2F66C

Structure of the escrt-i endosomal trafficking complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
65
structure length
65
Chain Sequence
SKKYGDIALKKKLEQNTKKLDEESSQLETTTRSIDSADDLDQFIKNYLDIRTQYHLRREKLATWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional organization of the ESCRT-I trafficking complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
molecule keywords Suppressor protein STP22 of temperature-sensitive alpha-fact
total genus 27
structure length 65
sequence length 65
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2f66C00
2F66C 3SJAC 3SJBC 3ICXA 1X4TA 3QF7A 2JS5A 3THOA 3ZS8C 3QG5A 1NT2B 2CAZC 3B2EE 3SJCC 3CSXA 1SKVA 2P22C
chains in the Genus database with same CATH superfamily
2LO1A 4UXNA 2Q7GA 5J2UB 5LGUA 2OTJV 1KUQA 1J5EO 1PL4A 4DR2B 3IAYA 3RWRD 2D3OW 3OFNG 1HNZB 4MT8A 4NR1A 3KZIZ 1D5AA 2EIJC 3SJAC 5IDJA 1Q86W 2UUCO 2A06H 2PI4A 3W7UA 1VQ4V 4DW0A 4JI0B 4F6RB 2CTPA 4NYKA 4LF4O 5EZYA 1EZVH 3RGBA 1EN5A 2W6JG 3SPJA 4UCSA 1SRYA 4LWSA 3F7YC 3EHBB 4AILC 2P4VA 4LFBB 4TV8A 2WLIA 1JVMA 2NNUA 3ZMTA 2PI5A 3RYHB 3SPGA 1ZSPA 1Z5VA 5L3BA 2KG7A 4UV9A 4I0XB 4DV5B 3M8AA 2P7TC 4I55B 4F4LA 3G71V 1SQPH 3JYCA 2ZD9A 2UUBO 3O65A 3JCZA 3WG7C 5KA5A 2WLMA 3K59A 4IHJA 1MABG 5BXZA 4O4HA 4DR6B 4QNHB 3B77A 4O4LA 1OHHG 3CHXA 2HJDA 1VQOV 3SYQA 3AK1A 1BGYH 1YVWA 3CRQA 4YJ2A 1CP9A 1JMKC 1X59A 5CBGA 4K0KB 4J7KA 4DR7B 3QO8A 1L0LH 3HKBB 2YIBD 1H2LA 4P9PA 1WNSA 3RBZA 3K08A 5EC1C 4MVUA 2VQFO 1XL4A 3L9DA 4JF3A 1WAZA 4FLTA 3CEIA 3X2QB 5LYJB 1TAEA 1N8RW 3EXAA 3W7WA 2F4VB 4B3RO 5LHGA 4GYCB 2R9IA 2RJZA 3DC5A 2HEPA 4FPPA 1G1XB 1QVGU 3QF7A 4DV5O 4LFCO 2XAQA 3ABLC 3JAKA 2ITCC 2CGNA 4DV0O 5L3FA 3UO2A 3IC9A 3T1HB 3QG5A 4HNAB 2PYJA 3H1IH 5CA1B 5KA6A 2V7QG 4CC6A 1H2KA 3P30A 1FAFA 4FZ0A 4EKWA 4B3RB 5KUMA 2D2CB 4X1KB 4JGSA 1ZTEA 2DQ3A 1O9HA 2B1GA 1W59A 1XMQB 1E1QG 4LFCB 4E2LA 3CC7V 3ASOB 1M9NA 3BEHA 1QR9A 4FK5C 1A32A 1TGOA 3CE2A 4I9QA 1CPYA 2OCCC 3JD3A 1F4MA 4ZOLB 1BE3H 1Q8IA 5KX5B 3HKCB 4RQFA 1OCZC 5ITZB 1Y76B 1S76D 3ZRSA 1HNXO 4DR6O 2HVJC 4DV4O 3OTOB 4DV6O 1K33A 1P7GA 1EN6A 3KKYA 4JYAB 2DJVA 5KAFZ 4JI7O 4JI5B 2AGAA 4I55A 4X20B 4OPAA 1FD9A 2Q7HA 1JFFA 4EB6B 3JD2A 4DUZB 2LGQA 4FIPC 3GB7C 1XI1A 5JVDB 2OCHA 3BHPA 4ZI7B 3FB7C 3N27A 4EEQA 4JI6O 4FZ1A 4N21A 3A0RA 5EYPA 2Q6AA 4IIJB 1XHXA 4J7ZA 1OCOC 1R6NA 4JYBA 3G4SV 5IJ0B 4Z1VA 2EBOA 3SPIA 2NLJC 4H33A 4DR1B 3RW0A 1N33O 1Y4MA 3E22B 3J81N 1TUBA 1BMFG 1H8HG 4FFBB 4J9ZB 3ZMVA 2UUAO 4FLZA 1VF7A 2JS3A 3JASA 3ABTA 3FFQA 2CK3G 2Z5UA 1ZL8B 3R65A 2IH3C 2NN4A 4RUFA 1NJIW 2RQ6A 2PF4E 2XASA 3K5OA 3RYIA 2QJ1A 5LHIA 3SYAA 4X89A 1S3JA 3K0DA 4DR1O 3JAKB 3D3QA 2LW7A 4LF9B 5D5PA 4B08A 4FMTA 1YTFD 4PA3A 5GONA 3SJQC 2GTAA 1YF2A 4JI3B 5JVDA 4ZI7A 3IC7A 1PKXA 1QCEA 2QA4V 2KSDA 1S77D 1NR1A 2P4KA 1KYOF 2Z0AA 4U7NA 1PP9H 2HLDG 3KCXA 2Q9LA 3K5MA 3GWKC 3BRCA 3JD1A 4GCZA 4LFAO 2CTRA 3CRCA 3UKMA 2UXBB 2YEVA 4DRXA 2PY5A 1AI7A 1P7BA 3BVOA 5J2TB 1VQ9V 3UQ8A 4JAUA 1ENVA 4WFBV 4KXRA 4ZHQA 3E8HA 4YY3B 1GMGA 5IYZB 2QWRB 2AHYA 5B1OA 1GH6A 1B04A 2M6YA 4QE7A 2K9PA 3CCUV 1DGSA 1FJGO 2ZNIA 3LUTB 1FXKC 1NVPD 3CC4V 1PNMA 2WPDG 1YEWA 3FX7A 2LGWA 4MSWC 2YIAA 4L8JA 2CH7B 4ABMA 1YCIA 4XDKA 2IU3A 5KHJA 1NTZH 1G4YB 4UCUA 5IWAB 2ZR3A 1KP2A 1Y6XA 2EULA 2Y69B 3U0ZA 2AHZA 1PPJH 4CH5A 4O4IB 2ZM6O 1M1KW 3ABMC 4GX2A 4PA4A 4LF7O 2UUBB 4OPHA 2FKXA 4MTXA 4NTYA 2ZIOA 1IDSA 2DQ0A 5KMGA 5L3DA 4DRXB 1GN6A 1IBLO 5H6RA 4Q20A 3H1KH 3FYEB 2IH1C 3T1HO 4Z1MG 5EBMC 4ICGA 2DOSA 4G2KA 2CAZC 1M90W 3CRRA 5TISZ 4LWSB 4LFBO 4PJ0Z 4FM2A 1QQCA 2FB5A 2QR4A 3AG4C 1N36B 2F1MA 1KMIZ 4HYOA 1E1RG 1YIJV 1K5SA 1IXBA 1N0JA 2DE0X 1AROP 3HKEB 2R70A 1QHTA 2YIBA 3B2EE 4K8XA 5KLVH 4YJ2B 4WFFA 3OMAB 3CX5F 1AP5A 4PI2A 1JOYA 5EC2C 4BWAA 1FXKA 3CP1A 2KB1A 3VBBA 4QJFB 1R3IC 4O2BB 4JV5B 3WB1A 5EBWC 1I5YA 3DGEA 4X62O 4DUYO 3ABMB 3E2EA 4D7SA 3ASNB 3M7MX 1WPXA 1UPGA 5J2UA 2JIZG 3K5NA 1SA0B 3CXHF 4KUMA 5KMGB 2F93B 2A3QA 4RO2A 4XBFA 5KAIZ 3ZHUA 5C8YB 3G80A 3ETEA 5LMUO 1DLBA 5C93A 3FB6C 1WPBA 1I7FA 2AW9A 3HKBA 2KG7B 1SQBH 1OCRC 5LP6A 5JCOC 4JYCA 1GAXA 4HNAA 3AG2B 3AG2C 3OEHG 5B66Z 1S0VA 3FAVA 4ZHQB 4UCOA 4OGQB 4X9QA 3LDEA 4J80A 4IGGA 3CCEV 5FPOA 2X0LA 4DR4B 3STZC 2EZOA 5CBFA 3ABUA 3P32A 5A2QN 1R6TA 3H1LH 3FKSG 1QR8A 4G28B 4X64O 3D36C 3RYCB 3D8CA 4BR6A 2EZPA 1OCZB 4NXMO 2F66C 2JGDA 1L0NH 2QKAA 2WLJA 1R3LC 1HW7A 4MW8A 2Q7EA 4I50A 3AG4B 3K57A 4X1KA 3J80N 2X6BA 1NVPB 3T4ZA 4DV2O 3ASOC 5BZBA 1KKDA 2QDOA 2RMKB 3E89A 3KCYA 3EFFK 2OCCB 1EN4A 2YC0A 3KG2A 3HR0A 1E79G 1TA8A 4OX9B 1VF5B 1TUBB 4BIOA 4CH3A 2VQEO 2E76B 4LCUC 1V55C 2JJ1G 1Y76A 1JA8A 4TOIA 2EIJB 1SQQH 4PELA 2DYRC 4QGPA 3CB2A 5A9GA 4OX9O 1QNMA 1GN2A 2QWOB 5FL7G 3RYIB 4UB6Z 3IJ4A 3CCRV 1MSDA 2Y0PA 5B1AC 2JJ2G 5JH7B 1DF4A 2BSKA 2A7WA 4PDVA 3RFRA 4JV5O 1MA1A 2L6LA 3JASB 3OT7A 5EZYB 1XMOB 3JSLA 3B40A 4PA6A 1M56C 1GM9A 4YY3O 2B5UA 2QWQB 1K4DC 4GLXA 4DV1B 3PN1A 5IYDO 1HNWB 2IJJA 3AK3A 3CCLV 1N34B 2A0LA 1Y67A 4BIUA 4GKKO 3G67A 3ZMUA 1THZA 5LXTA 5CB4A 3SYCA 1M56B 2YICA 1OZ0A 1FS0G 1G8MA 3W7TA 5EK0A 3SJCC 3CCQV 4BW5A 1YJWV 3QO5A 3ZHRA 1L8DA 1XREA 4YHHB 3CMEV 1JFFB 1IBKO 3UT5A 3RVYA 1UFIA 2BCCH 2QGNA 2P5OA 2UXNA 3K9AA 2JDIG 5BMVB 2CUGA 4WFGA 2WAMA 3JSNA 2CGOA 3GWOA 3U10A 1IZ3A 2MW2B 3S3WA 2UUAB 4JZ2A 3WB0A 4I7ZB 1XOUA 3LDDA 3TCUA 5KUKA 1SC5B 1GM7A 4MVZA 4F6EA 1N33B 1YXBA 3CJHA 5DN6G 5KHGA 2R9RB 2WA3A 2XAJA 3HB3B 3ZHTA 1XILA 3W7SA 1GO3F 2ATKC 3C3SA 3ZHSA 1UJWB 3CMAV 3LDCA 5CB4B 2ZKOA 2GBOA 2G38A 2H8PC 5LOVA 1DK1A 5HFLA 1NR7A 4X66B 5H2FZ 4JTAB 5B3SC 2GUZA 2P90A 4LF5B 1ZX3A 3APOA 2UXXA 1W0KG 2FL4A 5JJJB 1NQTA 1H2MA 2ZINA 4MVSA 2QKCA 3TK1A 2EIKC 2YXYA 1VARA 2E5LB 2ZT9B 4YIPA 2ZCEA 1RSOB 3C90A 3BA8A 5LA6B 1M4UA 2YI9A 1WLEA 5KHHA 3K0GA 1QLEC 1H2SB 4X88A 4X65B 2LJ2A 3CS5A 1IVSA 4JI1B 3K06A 4MVQA 1R1BA 2E3CA 5IY5B 4QPKA 3JATA 1NTKH 3B8MA 2HVKC 2YEVB 3PJSK 2O57A 4DV7O 1VQLV 3CD6V 1YZBA 5F2VO 1SZTA 5EIBC 4CH6A 1HNZO 1AR5A 4WBNA 1AI5A 3VQVA 3Q4HA 2EINC 3IFXA 1XDCA 2LP7A 2PUSA 4CBCA 2QM8A 1WB8A 4MVMA 4D6TH 3BY6A 1RPOA 1VQ8V 1LUWA 1D5NA 3ASNC 2ZE5A 5IJ9B 3A8TA 2PYLA 5L3GA 1HNWO 1WJZA 1Z2GA 1HR0B 4B3MB 1NTMH 3JALB 5BR8O 4GKJO 2UXCB 1D2DA 1WA8A 4P30A 4LH6A 2BOBC 4JTCB 5EYPB 4Q6GA 1XMOO 4IYHA 3ETGA 3A2FA 2HP8A 3OD4A 4O4LB 1IURA 2FYUH 2KQXA 3DC6A 4O2AB 2RCVA 2GTSA 5JH7A 4W4KA 2H3OA 4ZIBA 4JI1O 1V55B 4JZGA 4PDMA 4YIOA 5L3EA 3CRAA 1BQZA 4TSFG 1S5JA 1VP7A 4K0KO 2EINB 4QE9A 5H5NA 2AZ2A 3Q4HB 1M57C 2XAFA 1YSCA 1DF5A 1XUQA 3FB5C 1KD1W 4IYIA 1FKAO 3OTFA 1YITV 1P84F 1NU1H 4P2ZA 4RQEA 1NH2B 2Q67A 1Z5WA 3T4DA 5LP6B 1GRJA 1V54C 4KHPB 4DV2B 4U3JB 4AQYO 2X6AA 3ZEDA 3SJBC 2OWOA 1NKDA 3HPLC 4PA9A 2N74A 1GM8A 3ZX6A 1TVKA 3O9OA 3JCUZ 4NXMB 4MTGA 1TUEB 3B09A 3VQXA 2H94A 2OIEA 4UCRA 3F5TA 1RFYA 3RYCA 4TWKA 4J41A 4D7TA 1WP8A 3L72H 4JI6B 1EFRG 3EVKA 2K1EA 5CA3A 2GV9A 3JAWA 2W0FC 2GHYA 2ZXWC 2YDEA 4XDJA 2ZDIA 5B1BC 1PL0A 1H8EG 4YJ3A 1SESA 4PA7A 5IWAO 2F4VO 3SR2C 3MD0A 4JI7B 4DYLA 4GX5A 2PZSA 3LNMB 2ZE7A 4AHCA 2VWJA 1W2BU 1H38A 3OTOO 1VF6C 3E8GA 4KHPO 3R66A 1Q6UA 1MZEA 1KBHA 3L73H 1S5LZ 1B6QA 4TQDA 2M7WA 1K97A 3LSUA 4H0LB 1PM9A 5KHIA 3MAQA 2QM4A 3OMIB 4DV3B 4JI8B 4LR3A 2PGGA 3ZHQA 1EM1A 1SQXH 3ZRVA 3HKDB 2F95B 4G27B 4UCVA 2DWDC 3CRMA 5H6QA 2ODMA 1N34O 3TXQA 1YHQV 4E4EA 3K3WA 4FFKA 2LQTA 3I56V 4ZBMA 1KECA 2BSKB 4YXWG 2ZIMA 4B3SO 4NXNO 1AI6A 1Q81W 1ZAUA 4DW1A 2BTQB 3RN4A 2YUAA 4B7EA 2ZR2A 4BAYA 4L87A 3NXSA 4UV8A 4DUZO 1XBLA 3G6EV 3ICXA 3H1HH 3UCSC 2IJIA 4DO2A 1EZJA 4I50B 4O2BA 2JGUA 5GTIZ 4JI2O 4JI4O 4B3SB 5DM6V 5BR8B 4FFBA 1HR0O 1R3KC 5IYCO 4B3MO 1YJNV 1GTOA 1XL6A 4LF9O 3RYHA 2C2AA 5AG2A 2LFSA 5GW7A 3BAAA 3TETA 1JX9A 4DV3O 1IBMB 1HNXB 4I4TB 1G6UA 5CA0A 2CE4A 2IJHA 3OR7C 1QLNA 4HAMA 4PD4F 1MNGA 4UCTA 2AXTZ 1MMMA 2DWEC 2B1IA 1SF9A 2JRIA 1AILA 4DR2O 1SQVH 3I5DA 3K58A 1BHBA 1AVMA 1PD3A 1PNLA 3AEIA 1U97A 5DECA 4JYYA 1JR9A 5LA6A 1K92A 1QVFU 1BL8A 5CN0A 1K4CC 4K35A 1Y74B 3I55V 4LP8A 5C8YA 2UXDO 2XAHA 4YJ3B 1U96A 3UO3A 5IYZA 3UT5B 1Q7YW 1BS3A 2V1DA 3ZMSA 1AR1B 3OE7G 4H44B 1F51A 1WN7A 1US6A 1K5QA 3L75H 1FFTB 2VWKA 2WLNA 3FYIB 5IJ9A 1GN4A 2F23A 3VQYA 2L35A 1XNRO 4U3FH 4PI0A 1MG1A 2X6CA 2EX3A 1H2GA 4AQYB 1FPOA 2GDSA 2CTQA 3TJTA 1YTFB 3CWBH 2V4DA 4J10A 4JI8O 2ADQB 5JQGB 1MOFA 1JJ2U 3JARA 2AZ0A 1F4NA 3HKDA 2Y0IA 1VIBA 5GONB 4BW9A 4X62B 2Q0OC 2Q69A 4UB8Z 3QTCA 4IHJB 3TXSA 4GZRB 3N2KA 3ZRWB 4R50A 3C3TA 1NS1A 5B1NA 5LOVB 1YJ9V 3FB8C 4ZKIA 2QE7G 1Y74A 1XMQO 3T1YB 4X1IA 2XNDG 1NT2B 2ITDC 4H37A 4PDRA 4DR5O 3AG7A 1Q3EA 1VQMV 4FVMA 4WFAV 1BT8A 1AR4A 5HFMA 1URFA 2XHBA 4JI4B 1WP7A 4DV0B 5IY5C 4UUJC 1ZUQA 4X1YB 4NVPA 3THOA 1R73A 4X8AA 3QNEA 3D36A 1IBLB 1K9MW 2WSSG 1FXKB 1OJHA 3E35A 1MSWD 1RM1B 4PV1B 2IW5A 2HR3A 4JI0O 5LXTB 5CA1A 4NXNB 2EIKB 4GUNA 4RUEA 4C7UA 3CSXA 5JJEB 3JAWB 2NR5A 1BZKA 2QSAA 2ETNA 3N2GB 3ABKC 4O2AA 1P4RA 4HZ3A 4IIJA 2Z3YA 3ZS8C 1VQKV 2WLHA 3H9VA 1FFXB 5KHKA 3QO7A 2EIMC 1COWG 1XHZA 2GSMB 2ZNJA 1IBMO 2UU9O 1TVKB 3TGUH 1FYJA 1M5IA 3OMNB 2IU0A 4CH4A 4GX0A 3F7VC 5JJNB 2DW4A 4KL1A 3IGAC 5IYBO 4JI2B 3K04A 3DXRA 2P22C 4CC5A 3CCMV 2CDYA 3CC2V 3CJHB 2Y48A 3BABA 1K73W 3A0BZ 2E74B 4X66O 3JD4A 4FM0A 3BCCH 3JALA 4DR3B 3ZJZA 4LC1A 3P3NA 4RWUA 1N0NA 4R7CA 4HBNA 3N2GA 4MS2A 4LF6B 3MHSC 4R6ZA 3MDSA 4LNUA 3L71H 4CS3A 2WLKA 4DV1O 4UFZA 1SZXA 4KFMA 3OUFA 3RT3C 3NR7A 4IL6Z 4B7KA 3ZN0A 2RN9A 4F6RA 3J7AU 1RSOA 3WG7B 2FMLA 1ZWIC 1ZLZA 5GTHZ 2Q8VA 1OCRB 3ZMZA 1M93A 1LR1A 5BMVA 2JEXA 1J95A 2ZXWB 4EFEA 4GT1A 5H9CA 3OGCC 5FLXN 4FLUA 1VQNV 5LL6Y 3T2MA 3JD0A 5CA0B 4YHHO 2HHHB 1F23A 4O4JA 2EJRA 2UU9B 5B3SB 4I9WA 3BPZA 1I0HA 1SERA 3WB2A 1AJPA 1JCHA 2JGDB 2VS0A 3LSSA 1QBZA 3AG3C 5DEDA 3OW2U 4DUYB 1N32O 3W7XA 2HJFC 2KKWA 1R3JC 1R6KA 4P9OA 4GKKB 4TUYB 1B3QA 1I94B 3DTUB 1Q90D 3APQA 2WA4A 4K3AA 4WBNB 3RYFA 1F7YA 3VOUA 4FLWA 3HKCA 1CEZA 4J42A 4WF9V 4DV6B 4X64B 1N32B 1T5EA 4DK0A 2RDCA 3SPHA 3ABKB 1NZ6A 2Y69C 4MVRA 1W0JG 2QTSA 5FNVB 3ZCCA 1KP3A 2VRZA 1HDJA 1LNQA 3K03A 3CCSV 3CXCU 2XT9A 2HHHO 4DK1A 2R72A 4DXWA 3ABLB 2YXLA 1J5EB 2OT5A 2WLLB 1LUVA 5LBQA 1WB7A 5JCOA 1IBKB 3M99B 4WCEV 2YIDA 4RAIA 2CH7A 3FD9A 2JK5C 1IX9A 3F5WC 5LGTA 4NTWA 1Q5OA 1Q6IA 1IXMA 3LNNA 1OCCB 2CTWA 4X65O 1K3EA 5LMNB 5B1BB 2OYQA 2IJKA 4MTFA 3SYPA 5JQGA 4O4HB 3GVMA 3ZIAG 3ETQA 4U7OA 2P06A 5JWPA 1JPXA 3K79A 4GX1A 4A5UB 3LSQA 1S5HC 2RNBA 2XOKG 1K8AW 1V54B 1OCCC 1AJQA 2Q5ZA 4ZOLA 1GN3A 3QVNA 2XAGA 3ZRWA 3ML0A 3OGIB 1MZFA 2N04A 2JS5A 1GK9A 4I0XA 3S3XA 4U3JA 5EIBD 1B06A 4W4LA 2VQFB 4DR4O 4FLYA 4J11A 2OIGA 4IT5A 4LF8B 5LYJA 1M57B 3D3IA 1K7DA 3B4SA 4DR7O 4LH7A 2DMXA 3ZBHA 4DV7B 4TV8B 3T1CA 1SS3A 1KQSU 4JASA 1BQ0A 1ORQC 2A79B 5LMNO 2QTOA 1ZL8A 1ROPA 2MK3A 3E83A 2YXHA 2HKOA 1YI2V 4LF7B 5IT9N 5FPRA 3B8NA 3VQWA 5B5EZ 4QPJA 2WLIB 2DN9A 1VQ7V 1FFXA 2DYRB 1VQ5V 2ZE8A 4TV9A 2Q0AA 3A0HZ 2JEUA 3E8BA 4LBEC 2VQEB 3CPWU 1OCOB 4JAVA 1KC8W 4UVCA 2E75B 2PTMA 2P6JA 3X2QC 3RYFB 5K1XA 1BSMA 1P49A 4ASUG 3L74H 1Q6HA 4OXSA 1SKVA 4AI8A 2Q73A 4JTDB 5KX5A 1XQ8A 3AK2A 2HFEC 1AP6A 3ZN1A 1O9GA 4QIWF 3DXRB 3JARB 2ZQMA 3U11A 3RVZA 3CCJV 5E1AC 2FTKA 1KB9F 1QU7A 4LF4B 3STLC 3JAMN 2BOCC 2WWWA 1NBMG 4KP4A 4CS2A 5L3CA 1I5XA 3WFVA 2UUCB 1PNKA 3H01A 2Q68A 3SYOA 4Z2WA 3OEEG 3JATB 2QWPB 4O4IA 4B3TO 4X1IB 3UM7A 1NI8A 1SETA 1FXVA 5EBLC 1H2NA 4FJCC 4CZZA 3MHHC 2ZM6B 1N4CA 2Y4UA 1OV9A 1JQ0A 3L70H 2B9ZA 1AJNA 1FXHA 3N2KB 3OR6C 4FLVA 4I4TA 5CMUA 1I08A 3E86A 2BTOA 3K5LA 2QM7A 4FLXA 2R9AA 1SA0A 2E5LO 3P3PA 4DV4B 1XNQB 5IJ0A 3OUSA 4J7JA 4LF8O 1VMGA 5B1AB 3AG1C 3BFRA 4LF5O 4B3TB 3G6BA 1V9PA 5IE9A 4NKGB 3OM3B 2DYSC 4O4JB 1KU9A 1SQFA 1N36O 2IBZH 3CYOA 4JAAA 3SDLA 4MW3A 3ZRXA 4LF6O 2ZE6A 2A9HA 4H13B 4FM1A 2BE3A 1XEQA 3WU2Z 4PHZA 5ITZA 1VF6A 2YSUB 4LFAB 4TUYA 2UXDB 4DR3O 2OTLV 1EBOA 4UVBA 2Y4TA 1S72V 1HWYA 2ARHA 5BY1A 2ADPA 1NH2D 4JI3O 3HKEA 2DYSB 2ZDIC 1RM1C 4MTOA 4X20A 1Y66A 4JI5O 3H1JH 2YI8A 1AI4A 3AG3B 3FAVB 5CBHA 3AG1B 2EILC 4J9YB 5LMUB 2JVDA 2YS8A 3T1YO 2QEXV 2IM9A 2F43G 4TQFA 2EIMB 4TT3G 4MVOA 5J9PC 2W6IG 2EJ7A 2WLLA 3E22A 5LGNA 4XDLA 4EB6A 1Q82W 3E8FA 2BTQA 4WFEA 1L1FA 2W0XA 3BA9A 2X7RB 3CCVV 1SQGA 3DSQA 1RP3B 2HG5C 3OAAG 4BIZA 1FJGB 3K9SA 1BCCH 4NB5A 1GKFA 4I5SA 2LW1A 1I94O 2QKSA 1JJOA 4NTXA 3ETDA 5LHHA 5J2TA 1YDXA 1XNRB 2Q4PA 1VQ6V 1QLEB 2P67A 4X1YA 1PV0A 2LFRA 4K8ZA 1VEWA 1RPRA 1X4TA 4LNUB 4EFBA 2XUMA 5E79Z 2ILMA 2XTAA 1HP8A 3SGIA 2UXBO 1DTOA 4TV9B 1XNQO 2EILB 1CXZB 4PDLA 5LP6C 4GKJB 2UXCO 2QWNB 4UVAA 3ZHVA 2GUZB 3SPCA 4N23A 1K34A 4R8CA 4CS4A 4WFHA 1AB3A 2N05A 4JYAO 5FNVA 1VQPV 4JPRA 4DR5B 1Q43A 1WA8B 5D5QA 5K1PA 1BHAA 1KKCA
chains in the Genus database with same CATH topology
4NXMB 4O4JA 4PI2A 4BWAA 2Q7GA 2UU9B 3VQXA 4UCRA 3BPZA 5J2UB 3WB2A 3RYCA 4D7TA 4O2BB 4DR2B 3IAYA 3RWRD 1HNZB 4JV5B 3WB1A 4DUYB 4JI6B 4D7SA 2KKWA 2GV9A 3JAWA 1D5AA 3SJAC 3M7MX 4GKKB 4TUYB 1I94B 5J2UA 3K5NA 1SA0B 5KMGB 2F93B 4JI0B 4F6RB 4YJ3A 5EZYA 4WBNB 3RGBA 3RYFA 5C8YB 4FLWA 3HKCA 1WPBA 1I7FA 3HKBA 4UCSA 3SR2C 4JI7B 4DV6B 4X64B 5LP6A 2PZSA 5JCOC 1N32B 1T5EA 4AILC 4AHCA 2VWJA 4DK0A 4LFBB 4HNAA 4TV8A 4ZHQB 4UCOA 3RYHB 1Z5VA 5FNVB 4TQDA 5KHIA 3MAQA 2QM4A 5FPOA 4DV3B 4DV5B 4DR4B 4JI8B 4I55B 4LR3A 2PGGA 4DK1A 2R72A 3HKDB 2F95B 2YXLA 1J5EB 4UCVA 3RYCB 5JCOA 1IBKB 3K59A 2F66C 2ZIMA 4IHJA 4O4HA 4DR6B 1ZAUA 1Q5OA 2BTQB 1HW7A 4O4LA 3LNNA 2Q7EA 4I50A 3CHXA 3K57A 4X1KA 5LMNB 4YJ2A 2OYQA 5JQGA 1JMKC 4O4HB 4K0KB 3ETQA 3ICXA 4DR7B 3HKBB 2YIBD 4I50B 1WNSA 4O2BA 2JGUA 4B3SB 5BR8B 4FFBA 1TA8A 4ZOLA 4OX9B 1TUBB 4FLTA 4CH3A 5LYJB 1TAEA 2JS5A 3RYHA 2F4VB 4GYCB 2RJZA 4TOIA 2HEPA 3BAAA 4U3JA 5EIBD 3QF7A 2VQFB 3CB2A 1IBMB 4FLYA 1HNXB 4I4TB 1G6UA 3JAKA 4LF8B 5LYJA 5CA0A 3RYIB 4LH7A 3T1HB 3QG5A 4UCTA 4HNAB 5JH7B 4DV7B 4TV8B 2PYJA 5CA1B 4CC6A 3RFRA 3JASB 5EZYB 1XMOB 4B3RB 3JSLA 3K58A 4X1KB 4GLXA 4DV1B 1O9HA 4LF7B 1XMQB 3PN1A 5LA6A 4LFCB 5FPRA 1HNWB 3VQWA 1N34B 1TGOA 1FFXA 4I9QA 4TV9A 2Q0AA 2VQEB 5LXTA 4ZOLB 5CB4A 1Q8IA 5C8YA 2PTMA 5KX5B 4YJ3B 3HKCB 5IYZA 3UT5B 5K1XA 3RYFB 1P49A 5ITZB 3SJCC 1SKVA 1WN7A 2VWKA 5IJ9A 5KX5A 3OTOB 1XQ8A 3VQYA 1L8DA 4YHHB 1JFFB 3UT5A 1O9GA 3U11A 3JARB 4JYAB 4PI0A 2P5OA 5BMVB 2EX3A 4AQYB 4LF4B 4JI5B 3JSNA 2V4DA 4I55A 4X20B 4CS2A 2Q7HA 1JFFA 5JQGB 3U10A 4EB6B 3JARA 3HKDA 2UUCB 2UUAB 5GONB 4BW9A 4X62B 4DUZB 3WB0A 1XI1A 5JVDB 3BHPA 3JATB 4ZI7B 4EEQA 1N33B 3QTCA 4IHJB 4O4IA 3N2KA 4X1IB 5KHGA 5EYPA 5LOVB 4IIJB 1XHXA 2ZM6B 5CB4B 3T1YB 3N2KB 4X1IA 5IJ0B 4FLVA 1NT2B 4I4TA 5LOVA 4DR1B 2BTOA 3K5LA 1Q3EA 4FLXA 4FVMA 2R9AA 1SA0A 3E22B 1TUBA 4X66B 4FFBB 4LF5B 4DV4B 2XHBA 1XNQB 5IJ0A 4FLZA 4JI4B 5JJJB 1VF7A 3JASA 2ZINA 3FFQA 4DV0B 2RQ6A 2E5LB 4B3TB 4X1YB 4NVPA 3THOA 2ZCEA 3K5OA 3BA8A 5LA6B 1V9PA 1IBLB 1M4UA 3RYIA 2QJ1A 2YI9A 3JAKB 4O4JB 5KHHA 4LF9B 5D5PA 4X65B 1H2SB 1KU9A 1SQFA 4B08A 4JI1B 5GONA 5LXTB 5CA1A 4NXNB 4JI3B 5JVDA 2E3CA 3JATA 4ZI7A 3CSXA 4FM1A 5JJEB 3JAWB 4LFAB 4PHZA 5ITZA 3N2GB 4O2AA 4TUYA 2UXDB 4IIJA 3ZS8C 3K5MA 3BRCA 5EIBC 1FFXB 4CH6A 5KHKA 4WBNA 2UXBB 4DRXA 2PY5A 3VQVA 1XHZA 2ZNJA 3HKEA 5J2TB 3UQ8A 2PUSA 1TVKB 1M5IA 4ZHQA 4YY3B 4X20A 5IYZB 2YI8A 4CH4A 1B04A 5LMUB 5JJNB 2JVDA 5IJ9B 4KL1A 2IM9A 4TQFA 2PYLA 4JI2B 1HR0B 1DGSA 4B3MB 2P22C 2ZNIA 3JALB 4CC5A 2UXCB 1YEWA 4LH6A 3BABA 5EYPB 4Q6GA 3E22A 2YIAA 4L8JA 3A2FA 4FM0A 4EB6A 3JALA 5KHJA 2BTQA 4O4LB 4DR3B 4UCUA 3BA9A 5IWAB 4O2AB 1SQGA 3DSQA 3U0ZA 5JH7A 4CH5A 4HBNA 3N2GA 4ZIBA 1FJGB 4LF6B 4O4IB 4LNUA 4CS3A 2UUBB 4UFZA 1JJOA 1S5JA 2ZIOA 5KMGA 4DRXB 5J2TA 1XNRB 4X1YA 4K8ZA 4F6RA 1X4TA 4LNUB 1RSOA 4EFBA 3OTFA 3SGIA 4TV9B 2CAZC 1M93A 1Z5WA 5BMVA 5LP6B 5LP6C 4GKJB 4EFEA 4KHPB 4DV2B 4FM2A 4U3JB 1QQCA 4FLUA 3ZEDA 4CS4A 2F1MA 1KMIZ 1N36B 3SJBC 2OWOA 5FNVA 4DR5B 1Q43A 5CA0B 5D5QA 3HKEB 2R70A 5K1PA 1QHTA 1TVKA 2YIBA 3B2EE 2HHHB 4K8XA 4YJ2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F66 C;  3SJA C;  3SJB C;  3ICX A;  1X4T A;  3QF7 A;  2JS5 A;  3THO A;  3ZS8 C;  3QG5 A;  1NT2 B;  2CAZ C;  3B2E E;  3SJC C;  3CSX A;  1SKV A;  2P22 C; 
#chains in the Genus database with same CATH topology
 2LO1 A;  4UXN A;  2Q7G A;  5J2U B;  5LGU A;  2OTJ V;  1KUQ A;  1J5E O;  1PL4 A;  4DR2 B;  3IAY A;  3RWR D;  2D3O W;  3OFN G;  1HNZ B;  4MT8 A;  4NR1 A;  3KZI Z;  1D5A A;  2EIJ C;  3SJA C;  5IDJ A;  1Q86 W;  2UUC O;  2A06 H;  2PI4 A;  3W7U A;  1VQ4 V;  4DW0 A;  4JI0 B;  4F6R B;  2CTP A;  4NYK A;  4LF4 O;  5EZY A;  1EZV H;  3RGB A;  1EN5 A;  2W6J G;  3SPJ A;  4UCS A;  1SRY A;  4LWS A;  3F7Y C;  3EHB B;  4AIL C;  2P4V A;  4LFB B;  4TV8 A;  2WLI A;  1JVM A;  2NNU A;  3ZMT A;  2PI5 A;  3RYH B;  3SPG A;  1ZSP A;  1Z5V A;  5L3B A;  2KG7 A;  4UV9 A;  4I0X B;  4DV5 B;  3M8A A;  2P7T C;  4I55 B;  4F4L A;  3G71 V;  1SQP H;  3JYC A;  2ZD9 A;  2UUB O;  3O65 A;  3JCZ A;  3WG7 C;  5KA5 A;  2WLM A;  3K59 A;  4IHJ A;  1MAB G;  5BXZ A;  4O4H A;  4DR6 B;  4QNH B;  3B77 A;  4O4L A;  1OHH G;  3CHX A;  2HJD A;  1VQO V;  3SYQ A;  3AK1 A;  1BGY H;  1YVW A;  3CRQ A;  4YJ2 A;  1CP9 A;  1JMK C;  1X59 A;  5CBG A;  4K0K B;  4J7K A;  4DR7 B;  3QO8 A;  1L0L H;  3HKB B;  2YIB D;  1H2L A;  4P9P A;  1WNS A;  3RBZ A;  3K08 A;  5EC1 C;  4MVU A;  2VQF O;  1XL4 A;  3L9D A;  4JF3 A;  1WAZ A;  4FLT A;  3CEI A;  3X2Q B;  5LYJ B;  1TAE A;  1N8R W;  3EXA A;  3W7W A;  2F4V B;  4B3R O;  5LHG A;  4GYC B;  2R9I A;  2RJZ A;  3DC5 A;  2HEP A;  4FPP A;  1G1X B;  1QVG U;  3QF7 A;  4DV5 O;  4LFC O;  2XAQ A;  3ABL C;  3JAK A;  2ITC C;  2CGN A;  4DV0 O;  5L3F A;  3UO2 A;  3IC9 A;  3T1H B;  3QG5 A;  4HNA B;  2PYJ A;  3H1I H;  5CA1 B;  5KA6 A;  2V7Q G;  4CC6 A;  1H2K A;  3P30 A;  1FAF A;  4FZ0 A;  4EKW A;  4B3R B;  5KUM A;  2D2C B;  4X1K B;  4JGS A;  1ZTE A;  2DQ3 A;  1O9H A;  2B1G A;  1W59 A;  1XMQ B;  1E1Q G;  4LFC B;  4E2L A;  3CC7 V;  3ASO B;  1M9N A;  3BEH A;  1QR9 A;  4FK5 C;  1A32 A;  1TGO A;  3CE2 A;  4I9Q A;  1CPY A;  2OCC C;  3JD3 A;  1F4M A;  4ZOL B;  1BE3 H;  1Q8I A;  5KX5 B;  3HKC B;  4RQF A;  1OCZ C;  5ITZ B;  1Y76 B;  1S76 D;  3ZRS A;  1HNX O;  4DR6 O;  2HVJ C;  4DV4 O;  3OTO B;  4DV6 O;  1K33 A;  1P7G A;  1EN6 A;  3KKY A;  4JYA B;  2DJV A;  5KAF Z;  4JI7 O;  4JI5 B;  2AGA A;  4I55 A;  4X20 B;  4OPA A;  1FD9 A;  2Q7H A;  1JFF A;  4EB6 B;  3JD2 A;  4DUZ B;  2LGQ A;  4FIP C;  3GB7 C;  1XI1 A;  5JVD B;  2OCH A;  3BHP A;  4ZI7 B;  3FB7 C;  3N27 A;  4EEQ A;  4JI6 O;  4FZ1 A;  4N21 A;  3A0R A;  5EYP A;  2Q6A A;  4IIJ B;  1XHX A;  4J7Z A;  1OCO C;  1R6N A;  4JYB A;  3G4S V;  5IJ0 B;  4Z1V A;  2EBO A;  3SPI A;  2NLJ C;  4H33 A;  4DR1 B;  3RW0 A;  1N33 O;  1Y4M A;  3E22 B;  3J81 N;  1TUB A;  1BMF G;  1H8H G;  4FFB B;  4J9Z B;  3ZMV A;  2UUA O;  4FLZ A;  1VF7 A;  2JS3 A;  3JAS A;  3ABT A;  3FFQ A;  2CK3 G;  2Z5U A;  1ZL8 B;  3R65 A;  2IH3 C;  2NN4 A;  4RUF A;  1NJI W;  2RQ6 A;  2PF4 E;  2XAS A;  3K5O A;  3RYI A;  2QJ1 A;  5LHI A;  3SYA A;  4X89 A;  1S3J A;  3K0D A;  4DR1 O;  3JAK B;  3D3Q A;  2LW7 A;  4LF9 B;  5D5P A;  4B08 A;  4FMT A;  1YTF D;  4PA3 A;  5GON A;  3SJQ C;  2GTA A;  1YF2 A;  4JI3 B;  5JVD A;  4ZI7 A;  3IC7 A;  1PKX A;  1QCE A;  2QA4 V;  2KSD A;  1S77 D;  1NR1 A;  2P4K A;  1KYO F;  2Z0A A;  4U7N A;  1PP9 H;  2HLD G;  3KCX A;  2Q9L A;  3K5M A;  3GWK C;  3BRC A;  3JD1 A;  4GCZ A;  4LFA O;  2CTR A;  3CRC A;  3UKM A;  2UXB B;  2YEV A;  4DRX A;  2PY5 A;  1AI7 A;  1P7B A;  3BVO A;  5J2T B;  1VQ9 V;  3UQ8 A;  4JAU A;  1ENV A;  4WFB V;  4KXR A;  4ZHQ A;  3E8H A;  4YY3 B;  1GMG A;  5IYZ B;  2QWR B;  2AHY A;  5B1O A;  1GH6 A;  1B04 A;  2M6Y A;  4QE7 A;  2K9P A;  3CCU V;  1DGS A;  1FJG O;  2ZNI A;  3LUT B;  1FXK C;  1NVP D;  3CC4 V;  1PNM A;  2WPD G;  1YEW A;  3FX7 A;  2LGW A;  4MSW C;  2YIA A;  4L8J A;  2CH7 B;  4ABM A;  1YCI A;  4XDK A;  2IU3 A;  5KHJ A;  1NTZ H;  1G4Y B;  4UCU A;  5IWA B;  2ZR3 A;  1KP2 A;  1Y6X A;  2EUL A;  2Y69 B;  3U0Z A;  2AHZ A;  1PPJ H;  4CH5 A;  4O4I B;  2ZM6 O;  1M1K W;  3ABM C;  4GX2 A;  4PA4 A;  4LF7 O;  2UUB B;  4OPH A;  2FKX A;  4MTX A;  4NTY A;  2ZIO A;  1IDS A;  2DQ0 A;  5KMG A;  5L3D A;  4DRX B;  1GN6 A;  1IBL O;  5H6R A;  4Q20 A;  3H1K H;  3FYE B;  2IH1 C;  3T1H O;  4Z1M G;  5EBM C;  4ICG A;  2DOS A;  4G2K A;  2CAZ C;  1M90 W;  3CRR A;  5TIS Z;  4LWS B;  4LFB O;  4PJ0 Z;  4FM2 A;  1QQC A;  2FB5 A;  2QR4 A;  3AG4 C;  1N36 B;  2F1M A;  1KMI Z;  4HYO A;  1E1R G;  1YIJ V;  1K5S A;  1IXB A;  1N0J A;  2DE0 X;  1ARO P;  3HKE B;  2R70 A;  1QHT A;  2YIB A;  3B2E E;  4K8X A;  5KLV H;  4YJ2 B;  4WFF A;  3OMA B;  3CX5 F;  1AP5 A;  4PI2 A;  1JOY A;  5EC2 C;  4BWA A;  1FXK A;  3CP1 A;  2KB1 A;  3VBB A;  4QJF B;  1R3I C;  4O2B B;  4JV5 B;  3WB1 A;  5EBW C;  1I5Y A;  3DGE A;  4X62 O;  4DUY O;  3ABM B;  3E2E A;  4D7S A;  3ASN B;  3M7M X;  1WPX A;  1UPG A;  5J2U A;  2JIZ G;  3K5N A;  1SA0 B;  3CXH F;  4KUM A;  5KMG B;  2F93 B;  2A3Q A;  4RO2 A;  4XBF A;  5KAI Z;  3ZHU A;  5C8Y B;  3G80 A;  3ETE A;  5LMU O;  1DLB A;  5C93 A;  3FB6 C;  1WPB A;  1I7F A;  2AW9 A;  3HKB A;  2KG7 B;  1SQB H;  1OCR C;  5LP6 A;  5JCO C;  4JYC A;  1GAX A;  4HNA A;  3AG2 B;  3AG2 C;  3OEH G;  5B66 Z;  1S0V A;  3FAV A;  4ZHQ B;  4UCO A;  4OGQ B;  4X9Q A;  3LDE A;  4J80 A;  4IGG A;  3CCE V;  5FPO A;  2X0L A;  4DR4 B;  3STZ C;  2EZO A;  5CBF A;  3ABU A;  3P32 A;  5A2Q N;  1R6T A;  3H1L H;  3FKS G;  1QR8 A;  4G28 B;  4X64 O;  3D36 C;  3RYC B;  3D8C A;  4BR6 A;  2EZP A;  1OCZ B;  4NXM O;  2F66 C;  2JGD A;  1L0N H;  2QKA A;  2WLJ A;  1R3L C;  1HW7 A;  4MW8 A;  2Q7E A;  4I50 A;  3AG4 B;  3K57 A;  4X1K A;  3J80 N;  2X6B A;  1NVP B;  3T4Z A;  4DV2 O;  3ASO C;  5BZB A;  1KKD A;  2QDO A;  2RMK B;  3E89 A;  3KCY A;  3EFF K;  2OCC B;  1EN4 A;  2YC0 A;  3KG2 A;  3HR0 A;  1E79 G;  1TA8 A;  4OX9 B;  1VF5 B;  1TUB B;  4BIO A;  4CH3 A;  2VQE O;  2E76 B;  4LCU C;  1V55 C;  2JJ1 G;  1Y76 A;  1JA8 A;  4TOI A;  2EIJ B;  1SQQ H;  4PEL A;  2DYR C;  4QGP A;  3CB2 A;  5A9G A;  4OX9 O;  1QNM A;  1GN2 A;  2QWO B;  5FL7 G;  3RYI B;  4UB6 Z;  3IJ4 A;  3CCR V;  1MSD A;  2Y0P A;  5B1A C;  2JJ2 G;  5JH7 B;  1DF4 A;  2BSK A;  2A7W A;  4PDV A;  3RFR A;  4JV5 O;  1MA1 A;  2L6L A;  3JAS B;  3OT7 A;  5EZY B;  1XMO B;  3JSL A;  3B40 A;  4PA6 A;  1M56 C;  1GM9 A;  4YY3 O;  2B5U A;  2QWQ B;  1K4D C;  4GLX A;  4DV1 B;  3PN1 A;  5IYD O;  1HNW B;  2IJJ A;  3AK3 A;  3CCL V;  1N34 B;  2A0L A;  1Y67 A;  4BIU A;  4GKK O;  3G67 A;  3ZMU A;  1THZ A;  5LXT A;  5CB4 A;  3SYC A;  1M56 B;  2YIC A;  1OZ0 A;  1FS0 G;  1G8M A;  3W7T A;  5EK0 A;  3SJC C;  3CCQ V;  4BW5 A;  1YJW V;  3QO5 A;  3ZHR A;  1L8D A;  1XRE A;  4YHH B;  3CME V;  1JFF B;  1IBK O;  3UT5 A;  3RVY A;  1UFI A;  2BCC H;  2QGN A;  2P5O A;  2UXN A;  3K9A A;  2JDI G;  5BMV B;  2CUG A;  4WFG A;  2WAM A;  3JSN A;  2CGO A;  3GWO A;  3U10 A;  1IZ3 A;  2MW2 B;  3S3W A;  2UUA B;  4JZ2 A;  3WB0 A;  4I7Z B;  1XOU A;  3LDD A;  3TCU A;  5KUK A;  1SC5 B;  1GM7 A;  4MVZ A;  4F6E A;  1N33 B;  1YXB A;  3CJH A;  5DN6 G;  5KHG A;  2R9R B;  2WA3 A;  2XAJ A;  3HB3 B;  3ZHT A;  1XIL A;  3W7S A;  1GO3 F;  2ATK C;  3C3S A;  3ZHS A;  1UJW B;  3CMA V;  3LDC A;  5CB4 B;  2ZKO A;  2GBO A;  2G38 A;  2H8P C;  5LOV A;  1DK1 A;  5HFL A;  1NR7 A;  4X66 B;  5H2F Z;  4JTA B;  5B3S C;  2GUZ A;  2P90 A;  4LF5 B;  1ZX3 A;  3APO A;  2UXX A;  1W0K G;  2FL4 A;  5JJJ B;  1NQT A;  1H2M A;  2ZIN A;  4MVS A;  2QKC A;  3TK1 A;  2EIK C;  2YXY A;  1VAR A;  2E5L B;  2ZT9 B;  4YIP A;  2ZCE A;  1RSO B;  3C90 A;  3BA8 A;  5LA6 B;  1M4U A;  2YI9 A;  1WLE A;  5KHH A;  3K0G A;  1QLE C;  1H2S B;  4X88 A;  4X65 B;  2LJ2 A;  3CS5 A;  1IVS A;  4JI1 B;  3K06 A;  4MVQ A;  1R1B A;  2E3C A;  5IY5 B;  4QPK A;  3JAT A;  1NTK H;  3B8M A;  2HVK C;  2YEV B;  3PJS K;  2O57 A;  4DV7 O;  1VQL V;  3CD6 V;  1YZB A;  5F2V O;  1SZT A;  5EIB C;  4CH6 A;  1HNZ O;  1AR5 A;  4WBN A;  1AI5 A;  3VQV A;  3Q4H A;  2EIN C;  3IFX A;  1XDC A;  2LP7 A;  2PUS A;  4CBC A;  2QM8 A;  1WB8 A;  4MVM A;  4D6T H;  3BY6 A;  1RPO A;  1VQ8 V;  1LUW A;  1D5N A;  3ASN C;  2ZE5 A;  5IJ9 B;  3A8T A;  2PYL A;  5L3G A;  1HNW O;  1WJZ A;  1Z2G A;  1HR0 B;  4B3M B;  1NTM H;  3JAL B;  5BR8 O;  4GKJ O;  2UXC B;  1D2D A;  1WA8 A;  4P30 A;  4LH6 A;  2BOB C;  4JTC B;  5EYP B;  4Q6G A;  1XMO O;  4IYH A;  3ETG A;  3A2F A;  2HP8 A;  3OD4 A;  4O4L B;  1IUR A;  2FYU H;  2KQX A;  3DC6 A;  4O2A B;  2RCV A;  2GTS A;  5JH7 A;  4W4K A;  2H3O A;  4ZIB A;  4JI1 O;  1V55 B;  4JZG A;  4PDM A;  4YIO A;  5L3E A;  3CRA A;  1BQZ A;  4TSF G;  1S5J A;  1VP7 A;  4K0K O;  2EIN B;  4QE9 A;  5H5N A;  2AZ2 A;  3Q4H B;  1M57 C;  2XAF A;  1YSC A;  1DF5 A;  1XUQ A;  3FB5 C;  1KD1 W;  4IYI A;  1FKA O;  3OTF A;  1YIT V;  1P84 F;  1NU1 H;  4P2Z A;  4RQE A;  1NH2 B;  2Q67 A;  1Z5W A;  3T4D A;  5LP6 B;  1GRJ A;  1V54 C;  4KHP B;  4DV2 B;  4U3J B;  4AQY O;  2X6A A;  3ZED A;  3SJB C;  2OWO A;  1NKD A;  3HPL C;  4PA9 A;  2N74 A;  1GM8 A;  3ZX6 A;  1TVK A;  3O9O A;  3JCU Z;  4NXM B;  4MTG A;  1TUE B;  3B09 A;  3VQX A;  2H94 A;  2OIE A;  4UCR A;  3F5T A;  1RFY A;  3RYC A;  4TWK A;  4J41 A;  4D7T A;  1WP8 A;  3L72 H;  4JI6 B;  1EFR G;  3EVK A;  2K1E A;  5CA3 A;  2GV9 A;  3JAW A;  2W0F C;  2GHY A;  2ZXW C;  2YDE A;  4XDJ A;  2ZDI A;  5B1B C;  1PL0 A;  1H8E G;  4YJ3 A;  1SES A;  4PA7 A;  5IWA O;  2F4V O;  3SR2 C;  3MD0 A;  4JI7 B;  4DYL A;  4GX5 A;  2PZS A;  3LNM B;  2ZE7 A;  4AHC A;  2VWJ A;  1W2B U;  1H38 A;  3OTO O;  1VF6 C;  3E8G A;  4KHP O;  3R66 A;  1Q6U A;  1MZE A;  1KBH A;  3L73 H;  1S5L Z;  1B6Q A;  4TQD A;  2M7W A;  1K97 A;  3LSU A;  4H0L B;  1PM9 A;  5KHI A;  3MAQ A;  2QM4 A;  3OMI B;  4DV3 B;  4JI8 B;  4LR3 A;  2PGG A;  3ZHQ A;  1EM1 A;  1SQX H;  3ZRV A;  3HKD B;  2F95 B;  4G27 B;  4UCV A;  2DWD C;  3CRM A;  5H6Q A;  2ODM A;  1N34 O;  3TXQ A;  1YHQ V;  4E4E A;  3K3W A;  4FFK A;  2LQT A;  3I56 V;  4ZBM A;  1KEC A;  2BSK B;  4YXW G;  2ZIM A;  4B3S O;  4NXN O;  1AI6 A;  1Q81 W;  1ZAU A;  4DW1 A;  2BTQ B;  3RN4 A;  2YUA A;  4B7E A;  2ZR2 A;  4BAY A;  4L87 A;  3NXS A;  4UV8 A;  4DUZ O;  1XBL A;  3G6E V;  3ICX A;  3H1H H;  3UCS C;  2IJI A;  4DO2 A;  1EZJ A;  4I50 B;  4O2B A;  2JGU A;  5GTI Z;  4JI2 O;  4JI4 O;  4B3S B;  5DM6 V;  5BR8 B;  4FFB A;  1HR0 O;  1R3K C;  5IYC O;  4B3M O;  1YJN V;  1GTO A;  1XL6 A;  4LF9 O;  3RYH A;  2C2A A;  5AG2 A;  2LFS A;  5GW7 A;  3BAA A;  3TET A;  1JX9 A;  4DV3 O;  1IBM B;  1HNX B;  4I4T B;  1G6U A;  5CA0 A;  2CE4 A;  2IJH A;  3OR7 C;  1QLN A;  4HAM A;  4PD4 F;  1MNG A;  4UCT A;  2AXT Z;  1MMM A;  2DWE C;  2B1I A;  1SF9 A;  2JRI A;  1AIL A;  4DR2 O;  1SQV H;  3I5D A;  3K58 A;  1BHB A;  1AVM A;  1PD3 A;  1PNL A;  3AEI A;  1U97 A;  5DEC A;  4JYY A;  1JR9 A;  5LA6 A;  1K92 A;  1QVF U;  1BL8 A;  5CN0 A;  1K4C C;  4K35 A;  1Y74 B;  3I55 V;  4LP8 A;  5C8Y A;  2UXD O;  2XAH A;  4YJ3 B;  1U96 A;  3UO3 A;  5IYZ A;  3UT5 B;  1Q7Y W;  1BS3 A;  2V1D A;  3ZMS A;  1AR1 B;  3OE7 G;  4H44 B;  1F51 A;  1WN7 A;  1US6 A;  1K5Q A;  3L75 H;  1FFT B;  2VWK A;  2WLN A;  3FYI B;  5IJ9 A;  1GN4 A;  2F23 A;  3VQY A;  2L35 A;  1XNR O;  4U3F H;  4PI0 A;  1MG1 A;  2X6C A;  2EX3 A;  1H2G A;  4AQY B;  1FPO A;  2GDS A;  2CTQ A;  3TJT A;  1YTF B;  3CWB H;  2V4D A;  4J10 A;  4JI8 O;  2ADQ B;  5JQG B;  1MOF A;  1JJ2 U;  3JAR A;  2AZ0 A;  1F4N A;  3HKD A;  2Y0I A;  1VIB A;  5GON B;  4BW9 A;  4X62 B;  2Q0O C;  2Q69 A;  4UB8 Z;  3QTC A;  4IHJ B;  3TXS A;  4GZR B;  3N2K A;  3ZRW B;  4R50 A;  3C3T A;  1NS1 A;  5B1N A;  5LOV B;  1YJ9 V;  3FB8 C;  4ZKI A;  2QE7 G;  1Y74 A;  1XMQ O;  3T1Y B;  4X1I A;  2XND G;  1NT2 B;  2ITD C;  4H37 A;  4PDR A;  4DR5 O;  3AG7 A;  1Q3E A;  1VQM V;  4FVM A;  4WFA V;  1BT8 A;  1AR4 A;  5HFM A;  1URF A;  2XHB A;  4JI4 B;  1WP7 A;  4DV0 B;  5IY5 C;  4UUJ C;  1ZUQ A;  4X1Y B;  4NVP A;  3THO A;  1R73 A;  4X8A A;  3QNE A;  3D36 A;  1IBL B;  1K9M W;  2WSS G;  1FXK B;  1OJH A;  3E35 A;  1MSW D;  1RM1 B;  4PV1 B;  2IW5 A;  2HR3 A;  4JI0 O;  5LXT B;  5CA1 A;  4NXN B;  2EIK B;  4GUN A;  4RUE A;  4C7U A;  3CSX A;  5JJE B;  3JAW B;  2NR5 A;  1BZK A;  2QSA A;  2ETN A;  3N2G B;  3ABK C;  4O2A A;  1P4R A;  4HZ3 A;  4IIJ A;  2Z3Y A;  3ZS8 C;  1VQK V;  2WLH A;  3H9V A;  1FFX B;  5KHK A;  3QO7 A;  2EIM C;  1COW G;  1XHZ A;  2GSM B;  2ZNJ A;  1IBM O;  2UU9 O;  1TVK B;  3TGU H;  1FYJ A;  1M5I A;  3OMN B;  2IU0 A;  4CH4 A;  4GX0 A;  3F7V C;  5JJN B;  2DW4 A;  4KL1 A;  3IGA C;  5IYB O;  4JI2 B;  3K04 A;  3DXR A;  2P22 C;  4CC5 A;  3CCM V;  2CDY A;  3CC2 V;  3CJH B;  2Y48 A;  3BAB A;  1K73 W;  3A0B Z;  2E74 B;  4X66 O;  3JD4 A;  4FM0 A;  3BCC H;  3JAL A;  4DR3 B;  3ZJZ A;  4LC1 A;  3P3N A;  4RWU A;  1N0N A;  4R7C A;  4HBN A;  3N2G A;  4MS2 A;  4LF6 B;  3MHS C;  4R6Z A;  3MDS A;  4LNU A;  3L71 H;  4CS3 A;  2WLK A;  4DV1 O;  4UFZ A;  1SZX A;  4KFM A;  3OUF A;  3RT3 C;  3NR7 A;  4IL6 Z;  4B7K A;  3ZN0 A;  2RN9 A;  4F6R A;  3J7A U;  1RSO A;  3WG7 B;  2FML A;  1ZWI C;  1ZLZ A;  5GTH Z;  2Q8V A;  1OCR B;  3ZMZ A;  1M93 A;  1LR1 A;  5BMV A;  2JEX A;  1J95 A;  2ZXW B;  4EFE A;  4GT1 A;  5H9C A;  3OGC C;  5FLX N;  4FLU A;  1VQN V;  5LL6 Y;  3T2M A;  3JD0 A;  5CA0 B;  4YHH O;  2HHH B;  1F23 A;  4O4J A;  2EJR A;  2UU9 B;  5B3S B;  4I9W A;  3BPZ A;  1I0H A;  1SER A;  3WB2 A;  1AJP A;  1JCH A;  2JGD B;  2VS0 A;  3LSS A;  1QBZ A;  3AG3 C;  5DED A;  3OW2 U;  4DUY B;  1N32 O;  3W7X A;  2HJF C;  2KKW A;  1R3J C;  1R6K A;  4P9O A;  4GKK B;  4TUY B;  1B3Q A;  1I94 B;  3DTU B;  1Q90 D;  3APQ A;  2WA4 A;  4K3A A;  4WBN B;  3RYF A;  1F7Y A;  3VOU A;  4FLW A;  3HKC A;  1CEZ A;  4J42 A;  4WF9 V;  4DV6 B;  4X64 B;  1N32 B;  1T5E A;  4DK0 A;  2RDC A;  3SPH A;  3ABK B;  1NZ6 A;  2Y69 C;  4MVR A;  1W0J G;  2QTS A;  5FNV B;  3ZCC A;  1KP3 A;  2VRZ A;  1HDJ A;  1LNQ A;  3K03 A;  3CCS V;  3CXC U;  2XT9 A;  2HHH O;  4DK1 A;  2R72 A;  4DXW A;  3ABL B;  2YXL A;  1J5E B;  2OT5 A;  2WLL B;  1LUV A;  5LBQ A;  1WB7 A;  5JCO A;  1IBK B;  3M99 B;  4WCE V;  2YID A;  4RAI A;  2CH7 A;  3FD9 A;  2JK5 C;  1IX9 A;  3F5W C;  5LGT A;  4NTW A;  1Q5O A;  1Q6I A;  1IXM A;  3LNN A;  1OCC B;  2CTW A;  4X65 O;  1K3E A;  5LMN B;  5B1B B;  2OYQ A;  2IJK A;  4MTF A;  3SYP A;  5JQG A;  4O4H B;  3GVM A;  3ZIA G;  3ETQ A;  4U7O A;  2P06 A;  5JWP A;  1JPX A;  3K79 A;  4GX1 A;  4A5U B;  3LSQ A;  1S5H C;  2RNB A;  2XOK G;  1K8A W;  1V54 B;  1OCC C;  1AJQ A;  2Q5Z A;  4ZOL A;  1GN3 A;  3QVN A;  2XAG A;  3ZRW A;  3ML0 A;  3OGI B;  1MZF A;  2N04 A;  2JS5 A;  1GK9 A;  4I0X A;  3S3X A;  4U3J A;  5EIB D;  1B06 A;  4W4L A;  2VQF B;  4DR4 O;  4FLY A;  4J11 A;  2OIG A;  4IT5 A;  4LF8 B;  5LYJ A;  1M57 B;  3D3I A;  1K7D A;  3B4S A;  4DR7 O;  4LH7 A;  2DMX A;  3ZBH A;  4DV7 B;  4TV8 B;  3T1C A;  1SS3 A;  1KQS U;  4JAS A;  1BQ0 A;  1ORQ C;  2A79 B;  5LMN O;  2QTO A;  1ZL8 A;  1ROP A;  2MK3 A;  3E83 A;  2YXH A;  2HKO A;  1YI2 V;  4LF7 B;  5IT9 N;  5FPR A;  3B8N A;  3VQW A;  5B5E Z;  4QPJ A;  2WLI B;  2DN9 A;  1VQ7 V;  1FFX A;  2DYR B;  1VQ5 V;  2ZE8 A;  4TV9 A;  2Q0A A;  3A0H Z;  2JEU A;  3E8B A;  4LBE C;  2VQE B;  3CPW U;  1OCO B;  4JAV A;  1KC8 W;  4UVC A;  2E75 B;  2PTM A;  2P6J A;  3X2Q C;  3RYF B;  5K1X A;  1BSM A;  1P49 A;  4ASU G;  3L74 H;  1Q6H A;  4OXS A;  1SKV A;  4AI8 A;  2Q73 A;  4JTD B;  5KX5 A;  1XQ8 A;  3AK2 A;  2HFE C;  1AP6 A;  3ZN1 A;  1O9G A;  4QIW F;  3DXR B;  3JAR B;  2ZQM A;  3U11 A;  3RVZ A;  3CCJ V;  5E1A C;  2FTK A;  1KB9 F;  1QU7 A;  4LF4 B;  3STL C;  3JAM N;  2BOC C;  2WWW A;  1NBM G;  4KP4 A;  4CS2 A;  5L3C A;  1I5X A;  3WFV A;  2UUC B;  1PNK A;  3H01 A;  2Q68 A;  3SYO A;  4Z2W A;  3OEE G;  3JAT B;  2QWP B;  4O4I A;  4B3T O;  4X1I B;  3UM7 A;  1NI8 A;  1SET A;  1FXV A;  5EBL C;  1H2N A;  4FJC C;  4CZZ A;  3MHH C;  2ZM6 B;  1N4C A;  2Y4U A;  1OV9 A;  1JQ0 A;  3L70 H;  2B9Z A;  1AJN A;  1FXH A;  3N2K B;  3OR6 C;  4FLV A;  4I4T A;  5CMU A;  1I08 A;  3E86 A;  2BTO A;  3K5L A;  2QM7 A;  4FLX A;  2R9A A;  1SA0 A;  2E5L O;  3P3P A;  4DV4 B;  1XNQ B;  5IJ0 A;  3OUS A;  4J7J A;  4LF8 O;  1VMG A;  5B1A B;  3AG1 C;  3BFR A;  4LF5 O;  4B3T B;  3G6B A;  1V9P A;  5IE9 A;  4NKG B;  3OM3 B;  2DYS C;  4O4J B;  1KU9 A;  1SQF A;  1N36 O;  2IBZ H;  3CYO A;  4JAA A;  3SDL A;  4MW3 A;  3ZRX A;  4LF6 O;  2ZE6 A;  2A9H A;  4H13 B;  4FM1 A;  2BE3 A;  1XEQ A;  3WU2 Z;  4PHZ A;  5ITZ A;  1VF6 A;  2YSU B;  4LFA B;  4TUY A;  2UXD B;  4DR3 O;  2OTL V;  1EBO A;  4UVB A;  2Y4T A;  1S72 V;  1HWY A;  2ARH A;  5BY1 A;  2ADP A;  1NH2 D;  4JI3 O;  3HKE A;  2DYS B;  2ZDI C;  1RM1 C;  4MTO A;  4X20 A;  1Y66 A;  4JI5 O;  3H1J H;  2YI8 A;  1AI4 A;  3AG3 B;  3FAV B;  5CBH A;  3AG1 B;  2EIL C;  4J9Y B;  5LMU B;  2JVD A;  2YS8 A;  3T1Y O;  2QEX V;  2IM9 A;  2F43 G;  4TQF A;  2EIM B;  4TT3 G;  4MVO A;  5J9P C;  2W6I G;  2EJ7 A;  2WLL A;  3E22 A;  5LGN A;  4XDL A;  4EB6 A;  1Q82 W;  3E8F A;  2BTQ A;  4WFE A;  1L1F A;  2W0X A;  3BA9 A;  2X7R B;  3CCV V;  1SQG A;  3DSQ A;  1RP3 B;  2HG5 C;  3OAA G;  4BIZ A;  1FJG B;  3K9S A;  1BCC H;  4NB5 A;  1GKF A;  4I5S A;  2LW1 A;  1I94 O;  2QKS A;  1JJO A;  4NTX A;  3ETD A;  5LHH A;  5J2T A;  1YDX A;  1XNR B;  2Q4P A;  1VQ6 V;  1QLE B;  2P67 A;  4X1Y A;  1PV0 A;  2LFR A;  4K8Z A;  1VEW A;  1RPR A;  1X4T A;  4LNU B;  4EFB A;  2XUM A;  5E79 Z;  2ILM A;  2XTA A;  1HP8 A;  3SGI A;  2UXB O;  1DTO A;  4TV9 B;  1XNQ O;  2EIL B;  1CXZ B;  4PDL A;  5LP6 C;  4GKJ B;  2UXC O;  2QWN B;  4UVA A;  3ZHV A;  2GUZ B;  3SPC A;  4N23 A;  1K34 A;  4R8C A;  4CS4 A;  4WFH A;  1AB3 A;  2N05 A;  4JYA O;  5FNV A;  1VQP V;  4JPR A;  4DR5 B;  1Q43 A;  1WA8 B;  5D5Q A;  5K1P A;  1BHA A;  1KKC A; 
#chains in the Genus database with same CATH homology
 4NXM B;  4O4J A;  4PI2 A;  4BWA A;  2Q7G A;  2UU9 B;  3VQX A;  4UCR A;  3BPZ A;  5J2U B;  3WB2 A;  3RYC A;  4D7T A;  4O2B B;  4DR2 B;  3IAY A;  3RWR D;  1HNZ B;  4JV5 B;  3WB1 A;  4DUY B;  4JI6 B;  4D7S A;  2KKW A;  2GV9 A;  3JAW A;  1D5A A;  3SJA C;  3M7M X;  4GKK B;  4TUY B;  1I94 B;  5J2U A;  3K5N A;  1SA0 B;  5KMG B;  2F93 B;  4JI0 B;  4F6R B;  4YJ3 A;  5EZY A;  4WBN B;  3RGB A;  3RYF A;  5C8Y B;  4FLW A;  3HKC A;  1WPB A;  1I7F A;  3HKB A;  4UCS A;  3SR2 C;  4JI7 B;  4DV6 B;  4X64 B;  5LP6 A;  2PZS A;  5JCO C;  1N32 B;  1T5E A;  4AIL C;  4AHC A;  2VWJ A;  4DK0 A;  4LFB B;  4HNA A;  4TV8 A;  4ZHQ B;  4UCO A;  3RYH B;  1Z5V A;  5FNV B;  4TQD A;  5KHI A;  3MAQ A;  2QM4 A;  5FPO A;  4DV3 B;  4DV5 B;  4DR4 B;  4JI8 B;  4I55 B;  4LR3 A;  2PGG A;  4DK1 A;  2R72 A;  3HKD B;  2F95 B;  2YXL A;  1J5E B;  4UCV A;  3RYC B;  5JCO A;  1IBK B;  3K59 A;  2F66 C;  2ZIM A;  4IHJ A;  4O4H A;  4DR6 B;  1ZAU A;  1Q5O A;  2BTQ B;  1HW7 A;  4O4L A;  3LNN A;  2Q7E A;  4I50 A;  3CHX A;  3K57 A;  4X1K A;  5LMN B;  4YJ2 A;  2OYQ A;  5JQG A;  1JMK C;  4O4H B;  4K0K B;  3ETQ A;  3ICX A;  4DR7 B;  3HKB B;  2YIB D;  4I50 B;  1WNS A;  4O2B A;  2JGU A;  4B3S B;  5BR8 B;  4FFB A;  1TA8 A;  4ZOL A;  4OX9 B;  1TUB B;  4FLT A;  4CH3 A;  5LYJ B;  1TAE A;  2JS5 A;  3RYH A;  2F4V B;  4GYC B;  2RJZ A;  4TOI A;  2HEP A;  3BAA A;  4U3J A;  5EIB D;  3QF7 A;  2VQF B;  3CB2 A;  1IBM B;  4FLY A;  1HNX B;  4I4T B;  1G6U A;  3JAK A;  4LF8 B;  5LYJ A;  5CA0 A;  3RYI B;  4LH7 A;  3T1H B;  3QG5 A;  4UCT A;  4HNA B;  5JH7 B;  4DV7 B;  4TV8 B;  2PYJ A;  5CA1 B;  4CC6 A;  3RFR A;  3JAS B;  5EZY B;  1XMO B;  4B3R B;  3JSL A;  3K58 A;  4X1K B;  4GLX A;  4DV1 B;  1O9H A;  4LF7 B;  1XMQ B;  3PN1 A;  5LA6 A;  4LFC B;  5FPR A;  1HNW B;  3VQW A;  1N34 B;  1TGO A;  1FFX A;  4I9Q A;  4TV9 A;  2Q0A A;  2VQE B;  5LXT A;  4ZOL B;  5CB4 A;  1Q8I A;  5C8Y A;  2PTM A;  5KX5 B;  4YJ3 B;  3HKC B;  5IYZ A;  3UT5 B;  5K1X A;  3RYF B;  1P49 A;  5ITZ B;  3SJC C;  1SKV A;  1WN7 A;  2VWK A;  5IJ9 A;  5KX5 A;  3OTO B;  1XQ8 A;  3VQY A;  1L8D A;  4YHH B;  1JFF B;  3UT5 A;  1O9G A;  3U11 A;  3JAR B;  4JYA B;  4PI0 A;  2P5O A;  5BMV B;  2EX3 A;  4AQY B;  4LF4 B;  4JI5 B;  3JSN A;  2V4D A;  4I55 A;  4X20 B;  4CS2 A;  2Q7H A;  1JFF A;  5JQG B;  3U10 A;  4EB6 B;  3JAR A;  3HKD A;  2UUC B;  2UUA B;  5GON B;  4BW9 A;  4X62 B;  4DUZ B;  3WB0 A;  1XI1 A;  5JVD B;  3BHP A;  3JAT B;  4ZI7 B;  4EEQ A;  1N33 B;  3QTC A;  4IHJ B;  4O4I A;  3N2K A;  4X1I B;  5KHG A;  5EYP A;  5LOV B;  4IIJ B;  1XHX A;  2ZM6 B;  5CB4 B;  3T1Y B;  3N2K B;  4X1I A;  5IJ0 B;  4FLV A;  1NT2 B;  4I4T A;  5LOV A;  4DR1 B;  2BTO A;  3K5L A;  1Q3E A;  4FLX A;  4FVM A;  2R9A A;  1SA0 A;  3E22 B;  1TUB A;  4X66 B;  4FFB B;  4LF5 B;  4DV4 B;  2XHB A;  1XNQ B;  5IJ0 A;  4FLZ A;  4JI4 B;  5JJJ B;  1VF7 A;  3JAS A;  2ZIN A;  3FFQ A;  4DV0 B;  2RQ6 A;  2E5L B;  4B3T B;  4X1Y B;  4NVP A;  3THO A;  2ZCE A;  3K5O A;  3BA8 A;  5LA6 B;  1V9P A;  1IBL B;  1M4U A;  3RYI A;  2QJ1 A;  2YI9 A;  3JAK B;  4O4J B;  5KHH A;  4LF9 B;  5D5P A;  4X65 B;  1H2S B;  1KU9 A;  1SQF A;  4B08 A;  4JI1 B;  5GON A;  5LXT B;  5CA1 A;  4NXN B;  4JI3 B;  5JVD A;  2E3C A;  3JAT A;  4ZI7 A;  3CSX A;  4FM1 A;  5JJE B;  3JAW B;  4LFA B;  4PHZ A;  5ITZ A;  3N2G B;  4O2A A;  4TUY A;  2UXD B;  4IIJ A;  3ZS8 C;  3K5M A;  3BRC A;  5EIB C;  1FFX B;  4CH6 A;  5KHK A;  4WBN A;  2UXB B;  4DRX A;  2PY5 A;  3VQV A;  1XHZ A;  2ZNJ A;  3HKE A;  5J2T B;  3UQ8 A;  2PUS A;  1TVK B;  1M5I A;  4ZHQ A;  4YY3 B;  4X20 A;  5IYZ B;  2YI8 A;  4CH4 A;  1B04 A;  5LMU B;  5JJN B;  2JVD A;  5IJ9 B;  4KL1 A;  2IM9 A;  4TQF A;  2PYL A;  4JI2 B;  1HR0 B;  1DGS A;  4B3M B;  2P22 C;  2ZNI A;  3JAL B;  4CC5 A;  2UXC B;  1YEW A;  4LH6 A;  3BAB A;  5EYP B;  4Q6G A;  3E22 A;  2YIA A;  4L8J A;  3A2F A;  4FM0 A;  4EB6 A;  3JAL A;  5KHJ A;  2BTQ A;  4O4L B;  4DR3 B;  4UCU A;  3BA9 A;  5IWA B;  4O2A B;  1SQG A;  3DSQ A;  3U0Z A;  5JH7 A;  4CH5 A;  4HBN A;  3N2G A;  4ZIB A;  1FJG B;  4LF6 B;  4O4I B;  4LNU A;  4CS3 A;  2UUB B;  4UFZ A;  1JJO A;  1S5J A;  2ZIO A;  5KMG A;  4DRX B;  5J2T A;  1XNR B;  4X1Y A;  4K8Z A;  4F6R A;  1X4T A;  4LNU B;  1RSO A;  4EFB A;  3OTF A;  3SGI A;  4TV9 B;  2CAZ C;  1M93 A;  1Z5W A;  5BMV A;  5LP6 B;  5LP6 C;  4GKJ B;  4EFE A;  4KHP B;  4DV2 B;  4FM2 A;  4U3J B;  1QQC A;  4FLU A;  3ZED A;  4CS4 A;  2F1M A;  1KMI Z;  1N36 B;  3SJB C;  2OWO A;  5FNV A;  4DR5 B;  1Q43 A;  5CA0 B;  5D5Q A;  3HKE B;  2R70 A;  5K1P A;  1QHT A;  1TVK A;  2YIB A;  3B2E E;  2HHH B;  4K8X A;  4YJ2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...