2F66C

Structure of the escrt-i endosomal trafficking complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
65
structure length
65
Chain Sequence
SKKYGDIALKKKLEQNTKKLDEESSQLETTTRSIDSADDLDQFIKNYLDIRTQYHLRREKLATWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Suppressor protein STP22 of temperature-sensitive alpha-fact
publication title Structural and functional organization of the ESCRT-I trafficking complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 27
structure length 65
sequence length 65
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2f66C00
2F66C 1X4TA 2JS5A 2CAZC 2P22C 3THOA 3SJCC 3SJAC 3QF7A 1NT2B 3ICXA 3B2EE 3CSXA 1SKVA 3QG5A 3ZS8C 3SJBC
chains in the Genus database with same CATH superfamily
3CX5F 3IC7A 2R9RB 4DV5O 4DUZB 1XHZA 1XNQO 4X62B 5IE9A 2F43G 1B6QA 2JS3A 4BAYA 1F51A 4QPJA 4NB5A 1OCZC 4PA3A 3K5MA 4R7CA 1YJ9V 3N2KA 5J2UA 2Y69C 3BPZA 4TQDA 1FXKC 1SESA 4OPAA 4ZIBA 2QA4V 2EINB 2LGQA 1R3LC 1N33O 1F4MA 1SZXA 2JDIG 4DR1O 1SA0A 4FK5C 5F2VO 5JJEB 4DV4B 5D5PA 2YXLA 2JGDB 1GM8A 4I9WA 5JCOA 1H38A 4O4LA 2QWNB 2WWWA 3DXRA 5TISZ 4LF4B 1H2MA 5FL7G 4JI8B 3DC5A 3I5DA 2OCCB 4LH6A 3HKBA 1QR9A 4XBFA 2ADQB 3OW2U 5FPRA 2EZPA 4UB8Z 2Q9LA 1VIBA 2YS8A 2GTAA 3SPIA 2YICA 5B1BC 2LP7A 2ATKC 4KL1A 3D36A 1RP3B 5CA1A 1Y76A 1AB3A 4BIZA 4LBEC 3UT5B 5LP6B 1Z5WA 3K08A 4PELA 3WG7C 3AG7A 4E2LA 2X6CA 3SGIA 1HNZB 4NXMB 3F5TA 1NKDA 3EHBB 1M93A 4J41A 4RQEA 2A79B 4XDKA 4JYAO 4K0KB 4X65O 4JZ2A 4LWSA 4PA6A 2DYRB 4WFHA 1RM1B 4JV5B 4LF5O 5IJ9B 1U96A 3BY6A 5L3BA 1RPRA 3AK1A 3JAWB 2DQ3A 1JCHA 3E8FA 4JI5B 2ZIOA 2Y4UA 4J10A 3SPCA 4X66O 1AR1B 2HFEC 1DTOA 1ZL8A 3KG2A 4N23A 2VQFB 5IYZB 4B3TB 3G6BA 2RQ6A 5L3FA 3IC9A 4MVSA 1BCCH 1QU7A 3CJHB 1EFRG 2B1IA 5B1AB 4GX2A 3ZHVA 4UB6Z 2BTQA 1K9MW 3OMIB 5IYBO 1O9HA 1VF7A 3M99B 3T1HB 4FLTA 1FS0G 2F95B 3K79A 4CBCA 4DV3B 1DF5A 2ITDC 2CTPA 3K5NA 2VQEB 3E89A 2DWEC 3K58A 3IJ4A 1MSDA 1MZFA 2X6AA 5KAFZ 3KCXA 1IBMO 5LGUA 1H8EG 1DK1A 1PM9A 2A0LA 5BMVA 3SYPA 1CEZA 2YC0A 2Q0AA 3KZIZ 5LYJA 2GBOA 4JYBA 3OMNB 2FTKA 4U3JB 3HKDB 3E86A 1JMKC 3FAVA 3M7MX 4G2KA 4HAMA 4NXNB 2F4VB 3CRCA 3T1YO 4CH6A 1VQKV 4PD4F 3LNNA 1QHTA 4DR7B 2EJ7A 3ZHUA 4K8ZA 5EBLC 4JI2B 4TWKA 4I50A 4MT8A 4O2BA 2OCHA 3U0ZA 1QBZA 3Q4HA 4FM0A 3STLC 3JSLA 3PN1A 4G27B 5A2QN 4NTWA 5C8YB 3ZMUA 4DO2A 4RUEA 3K0GA 4J7KA 1K92A 3VQVA 2ZE8A 2ILMA 2ZNJA 1L1FA 5IY5C 1D2DA 3JALA 3UO2A 3RYCA 2M7WA 5JWPA 1XMQO 3ABTA 2DN9A 1V9PA 3F7YC 2QM7A 1CP9A 2ZM6O 4X1IA 2JJ2G 3H9VA 1BE3H 5J9PC 2GSMB 4X20B 3CMAV 4I9QA 1PL0A 1FPOA 4MVQA 4DR5O 1ZX3A 4FJCC 3ZS8C 1K73W 4ZBMA 5CBHA 1M1KW 2WLMA 2YEVA 4I5SA 2IJIA 1OCZB 1W0KG 3TXSA 1AI5A 4PHZA 5KMGA 1N32O 4FZ1A 3BVOA 2ZR3A 1VF6C 2Y69B 4I0XA 1FXKB 3MHHC 1I0HA 4KXRA 4KHPO 1WPBA 2D2CB 2ODMA 2CGNA 1AP6A 4F6RB 4JI7O 2O57A 4LFCO 1PL4A 5EZYB 5LHIA 5CBFA 1NH2D 5E79Z 4E4EA 1IBKO 1S72V 3AG4C 1I94O 3JASA 3K57A 1M4UA 5KHJA 1M9NA 1ZUQA 2F93B 4X1KA 2UUBO 4LF6O 2Y48A 3BRCA 3SJAC 4QIWF 1F4NA 1GH6A 3ICXA 1P49A 1AILA 1UJWB 3OGIB 3E83A 3QO5A 4MVZA 1BHBA 4JI1O 4DR2B 3QO7A 2UXDO 2A06H 5B1BB 2VWJA 5LMNB 1R3KC 3ETGA 3M8AA 5B5EZ 4JZGA 5LMUO 2P6JA 3D3IA 3TGUH 4DV1B 2LGWA 3JARB 3AG3C 3B2EE 4UV9A 1FKAO 4YY3B 1Y6XA 4AHCA 1TA8A 4H13B 3WG7B 3AK2A 3RN4A 5KX5A 3RVYA 1TVKA 3CMEV 3CPWU 4DRXB 2JIZG 4FLUA 3HKCA 1XI1A 2Q7GA 4PI0A 4CS3A 1R3IC 1R6NA 5IDJA 2E5LB 1MMMA 4XDLA 3C3SA 2RDCA 1Q43A 1SQVH 2CH7A 4B3MO 3QTCA 1YCIA 4Z2WA 4O2AB 2QKCA 3SYOA 3OFNG 4ZOLA 4Q6GA 4CH3A 5L3CA 1I5YA 5L3EA 4DR6B 3ZBHA 1O9GA 1WP8A 3ZCCA 4QPKA 3CCRV 1DLBA 1JA8A 2EIKC 1Q90D 4FZ0A 4X89A 1J95A 4UXNA 3JD4A 1P7GA 1E79G 4EB6B 4ZKIA 3ABUA 3BAAA 4GLXA 1WN7A 2WLLB 2Y0PA 3G4SV 5LOVA 1XOUA 2GTSA 4PDLA 3SJBC 4TUYA 3CCUV 5H2FZ 5JVDA 1NBMG 4H37A 3TXQA 4X64O 4JI4O 1NZ6A 1GMGA 3WB1A 3F5WC 2QE7G 3OEHG 5KA5A 2EILC 3CP1A 2HHHB 3X2QC 5B3SC 4MVOA 1U97A 2WAMA 3QVNA 1GN6A 1K33A 1ZSPA 4WFGA 1AVMA 2YI9A 3QG5A 5LHHA 2WLIA 4QE9A 3W7WA 3QO8A 3OMAB 4QE7A 1DGSA 2B5UA 1XNQB 2Q7HA 4LNUB 4DV2O 1XL6A 4UCRA 4PA9A 4I4TA 2YXYA 1Y4MA 5IY5B 2AZ0A 2JJ1G 1AP5A 4ABMA 1Q6UA 4GKJB 5FNVA 1TUEB 1EBOA 1LR1A 3FYIB 1J5EO 4MW8A 3CRRA 2QEXV 2YIDA 2P5OA 4IYIA 3A0BZ 1N33B 3OGCC 4CS4A 2PUSA 4YJ2A 4LF9B 2XHBA 2IM9A 2PGGA 4JTCB 2C2AA 4MW3A 1KBHA 4TOIA 4FFKA 4JI3B 4A5UB 1Q3EA 2N74A 3JD3A 1NT2B 1JR9A 3K3WA 1TUBB 4PV1B 3CCEV 1LUVA 3FKSG 4GUNA 4F6EA 2GUZB 1US6A 4JYCA 4LFAO 3R65A 1M5IA 1IBLB 4B3RB 4CH4A 2XT9A 1AI7A 1JFFA 3BCCH 2XNDG 4JI0B 3AG4B 1K3EA 3FFQA 2R70A 4D6TH 2CTQA 3HPLC 1HNXB 4TV8B 2UUAO 1IZ3A 4K3AA 3OR6C 1B04A 3AEIA 1ZLZA 1N34O 1HR0B 1RPOA 4O4IB 2N05A 2Q5ZA 2QDOA 3TETA 3HKEB 2BE3A 1I08A 1WPXA 2Y4TA 4C7UA 4TV9B 4R50A 4U7OA 3APQA 4PA7A 1VQ6V 2BSKB 4GYCB 2W6IG 4LF5B 3THOA 3A8TA 4YXWG 2QWPB 5JCOC 1VEWA 3AG3B 2VRZA 5CA0A 4QNHB 1FXVA 1FAFA 2UUCO 3W7UA 1HNWO 3SYAA 4GX5A 3ZHRA 1Q81W 4MSWC 3W7TA 2E3CA 5A9GA 2W0XA 4IIJA 3OAAG 1OCRC 5IJ0A 3SR2C 4LC1A 3P3NA 2LW1A 5BR8O 4YHHB 2ZXWC 4F4LA 5KHGA 4DV0B 1S77D 4DV7O 1HP8A 1VMGA 1PP9H 1YF2A 3H1JH 3RYIB 3T4ZA 3W7SA 3D36C 1WA8B 1Q82W 4D7TA 2DMXA 1QLEC 5L3GA 1H2NA 3ZN0A 1UPGA 1AR4A 3CCJV 4O4HB 1L0NH 2QWOB 5EBWC 2WSSG 4UUJC 5L3DA 4GKKB 3ASOC 4DR3B 4HYOA 3E22B 4B3SB 1VQ5V 5CB4A 3RGBA 1Z5VA 2ETNA 2NN4A 2DOSA 3RVZA 2EIKB 5LXTA 1YTFB 2E76B 1K4DC 4DW1A 3K5OA 3T2MA 4ZHQA 3QNEA 4LF7O 2EIJC 3CC2V 3JATB 2Q69A 3P30A 5EIBD 1R6KA 2FB5A 2Y0IA 5DM6V 4RQFA 2QGNA 1XUQA 4EEQA 1EN5A 4MTFA 3I56V 1SQQH 2CUGA 4WCEV 4I55B 4DUZO 3CWBH 3OTOO 4X62O 3NXSA 2F23A 5KHKA 3CCQV 4FLYA 3RYHA 2EILB 4W4KA 1VP7A 3X2QB 5B3SB 3JAKB 1VQLV 2BTOA 5KA6A 5EK0A 2KG7B 1A32A 2P4VA 3G71V 2GV9A 2JS5A 2FYUH 1B06A 1LNQA 5ITZA 2QTOA 4MS2A 4ZI7A 1S5JA 4QGPA 1FFXB 3JD2A 3N2GB 4DR5B 1PV0A 2LFRA 1BZKA 2Z3YA 4GT1A 4LF4O 1N32B 2EULA 4G28B 3CE2A 5FPOA 3O65A 5LA6B 3ETEA 3RT3C 1XNRO 2LW7A 5EYPB 5JQGA 4LFBB 4BIOA 2V4DA 4QJFB 2H8PC 3MHSC 3VQWA 3LSSA 3ZMZA 2DQ0A 1YZBA 4KUMA 2QSAA 4FFBB 3ZMTA 4Z1MG 4JTAB 1XMOB 2HKOA 4BIUA 1NU1H 5J2TB 3ZRXA 2LJ2A 2UU9B 1IBKB 1XL4A 3MDSA 2H94A 4KFMA 5FLXN 1I94B 1RSOB 4IHJB 2W6JG 4WFEA 4FM1A 3ZMVA 2RMKB 1WLEA 4L8JA 4PA4A 4JAAA 3K9SA 4J80A 4NXMO 1JPXA 5IYDO 4HNAA 3FYEB 3DGEA 2YXHA 5H9CA 2AXTZ 5JH7A 3CC4V 1IDSA 4JI1B 4ICGA 4K0KO 3ZMSA 1PNMA 3CHXA 2YSUB 2IJKA 2OIEA 3MD0A 1B3QA 1GO3F 3LUTB 1BMFG 2X6BA 3CCSV 4AQYO 2B1GA 3NR7A 4JI5O 3GWKC 3ZHQA 1W0JG 5GTHZ 2KQXA 1NTMH 2HJFC 1SKVA 3TK1A 3N2KB 1QVGU 5J2UB 3S3WA 4H33A 2N04A 3OEEG 1KU9A 2VQFO 4B3TO 3T4DA 2PZSA 1S0VA 3TCUA 1AJPA 5LGNA 5IWAB 1YIJV 1SA0B 4LF8B 4ASUG 4X1YA 4WBNA 1K8AW 1VQ8V 1M57C 3BA8A 4O4LB 1KKDA 1XBLA 5GONA 3JYCA 3DXRB 1E1RG 3ML0A 1N0NA 3K59A 3CRAA 2A3QA 3T1HO 3ZRWA 2UXBB 1ORQC 4DV3O 1NS1A 2VQEO 1OCRB 3ZX6A 3ETQA 2XASA 3HKBB 1NVPB 4DR4O 2ZXWB 1P84F 4UCUA 1S5LZ 5HFLA 4O4JA 1WB7A 1BGYH 4YIOA 5CA1B 3K04A 2AHZA 1Y76B 1QLEB 2NNUA 5EBMC 3D8CA 3DSQA 4UCVA 3L71H 1KP2A 3ZHTA 4UCOA 3CXCU 1IURA 1YSCA 2F4VO 4EKWA 4WF9V 1CPYA 4DV6O 4LH7A 4DR7O 2ZD9A 4DK1A 2K1EA 3ASOB 2HP8A 4LWSB 2F1MA 3RYFA 1QNMA 1GAXA 4JI2O 2Q73A 5CA3A 1VQ7V 3F7VC 1THZA 4JYYA 4YJ3A 1GN3A 1H2SB 3T1CA 2W0FC 4X64B 1Q8IA 3G80A 3K9AA 2JGUA 1ZL8B 2EIJB 1KC8W 2QM8A 2ZCEA 4OX9O 1Y74A 2EZOA 3SYQA 3CB2A 1QR8A 3L72H 3ZHSA 3ASNC 4N21A 1AI4A 4IYHA 2BTQB 2RNBA 3A0HZ 5GW7A 3WU2Z 3OM3B 2X0LA 2ZKOA 2QKAA 1IX9A 3BA9A 3H1LH 3SPHA 4MTXA 1VQOV 1Y67A 4MTGA 3JCUZ 3E8GA 3IFXA 4P9PA 1GRJA 5KLVH 3ZEDA 3UO3A 3A2FA 1Q6IA 1SQXH 4NTXA 2XAFA 2UXCB 4P9OA 2HEPA 2ZINA 1J5EB 5BMVB 2JGDA 3JD1A 5LYJB 1S5HC 4YIPA 3B4SA 1SZTA 4TSFG 2JEUA 1EN4A 3FAVB 1OCCC 2LQTA 1NJIW 4K8XA 3OTFA 2VWKA 3FX7A 4UFZA 2PYLA 1GTOA 4LFAB 4I50B 1R1BA 2DJVA 4JPRA 4O2BB 1K7DA 5B1NA 3Q4HB 3AG1C 3UT5A 5LP6A 3WB2A 1UFIA 1N34B 1KKCA 4KP4A 3JALB 1K97A 3RYCB 1QQCA 2AZ2A 2Q68A 2YDEA 2YIBD 3N27A 4X9QA 4IL6Z 4DV5B 2EIMC 1PKXA 1KMIZ 4X1IB 5IJ9A 4X8AA 3H1KH 2X7RB 3K0DA 3JAWA 2E74B 2HJDA 2UUCB 3J7AU 2YEVB 4NKGB 1BT8A 1IXBA 4BWAA 4B7KA 5KMGB 1NQTA 5IYZA 3B8MA 4I0XB 3CJHA 2P67A 5BR8B 4DR1B 2AW9A 1KB9F 4RAIA 1FYJA 1HW7A 4UV8A 1HWYA 1JQ0A 1NR1A 2CGOA 4DR6O 1KYOF 4CZZA 3A0RA 3GVMA 4HBNA 1YJNV 2PI5A 3JASB 3VBBA 4X1KB 1V54C 2ADPA 3AG2C 1WAZA 1M56C 5LBQA 1X59A 4PDVA 3CC7V 3RBZA 4JAUA 1K5SA 4JI6O 2ZDIA 2OIGA 4H0LB 1BS3A 2A9HA 4L87A 4J11A 2V1DA 1D5NA 4J9ZB 3E35A 3CEIA 4U3JA 4P2ZA 1D5AA 3JSNA 4U3FH 3HKDA 3ABKC 4OXSA 4PDMA 3WB0A 2XAGA 3IGAC 1ZAUA 3AK3A 5KX5B 1TVKB 2ZE6A 2R72A 1S3JA 4MVMA 4JYAB 2WPDG 3HKCB 4X65B 2CTWA 1GM7A 1YDXA 4OGQB 2EJRA 3B40A 2FKXA 3D3QA 2P90A 4LR3A 5C8YA 4X66B 2CH7B 3GWOA 5B66Z 3BEHA 3OTOB 2D3OW 2CAZC 4B08A 3E8HA 3L75H 1OJHA 1FJGO 4IGGA 2Z0AA 5GTIZ 2CTRA 2LO1A 4ZOLB 2IU0A 1YTFD 3UKMA 3ABLC 4GKJO 1F23A 3ASNB 3GB7C 3ZRSA 5KAIZ 4X20A 2A7WA 2YUAA 3EFFK 4D7SA 1SS3A 2OWOA 3U10A 5IYCO 4LF9O 4WFAV 1OHHG 2BOCC 4OPHA 1SQGA 4JI3O 5H5NA 1FXKA 1IBMB 4DUYO 1CXZB 1XILA 4CS2A 1VQPV 5H6RA 5LGTA 1XNRB 4F6RA 2KSDA 3JAMN 3ABMC 5LOVB 2BOBC 5EZYA 4IT5A 5AG2A 3J81N 2WLJA 2P22C 2L35A 4NYKA 4LP8A 4H44B 4NR1A 4TUYB 1IBLO 5JVDB 2E75B 4U7NA 4B3RO 3JD0A 3QF7A 2HR3A 3T1YB 4JI0O 3ZRVA 2NLJC 5K1XA 1EM1A 1OCCB 2Z5UA 2OYQA 4GZRB 1HNXO 2XAQA 1N36O 1HR0O 2CE4A 3R66A 1H8HG 1Q6HA 1XEQA 3CYOA 4BW5A 2ZQMA 3C3TA 3LSUA 3HB3B 4RO2A 3L74H 1XDCA 3U11A 2DE0X 4BR6A 4PJ0Z 5JJNB 2WLIB 5LHGA 2IU3A 4UCTA 1EZVH 3JARA 1JVMA 3AG1B 3WFVA 1W59A 1AJNA 3SJQC 1K5QA 4J7JA 4AQYB 2PF4E 3FB7C 4I4TB 4MVUA 4GX0A 1FFTB 3DC6A 2ZE5A 1XMQB 4DRXA 1H2KA 5DECA 1NI8A 1KUQA 5FNVB 1F7YA 4RUFA 2ZM6B 1ENVA 4YHHO 2EIMB 4K35A 4DV4O 1AJQA 1MABG 4MTOA 3VQXA 2ARHA 4DV0O 2UXNA 3E2EA 4YJ2B 2UXXA 1VQNV 5CMUA 4DXWA 1COWG 1Y66A 1KQSU 1T5EA 3APOA 4JI8O 1M90W 1BQZA 4O2AA 2PYJA 2CK3G 1V55C 2PY5A 3CCLV 1R3JC 4KHPB 4CC5A 1Q86W 3CCMV 1TAEA 2HG5C 2ZT9B 1SQBH 2XOKG 2Q0OC 4J7ZA 4JI7B 4TQFA 4DR4B 4LFCB 1N0JA 1N8RW 5DN6G 4GKKO 4TT3G 4DR3O 2FL4A 4B3SO 1HDJA 1YHQV 1JFFB 1RFYA 1XHXA 4UCSA 1I7FA 3VQYA 2UUBB 4LF6B 3ZIAG 1P4RA 1K4CC 1N4CA 1X4TA 1V54B 1YEWA 3KKYA 3FB8C 5KUMA 1HNZO 2Q67A 3AG2B 1YXBA 1PD3A 4EB6A 1M56B 1JJ2U 3CS5A 4MVRA 2UXDB 3PJSK 4DV6B 1OCOC 2WLLA 1JOYA 1KD1W 2IW5A 4JV5O 1VQMV 5LMUB 2P4KA 1NVPD 2ZE7A 2WA3A 2QM4A 1Q7YW 5JJJB 3LDCA 2ZR2A 2AGAA 3G6EV 1MOFA 3K03A 5CA0B 1VARA 2XAJA 4FIPC 3ABKB 3OUSA 2HVKC 4EFBA 4FLVA 1IXMA 1YITV 2YIAA 5CBGA 3G67A 3CCVV 4R8CA 3OUFA 1G6UA 4IIJB 1Q5OA 5IJ0B 3S3XA 2DW4A 4OX9B 1W2BU 2BCCH 2JVDA 3EXAA 5KHIA 1ZTEA 1IVSA 2K9PA 5E1AC 4B7EA 5H6QA 1GN2A 3SDLA 4J42A 4B3MB 4LNUA 4CH5A 3H1IH 5EC1C 3SYCA 1BSMA 1OV9A 2HVJC 1PPJH 1ROPA 4XDJA 2MW2B 4DYLA 1VQ9V 1SETA 1WNSA 1NTZH 3ABLB 4AILC 2MK3A 3L9DA 2DYSC 2RN9A 3ETDA 3UCSC 4GX1A 4I7ZB 2XTAA 1QVFU 2HLDG 3RW0A 4Q20A 5B1OA 3L70H 4LFBO 5CB4B 3OR7C 3OT7A 4NTYA 3BABA 4RWUA 3CD6V 3CXHF 5EC2C 1AR5A 1XMOO 4PDRA 4NXNO 5BY1A 5LXTB 2UU9O 2H3OA 2YIBA 1VF6A 4ZHQB 1AROP 2CDYA 4J9YB 1TUBA 2V7QG 1R6TA 2GUZA 1BL8A 1URFA 3C90A 1H2LA 1MNGA 3ABMB 5BZBA 4DW0A 1XQ8A 3FB6C 2OTJV 4JI4B 2M6YA 1S76D 2IH1C 2JK5C 4JGSA 3P32A 4UVCA 4TV8A 3K06A 1OZ0A 2OT5A 1EN6A 3RYHB 1QCEA 1SQFA 3OE7G 1G1XB 1DF4A 2QWRB 4O4IA 1Z2GA 1FXHA 4FLZA 2KKWA 2RCVA 3KCYA 3FB5C 3K5LA 3HKEA 2EINC 4TV9A 1NH2B 3H1HH 5ITZB 1K34A 5IWAO 1FD9A 1WP7A 2BSKA 4DV2B 2Q8VA 4ZI7B 4LF8O 1L0LH 1L8DA 3B8NA 1P7BA 5DEDA 4NVPA 3BFRA 3SPJA 4HZ3A 5IT9N 1AI6A 1NTKH 2OCCC 2UXBO 5C93A 1E1QG 4EFEA 3L73H 5JQGB 3DTUB 2XUMA 3RYIA 1XREA 1G8MA 3BHPA 2QR4A 2QKSA 1WA8A 3MAQA 1VF5B 3EVKA 2L6LA 1TGOA 3UQ8A 3E8BA 5LP6C 1MSWD 1ZWIC 1V55B 2QJ1A 4WFFA 3OD4A 2KB1A 1KP3A 4O4HA 2EX3A 5CN0A 2WLKA 1SQPH 4HNAB 1YJWV 1MG1A 1MZEA 4FLXA 4DR2O 5JH7B 2R9AA 4BW9A 5LMNO 2DYRC 1RM1C 1JJOA 1G4YB 2P06A 3E22A 2B9ZA 4JI6B 3I55V 4Z1VA 4DV1O 4PI2A 4FLWA 1NR7A 2VS0A 4YY3O 2UUAB 1YI2V 3VOUA 4P30A 2R9IA 1MA1A 3B09A 1GM9A 1YVWA 1VQ4V 3JATA 3SJCC 2PI4A 1GK9A 3ZN1A 4R6ZA 3CRQA 3LDEA 4AI8A 1R73A 5KUKA 1OCOB 2EBOA 1GN4A 5B1AC 2E5LO 2JEXA 2QTSA 4W4LA 2ZIMA 3HR0A 1LUWA 2YI8A 3LDDA 4I55A 4X1YB 2XAHA 3P3PA 4WBNB 2IJJA 2FMLA 1HNWB 4UVBA 4JF3A 5GONB 2F66C 2P7TC 3LSQA 2WLNA 5HFMA 3TJTA 5EIBC 4FPPA 3LNMB 3ZRWB 1SRYA 3JAKA 1FJGB 4UVAA 2IH3C 1WJZA 1SF9A 2LFSA 2KG7A 4DV7B 3FD9A 4JAVA 2ITCC 1M57B 4FM2A 2UXCO 4FMTA 3H01A 4FVMA 4GCZA 2ZDIC 5D5QA 3O9OA 4O4JB 1FFXA 3N2GA 3CRMA 3W7XA 1WB8A 2OTLV 1QLNA 4LCUC 4CC6A 2IJHA 2Q4PA 5KHHA 3RFRA 4JASA 2NR5A 5LL6Y 2QWQB 1H2GA 3B77A 5LA6A 1SC5B 1SERA 4DUYB 1BQ0A 2DYSB 1GKFA 3JCZA 5EYPA 4DK0A 3UM7A 5BXZA 2AHYA 3STZC 3RYFB 3RWRD 1EZJA 4WFBV 2GHYA 4FFBA 1KECA 1PNKA 5J2TA 4YJ3B 4X88A 1RSOA 4IHJA 1PNLA 2RJZA 4JTDB 2Q7EA 4LF7B 3SPGA 2HHHO 3CSXA 1BHAA 2IBZH 2Q6AA 2WA4A 1JX9A 1N36B 2G38A 2JRIA 3J80N 5K1PA 1Y74B 3IAYA 2WLHA 1I5XA 2GDSA 2ZNIA 2DWDC 2PTMA 3ZJZA
chains in the Genus database with same CATH topology
5LOVA 3VQXA 4DUZB 4O4JA 1XHZA 3SJBC 4X62B 5CA1B 4YJ2B 4TUYA 5JVDA 3DSQA 1T5EA 3WB1A 4UCVA 4O2AA 2PYJA 3K5MA 4UCOA 2PY5A 2HHHB 3N2KA 4KHPB 4CC5A 5J2UA 1TAEA 3BPZA 4TQDA 4ZIBA 4LH7A 4JI7B 4TQFA 4DK1A 4LFCB 4DR4B 2F1MA 1SA0A 3RYFA 5JJEB 2YI9A 3QG5A 4DV4B 5D5PA 2YXLA 1DGSA 5JCOA 1XNQB 2Q7HA 4LNUB 4O4LA 1JFFB 1XHXA 4UCSA 4YJ3A 1H2SB 1I7FA 3VQYA 2UUBB 4LF4B 4LF6B 4UCRA 4X64B 1X4TA 4I4TA 4JI8B 1Q8IA 1YEWA 2JGUA 4EB6A 4LH6A 2ZCEA 3HKBA 4GKJB 5FNVA 5FPRA 2UXDB 4DV6B 3CB2A 2P5OA 5LMUB 2BTQB 1N33B 4CS4A 2PUSA 4KL1A 5CA1A 2QM4A 4YJ2A 5JJJB 4LF9B 2XHBA 2IM9A 2PGGA 3BA9A 5CA0B 3UT5B 5LP6B 1Z5WA 4EFBA 4FLVA 4TOIA 2YIAA 4JI3B 3SGIA 1Q3EA 1HNZB 4NXMB 1G6UA 4IIJB 1Q5OA 1M93A 1NT2B 5IJ0B 3ZEDA 3A2FA 1TUBB 4OX9B 2JVDA 2UXCB 5KHIA 4K0KB 2HEPA 2ZINA 1J5EB 5BMVB 4JV5B 1M5IA 5IJ9B 1IBLB 5LYJB 4B3RB 4B3MB 4LNUA 4CH5A 4CH4A 1JFFA 3JAWB 4JI0B 3FFQA 4JI5B 2ZIOA 2R70A 1HNXB 4TV8B 1B04A 2VQFB 4O4IB 1HR0B 5IYZB 4B3TB 2RQ6A 1WNSA 4K8XA 3OTFA 2VWKA 3HKEB 4AILC 4UFZA 4TV9B 2PYLA 2BTQA 4LFAB 4I50B 4GYCB 4O2BB 4LF5B 3THOA 5CB4B 5JCOC 3BABA 1O9HA 5CA0A 3UT5A 1VF7A 5LP6A 3T1HB 4FLTA 2F95B 4DV3B 3WB2A 5LXTB 3K5NA 2E3CA 2VQEB 2YIBA 4ZHQB 4IIJA 1N34B 5IJ0A 3SR2C 3JALB 3RYCB 3K58A 1QQCA 1TUBA 4YHHB 2YIBD 5KHGA 4DV5B 4DV0B 1KMIZ 5BMVA 4X1IB 5IJ9A 2Q0AA 5LYJA 3RYIB 4D7TA 1XQ8A 3JAWA 4JI4B 4U3JB 3HKDB 2UUCB 4TV8A 1JMKC 3M7MX 4NXNB 2F4VB 3RYHB 1SQFA 4BWAA 5KMGB 4CH6A 4O4IA 5IYZA 3LNNA 4FLZA 2KKWA 4O4HB 1QHTA 4DR7B 3K5LA 3HKEA 4K8ZA 5BR8B 4DR1B 4TV9A 4JI2B 1HW7A 4GKKB 4DR3B 5ITZB 4I50A 3E22B 4DV2B 4O2BA 4B3SB 3U0ZA 5CB4A 4ZI7B 4FM0A 3RGBA 1L8DA 1Z5VA 3JSLA 3PN1A 5C8YB 4NVPA 4HBNA 5LXTA 3VQVA 3JASB 4X1KB 4ZHQA 3K5OA 2ZNJA 3JALA 3JATB 3RYCA 5EIBD 4EFEA 1V9PA 5JQGB 4EEQA 4X1IA 4X20B 4I9QA 3RYIA 4I55B 3BHPA 3MAQA 3ZS8C 4U3JA 1TGOA 1D5AA 3UQ8A 3JSNA 3HKDA 5LP6C 5KHKA 4FLYA 3RYHA 3WB0A 4PHZA 5KMGA 2QJ1A 1ZAUA 5KX5B 1TVKB 3JAKB 2R72A 4O4HA 2EX3A 2BTOA 4JYAB 3HKCB 4X65B 1WPBA 4HNAB 2GV9A 2JS5A 4FLXA 5JH7B 2R9AA 4BW9A 4F6RB 5ITZA 1JJOA 3E22A 4JI6B 5EZYB 4LR3A 4ZI7A 1S5JA 1FFXB 3N2GB 4PI2A 4FLWA 4DR5B 5C8YA 4X66B 2UUAB 3OTOB 2CAZC 3JASA 4B08A 1M4UA 5KHJA 3K57A 2F93B 4X1KA 3BRCA 1N32B 3JATA 3SJCC 3SJAC 5FPOA 3ICXA 4ZOLB 1P49A 5LA6B 5EYPB 4DR2B 5JQGA 4LFBB 2VWJA 2V4DA 2ZIMA 5LMNB 4X20A 2YI8A 3VQWA 4I55A 4X1YB 4WBNB 4FFBB 4D7SA 1HNWB 4DV1B 1XMOB 2OWOA 3JARB 3B2EE 3U10A 5GONB 5J2TB 2F66C 2UU9B 1IBKB 4YY3B 4AHCA 1TA8A 1I94B 4IHJB 5EIBC 4FM1A 5KX5A 1SQGA 1TVKA 3JAKA 4L8JA 1FJGB 1IBMB 4DRXB 4FLUA 3HKCA 1XI1A 4CS2A 4HNAA 2Q7GA 4PI0A 4DV7B 4CS3A 5JH7A 1XNRB 4F6RA 4FM2A 4JI1B 2E5LB 5LOVB 4FVMA 5EZYA 5D5QA 3CHXA 4O4JB 2P22C 1FFXA 3N2GA 1Q43A 4TUYB 5JVDB 3QTCA 3QF7A 4CC6A 3T1YB 5KHHA 3RFRA 5K1XA 4O2AB 2OYQA 1SKVA 3N2KB 5J2UB 4ZOLA 1KU9A 4Q6GA 5LA6A 4CH3A 4DUYB 2PZSA 3U11A 5EYPA 5IWAB 4DK0A 5JJNB 4DR6B 1SA0B 3RYFB 4LF8B 3RWRD 4X1YA 4WBNA 1O9GA 4FFBA 4UCTA 3BA8A 3JARA 4O4LB 5GONA 5J2TA 4YJ3B 1RSOA 4IHJA 2RJZA 2Q7EA 3K59A 4AQYB 4LF7B 4I4TB 2UXBB 3CSXA 1XMQB 4DRXA 4EB6B 3ETQA 1N36B 3HKBB 3BAAA 5FNVB 5K1PA 3IAYA 2ZM6B 4GLXA 1WN7A 2ZNIA 2PTMA 4UCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F66 C;  1X4T A;  2JS5 A;  2CAZ C;  2P22 C;  3THO A;  3SJC C;  3SJA C;  3QF7 A;  1NT2 B;  3ICX A;  3B2E E;  3CSX A;  1SKV A;  3QG5 A;  3ZS8 C;  3SJB C; 
#chains in the Genus database with same CATH topology
 3CX5 F;  3IC7 A;  2R9R B;  4DV5 O;  4DUZ B;  1XHZ A;  1XNQ O;  4X62 B;  5IE9 A;  2F43 G;  1B6Q A;  2JS3 A;  4BAY A;  1F51 A;  4QPJ A;  4NB5 A;  1OCZ C;  4PA3 A;  3K5M A;  4R7C A;  1YJ9 V;  3N2K A;  5J2U A;  2Y69 C;  3BPZ A;  4TQD A;  1FXK C;  1SES A;  4OPA A;  4ZIB A;  2QA4 V;  2EIN B;  2LGQ A;  1R3L C;  1N33 O;  1F4M A;  1SZX A;  2JDI G;  4DR1 O;  1SA0 A;  4FK5 C;  5F2V O;  5JJE B;  4DV4 B;  5D5P A;  2YXL A;  2JGD B;  1GM8 A;  4I9W A;  5JCO A;  1H38 A;  4O4L A;  2QWN B;  2WWW A;  3DXR A;  5TIS Z;  4LF4 B;  1H2M A;  5FL7 G;  4JI8 B;  3DC5 A;  3I5D A;  2OCC B;  4LH6 A;  3HKB A;  1QR9 A;  4XBF A;  2ADQ B;  3OW2 U;  5FPR A;  2EZP A;  4UB8 Z;  2Q9L A;  1VIB A;  2YS8 A;  2GTA A;  3SPI A;  2YIC A;  5B1B C;  2LP7 A;  2ATK C;  4KL1 A;  3D36 A;  1RP3 B;  5CA1 A;  1Y76 A;  1AB3 A;  4BIZ A;  4LBE C;  3UT5 B;  5LP6 B;  1Z5W A;  3K08 A;  4PEL A;  3WG7 C;  3AG7 A;  4E2L A;  2X6C A;  3SGI A;  1HNZ B;  4NXM B;  3F5T A;  1NKD A;  3EHB B;  1M93 A;  4J41 A;  4RQE A;  2A79 B;  4XDK A;  4JYA O;  4K0K B;  4X65 O;  4JZ2 A;  4LWS A;  4PA6 A;  2DYR B;  4WFH A;  1RM1 B;  4JV5 B;  4LF5 O;  5IJ9 B;  1U96 A;  3BY6 A;  5L3B A;  1RPR A;  3AK1 A;  3JAW B;  2DQ3 A;  1JCH A;  3E8F A;  4JI5 B;  2ZIO A;  2Y4U A;  4J10 A;  3SPC A;  4X66 O;  1AR1 B;  2HFE C;  1DTO A;  1ZL8 A;  3KG2 A;  4N23 A;  2VQF B;  5IYZ B;  4B3T B;  3G6B A;  2RQ6 A;  5L3F A;  3IC9 A;  4MVS A;  1BCC H;  1QU7 A;  3CJH B;  1EFR G;  2B1I A;  5B1A B;  4GX2 A;  3ZHV A;  4UB6 Z;  2BTQ A;  1K9M W;  3OMI B;  5IYB O;  1O9H A;  1VF7 A;  3M99 B;  3T1H B;  4FLT A;  1FS0 G;  2F95 B;  3K79 A;  4CBC A;  4DV3 B;  1DF5 A;  2ITD C;  2CTP A;  3K5N A;  2VQE B;  3E89 A;  2DWE C;  3K58 A;  3IJ4 A;  1MSD A;  1MZF A;  2X6A A;  5KAF Z;  3KCX A;  1IBM O;  5LGU A;  1H8E G;  1DK1 A;  1PM9 A;  2A0L A;  5BMV A;  3SYP A;  1CEZ A;  2YC0 A;  2Q0A A;  3KZI Z;  5LYJ A;  2GBO A;  4JYB A;  3OMN B;  2FTK A;  4U3J B;  3HKD B;  3E86 A;  1JMK C;  3FAV A;  3M7M X;  4G2K A;  4HAM A;  4NXN B;  2F4V B;  3CRC A;  3T1Y O;  4CH6 A;  1VQK V;  4PD4 F;  3LNN A;  1QHT A;  4DR7 B;  2EJ7 A;  3ZHU A;  4K8Z A;  5EBL C;  4JI2 B;  4TWK A;  4I50 A;  4MT8 A;  4O2B A;  2OCH A;  3U0Z A;  1QBZ A;  3Q4H A;  4FM0 A;  3STL C;  3JSL A;  3PN1 A;  4G27 B;  5A2Q N;  4NTW A;  5C8Y B;  3ZMU A;  4DO2 A;  4RUE A;  3K0G A;  4J7K A;  1K92 A;  3VQV A;  2ZE8 A;  2ILM A;  2ZNJ A;  1L1F A;  5IY5 C;  1D2D A;  3JAL A;  3UO2 A;  3RYC A;  2M7W A;  5JWP A;  1XMQ O;  3ABT A;  2DN9 A;  1V9P A;  3F7Y C;  2QM7 A;  1CP9 A;  2ZM6 O;  4X1I A;  2JJ2 G;  3H9V A;  1BE3 H;  5J9P C;  2GSM B;  4X20 B;  3CMA V;  4I9Q A;  1PL0 A;  1FPO A;  4MVQ A;  4DR5 O;  1ZX3 A;  4FJC C;  3ZS8 C;  1K73 W;  4ZBM A;  5CBH A;  1M1K W;  2WLM A;  2YEV A;  4I5S A;  2IJI A;  1OCZ B;  1W0K G;  3TXS A;  1AI5 A;  4PHZ A;  5KMG A;  1N32 O;  4FZ1 A;  3BVO A;  2ZR3 A;  1VF6 C;  2Y69 B;  4I0X A;  1FXK B;  3MHH C;  1I0H A;  4KXR A;  4KHP O;  1WPB A;  2D2C B;  2ODM A;  2CGN A;  1AP6 A;  4F6R B;  4JI7 O;  2O57 A;  4LFC O;  1PL4 A;  5EZY B;  5LHI A;  5CBF A;  1NH2 D;  5E79 Z;  4E4E A;  1IBK O;  1S72 V;  3AG4 C;  1I94 O;  3JAS A;  3K57 A;  1M4U A;  5KHJ A;  1M9N A;  1ZUQ A;  2F93 B;  4X1K A;  2UUB O;  4LF6 O;  2Y48 A;  3BRC A;  3SJA C;  4QIW F;  1F4N A;  1GH6 A;  3ICX A;  1P49 A;  1AIL A;  1UJW B;  3OGI B;  3E83 A;  3QO5 A;  4MVZ A;  1BHB A;  4JI1 O;  4DR2 B;  3QO7 A;  2UXD O;  2A06 H;  5B1B B;  2VWJ A;  5LMN B;  1R3K C;  3ETG A;  3M8A A;  5B5E Z;  4JZG A;  5LMU O;  2P6J A;  3D3I A;  3TGU H;  4DV1 B;  2LGW A;  3JAR B;  3AG3 C;  3B2E E;  4UV9 A;  1FKA O;  4YY3 B;  1Y6X A;  4AHC A;  1TA8 A;  4H13 B;  3WG7 B;  3AK2 A;  3RN4 A;  5KX5 A;  3RVY A;  1TVK A;  3CME V;  3CPW U;  4DRX B;  2JIZ G;  4FLU A;  3HKC A;  1XI1 A;  2Q7G A;  4PI0 A;  4CS3 A;  1R3I C;  1R6N A;  5IDJ A;  2E5L B;  1MMM A;  4XDL A;  3C3S A;  2RDC A;  1Q43 A;  1SQV H;  2CH7 A;  4B3M O;  3QTC A;  1YCI A;  4Z2W A;  4O2A B;  2QKC A;  3SYO A;  3OFN G;  4ZOL A;  4Q6G A;  4CH3 A;  5L3C A;  1I5Y A;  5L3E A;  4DR6 B;  3ZBH A;  1O9G A;  1WP8 A;  3ZCC A;  4QPK A;  3CCR V;  1DLB A;  1JA8 A;  2EIK C;  1Q90 D;  4FZ0 A;  4X89 A;  1J95 A;  4UXN A;  3JD4 A;  1P7G A;  1E79 G;  4EB6 B;  4ZKI A;  3ABU A;  3BAA A;  4GLX A;  1WN7 A;  2WLL B;  2Y0P A;  3G4S V;  5LOV A;  1XOU A;  2GTS A;  4PDL A;  3SJB C;  4TUY A;  3CCU V;  5H2F Z;  5JVD A;  1NBM G;  4H37 A;  3TXQ A;  4X64 O;  4JI4 O;  1NZ6 A;  1GMG A;  3WB1 A;  3F5W C;  2QE7 G;  3OEH G;  5KA5 A;  2EIL C;  3CP1 A;  2HHH B;  3X2Q C;  5B3S C;  4MVO A;  1U97 A;  2WAM A;  3QVN A;  1GN6 A;  1K33 A;  1ZSP A;  4WFG A;  1AVM A;  2YI9 A;  3QG5 A;  5LHH A;  2WLI A;  4QE9 A;  3W7W A;  3QO8 A;  3OMA B;  4QE7 A;  1DGS A;  2B5U A;  1XNQ B;  2Q7H A;  4LNU B;  4DV2 O;  1XL6 A;  4UCR A;  4PA9 A;  4I4T A;  2YXY A;  1Y4M A;  5IY5 B;  2AZ0 A;  2JJ1 G;  1AP5 A;  4ABM A;  1Q6U A;  4GKJ B;  5FNV A;  1TUE B;  1EBO A;  1LR1 A;  3FYI B;  1J5E O;  4MW8 A;  3CRR A;  2QEX V;  2YID A;  2P5O A;  4IYI A;  3A0B Z;  1N33 B;  3OGC C;  4CS4 A;  2PUS A;  4YJ2 A;  4LF9 B;  2XHB A;  2IM9 A;  2PGG A;  4JTC B;  2C2A A;  4MW3 A;  1KBH A;  4TOI A;  4FFK A;  4JI3 B;  4A5U B;  1Q3E A;  2N74 A;  3JD3 A;  1NT2 B;  1JR9 A;  3K3W A;  1TUB B;  4PV1 B;  3CCE V;  1LUV A;  3FKS G;  4GUN A;  4F6E A;  2GUZ B;  1US6 A;  4JYC A;  4LFA O;  3R65 A;  1M5I A;  1IBL B;  4B3R B;  4CH4 A;  2XT9 A;  1AI7 A;  1JFF A;  3BCC H;  2XND G;  4JI0 B;  3AG4 B;  1K3E A;  3FFQ A;  2R70 A;  4D6T H;  2CTQ A;  3HPL C;  1HNX B;  4TV8 B;  2UUA O;  1IZ3 A;  4K3A A;  3OR6 C;  1B04 A;  3AEI A;  1ZLZ A;  1N34 O;  1HR0 B;  1RPO A;  4O4I B;  2N05 A;  2Q5Z A;  2QDO A;  3TET A;  3HKE B;  2BE3 A;  1I08 A;  1WPX A;  2Y4T A;  4C7U A;  4TV9 B;  4R50 A;  4U7O A;  3APQ A;  4PA7 A;  1VQ6 V;  2BSK B;  4GYC B;  2W6I G;  4LF5 B;  3THO A;  3A8T A;  4YXW G;  2QWP B;  5JCO C;  1VEW A;  3AG3 B;  2VRZ A;  5CA0 A;  4QNH B;  1FXV A;  1FAF A;  2UUC O;  3W7U A;  1HNW O;  3SYA A;  4GX5 A;  3ZHR A;  1Q81 W;  4MSW C;  3W7T A;  2E3C A;  5A9G A;  2W0X A;  4IIJ A;  3OAA G;  1OCR C;  5IJ0 A;  3SR2 C;  4LC1 A;  3P3N A;  2LW1 A;  5BR8 O;  4YHH B;  2ZXW C;  4F4L A;  5KHG A;  4DV0 B;  1S77 D;  4DV7 O;  1HP8 A;  1VMG A;  1PP9 H;  1YF2 A;  3H1J H;  3RYI B;  3T4Z A;  3W7S A;  3D36 C;  1WA8 B;  1Q82 W;  4D7T A;  2DMX A;  1QLE C;  5L3G A;  1H2N A;  3ZN0 A;  1UPG A;  1AR4 A;  3CCJ V;  4O4H B;  1L0N H;  2QWO B;  5EBW C;  2WSS G;  4UUJ C;  5L3D A;  4GKK B;  3ASO C;  4DR3 B;  4HYO A;  3E22 B;  4B3S B;  1VQ5 V;  5CB4 A;  3RGB A;  1Z5V A;  2ETN A;  2NN4 A;  2DOS A;  3RVZ A;  2EIK B;  5LXT A;  1YTF B;  2E76 B;  1K4D C;  4DW1 A;  3K5O A;  3T2M A;  4ZHQ A;  3QNE A;  4LF7 O;  2EIJ C;  3CC2 V;  3JAT B;  2Q69 A;  3P30 A;  5EIB D;  1R6K A;  2FB5 A;  2Y0I A;  5DM6 V;  4RQF A;  2QGN A;  1XUQ A;  4EEQ A;  1EN5 A;  4MTF A;  3I56 V;  1SQQ H;  2CUG A;  4WCE V;  4I55 B;  4DUZ O;  3CWB H;  3OTO O;  4X62 O;  3NXS A;  2F23 A;  5KHK A;  3CCQ V;  4FLY A;  3RYH A;  2EIL B;  4W4K A;  1VP7 A;  3X2Q B;  5B3S B;  3JAK B;  1VQL V;  2BTO A;  5KA6 A;  5EK0 A;  2KG7 B;  1A32 A;  2P4V A;  3G71 V;  2GV9 A;  2JS5 A;  2FYU H;  1B06 A;  1LNQ A;  5ITZ A;  2QTO A;  4MS2 A;  4ZI7 A;  1S5J A;  4QGP A;  1FFX B;  3JD2 A;  3N2G B;  4DR5 B;  1PV0 A;  2LFR A;  1BZK A;  2Z3Y A;  4GT1 A;  4LF4 O;  1N32 B;  2EUL A;  4G28 B;  3CE2 A;  5FPO A;  3O65 A;  5LA6 B;  3ETE A;  3RT3 C;  1XNR O;  2LW7 A;  5EYP B;  5JQG A;  4LFB B;  4BIO A;  2V4D A;  4QJF B;  2H8P C;  3MHS C;  3VQW A;  3LSS A;  3ZMZ A;  2DQ0 A;  1YZB A;  4KUM A;  2QSA A;  4FFB B;  3ZMT A;  4Z1M G;  4JTA B;  1XMO B;  2HKO A;  4BIU A;  1NU1 H;  5J2T B;  3ZRX A;  2LJ2 A;  2UU9 B;  1IBK B;  1XL4 A;  3MDS A;  2H94 A;  4KFM A;  5FLX N;  1I94 B;  1RSO B;  4IHJ B;  2W6J G;  4WFE A;  4FM1 A;  3ZMV A;  2RMK B;  1WLE A;  4L8J A;  4PA4 A;  4JAA A;  3K9S A;  4J80 A;  4NXM O;  1JPX A;  5IYD O;  4HNA A;  3FYE B;  3DGE A;  2YXH A;  5H9C A;  2AXT Z;  5JH7 A;  3CC4 V;  1IDS A;  4JI1 B;  4ICG A;  4K0K O;  3ZMS A;  1PNM A;  3CHX A;  2YSU B;  2IJK A;  2OIE A;  3MD0 A;  1B3Q A;  1GO3 F;  3LUT B;  1BMF G;  2X6B A;  3CCS V;  4AQY O;  2B1G A;  3NR7 A;  4JI5 O;  3GWK C;  3ZHQ A;  1W0J G;  5GTH Z;  2KQX A;  1NTM H;  2HJF C;  1SKV A;  3TK1 A;  3N2K B;  1QVG U;  5J2U B;  3S3W A;  4H33 A;  2N04 A;  3OEE G;  1KU9 A;  2VQF O;  4B3T O;  3T4D A;  2PZS A;  1S0V A;  3TCU A;  1AJP A;  5LGN A;  5IWA B;  1YIJ V;  1SA0 B;  4LF8 B;  4ASU G;  4X1Y A;  4WBN A;  1K8A W;  1VQ8 V;  1M57 C;  3BA8 A;  4O4L B;  1KKD A;  1XBL A;  5GON A;  3JYC A;  3DXR B;  1E1R G;  3ML0 A;  1N0N A;  3K59 A;  3CRA A;  2A3Q A;  3T1H O;  3ZRW A;  2UXB B;  1ORQ C;  4DV3 O;  1NS1 A;  2VQE O;  1OCR B;  3ZX6 A;  3ETQ A;  2XAS A;  3HKB B;  1NVP B;  4DR4 O;  2ZXW B;  1P84 F;  4UCU A;  1S5L Z;  5HFL A;  4O4J A;  1WB7 A;  1BGY H;  4YIO A;  5CA1 B;  3K04 A;  2AHZ A;  1Y76 B;  1QLE B;  2NNU A;  5EBM C;  3D8C A;  3DSQ A;  4UCV A;  3L71 H;  1KP2 A;  3ZHT A;  4UCO A;  3CXC U;  1IUR A;  1YSC A;  2F4V O;  4EKW A;  4WF9 V;  1CPY A;  4DV6 O;  4LH7 A;  4DR7 O;  2ZD9 A;  4DK1 A;  2K1E A;  3ASO B;  2HP8 A;  4LWS B;  2F1M A;  3RYF A;  1QNM A;  1GAX A;  4JI2 O;  2Q73 A;  5CA3 A;  1VQ7 V;  3F7V C;  1THZ A;  4JYY A;  4YJ3 A;  1GN3 A;  1H2S B;  3T1C A;  2W0F C;  4X64 B;  1Q8I A;  3G80 A;  3K9A A;  2JGU A;  1ZL8 B;  2EIJ B;  1KC8 W;  2QM8 A;  2ZCE A;  4OX9 O;  1Y74 A;  2EZO A;  3SYQ A;  3CB2 A;  1QR8 A;  3L72 H;  3ZHS A;  3ASN C;  4N21 A;  1AI4 A;  4IYH A;  2BTQ B;  2RNB A;  3A0H Z;  5GW7 A;  3WU2 Z;  3OM3 B;  2X0L A;  2ZKO A;  2QKA A;  1IX9 A;  3BA9 A;  3H1L H;  3SPH A;  4MTX A;  1VQO V;  1Y67 A;  4MTG A;  3JCU Z;  3E8G A;  3IFX A;  4P9P A;  1GRJ A;  5KLV H;  3ZED A;  3UO3 A;  3A2F A;  1Q6I A;  1SQX H;  4NTX A;  2XAF A;  2UXC B;  4P9O A;  2HEP A;  2ZIN A;  1J5E B;  5BMV B;  2JGD A;  3JD1 A;  5LYJ B;  1S5H C;  4YIP A;  3B4S A;  1SZT A;  4TSF G;  2JEU A;  1EN4 A;  3FAV B;  1OCC C;  2LQT A;  1NJI W;  4K8X A;  3OTF A;  2VWK A;  3FX7 A;  4UFZ A;  2PYL A;  1GTO A;  4LFA B;  4I50 B;  1R1B A;  2DJV A;  4JPR A;  4O2B B;  1K7D A;  5B1N A;  3Q4H B;  3AG1 C;  3UT5 A;  5LP6 A;  3WB2 A;  1UFI A;  1N34 B;  1KKC A;  4KP4 A;  3JAL B;  1K97 A;  3RYC B;  1QQC A;  2AZ2 A;  2Q68 A;  2YDE A;  2YIB D;  3N27 A;  4X9Q A;  4IL6 Z;  4DV5 B;  2EIM C;  1PKX A;  1KMI Z;  4X1I B;  5IJ9 A;  4X8A A;  3H1K H;  2X7R B;  3K0D A;  3JAW A;  2E74 B;  2HJD A;  2UUC B;  3J7A U;  2YEV B;  4NKG B;  1BT8 A;  1IXB A;  4BWA A;  4B7K A;  5KMG B;  1NQT A;  5IYZ A;  3B8M A;  4I0X B;  3CJH A;  2P67 A;  5BR8 B;  4DR1 B;  2AW9 A;  1KB9 F;  4RAI A;  1FYJ A;  1HW7 A;  4UV8 A;  1HWY A;  1JQ0 A;  1NR1 A;  2CGO A;  4DR6 O;  1KYO F;  4CZZ A;  3A0R A;  3GVM A;  4HBN A;  1YJN V;  2PI5 A;  3JAS B;  3VBB A;  4X1K B;  1V54 C;  2ADP A;  3AG2 C;  1WAZ A;  1M56 C;  5LBQ A;  1X59 A;  4PDV A;  3CC7 V;  3RBZ A;  4JAU A;  1K5S A;  4JI6 O;  2ZDI A;  2OIG A;  4H0L B;  1BS3 A;  2A9H A;  4L87 A;  4J11 A;  2V1D A;  1D5N A;  4J9Z B;  3E35 A;  3CEI A;  4U3J A;  4P2Z A;  1D5A A;  3JSN A;  4U3F H;  3HKD A;  3ABK C;  4OXS A;  4PDM A;  3WB0 A;  2XAG A;  3IGA C;  1ZAU A;  3AK3 A;  5KX5 B;  1TVK B;  2ZE6 A;  2R72 A;  1S3J A;  4MVM A;  4JYA B;  2WPD G;  3HKC B;  4X65 B;  2CTW A;  1GM7 A;  1YDX A;  4OGQ B;  2EJR A;  3B40 A;  2FKX A;  3D3Q A;  2P90 A;  4LR3 A;  5C8Y A;  4X66 B;  2CH7 B;  3GWO A;  5B66 Z;  3BEH A;  3OTO B;  2D3O W;  2CAZ C;  4B08 A;  3E8H A;  3L75 H;  1OJH A;  1FJG O;  4IGG A;  2Z0A A;  5GTI Z;  2CTR A;  2LO1 A;  4ZOL B;  2IU0 A;  1YTF D;  3UKM A;  3ABL C;  4GKJ O;  1F23 A;  3ASN B;  3GB7 C;  3ZRS A;  5KAI Z;  4X20 A;  2A7W A;  2YUA A;  3EFF K;  4D7S A;  1SS3 A;  2OWO A;  3U10 A;  5IYC O;  4LF9 O;  4WFA V;  1OHH G;  2BOC C;  4OPH A;  1SQG A;  4JI3 O;  5H5N A;  1FXK A;  1IBM B;  4DUY O;  1CXZ B;  1XIL A;  4CS2 A;  1VQP V;  5H6R A;  5LGT A;  1XNR B;  4F6R A;  2KSD A;  3JAM N;  3ABM C;  5LOV B;  2BOB C;  5EZY A;  4IT5 A;  5AG2 A;  3J81 N;  2WLJ A;  2P22 C;  2L35 A;  4NYK A;  4LP8 A;  4H44 B;  4NR1 A;  4TUY B;  1IBL O;  5JVD B;  2E75 B;  4U7N A;  4B3R O;  3JD0 A;  3QF7 A;  2HR3 A;  3T1Y B;  4JI0 O;  3ZRV A;  2NLJ C;  5K1X A;  1EM1 A;  1OCC B;  2Z5U A;  2OYQ A;  4GZR B;  1HNX O;  2XAQ A;  1N36 O;  1HR0 O;  2CE4 A;  3R66 A;  1H8H G;  1Q6H A;  1XEQ A;  3CYO A;  4BW5 A;  2ZQM A;  3C3T A;  3LSU A;  3HB3 B;  4RO2 A;  3L74 H;  1XDC A;  3U11 A;  2DE0 X;  4BR6 A;  4PJ0 Z;  5JJN B;  2WLI B;  5LHG A;  2IU3 A;  4UCT A;  1EZV H;  3JAR A;  1JVM A;  3AG1 B;  3WFV A;  1W59 A;  1AJN A;  3SJQ C;  1K5Q A;  4J7J A;  4AQY B;  2PF4 E;  3FB7 C;  4I4T B;  4MVU A;  4GX0 A;  1FFT B;  3DC6 A;  2ZE5 A;  1XMQ B;  4DRX A;  1H2K A;  5DEC A;  1NI8 A;  1KUQ A;  5FNV B;  1F7Y A;  4RUF A;  2ZM6 B;  1ENV A;  4YHH O;  2EIM B;  4K35 A;  4DV4 O;  1AJQ A;  1MAB G;  4MTO A;  3VQX A;  2ARH A;  4DV0 O;  2UXN A;  3E2E A;  4YJ2 B;  2UXX A;  1VQN V;  5CMU A;  4DXW A;  1COW G;  1Y66 A;  1KQS U;  1T5E A;  3APO A;  4JI8 O;  1M90 W;  1BQZ A;  4O2A A;  2PYJ A;  2CK3 G;  1V55 C;  2PY5 A;  3CCL V;  1R3J C;  4KHP B;  4CC5 A;  1Q86 W;  3CCM V;  1TAE A;  2HG5 C;  2ZT9 B;  1SQB H;  2XOK G;  2Q0O C;  4J7Z A;  4JI7 B;  4TQF A;  4DR4 B;  4LFC B;  1N0J A;  1N8R W;  5DN6 G;  4GKK O;  4TT3 G;  4DR3 O;  2FL4 A;  4B3S O;  1HDJ A;  1YHQ V;  1JFF B;  1RFY A;  1XHX A;  4UCS A;  1I7F A;  3VQY A;  2UUB B;  4LF6 B;  3ZIA G;  1P4R A;  1K4C C;  1N4C A;  1X4T A;  1V54 B;  1YEW A;  3KKY A;  3FB8 C;  5KUM A;  1HNZ O;  2Q67 A;  3AG2 B;  1YXB A;  1PD3 A;  4EB6 A;  1M56 B;  1JJ2 U;  3CS5 A;  4MVR A;  2UXD B;  3PJS K;  4DV6 B;  1OCO C;  2WLL A;  1JOY A;  1KD1 W;  2IW5 A;  4JV5 O;  1VQM V;  5LMU B;  2P4K A;  1NVP D;  2ZE7 A;  2WA3 A;  2QM4 A;  1Q7Y W;  5JJJ B;  3LDC A;  2ZR2 A;  2AGA A;  3G6E V;  1MOF A;  3K03 A;  5CA0 B;  1VAR A;  2XAJ A;  4FIP C;  3ABK B;  3OUS A;  2HVK C;  4EFB A;  4FLV A;  1IXM A;  1YIT V;  2YIA A;  5CBG A;  3G67 A;  3CCV V;  4R8C A;  3OUF A;  1G6U A;  4IIJ B;  1Q5O A;  5IJ0 B;  3S3X A;  2DW4 A;  4OX9 B;  1W2B U;  2BCC H;  2JVD A;  3EXA A;  5KHI A;  1ZTE A;  1IVS A;  2K9P A;  5E1A C;  4B7E A;  5H6Q A;  1GN2 A;  3SDL A;  4J42 A;  4B3M B;  4LNU A;  4CH5 A;  3H1I H;  5EC1 C;  3SYC A;  1BSM A;  1OV9 A;  2HVJ C;  1PPJ H;  1ROP A;  4XDJ A;  2MW2 B;  4DYL A;  1VQ9 V;  1SET A;  1WNS A;  1NTZ H;  3ABL B;  4AIL C;  2MK3 A;  3L9D A;  2DYS C;  2RN9 A;  3ETD A;  3UCS C;  4GX1 A;  4I7Z B;  2XTA A;  1QVF U;  2HLD G;  3RW0 A;  4Q20 A;  5B1O A;  3L70 H;  4LFB O;  5CB4 B;  3OR7 C;  3OT7 A;  4NTY A;  3BAB A;  4RWU A;  3CD6 V;  3CXH F;  5EC2 C;  1AR5 A;  1XMO O;  4PDR A;  4NXN O;  5BY1 A;  5LXT B;  2UU9 O;  2H3O A;  2YIB A;  1VF6 A;  4ZHQ B;  1ARO P;  2CDY A;  4J9Y B;  1TUB A;  2V7Q G;  1R6T A;  2GUZ A;  1BL8 A;  1URF A;  3C90 A;  1H2L A;  1MNG A;  3ABM B;  5BZB A;  4DW0 A;  1XQ8 A;  3FB6 C;  2OTJ V;  4JI4 B;  2M6Y A;  1S76 D;  2IH1 C;  2JK5 C;  4JGS A;  3P32 A;  4UVC A;  4TV8 A;  3K06 A;  1OZ0 A;  2OT5 A;  1EN6 A;  3RYH B;  1QCE A;  1SQF A;  3OE7 G;  1G1X B;  1DF4 A;  2QWR B;  4O4I A;  1Z2G A;  1FXH A;  4FLZ A;  2KKW A;  2RCV A;  3KCY A;  3FB5 C;  3K5L A;  3HKE A;  2EIN C;  4TV9 A;  1NH2 B;  3H1H H;  5ITZ B;  1K34 A;  5IWA O;  1FD9 A;  1WP7 A;  2BSK A;  4DV2 B;  2Q8V A;  4ZI7 B;  4LF8 O;  1L0L H;  1L8D A;  3B8N A;  1P7B A;  5DED A;  4NVP A;  3BFR A;  3SPJ A;  4HZ3 A;  5IT9 N;  1AI6 A;  1NTK H;  2OCC C;  2UXB O;  5C93 A;  1E1Q G;  4EFE A;  3L73 H;  5JQG B;  3DTU B;  2XUM A;  3RYI A;  1XRE A;  1G8M A;  3BHP A;  2QR4 A;  2QKS A;  1WA8 A;  3MAQ A;  1VF5 B;  3EVK A;  2L6L A;  1TGO A;  3UQ8 A;  3E8B A;  5LP6 C;  1MSW D;  1ZWI C;  1V55 B;  2QJ1 A;  4WFF A;  3OD4 A;  2KB1 A;  1KP3 A;  4O4H A;  2EX3 A;  5CN0 A;  2WLK A;  1SQP H;  4HNA B;  1YJW V;  1MG1 A;  1MZE A;  4FLX A;  4DR2 O;  5JH7 B;  2R9A A;  4BW9 A;  5LMN O;  2DYR C;  1RM1 C;  1JJO A;  1G4Y B;  2P06 A;  3E22 A;  2B9Z A;  4JI6 B;  3I55 V;  4Z1V A;  4DV1 O;  4PI2 A;  4FLW A;  1NR7 A;  2VS0 A;  4YY3 O;  2UUA B;  1YI2 V;  3VOU A;  4P30 A;  2R9I A;  1MA1 A;  3B09 A;  1GM9 A;  1YVW A;  1VQ4 V;  3JAT A;  3SJC C;  2PI4 A;  1GK9 A;  3ZN1 A;  4R6Z A;  3CRQ A;  3LDE A;  4AI8 A;  1R73 A;  5KUK A;  1OCO B;  2EBO A;  1GN4 A;  5B1A C;  2E5L O;  2JEX A;  2QTS A;  4W4L A;  2ZIM A;  3HR0 A;  1LUW A;  2YI8 A;  3LDD A;  4I55 A;  4X1Y B;  2XAH A;  3P3P A;  4WBN B;  2IJJ A;  2FML A;  1HNW B;  4UVB A;  4JF3 A;  5GON B;  2F66 C;  2P7T C;  3LSQ A;  2WLN A;  5HFM A;  3TJT A;  5EIB C;  4FPP A;  3LNM B;  3ZRW B;  1SRY A;  3JAK A;  1FJG B;  4UVA A;  2IH3 C;  1WJZ A;  1SF9 A;  2LFS A;  2KG7 A;  4DV7 B;  3FD9 A;  4JAV A;  2ITC C;  1M57 B;  4FM2 A;  2UXC O;  4FMT A;  3H01 A;  4FVM A;  4GCZ A;  2ZDI C;  5D5Q A;  3O9O A;  4O4J B;  1FFX A;  3N2G A;  3CRM A;  3W7X A;  1WB8 A;  2OTL V;  1QLN A;  4LCU C;  4CC6 A;  2IJH A;  2Q4P A;  5KHH A;  3RFR A;  4JAS A;  2NR5 A;  5LL6 Y;  2QWQ B;  1H2G A;  3B77 A;  5LA6 A;  1SC5 B;  1SER A;  4DUY B;  1BQ0 A;  2DYS B;  1GKF A;  3JCZ A;  5EYP A;  4DK0 A;  3UM7 A;  5BXZ A;  2AHY A;  3STZ C;  3RYF B;  3RWR D;  1EZJ A;  4WFB V;  2GHY A;  4FFB A;  1KEC A;  1PNK A;  5J2T A;  4YJ3 B;  4X88 A;  1RSO A;  4IHJ A;  1PNL A;  2RJZ A;  4JTD B;  2Q7E A;  4LF7 B;  3SPG A;  2HHH O;  3CSX A;  1BHA A;  2IBZ H;  2Q6A A;  2WA4 A;  1JX9 A;  1N36 B;  2G38 A;  2JRI A;  3J80 N;  5K1P A;  1Y74 B;  3IAY A;  2WLH A;  1I5X A;  2GDS A;  2ZNI A;  2DWD C;  2PTM A;  3ZJZ A; 
#chains in the Genus database with same CATH homology
 5LOV A;  3VQX A;  4DUZ B;  4O4J A;  1XHZ A;  3SJB C;  4X62 B;  5CA1 B;  4YJ2 B;  4TUY A;  5JVD A;  3DSQ A;  1T5E A;  3WB1 A;  4UCV A;  4O2A A;  2PYJ A;  3K5M A;  4UCO A;  2PY5 A;  2HHH B;  3N2K A;  4KHP B;  4CC5 A;  5J2U A;  1TAE A;  3BPZ A;  4TQD A;  4ZIB A;  4LH7 A;  4JI7 B;  4TQF A;  4DK1 A;  4LFC B;  4DR4 B;  2F1M A;  1SA0 A;  3RYF A;  5JJE B;  2YI9 A;  3QG5 A;  4DV4 B;  5D5P A;  2YXL A;  1DGS A;  5JCO A;  1XNQ B;  2Q7H A;  4LNU B;  4O4L A;  1JFF B;  1XHX A;  4UCS A;  4YJ3 A;  1H2S B;  1I7F A;  3VQY A;  2UUB B;  4LF4 B;  4LF6 B;  4UCR A;  4X64 B;  1X4T A;  4I4T A;  4JI8 B;  1Q8I A;  1YEW A;  2JGU A;  4EB6 A;  4LH6 A;  2ZCE A;  3HKB A;  4GKJ B;  5FNV A;  5FPR A;  2UXD B;  4DV6 B;  3CB2 A;  2P5O A;  5LMU B;  2BTQ B;  1N33 B;  4CS4 A;  2PUS A;  4KL1 A;  5CA1 A;  2QM4 A;  4YJ2 A;  5JJJ B;  4LF9 B;  2XHB A;  2IM9 A;  2PGG A;  3BA9 A;  5CA0 B;  3UT5 B;  5LP6 B;  1Z5W A;  4EFB A;  4FLV A;  4TOI A;  2YIA A;  4JI3 B;  3SGI A;  1Q3E A;  1HNZ B;  4NXM B;  1G6U A;  4IIJ B;  1Q5O A;  1M93 A;  1NT2 B;  5IJ0 B;  3ZED A;  3A2F A;  1TUB B;  4OX9 B;  2JVD A;  2UXC B;  5KHI A;  4K0K B;  2HEP A;  2ZIN A;  1J5E B;  5BMV B;  4JV5 B;  1M5I A;  5IJ9 B;  1IBL B;  5LYJ B;  4B3R B;  4B3M B;  4LNU A;  4CH5 A;  4CH4 A;  1JFF A;  3JAW B;  4JI0 B;  3FFQ A;  4JI5 B;  2ZIO A;  2R70 A;  1HNX B;  4TV8 B;  1B04 A;  2VQF B;  4O4I B;  1HR0 B;  5IYZ B;  4B3T B;  2RQ6 A;  1WNS A;  4K8X A;  3OTF A;  2VWK A;  3HKE B;  4AIL C;  4UFZ A;  4TV9 B;  2PYL A;  2BTQ A;  4LFA B;  4I50 B;  4GYC B;  4O2B B;  4LF5 B;  3THO A;  5CB4 B;  5JCO C;  3BAB A;  1O9H A;  5CA0 A;  3UT5 A;  1VF7 A;  5LP6 A;  3T1H B;  4FLT A;  2F95 B;  4DV3 B;  3WB2 A;  5LXT B;  3K5N A;  2E3C A;  2VQE B;  2YIB A;  4ZHQ B;  4IIJ A;  1N34 B;  5IJ0 A;  3SR2 C;  3JAL B;  3RYC B;  3K58 A;  1QQC A;  1TUB A;  4YHH B;  2YIB D;  5KHG A;  4DV5 B;  4DV0 B;  1KMI Z;  5BMV A;  4X1I B;  5IJ9 A;  2Q0A A;  5LYJ A;  3RYI B;  4D7T A;  1XQ8 A;  3JAW A;  4JI4 B;  4U3J B;  3HKD B;  2UUC B;  4TV8 A;  1JMK C;  3M7M X;  4NXN B;  2F4V B;  3RYH B;  1SQF A;  4BWA A;  5KMG B;  4CH6 A;  4O4I A;  5IYZ A;  3LNN A;  4FLZ A;  2KKW A;  4O4H B;  1QHT A;  4DR7 B;  3K5L A;  3HKE A;  4K8Z A;  5BR8 B;  4DR1 B;  4TV9 A;  4JI2 B;  1HW7 A;  4GKK B;  4DR3 B;  5ITZ B;  4I50 A;  3E22 B;  4DV2 B;  4O2B A;  4B3S B;  3U0Z A;  5CB4 A;  4ZI7 B;  4FM0 A;  3RGB A;  1L8D A;  1Z5V A;  3JSL A;  3PN1 A;  5C8Y B;  4NVP A;  4HBN A;  5LXT A;  3VQV A;  3JAS B;  4X1K B;  4ZHQ A;  3K5O A;  2ZNJ A;  3JAL A;  3JAT B;  3RYC A;  5EIB D;  4EFE A;  1V9P A;  5JQG B;  4EEQ A;  4X1I A;  4X20 B;  4I9Q A;  3RYI A;  4I55 B;  3BHP A;  3MAQ A;  3ZS8 C;  4U3J A;  1TGO A;  1D5A A;  3UQ8 A;  3JSN A;  3HKD A;  5LP6 C;  5KHK A;  4FLY A;  3RYH A;  3WB0 A;  4PHZ A;  5KMG A;  2QJ1 A;  1ZAU A;  5KX5 B;  1TVK B;  3JAK B;  2R72 A;  4O4H A;  2EX3 A;  2BTO A;  4JYA B;  3HKC B;  4X65 B;  1WPB A;  4HNA B;  2GV9 A;  2JS5 A;  4FLX A;  5JH7 B;  2R9A A;  4BW9 A;  4F6R B;  5ITZ A;  1JJO A;  3E22 A;  4JI6 B;  5EZY B;  4LR3 A;  4ZI7 A;  1S5J A;  1FFX B;  3N2G B;  4PI2 A;  4FLW A;  4DR5 B;  5C8Y A;  4X66 B;  2UUA B;  3OTO B;  2CAZ C;  3JAS A;  4B08 A;  1M4U A;  5KHJ A;  3K57 A;  2F93 B;  4X1K A;  3BRC A;  1N32 B;  3JAT A;  3SJC C;  3SJA C;  5FPO A;  3ICX A;  4ZOL B;  1P49 A;  5LA6 B;  5EYP B;  4DR2 B;  5JQG A;  4LFB B;  2VWJ A;  2V4D A;  2ZIM A;  5LMN B;  4X20 A;  2YI8 A;  3VQW A;  4I55 A;  4X1Y B;  4WBN B;  4FFB B;  4D7S A;  1HNW B;  4DV1 B;  1XMO B;  2OWO A;  3JAR B;  3B2E E;  3U10 A;  5GON B;  5J2T B;  2F66 C;  2UU9 B;  1IBK B;  4YY3 B;  4AHC A;  1TA8 A;  1I94 B;  4IHJ B;  5EIB C;  4FM1 A;  5KX5 A;  1SQG A;  1TVK A;  3JAK A;  4L8J A;  1FJG B;  1IBM B;  4DRX B;  4FLU A;  3HKC A;  1XI1 A;  4CS2 A;  4HNA A;  2Q7G A;  4PI0 A;  4DV7 B;  4CS3 A;  5JH7 A;  1XNR B;  4F6R A;  4FM2 A;  4JI1 B;  2E5L B;  5LOV B;  4FVM A;  5EZY A;  5D5Q A;  3CHX A;  4O4J B;  2P22 C;  1FFX A;  3N2G A;  1Q43 A;  4TUY B;  5JVD B;  3QTC A;  3QF7 A;  4CC6 A;  3T1Y B;  5KHH A;  3RFR A;  5K1X A;  4O2A B;  2OYQ A;  1SKV A;  3N2K B;  5J2U B;  4ZOL A;  1KU9 A;  4Q6G A;  5LA6 A;  4CH3 A;  4DUY B;  2PZS A;  3U11 A;  5EYP A;  5IWA B;  4DK0 A;  5JJN B;  4DR6 B;  1SA0 B;  3RYF B;  4LF8 B;  3RWR D;  4X1Y A;  4WBN A;  1O9G A;  4FFB A;  4UCT A;  3BA8 A;  3JAR A;  4O4L B;  5GON A;  5J2T A;  4YJ3 B;  1RSO A;  4IHJ A;  2RJZ A;  2Q7E A;  3K59 A;  4AQY B;  4LF7 B;  4I4T B;  2UXB B;  3CSX A;  1XMQ B;  4DRX A;  4EB6 B;  3ETQ A;  1N36 B;  3HKB B;  3BAA A;  5FNV B;  5K1P A;  3IAY A;  2ZM6 B;  4GLX A;  1WN7 A;  2ZNI A;  2PTM A;  4UCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...