6A 2CKWA 2AF6A 4HKQA 4C8YA 5EWFA 2P9EA 2C2KB 4GC6A 4LQ3A 2PC6A 2VBZA 2ZH9A 1NJWA 2GQ2A 1M5SA 1T9UA 3D0GE 5IWAJ 1ZM3A 3HZEA 1JKHA 2WVCA 2NYIA 1M5PC 3CD6S 3LP1A 4OJGA 1PC4A 2MSSA 3I4PA 1SV5A 1CJKA 2HBZB 3EZ5A 4ID8A 4MAKA 4DCJB 3BEGB 2MZJA 2YKNB 2MY7A 3CJKA 2BKNA 1JJ4A 2PO4A 3MAHA 2OTLS 1UETA 2D7SA 2HIYA 1TK8A 4IFYB 5KFIA 3GWCA 3DLHA 2KFZA 2E5LJ 4PG6A 3NKYA 2X3GA 3UD4P 2PI4A 3DM2A 3OLBA 2KG1A 4B3TF 2JHEA 3M2UA 1RQ0A 3AD9C 3D6FB 3AOAA 1HMVA 1IBKJ 3S01A 4ES3A 1DURA 1SIZA 1HARA 4UTGA 1WSRA 3ULHA 1LNQA 2DPIA 1SC3B 2PSZA 4EUVA 4O44B 4DF4A 1R0AB 2BJ9A 3SCKE 5LXRA 3BZQA 1MU2B 2CWKA 4CLFA 1Z4UA 4ZVGA 2CZVC 1N54B 2I9SA 4DV0J 2LEPA 5KFWA 4NA2A 2CQ4A 3KWMA 4YFUA 2BA9A 3UPFA 4WIQA 1ZAVA 4BBYA 3IC1A 3NWGA 3AQOA 1VQKS 2HZAA 1X9WA 3I9ZA 1K47A 2QJ3A 3GQCA 3Q22A 2RB7A 3N79A 2EC0A 1BXNA 1LFPA 4OX6A 2XLKA 5F8JA 4O3PA 2D3O1 1HPZB 2Z0GA 5KOWA 3NGUA 4OI0A 3RUBL 1CJUB 3R5CA 4K7QA 2DXEA 4I7FB 4Y2KA 1FJCA 3BREA 4X4NA 1T9VA 2B4PA 2E1MC 1JXEA 1H73A 2B9EA 3ILLA 5KT4A 1HNVB 2OJ3A 4L75A 2V67A 2L41A 5LSOA 2BQRA 4ELTA 3I31A 1BWEA 2P8IA 3H4BA 3NG8A 1XWLA 2HQ3A 3ENAA 4KHRA 4ILRA 2B51A 2MHNA 2AWZA 3DNCA 4ANDA 1RAAB 2IM3A 4NE9C 1U1LA 1RT2A 2HBRB 4LBHA 1T11A 5J2MB 1I51B 1P9YA 3LOUA 4CM2A 2FJEB 3ET6A 4USWA 1VQ5S 2ZOGA 1RU1A 4IH6A 2V2ZA 4Q45A 3AODA 4NCAA 2FHJA 2VQEF 2HQCA 1I3OB 5AXNA 7FD1A 3MTJA 5A8WA 2JL9A 2NSCA 2BACA 2B5JA 2YNHA 3JSMA 4RWWA 3KNGA 3QGPA 3CIZA 4GKJJ 1VQLS 1HYSB 4FVMA 4UQTA 5IT9Y 1KLMB 2I6WA 1UTAA 4HHJA 4UUXA 3JQJA 2BRKA 2DPJA 3HULA 4FVCA 3OVAA 1RKIA 3LAMA 4C8KA 4Y28C 3MR2A 2XB2D 2HHHF 1ZZNA 2FQQB 4YHHF 4ZVOB 2DH8A 2YKOA 3PM9A 4IKAA 1RTIB 4USJC 1B0TA 2RRAA 1ELOA 2R7WA 5ETMA 1YJTA 1UZHA 3S6EA 2HW3A 2HNZB 3D1OA 2DGQA 5KFGA 3KUGA 1PG5B 3IG1A 4C3MA 1ZTTA 1FNOA 1S57A 3IBFB 2NXCA 1FA0A 2R7TA 2YTCA 4XK8C 3IR6B 3SDEA 1U6BA 3KG4A 2OEJA 4DV7F 1TV6B 4H54A 2CZ9A 3OV7A 3AOBA 4WWSA 3VGTA 3HFZB 4WJBA 3MMBA 1OS5A 1IR1A 2YWEA 2ILZA 3GIKA 1TL7B 3BV8A 2M7SA 4C97A 3DGPB 2HIQA 2I2YA 1EKSA 1FTCA 2CJXB 1WG1A 2YWFA 2HYIB 1SJ4P 3EDQB 5A8RA 2J8SA 2KKHA 4K4XA 1R8AA 2V8HA 3W9IA 2HAFA 2L9DA 2BQUA 1F9FA 2EFVA 2G13A 2RDDA 2CPJA 1W26A 2PFFB 5GMKa 3DOKA 3E2EA 3HK2A 4OJ1A 2KXFA 1Q8LA 3R3TA 2YNGB 2MQNA 3MPWA 3EPGA 3A3OB 1RHMB 4DZ6A 1CSJA 2UUAJ 2YWHA 3HX9A 1U1RA 4I0WA 3FQLA 1T05B 2KZMA 5C24B 3P4UB 2RRNA 3DMJB 2HQDA 3OXLA 4LF7J 4OJ3A 4TY8B 5EDWA 4IRCA 3AD8C 2VOPA 2IHR1 4NLTA 1G4CA 4L73A 2GW8A 2LFVA 3K7RA 1X4AA 3ZTSA 4IOAQ 1IN0A 5CZVA 5CABA 3H5UA 3SIPB 1PCAA 4RKUC 4DLEA 4PWUA 2R9LA 2KTQA 4C98A 2JC1A 1WF1A 1FDDA 4M5KA 2GVDB 2BJDA 1EIYB 3I96A 1EP4A 4ECXA 3HHDA 3TZYA 1KBRA 2HFZA 2I8EA 4N47A 3K5LA 3MM7B 1H6KX 3M6WA 4JI1F 3NBPA 3MPYA 3FK4A 4FYVB 4DR6J 2E5GA 3W8PA 1T0TV 1T03B 4UOGA 4MFBA 4WFZA 3UN2A 1V3RA 3PRDA 2XEXA 2Q66A 4LSNB 2Y1IA 2OFGX 2AEJA 1RBLA 3HLUA 4OYOA 4B9VA 3EMTA 4B3OB 3S8SA 4AQYF 3PO4A 4M5JA 3KHHA 2HVEA 4LRFA 4ZPBA 3TZWA 1WHVA 1FI4A 3PJWA 2LLZA 4OMFG 3ZZTA 4Z2XA 4QYZK 1XMBA 4M5IA 2CAJA 1RSCA 1TKTA 3C14B 2RF2A 5KTQA 4NL5A 1LV5A 2U2FA 1U47A 5GADI 2UXBF 1UJ4A 2J9DE 4ZVTB 1Y3KA 3Q8RB 2HWHA 2E66A 1SL0A 3TQEA 3MEEB 1Y4ZB 3W2VA 1I6JA 2V8PA 1FFGB 1WHYA 1LW2B 4EU0A 1FJGJ 2E9RX 1SQEA 2W7PA 1KFSA 4RW6B 2XZWA 4KFBB 4DG1B 3C15A 4RJVA 4Y65A 2RS2A 5DQGA 5KFJA 1ZM4A 4X62F 3MXHP 5KFRA 2RDJA 1O8BA 3V4IB 2BQ3A 2G4BA 1GEHA 4EBEA 4X4SA 5KFAA 3NRBA 3CC7S 4P9SA 1HIYA 5KG4A 3THVA 1VDHA 2CNOB 4WE1B 2F3JA 2MQQA 1FNMA 3LANA 2MKIA 3EZOA 3CCMS 4YB7A 3KHRA 4JV1A 4WYLA 4URQU 3EWGA 5F8IA 3NNHA 3D3CJ 3NGDA 4A8YA 3FEZA 1FESA 3TUPA 3SBMA 3W2WB 1M5KC 5ETQA 4QR1A 2Q1LA 5C25B 4K59A 2YKAA 2N7YA 2WVEA 3HHLB 3FRYA 3MAAA 1N88A 2VICA 1RK8A 4PABA 4ETZA 1BGXT 4P75A 4CLYA 2JNJA 5I42A 5AXLA 1NDLA 2HVDA 2UU9J 4HR2A 1CQNA 4KH1B 1RACB 5D4OA 1CVJA 5EX0A 2CQ3A 3NNAA 5HLFB 2YKPA 2QO3A 2CQ1A 4X4PA 1WI6A 4O3QA 3W7BA 1F60B 2ZH8A 2ZUGA 3AD7C 3MPUB 4UOHA 1MN9A 1RT1B 4BCAA 2KFYA 2XI2A 1KHWA 2ZC4A 1IBLJ 4F0MA 5FJ4A 1NHVA 2MZSA 4O3SA 4OHYA 3PO5A 4I2QA 3JSBA 5KT6A 1UMJA 1VQPS 1IBMJ 3BSOA 2QLJB 1E6YB 2EEYA 3OHAA 3F44A 4RBTA 2EXUA 2IRUA 3QWPA 4F02A 1U49A 2DRBA 4URGA 1HQ2A 3V6DB 1N5SA 3DU5A 5E7OB 1WC3A 1XMQJ 1AZSA 4I1TA 3MCMA 3DCAA 2DHAA 2GVZA 1O51A 1VBKA 4FPIA 4MKVA 2ATCB 3QIPB 1QSSA 4HDHA 1Q7LB 3WIVA 4ED5A 5E3CA 1RLDA 2ATLA 3M8RA 4LF9F 2VFTA 3FQKA 3RAMA 1JLEB 2QL5B 4KQZA 2Y3YA 2HNDA 3RB3A 1G2EA 2FVPA 2XI3A 1FX2A 2DNLA 4KGZB 3MFIA 3HHNB 4ED1A 1N5VA 3KLHB 1A6LA 5LMNJ 4KE5A 3TVKA 3BGFA 4BC9A 3PIPQ 3K8WA 2MQ8A 1CJVB 3DN9A 4FN5A 3B4MA 4O3NA 4NLXA 2OIHA 2A0FB 1BHNA 1YI2S 1TKDA 2FB0A 3D67A 3MEDB 3ZZPA 4C11B 3N5FA 1RP5A 3I5AA 2BE9B 2XY7A 2IJNA 5IQ6A 3JAMU 3TX8A 2HPUA 2FLNA 1T9TA 5GAEU 1NJIT 2HRYA 1IKWA 5HJYA 1HNXF 5D8HB 1TL3B 1BWVA 1X0FA 5HQ8A 4N7TA 1PIEA 1NK7A 3BO2A 4DFKA 3CC2S 3A8JA 3EGNA 4BWJA 3HSDA 2Z56B 3D54A 1S6PA 5KT3A 1IBCB 2J0WA 4LR7A 2R42A 3BQ2A 3TI0A 1FKAF 5CYMA 1IKVB 2QV6A 4F7VA 3W66A 1NK4A 2FHJD 2K1RB 3TW0A 2P6TA 2XLIA 1S48A 2A3JA 1FD2A 3TUIC 2X1FA 1ZBTA 4IYQA 4OFZA 4NZ6A 2MDAA 1D8YA 3TA1A 4UZCA 4ECTA 3W63A 2AJ2A 1C0UA 1WHXA 3LGMA 2DGSA 1RHKB 3CCSS 5J2QA 2DR7A 4FF4A 1CPZA 1KEKA 2PEHA 5T41A 2FZKB 4L72B 4ECUA 4RPFA 3BO3A 4DV3J 2GAGC 3CDAA 3J81j 3PNIA 1WHWA 4V19X 5ETLA 2MEWA 4PUOB 4J9VA 4CWBA 1F5BA 4C3LA 4JB8B 3UDCA 2F1FA 4OYIA 1VHFA 5CYJA 5E3AA 2ERRA 2BBEA 3A8EA 3SSQA 3KLIB 4ECSA 4CO2A 4EMDA 3ETOA 5K8PA 1HFEL 4GVLA 1RTJA 5IWAF 2VG7A 4NXNJ 4NLPA 4ECRA 1T9WA 1TELA 3JXOA 3TJ8A 3SV3A 4OZ3A 5J2PA 2AW0A 2HGMA 3HHKA 1S1XB 2VFRA 4RW9A 4C4WA 4K4SA 1Q86T 4QYRA 4Y2CA 2XWYA 1NDCA 2Y8YA 3FSIA 3FBFA 3EVMA 2BM1A 4OIXA 1BQNA 5CCMA 3EGWB 2XMMA 5A76A 3HFKA 2E5LF 4PG5A 3MMAB 1TFYA 1BE4A 3H98A 2V4JB 5IZHA 1UVJA 1IBKF 2OPRB 1NK8A 2OPSB 1C4CA 3GIRA 2LQ9A 2HNYA 4IG0B 1VOMA 2NR0A 3FBBA 2IRXA 3Q8UA 3J80U 1QM9A 4I2PA 3AQPA 5H9FK 3RR8A 4NCGB 2GZOA 3MECB 1TL1B 4DV0F 4DL5A 1Q78A 2MQMA 4TLRA 2O5DA 2QL7B 5HP1B 1JIHA 2HZCA 1CULB 4FF1A 1OWXA 2HGNA 1SH3A 1D0EA 3N9UC 2OSQA 1FFWB 3I9V9 3EUNA 5IOLA 1DRZA 4KTQA 1S79A 4OZ2A 2ZDOA 5IFMA 2B9WA 3M8QA 1HKAA 2GGPA 3C3LA 5JJBA 2QA1A 4M5MA 2ZNZA 2R8KA 2BANA 2RVJA 1R0CB 2PIIA 1QD1A 4IQMA 1VQ9S 3QATA 1LXJA 4EI2A 1NB2A 4LVNP 2HVHA 5K8OA 3FVYA 1FRHA 4FBTA 1T9YA 1X7VA 4USHA 4RNNA 1XQIA 2J9DA 3MR7A 2D3UA 2EFQA 3G8SA 1GQEA 2HS4A 3QPIA 3MM9B 4B17A 2CJ9A 4OV1A 2WOMB 1WSVA 5KFPA 2WBRA 2FLLA 1EETB 3C16B 3ITHB 4ZVRB 3KLGB 3PEJA 3ZZUA 5D77A 1KP6A 4OZ0A 1X60A 1NK5A 2W9AA 3I0SA 3MFHA 2RT3A 4J9OA 4G1QB 2WB4A 3L7OA 3VAIA 2IJFA 3T19A 4NA1A 2RKIA 3FSXA 2YKNA 3ONQA 3SZ2A 4RNMA 2G1HA 1S6QA 4M8LA 2YKMB 1LWCB 2CXEA 2CVIA 4EZ6A 1NEEA 2CIMA 4IFYA 1S1WA 1CS4A 2DHSA 2DHHA 5FD1A 3UDEA 2XS7A 3M2RA 4RO0A 3MM5A 2HMIB 5BYRA 1CLFA 3THTA 2GIFA 1VC0A 3IXQA 2IYIA 2E5JA 4HH0A 1AFIA 2HHQA 2XBPA 1H2TZ 4NZ0A 3C46A 3VAHA 2UUTA 1JLQA 3QZ7A 4QW8A 2PN6A 4LF6J 4MK9A 1HBUB 2J6UA 3SI8A 4OI6A 1S9EB 2RMLA 3CWJA 1ZA1B 3MI7X 1Z2ZA 3B54A 3OTOJ 5ETVA 3UNYA 1FK9A 1W2BR 2VQFF 1S1UA 2XMJA 4CLUA 2VODA 3PYFA 2OEKA 4PKDB 1RWPB 4RW7A 2R2SA 3W5ZA 3DOMB 3DRRB 3I55S 2JC0A 2VF3A 2CJYB 1PO6A 1RT4A 4WTYA 4DXLA 1E6VA 2OELA 1M5HA 1WG5A 4O23A 4OYBA 3V6KA 1WNEA 4DMZA 3CJQA 5KFXA 2JEGA 1X0PA 5EWEA 3PYEA 4I6WA 5HVGA 3M32B 5KFMA 4WFNQ 5K9FA 2CG4A 1CJUA 3FCVA 2XMWA 3QBCA 4ZPDA 4NYZA 3PW0A 2DNYA 1HBOB 4LIRA 3MDFA 1M1KT 2QRRA 2QLXA 1S9GB 3CDEA 2FTRA 2UUAF 5KOXA 3HI9A 2AMCB 3CO0P 3KTQA 2C42A 1N34J 3DXSX 4OZ5A 3TA0A 3KK1B 3NMRA 3RJMB 3KK2B 3MMCB 4LF7F 3RAXA 2Q6BA 4ZP8A 4IOCQ 2CNLB 2QMUB 1VRTA 1FRMA 1M1HA 5IT9U 2EFOA 1FKPA 3JQMA 4G1IA 4RUAA 3MOJB 1U2FA 4LIWA 2MB0B 1WI8A 5D0EA 1PSDA 4OX7A 3RB0A 5JVHQ 3H5XA 4NRUA 2RQCA 1B0PA 4LRBA 4GRSA 2PD1A 1FVQA 3ZTOA 2XQCA 1HHSA 2BRLA 3H25A 4TN2A 1T94A 4OI1A 1RUSA 1RWOB 5IM0B 4CLPA 3NCRA 1NAQA 4QIWD 1HQEB 2IAJA 4DR6F 1G1XA 4I56A 3UFCX 1UP1A 3R2DJ 4PRFA 4J9MA 1Q53A 4DPUA 2UP1A 4LVOP 4PQAA 1DZ5A 2Z8QA 4X4RA 3NMAA 3KJVB 1CJTA 1H7WA 3KYLA 3QSYB 2R7UA 2V2KA 3NS5A 3EICA 3VAJA 4J9RA 4B3RJ 3IRXB 4FXWA 4F4AA 1J5OA 1FDAA 3RG6A 3NOGA 4C0HA 2XS5A 3O6QA 3M8SA 3ENVA 1SC1B 1EJ7L 3CTRA 2GV1A 1HI8A 5HROA 3B78A 3H7HB 1OMSA 4IDKB 1CQMA 1RHQB 3PW4A 3T1HJ 4OZNA 3Q24A 3KK3A 3JSYA 3ZC4A 2CZ4A 4K2XA 4P2MA 2CQ0A 5L1KA 1M0SA 5ITHA 4QIEA 3WC0A 4J5OA 4RNOA 2ZBIA 2DTJA 1U0SA 4WXOA 3O2IA 5IT4A 1CEZA 1FJGF 4RBUA 3UN5A 3D0HE 4NLVA 3CDUA 1UWAA 1IKXB 3H0PA 1BQXA 3GFXA 3EVOA 5LT5A 2CNNB 1UPPA 5KFLA 4LF2A 4H4OA 1VLYA 4YR2A 2VG5B 1GH8A 3M8PB 4MKBA 1UZDA 3BH6B 1ZH5A 5DQIA 3CD0A 1MWQA 3EGVA 3DLLQ 4ZPWR 1D3WA 1RWMB 1EAYC 3B4DA 5CHCB 1SUQB 1KONA 3HXMA 3DLEB 1OO0B 4G65A 5L8RC 1JLBA 2MZ1A 4QBUA 2HHVA 2HWIA 4EYHB 1HLWA 1S59A 5B0FA 3A12A 1DTQA 4KSEB 3HT3A 1HI0P 1NPKA 4KAIA 2ZH6A 3GR0A 4ZVSB 2XCAA 4PAAA 4KV8B 4ECVA 1RB0A 2AU0A 4ETXA 1PC5A 3SQOP 5F8NA 3IFEA 3BKUA 3OFGA 4A47A 4AUKA 2W7OA 3VGSA 2UU9F 4QWCA 1HA1A 2VHGA 4XDCA 4K0KJ 2ZH5A 3PXGa 2ZE2B 2R7QA 4ZP6A 2XY6A 1DQAA 1LQ9A 3HSGA 4HI1A 4JI5J 4J91A 4C48A 3Q89A 5M2RA 1IBLF 4DPXA 1VC6A 1Q82T 4J9SA 4XO0A 1T3NA 1VIXA 4PQUA 3OFFA 1B3TA 2LQJA 1IBMF 2D74B 2DGXA 1X4EA 3MOZA 5L1JA 2V68A 3F56A 2WW8A 1RTHA 2ZD1B 2WZ1A 1FRIA 1WWHA 4BC7A 4PWDA 3TYTA 3P6YC 4URSA 2QZ8A 2AJFE 3A8KA 3W5XA 1XMQF 3IM8A 1FKOB 2BOAA 3L3CA 3PKYA 4DPWA 2XNRA 3ENWA 2DNOA 1LOUA 1SH2A 5KFOA 2IDEA 3LW5C 1UEKA 2XSJB 3TEGA 3KJQB 3K2YA 4M5DB 4K8RA 4YB1P 4HTIA 4RW4B 2WRMA 4YY3J 2M4MA 1EB0A 4R5PB 5F9LA 2YPZA 2HSEB 5LMNF 2V94A 2FJWA 2E1RA 4FXVA 2AYGA 4X64J 2C2MB 3PW2A 3AJDA 2LA6A 2Z2ZA 3IA0A 3RBXA 1VRUB 2V9KA 1F5AA 4DFMA 2W9CA 2HBYB 2W4CA 1SKRA 2M70A 1JJ2R 3B82A 5FDLB 2YX1A 2OPQB 1U1QA 9ATCB 2HGLA 3OR2A 1RAHB 2AGQA 1NK6A 1YG0A 4CYUA 3R27A 2FY8A 3CPWR 1TUGB 3A1YG 4OHVA 3HHLA 2LMIA 2VKRA 4HACB 5DM6Q 2RUSA 3OUYA 3V5RA 4KPCA 4ZCIA 3D1QA 1H72C 4DR2J 2ZH2A 1RT5A 3E01B 5LSRA 1YITS 3GV7B 1JLAB 2DCUB 1NK0A 5KFKA 1G6BA 2D9OA 3CMAS 4TU8A 3K89A 4LSLB 2BE7D 3R7NB 3DOLA 2RHQB 3KJFB 2CUYA 1SKSA 1TKZA 5FLXY 2QLWA 2HFOA 4PXBA 3UDLA 1RT1A 1L3VA 3HSZA 2XO6A 2UXCJ 2FDNA 1YZ6A 1T7PA 3CCWA 4YUDA 2JX2A 3BGUA 4M94A 4DV3F 2ZNYA 3DKDA 3GV5B 3GR1A 4DX6A 1REVA 1UEVA 5IT0A 3QGIA 4UF4A 2OTJS 1YJNS 4QCLA 3DRPB 2RQMA 5J1EA 3BN7A 4EK2A 2RQKA 3CGIA 1KQGB 2IVFB 3H40A 2RSQA 4M5GA 2QLFB 2MY8A 2UUWA 2R8HA 2V69A 2ZWOA 2XWXA 3CVKA 1SIWB 2D3OR 2W9BB 3FC9A 2HRTA 4QWEA 3UI3A 4FF2A 2D41A 3OR1B 2BX6A 3HMJG 1S0MA 1R0BG 9RUBA 3HVTB 1FDBA 1X4FA 3HCXA 4TKTA 2F4FA 4I6YA 5D0GA 3R6GB 5E3QA 4DV5J 2DO4A 1JQGA 4L6V3 2M8DB 3BSNA 4KR0B 5DG8A 1U4BA 2CQCA 1TK0A 2OI2A 1Y10A 2JSXA 1V5IB 5AE2A 1J2VA 5DDPC 4USIA 4JI0J 1RTDB 3MM8A 3QLHA 3KLEB 1CJVA 2XM3A 2ZHAA 3GJSB 5CQGA 1ULRA 2UV8A 5ETOA 4C11A 3X1LB 1RT6B 1C0TA 3BDEA 1XR6A 3GE9A 4YDDB 1OSCA 3POTA 2PMZD 1RDRA 1Q8IA 4Q2LA 3W62A 2CQ2A 1U6FA 4KB7A 3N6NA 3SV4A 1WOPA 3MM6B 1D1UA 3QRQA 3W60A 1NCLA 2OMLA 3GONA 5LSLA 3N6MA 1Y5NB 1LWEB 3EYZA 2XYPB 2HZVA 3LP2B 5E5NA 1VLOA 4YS2A 3ZO7A 2IVYA 2AHOB 5DG9A 2ALZA 1RT7A 1DQ8A 3GIMA 4A8KA 4ALZA 5CCLA 4C8ZA 1L5UA 3CUNA 4FP9A 5KFHA 5D3GA 3M6UA 4EBCA 3QJLA 4FYWB 1YDLA 1QAJA 2BE2B 2MGZB 4DU7A 4IH7A 1D9AA 5HL7Q 3FNNA 4A8XA 1IKYB 5ETPA 3I0RB 3DHWC 3K58A 5DDQC 4DL4A 3UD5A 2CQIA 3EPIA 2KYXA 1QSLA 1WKJA 2M88A 4B9LA 3KMSA 2DJWA 2E44A 1OPIA 4AE5A 5T7LA 1DJ0A 1WEZA 1QE1A 2B7BB 3DFEA 4WTOB 3KDOA 5HK4A 5A6PA 2B8QA 1QVGR 1R6VA 3JB9k 4WKRA 2IIHA 4QIVA 4TY9A 3H5YA 4Q43A 4DL6A 4ZDNA 3VWSA 4H4MA 4LFBJ 1WACA 4IFVB 3EVWA 2RAQA 1PAUB 1YRUA 5IC4B 5ETNA 1FRXA 3HPOA 3MWBA 1D9FA 3B8HA 4DX8H 5DDRC 3M05A 1S1XA 4WCEQ 2DNKA 1L3SA 4OX8A 1DLOA 4DU8A 1Q1KA 3TVYA 4KKOA 4B9SA 2DHGA 3BJYA 4C0BA 4FXDA 5C7PA 2RD5C 3AA9A 3FZBA 3TUJC 4WFYA 5A2QY 1KSPA 1HQUB 1XN9A 3PW7A 2CPDA 4GVBA 4KO0A 4ZN1A 1T02A 2YXLA 3HFVA 2OPSA 2Y1LB 4DPTA 2QX0A 1B7FA 2LQ5A 3NOCA 1QY7A 1JLFA 1XNQJ 1GAOA 2VU5A 2AGOA 1N32J 1NMEB 4ECZA 2ROGA 3W61A 3T6BA 4LF6F 5KFTA 5L46A 4MK8A 3ENQA 3OTOF 5C42B 3TA2A 3GG1A 4U9RA 4DV1J 2QLBB 5HP1A 2DHXA 1MNEA 2C2EA 2BV3A 1HNZJ 2KI2A 4ZVQB 2MKKA 4ZLPA 1K8AT 2UUBJ 3GILA 3WX8A 2HFVA 4WIIA 3BH7B 3GPAA 4ELUA 1QVFR 4ZJLA 1QDUB 3FEYB 4XAKA 4NLQA 5K8MA 5G0RA 2ACYA 4ED2A 3D28A 1XEZA 2OAUA 3V6JA 5H9EJ 5AE1A 4KHPJ 1FJEB 1U2CA 1T95A 4EBDA 2KXNB 2KT2A 1LK5A 2V4QA 2DCLA 3NY0A 1F6TA 3OLAA 3LALA 2Y1JA 1GXLA 4U8YA 5KFYA 4WP3A 4EFAC 2B9XA 3H2UB 3QO9A 5IV3A 4QWAA 3DLJA 4DEZA 4JI8J 4R8UB 1NBEB 4NI2B 1UL3A 3RBZA 2GJ2A 2PGCA 2W2OP 1GTHA 2R4FA 4NA3A 5EX3A 1KS2A 3O8WA 1BY9A 1LK7A 4CLSA 1FDNA 3C16A 1N34F 3PYDA 3MHYA 3HKZD 4DS5A 2W1BA 3IGNA 3LH2S 1VFJA 3DDKA 4FKYA 2CPYA 4Y34A 1NUEA 1XNRJ 4GO5X 2GQCA 1AYEA 3KJNB 4P2XA 2ASLA 2KVIA 4PXCA 2HWTA 3ILOA 1M90T 3CIMA 2ASYA 4NX9A 2BJ8A 4WP8A 2J9EA 1WC4A 2J0SD 5KFEA 2QIFA 2QMXA 2H65B 5B0BA 3WDOA 4IOBA 1AUDA 3BPSP 3T5KA 4LSZB 1AXQA 2MKHA 4F0KA 1R89A 5KAKA 1JKHB 2ZKUA 3OL8A 1APSA 1URNA 3LP1B 5KFZA 3CSKA 2GFFA 3LQVA 2AGPA 3CC4S 1SV5B 2RUGA 4P71A 1CJKB 2PA8D 3U1NA 1KNZA 5KG3A 3SCJE 2JFDA 3I4HX 4LUBA 3SSRA 1HBUA 3AB2B 1LKZA 5J1NA 4OYWA 1YVFA 3D6HB 2L08A 5JVGQ 1YJ9S 1NLKL 1FE0A 3DM2B 1FRLA 5CD4A 5KG0A 4D3HA 3TAPA 3T3FA 4B3RF 1U1PA 3M2UB 3CCTA 2PMWA 4X66J 4Q0BB 3TO8A 1U24A 3PHEA 2G1DA 3T1AA 1HMVB 3Q23A 1HI1A 3DRRA 1GXTA 1R31A 2OP5A 2B4UA 4MJKA 3FBEA 1QAIA 2W25A 3T1HF 4EO8A 2UVVA 4LJMA 2M0GB 4IQXA 3UVJA 3OPKA 1VQ6S 1HBMA 2W4DA 1O6XA 1N8RT 3PG9A 1DTTA 2UVUA 1N0VC 3O5TB 2BUNA 1NH7A 4DQPA 4A8QA 2PT0A 2NSBA 2EKYA 1UCNA 2BXJA 3DHXA 3TNVA 3OXFA 5KG7A 1S1VB 4DL0C 2QYCA 2WTFA 1REGX 1RWXB 5KFFA 3CJTA 1V3SA 3R7SB 3BSCA 3PRVA 4ZIWA 1U0HA 3QT7A 3CJ0A 1KTVA 4IUFA 3CJ5A 1M1GA 4IR9A 1TFWA 4UY8T 5C2GA 4U8VA 4LMZA 1EHWA 4ZPVR 2ZH1A 3W8GA 3I56S 5BXIA 1GX6A 3MMCA 1G7CB 3KMQA 4ZLNA 3JYTB 2POKA 1H7XA 4A8FA 3VGVA 3NGRA 5HSPA 3VGUA 5ETTA 3PIOQ 2DNHA 2ZC3A 3FBCA 5L39A 4K4ZA 2OPPA 2KM8C 2Z2MA 2I38A 4ED4A 1JLCA 2EBGA 5F8GA 1Y00A 3RYLA 3GFHA 2LU2A 1F5CA 4WFAQ 1IM4A 3PYGA 3H2LA 4JI4J 2KN4A 3LWMA 1G3OA 3US5A 3ET6B 3QIDA 5DS7A 5A6WA 4K0KF 4OHXA 4BWMA 2F8MA 2XYHB 5A8WB 4JI5F 2B5JB 4LR9A 5B0EA 2KT3A 3A3PB 5GAGI 4LR8A 3JSMB 4LF8J 3O3LA 3D6TB 2QGFB 4O0IA 2DXDA 3FGVA 3M2VA 3HM9A 4ILLA 2IM2A 3MR5A 1RBOB 3NLCA 1N6QA 5LJ5Y 1DARA 4DI6A 2F8HA 4ZPTR 3J7AN 2DK2A 4LFAJ 1C4AA 2RS8A 1TZ0A 1YRTA 1T8EA 4KGKA 3IP0A 2B4VA 2AJQA 3GYNA 1R8CA 4G1PA 2JFKA 3M9OB 3IG1B 5B7WA 3Q2TC 4AL6A 1KQKA 2VPZB 4J37A 2YQ0A 1TAUA 1H38A 1A0OB 4FYYB 3SDEB 1PILA 4YY3F 2N3OA 5K14A 1RHJB 5KT5A 5LM7E 1OSDA 1P8GA 2XTJP 4MK7A 4ECYA 3VZIA 1HWKA 4K5SA 3MMBB 3M8PA 2MXYA 4Q5VA 3VVUA 2R7OA 3MD3A 4X64F 2CPXA 2EK6A 1XMOF 1HHTP 3UWTA 3SCIE 2MYFA 3FMBA 1XERA 3VV2B 5A8RB 2CQDA 2R7RA 1YGYA 1JJCB 4U6PA 2DR6A 1CG2A 2JVOA 1DBDA 2NZCA 1FD8A 4P74A 2AKWB 4ICLA 4A8MP 3VAFA 1I94J 2KJWA 4IG3B 4USKA 2C1EB 2VBXA 5LXYA 3FDSA 5BJRA 4Y6IA 1V9OA 2GMHA 2X1BA 4DUTA 1S6UA 2MLYA 3DOKB 3QMQA 3NCQA 2B3TB 4A8OA 3UD3P 4CTAA 2SXLA 2VV5A 3RRHA 4C0OC 5DG7A 3C66A 1J5EJ 5E2QA 1NNDA 5U47A 5IQQA 1VCTA 3DDIA 1NU4A 4PG4A 4F3MA 4FS2A 4MIBA 1FTRA 4DR3J 4F2RA 3HSJA 4DR2F 1EX8A 2PEBA 1SC4B 3BBBA 3FFIB 5ETRA 3TRGA 3J7Z5 4O0NA 2M3DA 2VG6A 4F3QA 4OYAA 3NXZA 1VC5A 4XPEA 4K2JA 2F8EX 2ZE2A 5LJ3Y 2R2RA 2VQEJ 2XMUA 1JXLA 2HFNA 4B3SJ 2DGTA 1UA1A 2KL8A 1R8HA 2UXCF 4F67A 3KLFA 2C2OB 1PBAA 2MQLA 2WVFA 4ZPCA 1U26A 3PX6A 1YTYA 3BKFA 1LW0A 4FNIA 5KFQA 2ZITA 2Y0BB 4NLRA 6AT1B 4AT1B 3IS9A 3Q8VA 1EP4B 4ATNA 3MGJA 1RWVB 3CDBA 1ZZFA 3NWRA 3Q0AA 3NBPB 1YZ7A 3DLKA 4Z37A 4PR6A 1JMTA 5L9XA 4MFBB 5A8KA 2JWNA 4YR0A 3K5MA 5J2NA 1VI7A 1KC8T 2KU7A 3W9HA 3FZ2A 1EZZB 2FVRA 1N33J 4B08A 2HHTA 3Q2SC 4UZBA 4O4GA 1VQMS 1MMDA 2ZJRQ 4DV5F 4R5PA 1RT3B 4KHMA 4ZS6A 1P27B 3BYRA 2GCFA 2C3UA 2ZZTA 4DUZJ 1P1TA 2P9CA 3CNQP 2HKEA 2IVMA 4JP8A 1VRQC 1CBKA 4JI0F 1TKTB 2RF2B 1NB7A 2KZZA 4K4TA 4ZMMA 4F4ZA 1FX4A 4LRAA 3KHGA 3M30A 4RNHA 3W2VB 5T14A 3TOQA 1HW8A 1HBNA 4LFCJ 2LA4A 4QR2A 1VBYA 3AHPA 5EHHA 4RU2A 4HVZA 2CG8A 5FDLA 1CC8A 1HNWJ 5F8HA 2VUGA 3C15B 1SCJB 2VJVA 4DUYJ 5C5JA 4F4YA 1N56A 2K06A 1OPZA 1C2PA 3D66A 2NYHA 4MIWA 2UXDJ 2X51A 1FCAA 4PPZA 3R5DA 4MIAA 2WONA 3CDWA 2GJIA 3IRWP 4CO0A 1VJWA 4YR3A 3HZGA 2PE8A 2GMJA 1JNRB 1S1TB 4KRWA 2X7IA 2CYYA 2I0XA 3E01A 2ACMA 1QUVA 3ADAC 1RISA 3R5BA 3TAQA 4QR0A 1NHUA 1N36J 5FLXU 1V6HA 1VQNS 2WK4A 1BUXA 4G6VB 2VFUA 2OEMA 4X4TA 1ZOTA 4DQIA 4FF3A 3J81U 1BC6A 1OYDA 4KGVB 1HNIA 4MMOA 5L1LA 5KFVA 3CCZA 5IXUA 2X1GA 3AJ2A 5HVHA 3MAAB 3G6ES 1KKHA 5HBMA 1WF2A 1UPMB 4USUA 5BYQA 3VZHA 4DJBA 1WC6A 3ZTRA 5I42B 2KYZA 2DR5A 1NKEA 4N8NA 2QA4S 1ZM9A 1BQMA 2R8JA 2V63A 4X2BA 7AT1B 2BR0A 2CVEA 4LFBF 4DQSA 2BJ1A 5D4PA 5CD4H 1NZAA 4FDFA 4ZCKA 4JBCA 1S4FA 4NEZA 3GYGA 3HJFA 2DNZA 4CH1A 1URRA 2ZBQA 1FRJA 3G82A 4WU3A 5DZ7A 4I2QB 4RR5A 5DRKA 1NKCA 4WK1A 4X4OA 4DPYA 2E9ZA 1K0VA 5KG1A 3EZUA 4WZMA 2EVZA 2LCWA 2FPHX 1BMQB 5D78A 1AZSB 1OIAA 2GVZB 2DBBA 3RZAA 5I3UB 2NUHA 1Q81T 3SSSA 3RAQA 3RRGA 3L7UA 3FRZA 4F26A 1RAGB 3V4MA 3F73A 4ES2A 3TQ1A 3RW6A 5EGYA 1XBWA 4RUBA 1OQ3A 1VK8A 4W4MA 2ZBCA 3KDNA 1YBUA 3MF5A 4RW8A 2HNDB 4O3OA 2WB1D 5JMNA 1MMLA 2XULA 3HJVA 1N32F 1ZS6A 8AT1B 5SUHA 1AROP 2OFHX 4KYZA 4I6AA 4DSJA 2V34A 2V8GA 4ZCMA 2IMWP 4UW2A 5F8LA 1QAYA 1DFDA 4WPAA 4DV1F 2J76E 3G6YA 1WORA 3H2VE 2E9TA 2E1AA 3SCLE 3M1VB 2FUG9 1HNZF 2WSEC 4ECWA 4P2SA 4OQJA 2GHWA 3LP0B 1Q0NA 3CMES 2UUBF 1RWUA 1IKWB 2AD9A 3UR0A 1YBTA 1WKKA 3DC2A 4ZOSA 3HVWA 4OHZA 5DETA 2NPIA 1HWJA 5K20B 4CH7A 2CPZA 3P96A 4F8RA 1IKYA 4KHPF 4OZ1A 3PR5B 1IWAA 3OJSA 2YY3A 2DGUA 1S6PB 2CJKA 4CNZA 4DCPB 3CF5Q 3BF4A 2FD2A 5CYMB 1B70B 2B9YA 1VBZA 2R3VA 3C6UA 1X5OA 4JI8F 4UUWA 1WC1A 1KR4A 5A0YA 3IBWA 5I4MA 3OL7A 4DV4J 1YQHA 4K4VA 2A10A 4F4KA 2E7XA 1YKWA 2ASDA 1C0UB 2HHPA 1ZA2B 3QT8A 4PG7A 3MPVA 4YEAA 4AL7A 5J2QB 3AB4B 1N5YA 1XNRF 1S49A 3M6XA 1QAXA 3T6JA 3MEGA 3BKTA 4DR1J 4TLQA 4CNYA 2I5JB 4NWBA 1TTHB 4DR5J 2NCKL 3PFOA 4ID5A 3D5MA 4K4YA 1TKXA 1FWKA 2FJAB 4QPXA 2FY1A 2J0QD 4F36A 2X1AA 2R7SA 1UFWA 4X4UA 2NS1B 1ZETA 4OV6A 2HHUA 5HANA 1RTJB 2QL9B 2W2MP 2AX1A 3SQGA 4AXJA 4F2SA 3AFGA 2DGVA 3QYYA 1B0VA 2FYXA 2H1YA 2W2PP 4LQ9A 4ZCLA 5J2PB 1YWXA 1RKJA 3AT1B 4DHVA 4RW9B 1YJVA 3PHTA 1Q79A 4N41A 3NS7B 1UA0A 2LVWA 3K8VA 1BQNB 2HFUA 5M2PA 5F41A 3G87A 5M2UA 2KG0A 3VHQA 3V81A 4QIGA 1WOSA 3N01A 5E41A 2DXFA 4NLDA 4HYKA 2DNPA 4X66F 3R1HA 3W1YC 1Q8KA 3BGLA 1LWFA 2G0CA 3C19A 1KLNA 1C1CB 1YRXA 2HAIA 3C6TA 4Q8FA 2G0IA 3LPEA 2DISA 4E8UA 2YWWA 1PJ6A 4QWDA 2XCPA 2W2QP 4I2PB 2VZ9A 1SI9A 1C1BB 1RAIB 3ZNJ1 3HD1A 2VJUA 3I82A 2CQGA 3CJ2A 3J80Y 1NXIA 3LF0A 4Q44A 3E8OA 3C8YA 1NPRA 3TAMB 3IWNC 1RWWB 2XS2A 3AA8A 2C2ZB 4BLGA 1Q5VA 1U8SA 2W2NP 2F63A 1RAFB 2X3DA 3DYAB 2BABA 3IAM9 2ZJQQ 4JV2A 3M8QB 3G4SS 1UVIA 2GGPB 4FS1A 2N4DA 3BQ1A 1P1LA 2HLTA 2OGUA 2Y8WA 2BANB 1WF0A 2FGCA 3P5BP 1WD6A 2J5AA 1SKUB 4KY3A 3I5BA 4JI3J 5CA5A 2IRYA 3NGSA 4DX5A 4QYZJ 2J9CA 3L9ZA 1IQZA 2P9GA 4AYBD 1PYTA 2J7WA 5HMWA 2DRAA 2HHSA 2IDLA 2HVIA 3J7A1 4NMLA 2H5IB 3MCNA 1NSAA 3JTNA 4J90A 5IC6B 4C8NA 1TL5A 1QLNA 1SH0A 2H3EB 4JI4F 2DVIA 3I0SB 1Q95G 5ETKA 1XR5A 2Q6CA 4C2MA 3OBIA 2P6SA 3P49B 2B6AA 1R6YA 2JH3A 2Z2LA 3CXCR 4MKAA 2P5VA 1GXUA 2RKIB 1RE1B 4A8SA 2H48B 5L1IA 4LF8F 1SJ1A 3AY0A 1S6QB 3I32A 1JLGA 4OI2A 3DLGA 2V0NA 3U1LA 1S1WB 1CS4B 5CZXA 1FHTA 4DR7J 1S5ZA 3K5PA 5KFNA 3M2RB 4M63A 3MM5B 5G4DA 4J9PA 4WFBQ 3BS9A 4CO4A 2DNQA 2OLWA 4Q0BA 2IPOB 2YNIA 4LFAF 3W5YA 4DF8A 5L9NA 4NCBA 1KRPA 3F0NA 4B3MJ 2HK3A 1RA7A 1R8BA 4ZVPB 5KT2A 6FD1A 1JLQB 3R6LB 2QN6B 3TX0A 2ROEA 5GAHU 3G86A 4OLOA 2AIRB 2BOPA 2ZFHA 4USMA 4FBUA 4ZHRA 3EXCX 2CNKB 2BJ3A 3ZZRA 1FK9B 2EG2A 4MYUA 2IC3A 5DLGA 2XC9A 2LP4A 2DKOB 5AJ3J 1S1UB 4B9UA 5LMUJ 2WHOA 1RZMA 3OFHA 4RW7B 3EE3A 4HDGA 4UT4A 4BDPA 2NPFA 1S1VA 3KKFA 1L3UA 1M5VC 1RT4B 2OHDA 3AXKA 4DSIA 2GIRA 1E6VB 4AL5A 2D1CA 2KM8B 3M4XA 2V50A 2ZEJA 5D0RA 2F9DA 2QA4G 2YQ1A 2RNEA 4RZRA 2NLWA 4LF5J 4ZVFA 4C9DA 4TU9A 2ZWPA 2J7UA 3D9BA 1WEYA 1I94F 4WU2A 3TANA 3Q83A 3HT0A 3JYTA 1XC9A 5IV4A 1FO1A 1NO8A 4DWIA 1SJ3P 3QJPA 2LXIA 3IGVA 3MMJA 2Q43A 3I6PA 4JOUA 2J8AA 3PRBA 1J5EF 4RU9A 2VBYA 1HD0A 3I87A 5RUBA 2GMLA 3T9NA 4DR3F 2CPFA 3UCGA 4GKJF 1PGZA 2VFVA 2JLGA 1KOOA 4H4KA 2IBKA 3UR3C 2FVQA 2CPIA 3GG0A 3T5HA 3DDNA 2RJZA 1ZYQA 1Z2LA 4C7QA 5MLCV 1VRTB 3A4TA 1F3FA 3UE2A 3CB4A 5THWA 1MLAA 4NLWA 4B3SF 5CYQB 1FKPB 5F9NA 3OXGA 2XO7A 5D4LA 3DRYA 4DLGA 4O44A 1R0AA 3MUTP 2XGPA 1TUVA 1X4CA 1MU2A 3Q8QB 1ZAXA 2AP6A 3OSPA 3HKWA 4CO1A 5KFDA 1WDDA 2YWKA 1RCXB 4GKKJ 1RXOB 3D7SB 2IAJB 2PI5A 3SFGA 1GT8A 2DH7A 2L9WA 2V4RA 3HF5A 1FJ7A 2O66A 5LOQA 4CT8A 1NDPA 3HVAA 1UKUA 3FCHA 2YPYA 1N33F 1CJTB 3OTBA 1KD1T 1HPZA 2VB6A 1H98A 1VMBA 4ITSA 1B64A 2H5EA 1VQ8S 1TP7A 2VQFJ 3JS9A 2J6TA 3GJQB 2MSTA 4DUZF 4I7FA 1WC0A 1J5OB 4HTJA 3PJ9A 4NASA 2A2DA 1W7WA 3WZ0A 7FDRA 2VIHA 2G9OA 5HROB 1HNVA 4DS4A 3TZZA 1H74A 3PACA 3CCLS 1R43A 3BDPA 2CADA 5I3PA 1RGVA 3RB4A 4ZVUB 2KFNA 4U96A 1KVJA 3TJAA
chains in the Genus database with same CATH topology
4PZVA 1CBKA 4M5KA 4M5GA 1RAOA 5ETRA 3MCNA 1F9HA 3HSDA 4M5JA 4F7VA 3HT0A 3ILOA 4CYUA 5ETQA 1HQ2A 2BMBA 2F65A 3QBCA 4M5HA 1KBRA 5ETSA 5ETNA 3UDVA 3HD1A 1Q0NA 1RB0A 3KUHA 4CYUB 2F63A 1DY3A 3IP0A 1G4CA 4M5LA 1RU2A 1TMJA 5ETPA 4AD6A 5ETMA 3UDEA 1TMMA 4CRJA 3MCOA 3HCXA 1HKAA 1RU1A 2CG8A 3HSJA 3ILLA 5ETOA 3MCMA 1EX8A 4M5IA 1IM6A 3KUEA 2QX0A 4M5MA 5ETLA 5ETTA 5ETKA 3UD5A 3ILJA 4CWBA 3ILIA 1EQMA 1RTZA 3HD2A 1EQ0A 3HSGA 3HSZA 3KUGA 5ETVA 4M5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PZV A;  1CBK A;  4M5K A;  4M5G A;  1RAO A;  5ETR A;  3MCN A;  1F9H A;  3HSD A;  4M5J A;  4F7V A;  3HT0 A;  3ILO A;  4CYU A;  5ETQ A;  1HQ2 A;  2BMB A;  2F65 A;  3QBC A;  4M5H A;  1KBR A;  5ETS A;  5ETN A;  3UDV A;  3HD1 A;  1Q0N A;  1RB0 A;  3KUH A;  4CYU B;  2F63 A;  1DY3 A;  3IP0 A;  1G4C A;  4M5L A;  1RU2 A;  1TMJ A;  5ETP A;  4AD6 A;  5ETM A;  3UDE A;  1TMM A;  4CRJ A;  3MCO A;  3HCX A;  1HKA A;  1RU1 A;  2CG8 A;  3HSJ A;  3ILL A;  5ETO A;  3MCM A;  1EX8 A;  4M5I A;  1IM6 A;  3KUE A;  2QX0 A;  4M5M A;  5ETL A;  5ETT A;  5ETK A;  3UD5 A;  3ILJ A;  4CWB A;  3ILI A;  1EQM A;  1RTZ A;  3HD2 A;  1EQ0 A;  3HSG A;  3HSZ A;  3KUG A;  5ETV A;  4M5N A; 
#chains in the Genus database with same CATH topology
 4EZ9 A;  5IS2 A;  3OTE A;  3KK3 B;  1RAD B;  2ZJP Q;  2FGO A;  3T1Y J;  4LFC F;  2XMV A;  3GYX B;  3IO1 A;  4CRJ A;  2E5H A;  4IG3 A;  4TVA B;  4I68 A;  2RE1 A;  5J2M A;  1GFW B;  1FXL A;  1HNW F;  4CLT A;  3T41 A;  5AE3 A;  3OVS A;  4H4O B;  4DUY F;  2LDI A;  5D6G A;  1SBR A;  3T9Z A;  2BW7 A;  2MZQ A;  2FHM A;  2UXD F;  1Y9O A;  1F1B B;  2Z4P A;  4LBP A;  4F25 A;  4DL3 A;  2DD8 S;  2EFP A;  1RYR A;  4Y0F A;  2QTW A;  2MKS A;  5CH7 B;  2FLO A;  4KH0 B;  5KFC A;  1HYS A;  2O1P A;  3D2W A;  2LQ8 A;  3FFI A;  4NZ7 A;  1KLM A;  4KGX B;  2IYG A;  1TL4 A;  4ZN3 A;  2EPI A;  4Y2A A;  4N5S A;  1N36 F;  4EO6 A;  2QSW A;  2LEC A;  1JLB B;  1VIS A;  4F04 B;  1DTQ B;  4XDD A;  4DR4 J;  2W8K A;  2HVZ A;  2ZZN A;  2KB2 A;  1RTI A;  1KOH A;  3NP5 A;  1UVK A;  2Q79 A;  2HNZ A;  2OO4 A;  4J7C A;  3W64 A;  5HMZ A;  2ZUA A;  4KGM A;  4FZV A;  1D09 B;  2CFX A;  3JTO A;  4QW9 A;  2GIQ A;  3R5J B;  4OYZ A;  4DX7 A;  1V3Z A;  1TV6 A;  1S0N A;  2YX7 A;  4ZIV A;  2KHC A;  3KG1 A;  4ILM A;  4YN3 B;  2C2D A;  2QA2 A;  4L3N A;  2GHP A;  2MJU A;  1TL7 A;  1OY9 A;  1F9E B;  3DGP A;  3OL9 A;  5H9F J;  4FYD A;  2CJA A;  4GC7 A;  1PJ5 A;  4PQU B;  2PDA A;  1S77 D;  1S9F A;  2AEM A;  4HLB A;  3DRS B;  4EWT A;  1RT3 A;  1RTH B;  1TVR B;  4PWD B;  3IM9 A;  2HK2 A;  3D68 A;  1NH8 A;  4WFX A;  3ISN D;  4U7C A;  2MKJ A;  2VC0 A;  3VAM A;  4M5H A;  1RYS A;  1YJ7 A;  4YME A;  2HG4 A;  2YNG A;  4RLE A;  4EGL A;  3P8B B;  3PW5 A;  3ZFV A;  1T9X A;  1TR0 A;  2FHO B;  2WVB A;  1EQM A;  2OD4 A;  4OHW A;  4U95 A;  2F65 A;  4RBV A;  2N4C A;  2EG1 A;  1VHI A;  1T05 A;  4YQW A;  2FLP A;  2CQP A;  5C24 A;  3GV8 B;  3DMJ A;  3CCQ S;  4OZL A;  4TY8 A;  1AUS L;  3DRX A;  2EBE A;  4YB5 A;  1DAX A;  4U7U D;  4J9N A;  1IXK A;  1S1T A;  3WQP A;  1B7Y B;  5ADZ A;  2YNF B;  3R97 A;  5HMY A;  3A8I A;  2DYA A;  2W9C B;  4Q8E A;  4LF4 J;  3VAK A;  3ILI A;  2GVD A;  2OUG A;  3HP6 A;  4K50 A;  3QRR A;  3OR2 B;  3Q8Y A;  3ISZ A;  3CJ4 A;  3MM7 A;  3R5A A;  5HVF A;  1F3V A;  4CYU B;  3G71 S;  2AT1 B;  2B56 A;  4MYT A;  5HAT A;  3PV8 A;  1Q7Y T;  1T03 A;  4DQQ A;  3QNW B;  2W01 A;  2GNK A;  3OUY B;  1R3N A;  5CAA A;  1U48 A;  5DM7 Q;  2XG8 A;  3ETM A;  4LSN A;  1RT5 B;  3LA0 A;  4B3O A;  2QSF A;  4ENO A;  4DV4 F;  4I4B A;  3VCD A;  3J7Y I;  2Q3P A;  3DOL B;  4WK3 A;  2DRD A;  1TKZ B;  4XIU A;  1RHU B;  3PFE A;  3C14 A;  4PZV A;  2AJ0 A;  1PBU A;  3OFE A;  3M6V A;  4NEY A;  3S7R A;  1S10 A;  2EK1 A;  4DV6 J;  3OHB A;  1EAR A;  1REV B;  4AFF A;  3MEE A;  4DR1 F;  1WTF A;  5J1E B;  2QYG A;  4LRD A;  1LW2 A;  1KFD A;  5C2C A;  3GTY X;  4DR5 F;  3VTI A;  3GFZ A;  3ZXW A;  4FNH A;  2VPX B;  1LFW A;  3NGK A;  2V6A A;  4RW6 A;  2DO0 A;  2B4O A;  4OX9 J;  3RTV A;  4KFB A;  1HWI A;  2K2P A;  3I5C A;  4DG1 A;  4WYW A;  2WW4 A;  1N4L A;  2L3M A;  2XYG B;  5I3U A;  2WVD A;  4QQB A;  1D8Z A;  4X65 J;  3V4I A;  2BVZ A;  3FSY A;  4DV2 J;  1MG7 A;  1Y5I B;  3CO9 A;  4HL9 A;  2N7C A;  4CP5 A;  4C8M A;  3BGR B;  4CZC A;  1N5Q A;  3FUY A;  4NLY A;  4WE1 A;  3TEH B;  2Y1R I;  3L95 X;  4IH5 A;  2JOQ A;  3RU0 A;  2V2V A;  1SPB P;  3Q8P B;  4CO5 A;  2DEI A;  5DZ6 A;  3W2W A;  3MM8 B;  5FII A;  3QLH B;  3CE8 A;  2PA3 A;  5F3Z A;  5C25 A;  3N28 A;  4FYX B;  1IM6 A;  4DN0 A;  3M1V A;  2G2Y A;  1C0T B;  4UOF A;  4NOH A;  4E98 A;  2EKN A;  3LP0 A;  2J7K A;  5ETS A;  4ZA1 A;  4ZVH A;  4K5R A;  1QSY A;  1ZM2 A;  3U27 A;  4CM0 A;  3Q86 A;  4B9N A;  2RU3 A;  3IN5 A;  2IA0 A;  2IM1 A;  3POT B;  2GQQ A;  1S76 D;  2FC8 A;  3JSR A;  1UEU A;  3GU0 A;  2IA6 A;  5AXK A;  5HLF A;  4R0E A;  4DSL A;  1SL1 A;  4QU7 A;  4IRD A;  3CT9 A;  4NYO A;  3OJU A;  2R7X A;  3ZTP A;  3EGZ A;  1RT7 B;  2E5I A;  3UQS A;  1U6Z A;  3ZZY A;  1SKW A;  5KG2 A;  1E6Y A;  1K0T A;  1ITP A;  2R2U A;  1U2R A;  2YWG A;  2C28 A;  5D3G B;  2L9N A;  3BO4 A;  1SL2 A;  1YIJ S;  3DXB A;  1IJF B;  4TYB A;  3R8Y A;  1Y11 A;  2C2N A;  3RW7 A;  2LXU A;  3V6D A;  4PYA A;  2CJQ A;  1U1M A;  2MLX A;  3PDN A;  4HHH A;  4IR1 A;  5D0H A;  1IQT A;  1YK9 A;  4V1A k;  5GAG U;  3UW1 A;  2YKQ A;  2ZH7 A;  3QIP A;  2XSF A;  3OVB A;  1JB0 C;  2JEF A;  4NXN F;  4JI3 F;  3D0I E;  2I5J A;  2JLF A;  2ZZM A;  4NLS A;  1RI7 A;  5T7L B;  4WP9 A;  3U7J A;  4JUZ A;  1JLE A;  1QE1 B;  2AX0 A;  3TUZ C;  5DGB A;  3H20 A;  1RJJ A;  3D4J A;  3LGN A;  3RBD A;  2E7V A;  4NYP A;  3KLH A;  2DNG A;  2R2T A;  4H4M B;  3JQK A;  2PFD A;  3SYZ A;  4RL1 A;  2NQP A;  2LKZ A;  1N0U A;  1U1K A;  4JI6 J;  2QMW A;  1O5J A;  2QFI A;  1IJE B;  3OTC A;  1NSP A;  3MED A;  2OD6 A;  1X4H A;  2OKQ A;  1L3T A;  1DLO B;  2ROP A;  1KDN A;  5EN1 A;  1TL3 A;  1MRO B;  2JJ4 D;  1S7H A;  4KKO B;  4CLL A;  1U02 A;  3KUE A;  3OW2 R;  4DR7 F;  5B0D A;  2V2Q A;  4CLW A;  1GMV A;  4YB6 A;  2HHW A;  3X3U A;  1N48 A;  4DSE A;  2E1P A;  4CIO A;  1KN6 A;  1ICE B;  4GVB B;  4KO0 B;  4Y00 A;  3GIJ A;  3QFH A;  4B3M F;  1IKV A;  2D3Z A;  2E29 A;  5J1P A;  1C1C A;  2K1R A;  2ZVI A;  1JLF B;  3ICL A;  5KG5 A;  4ZP9 A;  1SB6 A;  4QOT A;  5DO2 A;  1K1S A;  1HW9 A;  2HHX A;  5MAO A;  1SJQ A;  1ZAW A;  1C1B A;  1JX4 A;  3H90 A;  4QZV B;  4M95 A;  3TP2 A;  3D3B J;  4L74 A;  4NPO A;  5AJ3 F;  1TMM A;  3LGH A;  3ZNU A;  2DR9 A;  5LMU F;  3OL6 A;  3TAM A;  2VA2 A;  1FT8 A;  2MZR A;  2RIJ A;  2AZ3 A;  1S7I A;  3CCE S;  2CPH A;  1VGY A;  1UVN A;  2MPU A;  3AH6 A;  5BYS A;  3DYA A;  3DI6 B;  4P10 A;  2XZD B;  2GS8 A;  1H2V Z;  3NAI A;  4PUO A;  1WOO A;  1X4G A;  2U1A A;  5E3P A;  4F3O A;  4LF5 F;  5G0R B;  3T5L A;  3QAE A;  2DEJ A;  4XPC A;  1OY8 A;  1FFS B;  3KLI A;  1NZ8 A;  2FVS A;  3N0V A;  1RLC L;  1IUJ A;  1FE4 A;  3MTK A;  2NXJ A;  1S4E A;  4K4W A;  3LWL A;  4YP3 A;  1HR0 J;  1K44 A;  3QO9 B;  3GJT B;  3AJ1 A;  4J9K A;  5F8M A;  1KTQ A;  3H8Y A;  3EXY A;  3ISN C;  4ED7 A;  5HQL A;  4OI4 A;  2BKP A;  1HWL A;  2KH9 A;  3S1T A;  2DT9 A;  2VAS A;  3NS6 A;  2ZBP A;  4OJH A;  3MMA A;  1FWP A;  2Z30 B;  4NXM J;  2HFS A;  4OYX A;  3QT5 A;  4ZLL A;  1TQL A;  3DU6 A;  3R7B B;  2V4J A;  5GME A;  2HLU A;  3R2C J;  1JWW A;  2OPR A;  4J9L A;  3TAR A;  2HS3 A;  2EWH A;  3PX4 A;  1WKL A;  4V19 J;  2HUR A;  2AZ1 A;  2F40 A;  4JYA J;  4TQR A;  3H59 A;  4RX6 A;  3TVZ A;  4IG0 A;  4X4V A;  2E7W A;  1NM2 A;  2DY1 A;  3MZI A;  1MN7 A;  1NKB A;  3M8Y A;  1NSK L;  3K5O A;  2QG9 B;  5AT1 B;  2VON A;  3CMQ A;  3PVX A;  4U67 Q;  4NCG A;  5JXS A;  3MEC A;  1TL1 A;  2YH0 A;  3P3D A;  2JDJ A;  4DFP A;  1VQ4 S;  5F3T A;  4I67 A;  1U7L A;  4LRE A;  4GKK F;  2FJD B;  3O1L A;  1CUL A;  2LYV A;  4DZD A;  3UCU P;  3BPD A;  3IMQ J;  1X5P A;  3BBF A;  2DIU A;  3WHI A;  4DPO A;  1TK5 A;  5EUH A;  3KNA A;  3U02 A;  4TQS A;  2IFX A;  1PKU A;  3MUV P;  1I1G A;  3BR9 A;  2WSC C;  4C8O A;  2RIL A;  3MD1 A;  1YX2 A;  3VQS A;  3OSN A;  3UN3 A;  3PZP A;  3IR5 B;  2GAH C;  6FDR A;  2LEA A;  3O44 A;  1WTB A;  2ZOM A;  3MM9 A;  2M2B A;  3ELH A;  3T5J A;  3UVJ B;  3T1Y F;  1HBM B;  2WOM A;  5E3R A;  1TU0 B;  4M1K A;  2F5G A;  3ILJ A;  4UOC A;  1EET A;  2H4W B;  3ITH A;  1DTT B;  1UWB B;  2D69 A;  3KLG A;  2CA9 A;  4TYA A;  3CD5 A;  3GZ7 A;  2KO1 A;  4B9M A;  1NPP A;  4CO3 A;  4G1Q A;  3M9N B;  1MMN A;  3FMW A;  4QJV A;  1XR7 A;  1HHQ A;  1GNK A;  4P2F A;  4ES1 A;  2K3K A;  4KT0 C;  3UDV A;  4HEA 9;  1K1Q A;  1U0H B;  4A46 A;  1ZTW A;  4S0M A;  1HD1 A;  2ABY A;  2YKM A;  1LWC A;  4RUH A;  1NDK A;  1HL6 A;  1NRK A;  2BKO A;  4PWW A;  4IRK A;  5GAD U;  5HO4 A;  4JI2 J;  4TU7 A;  1NJZ A;  1K73 T;  2JEI A;  2HMI A;  1VYA A;  1SVD A;  3IR7 B;  4ED8 A;  3M7V A;  5KT7 A;  5DQH A;  2ZHB A;  5CYQ A;  1FXR A;  4DR4 F;  1LEO A;  3GMG A;  2J0X A;  2OPP B;  1X9S A;  4OYM A;  4OZJ A;  1JLC B;  4U7U K;  3CJK B;  2YX4 A;  2KDO A;  3HHE A;  1D9D A;  2AJ4 A;  3M9M B;  2GC8 A;  3U1M A;  3R9L A;  2E1C A;  1PAE X;  2Z57 B;  3IWX A;  1S9E A;  2IMO A;  3W9J A;  3MR6 A;  3PCO B;  2ZOF A;  1DQ9 A;  1IR0 A;  3FKB A;  1VQO S;  1MWZ A;  1NK9 A;  3WIU A;  2EFG A;  2EC2 A;  3P5T L;  1X5S A;  2C3P A;  4JV5 J;  5B08 A;  3QFW A;  1YJW S;  3KOA A;  4JI7 J;  2W7A A;  3DOM A;  1U09 A;  3IAS 9;  3MAQ A;  4ZLJ A;  1VBX A;  2DIT A;  2RU9 A;  2CRL A;  2ALY B;  3HHL D;  2H54 B;  1F2H A;  2NXU A;  2B43 A;  2UUC J;  1DHM A;  1P6T A;  4H4K C;  3M2V B;  4YOE A;  3M32 A;  1J27 A;  1V5V A;  2FC9 A;  1L3K A;  4P6Q A;  2LQB A;  1N6Q B;  5BR8 J;  4NLG A;  3RR7 A;  2F4V J;  2Z58 B;  1VQS A;  1KQF B;  5LL6 d;  1GMW A;  3G2X A;  1HBO A;  3CJR A;  3A3N B;  3W65 A;  2AYE A;  1S9G A;  4ELV A;  4RWX A;  2D9P A;  4CT9 A;  3MR3 A;  1FF2 A;  2IJR A;  4NRT A;  2VH7 A;  2FJV A;  2NRE A;  3KK1 A;  2GO8 A;  5K14 B;  4FKX A;  5GAE I;  4F50 A;  3KK2 A;  3QT6 A;  1LWX A;  1RA6 A;  3OT9 A;  4A8W A;  3PR4 A;  2DR8 A;  2F9J A;  4F4X A;  3ZZZ A;  1WUU A;  5K5M A;  4TNO A;  4CI0 B;  1QTM A;  3ZTQ A;  2YH1 A;  2ZM6 J;  2C3O A;  2APO A;  3LUY A;  2AEF A;  4E0D A;  4ICL B;  2AQ4 A;  3LO3 A;  1ZPW X;  3PX0 A;  3M8Z A;  1RT2 B;  5B09 A;  4LF4 F;  2CQH A;  1RAO A;  2Z2Y B;  3CCU S;  1FER A;  2O67 A;  1U45 A;  1A7G E;  2H5J B;  2K7K A;  1Y5L B;  5IM0 A;  3LAK A;  2UVR A;  2K7J A;  1YSJ A;  4CTA B;  3FCW A;  4CLZ A;  4DCO B;  1HQE A;  5F0W A;  3N4W A;  5HQM A;  2KT5 A;  1R27 B;  4DL2 A;  2YNH B;  3TR5 A;  1GK8 A;  2MKY A;  3KUH A;  3RBE A;  2B8P A;  4DSK A;  3GII A;  3K59 A;  8RUC A;  1B99 A;  2B0G A;  5KG6 A;  3L09 A;  3BM7 A;  2EFN A;  4P52 A;  3KJV A;  4HT5 A;  1FXD A;  2LU1 A;  1AW0 A;  3E3X A;  4UQG A;  3F41 A;  5DGA A;  4LF1 A;  2XY5 A;  5HMX A;  2OH2 A;  1W25 A;  2VG6 B;  4B3T J;  2MKC A;  3IRX A;  2RHS B;  4PXD A;  5F0U A;  1NJY A;  1U25 A;  1Q5Y A;  4USV A;  1A9N B;  2C3Y A;  1YHQ S;  2CWX A;  4KPY A;  1S12 A;  4R25 A;  4B02 A;  2BEF A;  2ZDP A;  4IDK A;  3KLF B;  2C2R A;  2VFS A;  2LXF A;  4DV6 F;  2B7C B;  3VAL A;  1RWK B;  3GJR B;  5D4N A;  2NXE A;  1U8W A;  4ANE A;  1CC7 A;  1LW0 B;  1N5T A;  1RAJ A;  2N3L A;  2KVQ E;  3DRS A;  1S0O A;  3IS9 B;  1KQS R;  5KFB A;  1XK8 A;  4RNF A;  1TVR A;  4A4J A;  3WC2 A;  4CDI A;  1M5O C;  2MZT A;  3ZZ0 A;  1IKX A;  4AD6 A;  4YDX A;  4WBF A;  5HI7 A;  4OX9 F;  4W90 B;  2EI5 A;  2M5Y A;  4X84 A;  1RTZ A;  3OD2 A;  1SJF A;  2VG5 A;  3G8Q A;  4ED0 A;  3DLK B;  4X65 F;  4HHU A;  1WG4 A;  5A8K B;  3G6V A;  4O3R A;  3CJ8 A;  4OL8 A;  3FJ2 A;  4DV2 F;  4WZQ A;  5J2N B;  2JZ5 A;  4FPR A;  1K9M T;  3HD2 A;  4L76 A;  3KFW X;  3JTP A;  1F0X A;  2KHD A;  4ER8 A;  5JUM A;  4MKY A;  4G3I A;  1X31 C;  3CJS A;  4O4G B;  2XHC A;  3NEK A;  1SUQ A;  1Q4R A;  2N82 B;  2A6O A;  2DNM A;  3DLE A;  3HDS A;  4EEY A;  4WKY A;  1EQ0 A;  2HQG A;  4ANC A;  2DNN A;  4E2F B;  2CDR B;  1UAW A;  1XMO J;  3GSD A;  2FJX A;  2KRB A;  1OQ6 A;  1IVZ A;  2XMK A;  1S99 A;  4PYD A;  1UJ6 A;  2CDQ A;  2BZ2 A;  2YNF A;  3M30 B;  4KV8 A;  3P45 B;  2BMB A;  1QTN B;  2IM0 A;  1HBN B;  2H9Z A;  4R0J A;  4J9Q A;  4J9U E;  2XGQ A;  1UVL A;  3HVR A;  1VQ7 S;  4JV0 A;  2DY9 A;  2RRB A;  4F0H A;  2R7V A;  3CW2 C;  4Z7Y A;  3GCX P;  4N56 A;  2F7V A;  3EJM A;  3CED A;  5GAH I;  1OJ4 A;  2WON B;  1UW9 A;  2A6M A;  2QFJ A;  3OTD A;  5HAO A;  3K57 A;  3FEX B;  2UV8 G;  5H9E K;  2AYB A;  2LDY A;  1VJQ A;  3PY8 A;  2VDH A;  2W24 A;  1S97 A;  3BYP A;  2M52 A;  1FNX H;  2QT7 A;  4N8O A;  2P2C B;  2ZD1 A;  2VC1 A;  2VOO A;  4EYI B;  3MEK A;  3CUL A;  1WC5 A;  2HHH J;  2V8D A;  2HBQ B;  4YHH J;  4WXW A;  1BLU A;  1FKO A;  1HNI B;  4DSF A;  1VQY A;  4CH0 S;  3CCJ S;  2G2Z A;  4ED3 A;  1FEH A;  3V6H A;  1RAE B;  2DH9 A;  2O3D A;  2I1R A;  3J81 Y;  3SEO A;  5HBM B;  2XSJ A;  2FIU A;  2COL A;  1KVI A;  2NXN A;  4M5D A;  3D1H A;  4DDF A;  4Y2M A;  1RHR B;  1XTZ A;  5DDO C;  1X5T A;  4ECQ A;  1BQM B;  4RW4 A;  4X4Q A;  1Y0H A;  3H4D A;  3VAG A;  4DV7 J;  4L3K A;  3EX7 B;  3THP A;  4KC5 A;  3G9C A;  2O01 C;  3RRK A;  1KHV A;  1QUP A;  5L38 A;  3RB6 A;  3CCV S;  4NLU A;  2K3I A;  1UW4 A;  5B0A A;  4WF9 Q;  4JI6 F;  1VRU A;  1Y3J A;  3G82 B;  2A18 A;  2W4P A;  3K0J A;  3BGR A;  2V8V A;  1RCO B;  2RH3 A;  2G2O A;  4C8L A;  2OMO A;  5D15 A;  4GMK A;  4W92 B;  3MUM P;  3KXD A;  2OPQ A;  4OYP A;  2PMH A;  1JK9 B;  1VIO A;  1VR6 A;  3NAH A;  2FHK A;  2BJ7 A;  2RDI A;  2MQP A;  4P72 A;  1UFK A;  4Y3C A;  5B0C A;  3MPD A;  3B6B A;  2AJ1 A;  4W98 A;  4HAC A;  3PEH A;  3BN4 A;  1VK3 A;  1WDT A;  3Q8S B;  4KIA A;  4RW8 B;  3R5G A;  3QJJ A;  3WX4 A;  3R1L A;  1JLA A;  5H1S V;  1I5O B;  4LSL A;  2IBO A;  2IY5 B;  2RQ4 A;  4QWB A;  2GHV C;  1PYS B;  3SXL A;  1MW7 A;  4ZPA A;  1FRK A;  4UY8 5;  2WCX A;  3KHL A;  4HH1 A;  4GO7 X;  1T3O A;  3NGT A;  1GX5 A;  2DGW A;  1AB8 A;  4OLP A;  1RAB B;  3DRP A;  4ED6 A;  4CLK A;  3KG0 A;  2WSF C;  2KRR A;  3PKM A;  3AAW B;  4DQR A;  3K17 A;  1GTE A;  5KFU A;  2YQ3 A;  4MT1 A;  2W9B A;  4JI1 J;  2JRS A;  2GA7 A;  4IO1 A;  2ZHO A;  4M5L A;  2ZVS A;  4ZJO A;  2ZH3 A;  2H4Y B;  3OR1 A;  2VA3 A;  4OI3 A;  2V9W A;  1MSW D;  3HHL C;  3HVT A;  1HR0 F;  1P9Q C;  3C6U B;  2AYM A;  1JXV A;  2QC3 A;  4ERD A;  1RBA A;  3RGI A;  4AQY J;  2HS0 A;  5A0Y B;  4ZVE A;  1H3D A;  1U1N A;  1R8P A;  1N52 B;  2MMY A;  4QIF A;  2HQF A;  1TUW A;  2FZC B;  2XNQ A;  1UFL A;  2VBW A;  5HN0 A;  3H5S A;  3AXM A;  5GVQ A;  1RTD A;  2BM0 A;  5K8N A;  3MCS A;  1GMU A;  3KLE A;  3CCR S;  1N5Y B;  2UXB J;  1BD6 A;  4Y2I A;  4DOZ A;  1YLX A;  4NXM F;  2VD3 A;  5HJX A;  3G6X A;  3L7P A;  1DY3 A;  3MEG B;  3BSA A;  2WAQ D;  1MWY A;  3TZX A;  1EKR A;  2JEJ A;  1TAQ A;  1RT6 A;  5KFS A;  4PG8 A;  1GMW D;  4ID5 B;  4JYA F;  2J6S A;  1PYO B;  2YVS A;  1TKX B;  1YBA A;  2GO9 A;  3TJ9 A;  3PJX A;  1NSQ A;  1Q16 B;  2MJN A;  1MRO A;  3BGO P;  4IO9 Q;  1XNQ F;  3VF0 B;  2DGO A;  3UCZ P;  3QGG A;  1RU2 A;  3D6M B;  3GFY A;  3GP9 A;  2W8L A;  3E51 A;  2XZT B;  2XMT A;  4Q7A A;  4X62 J;  1SQF A;  3MM6 A;  3K5N A;  3SQG B;  1Q8B A;  1O0P A;  2Y0S D;  3NCP A;  3QRP A;  4MTP A;  2LEB A;  1LWE A;  1XJW B;  2FZG B;  2HQI A;  1TMJ A;  3LP2 A;  4ZP7 A;  4Z7C A;  4TXS A;  3VVT A;  1FVS A;  3GLJ A;  4P73 A;  3A13 A;  3DLB A;  1FEE A;  1X4B A;  5E0O A;  2EW9 A;  2R8G A;  3SMZ A;  4BS2 A;  2BE2 A;  2MGZ A;  4C6A A;  3QWU A;  4XTT A;  4ZKA A;  3LTO A;  3JAM Y;  2OSR A;  2QE5 A;  4I64 A;  2NUU G;  4I69 A;  1R7I A;  5I3Q A;  3GCW P;  4KBI A;  1Z1Z A;  2ADC A;  5DJB A;  5EWG A;  2G0J A;  4DFJ A;  1IR2 A;  4C3K A;  3V81 B;  3I0R A;  3N5B A;  4D3G A;  4ZK7 M;  4PXE A;  3QZ8 A;  2YBV A;  5AXM A;  1LWF B;  1KVK A;  4P7T A;  5CXT A;  4MH8 A;  2GJF A;  2VKZ G;  1U1O A;  2ILY A;  3DI6 A;  3C6T B;  3HO1 A;  4O4R A;  3QGH A;  1X4D A;  2VPW B;  4ZIT A;  1ACM B;  4HT7 A;  1RWN B;  2L48 A;  4CQ1 A;  2ADB A;  2AV5 A;  3NNC A;  2KXH A;  1B4S A;  1JJH A;  2H51 B;  2BYC A;  2DIV A;  2XLJ A;  4IFV A;  4DBQ A;  3EM1 A;  4P7V A;  3QQC D;  2ZBR A;  2DB1 A;  3J7Z T;  1UVM A;  4KJI A;  2K8G A;  3V2U C;  2JVR A;  1H2U X;  1SJR A;  1YJU A;  1AFJ A;  3M8W A;  1HWU A;  2MLZ A;  1S72 S;  1NJX A;  4PCQ A;  1XIQ A;  4HI2 A;  3QSI A;  4F4W A;  5A2Q U;  1F2G A;  4PPD A;  4JI2 F;  2MTL A;  2M9K A;  2UVW A;  4CCH A;  2A1B A;  3BBC A;  2VG7 B;  2QEX S;  1HQU A;  4RUC A;  4LF9 J;  5E33 A;  1NHK L;  4A48 A;  1VS3 A;  3AOC A;  3CJ3 A;  1SC6 A;  2WBM A;  4B9T A;  2HRU A;  3KLV A;  1AT1 B;  5B0G A;  2UZA A;  3PTW A;  1OYE A;  2FJB B;  2MQO A;  4UST A;  5SZT A;  1WEL A;  2C3M A;  2VL1 A;  1SXL A;  3CD7 A;  1LXN A;  4QU6 A;  1H0H B;  1X9M A;  1OY6 A;  1PJ7 A;  4M5N A;  3UO0 A;  5C42 A;  1JNZ B;  2Y9H A;  2M8H A;  4ZJQ A;  4K4U A;  1Y7P A;  3L4B C;  2B6A B;  4AXI A;  3W3S A;  4JV5 F;  1WJ9 A;  1FWL A;  4N77 A;  3MCO A;  4JI7 F;  4LBI A;  2XHW A;  2BW2 A;  2CQB A;  3DGV A;  1F9H A;  2HNY B;  1WEX A;  1ZPV A;  3EDR B;  1HNX J;  1YJR A;  1JLG B;  3DLG B;  3IWL A;  1S0V A;  2UUC F;  1SQG A;  5DLF A;  2A2C A;  2CPE A;  3VQT A;  1IWG A;  3UNG C;  3BR8 A;  2ZH4 A;  3BB5 A;  5BR8 F;  2YNI B;  2F4V F;  2GX8 A;  3GB0 A;  3QAU A;  3VR1 A;  1X8D A;  4NLO A;  4R8U A;  2VDI A;  4NI2 A;  2DNR A;  2MHE A;  1AA1 B;  4NMX A;  3BQ0 A;  3MUR P;  5GMD A;  2FVC A;  4QPT A;  4PEO A;  1KWM A;  1S6O A;  2CJB A;  3H42 A;  2HEK A;  1ROF A;  2V5H G;  2VPY B;  3G8T A;  1UWB A;  2R8I A;  4ZHR B;  4DL7 A;  4Q2M A;  4LRC A;  4BHQ A;  2IC3 B;  2C22 A;  4DN9 A;  3ZZO A;  3IBC B;  3SFU A;  4N76 A;  2ASJ A;  2ZKT A;  2BJE A;  1W2I A;  3N6L A;  3NL0 A;  3GSI A;  3TWZ A;  3WBZ A;  3C2P A;  2NZ4 A;  3G96 A;  3J7Y U;  1QJH A;  1UJ5 A;  2XMA A;  2KJV A;  2ZM6 F;  3OQ2 A;  3LPY A;  8ATC B;  2BDP A;  2JLE A;  4LT6 A;  2CKW A;  2AF6 A;  4HKQ A;  4C8Y A;  5EWF A;  2P9E A;  2C2K B;  4GC6 A;  4LQ3 A;  2PC6 A;  2VBZ A;  2ZH9 A;  1NJW A;  2GQ2 A;  1M5S A;  1T9U A;  3D0G E;  5IWA J;  1ZM3 A;  3HZE A;  1JKH A;  2WVC A;  2NYI A;  1M5P C;  3CD6 S;  3LP1 A;  4OJG A;  1PC4 A;  2MSS A;  3I4P A;  1SV5 A;  1CJK A;  2HBZ B;  3EZ5 A;  4ID8 A;  4MAK A;  4DCJ B;  3BEG B;  2MZJ A;  2YKN B;  2MY7 A;  3CJK A;  2BKN A;  1JJ4 A;  2PO4 A;  3MAH A;  2OTL S;  1UET A;  2D7S A;  2HIY A;  1TK8 A;  4IFY B;  5KFI A;  3GWC A;  3DLH A;  2KFZ A;  2E5L J;  4PG6 A;  3NKY A;  2X3G A;  3UD4 P;  2PI4 A;  3DM2 A;  3OLB A;  2KG1 A;  4B3T F;  2JHE A;  3M2U A;  1RQ0 A;  3AD9 C;  3D6F B;  3AOA A;  1HMV A;  1IBK J;  3S01 A;  4ES3 A;  1DUR A;  1SIZ A;  1HAR A;  4UTG A;  1WSR A;  3ULH A;  1LNQ A;  2DPI A;  1SC3 B;  2PSZ A;  4EUV A;  4O44 B;  4DF4 A;  1R0A B;  2BJ9 A;  3SCK E;  5LXR A;  3BZQ A;  1MU2 B;  2CWK A;  4CLF A;  1Z4U A;  4ZVG A;  2CZV C;  1N54 B;  2I9S A;  4DV0 J;  2LEP A;  5KFW A;  4NA2 A;  2CQ4 A;  3KWM A;  4YFU A;  2BA9 A;  3UPF A;  4WIQ A;  1ZAV A;  4BBY A;  3IC1 A;  3NWG A;  3AQO A;  1VQK S;  2HZA A;  1X9W A;  3I9Z A;  1K47 A;  2QJ3 A;  3GQC A;  3Q22 A;  2RB7 A;  3N79 A;  2EC0 A;  1BXN A;  1LFP A;  4OX6 A;  2XLK A;  5F8J A;  4O3P A;  2D3O 1;  1HPZ B;  2Z0G A;  5KOW A;  3NGU A;  4OI0 A;  3RUB L;  1CJU B;  3R5C A;  4K7Q A;  2DXE A;  4I7F B;  4Y2K A;  1FJC A;  3BRE A;  4X4N A;  1T9V A;  2B4P A;  2E1M C;  1JXE A;  1H73 A;  2B9E A;  3ILL A;  5KT4 A;  1HNV B;  2OJ3 A;  4L75 A;  2V67 A;  2L41 A;  5LSO A;  2BQR A;  4ELT A;  3I31 A;  1BWE A;  2P8I A;  3H4B A;  3NG8 A;  1XWL A;  2HQ3 A;  3ENA A;  4KHR A;  4ILR A;  2B51 A;  2MHN A;  2AWZ A;  3DNC A;  4AND A;  1RAA B;  2IM3 A;  4NE9 C;  1U1L A;  1RT2 A;  2HBR B;  4LBH A;  1T11 A;  5J2M B;  1I51 B;  1P9Y A;  3LOU A;  4CM2 A;  2FJE B;  3ET6 A;  4USW A;  1VQ5 S;  2ZOG A;  1RU1 A;  4IH6 A;  2V2Z A;  4Q45 A;  3AOD A;  4NCA A;  2FHJ A;  2VQE F;  2HQC A;  1I3O B;  5AXN A;  7FD1 A;  3MTJ A;  5A8W A;  2JL9 A;  2NSC A;  2BAC A;  2B5J A;  2YNH A;  3JSM A;  4RWW A;  3KNG A;  3QGP A;  3CIZ A;  4GKJ J;  1VQL S;  1HYS B;  4FVM A;  4UQT A;  5IT9 Y;  1KLM B;  2I6W A;  1UTA A;  4HHJ A;  4UUX A;  3JQJ A;  2BRK A;  2DPJ A;  3HUL A;  4FVC A;  3OVA A;  1RKI A;  3LAM A;  4C8K A;  4Y28 C;  3MR2 A;  2XB2 D;  2HHH F;  1ZZN A;  2FQQ B;  4YHH F;  4ZVO B;  2DH8 A;  2YKO A;  3PM9 A;  4IKA A;  1RTI B;  4USJ C;  1B0T A;  2RRA A;  1ELO A;  2R7W A;  5ETM A;  1YJT A;  1UZH A;  3S6E A;  2HW3 A;  2HNZ B;  3D1O A;  2DGQ A;  5KFG A;  3KUG A;  1PG5 B;  3IG1 A;  4C3M A;  1ZTT A;  1FNO A;  1S57 A;  3IBF B;  2NXC A;  1FA0 A;  2R7T A;  2YTC A;  4XK8 C;  3IR6 B;  3SDE A;  1U6B A;  3KG4 A;  2OEJ A;  4DV7 F;  1TV6 B;  4H54 A;  2CZ9 A;  3OV7 A;  3AOB A;  4WWS A;  3VGT A;  3HFZ B;  4WJB A;  3MMB A;  1OS5 A;  1IR1 A;  2YWE A;  2ILZ A;  3GIK A;  1TL7 B;  3BV8 A;  2M7S A;  4C97 A;  3DGP B;  2HIQ A;  2I2Y A;  1EKS A;  1FTC A;  2CJX B;  1WG1 A;  2YWF A;  2HYI B;  1SJ4 P;  3EDQ B;  5A8R A;  2J8S A;  2KKH A;  4K4X A;  1R8A A;  2V8H A;  3W9I A;  2HAF A;  2L9D A;  2BQU A;  1F9F A;  2EFV A;  2G13 A;  2RDD A;  2CPJ A;  1W26 A;  2PFF B;  5GMK a;  3DOK A;  3E2E A;  3HK2 A;  4OJ1 A;  2KXF A;  1Q8L A;  3R3T A;  2YNG B;  2MQN A;  3MPW A;  3EPG A;  3A3O B;  1RHM B;  4DZ6 A;  1CSJ A;  2UUA J;  2YWH A;  3HX9 A;  1U1R A;  4I0W A;  3FQL A;  1T05 B;  2KZM A;  5C24 B;  3P4U B;  2RRN A;  3DMJ B;  2HQD A;  3OXL A;  4LF7 J;  4OJ3 A;  4TY8 B;  5EDW A;  4IRC A;  3AD8 C;  2VOP A;  2IHR 1;  4NLT A;  1G4C A;  4L73 A;  2GW8 A;  2LFV A;  3K7R A;  1X4A A;  3ZTS A;  4IOA Q;  1IN0 A;  5CZV A;  5CAB A;  3H5U A;  3SIP B;  1PCA A;  4RKU C;  4DLE A;  4PWU A;  2R9L A;  2KTQ A;  4C98 A;  2JC1 A;  1WF1 A;  1FDD A;  4M5K A;  2GVD B;  2BJD A;  1EIY B;  3I96 A;  1EP4 A;  4ECX A;  3HHD A;  3TZY A;  1KBR A;  2HFZ A;  2I8E A;  4N47 A;  3K5L A;  3MM7 B;  1H6K X;  3M6W A;  4JI1 F;  3NBP A;  3MPY A;  3FK4 A;  4FYV B;  4DR6 J;  2E5G A;  3W8P A;  1T0T V;  1T03 B;  4UOG A;  4MFB A;  4WFZ A;  3UN2 A;  1V3R A;  3PRD A;  2XEX A;  2Q66 A;  4LSN B;  2Y1I A;  2OFG X;  2AEJ A;  1RBL A;  3HLU A;  4OYO A;  4B9V A;  3EMT A;  4B3O B;  3S8S A;  4AQY F;  3PO4 A;  4M5J A;  3KHH A;  2HVE A;  4LRF A;  4ZPB A;  3TZW A;  1WHV A;  1FI4 A;  3PJW A;  2LLZ A;  4OMF G;  3ZZT A;  4Z2X A;  4QYZ K;  1XMB A;  4M5I A;  2CAJ A;  1RSC A;  1TKT A;  3C14 B;  2RF2 A;  5KTQ A;  4NL5 A;  1LV5 A;  2U2F A;  1U47 A;  5GAD I;  2UXB F;  1UJ4 A;  2J9D E;  4ZVT B;  1Y3K A;  3Q8R B;  2HWH A;  2E66 A;  1SL0 A;  3TQE A;  3MEE B;  1Y4Z B;  3W2V A;  1I6J A;  2V8P A;  1FFG B;  1WHY A;  1LW2 B;  4EU0 A;  1FJG J;  2E9R X;  1SQE A;  2W7P A;  1KFS A;  4RW6 B;  2XZW A;  4KFB B;  4DG1 B;  3C15 A;  4RJV A;  4Y65 A;  2RS2 A;  5DQG A;  5KFJ A;  1ZM4 A;  4X62 F;  3MXH P;  5KFR A;  2RDJ A;  1O8B A;  3V4I B;  2BQ3 A;  2G4B A;  1GEH A;  4EBE A;  4X4S A;  5KFA A;  3NRB A;  3CC7 S;  4P9S A;  1HIY A;  5KG4 A;  3THV A;  1VDH A;  2CNO B;  4WE1 B;  2F3J A;  2MQQ A;  1FNM A;  3LAN A;  2MKI A;  3EZO A;  3CCM S;  4YB7 A;  3KHR A;  4JV1 A;  4WYL A;  4URQ U;  3EWG A;  5F8I A;  3NNH A;  3D3C J;  3NGD A;  4A8Y A;  3FEZ A;  1FES A;  3TUP A;  3SBM A;  3W2W B;  1M5K C;  5ETQ A;  4QR1 A;  2Q1L A;  5C25 B;  4K59 A;  2YKA A;  2N7Y A;  2WVE A;  3HHL B;  3FRY A;  3MAA A;  1N88 A;  2VIC A;  1RK8 A;  4PAB A;  4ETZ A;  1BGX T;  4P75 A;  4CLY A;  2JNJ A;  5I42 A;  5AXL A;  1NDL A;  2HVD A;  2UU9 J;  4HR2 A;  1CQN A;  4KH1 B;  1RAC B;  5D4O A;  1CVJ A;  5EX0 A;  2CQ3 A;  3NNA A;  5HLF B;  2YKP A;  2QO3 A;  2CQ1 A;  4X4P A;  1WI6 A;  4O3Q A;  3W7B A;  1F60 B;  2ZH8 A;  2ZUG A;  3AD7 C;  3MPU B;  4UOH A;  1MN9 A;  1RT1 B;  4BCA A;  2KFY A;  2XI2 A;  1KHW A;  2ZC4 A;  1IBL J;  4F0M A;  5FJ4 A;  1NHV A;  2MZS A;  4O3S A;  4OHY A;  3PO5 A;  4I2Q A;  3JSB A;  5KT6 A;  1UMJ A;  1VQP S;  1IBM J;  3BSO A;  2QLJ B;  1E6Y B;  2EEY A;  3OHA A;  3F44 A;  4RBT A;  2EXU A;  2IRU A;  3QWP A;  4F02 A;  1U49 A;  2DRB A;  4URG A;  1HQ2 A;  3V6D B;  1N5S A;  3DU5 A;  5E7O B;  1WC3 A;  1XMQ J;  1AZS A;  4I1T A;  3MCM A;  3DCA A;  2DHA A;  2GVZ A;  1O51 A;  1VBK A;  4FPI A;  4MKV A;  2ATC B;  3QIP B;  1QSS A;  4HDH A;  1Q7L B;  3WIV A;  4ED5 A;  5E3C A;  1RLD A;  2ATL A;  3M8R A;  4LF9 F;  2VFT A;  3FQK A;  3RAM A;  1JLE B;  2QL5 B;  4KQZ A;  2Y3Y A;  2HND A;  3RB3 A;  1G2E A;  2FVP A;  2XI3 A;  1FX2 A;  2DNL A;  4KGZ B;  3MFI A;  3HHN B;  4ED1 A;  1N5V A;  3KLH B;  1A6L A;  5LMN J;  4KE5 A;  3TVK A;  3BGF A;  4BC9 A;  3PIP Q;  3K8W A;  2MQ8 A;  1CJV B;  3DN9 A;  4FN5 A;  3B4M A;  4O3N A;  4NLX A;  2OIH A;  2A0F B;  1BHN A;  1YI2 S;  1TKD A;  2FB0 A;  3D67 A;  3MED B;  3ZZP A;  4C11 B;  3N5F A;  1RP5 A;  3I5A A;  2BE9 B;  2XY7 A;  2IJN A;  5IQ6 A;  3JAM U;  3TX8 A;  2HPU A;  2FLN A;  1T9T A;  5GAE U;  1NJI T;  2HRY A;  1IKW A;  5HJY A;  1HNX F;  5D8H B;  1TL3 B;  1BWV A;  1X0F A;  5HQ8 A;  4N7T A;  1PIE A;  1NK7 A;  3BO2 A;  4DFK A;  3CC2 S;  3A8J A;  3EGN A;  4BWJ A;  3HSD A;  2Z56 B;  3D54 A;  1S6P A;  5KT3 A;  1IBC B;  2J0W A;  4LR7 A;  2R42 A;  3BQ2 A;  3TI0 A;  1FKA F;  5CYM A;  1IKV B;  2QV6 A;  4F7V A;  3W66 A;  1NK4 A;  2FHJ D;  2K1R B;  3TW0 A;  2P6T A;  2XLI A;  1S48 A;  2A3J A;  1FD2 A;  3TUI C;  2X1F A;  1ZBT A;  4IYQ A;  4OFZ A;  4NZ6 A;  2MDA A;  1D8Y A;  3TA1 A;  4UZC A;  4ECT A;  3W63 A;  2AJ2 A;  1C0U A;  1WHX A;  3LGM A;  2DGS A;  1RHK B;  3CCS S;  5J2Q A;  2DR7 A;  4FF4 A;  1CPZ A;  1KEK A;  2PEH A;  5T41 A;  2FZK B;  4L72 B;  4ECU A;  4RPF A;  3BO3 A;  4DV3 J;  2GAG C;  3CDA A;  3J81 j;  3PNI A;  1WHW A;  4V19 X;  5ETL A;  2MEW A;  4PUO B;  4J9V A;  4CWB A;  1F5B A;  4C3L A;  4JB8 B;  3UDC A;  2F1F A;  4OYI A;  1VHF A;  5CYJ A;  5E3A A;  2ERR A;  2BBE A;  3A8E A;  3SSQ A;  3KLI B;  4ECS A;  4CO2 A;  4EMD A;  3ETO A;  5K8P A;  1HFE L;  4GVL A;  1RTJ A;  5IWA F;  2VG7 A;  4NXN J;  4NLP A;  4ECR A;  1T9W A;  1TEL A;  3JXO A;  3TJ8 A;  3SV3 A;  4OZ3 A;  5J2P A;  2AW0 A;  2HGM A;  3HHK A;  1S1X B;  2VFR A;  4RW9 A;  4C4W A;  4K4S A;  1Q86 T;  4QYR A;  4Y2C A;  2XWY A;  1NDC A;  2Y8Y A;  3FSI A;  3FBF A;  3EVM A;  2BM1 A;  4OIX A;  1BQN A;  5CCM A;  3EGW B;  2XMM A;  5A76 A;  3HFK A;  2E5L F;  4PG5 A;  3MMA B;  1TFY A;  1BE4 A;  3H98 A;  2V4J B;  5IZH A;  1UVJ A;  1IBK F;  2OPR B;  1NK8 A;  2OPS B;  1C4C A;  3GIR A;  2LQ9 A;  2HNY A;  4IG0 B;  1VOM A;  2NR0 A;  3FBB A;  2IRX A;  3Q8U A;  3J80 U;  1QM9 A;  4I2P A;  3AQP A;  5H9F K;  3RR8 A;  4NCG B;  2GZO A;  3MEC B;  1TL1 B;  4DV0 F;  4DL5 A;  1Q78 A;  2MQM A;  4TLR A;  2O5D A;  2QL7 B;  5HP1 B;  1JIH A;  2HZC A;  1CUL B;  4FF1 A;  1OWX A;  2HGN A;  1SH3 A;  1D0E A;  3N9U C;  2OSQ A;  1FFW B;  3I9V 9;  3EUN A;  5IOL A;  1DRZ A;  4KTQ A;  1S79 A;  4OZ2 A;  2ZDO A;  5IFM A;  2B9W A;  3M8Q A;  1HKA A;  2GGP A;  3C3L A;  5JJB A;  2QA1 A;  4M5M A;  2ZNZ A;  2R8K A;  2BAN A;  2RVJ A;  1R0C B;  2PII A;  1QD1 A;  4IQM A;  1VQ9 S;  3QAT A;  1LXJ A;  4EI2 A;  1NB2 A;  4LVN P;  2HVH A;  5K8O A;  3FVY A;  1FRH A;  4FBT A;  1T9Y A;  1X7V A;  4USH A;  4RNN A;  1XQI A;  2J9D A;  3MR7 A;  2D3U A;  2EFQ A;  3G8S A;  1GQE A;  2HS4 A;  3QPI A;  3MM9 B;  4B17 A;  2CJ9 A;  4OV1 A;  2WOM B;  1WSV A;  5KFP A;  2WBR A;  2FLL A;  1EET B;  3C16 B;  3ITH B;  4ZVR B;  3KLG B;  3PEJ A;  3ZZU A;  5D77 A;  1KP6 A;  4OZ0 A;  1X60 A;  1NK5 A;  2W9A A;  3I0S A;  3MFH A;  2RT3 A;  4J9O A;  4G1Q B;  2WB4 A;  3L7O A;  3VAI A;  2IJF A;  3T19 A;  4NA1 A;  2RKI A;  3FSX A;  2YKN A;  3ONQ A;  3SZ2 A;  4RNM A;  2G1H A;  1S6Q A;  4M8L A;  2YKM B;  1LWC B;  2CXE A;  2CVI A;  4EZ6 A;  1NEE A;  2CIM A;  4IFY A;  1S1W A;  1CS4 A;  2DHS A;  2DHH A;  5FD1 A;  3UDE A;  2XS7 A;  3M2R A;  4RO0 A;  3MM5 A;  2HMI B;  5BYR A;  1CLF A;  3THT A;  2GIF A;  1VC0 A;  3IXQ A;  2IYI A;  2E5J A;  4HH0 A;  1AFI A;  2HHQ A;  2XBP A;  1H2T Z;  4NZ0 A;  3C46 A;  3VAH A;  2UUT A;  1JLQ A;  3QZ7 A;  4QW8 A;  2PN6 A;  4LF6 J;  4MK9 A;  1HBU B;  2J6U A;  3SI8 A;  4OI6 A;  1S9E B;  2RML A;  3CWJ A;  1ZA1 B;  3MI7 X;  1Z2Z A;  3B54 A;  3OTO J;  5ETV A;  3UNY A;  1FK9 A;  1W2B R;  2VQF F;  1S1U A;  2XMJ A;  4CLU A;  2VOD A;  3PYF A;  2OEK A;  4PKD B;  1RWP B;  4RW7 A;  2R2S A;  3W5Z A;  3DOM B;  3DRR B;  3I55 S;  2JC0 A;  2VF3 A;  2CJY B;  1PO6 A;  1RT4 A;  4WTY A;  4DXL A;  1E6V A;  2OEL A;  1M5H A;  1WG5 A;  4O23 A;  4OYB A;  3V6K A;  1WNE A;  4DMZ A;  3CJQ A;  5KFX A;  2JEG A;  1X0P A;  5EWE A;  3PYE A;  4I6W A;  5HVG A;  3M32 B;  5KFM A;  4WFN Q;  5K9F A;  2CG4 A;  1CJU A;  3FCV A;  2XMW A;  3QBC A;  4ZPD A;  4NYZ A;  3PW0 A;  2DNY A;  1HBO B;  4LIR A;  3MDF A;  1M1K T;  2QRR A;  2QLX A;  1S9G B;  3CDE A;  2FTR A;  2UUA F;  5KOX A;  3HI9 A;  2AMC B;  3CO0 P;  3KTQ A;  2C42 A;  1N34 J;  3DXS X;  4OZ5 A;  3TA0 A;  3KK1 B;  3NMR A;  3RJM B;  3KK2 B;  3MMC B;  4LF7 F;  3RAX A;  2Q6B A;  4ZP8 A;  4IOC Q;  2CNL B;  2QMU B;  1VRT A;  1FRM A;  1M1H A;  5IT9 U;  2EFO A;  1FKP A;  3JQM A;  4G1I A;  4RUA A;  3MOJ B;  1U2F A;  4LIW A;  2MB0 B;  1WI8 A;  5D0E A;  1PSD A;  4OX7 A;  3RB0 A;  5JVH Q;  3H5X A;  4NRU A;  2RQC A;  1B0P A;  4LRB A;  4GRS A;  2PD1 A;  1FVQ A;  3ZTO A;  2XQC A;  1HHS A;  2BRL A;  3H25 A;  4TN2 A;  1T94 A;  4OI1 A;  1RUS A;  1RWO B;  5IM0 B;  4CLP A;  3NCR A;  1NAQ A;  4QIW D;  1HQE B;  2IAJ A;  4DR6 F;  1G1X A;  4I56 A;  3UFC X;  1UP1 A;  3R2D J;  4PRF A;  4J9M A;  1Q53 A;  4DPU A;  2UP1 A;  4LVO P;  4PQA A;  1DZ5 A;  2Z8Q A;  4X4R A;  3NMA A;  3KJV B;  1CJT A;  1H7W A;  3KYL A;  3QSY B;  2R7U A;  2V2K A;  3NS5 A;  3EIC A;  3VAJ A;  4J9R A;  4B3R J;  3IRX B;  4FXW A;  4F4A A;  1J5O A;  1FDA A;  3RG6 A;  3NOG A;  4C0H A;  2XS5 A;  3O6Q A;  3M8S A;  3ENV A;  1SC1 B;  1EJ7 L;  3CTR A;  2GV1 A;  1HI8 A;  5HRO A;  3B78 A;  3H7H B;  1OMS A;  4IDK B;  1CQM A;  1RHQ B;  3PW4 A;  3T1H J;  4OZN A;  3Q24 A;  3KK3 A;  3JSY A;  3ZC4 A;  2CZ4 A;  4K2X A;  4P2M A;  2CQ0 A;  5L1K A;  1M0S A;  5ITH A;  4QIE A;  3WC0 A;  4J5O A;  4RNO A;  2ZBI A;  2DTJ A;  1U0S A;  4WXO A;  3O2I A;  5IT4 A;  1CEZ A;  1FJG F;  4RBU A;  3UN5 A;  3D0H E;  4NLV A;  3CDU A;  1UWA A;  1IKX B;  3H0P A;  1BQX A;  3GFX A;  3EVO A;  5LT5 A;  2CNN B;  1UPP A;  5KFL A;  4LF2 A;  4H4O A;  1VLY A;  4YR2 A;  2VG5 B;  1GH8 A;  3M8P B;  4MKB A;  1UZD A;  3BH6 B;  1ZH5 A;  5DQI A;  3CD0 A;  1MWQ A;  3EGV A;  3DLL Q;  4ZPW R;  1D3W A;  1RWM B;  1EAY C;  3B4D A;  5CHC B;  1SUQ B;  1KON A;  3HXM A;  3DLE B;  1OO0 B;  4G65 A;  5L8R C;  1JLB A;  2MZ1 A;  4QBU A;  2HHV A;  2HWI A;  4EYH B;  1HLW A;  1S59 A;  5B0F A;  3A12 A;  1DTQ A;  4KSE B;  3HT3 A;  1HI0 P;  1NPK A;  4KAI A;  2ZH6 A;  3GR0 A;  4ZVS B;  2XCA A;  4PAA A;  4KV8 B;  4ECV A;  1RB0 A;  2AU0 A;  4ETX A;  1PC5 A;  3SQO P;  5F8N A;  3IFE A;  3BKU A;  3OFG A;  4A47 A;  4AUK A;  2W7O A;  3VGS A;  2UU9 F;  4QWC A;  1HA1 A;  2VHG A;  4XDC A;  4K0K J;  2ZH5 A;  3PXG a;  2ZE2 B;  2R7Q A;  4ZP6 A;  2XY6 A;  1DQA A;  1LQ9 A;  3HSG A;  4HI1 A;  4JI5 J;  4J91 A;  4C48 A;  3Q89 A;  5M2R A;  1IBL F;  4DPX A;  1VC6 A;  1Q82 T;  4J9S A;  4XO0 A;  1T3N A;  1VIX A;  4PQU A;  3OFF A;  1B3T A;  2LQJ A;  1IBM F;  2D74 B;  2DGX A;  1X4E A;  3MOZ A;  5L1J A;  2V68 A;  3F56 A;  2WW8 A;  1RTH A;  2ZD1 B;  2WZ1 A;  1FRI A;  1WWH A;  4BC7 A;  4PWD A;  3TYT A;  3P6Y C;  4URS A;  2QZ8 A;  2AJF E;  3A8K A;  3W5X A;  1XMQ F;  3IM8 A;  1FKO B;  2BOA A;  3L3C A;  3PKY A;  4DPW A;  2XNR A;  3ENW A;  2DNO A;  1LOU A;  1SH2 A;  5KFO A;  2IDE A;  3LW5 C;  1UEK A;  2XSJ B;  3TEG A;  3KJQ B;  3K2Y A;  4M5D B;  4K8R A;  4YB1 P;  4HTI A;  4RW4 B;  2WRM A;  4YY3 J;  2M4M A;  1EB0 A;  4R5P B;  5F9L A;  2YPZ A;  2HSE B;  5LMN F;  2V94 A;  2FJW A;  2E1R A;  4FXV A;  2AYG A;  4X64 J;  2C2M B;  3PW2 A;  3AJD A;  2LA6 A;  2Z2Z A;  3IA0 A;  3RBX A;  1VRU B;  2V9K A;  1F5A A;  4DFM A;  2W9C A;  2HBY B;  2W4C A;  1SKR A;  2M70 A;  1JJ2 R;  3B82 A;  5FDL B;  2YX1 A;  2OPQ B;  1U1Q A;  9ATC B;  2HGL A;  3OR2 A;  1RAH B;  2AGQ A;  1NK6 A;  1YG0 A;  4CYU A;  3R27 A;  2FY8 A;  3CPW R;  1TUG B;  3A1Y G;  4OHV A;  3HHL A;  2LMI A;  2VKR A;  4HAC B;  5DM6 Q;  2RUS A;  3OUY A;  3V5R A;  4KPC A;  4ZCI A;  3D1Q A;  1H72 C;  4DR2 J;  2ZH2 A;  1RT5 A;  3E01 B;  5LSR A;  1YIT S;  3GV7 B;  1JLA B;  2DCU B;  1NK0 A;  5KFK A;  1G6B A;  2D9O A;  3CMA S;  4TU8 A;  3K89 A;  4LSL B;  2BE7 D;  3R7N B;  3DOL A;  2RHQ B;  3KJF B;  2CUY A;  1SKS A;  1TKZ A;  5FLX Y;  2QLW A;  2HFO A;  4PXB A;  3UDL A;  1RT1 A;  1L3V A;  3HSZ A;  2XO6 A;  2UXC J;  2FDN A;  1YZ6 A;  1T7P A;  3CCW A;  4YUD A;  2JX2 A;  3BGU A;  4M94 A;  4DV3 F;  2ZNY A;  3DKD A;  3GV5 B;  3GR1 A;  4DX6 A;  1REV A;  1UEV A;  5IT0 A;  3QGI A;  4UF4 A;  2OTJ S;  1YJN S;  4QCL A;  3DRP B;  2RQM A;  5J1E A;  3BN7 A;  4EK2 A;  2RQK A;  3CGI A;  1KQG B;  2IVF B;  3H40 A;  2RSQ A;  4M5G A;  2QLF B;  2MY8 A;  2UUW A;  2R8H A;  2V69 A;  2ZWO A;  2XWX A;  3CVK A;  1SIW B;  2D3O R;  2W9B B;  3FC9 A;  2HRT A;  4QWE A;  3UI3 A;  4FF2 A;  2D41 A;  3OR1 B;  2BX6 A;  3HMJ G;  1S0M A;  1R0B G;  9RUB A;  3HVT B;  1FDB A;  1X4F A;  3HCX A;  4TKT A;  2F4F A;  4I6Y A;  5D0G A;  3R6G B;  5E3Q A;  4DV5 J;  2DO4 A;  1JQG A;  4L6V 3;  2M8D B;  3BSN A;  4KR0 B;  5DG8 A;  1U4B A;  2CQC A;  1TK0 A;  2OI2 A;  1Y10 A;  2JSX A;  1V5I B;  5AE2 A;  1J2V A;  5DDP C;  4USI A;  4JI0 J;  1RTD B;  3MM8 A;  3QLH A;  3KLE B;  1CJV A;  2XM3 A;  2ZHA A;  3GJS B;  5CQG A;  1ULR A;  2UV8 A;  5ETO A;  4C11 A;  3X1L B;  1RT6 B;  1C0T A;  3BDE A;  1XR6 A;  3GE9 A;  4YDD B;  1OSC A;  3POT A;  2PMZ D;  1RDR A;  1Q8I A;  4Q2L A;  3W62 A;  2CQ2 A;  1U6F A;  4KB7 A;  3N6N A;  3SV4 A;  1WOP A;  3MM6 B;  1D1U A;  3QRQ A;  3W60 A;  1NCL A;  2OML A;  3GON A;  5LSL A;  3N6M A;  1Y5N B;  1LWE B;  3EYZ A;  2XYP B;  2HZV A;  3LP2 B;  5E5N A;  1VLO A;  4YS2 A;  3ZO7 A;  2IVY A;  2AHO B;  5DG9 A;  2ALZ A;  1RT7 A;  1DQ8 A;  3GIM A;  4A8K A;  4ALZ A;  5CCL A;  4C8Z A;  1L5U A;  3CUN A;  4FP9 A;  5KFH A;  5D3G A;  3M6U A;  4EBC A;  3QJL A;  4FYW B;  1YDL A;  1QAJ A;  2BE2 B;  2MGZ B;  4DU7 A;  4IH7 A;  1D9A A;  5HL7 Q;  3FNN A;  4A8X A;  1IKY B;  5ETP A;  3I0R B;  3DHW C;  3K58 A;  5DDQ C;  4DL4 A;  3UD5 A;  2CQI A;  3EPI A;  2KYX A;  1QSL A;  1WKJ A;  2M88 A;  4B9L A;  3KMS A;  2DJW A;  2E44 A;  1OPI A;  4AE5 A;  5T7L A;  1DJ0 A;  1WEZ A;  1QE1 A;  2B7B B;  3DFE A;  4WTO B;  3KDO A;  5HK4 A;  5A6P A;  2B8Q A;  1QVG R;  1R6V A;  3JB9 k;  4WKR A;  2IIH A;  4QIV A;  4TY9 A;  3H5Y A;  4Q43 A;  4DL6 A;  4ZDN A;  3VWS A;  4H4M A;  4LFB J;  1WAC A;  4IFV B;  3EVW A;  2RAQ A;  1PAU B;  1YRU A;  5IC4 B;  5ETN A;  1FRX A;  3HPO A;  3MWB A;  1D9F A;  3B8H A;  4DX8 H;  5DDR C;  3M05 A;  1S1X A;  4WCE Q;  2DNK A;  1L3S A;  4OX8 A;  1DLO A;  4DU8 A;  1Q1K A;  3TVY A;  4KKO A;  4B9S A;  2DHG A;  3BJY A;  4C0B A;  4FXD A;  5C7P A;  2RD5 C;  3AA9 A;  3FZB A;  3TUJ C;  4WFY A;  5A2Q Y;  1KSP A;  1HQU B;  1XN9 A;  3PW7 A;  2CPD A;  4GVB A;  4KO0 A;  4ZN1 A;  1T02 A;  2YXL A;  3HFV A;  2OPS A;  2Y1L B;  4DPT A;  2QX0 A;  1B7F A;  2LQ5 A;  3NOC A;  1QY7 A;  1JLF A;  1XNQ J;  1GAO A;  2VU5 A;  2AGO A;  1N32 J;  1NME B;  4ECZ A;  2ROG A;  3W61 A;  3T6B A;  4LF6 F;  5KFT A;  5L46 A;  4MK8 A;  3ENQ A;  3OTO F;  5C42 B;  3TA2 A;  3GG1 A;  4U9R A;  4DV1 J;  2QLB B;  5HP1 A;  2DHX A;  1MNE A;  2C2E A;  2BV3 A;  1HNZ J;  2KI2 A;  4ZVQ B;  2MKK A;  4ZLP A;  1K8A T;  2UUB J;  3GIL A;  3WX8 A;  2HFV A;  4WII A;  3BH7 B;  3GPA A;  4ELU A;  1QVF R;  4ZJL A;  1QDU B;  3FEY B;  4XAK A;  4NLQ A;  5K8M A;  5G0R A;  2ACY A;  4ED2 A;  3D28 A;  1XEZ A;  2OAU A;  3V6J A;  5H9E J;  5AE1 A;  4KHP J;  1FJE B;  1U2C A;  1T95 A;  4EBD A;  2KXN B;  2KT2 A;  1LK5 A;  2V4Q A;  2DCL A;  3NY0 A;  1F6T A;  3OLA A;  3LAL A;  2Y1J A;  1GXL A;  4U8Y A;  5KFY A;  4WP3 A;  4EFA C;  2B9X A;  3H2U B;  3QO9 A;  5IV3 A;  4QWA A;  3DLJ A;  4DEZ A;  4JI8 J;  4R8U B;  1NBE B;  4NI2 B;  1UL3 A;  3RBZ A;  2GJ2 A;  2PGC A;  2W2O P;  1GTH A;  2R4F A;  4NA3 A;  5EX3 A;  1KS2 A;  3O8W A;  1BY9 A;  1LK7 A;  4CLS A;  1FDN A;  3C16 A;  1N34 F;  3PYD A;  3MHY A;  3HKZ D;  4DS5 A;  2W1B A;  3IGN A;  3LH2 S;  1VFJ A;  3DDK A;  4FKY A;  2CPY A;  4Y34 A;  1NUE A;  1XNR J;  4GO5 X;  2GQC A;  1AYE A;  3KJN B;  4P2X A;  2ASL A;  2KVI A;  4PXC A;  2HWT A;  3ILO A;  1M90 T;  3CIM A;  2ASY A;  4NX9 A;  2BJ8 A;  4WP8 A;  2J9E A;  1WC4 A;  2J0S D;  5KFE A;  2QIF A;  2QMX A;  2H65 B;  5B0B A;  3WDO A;  4IOB A;  1AUD A;  3BPS P;  3T5K A;  4LSZ B;  1AXQ A;  2MKH A;  4F0K A;  1R89 A;  5KAK A;  1JKH B;  2ZKU A;  3OL8 A;  1APS A;  1URN A;  3LP1 B;  5KFZ A;  3CSK A;  2GFF A;  3LQV A;  2AGP A;  3CC4 S;  1SV5 B;  2RUG A;  4P71 A;  1CJK B;  2PA8 D;  3U1N A;  1KNZ A;  5KG3 A;  3SCJ E;  2JFD A;  3I4H X;  4LUB A;  3SSR A;  1HBU A;  3AB2 B;  1LKZ A;  5J1N A;  4OYW A;  1YVF A;  3D6H B;  2L08 A;  5JVG Q;  1YJ9 S;  1NLK L;  1FE0 A;  3DM2 B;  1FRL A;  5CD4 A;  5KG0 A;  4D3H A;  3TAP A;  3T3F A;  4B3R F;  1U1P A;  3M2U B;  3CCT A;  2PMW A;  4X66 J;  4Q0B B;  3TO8 A;  1U24 A;  3PHE A;  2G1D A;  3T1A A;  1HMV B;  3Q23 A;  1HI1 A;  3DRR A;  1GXT A;  1R31 A;  2OP5 A;  2B4U A;  4MJK A;  3FBE A;  1QAI A;  2W25 A;  3T1H F;  4EO8 A;  2UVV A;  4LJM A;  2M0G B;  4IQX A;  3UVJ A;  3OPK A;  1VQ6 S;  1HBM A;  2W4D A;  1O6X A;  1N8R T;  3PG9 A;  1DTT A;  2UVU A;  1N0V C;  3O5T B;  2BUN A;  1NH7 A;  4DQP A;  4A8Q A;  2PT0 A;  2NSB A;  2EKY A;  1UCN A;  2BXJ A;  3DHX A;  3TNV A;  3OXF A;  5KG7 A;  1S1V B;  4DL0 C;  2QYC A;  2WTF A;  1REG X;  1RWX B;  5KFF A;  3CJT A;  1V3S A;  3R7S B;  3BSC A;  3PRV A;  4ZIW A;  1U0H A;  3QT7 A;  3CJ0 A;  1KTV A;  4IUF A;  3CJ5 A;  1M1G A;  4IR9 A;  1TFW A;  4UY8 T;  5C2G A;  4U8V A;  4LMZ A;  1EHW A;  4ZPV R;  2ZH1 A;  3W8G A;  3I56 S;  5BXI A;  1GX6 A;  3MMC A;  1G7C B;  3KMQ A;  4ZLN A;  3JYT B;  2POK A;  1H7X A;  4A8F A;  3VGV A;  3NGR A;  5HSP A;  3VGU A;  5ETT A;  3PIO Q;  2DNH A;  2ZC3 A;  3FBC A;  5L39 A;  4K4Z A;  2OPP A;  2KM8 C;  2Z2M A;  2I38 A;  4ED4 A;  1JLC A;  2EBG A;  5F8G A;  1Y00 A;  3RYL A;  3GFH A;  2LU2 A;  1F5C A;  4WFA Q;  1IM4 A;  3PYG A;  3H2L A;  4JI4 J;  2KN4 A;  3LWM A;  1G3O A;  3US5 A;  3ET6 B;  3QID A;  5DS7 A;  5A6W A;  4K0K F;  4OHX A;  4BWM A;  2F8M A;  2XYH B;  5A8W B;  4JI5 F;  2B5J B;  4LR9 A;  5B0E A;  2KT3 A;  3A3P B;  5GAG I;  4LR8 A;  3JSM B;  4LF8 J;  3O3L A;  3D6T B;  2QGF B;  4O0I A;  2DXD A;  3FGV A;  3M2V A;  3HM9 A;  4ILL A;  2IM2 A;  3MR5 A;  1RBO B;  3NLC A;  1N6Q A;  5LJ5 Y;  1DAR A;  4DI6 A;  2F8H A;  4ZPT R;  3J7A N;  2DK2 A;  4LFA J;  1C4A A;  2RS8 A;  1TZ0 A;  1YRT A;  1T8E A;  4KGK A;  3IP0 A;  2B4V A;  2AJQ A;  3GYN A;  1R8C A;  4G1P A;  2JFK A;  3M9O B;  3IG1 B;  5B7W A;  3Q2T C;  4AL6 A;  1KQK A;  2VPZ B;  4J37 A;  2YQ0 A;  1TAU A;  1H38 A;  1A0O B;  4FYY B;  3SDE B;  1PIL A;  4YY3 F;  2N3O A;  5K14 A;  1RHJ B;  5KT5 A;  5LM7 E;  1OSD A;  1P8G A;  2XTJ P;  4MK7 A;  4ECY A;  3VZI A;  1HWK A;  4K5S A;  3MMB B;  3M8P A;  2MXY A;  4Q5V A;  3VVU A;  2R7O A;  3MD3 A;  4X64 F;  2CPX A;  2EK6 A;  1XMO F;  1HHT P;  3UWT A;  3SCI E;  2MYF A;  3FMB A;  1XER A;  3VV2 B;  5A8R B;  2CQD A;  2R7R A;  1YGY A;  1JJC B;  4U6P A;  2DR6 A;  1CG2 A;  2JVO A;  1DBD A;  2NZC A;  1FD8 A;  4P74 A;  2AKW B;  4ICL A;  4A8M P;  3VAF A;  1I94 J;  2KJW A;  4IG3 B;  4USK A;  2C1E B;  2VBX A;  5LXY A;  3FDS A;  5BJR A;  4Y6I A;  1V9O A;  2GMH A;  2X1B A;  4DUT A;  1S6U A;  2MLY A;  3DOK B;  3QMQ A;  3NCQ A;  2B3T B;  4A8O A;  3UD3 P;  4CTA A;  2SXL A;  2VV5 A;  3RRH A;  4C0O C;  5DG7 A;  3C66 A;  1J5E J;  5E2Q A;  1NND A;  5U47 A;  5IQQ A;  1VCT A;  3DDI A;  1NU4 A;  4PG4 A;  4F3M A;  4FS2 A;  4MIB A;  1FTR A;  4DR3 J;  4F2R A;  3HSJ A;  4DR2 F;  1EX8 A;  2PEB A;  1SC4 B;  3BBB A;  3FFI B;  5ETR A;  3TRG A;  3J7Z 5;  4O0N A;  2M3D A;  2VG6 A;  4F3Q A;  4OYA A;  3NXZ A;  1VC5 A;  4XPE A;  4K2J A;  2F8E X;  2ZE2 A;  5LJ3 Y;  2R2R A;  2VQE J;  2XMU A;  1JXL A;  2HFN A;  4B3S J;  2DGT A;  1UA1 A;  2KL8 A;  1R8H A;  2UXC F;  4F67 A;  3KLF A;  2C2O B;  1PBA A;  2MQL A;  2WVF A;  4ZPC A;  1U26 A;  3PX6 A;  1YTY A;  3BKF A;  1LW0 A;  4FNI A;  5KFQ A;  2ZIT A;  2Y0B B;  4NLR A;  6AT1 B;  4AT1 B;  3IS9 A;  3Q8V A;  1EP4 B;  4ATN A;  3MGJ A;  1RWV B;  3CDB A;  1ZZF A;  3NWR A;  3Q0A A;  3NBP B;  1YZ7 A;  3DLK A;  4Z37 A;  4PR6 A;  1JMT A;  5L9X A;  4MFB B;  5A8K A;  2JWN A;  4YR0 A;  3K5M A;  5J2N A;  1VI7 A;  1KC8 T;  2KU7 A;  3W9H A;  3FZ2 A;  1EZZ B;  2FVR A;  1N33 J;  4B08 A;  2HHT A;  3Q2S C;  4UZB A;  4O4G A;  1VQM S;  1MMD A;  2ZJR Q;  4DV5 F;  4R5P A;  1RT3 B;  4KHM A;  4ZS6 A;  1P27 B;  3BYR A;  2GCF A;  2C3U A;  2ZZT A;  4DUZ J;  1P1T A;  2P9C A;  3CNQ P;  2HKE A;  2IVM A;  4JP8 A;  1VRQ C;  1CBK A;  4JI0 F;  1TKT B;  2RF2 B;  1NB7 A;  2KZZ A;  4K4T A;  4ZMM A;  4F4Z A;  1FX4 A;  4LRA A;  3KHG A;  3M30 A;  4RNH A;  3W2V B;  5T14 A;  3TOQ A;  1HW8 A;  1HBN A;  4LFC J;  2LA4 A;  4QR2 A;  1VBY A;  3AHP A;  5EHH A;  4RU2 A;  4HVZ A;  2CG8 A;  5FDL A;  1CC8 A;  1HNW J;  5F8H A;  2VUG A;  3C15 B;  1SCJ B;  2VJV A;  4DUY J;  5C5J A;  4F4Y A;  1N56 A;  2K06 A;  1OPZ A;  1C2P A;  3D66 A;  2NYH A;  4MIW A;  2UXD J;  2X51 A;  1FCA A;  4PPZ A;  3R5D A;  4MIA A;  2WON A;  3CDW A;  2GJI A;  3IRW P;  4CO0 A;  1VJW A;  4YR3 A;  3HZG A;  2PE8 A;  2GMJ A;  1JNR B;  1S1T B;  4KRW A;  2X7I A;  2CYY A;  2I0X A;  3E01 A;  2ACM A;  1QUV A;  3ADA C;  1RIS A;  3R5B A;  3TAQ A;  4QR0 A;  1NHU A;  1N36 J;  5FLX U;  1V6H A;  1VQN S;  2WK4 A;  1BUX A;  4G6V B;  2VFU A;  2OEM A;  4X4T A;  1ZOT A;  4DQI A;  4FF3 A;  3J81 U;  1BC6 A;  1OYD A;  4KGV B;  1HNI A;  4MMO A;  5L1L A;  5KFV A;  3CCZ A;  5IXU A;  2X1G A;  3AJ2 A;  5HVH A;  3MAA B;  3G6E S;  1KKH A;  5HBM A;  1WF2 A;  1UPM B;  4USU A;  5BYQ A;  3VZH A;  4DJB A;  1WC6 A;  3ZTR A;  5I42 B;  2KYZ A;  2DR5 A;  1NKE A;  4N8N A;  2QA4 S;  1ZM9 A;  1BQM A;  2R8J A;  2V63 A;  4X2B A;  7AT1 B;  2BR0 A;  2CVE A;  4LFB F;  4DQS A;  2BJ1 A;  5D4P A;  5CD4 H;  1NZA A;  4FDF A;  4ZCK A;  4JBC A;  1S4F A;  4NEZ A;  3GYG A;  3HJF A;  2DNZ A;  4CH1 A;  1URR A;  2ZBQ A;  1FRJ A;  3G82 A;  4WU3 A;  5DZ7 A;  4I2Q B;  4RR5 A;  5DRK A;  1NKC A;  4WK1 A;  4X4O A;  4DPY A;  2E9Z A;  1K0V A;  5KG1 A;  3EZU A;  4WZM A;  2EVZ A;  2LCW A;  2FPH X;  1BMQ B;  5D78 A;  1AZS B;  1OIA A;  2GVZ B;  2DBB A;  3RZA A;  5I3U B;  2NUH A;  1Q81 T;  3SSS A;  3RAQ A;  3RRG A;  3L7U A;  3FRZ A;  4F26 A;  1RAG B;  3V4M A;  3F73 A;  4ES2 A;  3TQ1 A;  3RW6 A;  5EGY A;  1XBW A;  4RUB A;  1OQ3 A;  1VK8 A;  4W4M A;  2ZBC A;  3KDN A;  1YBU A;  3MF5 A;  4RW8 A;  2HND B;  4O3O A;  2WB1 D;  5JMN A;  1MML A;  2XUL A;  3HJV A;  1N32 F;  1ZS6 A;  8AT1 B;  5SUH A;  1ARO P;  2OFH X;  4KYZ A;  4I6A A;  4DSJ A;  2V34 A;  2V8G A;  4ZCM A;  2IMW P;  4UW2 A;  5F8L A;  1QAY A;  1DFD A;  4WPA A;  4DV1 F;  2J76 E;  3G6Y A;  1WOR A;  3H2V E;  2E9T A;  2E1A A;  3SCL E;  3M1V B;  2FUG 9;  1HNZ F;  2WSE C;  4ECW A;  4P2S A;  4OQJ A;  2GHW A;  3LP0 B;  1Q0N A;  3CME S;  2UUB F;  1RWU A;  1IKW B;  2AD9 A;  3UR0 A;  1YBT A;  1WKK A;  3DC2 A;  4ZOS A;  3HVW A;  4OHZ A;  5DET A;  2NPI A;  1HWJ A;  5K20 B;  4CH7 A;  2CPZ A;  3P96 A;  4F8R A;  1IKY A;  4KHP F;  4OZ1 A;  3PR5 B;  1IWA A;  3OJS A;  2YY3 A;  2DGU A;  1S6P B;  2CJK A;  4CNZ A;  4DCP B;  3CF5 Q;  3BF4 A;  2FD2 A;  5CYM B;  1B70 B;  2B9Y A;  1VBZ A;  2R3V A;  3C6U A;  1X5O A;  4JI8 F;  4UUW A;  1WC1 A;  1KR4 A;  5A0Y A;  3IBW A;  5I4M A;  3OL7 A;  4DV4 J;  1YQH A;  4K4V A;  2A10 A;  4F4K A;  2E7X A;  1YKW A;  2ASD A;  1C0U B;  2HHP A;  1ZA2 B;  3QT8 A;  4PG7 A;  3MPV A;  4YEA A;  4AL7 A;  5J2Q B;  3AB4 B;  1N5Y A;  1XNR F;  1S49 A;  3M6X A;  1QAX A;  3T6J A;  3MEG A;  3BKT A;  4DR1 J;  4TLQ A;  4CNY A;  2I5J B;  4NWB A;  1TTH B;  4DR5 J;  2NCK L;  3PFO A;  4ID5 A;  3D5M A;  4K4Y A;  1TKX A;  1FWK A;  2FJA B;  4QPX A;  2FY1 A;  2J0Q D;  4F36 A;  2X1A A;  2R7S A;  1UFW A;  4X4U A;  2NS1 B;  1ZET A;  4OV6 A;  2HHU A;  5HAN A;  1RTJ B;  2QL9 B;  2W2M P;  2AX1 A;  3SQG A;  4AXJ A;  4F2S A;  3AFG A;  2DGV A;  3QYY A;  1B0V A;  2FYX A;  2H1Y A;  2W2P P;  4LQ9 A;  4ZCL A;  5J2P B;  1YWX A;  1RKJ A;  3AT1 B;  4DHV A;  4RW9 B;  1YJV A;  3PHT A;  1Q79 A;  4N41 A;  3NS7 B;  1UA0 A;  2LVW A;  3K8V A;  1BQN B;  2HFU A;  5M2P A;  5F41 A;  3G87 A;  5M2U A;  2KG0 A;  3VHQ A;  3V81 A;  4QIG A;  1WOS A;  3N01 A;  5E41 A;  2DXF A;  4NLD A;  4HYK A;  2DNP A;  4X66 F;  3R1H A;  3W1Y C;  1Q8K A;  3BGL A;  1LWF A;  2G0C A;  3C19 A;  1KLN A;  1C1C B;  1YRX A;  2HAI A;  3C6T A;  4Q8F A;  2G0I A;  3LPE A;  2DIS A;  4E8U A;  2YWW A;  1PJ6 A;  4QWD A;  2XCP A;  2W2Q P;  4I2P B;  2VZ9 A;  1SI9 A;  1C1B B;  1RAI B;  3ZNJ 1;  3HD1 A;  2VJU A;  3I82 A;  2CQG A;  3CJ2 A;  3J80 Y;  1NXI A;  3LF0 A;  4Q44 A;  3E8O A;  3C8Y A;  1NPR A;  3TAM B;  3IWN C;  1RWW B;  2XS2 A;  3AA8 A;  2C2Z B;  4BLG A;  1Q5V A;  1U8S A;  2W2N P;  2F63 A;  1RAF B;  2X3D A;  3DYA B;  2BAB A;  3IAM 9;  2ZJQ Q;  4JV2 A;  3M8Q B;  3G4S S;  1UVI A;  2GGP B;  4FS1 A;  2N4D A;  3BQ1 A;  1P1L A;  2HLT A;  2OGU A;  2Y8W A;  2BAN B;  1WF0 A;  2FGC A;  3P5B P;  1WD6 A;  2J5A A;  1SKU B;  4KY3 A;  3I5B A;  4JI3 J;  5CA5 A;  2IRY A;  3NGS A;  4DX5 A;  4QYZ J;  2J9C A;  3L9Z A;  1IQZ A;  2P9G A;  4AYB D;  1PYT A;  2J7W A;  5HMW A;  2DRA A;  2HHS A;  2IDL A;  2HVI A;  3J7A 1;  4NML A;  2H5I B;  3MCN A;  1NSA A;  3JTN A;  4J90 A;  5IC6 B;  4C8N A;  1TL5 A;  1QLN A;  1SH0 A;  2H3E B;  4JI4 F;  2DVI A;  3I0S B;  1Q95 G;  5ETK A;  1XR5 A;  2Q6C A;  4C2M A;  3OBI A;  2P6S A;  3P49 B;  2B6A A;  1R6Y A;  2JH3 A;  2Z2L A;  3CXC R;  4MKA A;  2P5V A;  1GXU A;  2RKI B;  1RE1 B;  4A8S A;  2H48 B;  5L1I A;  4LF8 F;  1SJ1 A;  3AY0 A;  1S6Q B;  3I32 A;  1JLG A;  4OI2 A;  3DLG A;  2V0N A;  3U1L A;  1S1W B;  1CS4 B;  5CZX A;  1FHT A;  4DR7 J;  1S5Z A;  3K5P A;  5KFN A;  3M2R B;  4M63 A;  3MM5 B;  5G4D A;  4J9P A;  4WFB Q;  3BS9 A;  4CO4 A;  2DNQ A;  2OLW A;  4Q0B A;  2IPO B;  2YNI A;  4LFA F;  3W5Y A;  4DF8 A;  5L9N A;  4NCB A;  1KRP A;  3F0N A;  4B3M J;  2HK3 A;  1RA7 A;  1R8B A;  4ZVP B;  5KT2 A;  6FD1 A;  1JLQ B;  3R6L B;  2QN6 B;  3TX0 A;  2ROE A;  5GAH U;  3G86 A;  4OLO A;  2AIR B;  2BOP A;  2ZFH A;  4USM A;  4FBU A;  4ZHR A;  3EXC X;  2CNK B;  2BJ3 A;  3ZZR A;  1FK9 B;  2EG2 A;  4MYU A;  2IC3 A;  5DLG A;  2XC9 A;  2LP4 A;  2DKO B;  5AJ3 J;  1S1U B;  4B9U A;  5LMU J;  2WHO A;  1RZM A;  3OFH A;  4RW7 B;  3EE3 A;  4HDG A;  4UT4 A;  4BDP A;  2NPF A;  1S1V A;  3KKF A;  1L3U A;  1M5V C;  1RT4 B;  2OHD A;  3AXK A;  4DSI A;  2GIR A;  1E6V B;  4AL5 A;  2D1C A;  2KM8 B;  3M4X A;  2V50 A;  2ZEJ A;  5D0R A;  2F9D A;  2QA4 G;  2YQ1 A;  2RNE A;  4RZR A;  2NLW A;  4LF5 J;  4ZVF A;  4C9D A;  4TU9 A;  2ZWP A;  2J7U A;  3D9B A;  1WEY A;  1I94 F;  4WU2 A;  3TAN A;  3Q83 A;  3HT0 A;  3JYT A;  1XC9 A;  5IV4 A;  1FO1 A;  1NO8 A;  4DWI A;  1SJ3 P;  3QJP A;  2LXI A;  3IGV A;  3MMJ A;  2Q43 A;  3I6P A;  4JOU A;  2J8A A;  3PRB A;  1J5E F;  4RU9 A;  2VBY A;  1HD0 A;  3I87 A;  5RUB A;  2GML A;  3T9N A;  4DR3 F;  2CPF A;  3UCG A;  4GKJ F;  1PGZ A;  2VFV A;  2JLG A;  1KOO A;  4H4K A;  2IBK A;  3UR3 C;  2FVQ A;  2CPI A;  3GG0 A;  3T5H A;  3DDN A;  2RJZ A;  1ZYQ A;  1Z2L A;  4C7Q A;  5MLC V;  1VRT B;  3A4T A;  1F3F A;  3UE2 A;  3CB4 A;  5THW A;  1MLA A;  4NLW A;  4B3S F;  5CYQ B;  1FKP B;  5F9N A;  3OXG A;  2XO7 A;  5D4L A;  3DRY A;  4DLG A;  4O44 A;  1R0A A;  3MUT P;  2XGP A;  1TUV A;  1X4C A;  1MU2 A;  3Q8Q B;  1ZAX A;  2AP6 A;  3OSP A;  3HKW A;  4CO1 A;  5KFD A;  1WDD A;  2YWK A;  1RCX B;  4GKK J;  1RXO B;  3D7S B;  2IAJ B;  2PI5 A;  3SFG A;  1GT8 A;  2DH7 A;  2L9W A;  2V4R A;  3HF5 A;  1FJ7 A;  2O66 A;  5LOQ A;  4CT8 A;  1NDP A;  3HVA A;  1UKU A;  3FCH A;  2YPY A;  1N33 F;  1CJT B;  3OTB A;  1KD1 T;  1HPZ A;  2VB6 A;  1H98 A;  1VMB A;  4ITS A;  1B64 A;  2H5E A;  1VQ8 S;  1TP7 A;  2VQF J;  3JS9 A;  2J6T A;  3GJQ B;  2MST A;  4DUZ F;  4I7F A;  1WC0 A;  1J5O B;  4HTJ A;  3PJ9 A;  4NAS A;  2A2D A;  1W7W A;  3WZ0 A;  7FDR A;  2VIH A;  2G9O A;  5HRO B;  1HNV A;  4DS4 A;  3TZZ A;  1H74 A;  3PAC A;  3CCL S;  1R43 A;  3BDP A;  2CAD A;  5I3P A;  1RGV A;  3RB4 A;  4ZVU B;  2KFN A;  4U96 A;  1KVJ A;  3TJA A; 
#chains in the Genus database with same CATH homology
 4PZV A;  1CBK A;  4M5K A;  4M5G A;  1RAO A;  5ETR A;  3MCN A;  1F9H A;  3HSD A;  4M5J A;  4F7V A;  3HT0 A;  3ILO A;  4CYU A;  5ETQ A;  1HQ2 A;  2BMB A;  2F65 A;  3QBC A;  4M5H A;  1KBR A;  5ETS A;  5ETN A;  3UDV A;  3HD1 A;  1Q0N A;  1RB0 A;  3KUH A;  4CYU B;  2F63 A;  1DY3 A;  3IP0 A;  1G4C A;  4M5L A;  1RU2 A;  1TMJ A;  5ETP A;  4AD6 A;  5ETM A;  3UDE A;  1TMM A;  4CRJ A;  3MCO A;  3HCX A;  1HKA A;  1RU1 A;  2CG8 A;  3HSJ A;  3ILL A;  5ETO A;  3MCM A;  1EX8 A;  4M5I A;  1IM6 A;  3KUE A;  2QX0 A;  4M5M A;  5ETL A;  5ETT A;  5ETK A;  3UD5 A;  3ILJ A;  4CWB A;  3ILI A;  1EQM A;  1RTZ A;  3HD2 A;  1EQ0 A;  3HSG A;  3HSZ A;  3KUG A;  5ETV A;  4M5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...