2F65A

Solution structure of hppk in complex with inhibitor analog ampcpp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of HPPK in complex with inhibitor analog AMPCPP
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
total genus 18
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2005-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 2f65A00
5ETQA 2F63A 1EQMA 2F65A 1HQ2A 2BMBA 3HSGA 3ILOA 3MCMA 4CYUA 1RAOA 3KUEA 1F9HA 4M5JA 1KBRA 4CWBA 5ETLA 1RTZA 3HD2A 3HSDA 1TMJA 5ETKA 4PZVA 1TMMA 1CBKA 1G4CA 5ETSA 4AD6A 3KUHA 4M5IA 1RU1A 4CYUB 4F7VA 1EQ0A 5ETPA 3UDVA 3HSJA 3ILJA 3HCXA 1IM6A 3ILLA 4M5GA 1EX8A 2CG8A 3ILIA 1HKAA 3HSZA 3IP0A 3MCNA 4M5HA 2QX0A 3QBCA 5ETVA 4M5NA 3UDEA 1RB0A 5ETRA 3HD1A 5ETNA 3HT0A 5ETOA 5ETTA 3MCOA 3KUGA 4M5MA 3UD5A 1RU2A 4M5KA 4CRJA 5ETMA 4M5LA 1Q0NA 1DY3A
chains in the Genus database with same CATH superfamily
3RBZA 2MKYA 1Z2LA 2G1DA 3D1OA 3KJQB 2FZGB 3JSRA 2AMCB 2CJQA 5KFUA 3KLGB 1CLFA 1NK4A 1BQMB 2YXLA 3M2UA 3MFHA 4IKAA 1NPKA 2E44A 2ATCB 1YI2S 1VRTB 3EGZA 3QLHB 4HL9A 4I6YA 3DDNA 2HYIB 3HFZB 4O0NA 4ZPAA 2ZJRQ 5KTQA 3RW6A 2AGPA 1GAOA 2DXDA 2KL8A 3FNNA 3EX7B 2NREA 3PO4A 2EVZA 4X4OA 2OIHA 3L95X 1UVNA 3UVJA 2XMAA 4PXCA 4YN3B 2QJ3A 3LP2A 3TWZA 3CULA 4GC6A 4LF8F 2RF2B 4Q5VA 1TR0A 4L75A 4B3RJ 3H2UB 3M8WA 2MQLA 2RIJA 3M8PB 3NS6A 2WVDA 4JI3J 4LF8J 2VFRA 2ZOFA 1ZPWX 2BUNA 1JLBB 2IDEA 2NXJA 3OSPA 4C0OC 3K89A 3EXYA 4OX7A 1RT2A 2XULA 4FPIA 3AQPA 1KONA 3G86A 3O44A 1VIOA 3QFHA 1M5OC 5HLFB 1I6JA 2JEFA 4WK1A 1RT5A 1AZSA 4ICLA 2FJEB 1FNMA 5CXTA 2MQ8A 3K58A 1AW0A 1X9SA 3CCES 1QM9A 2MTLA 4IG3B 1Q7YT 2VFSA 2NUUG 4J5OA 2BABA 3D6TB 3QT5A 5H9EK 1S9EA 1XMBA 1N88A 3PR4A 3I6PA 4M5NA 1N8RT 3BKTA 3FBFA 1LK5A 3CCTA 5K5MA 5K8OA 2OH2A 4B9SA 2C3UA 3J81j 3HP6A 4C0BA 3JQKA 2YKNB 3CJ4A 3P49B 1FKOA 1F60B 1HWIA 1KS2A 3MMBB 1RWUA 3N0VA 5CH7B 2D3O1 1HR0F 4L76A 1OSCA 1S1VB 5GAEI 3CCWA 1O0PA 1T02A 2LEAA 2WONB 4RX6A 2BACA 2VFTA 5L1IA 2M4MA 2D7SA 3SZ2A 2KXNB 2OPQA 3X1LB 2BDPA 2I38A 2MYFA 4IFYB 4RNOA 1VQLS 3OXGA 1TFYA 4ZP7A 5I42A 1RI7A 4ZVOB 3IFEA 1HBOA 1WHVA 4MJKA 2EFNA 3C15A 3EVMA 4HVZA 4RW9B 1SJ1A 3DLGB 1ZM2A 2A6MA 3HSZA 3N4WA 3W9JA 3KK2B 4ED3A 2FZKB 4E0DA 2EK6A 2HFUA 2W24A 2GHWA 2LA6A 4P52A 5GAEU 2D41A 4C11A 3PX0A 3ENQA 1Y4ZB 2R7WA 4B3SJ 2HGMA 4OZ1A 5DG7A 4NRTA 3BQ2A 2D74B 2AJFE 1GXLA 2OELA 2R7XA 1FHTA 1RT7B 2CPHA 1FRIA 4FYVB 2XNQA 4ID8A 3QAUA 3SV3A 2V8VA 2HRUA 1L3KA 3GR1A 2UXBF 1GFWB 1S49A 3C16A 2N3OA 3I56S 3MR7A 4YR2A 1UFLA 5I3UA 2AGQA 2IA6A 4ZP9A 1FX4A 1FRXA 4YB5A 3CD5A 3M8QA 3V6DB 2F4FA 1JMTA 2UUBJ 4PG6A 2YNFA 2CIMA 3UCGA 2B5JA 2HRYA 3V2UC 1TV6B 2XLKA 1CC7A 4UUXA 3ULHA 1GXUA 2WVEA 4IRCA 3N28A 3LALA 1S79A 5E5NA 2DR7A 2RVJA 3FEYB 1CJKB 1TKTB 3FDSA 4J9PA 4ER8A 1CC8A 2DD8S 2B6AA 2AJ4A 2C3YA 3JAMU 4DG1A 2E7WA 3BBCA 2NSCA 4DL5A 3QO9B 5KFMA 1YG0A 3Q8SB 4NLXA 4LF2A 1AA1B 3OTOF 1RTIB 2FHMA 5LMNJ 1KOOA 3D1QA 2C28A 2WZ1A 3ISND 3GJQB 2ASYA 2E66A 1S1XA 3S6EA 1VK8A 5ADZA 2QLBB 1IJEB 3IS9A 2A2CA 5HVHA 5KFDA 5F8GA 2XWYA 2G13A 3MEEB 3Q8RB 2VQFJ 4I2PA 1X5PA 2O01C 3HCXA 5B0BA 7FDRA 2HLTA 1YX2A 3OR2B 4MIWA 3V5RA 2QSFA 3R6LB 4ZVHA 4KGXB 1RTHA 4RW4B 4B17A 4C48A 2AZ3A 3HFVA 2BV3A 4TNOA 1VOMA 1IWGA 3R97A 1QSSA 1W25A 1Q8BA 4JI4J 2CKWA 1HBUA 3CJQA 4LBIA 5IC4B 3S01A 2QA2A 4QIWD 5KFGA 4DCOB 4P6QA 4NXMJ 1S77D 2X3DA 1D9FA 5J1EB 3GSIA 5B0CA 1SL2A 3QATA 1IXKA 2BEFA 4M5JA 4DSIA 1VBZA 3MTJA 1NDPA 2W2QP 4NA1A 2FGOA 3KTQA 1K44A 3O2IA 3P5TL 3TI0A 3P45B 3MFIA 2AP6A 3CJ0A 1S6OA 1U24A 4LREA 5H9FK 4NLSA 2G2OA 1N54B 3MAHA 2BJ7A 3TOQA 2I2YA 2Y0BB 2K1RA 3OL6A 3O1LA 5GMKa 2ZH4A 1MWZA 2DNNA 2LDIA 4LSNA 4O44A 2HIQA 5CYQA 3POTB 3J7YU 1MROA 1FKAF 2CJAA 1VQMS 3I5BA 3KK2A 3IXQA 5HL7Q 1S6QA 1JXVA 1BHNA 1TP7A 2EG2A 3N79A 4OYOA 1TL3B 4ZVRB 3ISNC 3OFHA 4WP3A 3SDEA 2X1FA 3DRPA 5BJRA 2MQQA 1YJUA 1WTFA 5BYQA 2JEGA 4QWBA 1H2UX 2ZC3A 3R2CJ 2BANA 2RQCA 4WBFA 2H5EA 3UFCX 2XSJB 2RQMA 1FXRA 2VG7B 3MI7X 3THTA 5KFFA 2QSWA 1T7PA 3EZ5A 4DFKA 2DO4A 4X62J 4XPEA 1Z2ZA 2J7WA 1RAGB 1FFWB 3FBEA 5BXIA 3GLJA 4Q43A 3ILLA 2NS1B 2HQIA 3NEKA 1QAXA 1GNKA 1RABB 4IH7A 4F4WA 1UW4A 4DR4J 4QWCA 3V4IA 2RMLA 2A18A 2YPYA 3AT1B 3CJ8A 5IFMA 1SPBP 2AYMA 2BKOA 2Z2ZA 3KK1A 1T9TA 3H5UA 5CD4H 2RDJA 1ZTWA 1WEXA 1RU2A 3MEDA 3HHKA 5IT0A 2BE2A 5HROA 4W90B 1TKTA 1Y10A 2P6TA 1P1TA 2FJWA 4K0KF 2UVWA 3GCWP 2BM1A 3WC2A 2RILA 2LDYA 3NG8A 5HP1B 4UTGA 1F9FA 4ZCKA 4CTAA 5F8MA 1NXIA 2MKKA 1IQTA 1NB2A 1Y3KA 1TL4A 4P75A 1JKHA 1ELOA 4NLTA 3KJFB 3M9NB 2J8AA 4OFZA 2OKQA 3HXMA 4OI0A 1T9UA 3HMJG 2O67A 1Q5YA 4ECYA 1DQ9A 1FDDA 2CQDA 1YJRA 2YNGA 3FBCA 5KFKA 3T1YJ 1QE1A 2KT2A 4J9LA 2E29A 2DH8A 3KFWX 5EUHA 3I0RA 1AXQA 1R8PA 4C6AA 4NLQA 3HFKA 4A8WA 3H42A 2WBMA 2XZTB 4J37A 1G6BA 5J1NA 1WDDA 4ECXA 1I5OB 1VQ6S 1UA0A 2J8SA 1XR6A 2OI2A 2WB1D 3AFGA 3OLBA 1U26A 2IM2A 1L5UA 3MXHP 2OAUA 1C4AA 1SUQB 2BR0A 2DRAA 2R7OA 3W66A 2I8EA 1IKYA 4I68A 2AYGA 2ASJA 3L4BC 4MK9A 2FJBB 3HHLC 4W98A 1OYEA 1SKWA 3CC7S 1QAIA 2ZZNA 4OV1A 3US5A 4ES3A 4DZ6A 5F8IA 3IR7B 2PEHA 1DLOB 1CSJA 2ZVIA 3HHNB 3CJTA 1L3VA 3DRSB 2YWWA 2LYVA 3M2RB 4LF5F 1WC5A 3JQJA 3MECA 5AE1A 4QW8A 3MAQA 3RR8A 4NXMF 4BS2A 1JJHA 2KTQA 5J2QA 2VPZB 1L3UA 4K4XA 1S1VA 1A9NB 5B7WA 4N47A 3NNAA 2YY3A 3W5YA 1UKUA 2C2NA 4C9DA 4WE1A 3B54A 4ZP8A 5G0RA 2KU7A 2L48A 4ZJLA 3RRKA 1KVKA 3C6UB 3PFEA 1X4FA 1TKDA 1RHUB 5AXLA 4C8OA 1FDNA 2DNRA 3LP1A 2I6WA 5K14B 1YVFA 1IKXA 4WU2A 5ETKA 4ZVPB 5IWAJ 4QW9A 4CYUB 2DNOA 2ZNZA 1EETB 1RWXB 2YWEA 1NH8A 3MD3A 2F40A 4ECSA 3R6GB 2R8KA 1N36J 1Y5NB 4A48A 5CQGA 1RA7A 3GPAA 3HHEA 4XIUA 1W7WA 1C0UA 1WC6A 2MKSA 3HX9A 2KRBA 3NGSA 4CLLA 2RRNA 1VQKS 3UQSA 5AE3A 3UCUP 2PSZA 1RT7A 5C25A 1J5EF 4CNZA 4EWTA 2ZEJA 3TX8A 3IG1A 1FT8A 2XG8A 4JI4F 5KT6A 4QR1A 4ZA1A 1QTMA 1S7IA 3Q8YA 4YDXA 3DHXA 3GONA 3VALA 1DRZA 2HFSA 3T5HA 2RNEA 1S9GB 2HBYB 1KQFB 2PE8A 2X51A 2RF2A 4K5RA 2MKCA 4KIAA 4OJ1A 3LP2B 2FLPA 2C22A 1X4CA 2AU0A 1UFKA 4D3GA 4CLYA 3CTRA 3LTOA 2RJZA 4ZJQA 4F4YA 2PC6A 2I0XA 1Q53A 2ALYB 3BGFA 1A6LA 4X4PA 4O3RA 5KFIA 3D6HB 3QT8A 1HD1A 2G2ZA 5M2UA 2BBEA 2P5VA 4N77A 1U0HB 4ZPTR 5IS2A 1D1UA 4NE9C 1VR6A 4JV1A 3ZTQA 2RU3A 2IIHA 2KKHA 2M88A 4EFAC 2VQEJ 1CQNA 4DR6J 3ETOA 1DAXA 1YIJS 2DB1A 4WPAA 4IRDA 2EW9A 2R9LA 1WOPA 1ZPVA 1TL1A 4QIFA 4ZVGA 5B0AA 3G4SS 1NEEA 5DGAA 3NCRA 4OI3A 4PG5A 3J7YI 5GAGI 5KFPA 4URQU 4QQBA 3A8IA 5HMZA 2KJVA 2MZJA 1X4EA 3KHHA 1FVQA 3TQEA 2AKWB 3HHDA 2Q43A 3HJVA 4QWEA 4EBDA 1K9MT 4EI2A 3GJRB 2GVDB 1KFDA 1UEVA 2IJNA 3OSNA 1M5HA 4DR1J 2F8HA 2RKIB 4G6VB 3CEDA 3M32A 2ROEA 4NYOA 4M5HA 4DR1F 1S1TB 4M1KA 4OIXA 4NXNF 3ET6B 1H73A 3LOUA 3KG1A 2J0XA 3MECB 2HFOA 1I3OB 3W63A 4RR5A 2MXYA 4OYIA 2XS5A 4IYQA 2JRSA 2ILZA 3DXBA 2K3IA 1S9EB 2PMWA 5CABA 5KFEA 4DMZA 1WG5A 2Y3YA 4YDDB 2ZOGA 2W9AA 1LXNA 1X4DA 4LRFA 3G6ES 2B9XA 3T9ZA 1EAYC 2IBOA 1R0BG 4LRBA 2V4RA 4M95A 2V2VA 1Q79A 4CP5A 1HPZA 1AYEA 1Z1ZA 2PA8D 3ONQA 4ELVA 3E3XA 2EPIA 3C6UA 1RAAB 4RO0A 3X3UA 5MAOA 1E6VA 1ZA2B 4I0WA 1DURA 1RT1B 5D4OA 3MMAA 3VHQA 3H40A 2VIHA 3RJMB 3KXDA 1QVGR 1NDLA 1LW0B 2WOMA 1BWEA 3CJ5A 5KFNA 2GW8A 4YB6A 4U7UD 5C2CA 4DPXA 3CT9A 5C25B 2HEKA 1B70B 4NX9A 4WWSA 2W9CB 4OHVA 3MAAA 1C0UB 1H3DA 4EZ6A 2VDIA 4KKOB 3T5KA 4CM2A 2W2NP 1RTJB 2J6TA 2R7SA 4ZCMA 4KO0B 2WTFA 3IAS9 2M52A 2VG5B 1GMWD 2CQ3A 2EBEA 2MZ1A 1WTBA 1RZMA 2V69A 4QZVB 1M0SA 2E5HA 4DQIA 2FPHX 2VASA 3PEHA 3QT6A 3IBCB 3KNGA 2ZH8A 4GVBB 4YUDA 3DGVA 1G7CB 3TVKA 2DNQA 2CQ4A 1N6QB 1BQMA 3LUYA 3PYEA 3TZXA 5AJ3J 1HNXJ 2HHTA 3V81A 1SV5B 5A8RB 3GTYX 1I1GA 5LMUF 5AJ3F 4J7CA 2LXFA 2ZC4A 4FVCA 3I9ZA 5KG6A 4JI7F 2GMJA 3MM8B 4A4JA 5HROB 2Y8WA 1KQSR 4H54A 3T41A 3R5CA 5F9NA 1HKAA 1IKXB 2U2FA 1IBMJ 2B3TB 3ZNUA 2W8LA 1TKZB 3AOBA 3BSAA 2AHOB 4U67Q 3OXFA 2ZJPQ 1UJ6A 4PQUB 2NXUA 4QJVA 3NBPB 2MHEA 3SSQA 3WX8A 1R3NA 1M5SA 4RUCA 1S10A 4U7CA 3CF5Q 1R6VA 4PKDB 1JXLA 1SCJB 5FDLB 5GMEA 2IRUA 3Q22A 1NJZA 1U49A 5IQQA 4GKJJ 1MMNA 1Q1KA 2EFOA 3AJ1A 1N34J 4GKJF 3UCZP 1WKJA 2FDNA 4BWJA 2F8EX 4CWBA 3AD7C 2RD5C 3GG1A 4HHUA 3M2VA 1JNRB 3FRYA 3NGRA 3W1YC 2OPRB 4Q44A 4RPFA 5L8RC 3FK4A 2R7UA 3M9OB 1RAJA 2VICA 1LWCA 2IRYA 2XMWA 5BR8F 5E2QA 2UVRA 2FHJD 1SC4B 3QGIA 4NL5A 1SKRA 3NMAA 1HHQA 3MCNA 2FLNA 2BRKA 2O66A 2CDQA 1EB0A 3KLIB 4ZVUB 5K9FA 2KT3A 3CJKB 2DEJA 2G1HA 2EI5A 4GMKA 2UUTA 4JI2F 1F2HA 4LFCJ 1H74A 2UZAA 4FYWB 1RACB 2DO0A 2MSTA 4A47A 3NGKA 1REGX 2CYYA 1UA1A 1Z4UA 2JX2A 1GT8A 2V8PA 3J80U 4CO2A 1FXDA 3Q24A 1SJ4P 3NNCA 4A8FA 3BM7A 5E0OA 4DJBA 2C2MB 4FBTA 3BPDA 4R0EA 4IQXA 4NLGA 1TKXA 3QJPA 2DIVA 3SDEB 1JJ4A 1QAJA 4MIAA 2QA4S 1VQ7S 4CH1A 3W61A 2DHGA 4PXDA 3SFGA 3S1TA 4LFAJ 1NSKL 4DCPB 2M8HA 4I56A 4DL6A 4DSJA 1VISA 2MZTA 4QPTA 4LF4J 4IUFA 1XK8A 2ZH9A 3OTBA 1S76D 1JIHA 3H4BA 1WEZA 2BJDA 4UW2A 1S5ZA 4X2BA 3AB4B 4X4RA 3D6FB 1U1NA 2CUYA 2ZZTA 3P3DA 4Z2XA 1GMVA 2QTWA 4P74A 3PVXA 4ETZA 3OUYB 2FY8A 4DR2F 4MH8A 4Y3CA 2E1PA 1Y11A 4KC5A 1OJ4A 4J9VA 4FPRA 2XS7A 2J0SD 4DV1F 4X4SA 4OHWA 2HZCA 1P8GA 3QGGA 1M5KC 3BGOP 4CLUA 4R8UB 4ILRA 1YGYA 4G1IA 2XLJA 2R7VA 2LMIA 1N34F 4DR4F 3NY0A 4RL1A 5CYMB 3PXGa 1R0AA 2FVCA 2IFXA 4PCQA 4PRFA 4NMXA 4HH0A 4P2SA 3J81U 2IM0A 4G1QA 2XZWA 2H48B 2VFUA 5HQMA 2XBPA 2YWHA 2AJ1A 2LFVA 1UFWA 5HVGA 2GA7A 2DXFA 3I0SA 3MEGA 1AROP 3MDFA 3HHLA 3N6NA 3R7SB 4LSLA 1GX6A 3TP2A 1VQPS 3KLFB 3HSGA 3QFWA 4C0HA 1TUWA 3TZYA 5GMDA 3FMWA 2F4VF 5D0RA 2OEJA 3DMJB 3D54A 4DV0J 3M7VA 3TVYA 2AYBA 3SCKE 2OTLS 3DOKB 3LP0A 4LBHA 1JWWA 2HNZA 5EHHA 1C0TA 4J9QA 3EGNA 2AX1A 3EWGA 3SV4A 1J27A 1LW2A 2HS4A 5E3AA 3FCWA 1DBDA 2BM0A 2HK3A 1URRA 2MKIA 4P2XA 1S1WB 1WWHA 3DXSX 2HG4A 2FB0A 2M3DA 3DN9A 3VGTA 4Y6IA 4Y00A 3IBWA 4J9KA 3J7AN 4NCGA 3LO3A 5L39A 1PO6A 4PR6A 4ILLA 1R8AA 2PN6A 3A8EA 1VMBA 3CCZA 4M8LA 1NUEA 2KB2A 1HBOB 2PFDA 5KFQA 5KT2A 5D3GB 3TAQA 2AJQA 6FD1A 2UXCJ 2WCXA 2GAHC 1KHWA 3BSOA 3OVAA 1VBYA 1WNEA 3F0NA 2DEIA 4F3QA 2KXFA 1V3SA 1VBKA 5JVHQ 1T0TV 3PW2A 2DGUA 3T6BA 9ATCB 4DSFA 4ZLPA 4KGVB 4ZP6A 2CPIA 4FBUA 4H4OA 3OFFA 1AUSL 3LA0A 3RBDA 2ERRA 1XNRF 2JLEA 1JLGB 3NMRA 2L3MA 3GCXP 4KSEB 4JV5J 3OFEA 2YKNA 1OY8A 4URSA 3KYLA 4L73A 3ETMA 3G6XA 4P2FA 2KYZA 3V4MA 1O51A 2QL5B 1RSCA 3HZGA 4IOBA 2CQGA 4KAIA 5L9XA 3M1VA 6AT1B 4ZOSA 4W4MA 1D8ZA 4DSLA 3DRPB 4WYLA 1HNWF 5DDOC 1RCXB 1JXEA 2A2DA 1V9OA 5ETMA 2LLZA 2ZBPA 5I42B 4DV3F 3TQ1A 4IFYA 2XEXA 1DZ5A 3D9BA 1MN9A 4C98A 2VJVA 4N76A 2CQ1A 1SJFA 1RT5B 1WKKA 2HWHA 3FGVA 1CEZA 5KFVA 2QYCA 3BO3A 2Q6CA 1EP4B 3NXZA 3EM1A 3B8HA 3H5SA 1UCNA 4PYDA 1ZAVA 2WHOA 3G96A 4F4XA 4ED0A 2D69A 4RJVA 2NPIA 2V63A 2HHPA 3ILIA 3M6UA 2CWKA 5HI7A 1WC1A 2XGPA 2MEWA 2LEPA 2HNDA 4ZPWR 4PQAA 1CQMA 3BGUA 1R31A 2RS2A 3RU0A 4OHZA 1QUVA 2RS8A 4OI1A 2QRRA 1REVB 1R43A 1RT4B 5KFLA 1TAQA 2KFYA 3CXCR 1MN7A 5A2QY 4YHHF 1X8DA 4QPXA 1SV5A 2GX8A 4USKA 5D6GA 3MR3A 3OLAA 1R8HA 3PX6A 4K4YA 1T9VA 2IY5B 2LEBA 1FK9B 4IO9Q 4DV2F 1B0TA 3TZWA 2OUGA 2E1MC 3BB5A 4URGA 3E2EA 1B7YB 1PYTA 3JTNA 2HNDB 1MMDA 4NA2A 2JOQA 3DMJA 4YOEA 3MMCB 3NCPA 3NGDA 3OHAA 2CPXA 2V50A 4HT7A 3BSCA 4K2XA 2R2SA 2ZHOA 1OY9A 2AJ2A 5ETPA 1B0PA 3PHTA 4A8XA 5J1EA 3LWLA 2SXLA 3M6XA 4YB7A 3CCUS 4UY85 3LF0A 1LQ9A 1RAEB 3C14B 3AD8C 1RT6B 3FKBA 3R5BA 3MM6A 1SH0A 5IQ6A 3ZO7A 5J2NA 4IRKA 5F3TA 4F0KA 1VK3A 3FZBA 2QIFA 1RTIA 1NHKL 5LMUJ 1WORA 4PYAA 1V3ZA 2C2OB 3DRYA 3SCIE 2WSEC 4O4GA 1T03B 2XQCA 4IR1A 3K5PA 2IAJA 4M5KA 5KFRA 4NZ7A 3ISZA 3KLHA 1FKOB 1MG7A 1TQLA 2QZ8A 1UWBA 3DLEB 3DRXA 4NA3A 2GHPA 5RUBA 3CUNA 2BE2B 3SBMA 4X64J 1OSDA 2CQCA 3ITHA 3TJAA 3OR1B 3KLIA 4A8MP 1T11A 5A6WA 5EGYA 3Q8PB 3CCRS 1HWUA 4FP9A 2OPPA 3ICLA 4NEZA 2HPUA 3G82B 3KKFA 1XMOJ 3MR6A 4NLDA 4DX5A 1U6BA 2MZQA 4NLRA 2CQBA 2ZDOA 1QTNB 3CCVS 1ITPA 3BREA 2E9TA 1RAHB 2W8KA 2V2ZA 4MYUA 4USWA 3ZTOA 3QWPA 5DETA 4QR2A 3DLHA 5LM7E 2ROGA 1VIXA 3RG6A 3EVWA 4M5LA 4BBYA 3C6TA 2JZ5A 3IRXB 2DK2A 2DNKA 2F63A 4CO1A 2LP4A 3LGNA 1VYAA 4KO0A 4LVOP 1BQXA 2B43A 1GQEA 3F44A 3CDAA 4YQWA 3PY8A 2FC9A 5T41A 2JEJA 1MROB 2V8GA 4A46A 3HD2A 3POTA 2NYIA 1S99A 2B4UA 1B64A 3F73A 3R5DA 5E41A 3JS9A 1RLDA 3DKDA 1TELA 4XPCA 4RU9A 2EBGA 1SKSA 3DM2A 5F8LA 1N5YB 2DRBA 5KFWA 2NQPA 3NWRA 2OEMA 3AHPA 3AODA 2CG8A 4ECQA 2E1AA 3GJSB 4USTA 1TZ0A 4X65F 1WSVA 3DI6B 2XGQA 4LF5J 2MLZA 3MM7A 3OQ2A 4OZ3A 3PO5A 3GE9A 5T7LB 3P4UB 2R42A 3PTWA 4ZN3A 1S59A 3DU6A 5CCMA 4WP9A 3G8SA 1N33J 3VZIA 3H4DA 4PG7A 5HJXA 5DQHA 1QSLA 2FHJA 1HWKA 2AEFA 4N8OA 4AQYF 3KOAA 3K5LA 4C8ZA 4X4NA 1E6YA 4FKYA 1DHMA 2FD2A 4KFBB 4DZDA 4UQGA 4JV5F 4NLVA 1F6TA 1QAYA 1W26A 2W2OP 4I7FB 2PFFB 1Q81T 2VB6A 2MY8A 2ZH5A 1R0AB 2XMMA 4WXOA 2HHHF 2MY7A 4I2PB 4NYPA 3CD0A 5FDLA 3SFUA 3EPIA 1FKPB 2H5IB 5IT4A 2KG1A 3MOZA 1YDLA 2CQ0A 2FZCB 1MWQA 2L9DA 1IKWA 3IS9B 4KT0C 2E7VA 1XJWB 2VG6A 3MEKA 3NS7B 1N56A 2CPYA 4B9LA 4K4SA 4DV3J 5H9EJ 4KGMA 1H6KX 2P9EA 2XNRA 5I3UB 4K2JA 2YNHA 2IRXA 3OFGA 2GQQA 3OBIA 1JX4A 3QRQA 2ALZA 5ETQA 3FSYA 1WF1A 4RNFA 3K5OA 4OX9F 3MR5A 4I2QA 2CJYB 3DRRB 5DO2A 3OR1A 1AZSB 2QFIA 3OPKA 2DRDA 4ICLB 2HGNA 3WQPA 2KH9A 2UVVA 5A2QU 1K0VA 4PABA 1S0NA 3L09A 3CB4A 2V8HA 4MK8A 3I82A 4WE1B 1LW0A 2WOMB 3OVBA 4TU9A 1U02A 4JB8B 3I5AA 4PG4A 4Z37A 2KM8B 2FVPA 2F4VJ 1FO1A 2EC0A 1X4BA 2F5GA 2RUSA 3GYNA 1CS4A 4ZPDA 2YWGA 2YX7A 2UV8G 5GVQA 4DPOA 2WSFC 4HHHA 1V3RA 4KKOA 3DLKA 3O8WA 4DR7J 1KTVA 2FVQA 2YTCA 3HULA 3K8VA 3PR5B 2XLIA 1QJHA 1LWXA 3C19A 3DGPA 3PNIA 2H5JB 2VODA 2ADBA 1U25A 1KP6A 1HNVB 2KHDA 4XO0A 2XY5A 5DDRC 4X84A 5F8JA 2CPEA 1HFEL 2HAIA 4KV8B 4N8NA 2E1RA 3EGWB 1FD8A 4OYXA 2KYXA 2R4FA 4C2MA 1R89A 2CG4A 3PYGA 5ITHA 5K20B 3KLGA 4WK3A 4DV7J 2AQ4A 1FRLA 3PRDA 4RW9A 1VFJA 2K7KA 2EFVA 4ZK7M 3DM2B 2CQ2A 3AD9C 1WI6A 3K5MA 2Y8YA 3PYFA 2YKMB 2IVMA 5KFJA 1BUXA 3BGLA 3T1HF 1HW9A 2HHVA 2ROPA 2ZBQA 3QMQA 5HAOA 2U1AA 2DGQA 4CLZA 4ZPBA 3NS5A 3UPFA 4DR5F 2RU9A 3LP1B 3AOAA 1M1KT 4YMEA 3NGTA 4O4RA 1S1TA 1RKJA 2BJEA 4FYDA 3VAKA 4M5MA 2HWIA 2ZE2B 3T1AA 2VHGA 2OJ3A 1S1UB 1NK8A 2FIUA 5J2PA 3BO2A 2XMJA 4HLBA 3OL8A 5LXRA 2HW3A 4MAKA 3K8WA 4RWXA 2IJRA 1ULRA 2VC0A 4RNHA 4CLWA 1DARA 4HACA 1RUSA 3MPVA 2VPWB 4KFBA 4DX7A 2C2EA 2VF3A 5AXMA 4RLEA 1S57A 3H20A 4DQSA 1J5OB 1E6YB 3BQ0A 1PYSB 3E01B 1EIYB 2MB0B 1MU2B 1Q78A 3Q2TC 3DHWC 2AW0A 4DU7A 3RB6A 2E9RX 1HYSA 3DU5A 4IG3A 3A3PB 5CZXA 1L3SA 2HRTA 2Q79A 4LF9F 3GIMA 3G2XA 1X4HA 5EN1A 2VG6B 1RB0A 1BQNB 3NAHA 5BR8J 4F50A 4F3OA 2QE5A 1JB0C 1XR5A 4CLTA 1VI7A 1A7GE 2DNPA 3JTOA 1ZM3A 4ZLJA 1HNVA 4ZIVA 4PXBA 5GADI 2GMHA 2EFGA 3QT7A 1I51B 4LFCF 2WBRA 4KH1B 4FXDA 3VF0B 2UU9J 1RAIB 5C2GA 2DR6A 4OHXA 1ZH5A 2ZBIA 1U1PA 2M70A 3VVTA 4B02A 1CJVB 1U1OA 1IBLF 2DGXA 3NAIA 2KO1A 3EXCX 1JNZB 3C14A 3LPYA 4AL6A 2GJ2A 1VRUA 3IM8A 3L7PA 2R7TA 1RYSA 4X65J 3C6TB 3IRXA 5DS7A 5CCLA 1UL3A 5EX3A 4QYRA 3H2VE 1PJ5A 3H7HB 4O4GB 3ZTSA 2Z8QA 1E6VB 2QGFB 3GMGA 4DV4J 2L9WA 2QC3A 2V4JB 1H7WA 2QMXA 1D9AA 4DV5J 2XMTA 1S1WA 1SQGA 2Z2YB 4DR3F 4EEYA 1LK7A 4DX8H 1S4FA 3FSIA 2R3VA 4ATNA 4DV5F 1S72S 3R5JB 1HNXF 4LF4F 3GZ7A 2ATLA 2QLJB 5J2QB 3IR6B 3CIZA 3N5FA 4UOGA 4DPTA 4OYAA 1Q82T 1O6XA 4F8RA 1WF0A 2F9DA 3M30B 1TAUA 1RT3A 2DGTA 3D4JA 1OPIA 3MPWA 1VQ5S 1XNRJ 1FD2A 2BJ9A 1QDUB 2PT0A 2XZDB 4MMOA 2POKA 2V34A 4KGKA 3WC0A 3FVYA 2A3JA 1NNDA 3ILJA 3JQMA 2DISA 1RISA 3VQSA 3QSYB 3MUVP 5K8NA 1N5SA 1Q4RA 5D0EA 2AX0A 1KWMA 1ZM9A 4FN5A 3HLUA 1FVSA 1NSPA 1U2FA 1XIQA 3FSXA 2BKNA 1VDHA 3V6JA 2YX1A 2UUWA 3KK3B 2Q1LA 2UXDF 3DRSA 2KM8C 2KXHA 1K0TA 3D66A 2KVQE 2YKPA 1HBMB 3RZAA 3TEGA 3HVWA 3A8JA 4Y2MA 2DXEA 3WX4A 1Q95G 1DQAA 1J5EJ 4ED5A 1RQ0A 3RAXA 3JSYA 3VGUA 1NHUA 1UZHA 4EO6A 2GIRA 2H3EB 1UW9A 3V4IB 4KR0B 3DI6A 3PDNA 4YR3A 3LGHA 2P9CA 3DDIA 4PZVA 1G2EA 2B6AB 5GAHI 3V6KA 1KTQA 1X4GA 3GYXB 2RSQA 5KT4A 4ES1A 4GVLA 5KT7A 1C1CA 1QLNA 2HKEA 2PA3A 1L3TA 4RNNA 2KFZA 4HDGA 7FD1A 5EX0A 4DUZJ 3QJLA 3U1NA 3LPEA 3IWNC 3QAEA 2Q6BA 3IAM9 1MWYA 5J2NB 3THPA 2WVCA 3BS9A 2NUHA 3TYTA 3SQOP 3PW7A 4B3SF 3WIVA 4ECUA 2ACMA 1WC4A 3TA1A 1SBRA 3MD1A 1WC3A 2AYEA 2Z57B 3K7RA 5B0GA 1LV5A 3H5YA 2W2PP 3N9UC 1BWVA 5CD4A 1JKHB 5A76A 2CNOB 2AEMA 1HHTP 1F9HA 2RDDA 1XTZA 1FRJA 4XTTA 3ZNJ1 3BO4A 1N33F 3C8YA 3D6MB 1IUJA 4X66J 2IC3A 2OO4A 4OQJA 5THWA 4B3MF 2W01A 4F3MA 4X4TA 1T05B 1LW2B 3ADAC 1CG2A 3OT9A 5KFSA 1N0VC 2C3MA 3VTIA 2OD4A 1XWLA 1S12A 2DNYA 2G2YA 3JXOA 3UWTA 3PJXA 4CO3A 5LSRA 4UQTA 2Y1RI 3LWMA 2VA2A 4KHMA 3GR0A 2IJFA 4LIWA 4U9RA 4CH7A 6FDRA 4IQMA 1HBMA 1N5TA 2CZ4A 3A13A 4NLWA 1LNQA 3HKZD 2NYHA 4USIA 1C1BA 4JI1J 3ZZRA 1OWXA 2GAGC 4MT1A 2LQBA 3G6YA 1FWKA 3D28A 1U2RA 1F5CA 4ERDA 4BCAA 4CLSA 4ILMA 1KOHA 4DDFA 1RHRB 4XAKA 1TL5A 3FFIB 3M2RA 3T5JA 4EU0A 1P6TA 4CO0A 2BVZA 4DL7A 3HO1A 2L08A 1T95A 1X31C 2VUGA 5D78A 5D77A 1O5JA 1HBNB 2D1CA 2NSBA 3A3NB 3M1VB 4F4AA 2H4YB 1DTTB 3EVOA 4N41A 2VQFF 1SH3A 2BW2A 1RBLA 4LRCA 4DQQA 4WIIA 4F2SA 3PX4A 4LBPA 3GIJA 4RUAA 1SXLA 5IC6B 1AUDA 3GIRA 2V9WA 4JI5F 5I3PA 4NI2A 1HNZF 2G9OA 4DHVA 2DHHA 2FJAB 3VAFA 2CRLA 3ZZTA 1BMQB 2X1GA 3OTEA 2G0JA 5KFBA 2ZJQQ 1AT1B 2WW8A 2YH0A 1N6QA 4HEA9 1VHFA 3BBFA 3DFEA 2VA3A 4WFBQ 2CA9A 3VAJA 4J9RA 3W5ZA 4WF9Q 1X9MA 2DGWA 2KHCA 4M5IA 2RDIA 2W4CA 4BLGA 4TKTA 3QRRA 2V5HG 1VC0A 2C2KB 1PAUB 2J5AA 3CC2S 3CJ3A 1LEOA 4FNHA 2VDHA 1Q8IA 3AXKA 4LQ9A 2JDJA 3FBBA 1CJUA 2OFGX 2VL1A 4CTAB 3EJMA 5ETRA 4ZCIA 1T3NA 3W7BA 2CADA 3QO9A 5DG9A 1Y0HA 2UUAJ 4DG1B 5IT9U 4ED6A 2PGCA 2ZOMA 1VQYA 3BH7B 1KQGB 1UEUA 4YB1P 1CJKA 2AZ1A 2W7OA 1X0FA 2F65A 4CNYA 1H98A 1TUVA 4ZVQB 3ENAA 3TUIC 2QT7A 3EUNA 3Q2SC 2DVIA 2UUBF 2YQ1A 1HNIB 2PI4A 1TKXB 1RGVA 1U48A 4HTJA 2B51A 1JLQB 2CPFA 1K1QA 5U47A 4MKVA 4ZLNA 7AT1B 1VQOS 4P72A 3WZ0A 2RB7A 1LWCB 1SC3B 1UAWA 3HHLB 4CLKA 5D4PA 3I0SB 4ANCA 2DNHA 3TZZA 4CQ1A 4DL0C 3BBBA 2R7RA 2OPRA 1IN0A 1SJRA 5A6PA 4QYZJ 2IC3B 2JVRA 3HI9A 4CCHA 3TRGA 1HA1A 4BC9A 1PC4A 2J9CA 5K8PA 3GILA 3SEOA 2FYXA 2HBRB 4P10A 4DUTA 4F02A 1M1HA 5F8HA 4PWWA 2J7UA 4K8RA 2IYIA 4Q2LA 4K7QA 3GFXA 3GP9A 4LF7F 2NXEA 3HVTB 3EICA 4LT6A 3AJDA 1O8BA 3M8SA 4J9SA 4LF9J 3PKMA 3BN7A 4PQUA 3VR1A 1JLCB 1GTHA 2BYCA 3VAGA 4OI6A 4DFJA 3NNHA 3GIKA 1NDKA 4NCGB 2CNLB 4KJIA 1RTZA 3M9MB 2XMKA 1F0XA 2YKQA 4HI1A 3EMTA 3BF4A 4TYAA 3Q89A 2QN6B 1Q5VA 1SJQA 2YQ0A 3H98A 3H90A 4IH6A 4OLPA 4OX8A 4XK8C 3ZZYA 3OVSA 4AE5A 4JI2J 1RADB 2MKHA 1IBLJ 1CULB 3NOGA 2R2TA 1ZZNA 2RHSB 4ITSA 3BSNA 2DT9A 2C42A 3MM7B 4DL2A 4AL5A 1BXNA 1JLAA 2HVEA 3BJYA 1WELA 1VC6A 1KC8T 2VZ9A 1EKSA 1T8EA 2HS3A 1NZ8A 2LCWA 1RT3B 3M6WA 4O3PA 2Y9HA 1C4CA 3KLFA 2ZH1A 4LR7A 1NMEB 4DV2J 1UVLA 3ZZUA 3KDOA 3SYZA 1XMQJ 3NCQA 4DPUA 5J2MA 4PUOA 3E51A 3QQCD 2RT3A 4HT5A 5F0UA 4LF6J 1QVFR 4B9VA 2XMUA 2UUAF 1HWJA 2Y0SD 5L38A 4X66F 2B9EA 3ENWA 4TYBA 3CJSA 5B0FA 2JSXA 3NGUA 1MLAA 4HHJA 4K4VA 2HHSA 1FJCA 3UDCA 2Y1JA 4R8UA 2VG5A 1PBAA 3MF5A 4AT1B 1TU0B 2P2CB 4EO8A 4ZIWA 1KR4A 2DNZA 4LR9A 4IFVA 3IN5A 2WVBA 1ZOTA 2IVYA 1HYSB 5C24B 1JLEA 5C7PA 2LVWA 4U6PA 1RAFB 4N7TA 1EETA 5LJ5Y 3RB3A 1FWPA 1UVKA 2XSFA 3AOCA 3M8PA 2R8GA 4F4KA 3D0GE 5BYRA 3OTOJ 2A0FB 4L3NA 3GSDA 3IR5B 4MFBB 5A8RA 4P73A 3OHBA 3FEXB 3OW2R 2AGOA 2I5JB 1VC5A 3HKWA 2UP1A 4C8KA 1FXLA 1TV6A 3GFYA 3H2LA 3TO8A 1TMJA 4BWMA 3ZZPA 3CCQS 1U1KA 2DGVA 5HO4A 2CVEA 1FKPA 4NEYA 2GFFA 5JMNA 4YFUA 4BC7A 1Y9OA 2BE9B 1D0EA 1X9WA 2G4BA 2R7QA 1HARA 1VS3A 4RWWA 4M5GA 1EX8A 4OZLA 5E3PA 2ZH2A 4J9NA 1Y3JA 3QWUA 5E7OB 1XERA 3LH2S 4NOHA 1ZAXA 3CMAS 2OEKA 3IO1A 2XCPA 5JUMA 3D0IE 3CJ2A 2DR9A 1BGXT 5B08A 5KT5A 2O3DA 5M2RA 4F25A 4P7VA 4YEAA 5FLXY 3VZHA 1KLMA 1PILA 2IDLA 4TU8A 1GTEA 4KBIA 5A8KB 4DV6F 1OIAA 3TW0A 1IKYB 1D9DA 3D0HE 1U0HA 2G0CA 1SIZA 3T3FA 4KGZB 1BQNA 1PBUA 2CPZA 1HPZB 2V8DA 2M5YA 4ED8A 4RBTA 3MOJB 2HHWA 5D4NA 2HFZA 2IM3A 3B78A 2A1BA 4OMFG 5DGBA 5GADU 4LFBJ 4ZPVR 1NJIT 4ECWA 3D67A 1NK5A 4C3MA 5FJ4A 3QIDA 4JI0F 2OSQA 2OPSA 3BKFA 2OMOA 1URNA 4PG8A 3IP0A 3TA2A 3HM9A 2X1BA 3N6LA 5KT3A 4B3MJ 4HKQA 1S9GA 1JLAB 2X7IA 3A4TA 4NCBA 3RTVA 4B3RF 4KV8A 4B3OB 3S8SA 3PFOA 3IWLA 2GQCA 3DCAA 2LU1A 1LWFA 1KEKA 2DJWA 2HQDA 3B82A 3W2VB 1EQMA 3ILOA 3N01A 4MKAA 2JH3A 2HHQA 2KI2A 4UOCA 3VAMA 2OLWA 3EDQB 4LSZB 3RRHA 2CJ9A 4FS1A 4OZJA 3JSBA 3DRRA 3K2YA 2MQPA 2HHHJ 2VPYB 4F4ZA 5AE2A 1UTAA 5F9LA 2ZHAA 1NSAA 2ASDA 1HMVA 2DGSA 5F41A 2RQ4A 4ZLLA 3KMSA 1MNEA 4I64A 3D5MA 1Y5LB 1YKWA 3VQTA 4EZ9A 2PI5A 2XHCA 3KJVA 4MKYA 5K8MA 3Q8VA 4UY8T 2VV5A 4A8OA 3V81B 2HVDA 3IG1B 1SVDA 2HSEB 4BHQA 1OY6A 1PYOB 2Z56B 3O3LA 4TVAB 2DHSA 5DG8A 1I94J 1FNOA 1U1RA 4CDIA 2V2KA 4C4WA 2AT1B 1EHWA 2AEJA 2NZCA 3BDEA 5EDWA 2J9EA 1SL0A 4I6AA 1S1UA 2IYGA 1VQ9S 2WVFA 1F3FA 4NWBA 4ZS6A 2BXJA 3BGRB 1JLEB 2DYAA 5H1SV 2HS0A 1RTJA 1RXOB 3U27A 5BYSA 1SI9A 4A8YA 1NCLA 3MAAB 4CO4A 3C2PA 2BZ2A 3DNCA 3QIPB 3UVJB 2DY9A 1BE4A 1A0OB 4B08A 1HNZJ 2B4OA 1NDCA 1ZS6A 3CGIA 1R8CA 2QG9B 2YNIB 4AD6A 5HMXA 2CXEA 1NPRA 5HMYA 1YSJA 1KNZA 1TVRA 1DQ8A 4RW6B 2GV1A 2MQMA 3MMCA 4DUZF 4OYPA 4DV6J 3D7SB 3TEHB 3CC4S 1T9XA 2DIUA 3Q8UA 3EGVA 3CE8A 2FJXA 3CSKA 4YHHJ 2ZZMA 4OLOA 1UVIA 2J6SA 4R5PB 2ADCA 1K8AT 1RT6A 4RW8A 1TK0A 3MM9A 4ZITA 4KQZA 4WFXA 1DLOA 1R7IA 1OYDA 3IRWP 4TQRA 2ZKTA 4LF6F 1TL7B 1M90T 1AFIA 1XMQF 4E98A 3LP0B 4DU8A 4ANDA 3S7RA 1F9EB 3DLKB 5DDPC 4C8YA 1QE1B 2MPUA 5KOXA 3P5BP 3JAMY 2YNGB 3HVAA 4NLOA 1RKIA 3PRVA 3PM9A 3DLLQ 4Y2CA 3M32B 3ZXWA 1W2IA 2JFDA 1Q16B 2G0IA 5G0RB 2B8PA 2BJ8A 3LANA 3MUMP 3KHGA 5CZVA 1ZTTA 3D68A 2ZFHA 2E5LF 2HK2A 2BOAA 2GVDA 2YH1A 3LW5C 4NZ0A 3UE2A 2N7YA 3FFIA 4J9MA 3RW7A 3AAWB 4TY8B 4YS2A 3DYAB 3KLEB 1R6YA 3HVRA 1ZA1B 1N32F 4JBCA 4DXLA 1T94A 4J91A 2R2UA 4OI4A 4Y34A 1DTTA 4OI2A 5ETOA 1PCAA 3KUGA 2BQUA 5DZ7A 4JYAF 1UP1A 4DL3A 1HBNA 1HNWJ 2B0GA 3RR7A 1D09B 3H0PA 3D3BJ 3SSRA 1RWOB 1V5VA 1VJQA 1IVZA 3RBXA 2MGZB 3CMES 4WTYA 3SSSA 4KE5A 2HQ3A 2ZNYA 4USUA 1YJ9S 4Q2MA 3ITHB 3OUYA 5DM6Q 1OS5A 2N7CA 2R8HA 2H9ZA 4ZPCA 2EKNA 1NO8A 4N5SA 3AXMA 5LL6d 4WTOB 3TJ9A 1WOOA 3EDRB 3W60A 3OJSA 2Q3PA 4USMA 2GO8A 2H65B 2QL7B 2IMWP 5E33A 2H54B 3VGVA 4K0KJ 1N36F 5ETVA 2O5DA 3Q23A 5B0DA 2R8JA 2F8MA 5CHCB 3U02A 2H51B 1HQUB 4O0IA 4K4UA 4Q0BB 2HBQB 5J2MB 2GJFA 5AT1B 3WIUA 4JI5J 5HN0A 4PUOB 4KHRA 5I3QA 4JYAJ 1UZDA 2E5GA 2PEBA 4CH0S 2DPIA 1U8SA 3QPIA 4ECZA 3J7A1 4TY9A 4PEOA 3PV8A 3C16B 1RHMB 1Y5IB 2BE7D 4L72B 2Z2LA 4TN2A 2Y1LB 4I4BA 1P9YA 4Y65A 3W64A 4C3KA 3L7UA 5ETLA 1VHIA 3W8GA 4CM0A 3PW0A 2VBYA 1FFSB 4DPWA 3MM6B 1IBCB 3TAMB 3KLVA 4B9TA 3NL0A 3MGJA 1R27B 5L1JA 4O3NA 2K8GA 2M0GB 1OQ3A 3UN2A 1ZM4A 2N4DA 1REVA 1IM6A 3DOMA 2L9NA 2HNZB 3JB9k 4N56A 4JI8J 2B4PA 2B56A 1H38A 4JI8F 4GC7A 1RWMB 5DZ6A 4ID5B 5H9FJ 3TUJC 1YITS 2VC1A 2H4WB 5L46A 2QO3A 1FK9A 5LSOA 4DFPA 1WI8A 2EXUA 2ZBRA 1PIEA 3J7ZT 1FESA 2CJBA 2VKRA 4ZN1A 4AQYJ 5HJYA 1QY7A 5C42B 2C2DA 3W8PA 1VQ4S 1LWEB 3TAMA 4DEZA 5L9NA 4FF4A 3D2WA 5LSLA 2RRAA 3SQGA 5AXNA 1SQFA 2D9OA 4RUHA 1MSWD 4FXWA 2KN4A 2GGPB 1P1LA 3BYPA 2E9ZA 1J2VA 3N6MA 4QIGA 1K1SA 1ZAWA 5HANA 2YX4A 1M1GA 2CJKA 4DSKA 2RHQB 3BN4A 3NP5A 3PHEA 3MMBA 1JLCA 4GRSA 8RUCA 1G4CA 2PIIA 1EARA 4OZNA 1WHXA 3C46A 3HVTA 3PEJA 4LSLB 1TL3A 5E3CA 5LMNF 4AL7A 2J6UA 2CVIA 2RRBA 2CAJA 1S0MA 1HBUB 4EK2A 1JLQA 2DGOA 2MLYA 3VGSA 3BR8A 1HQUA 2L41A 5DJBA 4KPYA 3M8ZA 1KKHA 1ROFA 2VU5A 2K2PA 3M30A 3PJWA 3CDWA 3EZOA 4JV0A 3UD4P 4OZ0A 3M4XA 3UNGC 2DNMA 3SIPB 4G65A 3CCMS 2QEXS 1FF2A 1NLKL 5LXYA 1NKEA 3QSIA 3CPWR 1HI0P 5CYJA 1FE4A 2D3ZA 2IVFB 3LGMA 3T6JA 1H2TZ 4DLGA 3QJJA 3PW4A 4WIQA 4WFZA 2APOA 1IQZA 3OTCA 3KUEA 5B0EA 2GJIA 2GVZA 1C2PA 1UPPA 4OYMA 4CLFA 1LOUA 1YWXA 5M2PA 4ELUA 3CIMA 2JVOA 1CBKA 4ZKAA 1SC1B 4A8SA 2MQNA 5LOQA 2VD3A 3SCLE 1KRPA 2J0QD 1YJVA 9RUBA 3CCSS 4FF3A 4X4UA 3DLJA 4HH1A 2XI2A 1IM4A 1TTHB 3TNVA 4YY3F 4RBVA 1B7FA 2GO9A 2GVZB 4GKKF 1RJJA 2MMYA 3HK2A 5HATA 1IJFB 2B5JB 3VV2B 2DPJA 1OQ6A 2YNFB 3QGHA 3Q83A 4CRJA 1RCOB 4WKYA 2B7CB 2DH7A 4L3KA 5IM0A 2X1AA 3V6DA 2XY7A 1TVRB 1KQKA 3GIIA 2XWXA 1RT1A 1C0TB 1VLOA 1LFPA 1N5QA 1X0PA 3QLHA 2YNIA 4Z7YA 3VAIA 4PWDB 3DOKA 3M2UB 1V6HA 2CJXB 1RWPB 4WP8A 1NK6A 4IR9A 1VQSA 2UV8A 1U1LA 4PXEA 4CLPA 2VQEF 4G1PA 3NLCA 1KD1T 1P27B 3IC1A 1FDBA 3TR5A 5HBMB 3AJ2A 4DPYA 2DH9A 2FQQB 1Q7LB 1FE0A 1WKLA 4USVA 1MU2A 1N32J 2LKZA 2C2RA 3KK3A 1FFGB 1IBMF 1GX5A 1EP4A 3M2VB 3PCOB 3W9HA 4IOAQ 1B4SA 4DQRA 3RYLA 2N82B 3MM5A 3OR2A 5ETNA 2JLGA 1FEEA 2XI3A 2ZH7A 2W1BA 2CPJA 3CCLS 1BC6A 2RH3A 4ZVFA 3MEEA 3OXLA 3MMJA 3H25A 1NKBA 2E5IA 3G8TA 2XYHB 4C8MA 3B4DA 5GAHU 3TANA 2IBKA 1RWVB 1WD6A 2W4PA 4LRDA 1S9FA 4HTIA 4OX9J 1XMOF 2EFQA 3GV7B 2FGCA 4S0MA 2IPOB 1LKZA 5FIIA 1H2VZ 1UJ4A 2BJ1A 2GGPA 3DYAA 1NH7A 3MWBA 5IWAF 4ED2A 4KY3A 2M7SA 5HQLA 2ASLA 3JSMA 4UOFA 2GMLA 1YBTA 4U8VA 1RP5A 1C1BB 2OGUA 3L9ZA 4LF1A 1NKCA 2MKJA 1HWLA 3AH6A 1HI1A 2YKAA 2QMUB 3A8KA 4C11B 4ETXA 4CIOA 2LXIA 4LJMA 3HD1A 3NKYA 4FZVA 4LMZA 2QA4G 3CWJA 3FZ2A 3AQOA 4MKBA 3IM9A 4FS2A 3GU0A 4PWDA 1RYRA 5T14A 4H4KC 2YKMA 4FVMA 4DSEA 3EE3A 3T1YF 1T05A 4B9UA 3G9CA 1FWLA 4BDPA 2F9JA 3OV7A 3TX0A 4ECVA 1YQHA 2HFVA 3A3OB 2OPQB 1B99A 2IMOA 2OD6A 3EPGA 4UOHA 1EZZB 1PSDA 2RQKA 2XHWA 3AB2B 1NZAA 2YQ3A 1CJTB 2YWFA 4FXVA 3VCDA 1GXTA 2LQ9A 2RE1A 5KFCA 1JJ2R 1B3TA 2LXUA 5A8KA 2VOOA 4WZMA 3AA9A 1EQ0A 2JWNA 3PYDA 2J9DE 5MLCV 4E2FB 3R1HA 1VCTA 2KT5A 3VWSA 3MMAB 4UZBA 1HD0A 1X5OA 1IR2A 1VRUB 4I67A 2Z0GA 1VRTA 2UXCF 2ZHBA 4QU6A 4K4WA 4X4VA 1YHQS 5KG2A 1VLYA 5EWFA 1Y7PA 5KFOA 4A8KA 4JI3F 2MGZA 4B9NA 3M8YA 3R5GA 2OPSB 1YRUA 4GO5X 3ZZOA 1ZETA 1K47A 4RW7A 3W2WA 3EYZA 4B3TF 4DQPA 3G71S 2XYPB 2V2QA 2EWHA 4F36A 1J5OA 3M05A 5K14A 3KHRA 2WRMA 1OO0B 4EYHB 4KYZA 4JUZA 1CPZA 2XMVA 4G1QB 4JV2A 4K59A 3RRGA 3J7Z5 5IT9Y 2FUG9 2WB4A 2BA9A 5IV3A 2GQ2A 3PRBA 2R2RA 2F3JA 2W4DA 2Z2MA 3DOLA 1D3WA 2LECA 1UVJA 3RUBL 1JLBA 3M8QB 2OHDA 3R1LA 1PGZA 4JOUA 5E3QA 3U1MA 5A8WB 3RGIA 5C24A 4IFVB 2HBZB 1RTDA 4YR0A 2FC8A 4HACB 1S0OA 2VOPA 1IKWB 4GO7X 1BY9A 1U6ZA 2HURA 2QA1A 3TUZC 1U09A 4JP8A 5KFAA 3CO0P 4WFAQ 2B4VA 1WEYA 3DOLB 3R27A 4RW8B 4AXJA 4AYBD 3DLBA 2HGLA 2E5JA 2J76E 2YKOA 3BYRA 3CW2C 4R5PA 1FJGJ 1UVMA 5L1LA 2EKYA 1IWAA 4OZ2A 1WHWA 2V4JA 5JVGQ 2NPFA 5LJ3Y 2MZSA 3G6VA 2D9PA 4WYWA 3W3SA 2KFNA 1NU4A 1I94F 2HZVA 4DLEA 2C3OA 2C3PA 1DJ0A 1FJ7A 1SIWB 2IHR1 3HSJA 3U1LA 1X7VA 2FLLA 2MSSA 3UO0A 3QIPA 1ICEB 4LQ3A 4IO1A 1H72C 1S97A 3B6BA 5KFYA 2AJ0A 1TK5A 4RU2A 3GV8B 2DTJA 3GYGA 1ZBTA 5D4LA 3OD2A 3AY0A 4DV7F 1UJ5A 3VAHA 1NJYA 3N5BA 3H59A 4MIBA 3UI3A 2HHXA 4LFAF 2D3UA 2RUGA 1RLCL 2N3LA 3O6QA 1NK9A 1YBAA 3FQLA 3NBPA 2X3GA 3NRBA 1SB6A 4HYKA 4DS5A 3K0JA 4QIEA 5FD1A 4F67A 4WFYA 4DR6F 1LFWA 2MHNA 2F1FA 4WU3A 2GIQA 3K5NA 1YZ7A 2F7VA 3B4MA 2WSCC 2ZD1A 4XDDA 4B3TJ 1VGYA 2HMIB 2HQFA 3HZEA 5A8WA 2ZVSA 4PWUA 2OPPB 1WC0A 2HLUA 1Q86T 2J7KA 4F04B 4TU7A 1GK8A 3PIPQ 4X64F 4TQSA 3KK1B 4NCAA 2ILYA 4WZQA 2QLFB 3F56A 1AB8A 4ZHRB 4JI1F 1S6UA 4X62F 3KMQA 1BLUA 1NRKA 5JXSA 4X4QA 4WCEQ 4ZDNA 4DL4A 2OMLA 2UUCJ 2LQ5A 1LWFB 1U1MA 4K4TA 1HI8A 3MZIA 1FTCA 2OFHX 4CT8A 2ZE2A 3TAPA 3RAQA 1T03A 3MCMA 2VFVA 3BQ1A 2HMIA 1JLFA 1U4BA 4JI6J 1HMVB 2N4CA 3GFZA 2BANB 1GMWA 1QD1A 3MPDA 3MPYA 3RAMA 1FJEB 1ZZFA 5JJBA 3HSDA 3L7OA 4KH0B 4TXSA 2JC1A 5G4DA 2HNYB 2W9CA 2P9GA 2FHKA 5A0YB 4G3IA 2NR0A 4DF4A 4LRAA 4NLUA 5DRKA 3T1HJ 1N0UA 5I4MA 5KAKA 2PO4A 1SH2A 4MTPA 1F1BB 4ZJOA 2MJUA 2BQ3A 2I1RA 4GVBA 3CD7A 3WBZA 1CJUB 3IWXA 2ZWOA 3PJ9A 5DQIA 5DLFA 1HLWA 3BV8A 4ED7A 2GS8A 3R5AA 4OX6A 4Y0FA 4DF8A 4FYXB 3W2WB 1APSA 5HVFA 3JYTB 3PACA 3I87A 1U1QA 3TVZA 4DI6A 1YLXA 1IKVB 4USJC 3H5XA 3BZQA 3OJUA 5FLXU 2CZ9A 4LFBF 1CS4B 1YK9A 4J9UE 2HQGA 8ATCB 2GHVC 3Q0AA 1TK8A 1N4LA 1HIYA 5ETSA 1SC6A 3HDSA 4F7VA 3D3CJ 3GWCA 4QIVA 4RW6A 1YJWS 2IA0A 1KLMB 4H4MA 4O3OA 1KHVA 3ELHA 3SI8A 1RWKB 3DGPB 4KRWA 1MW7A 3P8BB 2I9SA 4LUBA 4PAAA 1FI4A 1FEHA 4TLQA 3UDEA 2I5JA 1RK8A 4YP3A 3THVA 2RAQA 3I0RB 2DR5A 4K5SA 3E8OA 1S48A 2E1CA 4DFMA 4OV6A 1XN9A 1D8YA 4C8LA 2CQIA 2V0NA 3W62A 2FJVA 4L6V3 3J81Y 1RA6A 3BKUA 3MEDB 1F5AA 3CO9A 3OTDA 3PG9A 1WHYA 4R25A 5E3RA 2A10A 3O5TB 4H4KA 3UR3C 1FX2A 2HIYA 3LQVA 4P71A 1X5TA 3ET6A 1QUPA 4M63A 4QBUA 4QCLA 5IOLA 1R8BA 1VQ8S 2UUCF 4DV1J 2J9DA 2PMZD 4ZCLA 2AV5A 2NLWA 4ECRA 1NJWA 4Q8EA 2WAQD 4U8YA 1JLGA 2GC8A 2QLWA 1GEHA 4F26A 3PKYA 3CDEA 1EKRA 3TA0A 4ECTA 2LQJA 4H4OB 5KFXA 4RW7B 2XSJA 3GG0A 1S7HA 1YRTA 1JJCB 2CWXA 3A1YG 4C7QA 3OL7A 1M5PC 2DNGA 2LU2A 1KLNA 3UD5A 4V19J 4DS4A 2OSRA 2P6SA 1OPZA 2V68A 3I96A 2FY1A 2EC2A 2WW4A 4DV0F 3GQCA 2XC9A 2CZVC 5IM0B 3C3LA 1S6PA 2W9BB 2AWZA 2H1YA 1FJGF 3TARA 5DQGA 3PZPA 1CJTA 5F8NA 1RE1B 1XQIA 3W65A 2EG1A 2BW7A 3KDNA 5KG7A 1U0SA 1F3VA 1VJWA 3MCSA 5D0HA 3PW5A 3UW1A 3P6YC 4AFFA 4L74A 4DUYJ 2KZMA 2EFPA 4NI2B 2GZOA 1WOSA 5HBMA 1HQEA 1RWNB 3FMBA 1S6QB 4YY3J 2QFJA 1VBXA 3TUPA 1WG1A 4I1TA 3UDLA 4JI0J 4CI0B 2JEIA 1GH8A 1YJTA 2HAFA 2ZUGA 2AIRB 3HT0A 4QOTA 3I5CA 3CDUA 3KG0A 5D8HB 3WHIA 3LAMA 4FDFA 1F2GA 4Q8FA 1W2BR 4LR8A 4IDKB 5KG3A 2JHEA 5D0GA 1U8WA 1N5YA 2KDOA 2FHOB 4M5DB 1YZ6A 2YVSA 1KBRA 4ALZA 4EGLA 3FC9A 5L1KA 1U6FA 2COLA 4Y2AA 1RWWB 2JLFA 3G82A 2MJNA 3IGNA 5IZHA 5KOWA 2ZITA 1SL1A 3H8YA 3UN5A 1X4AA 1T3OA 2BJ3A 2MQOA 3JTPA 1XNQF 1S1XB 3CMQA 3MEGB 2VJUA 3NWGA 1FERA 2B7BB 1NSQA 2C1EB 4LIRA 4U7UK 4CZCA 5HSPA 5DLGA 3KHLA 4FF1A 1XNQJ 1HNIA 3DC2A 2ZDPA 5HP1A 2GNKA 4RW4A 4NMLA 3CJRA 2BOPA 5ETTA 4FYYB 2ACYA 4F2RA 1C1CB 3MUTP 3SQGB 1DFDA 2AD9A 2W2MP 3FUYA 3SMZA 1NJXA 5KFZA 3BPSP 3GB0A 1Q0NA 2IAJB 3KLHB 4NXNJ 2BMBA 4USHA 4KHPF 1WACA 2K06A 5IXUA 2KRRA 4TLRA 4NZ6A 3Q86A 1H0HB 4OJ3A 3HPOA 4PPZA 5KG0A 3QRPA 3FEZA 4P9SA 1XEZA 4DCJB 4IH5A 4FNIA 3R3TA 3UNYA 3RB0A 3R7BB 4MK7A 8AT1B 1T9WA 5HQ8A 2VBXA 3CDBA 4IG0A 2ZH3A 2AF6A 1U47A 1RHJB 3A12A 1HHSA 1G1XA 5DM7Q 2DITA 2NXCA 3P96A 2LA4A 1SUQA 4ZVEA 4LSNB 1TUGB 3I32A 1NHVA 4O44B 5CYQB 2DR8A 5KFHA 1S0VA 4K50A 3G8QA 4WKRA 1FRHA 2CNNB 3MPUB 4IDKA 2GIFA 4I6WA 3FCHA 4NYZA 1YJ7A 2FVSA 1DTQB 1ACMB 2V67A 4HI2A 1DY3A 4OHYA 4IG0B 4ZVSB 2QYGA 4D3HA 2HWTA 4DWIA 4AXIA 1RAOA 2OP5A 4Q0BA 1P9QC 2XCAA 1R0CB 4CO5A 3CCJS 3RB4A 4OJGA 4C8NA 3V6HA 4QWAA 4ES2A 3FRZA 4OJHA 1CULA 1DTQA 1UPMB 3QZ7A 4U96A 2K3KA 4FF2A 5HK4A 1RT4A 1Q8KA 2B9YA 2WK4A 3KJNB 4JI6F 3T5LA 3QBCA 4RNMA 3QYYA 2W7PA 2HVHA 5HMWA 3GFHA 2JNJA 2HQCA 4UZCA 3LAKA 1FRMA 3R7NB 2BRLA 1FDAA 3HF5A 2XO6A 1ZYQA 1RBAA 2XM3A 2JFKA 2HHUA 3WDOA 2XO7A 1HQ2A 4DR2J 2XS2A 1HL6A 1NPPA 2GCFA 1SKUB 1X5SA 3C66A 1MMLA 3D1HA 3MHYA 3NOCA 1RBOB 2P8IA 2MDAA 4ID5A 3R8YA 4DN9A 3PIOQ 2CFXA 1Y00A 1IR0A 2V94A 4QYZK 1H7XA 1PJ6A 1VQNS 5CA5A 2ZM6J 4M5DA 3W9IA 3MM8A 1S6PB 2W9BA 2JL9A 3KUHA 2CQPA 2D3OR 1XC9A 1KVJA 1LWEA 1RDRA 5C42A 2QMWA 2DBBA 5DDQC 2PD1A 2A6OA 2VG7A 4OYBA 4LF7J 5HLFA 4AUKA 4J90A 2YPZA 1OMSA 1KDNA 1TKZA 5D15A 2HZAA 1V5IB 1VRQC 3ZZ0A 4DBQA 2YBVA 1G3OA 2DCUB 3QGPA 1TL7A 5LT5A 2ZWPA 3GJTB 3UN3A 4CT9A 5KG5A 1KN6A 2QV6A 3IBFB 1KFSA 3HJFA 4Z7CA 4WXWA 5B09A 2UU9F 5KFTA 1YTYA 1JQGA 3ZTPA 3MURP 2LQ8A 4EYIB 4QWDA 4DUYF 1RTHB 5AXKA 2K1RB 4QU7A 2Q66A 1FRKA 3I4HX 4A8QA 2KZZA 4H4MB 4EUVA 1RHQB 1RT2B 4E8UA 1WSRA 2CNKB 1KSPA 1NK0A 5D3GA 4ED4A 2HFNA 1SQEA 4ED1A 2VPXB 4GKKJ 4B3OA 4DV4F 3HHLD 2DY1A 4P2MA 2XYGB 4EBEA 3T9NA 2PDAA 1X60A 2QX0A 3QNWB 4KPCA 1PG5B 3BEGB 3MR2A 3DLGA 3U7JA 1YJNS 2K7JA 3C15B 4R0JA 2M9KA 2ZH6A 4O3SA 3I31A 5GAGU 1PAEX 1UMJA 2UXBJ 3W5XA 1Q8LA 1NM2A 3SCJE 2E7XA 2BX6A 2DNLA 3ZTRA 4KTQA 3QZ8A 4EBCA 1U45A 4DOZA 3DDKA 2J0WA 3EZUA 3I4PA 1XBWA 2DHXA 1K73T 3F41A 2Z4PA 3FCVA 2E5LJ 1RHKB 2EEYA 3CVKA 2OTJS 2FLOA 4P7TA 4M94A 4JI7J 1FCAA 5CYMA 2YWKA 1U7LA 3SXLA 1WG4A 2ABYA 1UETA 2MZRA 3IMQJ 4V1Ak 1AFJA 2VBWA 4RKUC 2KG0A 2FVRA 2JJ4D 2KJWA 3R9LA 2QLXA 5KG4A 2HNYA 1WDTA 4FKXA 4NASA 1RTDB 4NLYA 4NLPA 1BD6A 1LXJA 4WFNQ 3CNQP 2M8DB 4ELTA 3BGRA 4V19X 3ZZZA 2ZM6F 1HW8A 3FQKA 3HT3A 2HVZA 3BH6B 3TJ8A 2Z58B 3IGVA 2UVUA 4IOCQ 2PMHA 4C97A 1TFWA 3UR0A 4WJBA 4ZMMA 2M2BA 5J2PB 2V4QA 3BR9A 4OZ5A 3RBEA 1HR0J 2HVIA 1NAQA 4KHPJ 4K4ZA 4ZHRA 4O3QA 5IV4A 2V9KA 4EMDA 2W25A 4MFBA 4O23A 2VH7A 3AA8A 1IKVA 1PJ7A 4ZVTB 2CQHA 2VKZG 4UT4A 3KJVB 1JLFB 3L3CA 3R2DJ 1HQEB 1RU1A 3MTKA 3DOMB 4I69A 4DR7F 1U2CA 3K59A 1IBKJ 3MM9B 4KB7A 4XDCA 2B8QA 1IBKF 5T7LA 1N52B 4LVNP 3ZC4A 2QL9B 1IR1A 2CPDA 3KWMA 4U95A 2WONA 5KG1A 4Y2IA 3G87A 2XTJP 3I55S 1FA0A 2JC0A 4NPOA 4UUWA 4Y2KA 4ENOA 1SJ3P 1FTRA 2KVIA 2V6AA 1NK7A 5F0WA 4F0HA 4ANEA 2ZUAA 4I7FA 3VVUA 2O1PA 4J9OA 3CJKA 3KNAA 3K57A 4DN0A 1CJVA 4DR3J 2B9WA 2ZBCA 5F3ZA 4OYWA 4Q7AA 1NBEB 2BKPA 1N5VA 4W92B 2NCKL 2YNHB 3E01A 4DR5J 2VONA 2VBZA 4RUBA 1UWAA 3KG4A 4PPDA 1M5VC 2MLXA 3Q8QB 3UD3P 1T9YA 2C2ZB 4Y28C 1YBUA 3K17A 4RZRA 5EWGA 2RKIA 3IA0A 3MCOA 4HDHA 2R8IA 1KVIA 4I2QB 5CAAA 1JK9B 4B9MA 4C3LA 4F0MA 5C5JA 2DCLA 1F5BA 5J1PA 4MYTA 2FJDB 3M6VA 3JSMB 2ZKUA 2XY6A 3CD6S 5A0YA 4HR2A 3T19A 4CYUA 5SZTA 4OYZA 4RBUA 2ZD1B 1CVJA 1S4EA 1GMUA 3GV5B 3ZFVA 1NB7A 3FJ2A 1TL1B 1QSYA 1N48A 1WUUA 2EK1A 3ENVA 5EWEA 3KLEA 3M8RA 1PKUA 1TMMA 4TY8A 2UXDJ 1B0VA 2CDRB 3W2VA 3UDVA 4UF4A 1UWBB 3DLEA 1XR7A 1UEKA 1YRXA 2NXNA 2BQRA 3MM5B 4OL8A 1EJ7L 3J80Y 2Y1IA 4DX6A 2IM1A 4NRUA 5SUHA 2W7AA 1PC5A 3BDPA 2DHAA 1WF2A 2XB2D 4Q45A 2DKOB 2Z30B 2NZ4A 4QR0A 1WJ9A 1FNXH 2FTRA 3I9V9 3JYTA 3OL9A
chains in the Genus database with same CATH topology
5ETQA 2F63A 1EQMA 2F65A 1HQ2A 2BMBA 3HSGA 3ILOA 3MCMA 4CYUA 1RAOA 3KUEA 1F9HA 4M5JA 1KBRA 4CWBA 5ETLA 1RTZA 3HD2A 3HSDA 1TMJA 5ETKA 4PZVA 1TMMA 1CBKA 1G4CA 5ETSA 4AD6A 3KUHA 4M5IA 1RU1A 4CYUB 4F7VA 1EQ0A 5ETPA 3UDVA 3HSJA 3ILJA 3HCXA 1IM6A 3ILLA 4M5GA 1EX8A 2CG8A 3ILIA 1HKAA 3HSZA 3IP0A 3MCNA 4M5HA 2QX0A 3QBCA 5ETVA 4M5NA 3UDEA 1RB0A 5ETRA 3HD1A 5ETNA 3HT0A 5ETOA 5ETTA 3MCOA 3KUGA 4M5MA 3UD5A 1RU2A 4M5KA 4CRJA 5ETMA 4M5LA 1Q0NA 1DY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ETQ A;  2F63 A;  1EQM A;  2F65 A;  1HQ2 A;  2BMB A;  3HSG A;  3ILO A;  3MCM A;  4CYU A;  1RAO A;  3KUE A;  1F9H A;  4M5J A;  1KBR A;  4CWB A;  5ETL A;  1RTZ A;  3HD2 A;  3HSD A;  1TMJ A;  5ETK A;  4PZV A;  1TMM A;  1CBK A;  1G4C A;  5ETS A;  4AD6 A;  3KUH A;  4M5I A;  1RU1 A;  4CYU B;  4F7V A;  1EQ0 A;  5ETP A;  3UDV A;  3HSJ A;  3ILJ A;  3HCX A;  1IM6 A;  3ILL A;  4M5G A;  1EX8 A;  2CG8 A;  3ILI A;  1HKA A;  3HSZ A;  3IP0 A;  3MCN A;  4M5H A;  2QX0 A;  3QBC A;  5ETV A;  4M5N A;  3UDE A;  1RB0 A;  5ETR A;  3HD1 A;  5ETN A;  3HT0 A;  5ETO A;  5ETT A;  3MCO A;  3KUG A;  4M5M A;  3UD5 A;  1RU2 A;  4M5K A;  4CRJ A;  5ETM A;  4M5L A;  1Q0N A;  1DY3 A; 
#chains in the Genus database with same CATH topology
 3RBZ A;  2MKY A;  1Z2L A;  2G1D A;  3D1O A;  3KJQ B;  2FZG B;  3JSR A;  2AMC B;  2CJQ A;  5KFU A;  3KLG B;  1CLF A;  1NK4 A;  1BQM B;  2YXL A;  3M2U A;  3MFH A;  4IKA A;  1NPK A;  2E44 A;  2ATC B;  1YI2 S;  1VRT B;  3EGZ A;  3QLH B;  4HL9 A;  4I6Y A;  3DDN A;  2HYI B;  3HFZ B;  4O0N A;  4ZPA A;  2ZJR Q;  5KTQ A;  3RW6 A;  2AGP A;  1GAO A;  2DXD A;  2KL8 A;  3FNN A;  3EX7 B;  2NRE A;  3PO4 A;  2EVZ A;  4X4O A;  2OIH A;  3L95 X;  1UVN A;  3UVJ A;  2XMA A;  4PXC A;  4YN3 B;  2QJ3 A;  3LP2 A;  3TWZ A;  3CUL A;  4GC6 A;  4LF8 F;  2RF2 B;  4Q5V A;  1TR0 A;  4L75 A;  4B3R J;  3H2U B;  3M8W A;  2MQL A;  2RIJ A;  3M8P B;  3NS6 A;  2WVD A;  4JI3 J;  4LF8 J;  2VFR A;  2ZOF A;  1ZPW X;  2BUN A;  1JLB B;  2IDE A;  2NXJ A;  3OSP A;  4C0O C;  3K89 A;  3EXY A;  4OX7 A;  1RT2 A;  2XUL A;  4FPI A;  3AQP A;  1KON A;  3G86 A;  3O44 A;  1VIO A;  3QFH A;  1M5O C;  5HLF B;  1I6J A;  2JEF A;  4WK1 A;  1RT5 A;  1AZS A;  4ICL A;  2FJE B;  1FNM A;  5CXT A;  2MQ8 A;  3K58 A;  1AW0 A;  1X9S A;  3CCE S;  1QM9 A;  2MTL A;  4IG3 B;  1Q7Y T;  2VFS A;  2NUU G;  4J5O A;  2BAB A;  3D6T B;  3QT5 A;  5H9E K;  1S9E A;  1XMB A;  1N88 A;  3PR4 A;  3I6P A;  4M5N A;  1N8R T;  3BKT A;  3FBF A;  1LK5 A;  3CCT A;  5K5M A;  5K8O A;  2OH2 A;  4B9S A;  2C3U A;  3J81 j;  3HP6 A;  4C0B A;  3JQK A;  2YKN B;  3CJ4 A;  3P49 B;  1FKO A;  1F60 B;  1HWI A;  1KS2 A;  3MMB B;  1RWU A;  3N0V A;  5CH7 B;  2D3O 1;  1HR0 F;  4L76 A;  1OSC A;  1S1V B;  5GAE I;  3CCW A;  1O0P A;  1T02 A;  2LEA A;  2WON B;  4RX6 A;  2BAC A;  2VFT A;  5L1I A;  2M4M A;  2D7S A;  3SZ2 A;  2KXN B;  2OPQ A;  3X1L B;  2BDP A;  2I38 A;  2MYF A;  4IFY B;  4RNO A;  1VQL S;  3OXG A;  1TFY A;  4ZP7 A;  5I42 A;  1RI7 A;  4ZVO B;  3IFE A;  1HBO A;  1WHV A;  4MJK A;  2EFN A;  3C15 A;  3EVM A;  4HVZ A;  4RW9 B;  1SJ1 A;  3DLG B;  1ZM2 A;  2A6M A;  3HSZ A;  3N4W A;  3W9J A;  3KK2 B;  4ED3 A;  2FZK B;  4E0D A;  2EK6 A;  2HFU A;  2W24 A;  2GHW A;  2LA6 A;  4P52 A;  5GAE U;  2D41 A;  4C11 A;  3PX0 A;  3ENQ A;  1Y4Z B;  2R7W A;  4B3S J;  2HGM A;  4OZ1 A;  5DG7 A;  4NRT A;  3BQ2 A;  2D74 B;  2AJF E;  1GXL A;  2OEL A;  2R7X A;  1FHT A;  1RT7 B;  2CPH A;  1FRI A;  4FYV B;  2XNQ A;  4ID8 A;  3QAU A;  3SV3 A;  2V8V A;  2HRU A;  1L3K A;  3GR1 A;  2UXB F;  1GFW B;  1S49 A;  3C16 A;  2N3O A;  3I56 S;  3MR7 A;  4YR2 A;  1UFL A;  5I3U A;  2AGQ A;  2IA6 A;  4ZP9 A;  1FX4 A;  1FRX A;  4YB5 A;  3CD5 A;  3M8Q A;  3V6D B;  2F4F A;  1JMT A;  2UUB J;  4PG6 A;  2YNF A;  2CIM A;  3UCG A;  2B5J A;  2HRY A;  3V2U C;  1TV6 B;  2XLK A;  1CC7 A;  4UUX A;  3ULH A;  1GXU A;  2WVE A;  4IRC A;  3N28 A;  3LAL A;  1S79 A;  5E5N A;  2DR7 A;  2RVJ A;  3FEY B;  1CJK B;  1TKT B;  3FDS A;  4J9P A;  4ER8 A;  1CC8 A;  2DD8 S;  2B6A A;  2AJ4 A;  2C3Y A;  3JAM U;  4DG1 A;  2E7W A;  3BBC A;  2NSC A;  4DL5 A;  3QO9 B;  5KFM A;  1YG0 A;  3Q8S B;  4NLX A;  4LF2 A;  1AA1 B;  3OTO F;  1RTI B;  2FHM A;  5LMN J;  1KOO A;  3D1Q A;  2C28 A;  2WZ1 A;  3ISN D;  3GJQ B;  2ASY A;  2E66 A;  1S1X A;  3S6E A;  1VK8 A;  5ADZ A;  2QLB B;  1IJE B;  3IS9 A;  2A2C A;  5HVH A;  5KFD A;  5F8G A;  2XWY A;  2G13 A;  3MEE B;  3Q8R B;  2VQF J;  4I2P A;  1X5P A;  2O01 C;  3HCX A;  5B0B A;  7FDR A;  2HLT A;  1YX2 A;  3OR2 B;  4MIW A;  3V5R A;  2QSF A;  3R6L B;  4ZVH A;  4KGX B;  1RTH A;  4RW4 B;  4B17 A;  4C48 A;  2AZ3 A;  3HFV A;  2BV3 A;  4TNO A;  1VOM A;  1IWG A;  3R97 A;  1QSS A;  1W25 A;  1Q8B A;  4JI4 J;  2CKW A;  1HBU A;  3CJQ A;  4LBI A;  5IC4 B;  3S01 A;  2QA2 A;  4QIW D;  5KFG A;  4DCO B;  4P6Q A;  4NXM J;  1S77 D;  2X3D A;  1D9F A;  5J1E B;  3GSI A;  5B0C A;  1SL2 A;  3QAT A;  1IXK A;  2BEF A;  4M5J A;  4DSI A;  1VBZ A;  3MTJ A;  1NDP A;  2W2Q P;  4NA1 A;  2FGO A;  3KTQ A;  1K44 A;  3O2I A;  3P5T L;  3TI0 A;  3P45 B;  3MFI A;  2AP6 A;  3CJ0 A;  1S6O A;  1U24 A;  4LRE A;  5H9F K;  4NLS A;  2G2O A;  1N54 B;  3MAH A;  2BJ7 A;  3TOQ A;  2I2Y A;  2Y0B B;  2K1R A;  3OL6 A;  3O1L A;  5GMK a;  2ZH4 A;  1MWZ A;  2DNN A;  2LDI A;  4LSN A;  4O44 A;  2HIQ A;  5CYQ A;  3POT B;  3J7Y U;  1MRO A;  1FKA F;  2CJA A;  1VQM S;  3I5B A;  3KK2 A;  3IXQ A;  5HL7 Q;  1S6Q A;  1JXV A;  1BHN A;  1TP7 A;  2EG2 A;  3N79 A;  4OYO A;  1TL3 B;  4ZVR B;  3ISN C;  3OFH A;  4WP3 A;  3SDE A;  2X1F A;  3DRP A;  5BJR A;  2MQQ A;  1YJU A;  1WTF A;  5BYQ A;  2JEG A;  4QWB A;  1H2U X;  2ZC3 A;  3R2C J;  2BAN A;  2RQC A;  4WBF A;  2H5E A;  3UFC X;  2XSJ B;  2RQM A;  1FXR A;  2VG7 B;  3MI7 X;  3THT A;  5KFF A;  2QSW A;  1T7P A;  3EZ5 A;  4DFK A;  2DO4 A;  4X62 J;  4XPE A;  1Z2Z A;  2J7W A;  1RAG B;  1FFW B;  3FBE A;  5BXI A;  3GLJ A;  4Q43 A;  3ILL A;  2NS1 B;  2HQI A;  3NEK A;  1QAX A;  1GNK A;  1RAB B;  4IH7 A;  4F4W A;  1UW4 A;  4DR4 J;  4QWC A;  3V4I A;  2RML A;  2A18 A;  2YPY A;  3AT1 B;  3CJ8 A;  5IFM A;  1SPB P;  2AYM A;  2BKO A;  2Z2Z A;  3KK1 A;  1T9T A;  3H5U A;  5CD4 H;  2RDJ A;  1ZTW A;  1WEX A;  1RU2 A;  3MED A;  3HHK A;  5IT0 A;  2BE2 A;  5HRO A;  4W90 B;  1TKT A;  1Y10 A;  2P6T A;  1P1T A;  2FJW A;  4K0K F;  2UVW A;  3GCW P;  2BM1 A;  3WC2 A;  2RIL A;  2LDY A;  3NG8 A;  5HP1 B;  4UTG A;  1F9F A;  4ZCK A;  4CTA A;  5F8M A;  1NXI A;  2MKK A;  1IQT A;  1NB2 A;  1Y3K A;  1TL4 A;  4P75 A;  1JKH A;  1ELO A;  4NLT A;  3KJF B;  3M9N B;  2J8A A;  4OFZ A;  2OKQ A;  3HXM A;  4OI0 A;  1T9U A;  3HMJ G;  2O67 A;  1Q5Y A;  4ECY A;  1DQ9 A;  1FDD A;  2CQD A;  1YJR A;  2YNG A;  3FBC A;  5KFK A;  3T1Y J;  1QE1 A;  2KT2 A;  4J9L A;  2E29 A;  2DH8 A;  3KFW X;  5EUH A;  3I0R A;  1AXQ A;  1R8P A;  4C6A A;  4NLQ A;  3HFK A;  4A8W A;  3H42 A;  2WBM A;  2XZT B;  4J37 A;  1G6B A;  5J1N A;  1WDD A;  4ECX A;  1I5O B;  1VQ6 S;  1UA0 A;  2J8S A;  1XR6 A;  2OI2 A;  2WB1 D;  3AFG A;  3OLB A;  1U26 A;  2IM2 A;  1L5U A;  3MXH P;  2OAU A;  1C4A A;  1SUQ B;  2BR0 A;  2DRA A;  2R7O A;  3W66 A;  2I8E A;  1IKY A;  4I68 A;  2AYG A;  2ASJ A;  3L4B C;  4MK9 A;  2FJB B;  3HHL C;  4W98 A;  1OYE A;  1SKW A;  3CC7 S;  1QAI A;  2ZZN A;  4OV1 A;  3US5 A;  4ES3 A;  4DZ6 A;  5F8I A;  3IR7 B;  2PEH A;  1DLO B;  1CSJ A;  2ZVI A;  3HHN B;  3CJT A;  1L3V A;  3DRS B;  2YWW A;  2LYV A;  3M2R B;  4LF5 F;  1WC5 A;  3JQJ A;  3MEC A;  5AE1 A;  4QW8 A;  3MAQ A;  3RR8 A;  4NXM F;  4BS2 A;  1JJH A;  2KTQ A;  5J2Q A;  2VPZ B;  1L3U A;  4K4X A;  1S1V A;  1A9N B;  5B7W A;  4N47 A;  3NNA A;  2YY3 A;  3W5Y A;  1UKU A;  2C2N A;  4C9D A;  4WE1 A;  3B54 A;  4ZP8 A;  5G0R A;  2KU7 A;  2L48 A;  4ZJL A;  3RRK A;  1KVK A;  3C6U B;  3PFE A;  1X4F A;  1TKD A;  1RHU B;  5AXL A;  4C8O A;  1FDN A;  2DNR A;  3LP1 A;  2I6W A;  5K14 B;  1YVF A;  1IKX A;  4WU2 A;  5ETK A;  4ZVP B;  5IWA J;  4QW9 A;  4CYU B;  2DNO A;  2ZNZ A;  1EET B;  1RWX B;  2YWE A;  1NH8 A;  3MD3 A;  2F40 A;  4ECS A;  3R6G B;  2R8K A;  1N36 J;  1Y5N B;  4A48 A;  5CQG A;  1RA7 A;  3GPA A;  3HHE A;  4XIU A;  1W7W A;  1C0U A;  1WC6 A;  2MKS A;  3HX9 A;  2KRB A;  3NGS A;  4CLL A;  2RRN A;  1VQK S;  3UQS A;  5AE3 A;  3UCU P;  2PSZ A;  1RT7 A;  5C25 A;  1J5E F;  4CNZ A;  4EWT A;  2ZEJ A;  3TX8 A;  3IG1 A;  1FT8 A;  2XG8 A;  4JI4 F;  5KT6 A;  4QR1 A;  4ZA1 A;  1QTM A;  1S7I A;  3Q8Y A;  4YDX A;  3DHX A;  3GON A;  3VAL A;  1DRZ A;  2HFS A;  3T5H A;  2RNE A;  1S9G B;  2HBY B;  1KQF B;  2PE8 A;  2X51 A;  2RF2 A;  4K5R A;  2MKC A;  4KIA A;  4OJ1 A;  3LP2 B;  2FLP A;  2C22 A;  1X4C A;  2AU0 A;  1UFK A;  4D3G A;  4CLY A;  3CTR A;  3LTO A;  2RJZ A;  4ZJQ A;  4F4Y A;  2PC6 A;  2I0X A;  1Q53 A;  2ALY B;  3BGF A;  1A6L A;  4X4P A;  4O3R A;  5KFI A;  3D6H B;  3QT8 A;  1HD1 A;  2G2Z A;  5M2U A;  2BBE A;  2P5V A;  4N77 A;  1U0H B;  4ZPT R;  5IS2 A;  1D1U A;  4NE9 C;  1VR6 A;  4JV1 A;  3ZTQ A;  2RU3 A;  2IIH A;  2KKH A;  2M88 A;  4EFA C;  2VQE J;  1CQN A;  4DR6 J;  3ETO A;  1DAX A;  1YIJ S;  2DB1 A;  4WPA A;  4IRD A;  2EW9 A;  2R9L A;  1WOP A;  1ZPV A;  1TL1 A;  4QIF A;  4ZVG A;  5B0A A;  3G4S S;  1NEE A;  5DGA A;  3NCR A;  4OI3 A;  4PG5 A;  3J7Y I;  5GAG I;  5KFP A;  4URQ U;  4QQB A;  3A8I A;  5HMZ A;  2KJV A;  2MZJ A;  1X4E A;  3KHH A;  1FVQ A;  3TQE A;  2AKW B;  3HHD A;  2Q43 A;  3HJV A;  4QWE A;  4EBD A;  1K9M T;  4EI2 A;  3GJR B;  2GVD B;  1KFD A;  1UEV A;  2IJN A;  3OSN A;  1M5H A;  4DR1 J;  2F8H A;  2RKI B;  4G6V B;  3CED A;  3M32 A;  2ROE A;  4NYO A;  4M5H A;  4DR1 F;  1S1T B;  4M1K A;  4OIX A;  4NXN F;  3ET6 B;  1H73 A;  3LOU A;  3KG1 A;  2J0X A;  3MEC B;  2HFO A;  1I3O B;  3W63 A;  4RR5 A;  2MXY A;  4OYI A;  2XS5 A;  4IYQ A;  2JRS A;  2ILZ A;  3DXB A;  2K3I A;  1S9E B;  2PMW A;  5CAB A;  5KFE A;  4DMZ A;  1WG5 A;  2Y3Y A;  4YDD B;  2ZOG A;  2W9A A;  1LXN A;  1X4D A;  4LRF A;  3G6E S;  2B9X A;  3T9Z A;  1EAY C;  2IBO A;  1R0B G;  4LRB A;  2V4R A;  4M95 A;  2V2V A;  1Q79 A;  4CP5 A;  1HPZ A;  1AYE A;  1Z1Z A;  2PA8 D;  3ONQ A;  4ELV A;  3E3X A;  2EPI A;  3C6U A;  1RAA B;  4RO0 A;  3X3U A;  5MAO A;  1E6V A;  1ZA2 B;  4I0W A;  1DUR A;  1RT1 B;  5D4O A;  3MMA A;  3VHQ A;  3H40 A;  2VIH A;  3RJM B;  3KXD A;  1QVG R;  1NDL A;  1LW0 B;  2WOM A;  1BWE A;  3CJ5 A;  5KFN A;  2GW8 A;  4YB6 A;  4U7U D;  5C2C A;  4DPX A;  3CT9 A;  5C25 B;  2HEK A;  1B70 B;  4NX9 A;  4WWS A;  2W9C B;  4OHV A;  3MAA A;  1C0U B;  1H3D A;  4EZ6 A;  2VDI A;  4KKO B;  3T5K A;  4CM2 A;  2W2N P;  1RTJ B;  2J6T A;  2R7S A;  4ZCM A;  4KO0 B;  2WTF A;  3IAS 9;  2M52 A;  2VG5 B;  1GMW D;  2CQ3 A;  2EBE A;  2MZ1 A;  1WTB A;  1RZM A;  2V69 A;  4QZV B;  1M0S A;  2E5H A;  4DQI A;  2FPH X;  2VAS A;  3PEH A;  3QT6 A;  3IBC B;  3KNG A;  2ZH8 A;  4GVB B;  4YUD A;  3DGV A;  1G7C B;  3TVK A;  2DNQ A;  2CQ4 A;  1N6Q B;  1BQM A;  3LUY A;  3PYE A;  3TZX A;  5AJ3 J;  1HNX J;  2HHT A;  3V81 A;  1SV5 B;  5A8R B;  3GTY X;  1I1G A;  5LMU F;  5AJ3 F;  4J7C A;  2LXF A;  2ZC4 A;  4FVC A;  3I9Z A;  5KG6 A;  4JI7 F;  2GMJ A;  3MM8 B;  4A4J A;  5HRO B;  2Y8W A;  1KQS R;  4H54 A;  3T41 A;  3R5C A;  5F9N A;  1HKA A;  1IKX B;  2U2F A;  1IBM J;  2B3T B;  3ZNU A;  2W8L A;  1TKZ B;  3AOB A;  3BSA A;  2AHO B;  4U67 Q;  3OXF A;  2ZJP Q;  1UJ6 A;  4PQU B;  2NXU A;  4QJV A;  3NBP B;  2MHE A;  3SSQ A;  3WX8 A;  1R3N A;  1M5S A;  4RUC A;  1S10 A;  4U7C A;  3CF5 Q;  1R6V A;  4PKD B;  1JXL A;  1SCJ B;  5FDL B;  5GME A;  2IRU A;  3Q22 A;  1NJZ A;  1U49 A;  5IQQ A;  4GKJ J;  1MMN A;  1Q1K A;  2EFO A;  3AJ1 A;  1N34 J;  4GKJ F;  3UCZ P;  1WKJ A;  2FDN A;  4BWJ A;  2F8E X;  4CWB A;  3AD7 C;  2RD5 C;  3GG1 A;  4HHU A;  3M2V A;  1JNR B;  3FRY A;  3NGR A;  3W1Y C;  2OPR B;  4Q44 A;  4RPF A;  5L8R C;  3FK4 A;  2R7U A;  3M9O B;  1RAJ A;  2VIC A;  1LWC A;  2IRY A;  2XMW A;  5BR8 F;  5E2Q A;  2UVR A;  2FHJ D;  1SC4 B;  3QGI A;  4NL5 A;  1SKR A;  3NMA A;  1HHQ A;  3MCN A;  2FLN A;  2BRK A;  2O66 A;  2CDQ A;  1EB0 A;  3KLI B;  4ZVU B;  5K9F A;  2KT3 A;  3CJK B;  2DEJ A;  2G1H A;  2EI5 A;  4GMK A;  2UUT A;  4JI2 F;  1F2H A;  4LFC J;  1H74 A;  2UZA A;  4FYW B;  1RAC B;  2DO0 A;  2MST A;  4A47 A;  3NGK A;  1REG X;  2CYY A;  1UA1 A;  1Z4U A;  2JX2 A;  1GT8 A;  2V8P A;  3J80 U;  4CO2 A;  1FXD A;  3Q24 A;  1SJ4 P;  3NNC A;  4A8F A;  3BM7 A;  5E0O A;  4DJB A;  2C2M B;  4FBT A;  3BPD A;  4R0E A;  4IQX A;  4NLG A;  1TKX A;  3QJP A;  2DIV A;  3SDE B;  1JJ4 A;  1QAJ A;  4MIA A;  2QA4 S;  1VQ7 S;  4CH1 A;  3W61 A;  2DHG A;  4PXD A;  3SFG A;  3S1T A;  4LFA J;  1NSK L;  4DCP B;  2M8H A;  4I56 A;  4DL6 A;  4DSJ A;  1VIS A;  2MZT A;  4QPT A;  4LF4 J;  4IUF A;  1XK8 A;  2ZH9 A;  3OTB A;  1S76 D;  1JIH A;  3H4B A;  1WEZ A;  2BJD A;  4UW2 A;  1S5Z A;  4X2B A;  3AB4 B;  4X4R A;  3D6F B;  1U1N A;  2CUY A;  2ZZT A;  3P3D A;  4Z2X A;  1GMV A;  2QTW A;  4P74 A;  3PVX A;  4ETZ A;  3OUY B;  2FY8 A;  4DR2 F;  4MH8 A;  4Y3C A;  2E1P A;  1Y11 A;  4KC5 A;  1OJ4 A;  4J9V A;  4FPR A;  2XS7 A;  2J0S D;  4DV1 F;  4X4S A;  4OHW A;  2HZC A;  1P8G A;  3QGG A;  1M5K C;  3BGO P;  4CLU A;  4R8U B;  4ILR A;  1YGY A;  4G1I A;  2XLJ A;  2R7V A;  2LMI A;  1N34 F;  4DR4 F;  3NY0 A;  4RL1 A;  5CYM B;  3PXG a;  1R0A A;  2FVC A;  2IFX A;  4PCQ A;  4PRF A;  4NMX A;  4HH0 A;  4P2S A;  3J81 U;  2IM0 A;  4G1Q A;  2XZW A;  2H48 B;  2VFU A;  5HQM A;  2XBP A;  2YWH A;  2AJ1 A;  2LFV A;  1UFW A;  5HVG A;  2GA7 A;  2DXF A;  3I0S A;  3MEG A;  1ARO P;  3MDF A;  3HHL A;  3N6N A;  3R7S B;  4LSL A;  1GX6 A;  3TP2 A;  1VQP S;  3KLF B;  3HSG A;  3QFW A;  4C0H A;  1TUW A;  3TZY A;  5GMD A;  3FMW A;  2F4V F;  5D0R A;  2OEJ A;  3DMJ B;  3D54 A;  4DV0 J;  3M7V A;  3TVY A;  2AYB A;  3SCK E;  2OTL S;  3DOK B;  3LP0 A;  4LBH A;  1JWW A;  2HNZ A;  5EHH A;  1C0T A;  4J9Q A;  3EGN A;  2AX1 A;  3EWG A;  3SV4 A;  1J27 A;  1LW2 A;  2HS4 A;  5E3A A;  3FCW A;  1DBD A;  2BM0 A;  2HK3 A;  1URR A;  2MKI A;  4P2X A;  1S1W B;  1WWH A;  3DXS X;  2HG4 A;  2FB0 A;  2M3D A;  3DN9 A;  3VGT A;  4Y6I A;  4Y00 A;  3IBW A;  4J9K A;  3J7A N;  4NCG A;  3LO3 A;  5L39 A;  1PO6 A;  4PR6 A;  4ILL A;  1R8A A;  2PN6 A;  3A8E A;  1VMB A;  3CCZ A;  4M8L A;  1NUE A;  2KB2 A;  1HBO B;  2PFD A;  5KFQ A;  5KT2 A;  5D3G B;  3TAQ A;  2AJQ A;  6FD1 A;  2UXC J;  2WCX A;  2GAH C;  1KHW A;  3BSO A;  3OVA A;  1VBY A;  1WNE A;  3F0N A;  2DEI A;  4F3Q A;  2KXF A;  1V3S A;  1VBK A;  5JVH Q;  1T0T V;  3PW2 A;  2DGU A;  3T6B A;  9ATC B;  4DSF A;  4ZLP A;  4KGV B;  4ZP6 A;  2CPI A;  4FBU A;  4H4O A;  3OFF A;  1AUS L;  3LA0 A;  3RBD A;  2ERR A;  1XNR F;  2JLE A;  1JLG B;  3NMR A;  2L3M A;  3GCX P;  4KSE B;  4JV5 J;  3OFE A;  2YKN A;  1OY8 A;  4URS A;  3KYL A;  4L73 A;  3ETM A;  3G6X A;  4P2F A;  2KYZ A;  3V4M A;  1O51 A;  2QL5 B;  1RSC A;  3HZG A;  4IOB A;  2CQG A;  4KAI A;  5L9X A;  3M1V A;  6AT1 B;  4ZOS A;  4W4M A;  1D8Z A;  4DSL A;  3DRP B;  4WYL A;  1HNW F;  5DDO C;  1RCX B;  1JXE A;  2A2D A;  1V9O A;  5ETM A;  2LLZ A;  2ZBP A;  5I42 B;  4DV3 F;  3TQ1 A;  4IFY A;  2XEX A;  1DZ5 A;  3D9B A;  1MN9 A;  4C98 A;  2VJV A;  4N76 A;  2CQ1 A;  1SJF A;  1RT5 B;  1WKK A;  2HWH A;  3FGV A;  1CEZ A;  5KFV A;  2QYC A;  3BO3 A;  2Q6C A;  1EP4 B;  3NXZ A;  3EM1 A;  3B8H A;  3H5S A;  1UCN A;  4PYD A;  1ZAV A;  2WHO A;  3G96 A;  4F4X A;  4ED0 A;  2D69 A;  4RJV A;  2NPI A;  2V63 A;  2HHP A;  3ILI A;  3M6U A;  2CWK A;  5HI7 A;  1WC1 A;  2XGP A;  2MEW A;  2LEP A;  2HND A;  4ZPW R;  4PQA A;  1CQM A;  3BGU A;  1R31 A;  2RS2 A;  3RU0 A;  4OHZ A;  1QUV A;  2RS8 A;  4OI1 A;  2QRR A;  1REV B;  1R43 A;  1RT4 B;  5KFL A;  1TAQ A;  2KFY A;  3CXC R;  1MN7 A;  5A2Q Y;  4YHH F;  1X8D A;  4QPX A;  1SV5 A;  2GX8 A;  4USK A;  5D6G A;  3MR3 A;  3OLA A;  1R8H A;  3PX6 A;  4K4Y A;  1T9V A;  2IY5 B;  2LEB A;  1FK9 B;  4IO9 Q;  4DV2 F;  1B0T A;  3TZW A;  2OUG A;  2E1M C;  3BB5 A;  4URG A;  3E2E A;  1B7Y B;  1PYT A;  3JTN A;  2HND B;  1MMD A;  4NA2 A;  2JOQ A;  3DMJ A;  4YOE A;  3MMC B;  3NCP A;  3NGD A;  3OHA A;  2CPX A;  2V50 A;  4HT7 A;  3BSC A;  4K2X A;  2R2S A;  2ZHO A;  1OY9 A;  2AJ2 A;  5ETP A;  1B0P A;  3PHT A;  4A8X A;  5J1E A;  3LWL A;  2SXL A;  3M6X A;  4YB7 A;  3CCU S;  4UY8 5;  3LF0 A;  1LQ9 A;  1RAE B;  3C14 B;  3AD8 C;  1RT6 B;  3FKB A;  3R5B A;  3MM6 A;  1SH0 A;  5IQ6 A;  3ZO7 A;  5J2N A;  4IRK A;  5F3T A;  4F0K A;  1VK3 A;  3FZB A;  2QIF A;  1RTI A;  1NHK L;  5LMU J;  1WOR A;  4PYA A;  1V3Z A;  2C2O B;  3DRY A;  3SCI E;  2WSE C;  4O4G A;  1T03 B;  2XQC A;  4IR1 A;  3K5P A;  2IAJ A;  4M5K A;  5KFR A;  4NZ7 A;  3ISZ A;  3KLH A;  1FKO B;  1MG7 A;  1TQL A;  2QZ8 A;  1UWB A;  3DLE B;  3DRX A;  4NA3 A;  2GHP A;  5RUB A;  3CUN A;  2BE2 B;  3SBM A;  4X64 J;  1OSD A;  2CQC A;  3ITH A;  3TJA A;  3OR1 B;  3KLI A;  4A8M P;  1T11 A;  5A6W A;  5EGY A;  3Q8P B;  3CCR S;  1HWU A;  4FP9 A;  2OPP A;  3ICL A;  4NEZ A;  2HPU A;  3G82 B;  3KKF A;  1XMO J;  3MR6 A;  4NLD A;  4DX5 A;  1U6B A;  2MZQ A;  4NLR A;  2CQB A;  2ZDO A;  1QTN B;  3CCV S;  1ITP A;  3BRE A;  2E9T A;  1RAH B;  2W8K A;  2V2Z A;  4MYU A;  4USW A;  3ZTO A;  3QWP A;  5DET A;  4QR2 A;  3DLH A;  5LM7 E;  2ROG A;  1VIX A;  3RG6 A;  3EVW A;  4M5L A;  4BBY A;  3C6T A;  2JZ5 A;  3IRX B;  2DK2 A;  2DNK A;  2F63 A;  4CO1 A;  2LP4 A;  3LGN A;  1VYA A;  4KO0 A;  4LVO P;  1BQX A;  2B43 A;  1GQE A;  3F44 A;  3CDA A;  4YQW A;  3PY8 A;  2FC9 A;  5T41 A;  2JEJ A;  1MRO B;  2V8G A;  4A46 A;  3HD2 A;  3POT A;  2NYI A;  1S99 A;  2B4U A;  1B64 A;  3F73 A;  3R5D A;  5E41 A;  3JS9 A;  1RLD A;  3DKD A;  1TEL A;  4XPC A;  4RU9 A;  2EBG A;  1SKS A;  3DM2 A;  5F8L A;  1N5Y B;  2DRB A;  5KFW A;  2NQP A;  3NWR A;  2OEM A;  3AHP A;  3AOD A;  2CG8 A;  4ECQ A;  2E1A A;  3GJS B;  4UST A;  1TZ0 A;  4X65 F;  1WSV A;  3DI6 B;  2XGQ A;  4LF5 J;  2MLZ A;  3MM7 A;  3OQ2 A;  4OZ3 A;  3PO5 A;  3GE9 A;  5T7L B;  3P4U B;  2R42 A;  3PTW A;  4ZN3 A;  1S59 A;  3DU6 A;  5CCM A;  4WP9 A;  3G8S A;  1N33 J;  3VZI A;  3H4D A;  4PG7 A;  5HJX A;  5DQH A;  1QSL A;  2FHJ A;  1HWK A;  2AEF A;  4N8O A;  4AQY F;  3KOA A;  3K5L A;  4C8Z A;  4X4N A;  1E6Y A;  4FKY A;  1DHM A;  2FD2 A;  4KFB B;  4DZD A;  4UQG A;  4JV5 F;  4NLV A;  1F6T A;  1QAY A;  1W26 A;  2W2O P;  4I7F B;  2PFF B;  1Q81 T;  2VB6 A;  2MY8 A;  2ZH5 A;  1R0A B;  2XMM A;  4WXO A;  2HHH F;  2MY7 A;  4I2P B;  4NYP A;  3CD0 A;  5FDL A;  3SFU A;  3EPI A;  1FKP B;  2H5I B;  5IT4 A;  2KG1 A;  3MOZ A;  1YDL A;  2CQ0 A;  2FZC B;  1MWQ A;  2L9D A;  1IKW A;  3IS9 B;  4KT0 C;  2E7V A;  1XJW B;  2VG6 A;  3MEK A;  3NS7 B;  1N56 A;  2CPY A;  4B9L A;  4K4S A;  4DV3 J;  5H9E J;  4KGM A;  1H6K X;  2P9E A;  2XNR A;  5I3U B;  4K2J A;  2YNH A;  2IRX A;  3OFG A;  2GQQ A;  3OBI A;  1JX4 A;  3QRQ A;  2ALZ A;  5ETQ A;  3FSY A;  1WF1 A;  4RNF A;  3K5O A;  4OX9 F;  3MR5 A;  4I2Q A;  2CJY B;  3DRR B;  5DO2 A;  3OR1 A;  1AZS B;  2QFI A;  3OPK A;  2DRD A;  4ICL B;  2HGN A;  3WQP A;  2KH9 A;  2UVV A;  5A2Q U;  1K0V A;  4PAB A;  1S0N A;  3L09 A;  3CB4 A;  2V8H A;  4MK8 A;  3I82 A;  4WE1 B;  1LW0 A;  2WOM B;  3OVB A;  4TU9 A;  1U02 A;  4JB8 B;  3I5A A;  4PG4 A;  4Z37 A;  2KM8 B;  2FVP A;  2F4V J;  1FO1 A;  2EC0 A;  1X4B A;  2F5G A;  2RUS A;  3GYN A;  1CS4 A;  4ZPD A;  2YWG A;  2YX7 A;  2UV8 G;  5GVQ A;  4DPO A;  2WSF C;  4HHH A;  1V3R A;  4KKO A;  3DLK A;  3O8W A;  4DR7 J;  1KTV A;  2FVQ A;  2YTC A;  3HUL A;  3K8V A;  3PR5 B;  2XLI A;  1QJH A;  1LWX A;  3C19 A;  3DGP A;  3PNI A;  2H5J B;  2VOD A;  2ADB A;  1U25 A;  1KP6 A;  1HNV B;  2KHD A;  4XO0 A;  2XY5 A;  5DDR C;  4X84 A;  5F8J A;  2CPE A;  1HFE L;  2HAI A;  4KV8 B;  4N8N A;  2E1R A;  3EGW B;  1FD8 A;  4OYX A;  2KYX A;  2R4F A;  4C2M A;  1R89 A;  2CG4 A;  3PYG A;  5ITH A;  5K20 B;  3KLG A;  4WK3 A;  4DV7 J;  2AQ4 A;  1FRL A;  3PRD A;  4RW9 A;  1VFJ A;  2K7K A;  2EFV A;  4ZK7 M;  3DM2 B;  2CQ2 A;  3AD9 C;  1WI6 A;  3K5M A;  2Y8Y A;  3PYF A;  2YKM B;  2IVM A;  5KFJ A;  1BUX A;  3BGL A;  3T1H F;  1HW9 A;  2HHV A;  2ROP A;  2ZBQ A;  3QMQ A;  5HAO A;  2U1A A;  2DGQ A;  4CLZ A;  4ZPB A;  3NS5 A;  3UPF A;  4DR5 F;  2RU9 A;  3LP1 B;  3AOA A;  1M1K T;  4YME A;  3NGT A;  4O4R A;  1S1T A;  1RKJ A;  2BJE A;  4FYD A;  3VAK A;  4M5M A;  2HWI A;  2ZE2 B;  3T1A A;  2VHG A;  2OJ3 A;  1S1U B;  1NK8 A;  2FIU A;  5J2P A;  3BO2 A;  2XMJ A;  4HLB A;  3OL8 A;  5LXR A;  2HW3 A;  4MAK A;  3K8W A;  4RWX A;  2IJR A;  1ULR A;  2VC0 A;  4RNH A;  4CLW A;  1DAR A;  4HAC A;  1RUS A;  3MPV A;  2VPW B;  4KFB A;  4DX7 A;  2C2E A;  2VF3 A;  5AXM A;  4RLE A;  1S57 A;  3H20 A;  4DQS A;  1J5O B;  1E6Y B;  3BQ0 A;  1PYS B;  3E01 B;  1EIY B;  2MB0 B;  1MU2 B;  1Q78 A;  3Q2T C;  3DHW C;  2AW0 A;  4DU7 A;  3RB6 A;  2E9R X;  1HYS A;  3DU5 A;  4IG3 A;  3A3P B;  5CZX A;  1L3S A;  2HRT A;  2Q79 A;  4LF9 F;  3GIM A;  3G2X A;  1X4H A;  5EN1 A;  2VG6 B;  1RB0 A;  1BQN B;  3NAH A;  5BR8 J;  4F50 A;  4F3O A;  2QE5 A;  1JB0 C;  1XR5 A;  4CLT A;  1VI7 A;  1A7G E;  2DNP A;  3JTO A;  1ZM3 A;  4ZLJ A;  1HNV A;  4ZIV A;  4PXB A;  5GAD I;  2GMH A;  2EFG A;  3QT7 A;  1I51 B;  4LFC F;  2WBR A;  4KH1 B;  4FXD A;  3VF0 B;  2UU9 J;  1RAI B;  5C2G A;  2DR6 A;  4OHX A;  1ZH5 A;  2ZBI A;  1U1P A;  2M70 A;  3VVT A;  4B02 A;  1CJV B;  1U1O A;  1IBL F;  2DGX A;  3NAI A;  2KO1 A;  3EXC X;  1JNZ B;  3C14 A;  3LPY A;  4AL6 A;  2GJ2 A;  1VRU A;  3IM8 A;  3L7P A;  2R7T A;  1RYS A;  4X65 J;  3C6T B;  3IRX A;  5DS7 A;  5CCL A;  1UL3 A;  5EX3 A;  4QYR A;  3H2V E;  1PJ5 A;  3H7H B;  4O4G B;  3ZTS A;  2Z8Q A;  1E6V B;  2QGF B;  3GMG A;  4DV4 J;  2L9W A;  2QC3 A;  2V4J B;  1H7W A;  2QMX A;  1D9A A;  4DV5 J;  2XMT A;  1S1W A;  1SQG A;  2Z2Y B;  4DR3 F;  4EEY A;  1LK7 A;  4DX8 H;  1S4F A;  3FSI A;  2R3V A;  4ATN A;  4DV5 F;  1S72 S;  3R5J B;  1HNX F;  4LF4 F;  3GZ7 A;  2ATL A;  2QLJ B;  5J2Q B;  3IR6 B;  3CIZ A;  3N5F A;  4UOG A;  4DPT A;  4OYA A;  1Q82 T;  1O6X A;  4F8R A;  1WF0 A;  2F9D A;  3M30 B;  1TAU A;  1RT3 A;  2DGT A;  3D4J A;  1OPI A;  3MPW A;  1VQ5 S;  1XNR J;  1FD2 A;  2BJ9 A;  1QDU B;  2PT0 A;  2XZD B;  4MMO A;  2POK A;  2V34 A;  4KGK A;  3WC0 A;  3FVY A;  2A3J A;  1NND A;  3ILJ A;  3JQM A;  2DIS A;  1RIS A;  3VQS A;  3QSY B;  3MUV P;  5K8N A;  1N5S A;  1Q4R A;  5D0E A;  2AX0 A;  1KWM A;  1ZM9 A;  4FN5 A;  3HLU A;  1FVS A;  1NSP A;  1U2F A;  1XIQ A;  3FSX A;  2BKN A;  1VDH A;  3V6J A;  2YX1 A;  2UUW A;  3KK3 B;  2Q1L A;  2UXD F;  3DRS A;  2KM8 C;  2KXH A;  1K0T A;  3D66 A;  2KVQ E;  2YKP A;  1HBM B;  3RZA A;  3TEG A;  3HVW A;  3A8J A;  4Y2M A;  2DXE A;  3WX4 A;  1Q95 G;  1DQA A;  1J5E J;  4ED5 A;  1RQ0 A;  3RAX A;  3JSY A;  3VGU A;  1NHU A;  1UZH A;  4EO6 A;  2GIR A;  2H3E B;  1UW9 A;  3V4I B;  4KR0 B;  3DI6 A;  3PDN A;  4YR3 A;  3LGH A;  2P9C A;  3DDI A;  4PZV A;  1G2E A;  2B6A B;  5GAH I;  3V6K A;  1KTQ A;  1X4G A;  3GYX B;  2RSQ A;  5KT4 A;  4ES1 A;  4GVL A;  5KT7 A;  1C1C A;  1QLN A;  2HKE A;  2PA3 A;  1L3T A;  4RNN A;  2KFZ A;  4HDG A;  7FD1 A;  5EX0 A;  4DUZ J;  3QJL A;  3U1N A;  3LPE A;  3IWN C;  3QAE A;  2Q6B A;  3IAM 9;  1MWY A;  5J2N B;  3THP A;  2WVC A;  3BS9 A;  2NUH A;  3TYT A;  3SQO P;  3PW7 A;  4B3S F;  3WIV A;  4ECU A;  2ACM A;  1WC4 A;  3TA1 A;  1SBR A;  3MD1 A;  1WC3 A;  2AYE A;  2Z57 B;  3K7R A;  5B0G A;  1LV5 A;  3H5Y A;  2W2P P;  3N9U C;  1BWV A;  5CD4 A;  1JKH B;  5A76 A;  2CNO B;  2AEM A;  1HHT P;  1F9H A;  2RDD A;  1XTZ A;  1FRJ A;  4XTT A;  3ZNJ 1;  3BO4 A;  1N33 F;  3C8Y A;  3D6M B;  1IUJ A;  4X66 J;  2IC3 A;  2OO4 A;  4OQJ A;  5THW A;  4B3M F;  2W01 A;  4F3M A;  4X4T A;  1T05 B;  1LW2 B;  3ADA C;  1CG2 A;  3OT9 A;  5KFS A;  1N0V C;  2C3M A;  3VTI A;  2OD4 A;  1XWL A;  1S12 A;  2DNY A;  2G2Y A;  3JXO A;  3UWT A;  3PJX A;  4CO3 A;  5LSR A;  4UQT A;  2Y1R I;  3LWM A;  2VA2 A;  4KHM A;  3GR0 A;  2IJF A;  4LIW A;  4U9R A;  4CH7 A;  6FDR A;  4IQM A;  1HBM A;  1N5T A;  2CZ4 A;  3A13 A;  4NLW A;  1LNQ A;  3HKZ D;  2NYH A;  4USI A;  1C1B A;  4JI1 J;  3ZZR A;  1OWX A;  2GAG C;  4MT1 A;  2LQB A;  3G6Y A;  1FWK A;  3D28 A;  1U2R A;  1F5C A;  4ERD A;  4BCA A;  4CLS A;  4ILM A;  1KOH A;  4DDF A;  1RHR B;  4XAK A;  1TL5 A;  3FFI B;  3M2R A;  3T5J A;  4EU0 A;  1P6T A;  4CO0 A;  2BVZ A;  4DL7 A;  3HO1 A;  2L08 A;  1T95 A;  1X31 C;  2VUG A;  5D78 A;  5D77 A;  1O5J A;  1HBN B;  2D1C A;  2NSB A;  3A3N B;  3M1V B;  4F4A A;  2H4Y B;  1DTT B;  3EVO A;  4N41 A;  2VQF F;  1SH3 A;  2BW2 A;  1RBL A;  4LRC A;  4DQQ A;  4WII A;  4F2S A;  3PX4 A;  4LBP A;  3GIJ A;  4RUA A;  1SXL A;  5IC6 B;  1AUD A;  3GIR A;  2V9W A;  4JI5 F;  5I3P A;  4NI2 A;  1HNZ F;  2G9O A;  4DHV A;  2DHH A;  2FJA B;  3VAF A;  2CRL A;  3ZZT A;  1BMQ B;  2X1G A;  3OTE A;  2G0J A;  5KFB A;  2ZJQ Q;  1AT1 B;  2WW8 A;  2YH0 A;  1N6Q A;  4HEA 9;  1VHF A;  3BBF A;  3DFE A;  2VA3 A;  4WFB Q;  2CA9 A;  3VAJ A;  4J9R A;  3W5Z A;  4WF9 Q;  1X9M A;  2DGW A;  2KHC A;  4M5I A;  2RDI A;  2W4C A;  4BLG A;  4TKT A;  3QRR A;  2V5H G;  1VC0 A;  2C2K B;  1PAU B;  2J5A A;  3CC2 S;  3CJ3 A;  1LEO A;  4FNH A;  2VDH A;  1Q8I A;  3AXK A;  4LQ9 A;  2JDJ A;  3FBB A;  1CJU A;  2OFG X;  2VL1 A;  4CTA B;  3EJM A;  5ETR A;  4ZCI A;  1T3N A;  3W7B A;  2CAD A;  3QO9 A;  5DG9 A;  1Y0H A;  2UUA J;  4DG1 B;  5IT9 U;  4ED6 A;  2PGC A;  2ZOM A;  1VQY A;  3BH7 B;  1KQG B;  1UEU A;  4YB1 P;  1CJK A;  2AZ1 A;  2W7O A;  1X0F A;  2F65 A;  4CNY A;  1H98 A;  1TUV A;  4ZVQ B;  3ENA A;  3TUI C;  2QT7 A;  3EUN A;  3Q2S C;  2DVI A;  2UUB F;  2YQ1 A;  1HNI B;  2PI4 A;  1TKX B;  1RGV A;  1U48 A;  4HTJ A;  2B51 A;  1JLQ B;  2CPF A;  1K1Q A;  5U47 A;  4MKV A;  4ZLN A;  7AT1 B;  1VQO S;  4P72 A;  3WZ0 A;  2RB7 A;  1LWC B;  1SC3 B;  1UAW A;  3HHL B;  4CLK A;  5D4P A;  3I0S B;  4ANC A;  2DNH A;  3TZZ A;  4CQ1 A;  4DL0 C;  3BBB A;  2R7R A;  2OPR A;  1IN0 A;  1SJR A;  5A6P A;  4QYZ J;  2IC3 B;  2JVR A;  3HI9 A;  4CCH A;  3TRG A;  1HA1 A;  4BC9 A;  1PC4 A;  2J9C A;  5K8P A;  3GIL A;  3SEO A;  2FYX A;  2HBR B;  4P10 A;  4DUT A;  4F02 A;  1M1H A;  5F8H A;  4PWW A;  2J7U A;  4K8R A;  2IYI A;  4Q2L A;  4K7Q A;  3GFX A;  3GP9 A;  4LF7 F;  2NXE A;  3HVT B;  3EIC A;  4LT6 A;  3AJD A;  1O8B A;  3M8S A;  4J9S A;  4LF9 J;  3PKM A;  3BN7 A;  4PQU A;  3VR1 A;  1JLC B;  1GTH A;  2BYC A;  3VAG A;  4OI6 A;  4DFJ A;  3NNH A;  3GIK A;  1NDK A;  4NCG B;  2CNL B;  4KJI A;  1RTZ A;  3M9M B;  2XMK A;  1F0X A;  2YKQ A;  4HI1 A;  3EMT A;  3BF4 A;  4TYA A;  3Q89 A;  2QN6 B;  1Q5V A;  1SJQ A;  2YQ0 A;  3H98 A;  3H90 A;  4IH6 A;  4OLP A;  4OX8 A;  4XK8 C;  3ZZY A;  3OVS A;  4AE5 A;  4JI2 J;  1RAD B;  2MKH A;  1IBL J;  1CUL B;  3NOG A;  2R2T A;  1ZZN A;  2RHS B;  4ITS A;  3BSN A;  2DT9 A;  2C42 A;  3MM7 B;  4DL2 A;  4AL5 A;  1BXN A;  1JLA A;  2HVE A;  3BJY A;  1WEL A;  1VC6 A;  1KC8 T;  2VZ9 A;  1EKS A;  1T8E A;  2HS3 A;  1NZ8 A;  2LCW A;  1RT3 B;  3M6W A;  4O3P A;  2Y9H A;  1C4C A;  3KLF A;  2ZH1 A;  4LR7 A;  1NME B;  4DV2 J;  1UVL A;  3ZZU A;  3KDO A;  3SYZ A;  1XMQ J;  3NCQ A;  4DPU A;  5J2M A;  4PUO A;  3E51 A;  3QQC D;  2RT3 A;  4HT5 A;  5F0U A;  4LF6 J;  1QVF R;  4B9V A;  2XMU A;  2UUA F;  1HWJ A;  2Y0S D;  5L38 A;  4X66 F;  2B9E A;  3ENW A;  4TYB A;  3CJS A;  5B0F A;  2JSX A;  3NGU A;  1MLA A;  4HHJ A;  4K4V A;  2HHS A;  1FJC A;  3UDC A;  2Y1J A;  4R8U A;  2VG5 A;  1PBA A;  3MF5 A;  4AT1 B;  1TU0 B;  2P2C B;  4EO8 A;  4ZIW A;  1KR4 A;  2DNZ A;  4LR9 A;  4IFV A;  3IN5 A;  2WVB A;  1ZOT A;  2IVY A;  1HYS B;  5C24 B;  1JLE A;  5C7P A;  2LVW A;  4U6P A;  1RAF B;  4N7T A;  1EET A;  5LJ5 Y;  3RB3 A;  1FWP A;  1UVK A;  2XSF A;  3AOC A;  3M8P A;  2R8G A;  4F4K A;  3D0G E;  5BYR A;  3OTO J;  2A0F B;  4L3N A;  3GSD A;  3IR5 B;  4MFB B;  5A8R A;  4P73 A;  3OHB A;  3FEX B;  3OW2 R;  2AGO A;  2I5J B;  1VC5 A;  3HKW A;  2UP1 A;  4C8K A;  1FXL A;  1TV6 A;  3GFY A;  3H2L A;  3TO8 A;  1TMJ A;  4BWM A;  3ZZP A;  3CCQ S;  1U1K A;  2DGV A;  5HO4 A;  2CVE A;  1FKP A;  4NEY A;  2GFF A;  5JMN A;  4YFU A;  4BC7 A;  1Y9O A;  2BE9 B;  1D0E A;  1X9W A;  2G4B A;  2R7Q A;  1HAR A;  1VS3 A;  4RWW A;  4M5G A;  1EX8 A;  4OZL A;  5E3P A;  2ZH2 A;  4J9N A;  1Y3J A;  3QWU A;  5E7O B;  1XER A;  3LH2 S;  4NOH A;  1ZAX A;  3CMA S;  2OEK A;  3IO1 A;  2XCP A;  5JUM A;  3D0I E;  3CJ2 A;  2DR9 A;  1BGX T;  5B08 A;  5KT5 A;  2O3D A;  5M2R A;  4F25 A;  4P7V A;  4YEA A;  5FLX Y;  3VZH A;  1KLM A;  1PIL A;  2IDL A;  4TU8 A;  1GTE A;  4KBI A;  5A8K B;  4DV6 F;  1OIA A;  3TW0 A;  1IKY B;  1D9D A;  3D0H E;  1U0H A;  2G0C A;  1SIZ A;  3T3F A;  4KGZ B;  1BQN A;  1PBU A;  2CPZ A;  1HPZ B;  2V8D A;  2M5Y A;  4ED8 A;  4RBT A;  3MOJ B;  2HHW A;  5D4N A;  2HFZ A;  2IM3 A;  3B78 A;  2A1B A;  4OMF G;  5DGB A;  5GAD U;  4LFB J;  4ZPV R;  1NJI T;  4ECW A;  3D67 A;  1NK5 A;  4C3M A;  5FJ4 A;  3QID A;  4JI0 F;  2OSQ A;  2OPS A;  3BKF A;  2OMO A;  1URN A;  4PG8 A;  3IP0 A;  3TA2 A;  3HM9 A;  2X1B A;  3N6L A;  5KT3 A;  4B3M J;  4HKQ A;  1S9G A;  1JLA B;  2X7I A;  3A4T A;  4NCB A;  3RTV A;  4B3R F;  4KV8 A;  4B3O B;  3S8S A;  3PFO A;  3IWL A;  2GQC A;  3DCA A;  2LU1 A;  1LWF A;  1KEK A;  2DJW A;  2HQD A;  3B82 A;  3W2V B;  1EQM A;  3ILO A;  3N01 A;  4MKA A;  2JH3 A;  2HHQ A;  2KI2 A;  4UOC A;  3VAM A;  2OLW A;  3EDQ B;  4LSZ B;  3RRH A;  2CJ9 A;  4FS1 A;  4OZJ A;  3JSB A;  3DRR A;  3K2Y A;  2MQP A;  2HHH J;  2VPY B;  4F4Z A;  5AE2 A;  1UTA A;  5F9L A;  2ZHA A;  1NSA A;  2ASD A;  1HMV A;  2DGS A;  5F41 A;  2RQ4 A;  4ZLL A;  3KMS A;  1MNE A;  4I64 A;  3D5M A;  1Y5L B;  1YKW A;  3VQT A;  4EZ9 A;  2PI5 A;  2XHC A;  3KJV A;  4MKY A;  5K8M A;  3Q8V A;  4UY8 T;  2VV5 A;  4A8O A;  3V81 B;  2HVD A;  3IG1 B;  1SVD A;  2HSE B;  4BHQ A;  1OY6 A;  1PYO B;  2Z56 B;  3O3L A;  4TVA B;  2DHS A;  5DG8 A;  1I94 J;  1FNO A;  1U1R A;  4CDI A;  2V2K A;  4C4W A;  2AT1 B;  1EHW A;  2AEJ A;  2NZC A;  3BDE A;  5EDW A;  2J9E A;  1SL0 A;  4I6A A;  1S1U A;  2IYG A;  1VQ9 S;  2WVF A;  1F3F A;  4NWB A;  4ZS6 A;  2BXJ A;  3BGR B;  1JLE B;  2DYA A;  5H1S V;  2HS0 A;  1RTJ A;  1RXO B;  3U27 A;  5BYS A;  1SI9 A;  4A8Y A;  1NCL A;  3MAA B;  4CO4 A;  3C2P A;  2BZ2 A;  3DNC A;  3QIP B;  3UVJ B;  2DY9 A;  1BE4 A;  1A0O B;  4B08 A;  1HNZ J;  2B4O A;  1NDC A;  1ZS6 A;  3CGI A;  1R8C A;  2QG9 B;  2YNI B;  4AD6 A;  5HMX A;  2CXE A;  1NPR A;  5HMY A;  1YSJ A;  1KNZ A;  1TVR A;  1DQ8 A;  4RW6 B;  2GV1 A;  2MQM A;  3MMC A;  4DUZ F;  4OYP A;  4DV6 J;  3D7S B;  3TEH B;  3CC4 S;  1T9X A;  2DIU A;  3Q8U A;  3EGV A;  3CE8 A;  2FJX A;  3CSK A;  4YHH J;  2ZZM A;  4OLO A;  1UVI A;  2J6S A;  4R5P B;  2ADC A;  1K8A T;  1RT6 A;  4RW8 A;  1TK0 A;  3MM9 A;  4ZIT A;  4KQZ A;  4WFX A;  1DLO A;  1R7I A;  1OYD A;  3IRW P;  4TQR A;  2ZKT A;  4LF6 F;  1TL7 B;  1M90 T;  1AFI A;  1XMQ F;  4E98 A;  3LP0 B;  4DU8 A;  4AND A;  3S7R A;  1F9E B;  3DLK B;  5DDP C;  4C8Y A;  1QE1 B;  2MPU A;  5KOX A;  3P5B P;  3JAM Y;  2YNG B;  3HVA A;  4NLO A;  1RKI A;  3PRV A;  3PM9 A;  3DLL Q;  4Y2C A;  3M32 B;  3ZXW A;  1W2I A;  2JFD A;  1Q16 B;  2G0I A;  5G0R B;  2B8P A;  2BJ8 A;  3LAN A;  3MUM P;  3KHG A;  5CZV A;  1ZTT A;  3D68 A;  2ZFH A;  2E5L F;  2HK2 A;  2BOA A;  2GVD A;  2YH1 A;  3LW5 C;  4NZ0 A;  3UE2 A;  2N7Y A;  3FFI A;  4J9M A;  3RW7 A;  3AAW B;  4TY8 B;  4YS2 A;  3DYA B;  3KLE B;  1R6Y A;  3HVR A;  1ZA1 B;  1N32 F;  4JBC A;  4DXL A;  1T94 A;  4J91 A;  2R2U A;  4OI4 A;  4Y34 A;  1DTT A;  4OI2 A;  5ETO A;  1PCA A;  3KUG A;  2BQU A;  5DZ7 A;  4JYA F;  1UP1 A;  4DL3 A;  1HBN A;  1HNW J;  2B0G A;  3RR7 A;  1D09 B;  3H0P A;  3D3B J;  3SSR A;  1RWO B;  1V5V A;  1VJQ A;  1IVZ A;  3RBX A;  2MGZ B;  3CME S;  4WTY A;  3SSS A;  4KE5 A;  2HQ3 A;  2ZNY A;  4USU A;  1YJ9 S;  4Q2M A;  3ITH B;  3OUY A;  5DM6 Q;  1OS5 A;  2N7C A;  2R8H A;  2H9Z A;  4ZPC A;  2EKN A;  1NO8 A;  4N5S A;  3AXM A;  5LL6 d;  4WTO B;  3TJ9 A;  1WOO A;  3EDR B;  3W60 A;  3OJS A;  2Q3P A;  4USM A;  2GO8 A;  2H65 B;  2QL7 B;  2IMW P;  5E33 A;  2H54 B;  3VGV A;  4K0K J;  1N36 F;  5ETV A;  2O5D A;  3Q23 A;  5B0D A;  2R8J A;  2F8M A;  5CHC B;  3U02 A;  2H51 B;  1HQU B;  4O0I A;  4K4U A;  4Q0B B;  2HBQ B;  5J2M B;  2GJF A;  5AT1 B;  3WIU A;  4JI5 J;  5HN0 A;  4PUO B;  4KHR A;  5I3Q A;  4JYA J;  1UZD A;  2E5G A;  2PEB A;  4CH0 S;  2DPI A;  1U8S A;  3QPI A;  4ECZ A;  3J7A 1;  4TY9 A;  4PEO A;  3PV8 A;  3C16 B;  1RHM B;  1Y5I B;  2BE7 D;  4L72 B;  2Z2L A;  4TN2 A;  2Y1L B;  4I4B A;  1P9Y A;  4Y65 A;  3W64 A;  4C3K A;  3L7U A;  5ETL A;  1VHI A;  3W8G A;  4CM0 A;  3PW0 A;  2VBY A;  1FFS B;  4DPW A;  3MM6 B;  1IBC B;  3TAM B;  3KLV A;  4B9T A;  3NL0 A;  3MGJ A;  1R27 B;  5L1J A;  4O3N A;  2K8G A;  2M0G B;  1OQ3 A;  3UN2 A;  1ZM4 A;  2N4D A;  1REV A;  1IM6 A;  3DOM A;  2L9N A;  2HNZ B;  3JB9 k;  4N56 A;  4JI8 J;  2B4P A;  2B56 A;  1H38 A;  4JI8 F;  4GC7 A;  1RWM B;  5DZ6 A;  4ID5 B;  5H9F J;  3TUJ C;  1YIT S;  2VC1 A;  2H4W B;  5L46 A;  2QO3 A;  1FK9 A;  5LSO A;  4DFP A;  1WI8 A;  2EXU A;  2ZBR A;  1PIE A;  3J7Z T;  1FES A;  2CJB A;  2VKR A;  4ZN1 A;  4AQY J;  5HJY A;  1QY7 A;  5C42 B;  2C2D A;  3W8P A;  1VQ4 S;  1LWE B;  3TAM A;  4DEZ A;  5L9N A;  4FF4 A;  3D2W A;  5LSL A;  2RRA A;  3SQG A;  5AXN A;  1SQF A;  2D9O A;  4RUH A;  1MSW D;  4FXW A;  2KN4 A;  2GGP B;  1P1L A;  3BYP A;  2E9Z A;  1J2V A;  3N6M A;  4QIG A;  1K1S A;  1ZAW A;  5HAN A;  2YX4 A;  1M1G A;  2CJK A;  4DSK A;  2RHQ B;  3BN4 A;  3NP5 A;  3PHE A;  3MMB A;  1JLC A;  4GRS A;  8RUC A;  1G4C A;  2PII A;  1EAR A;  4OZN A;  1WHX A;  3C46 A;  3HVT A;  3PEJ A;  4LSL B;  1TL3 A;  5E3C A;  5LMN F;  4AL7 A;  2J6U A;  2CVI A;  2RRB A;  2CAJ A;  1S0M A;  1HBU B;  4EK2 A;  1JLQ A;  2DGO A;  2MLY A;  3VGS A;  3BR8 A;  1HQU A;  2L41 A;  5DJB A;  4KPY A;  3M8Z A;  1KKH A;  1ROF A;  2VU5 A;  2K2P A;  3M30 A;  3PJW A;  3CDW A;  3EZO A;  4JV0 A;  3UD4 P;  4OZ0 A;  3M4X A;  3UNG C;  2DNM A;  3SIP B;  4G65 A;  3CCM S;  2QEX S;  1FF2 A;  1NLK L;  5LXY A;  1NKE A;  3QSI A;  3CPW R;  1HI0 P;  5CYJ A;  1FE4 A;  2D3Z A;  2IVF B;  3LGM A;  3T6J A;  1H2T Z;  4DLG A;  3QJJ A;  3PW4 A;  4WIQ A;  4WFZ A;  2APO A;  1IQZ A;  3OTC A;  3KUE A;  5B0E A;  2GJI A;  2GVZ A;  1C2P A;  1UPP A;  4OYM A;  4CLF A;  1LOU A;  1YWX A;  5M2P A;  4ELU A;  3CIM A;  2JVO A;  1CBK A;  4ZKA A;  1SC1 B;  4A8S A;  2MQN A;  5LOQ A;  2VD3 A;  3SCL E;  1KRP A;  2J0Q D;  1YJV A;  9RUB A;  3CCS S;  4FF3 A;  4X4U A;  3DLJ A;  4HH1 A;  2XI2 A;  1IM4 A;  1TTH B;  3TNV A;  4YY3 F;  4RBV A;  1B7F A;  2GO9 A;  2GVZ B;  4GKK F;  1RJJ A;  2MMY A;  3HK2 A;  5HAT A;  1IJF B;  2B5J B;  3VV2 B;  2DPJ A;  1OQ6 A;  2YNF B;  3QGH A;  3Q83 A;  4CRJ A;  1RCO B;  4WKY A;  2B7C B;  2DH7 A;  4L3K A;  5IM0 A;  2X1A A;  3V6D A;  2XY7 A;  1TVR B;  1KQK A;  3GII A;  2XWX A;  1RT1 A;  1C0T B;  1VLO A;  1LFP A;  1N5Q A;  1X0P A;  3QLH A;  2YNI A;  4Z7Y A;  3VAI A;  4PWD B;  3DOK A;  3M2U B;  1V6H A;  2CJX B;  1RWP B;  4WP8 A;  1NK6 A;  4IR9 A;  1VQS A;  2UV8 A;  1U1L A;  4PXE A;  4CLP A;  2VQE F;  4G1P A;  3NLC A;  1KD1 T;  1P27 B;  3IC1 A;  1FDB A;  3TR5 A;  5HBM B;  3AJ2 A;  4DPY A;  2DH9 A;  2FQQ B;  1Q7L B;  1FE0 A;  1WKL A;  4USV A;  1MU2 A;  1N32 J;  2LKZ A;  2C2R A;  3KK3 A;  1FFG B;  1IBM F;  1GX5 A;  1EP4 A;  3M2V B;  3PCO B;  3W9H A;  4IOA Q;  1B4S A;  4DQR A;  3RYL A;  2N82 B;  3MM5 A;  3OR2 A;  5ETN A;  2JLG A;  1FEE A;  2XI3 A;  2ZH7 A;  2W1B A;  2CPJ A;  3CCL S;  1BC6 A;  2RH3 A;  4ZVF A;  3MEE A;  3OXL A;  3MMJ A;  3H25 A;  1NKB A;  2E5I A;  3G8T A;  2XYH B;  4C8M A;  3B4D A;  5GAH U;  3TAN A;  2IBK A;  1RWV B;  1WD6 A;  2W4P A;  4LRD A;  1S9F A;  4HTI A;  4OX9 J;  1XMO F;  2EFQ A;  3GV7 B;  2FGC A;  4S0M A;  2IPO B;  1LKZ A;  5FII A;  1H2V Z;  1UJ4 A;  2BJ1 A;  2GGP A;  3DYA A;  1NH7 A;  3MWB A;  5IWA F;  4ED2 A;  4KY3 A;  2M7S A;  5HQL A;  2ASL A;  3JSM A;  4UOF A;  2GML A;  1YBT A;  4U8V A;  1RP5 A;  1C1B B;  2OGU A;  3L9Z A;  4LF1 A;  1NKC A;  2MKJ A;  1HWL A;  3AH6 A;  1HI1 A;  2YKA A;  2QMU B;  3A8K A;  4C11 B;  4ETX A;  4CIO A;  2LXI A;  4LJM A;  3HD1 A;  3NKY A;  4FZV A;  4LMZ A;  2QA4 G;  3CWJ A;  3FZ2 A;  3AQO A;  4MKB A;  3IM9 A;  4FS2 A;  3GU0 A;  4PWD A;  1RYR A;  5T14 A;  4H4K C;  2YKM A;  4FVM A;  4DSE A;  3EE3 A;  3T1Y F;  1T05 A;  4B9U A;  3G9C A;  1FWL A;  4BDP A;  2F9J A;  3OV7 A;  3TX0 A;  4ECV A;  1YQH A;  2HFV A;  3A3O B;  2OPQ B;  1B99 A;  2IMO A;  2OD6 A;  3EPG A;  4UOH A;  1EZZ B;  1PSD A;  2RQK A;  2XHW A;  3AB2 B;  1NZA A;  2YQ3 A;  1CJT B;  2YWF A;  4FXV A;  3VCD A;  1GXT A;  2LQ9 A;  2RE1 A;  5KFC A;  1JJ2 R;  1B3T A;  2LXU A;  5A8K A;  2VOO A;  4WZM A;  3AA9 A;  1EQ0 A;  2JWN A;  3PYD A;  2J9D E;  5MLC V;  4E2F B;  3R1H A;  1VCT A;  2KT5 A;  3VWS A;  3MMA B;  4UZB A;  1HD0 A;  1X5O A;  1IR2 A;  1VRU B;  4I67 A;  2Z0G A;  1VRT A;  2UXC F;  2ZHB A;  4QU6 A;  4K4W A;  4X4V A;  1YHQ S;  5KG2 A;  1VLY A;  5EWF A;  1Y7P A;  5KFO A;  4A8K A;  4JI3 F;  2MGZ A;  4B9N A;  3M8Y A;  3R5G A;  2OPS B;  1YRU A;  4GO5 X;  3ZZO A;  1ZET A;  1K47 A;  4RW7 A;  3W2W A;  3EYZ A;  4B3T F;  4DQP A;  3G71 S;  2XYP B;  2V2Q A;  2EWH A;  4F36 A;  1J5O A;  3M05 A;  5K14 A;  3KHR A;  2WRM A;  1OO0 B;  4EYH B;  4KYZ A;  4JUZ A;  1CPZ A;  2XMV A;  4G1Q B;  4JV2 A;  4K59 A;  3RRG A;  3J7Z 5;  5IT9 Y;  2FUG 9;  2WB4 A;  2BA9 A;  5IV3 A;  2GQ2 A;  3PRB A;  2R2R A;  2F3J A;  2W4D A;  2Z2M A;  3DOL A;  1D3W A;  2LEC A;  1UVJ A;  3RUB L;  1JLB A;  3M8Q B;  2OHD A;  3R1L A;  1PGZ A;  4JOU A;  5E3Q A;  3U1M A;  5A8W B;  3RGI A;  5C24 A;  4IFV B;  2HBZ B;  1RTD A;  4YR0 A;  2FC8 A;  4HAC B;  1S0O A;  2VOP A;  1IKW B;  4GO7 X;  1BY9 A;  1U6Z A;  2HUR A;  2QA1 A;  3TUZ C;  1U09 A;  4JP8 A;  5KFA A;  3CO0 P;  4WFA Q;  2B4V A;  1WEY A;  3DOL B;  3R27 A;  4RW8 B;  4AXJ A;  4AYB D;  3DLB A;  2HGL A;  2E5J A;  2J76 E;  2YKO A;  3BYR A;  3CW2 C;  4R5P A;  1FJG J;  1UVM A;  5L1L A;  2EKY A;  1IWA A;  4OZ2 A;  1WHW A;  2V4J A;  5JVG Q;  2NPF A;  5LJ3 Y;  2MZS A;  3G6V A;  2D9P A;  4WYW A;  3W3S A;  2KFN A;  1NU4 A;  1I94 F;  2HZV A;  4DLE A;  2C3O A;  2C3P A;  1DJ0 A;  1FJ7 A;  1SIW B;  2IHR 1;  3HSJ A;  3U1L A;  1X7V A;  2FLL A;  2MSS A;  3UO0 A;  3QIP A;  1ICE B;  4LQ3 A;  4IO1 A;  1H72 C;  1S97 A;  3B6B A;  5KFY A;  2AJ0 A;  1TK5 A;  4RU2 A;  3GV8 B;  2DTJ A;  3GYG A;  1ZBT A;  5D4L A;  3OD2 A;  3AY0 A;  4DV7 F;  1UJ5 A;  3VAH A;  1NJY A;  3N5B A;  3H59 A;  4MIB A;  3UI3 A;  2HHX A;  4LFA F;  2D3U A;  2RUG A;  1RLC L;  2N3L A;  3O6Q A;  1NK9 A;  1YBA A;  3FQL A;  3NBP A;  2X3G A;  3NRB A;  1SB6 A;  4HYK A;  4DS5 A;  3K0J A;  4QIE A;  5FD1 A;  4F67 A;  4WFY A;  4DR6 F;  1LFW A;  2MHN A;  2F1F A;  4WU3 A;  2GIQ A;  3K5N A;  1YZ7 A;  2F7V A;  3B4M A;  2WSC C;  2ZD1 A;  4XDD A;  4B3T J;  1VGY A;  2HMI B;  2HQF A;  3HZE A;  5A8W A;  2ZVS A;  4PWU A;  2OPP B;  1WC0 A;  2HLU A;  1Q86 T;  2J7K A;  4F04 B;  4TU7 A;  1GK8 A;  3PIP Q;  4X64 F;  4TQS A;  3KK1 B;  4NCA A;  2ILY A;  4WZQ A;  2QLF B;  3F56 A;  1AB8 A;  4ZHR B;  4JI1 F;  1S6U A;  4X62 F;  3KMQ A;  1BLU A;  1NRK A;  5JXS A;  4X4Q A;  4WCE Q;  4ZDN A;  4DL4 A;  2OML A;  2UUC J;  2LQ5 A;  1LWF B;  1U1M A;  4K4T A;  1HI8 A;  3MZI A;  1FTC A;  2OFH X;  4CT8 A;  2ZE2 A;  3TAP A;  3RAQ A;  1T03 A;  3MCM A;  2VFV A;  3BQ1 A;  2HMI A;  1JLF A;  1U4B A;  4JI6 J;  1HMV B;  2N4C A;  3GFZ A;  2BAN B;  1GMW A;  1QD1 A;  3MPD A;  3MPY A;  3RAM A;  1FJE B;  1ZZF A;  5JJB A;  3HSD A;  3L7O A;  4KH0 B;  4TXS A;  2JC1 A;  5G4D A;  2HNY B;  2W9C A;  2P9G A;  2FHK A;  5A0Y B;  4G3I A;  2NR0 A;  4DF4 A;  4LRA A;  4NLU A;  5DRK A;  3T1H J;  1N0U A;  5I4M A;  5KAK A;  2PO4 A;  1SH2 A;  4MTP A;  1F1B B;  4ZJO A;  2MJU A;  2BQ3 A;  2I1R A;  4GVB A;  3CD7 A;  3WBZ A;  1CJU B;  3IWX A;  2ZWO A;  3PJ9 A;  5DQI A;  5DLF A;  1HLW A;  3BV8 A;  4ED7 A;  2GS8 A;  3R5A A;  4OX6 A;  4Y0F A;  4DF8 A;  4FYX B;  3W2W B;  1APS A;  5HVF A;  3JYT B;  3PAC A;  3I87 A;  1U1Q A;  3TVZ A;  4DI6 A;  1YLX A;  1IKV B;  4USJ C;  3H5X A;  3BZQ A;  3OJU A;  5FLX U;  2CZ9 A;  4LFB F;  1CS4 B;  1YK9 A;  4J9U E;  2HQG A;  8ATC B;  2GHV C;  3Q0A A;  1TK8 A;  1N4L A;  1HIY A;  5ETS A;  1SC6 A;  3HDS A;  4F7V A;  3D3C J;  3GWC A;  4QIV A;  4RW6 A;  1YJW S;  2IA0 A;  1KLM B;  4H4M A;  4O3O A;  1KHV A;  3ELH A;  3SI8 A;  1RWK B;  3DGP B;  4KRW A;  1MW7 A;  3P8B B;  2I9S A;  4LUB A;  4PAA A;  1FI4 A;  1FEH A;  4TLQ A;  3UDE A;  2I5J A;  1RK8 A;  4YP3 A;  3THV A;  2RAQ A;  3I0R B;  2DR5 A;  4K5S A;  3E8O A;  1S48 A;  2E1C A;  4DFM A;  4OV6 A;  1XN9 A;  1D8Y A;  4C8L A;  2CQI A;  2V0N A;  3W62 A;  2FJV A;  4L6V 3;  3J81 Y;  1RA6 A;  3BKU A;  3MED B;  1F5A A;  3CO9 A;  3OTD A;  3PG9 A;  1WHY A;  4R25 A;  5E3R A;  2A10 A;  3O5T B;  4H4K A;  3UR3 C;  1FX2 A;  2HIY A;  3LQV A;  4P71 A;  1X5T A;  3ET6 A;  1QUP A;  4M63 A;  4QBU A;  4QCL A;  5IOL A;  1R8B A;  1VQ8 S;  2UUC F;  4DV1 J;  2J9D A;  2PMZ D;  4ZCL A;  2AV5 A;  2NLW A;  4ECR A;  1NJW A;  4Q8E A;  2WAQ D;  4U8Y A;  1JLG A;  2GC8 A;  2QLW A;  1GEH A;  4F26 A;  3PKY A;  3CDE A;  1EKR A;  3TA0 A;  4ECT A;  2LQJ A;  4H4O B;  5KFX A;  4RW7 B;  2XSJ A;  3GG0 A;  1S7H A;  1YRT A;  1JJC B;  2CWX A;  3A1Y G;  4C7Q A;  3OL7 A;  1M5P C;  2DNG A;  2LU2 A;  1KLN A;  3UD5 A;  4V19 J;  4DS4 A;  2OSR A;  2P6S A;  1OPZ A;  2V68 A;  3I96 A;  2FY1 A;  2EC2 A;  2WW4 A;  4DV0 F;  3GQC A;  2XC9 A;  2CZV C;  5IM0 B;  3C3L A;  1S6P A;  2W9B B;  2AWZ A;  2H1Y A;  1FJG F;  3TAR A;  5DQG A;  3PZP A;  1CJT A;  5F8N A;  1RE1 B;  1XQI A;  3W65 A;  2EG1 A;  2BW7 A;  3KDN A;  5KG7 A;  1U0S A;  1F3V A;  1VJW A;  3MCS A;  5D0H A;  3PW5 A;  3UW1 A;  3P6Y C;  4AFF A;  4L74 A;  4DUY J;  2KZM A;  2EFP A;  4NI2 B;  2GZO A;  1WOS A;  5HBM A;  1HQE A;  1RWN B;  3FMB A;  1S6Q B;  4YY3 J;  2QFJ A;  1VBX A;  3TUP A;  1WG1 A;  4I1T A;  3UDL A;  4JI0 J;  4CI0 B;  2JEI A;  1GH8 A;  1YJT A;  2HAF A;  2ZUG A;  2AIR B;  3HT0 A;  4QOT A;  3I5C A;  3CDU A;  3KG0 A;  5D8H B;  3WHI A;  3LAM A;  4FDF A;  1F2G A;  4Q8F A;  1W2B R;  4LR8 A;  4IDK B;  5KG3 A;  2JHE A;  5D0G A;  1U8W A;  1N5Y A;  2KDO A;  2FHO B;  4M5D B;  1YZ6 A;  2YVS A;  1KBR A;  4ALZ A;  4EGL A;  3FC9 A;  5L1K A;  1U6F A;  2COL A;  4Y2A A;  1RWW B;  2JLF A;  3G82 A;  2MJN A;  3IGN A;  5IZH A;  5KOW A;  2ZIT A;  1SL1 A;  3H8Y A;  3UN5 A;  1X4A A;  1T3O A;  2BJ3 A;  2MQO A;  3JTP A;  1XNQ F;  1S1X B;  3CMQ A;  3MEG B;  2VJU A;  3NWG A;  1FER A;  2B7B B;  1NSQ A;  2C1E B;  4LIR A;  4U7U K;  4CZC A;  5HSP A;  5DLG A;  3KHL A;  4FF1 A;  1XNQ J;  1HNI A;  3DC2 A;  2ZDP A;  5HP1 A;  2GNK A;  4RW4 A;  4NML A;  3CJR A;  2BOP A;  5ETT A;  4FYY B;  2ACY A;  4F2R A;  1C1C B;  3MUT P;  3SQG B;  1DFD A;  2AD9 A;  2W2M P;  3FUY A;  3SMZ A;  1NJX A;  5KFZ A;  3BPS P;  3GB0 A;  1Q0N A;  2IAJ B;  3KLH B;  4NXN J;  2BMB A;  4USH A;  4KHP F;  1WAC A;  2K06 A;  5IXU A;  2KRR A;  4TLR A;  4NZ6 A;  3Q86 A;  1H0H B;  4OJ3 A;  3HPO A;  4PPZ A;  5KG0 A;  3QRP A;  3FEZ A;  4P9S A;  1XEZ A;  4DCJ B;  4IH5 A;  4FNI A;  3R3T A;  3UNY A;  3RB0 A;  3R7B B;  4MK7 A;  8AT1 B;  1T9W A;  5HQ8 A;  2VBX A;  3CDB A;  4IG0 A;  2ZH3 A;  2AF6 A;  1U47 A;  1RHJ B;  3A12 A;  1HHS A;  1G1X A;  5DM7 Q;  2DIT A;  2NXC A;  3P96 A;  2LA4 A;  1SUQ A;  4ZVE A;  4LSN B;  1TUG B;  3I32 A;  1NHV A;  4O44 B;  5CYQ B;  2DR8 A;  5KFH A;  1S0V A;  4K50 A;  3G8Q A;  4WKR A;  1FRH A;  2CNN B;  3MPU B;  4IDK A;  2GIF A;  4I6W A;  3FCH A;  4NYZ A;  1YJ7 A;  2FVS A;  1DTQ B;  1ACM B;  2V67 A;  4HI2 A;  1DY3 A;  4OHY A;  4IG0 B;  4ZVS B;  2QYG A;  4D3H A;  2HWT A;  4DWI A;  4AXI A;  1RAO A;  2OP5 A;  4Q0B A;  1P9Q C;  2XCA A;  1R0C B;  4CO5 A;  3CCJ S;  3RB4 A;  4OJG A;  4C8N A;  3V6H A;  4QWA A;  4ES2 A;  3FRZ A;  4OJH A;  1CUL A;  1DTQ A;  1UPM B;  3QZ7 A;  4U96 A;  2K3K A;  4FF2 A;  5HK4 A;  1RT4 A;  1Q8K A;  2B9Y A;  2WK4 A;  3KJN B;  4JI6 F;  3T5L A;  3QBC A;  4RNM A;  3QYY A;  2W7P A;  2HVH A;  5HMW A;  3GFH A;  2JNJ A;  2HQC A;  4UZC A;  3LAK A;  1FRM A;  3R7N B;  2BRL A;  1FDA A;  3HF5 A;  2XO6 A;  1ZYQ A;  1RBA A;  2XM3 A;  2JFK A;  2HHU A;  3WDO A;  2XO7 A;  1HQ2 A;  4DR2 J;  2XS2 A;  1HL6 A;  1NPP A;  2GCF A;  1SKU B;  1X5S A;  3C66 A;  1MML A;  3D1H A;  3MHY A;  3NOC A;  1RBO B;  2P8I A;  2MDA A;  4ID5 A;  3R8Y A;  4DN9 A;  3PIO Q;  2CFX A;  1Y00 A;  1IR0 A;  2V94 A;  4QYZ K;  1H7X A;  1PJ6 A;  1VQN S;  5CA5 A;  2ZM6 J;  4M5D A;  3W9I A;  3MM8 A;  1S6P B;  2W9B A;  2JL9 A;  3KUH A;  2CQP A;  2D3O R;  1XC9 A;  1KVJ A;  1LWE A;  1RDR A;  5C42 A;  2QMW A;  2DBB A;  5DDQ C;  2PD1 A;  2A6O A;  2VG7 A;  4OYB A;  4LF7 J;  5HLF A;  4AUK A;  4J90 A;  2YPZ A;  1OMS A;  1KDN A;  1TKZ A;  5D15 A;  2HZA A;  1V5I B;  1VRQ C;  3ZZ0 A;  4DBQ A;  2YBV A;  1G3O A;  2DCU B;  3QGP A;  1TL7 A;  5LT5 A;  2ZWP A;  3GJT B;  3UN3 A;  4CT9 A;  5KG5 A;  1KN6 A;  2QV6 A;  3IBF B;  1KFS A;  3HJF A;  4Z7C A;  4WXW A;  5B09 A;  2UU9 F;  5KFT A;  1YTY A;  1JQG A;  3ZTP A;  3MUR P;  2LQ8 A;  4EYI B;  4QWD A;  4DUY F;  1RTH B;  5AXK A;  2K1R B;  4QU7 A;  2Q66 A;  1FRK A;  3I4H X;  4A8Q A;  2KZZ A;  4H4M B;  4EUV A;  1RHQ B;  1RT2 B;  4E8U A;  1WSR A;  2CNK B;  1KSP A;  1NK0 A;  5D3G A;  4ED4 A;  2HFN A;  1SQE A;  4ED1 A;  2VPX B;  4GKK J;  4B3O A;  4DV4 F;  3HHL D;  2DY1 A;  4P2M A;  2XYG B;  4EBE A;  3T9N A;  2PDA A;  1X60 A;  2QX0 A;  3QNW B;  4KPC A;  1PG5 B;  3BEG B;  3MR2 A;  3DLG A;  3U7J A;  1YJN S;  2K7J A;  3C15 B;  4R0J A;  2M9K A;  2ZH6 A;  4O3S A;  3I31 A;  5GAG U;  1PAE X;  1UMJ A;  2UXB J;  3W5X A;  1Q8L A;  1NM2 A;  3SCJ E;  2E7X A;  2BX6 A;  2DNL A;  3ZTR A;  4KTQ A;  3QZ8 A;  4EBC A;  1U45 A;  4DOZ A;  3DDK A;  2J0W A;  3EZU A;  3I4P A;  1XBW A;  2DHX A;  1K73 T;  3F41 A;  2Z4P A;  3FCV A;  2E5L J;  1RHK B;  2EEY A;  3CVK A;  2OTJ S;  2FLO A;  4P7T A;  4M94 A;  4JI7 J;  1FCA A;  5CYM A;  2YWK A;  1U7L A;  3SXL A;  1WG4 A;  2ABY A;  1UET A;  2MZR A;  3IMQ J;  4V1A k;  1AFJ A;  2VBW A;  4RKU C;  2KG0 A;  2FVR A;  2JJ4 D;  2KJW A;  3R9L A;  2QLX A;  5KG4 A;  2HNY A;  1WDT A;  4FKX A;  4NAS A;  1RTD B;  4NLY A;  4NLP A;  1BD6 A;  1LXJ A;  4WFN Q;  3CNQ P;  2M8D B;  4ELT A;  3BGR A;  4V19 X;  3ZZZ A;  2ZM6 F;  1HW8 A;  3FQK A;  3HT3 A;  2HVZ A;  3BH6 B;  3TJ8 A;  2Z58 B;  3IGV A;  2UVU A;  4IOC Q;  2PMH A;  4C97 A;  1TFW A;  3UR0 A;  4WJB A;  4ZMM A;  2M2B A;  5J2P B;  2V4Q A;  3BR9 A;  4OZ5 A;  3RBE A;  1HR0 J;  2HVI A;  1NAQ A;  4KHP J;  4K4Z A;  4ZHR A;  4O3Q A;  5IV4 A;  2V9K A;  4EMD A;  2W25 A;  4MFB A;  4O23 A;  2VH7 A;  3AA8 A;  1IKV A;  1PJ7 A;  4ZVT B;  2CQH A;  2VKZ G;  4UT4 A;  3KJV B;  1JLF B;  3L3C A;  3R2D J;  1HQE B;  1RU1 A;  3MTK A;  3DOM B;  4I69 A;  4DR7 F;  1U2C A;  3K59 A;  1IBK J;  3MM9 B;  4KB7 A;  4XDC A;  2B8Q A;  1IBK F;  5T7L A;  1N52 B;  4LVN P;  3ZC4 A;  2QL9 B;  1IR1 A;  2CPD A;  3KWM A;  4U95 A;  2WON A;  5KG1 A;  4Y2I A;  3G87 A;  2XTJ P;  3I55 S;  1FA0 A;  2JC0 A;  4NPO A;  4UUW A;  4Y2K A;  4ENO A;  1SJ3 P;  1FTR A;  2KVI A;  2V6A A;  1NK7 A;  5F0W A;  4F0H A;  4ANE A;  2ZUA A;  4I7F A;  3VVU A;  2O1P A;  4J9O A;  3CJK A;  3KNA A;  3K57 A;  4DN0 A;  1CJV A;  4DR3 J;  2B9W A;  2ZBC A;  5F3Z A;  4OYW A;  4Q7A A;  1NBE B;  2BKP A;  1N5V A;  4W92 B;  2NCK L;  2YNH B;  3E01 A;  4DR5 J;  2VON A;  2VBZ A;  4RUB A;  1UWA A;  3KG4 A;  4PPD A;  1M5V C;  2MLX A;  3Q8Q B;  3UD3 P;  1T9Y A;  2C2Z B;  4Y28 C;  1YBU A;  3K17 A;  4RZR A;  5EWG A;  2RKI A;  3IA0 A;  3MCO A;  4HDH A;  2R8I A;  1KVI A;  4I2Q B;  5CAA A;  1JK9 B;  4B9M A;  4C3L A;  4F0M A;  5C5J A;  2DCL A;  1F5B A;  5J1P A;  4MYT A;  2FJD B;  3M6V A;  3JSM B;  2ZKU A;  2XY6 A;  3CD6 S;  5A0Y A;  4HR2 A;  3T19 A;  4CYU A;  5SZT A;  4OYZ A;  4RBU A;  2ZD1 B;  1CVJ A;  1S4E A;  1GMU A;  3GV5 B;  3ZFV A;  1NB7 A;  3FJ2 A;  1TL1 B;  1QSY A;  1N48 A;  1WUU A;  2EK1 A;  3ENV A;  5EWE A;  3KLE A;  3M8R A;  1PKU A;  1TMM A;  4TY8 A;  2UXD J;  1B0V A;  2CDR B;  3W2V A;  3UDV A;  4UF4 A;  1UWB B;  3DLE A;  1XR7 A;  1UEK A;  1YRX A;  2NXN A;  2BQR A;  3MM5 B;  4OL8 A;  1EJ7 L;  3J80 Y;  2Y1I A;  4DX6 A;  2IM1 A;  4NRU A;  5SUH A;  2W7A A;  1PC5 A;  3BDP A;  2DHA A;  1WF2 A;  2XB2 D;  4Q45 A;  2DKO B;  2Z30 B;  2NZ4 A;  4QR0 A;  1WJ9 A;  1FNX H;  2FTR A;  3I9V 9;  3JYT A;  3OL9 A; 
#chains in the Genus database with same CATH homology
 5ETQ A;  2F63 A;  1EQM A;  2F65 A;  1HQ2 A;  2BMB A;  3HSG A;  3ILO A;  3MCM A;  4CYU A;  1RAO A;  3KUE A;  1F9H A;  4M5J A;  1KBR A;  4CWB A;  5ETL A;  1RTZ A;  3HD2 A;  3HSD A;  1TMJ A;  5ETK A;  4PZV A;  1TMM A;  1CBK A;  1G4C A;  5ETS A;  4AD6 A;  3KUH A;  4M5I A;  1RU1 A;  4CYU B;  4F7V A;  1EQ0 A;  5ETP A;  3UDV A;  3HSJ A;  3ILJ A;  3HCX A;  1IM6 A;  3ILL A;  4M5G A;  1EX8 A;  2CG8 A;  3ILI A;  1HKA A;  3HSZ A;  3IP0 A;  3MCN A;  4M5H A;  2QX0 A;  3QBC A;  5ETV A;  4M5N A;  3UDE A;  1RB0 A;  5ETR A;  3HD1 A;  5ETN A;  3HT0 A;  5ETO A;  5ETT A;  3MCO A;  3KUG A;  4M5M A;  3UD5 A;  1RU2 A;  4M5K A;  4CRJ A;  5ETM A;  4M5L A;  1Q0N A;  1DY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...