2F66C

Structure of the escrt-i endosomal trafficking complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
65
structure length
65
Chain Sequence
SKKYGDIALKKKLEQNTKKLDEESSQLETTTRSIDSADDLDQFIKNYLDIRTQYHLRREKLATWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Suppressor protein STP22 of temperature-sensitive alpha-fact
publication title Structural and functional organization of the ESCRT-I trafficking complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 27
structure length 65
sequence length 65
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2f66C00
1NT2B 3SJBC 3THOA 3QF7A 1SKVA 3QG5A 2CAZC 2JS5A 1X4TA 3CSXA 2P22C 3SJAC 3SJCC 2F66C 3B2EE 3ZS8C 3ICXA
chains in the Genus database with same CATH superfamily
3CD6V 1J5EO 5KAFZ 3ZJZA 2P4VA 1QVGU 3BHPA 3JSNA 5FL7G 1FYJA 1TUEB 3N2GB 1MOFA 2CGOA 4YY3O 1AROP 2UU9O 1KC8W 1GN4A 1URFA 3DGEA 4JAVA 2Z5UA 4JI8O 3VOUA 1OZ0A 2X6AA 2ZDIC 5TISZ 3ZHVA 1ZTEA 1WPBA 3RGBA 3J81N 3F7YC 2Q4PA 4AQYO 5E1AC 2F93B 1T5EA 1QLNA 2X6BA 1BHBA 3K03A 1JFFA 4D6TH 1WB8A 4I5SA 4O4JB 4EB6A 1YXBA 3O9OA 1X4TA 2E74B 1XREA 4HAMA 4GUNA 3AG2C 3K0GA 4FLXA 5KX5B 2W6JG 1W0JG 2E76B 4X66O 2QR4A 4TQFA 2JK5C 2D2CB 2WLMA 2ZD9A 1GN6A 3ETEA 4C7UA 1GMGA 3G71V 1EFRG 2EJRA 1L1FA 5ITZA 5B1OA 3IJ4A 3I56V 2JJ2G 3Q4HB 3ZS8C 4JF3A 4LF8O 1J95A 5KA5A 4O4LA 4CS4A 1YITV 4GKJO 2WLNA 5B1AB 1PM9A 4LF4B 2YXHA 4GX5A 3OTOO 3FB5C 2ATKC 4FLYA 4K35A 5FPOA 5LHHA 3W7SA 5IT9N 2WWWA 2JS5A 4P2ZA 4NYKA 5LGTA 4IYHA 1VIBA 4W4KA 1AJPA 3OR7C 4OGQB 3JD0A 3JCUZ 4GKKO 1KUQA 3E83A 5J2UA 2F66C 1AP5A 5LHIA 4LFBO 5A9GA 4MTFA 3T1HB 4IT5A 3RBZA 4I50B 3G80A 4PA4A 1QU7A 1HNXB 4B3TO 4FZ1A 1XNQO 2BSKA 1VQNV 2W0FC 1TVKA 4I9WA 1TA8A 1NQTA 3SPCA 1EM1A 1Q43A 1NR1A 4X89A 1AR4A 4GCZA 1M56C 2KKWA 3JALA 4B7EA 2A9HA 1NI8A 1NVPD 3CC4V 1AILA 2UXBB 5CA0A 4H13B 3LSSA 4L87A 3VQYA 1FS0G 3CCVV 3AEIA 5EIBD 2KQXA 2P4KA 2P06A 3SYOA 3AG3B 4OXSA 3HKCB 3F7VC 2QKAA 3D3QA 1Y4MA 1B3QA 2WSSG 4GX1A 3BRCA 1PL0A 3ZRSA 2K1EA 5KHHA 1PP9H 3OEHG 2ZR3A 4I7ZB 3WB0A 4LR3A 2PY5A 2LGWA 3J80N 2OTJV 3K58A 3NR7A 4JI5O 1KP3A 3LSQA 1M93A 3UT5B 3DTUB 4B3SO 4P9OA 5LMNB 1BS3A 3JAKB 3IGAC 3PN1A 4DO2A 4QE7A 3ZHSA 2ZM6B 2KG7B 3KG2A 5H6RA 4EFEA 1H8EG 2HR3A 2QTSA 1YZBA 2K9PA 2AZ2A 2DOSA 2YEVA 2XAFA 1P4RA 4PA3A 2KSDA 3SYAA 5L3CA 4J10A 1O9HA 4QJFB 4X62O 3ML0A 3SR2C 3FX7A 3U10A 1ZWIC 1YIJV 1PNMA 3ZN1A 5H5NA 1I94B 2Q67A 3H9VA 3OUFA 4CS3A 2B1IA 2OT5A 2HHHB 1DK1A 4DK0A 3E35A 3Q4HA 2A7WA 3A0HZ 1V54C 3OUSA 1JMKC 4DV3O 2QTOA 3ZHRA 1VMGA 1U97A 4DV5O 3K5NA 3CMEV 2OTLV 4MSWC 4F6RB 1Q6HA 2BOCC 4JI1B 1ZAUA 1E1RG 2ZNJA 4BIOA 2ZINA 1NJIW 5B1AC 4I50A 4U7OA 4MW8A 2B9ZA 2UUAB 1OCOB 5JJJB 4PDMA 4HNAB 3HR0A 1Y74B 4H33A 1VQKV 2B5UA 4YHHB 2E75B 4U3FH 1Q90D 2DMXA 1SZXA 3ZMUA 1K34A 2W0XA 3WB2A 2QE7G 1H8HG 1KYOF 2Q8VA 4IYIA 4UCRA 2DE0X 3UO2A 3ETGA 4LCUC 4KFMA 1E79G 1MG1A 3HKCA 1WP7A 3MDSA 3AG1B 3I5DA 4RWUA 1AR1B 3K5LA 4KXRA 2F43G 2DWDC 4LF7O 1GM9A 4LF6B 4F4LA 3JD3A 4UCUA 4H0LB 5KUKA 3P32A 4JV5B 3P3NA 2JJ1G 1M57C 1US6A 2VQEB 1VQLV 3AG3C 4AI8A 3QTCA 3ZIAG 2FL4A 4PI0A 5DECA 2BCCH 4KP4A 3UT5A 2F4VB 3CCQV 1ZL8B 1FFXB 3BVOA 3JAKA 2OCHA 2P7TC 2Q7HA 4UV8A 1BE3H 2KG7A 1UPGA 1W59A 3G6BA 5L3FA 1G6UA 3K57A 1RPRA 3ABMB 2Y4UA 3QO5A 3HKEB 3MD0A 3R65A 4G28B 3W7UA 3H1IH 1KBHA 5BR8B 4D7SA 4NXMO 3K9AA 5JQGB 4WFHA 1JR9A 2EIKB 1PV0A 1S5JA 4OX9B 3FD9A 4FLZA 4CC5A 2OWOA 1HW7A 2LJ2A 3GWOA 3M7MX 4NB5A 1YVWA 1THZA 3OTFA 2WA3A 3G4SV 1YJNV 2GUZB 4MVOA 5IDJA 1NH2D 1W0KG 4FLWA 2ZXWC 4O2AB 4YJ3B 4QGPA 5L3DA 1NKDA 1XQ8A 1N33O 3RW0A 2ZR2A 4F6RA 2UXDO 2PTMA 2UXXA 2E5LB 2IM9A 2QEXV 3ABKB 4RQFA 2LQTA 1S0VA 3LDDA 3SPHA 4HNAA 1Y74A 2ZT9B 3CWBH 1AVMA 1NTZH 4L8JA 2XNDG 3OR6C 1JVMA 2QWOB 4TSFG 1KP2A 4BIUA 4G2KA 1MZFA 3ETDA 4LH6A 1P84F 1ZUQA 4PA7A 4JI2O 1OCOC 1XNRB 2EILB 2BE3A 5H6QA 3B40A 2LO1A 1MZEA 2CDYA 3APOA 1GK9A 3CX5F 1VF7A 4EFBA 2VWJA 1QQCA 2XAJA 3GWKC 4MTOA 1IXBA 1NT2B 1OCZC 3QO7A 4DR6B 2WLJA 1LNQA 3G6EV 4DV1O 5L3BA 4JI3B 1D5AA 3DXRB 5CBHA 5JCOA 5KAIZ 1J5EB 4YXWG 4F6EA 2EZPA 4IGGA 3AG1C 3UKMA 4JASA 1W2BU 2Y0PA 4DR1B 4Q20A 1ZL8A 1FFXA 5K1PA 2WAMA 2QGNA 5KLVH 4LF9B 3ZHUA 1S72V 3K79A 5JCOC 4JYAB 4PHZA 4IL6Z 1HNWB 2XOKG 1B04A 5IJ0B 1XDCA 4TT3G 4WFGA 3S3WA 3CYOA 1IBMB 5KHGA 3HKEA 1VQ8V 2P5OA 4DUZO 4JI6B 3MHHC 2RMKB 2ZE7A 1IURA 4RUFA 3N2KB 3G67A 1Y66A 5JQGA 4J7ZA 3I55V 3R66A 4DV7O 5A2QN 5J2UB 3ABMC 5IWAB 1COWG 2DJVA 2IH3C 2XUMA 2GUZA 4GKJB 3ABLB 2F1MA 2Z0AA 4YJ3A 3CB2A 5LYJA 4PDVA 4DV6B 2CK3G 2PYJA 2PYLA 1FJGB 2EIKC 4MVZA 4FJCC 3MAQA 5EBMC 1IBKO 2RCVA 2AHZA 1KQSU 2IU3A 1Q3EA 2NN4A 1SZTA 4DV0B 3DC6A 1JPXA 1AJQA 4E2LA 4KUMA 1P7GA 4J80A 4J7KA 2CUGA 4FM2A 3ZRWB 3CXCU 4DR2O 4B3TB 1GN2A 4J41A 3B4SA 3AG4B 3JARB 3W7XA 3FB8C 4NXNO 2C2AA 2R9IA 3ASNB 3BPZA 3FAVB 3ICXA 3STZC 4CC6A 3B8MA 4PI2A 2YIBA 5CA1B 5KHJA 1VARA 1Q7YW 2AXTZ 1D5NA 3CRQA 2ADQB 3ABKC 4LFCO 2CTRA 4ZKIA 4DR5O 4B3MO 3E86A 3JCZA 3CRMA 3SGIA 4JI0O 4JI7B 4JI4O 1N4CA 4MS2A 4O4IB 1JCHA 2LW7A 5KMGB 4PV1B 3L70H 1OHHG 3DXRA 1Q8IA 2CTPA 3SYQA 1ZX3A 1Q82W 2EILC 1CP9A 3KCYA 4X64O 5KA6A 2YEVB 4K8XA 1CXZB 1V54B 1K7DA 3EXAA 1WLEA 1XMQO 4CH5A 1DTOA 1B06A 4X8AA 2NR5A 2RNBA 3SJAC 3ETQA 5IJ0A 2ZE8A 1IBLB 2YXYA 1K4CC 3GVMA 4JPRA 4DUYO 1XMOO 5DN6G 2QJ1A 2R9AA 1N0JA 2UXNA 3H1HH 1XEQA 3IFXA 3E89A 1JJ2U 4UCOA 2UUCB 2V7QG 1VQ7V 3N2KA 4P9PA 5DEDA 1R1BA 4Q6GA 1KU9A 2RQ6A 5EZYB 2EX3A 3RVZA 3JSLA 4H44B 2X0LA 4UB6Z 1NTKH 5LHGA 4I55B 2WPDG 4NR1A 1F51A 5B66Z 1K8AW 3FFQA 1KKDA 4JTCB 3FB7C 4UVCA 2UUBO 4WBNB 2H3OA 4WFAV 3OEEG 1RPOA 3CCUV 3JYCA 4ICGA 4LFAO 4HYOA 5EBLC 4I4TB 1VQ4V 1VQ6V 3ZRWA 3ABLC 1GM8A 4HBNA 3CSXA 1M57B 3CCSV 2EIMC 3OM3B 3JARA 2JS3A 4ZBMA 4NVPA 5LMUO 3FAVA 3LNMB 3CE2A 5CA1A 1K92A 2VQFB 1PNLA 5BY1A 3CXHF 4XDJA 4DR4B 2A0LA 2A06H 3QF7A 1S3JA 3B2EE 1KD1W 3AG4C 3JASB 1Y67A 2P6JA 1JOYA 3ASNC 4O4IA 3D8CA 4UUJC 2HEPA 3FB6C 5KMGA 2GTSA 2AGAA 5JH7B 2ZIOA 1FXHA 3UM7A 3M99B 4FVMA 4UV9A 4PA6A 3OMNB 2DYSB 2FYUH 3CCJV 1HWYA 1N0NA 2ITDC 1IDSA 1R3KC 4X65O 1XUQA 2ZXWB 3AK1A 2Y69B 1CEZA 1VF6A 3C3SA 5CN0A 4PDLA 1SESA 2PUSA 4I9QA 2JIZG 5GTIZ 3K5OA 2CTWA 5C93A 2EINC 1AJNA 2BTQB 1L8DA 3EHBB 4LF4O 4PELA 2ZNIA 1U96A 3VQVA 3P3PA 5IE9A 4UB8Z 5LGNA 4DR3B 1Z5WA 1G4YB 2DWEC 2RJZA 4JAAA 1WA8B 2CH7B 2VWKA 3EVKA 1VF6C 1K9MW 3RYIB 3QG5A 2YI8A 4GX2A 3RYFB 4RUEA 3RYHB 5EZYA 2ITCC 3LDCA 1HNXO 3E8GA 3CMAV 2G38A 2Q6AA 1XL6A 3ZBHA 3JD2A 4I55A 1XHXA 1HP8A 2M6YA 2F95B 5IJ9B 4J9ZB 2DYRC 3OW2U 3IC9A 1GTOA 4WBNA 1LR1A 1OCZB 2ODMA 4MVUA 1FXKB 3WB1A 4I4TA 1Z2GA 3L74H 1ROPA 5HFMA 3K0DA 1HR0B 2Q0OC 1DLBA 4BW9A 3ZX6A 4JZGA 4N21A 1JA8A 5CB4B 2IJJA 1XI1A 2Y4TA 3J7AU 1QLEB 1OCCC 4DV4B 5BMVA 1N36B 4OPAA 1HNZO 3UQ8A 1E1QG 3KKYA 3JASA 5B5EZ 1IX9A 3LDEA 5CMUA 5LMNO 3ZEDA 3B77A 1A32A 3SJCC 3CPWU 4PDRA 2WLLB 1WJZA 1H2GA 2ZM6O 4DV1B 4ZI7B 5JH7A 3TXSA 1GM7A 3TJTA 3P30A 4CS2A 2RDCA 3L75H 4BWAA 1SS3A 2V4DA 2FKXA 3BA9A 5EBWC 3K08A 1I94O 2X6CA 1AI5A 2UXCO 4FZ0A 4XDLA 1Q86W 4MVSA 2HHHO 3CCRV 1NS1A 3AK3A 1R73A 3E22B 2XAGA 4GYCB 1YDXA 1F4NA 3THOA 2BTQA 3AK2A 2DYSC 1IVSA 1PPJH 4CH3A 1SQVH 1WA8A 2CH7A 2Y69C 4DR7B 5JWPA 3K3WA 5LYJB 5C8YA 1UFIA 4KHPB 3H1KH 1P49A 4K3AA 4JI1O 4B3RO 2XAQA 1ORQC 4LF5B 4H37A 3K04A 4DV7B 3RYIA 4NTWA 3RYFA 3RYHA 1N34O 1BL8A 4MVQA 2ZE6A 2UUAO 4TOIA 2WLKA 3DC5A 3CHXA 4LNUA 4X1YB 4BAYA 5IYZB 4YHHO 3T1YB 1I7FA 1RSOB 3TK1A 1G1XB 2LW1A 2OIEA 1P7BA 2IU0A 5IJ9A 1YJ9V 5L3EA 5FLXN 2P90A 2XHBA 1OCRB 3IAYA 5LXTA 1FXKA 3CRAA 2YI9A 3ZRXA 4UCSA 4TWKA 5F2VO 2A3QA 3CCMV 2QM7A 4O2BB 4Z1VA 1Y6XA 1Q5OA 2XTAA 2WLHA 4G27B 5LBQA 1EN5A 2B1GA 1EN4A 4K0KB 5CB4A 5H9CA 2V1DA 1VQ5V 2LP7A 4DV2B 1I0HA 4LF6O 2YS8A 3SYPA 1FXKC 5BZBA 1MNGA 2L6LA 3EFFK 4JV5O 4R6ZA 2CE4A 2VQEO 4DRXB 2KB1A 2QWPB 4YY3B 2YXLA 3A2FA 3B8NA 4TV8B 2UU9B 2F4VO 1B6QA 4JI8B 4J42A 1EN6A 2WLLA 1XL4A 3ZRVA 1H2MA 1MABG 3RFRA 1L0NH 4X1KA 4AQYB 3JAWB 4ZI7A 1QLEC 4WCEV 2IBZH 1QR9A 2Q73A 3ZHTA 2PZSA 1VP7A 5IYDO 3UO3A 2JGDB 1KECA 2GBOA 3ZMTA 3T4DA 1HDJA 3MHSC 3GB7C 4RQEA 1YSCA 2IJHA 5BR8O 2HP8A 4X66B 3OD4A 2QM8A 3BCCH 4XBFA 1BQ0A 1N32O 3ZN0A 2ILMA 2HLDG 4OX9O 1MSDA 3SPGA 2DQ3A 3E22A 1K4DC 4DK1A 4ZHQB 1YF2A 4FLTA 4DUYB 4LF8B 5BXZA 5JJNB 2QWRB 4QE9A 1XMOB 3HKBB 1K97A 4ABMA 2QA4V 2EIMB 4WF9V 3OTOB 1YI2V 4O4HB 1SQGA 4YJ2B 2ZIMA 1KMIZ 2NNUA 2E5LO 2IW5A 2Q68A 2YICA 3N27A 3ASOB 4GKKB 2YUAA 2R72A 2PF4E 3RT3C 4LFBB 1V9PA 3E8FA 5IYZA 1S5HC 4FFBB 4PD4F 4X1YA 3X2QB 4UXNA 1RSOA 1AI7A 1XNQB 3K5MA 2ARHA 4UCVA 3K59A 4FMTA 3CCEV 1JQ0A 2UUBB 3CC2V 1NVPB 3OAAG 2QSAA 3KZIZ 3RWRD 2YIBD 1Z5VA 2YIAA 3S3XA 2D3OW 1SQFA 5DM6V 1XNRO 4UVBA 2FB5A 1M1KW 4O2BA 1I5XA 3E8HA 3BA8A 2HG5C 1KB9F 3CRCA 4AILC 2W6IG 3LSUA 1OCRC 2EBOA 4JI3O 2BTOA 4A5UB 3HPLC 2Q5ZA 4IIJB 2DQ0A 1TAEA 1K5SA 3ZMSA 4DRXA 1CPYA 1RM1B 4TV8A 2EINB 4MW3A 4JI5B 4DR1O 1VQMV 4W4LA 2LGQA 4MT8A 1M9NA 4FPPA 4LF9O 4B3SB 3JAWA 2IJKA 2HJFC 1YCIA 4JYAO 5LGUA 1HNWO 4Z2WA 3OT7A 1AR5A 4X9QA 4MTGA 1TUBA 1S76D 5LL6Y 2EULA 4WFBV 1IBMO 2JGDA 2HVJC 3APQA 1SRYA 4N23A 3TXQA 4JI6O 4DW0A 3CS5A 4X62B 3QVNA 5LOVB 1G8MA 4X65B 3RYCA 2GHYA 4X20A 3VQWA 4J11A 2DYRB 1V55B 2MW2B 2M7WA 5IWAO 2IH1C 4ZHQA 4B7KA 5CBFA 3ABUA 3CJHB 1R3LC 4R50A 3IC7A 4DV3B 3HKBA 4GT1A 1LUVA 3BABA 4LP8A 4DV6O 5H2FZ 4DV5B 4RAIA 1OV9A 1FJGO 1GO3F 1WN7A 4O4HA 1NR7A 4YJ2A 1Q81W 3A8TA 3VBBA 4DV0O 4LWSB 1SQBH 3CRRA 3HB3B 1OCCB 4TUYB 3WFVA 2N04A 1ZLZA 4FFBA 2PI4A 3W7WA 4X1IB 2YDEA 3DSQA 1I08A 5LP6B 3ZMZA 5B1BB 4R7CA 5E79Z 1K73W 2O57A 3CEIA 2Y48A 2QM4A 4UCTA 4HZ3A 4LBEC 2WA4A 3ASOC 2Q7GA 3PJSK 2HKOA 2N05A 5FNVB 1I5YA 1RFYA 1EZVH 4JYBA 5JVDB 2ZCEA 2JEUA 5BMVB 4R8CA 1YHQV 3X2QC 1EZJA 4JI7O 3CC7V 2HVKC 1SQQH 3K9SA 2ZQMA 2H8PC 3NXSA 1AI4A 2OIGA 4LF7B 3TCUA 1F7YA 4IIJA 4UVAA 5EIBC 2WLIB 4YIPA 1X59A 2Y0IA 3N2GA 4ZIBA 1FD9A 1PNKA 3E8BA 2JGUA 2XAHA 2XASA 1HNZB 3LUTB 5JJEB 4Z1MG 4TV9B 4JTAB 3E2EA 5K1XA 3BEHA 4KL1A 3C90A 2NLJC 4O4JA 1IBLO 4BIZA 1MMMA 2CTQA 1RM1C 1SQXH 3L72H 2Q7EA 1MA1A 5KX5A 2AHYA 4D7TA 1TGOA 1DF5A 2ZKOA 3VQXA 1NU1H 5LOVA 2UUCO 5LA6B 1KKCA 2QKSA 5C8YB 4NKGB 2UXCB 1NZ6A 4NXMB 1FAFA 1Q6IA 5EK0A 3FYEB 4ZOLB 2YC0A 5B3SB 1H2NA 1SA0B 4U7NA 1NTMH 3T1HO 1NH2B 1PD3A 2OCCB 3CJHA 3K06A 5GTHZ 2ADPA 4LNUB 2PGGA 2L35A 3W7TA 1N33B 1XILA 3L73H 3SDLA 1V55C 1GRJA 3TGUH 4B3RB 2JDIG 2GDSA 2UXDB 3O65A 4LWSA 2UXBO 1PKXA 2R9RB 4JGSA 5IY5B 5LXTB 3OGCC 3OFNG 3JATB 1N34B 3QNEA 3L9DA 4TUYA 1WPXA 4UFZA 2QWQB 1NBMG 4EEQA 1JX9A 2YIDA 4X1IA 3JD4A 4ASUG 2BOBC 1YEWA 5LP6A 1M5IA 2VQFO 4MTXA 4DR4O 3RVYA 5FNVA 5GONB 1IZ3A 5JVDA 1Y76B 2EZOA 4X88A 5J2TB 4JI2B 3JD1A 1QCEA 4U3JB 2GTAA 2VRZA 4QPKA 5LP6C 4I0XB 5B1BC 1N8RW 2ZE5A 3FYIB 3UCSC 1DF4A 2HFEC 4X1KB 4CZZA 1H2KA 4FM0A 2WLIA 1GH6A 1BSMA 1VF5B 3H1LH 4MVRA 1K33A 1FPOA 1SETA 3FKSG 4NTXA 3D3IA 3ABTA 1EBOA 3ZCCA 3H1JH 1DGSA 2MK3A 4TV9A 3SYCA 1ENVA 3QO8A 1WAZA 2EIJB 3OE7G 1FKAO 1AI6A 1QNMA 2Q0AA 2EJ7A 1YTFB 3C3TA 3HKDB 4CH6A 5EC1C 1UJWB 1BT8A 5EYPB 4YIOA 3TETA 1R3JC 2X7RB 1GN3A 4QPJA 3SJQC 2AZ0A 4CH4A 4FM1A 4JYCA 4DR3O 1K5QA 4IHJB 1M4UA 4GZRB 4E4EA 3U0ZA 4B08A 5FPRA 1PL4A 4DUZB 5LA6A 3OGIB 2XT9A 3JAMN 5KHIA 1N32B 2FMLA 5D5QA 1GAXA 4PA9A 3BAAA 2IJIA 3SJBC 4JTDB 4FIPC 4RO2A 4ZOLA 1FXVA 2HJDA 1QHTA 1WB7A 1SA0A 2QDOA 3A0BZ 4PJ0Z 1QBZA 1GKFA 2JEXA 5J9PC 4OPHA 1FFTB 1O9GA 1XBLA 2Q69A 4P30A 3M8AA 1JJOA 2OYQA 1H2LA 3KCXA 3WG7B 1Q6UA 5EC2C 5B3SC 1IBKB 1VQOV 1MSWD 4QNHB 3JATA 4DYLA 3D36A 4FFKA 2OCCC 2JRIA 2Z3YA 3F5TA 5KUMA 1HR0O 5CA3A 4DR2B 4FLVA 1BMFG 4AHCA 1M90W 5KHKA 3SPIA 3B09A 4FK5C 3ZHQA 4NXNB 1S5LZ 2QKCA 4GLXA 1VQ9V 4DV4O 5GONA 5IY5C 1RP3B 3D36C 4WFFA 1N36O 1ZSPA 4LFCB 1Y76A 4LH7A 5AG2A 5J2TA 1SKVA 1XOUA 1D2DA 3SPJA 2GSMB 4DR5B 4B3MB 5IYBO 4U3JA 4BR6A 1R6NA 3AG2B 5B1NA 4EKWA 2P22C 4I0XA 4JI0B 1K3EA 5HFLA 4JI4B 2GV9A 1SF9A 1QVFU 3STLC 4FLUA 2VS0A 2YSUB 4MVMA 3T4ZA 1JFFB 1H2SB 1IXMA 2LFSA 2CGNA 4EB6B 1TUBB 2CAZC 5GW7A 4X64B 4JZ2A 1F4MA 2DN9A 1WP8A 4TQDA 3OMAB 1S77D 4LC1A 4J9YB 5IYCO 1XMQB 1BZKA 3HKDA 1YTFD 2ETNA 3RYCB 5ITZB 4X20B 4JAUA 5EYPA 2H94A 2PI5A 2AW9A 3RN4A 4BW5A 4NTYA 4O4LB 1BCCH 2DW4A 1WNSA 1BQZA 4IHJA 3WU2Z 1L0LH 4JYYA 3ZMVA 2A79B 2EIJC 4DR7O 4KHPO 3BY6A 4XDKA 3BFRA 2RN9A 1VEWA 1BGYH 3H01A 3OMIB 4LF5O 1R6TA 1SQPH 3F5WC 3CP1A 1R3IC 4CBCA 1M56B 1XHZA 2R70A 1AP6A 5D5PA 1QR8A 2N74A 1YJWV 1SERA 1AB3A 3T1YO 2BSKB 4O2AA 5CBGA 1F23A 1TVKB 3T2MA 2QWNB 3AG7A 5L3GA 1LUWA 4GX0A 2Q9LA 3JALB 2LFRA 4J7JA 3A0RA 2E3CA 1BHAA 4DW1A 5CA0B 1VQPV 1H38A 4LFAB 3LNNA 2JVDA 2FTKA 1OJHA 4K8ZA 3CCLV 1SC5B 1R6KA 4K0KO 2F23A 2P67A 2ZDIA 4DXWA 3U11A 4DV2O 4WFEA 3L71H 4DR6O 5LMUB 3WG7C 4QIWF 3T1CA
chains in the Genus database with same CATH topology
2VWJA 1QQCA 4DV4B 3BHPA 3JSNA 5BMVA 3N2GB 1N36B 1NT2B 4DR6B 3UQ8A 4JI3B 1D5AA 3JASA 4LF7B 4IIJA 5EIBC 5JCOA 1J5EB 3ZEDA 3SJCC 3N2GA 3RGBA 1WPBA 4ZIBA 2JGUA 2F93B 1HNZB 4DV1B 4ZI7B 5JJEB 1T5EA 5JH7A 4TV9B 1JFFA 4DR1B 4O4JB 4EB6A 1FFXA 5K1PA 4CS2A 1X4TA 4LF9B 4BWAA 5K1XA 4KL1A 2V4DA 5JCOC 4FLXA 4O4JA 5KX5B 4JYAB 4PHZA 4TQFA 1HNWB 1B04A 3BA9A 5IJ0B 2Q7EA 1IBMB 5KX5A 5ITZA 4D7TA 5KHGA 1TGOA 3HKEA 2P5OA 4JI6B 3VQXA 5LOVA 5LA6B 3ZS8C 3E22B 4GYCB 3THOA 2BTQA 3N2KB 5C8YB 4O4LA 4CS4A 2UXCB 5JQGA 4LF4B 4NXMB 4ZOLB 4CH3A 4FLYA 5J2UB 4DR7B 5FPOA 1SA0B 5C8YA 5LYJB 5IWAB 4KHPB 2JS5A 1P49A 4GKJB 2F1MA 4LF5B 4DV7B 4LNUB 3RYIA 5J2UA 2PGGA 2F66C 4YJ3A 3CB2A 5LYJA 3RYFA 4DV6B 3RYHA 3T1HB 2PYJA 4I50B 4TOIA 2PYLA 1FJGB 1N33B 1HNXB 3MAQA 3CHXA 4B3RB 4LNUA 4X1YB 5IYZB 3T1YB 1I7FA 2UXDB 1Q3EA 1TVKA 4DV0B 5LXTB 1TA8A 3JATB 5IJ9A 1N34B 4FM2A 1Q43A 4TUYA 4UFZA 2XHBA 4EEQA 2KKWA 4B3TB 3JALA 3IAYA 4X1IA 5LXTA 3JARB 2YI9A 2UXBB 5CA0A 4UCSA 1YEWA 5LP6A 3VQYA 3BPZA 1M5IA 3ICXA 5EIBD 4CC6A 4PI2A 2YIBA 5CA1B 5KHJA 4O2BB 1Q5OA 3HKCB 5FNVA 5GONB 5JVDA 4K0KB 5CB4A 5J2TB 3BRCA 4DV2B 4JI2B 5KHHA 4U3JB 3SGIA 4JI7B 5LP6C 4O4IB 3WB0A 4LR3A 4DRXB 2PY5A 5KMGB 4YY3B 3K58A 2YXLA 3A2FA 4TV8B 2UU9B 4X1KB 1Q8IA 4FM0A 1M93A 3UT5B 4JI8B 5LMNB 3RFRA 3JAKB 3PN1A 4X1KA 4AQYB 3JAWB 4ZI7A 1DGSA 2ZM6B 4K8XA 4TV9A 4EFEA 2PZSA 4CH5A 2Q0AA 3HKDB 4CH6A 1O9HA 3SJAC 3ETQA 3SR2C 5EYPB 3U10A 5IJ0A 4X66B 1IBLB 4CH4A 4FM1A 1I94B 4CS3A 4IHJB 2QJ1A 1M4UA 2R9AA 3U0ZA 2HHHB 4B08A 5FPRA 4DUZB 5LA6A 4DK0A 4UCOA 3E22A 2UUCB 4DK1A 5KHIA 4ZHQB 1N32B 4FLTA 3N2KA 4DUYB 4LF8B 1JMKC 5D5QA 5JJNB 3BAAA 4Q6GA 3SJBC 1XMOB 1KU9A 3HKBB 4ZOLA 3K5NA 2RQ6A 1QHTA 1SA0A 3OTOB 5EZYB 2EX3A 3JSLA 4O4HB 1SQGA 4YJ2B 2ZIMA 4F6RB 1KMIZ 4JI1B 1ZAUA 1O9GA 2ZNJA 4I55B 4GKKB 3FFQA 2ZINA 2R72A 4LFBB 4I50A 1JJOA 2OYQA 1V9PA 2UUAB 5JJJB 5IYZA 4X1YA 4FFBB 4WBNB 1RSOA 4HNAB 1XNQB 4YHHB 3K5MA 1IBKB 4UCVA 4I4TB 3JATA 3K59A 2UUBB 4HBNA 3RWRD 3CSXA 4DR2B 4FLVA 3WB2A 2YIBD 1Z5VA 2YIAA 3JARA 4AHCA 1SQFA 4UCRA 5KHKA 4NVPA 4NXNB 5CA1A 4O2BA 2VQFB 4GLXA 3HKCA 3BA8A 5GONA 4DR4B 4AILC 4LFCB 4LH7A 5J2TA 3K5LA 3QF7A 1SKVA 2BTOA 4DR5B 3B2EE 4LF6B 3JASB 4B3MB 4U3JA 4IIJB 4UCUA 2P22C 4O4IA 4JI0B 4JV5B 1TAEA 4JI4B 2GV9A 2HEPA 4DRXA 5KMGA 2VQEB 4TV8A 3QTCA 4FLUA 4JI5B 5JH7B 4PI0A 3UT5A 2F4VB 1JFFB 2ZIOA 1H2SB 4EB6B 4FVMA 1FFXB 4B3SB 1TUBB 2CAZC 3JAKA 4X64B 3JAWA 2Q7HA 4TQDA 1G6UA 1TUBA 3K57A 1XMQB 1VF7A 3HKDA 3RYCB 5ITZB 4X20B 3HKEB 2PUSA 4I9QA 5EYPA 4X62B 3K5OA 5LOVB 5BR8B 4X65B 3RYCA 2BTQB 1L8DA 4D7SA 4X20A 4O4LB 2ZNIA 3VQWA 1WNSA 3VQVA 5JQGB 4IHJA 4DR3B 1S5JA 4OX9B 1Z5WA 4FLZA 4CC5A 2RJZA 2OWOA 1HW7A 3M7MX 2VWKA 4ZHQA 3OTFA 4DV3B 4FLWA 3HKBA 1XHZA 2R70A 3BABA 5D5PA 4O2AB 3RYIB 3QG5A 4YJ3B 2YI8A 4DV5B 3RYFB 1XQ8A 3RYHB 5EZYA 1WN7A 4O4HA 4YJ2A 4F6RA 4O2AA 2PTMA 2E5LB 4I55A 1XHXA 1TVKB 2IM9A 2F95B 5IJ9B 4TUYB 4WBNA 4FFBA 3JALB 4HNAA 4X1IB 2E3CA 3WB1A 4I4TA 3DSQA 5CA0B 4LFAB 5LP6B 4L8JA 3LNNA 2JVDA 2QM4A 4UCTA 4K8ZA 1HR0B 2Q7GA 4BW9A 5FNVB 4LH6A 3U11A 5JVDB 2ZCEA 5CB4B 1XNRB 1XI1A 5BMVB 5LMUB 4EFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NT2 B;  3SJB C;  3THO A;  3QF7 A;  1SKV A;  3QG5 A;  2CAZ C;  2JS5 A;  1X4T A;  3CSX A;  2P22 C;  3SJA C;  3SJC C;  2F66 C;  3B2E E;  3ZS8 C;  3ICX A; 
#chains in the Genus database with same CATH topology
 3CD6 V;  1J5E O;  5KAF Z;  3ZJZ A;  2P4V A;  1QVG U;  3BHP A;  3JSN A;  5FL7 G;  1FYJ A;  1TUE B;  3N2G B;  1MOF A;  2CGO A;  4YY3 O;  1ARO P;  2UU9 O;  1KC8 W;  1GN4 A;  1URF A;  3DGE A;  4JAV A;  2Z5U A;  4JI8 O;  3VOU A;  1OZ0 A;  2X6A A;  2ZDI C;  5TIS Z;  3ZHV A;  1ZTE A;  1WPB A;  3RGB A;  3J81 N;  3F7Y C;  2Q4P A;  4AQY O;  5E1A C;  2F93 B;  1T5E A;  1QLN A;  2X6B A;  1BHB A;  3K03 A;  1JFF A;  4D6T H;  1WB8 A;  4I5S A;  4O4J B;  4EB6 A;  1YXB A;  3O9O A;  1X4T A;  2E74 B;  1XRE A;  4HAM A;  4GUN A;  3AG2 C;  3K0G A;  4FLX A;  5KX5 B;  2W6J G;  1W0J G;  2E76 B;  4X66 O;  2QR4 A;  4TQF A;  2JK5 C;  2D2C B;  2WLM A;  2ZD9 A;  1GN6 A;  3ETE A;  4C7U A;  1GMG A;  3G71 V;  1EFR G;  2EJR A;  1L1F A;  5ITZ A;  5B1O A;  3IJ4 A;  3I56 V;  2JJ2 G;  3Q4H B;  3ZS8 C;  4JF3 A;  4LF8 O;  1J95 A;  5KA5 A;  4O4L A;  4CS4 A;  1YIT V;  4GKJ O;  2WLN A;  5B1A B;  1PM9 A;  4LF4 B;  2YXH A;  4GX5 A;  3OTO O;  3FB5 C;  2ATK C;  4FLY A;  4K35 A;  5FPO A;  5LHH A;  3W7S A;  5IT9 N;  2WWW A;  2JS5 A;  4P2Z A;  4NYK A;  5LGT A;  4IYH A;  1VIB A;  4W4K A;  1AJP A;  3OR7 C;  4OGQ B;  3JD0 A;  3JCU Z;  4GKK O;  1KUQ A;  3E83 A;  5J2U A;  2F66 C;  1AP5 A;  5LHI A;  4LFB O;  5A9G A;  4MTF A;  3T1H B;  4IT5 A;  3RBZ A;  4I50 B;  3G80 A;  4PA4 A;  1QU7 A;  1HNX B;  4B3T O;  4FZ1 A;  1XNQ O;  2BSK A;  1VQN V;  2W0F C;  1TVK A;  4I9W A;  1TA8 A;  1NQT A;  3SPC A;  1EM1 A;  1Q43 A;  1NR1 A;  4X89 A;  1AR4 A;  4GCZ A;  1M56 C;  2KKW A;  3JAL A;  4B7E A;  2A9H A;  1NI8 A;  1NVP D;  3CC4 V;  1AIL A;  2UXB B;  5CA0 A;  4H13 B;  3LSS A;  4L87 A;  3VQY A;  1FS0 G;  3CCV V;  3AEI A;  5EIB D;  2KQX A;  2P4K A;  2P06 A;  3SYO A;  3AG3 B;  4OXS A;  3HKC B;  3F7V C;  2QKA A;  3D3Q A;  1Y4M A;  1B3Q A;  2WSS G;  4GX1 A;  3BRC A;  1PL0 A;  3ZRS A;  2K1E A;  5KHH A;  1PP9 H;  3OEH G;  2ZR3 A;  4I7Z B;  3WB0 A;  4LR3 A;  2PY5 A;  2LGW A;  3J80 N;  2OTJ V;  3K58 A;  3NR7 A;  4JI5 O;  1KP3 A;  3LSQ A;  1M93 A;  3UT5 B;  3DTU B;  4B3S O;  4P9O A;  5LMN B;  1BS3 A;  3JAK B;  3IGA C;  3PN1 A;  4DO2 A;  4QE7 A;  3ZHS A;  2ZM6 B;  2KG7 B;  3KG2 A;  5H6R A;  4EFE A;  1H8E G;  2HR3 A;  2QTS A;  1YZB A;  2K9P A;  2AZ2 A;  2DOS A;  2YEV A;  2XAF A;  1P4R A;  4PA3 A;  2KSD A;  3SYA A;  5L3C A;  4J10 A;  1O9H A;  4QJF B;  4X62 O;  3ML0 A;  3SR2 C;  3FX7 A;  3U10 A;  1ZWI C;  1YIJ V;  1PNM A;  3ZN1 A;  5H5N A;  1I94 B;  2Q67 A;  3H9V A;  3OUF A;  4CS3 A;  2B1I A;  2OT5 A;  2HHH B;  1DK1 A;  4DK0 A;  3E35 A;  3Q4H A;  2A7W A;  3A0H Z;  1V54 C;  3OUS A;  1JMK C;  4DV3 O;  2QTO A;  3ZHR A;  1VMG A;  1U97 A;  4DV5 O;  3K5N A;  3CME V;  2OTL V;  4MSW C;  4F6R B;  1Q6H A;  2BOC C;  4JI1 B;  1ZAU A;  1E1R G;  2ZNJ A;  4BIO A;  2ZIN A;  1NJI W;  5B1A C;  4I50 A;  4U7O A;  4MW8 A;  2B9Z A;  2UUA B;  1OCO B;  5JJJ B;  4PDM A;  4HNA B;  3HR0 A;  1Y74 B;  4H33 A;  1VQK V;  2B5U A;  4YHH B;  2E75 B;  4U3F H;  1Q90 D;  2DMX A;  1SZX A;  3ZMU A;  1K34 A;  2W0X A;  3WB2 A;  2QE7 G;  1H8H G;  1KYO F;  2Q8V A;  4IYI A;  4UCR A;  2DE0 X;  3UO2 A;  3ETG A;  4LCU C;  4KFM A;  1E79 G;  1MG1 A;  3HKC A;  1WP7 A;  3MDS A;  3AG1 B;  3I5D A;  4RWU A;  1AR1 B;  3K5L A;  4KXR A;  2F43 G;  2DWD C;  4LF7 O;  1GM9 A;  4LF6 B;  4F4L A;  3JD3 A;  4UCU A;  4H0L B;  5KUK A;  3P32 A;  4JV5 B;  3P3N A;  2JJ1 G;  1M57 C;  1US6 A;  2VQE B;  1VQL V;  3AG3 C;  4AI8 A;  3QTC A;  3ZIA G;  2FL4 A;  4PI0 A;  5DEC A;  2BCC H;  4KP4 A;  3UT5 A;  2F4V B;  3CCQ V;  1ZL8 B;  1FFX B;  3BVO A;  3JAK A;  2OCH A;  2P7T C;  2Q7H A;  4UV8 A;  1BE3 H;  2KG7 A;  1UPG A;  1W59 A;  3G6B A;  5L3F A;  1G6U A;  3K57 A;  1RPR A;  3ABM B;  2Y4U A;  3QO5 A;  3HKE B;  3MD0 A;  3R65 A;  4G28 B;  3W7U A;  3H1I H;  1KBH A;  5BR8 B;  4D7S A;  4NXM O;  3K9A A;  5JQG B;  4WFH A;  1JR9 A;  2EIK B;  1PV0 A;  1S5J A;  4OX9 B;  3FD9 A;  4FLZ A;  4CC5 A;  2OWO A;  1HW7 A;  2LJ2 A;  3GWO A;  3M7M X;  4NB5 A;  1YVW A;  1THZ A;  3OTF A;  2WA3 A;  3G4S V;  1YJN V;  2GUZ B;  4MVO A;  5IDJ A;  1NH2 D;  1W0K G;  4FLW A;  2ZXW C;  4O2A B;  4YJ3 B;  4QGP A;  5L3D A;  1NKD A;  1XQ8 A;  1N33 O;  3RW0 A;  2ZR2 A;  4F6R A;  2UXD O;  2PTM A;  2UXX A;  2E5L B;  2IM9 A;  2QEX V;  3ABK B;  4RQF A;  2LQT A;  1S0V A;  3LDD A;  3SPH A;  4HNA A;  1Y74 A;  2ZT9 B;  3CWB H;  1AVM A;  1NTZ H;  4L8J A;  2XND G;  3OR6 C;  1JVM A;  2QWO B;  4TSF G;  1KP2 A;  4BIU A;  4G2K A;  1MZF A;  3ETD A;  4LH6 A;  1P84 F;  1ZUQ A;  4PA7 A;  4JI2 O;  1OCO C;  1XNR B;  2EIL B;  2BE3 A;  5H6Q A;  3B40 A;  2LO1 A;  1MZE A;  2CDY A;  3APO A;  1GK9 A;  3CX5 F;  1VF7 A;  4EFB A;  2VWJ A;  1QQC A;  2XAJ A;  3GWK C;  4MTO A;  1IXB A;  1NT2 B;  1OCZ C;  3QO7 A;  4DR6 B;  2WLJ A;  1LNQ A;  3G6E V;  4DV1 O;  5L3B A;  4JI3 B;  1D5A A;  3DXR B;  5CBH A;  5JCO A;  5KAI Z;  1J5E B;  4YXW G;  4F6E A;  2EZP A;  4IGG A;  3AG1 C;  3UKM A;  4JAS A;  1W2B U;  2Y0P A;  4DR1 B;  4Q20 A;  1ZL8 A;  1FFX A;  5K1P A;  2WAM A;  2QGN A;  5KLV H;  4LF9 B;  3ZHU A;  1S72 V;  3K79 A;  5JCO C;  4JYA B;  4PHZ A;  4IL6 Z;  1HNW B;  2XOK G;  1B04 A;  5IJ0 B;  1XDC A;  4TT3 G;  4WFG A;  3S3W A;  3CYO A;  1IBM B;  5KHG A;  3HKE A;  1VQ8 V;  2P5O A;  4DUZ O;  4JI6 B;  3MHH C;  2RMK B;  2ZE7 A;  1IUR A;  4RUF A;  3N2K B;  3G67 A;  1Y66 A;  5JQG A;  4J7Z A;  3I55 V;  3R66 A;  4DV7 O;  5A2Q N;  5J2U B;  3ABM C;  5IWA B;  1COW G;  2DJV A;  2IH3 C;  2XUM A;  2GUZ A;  4GKJ B;  3ABL B;  2F1M A;  2Z0A A;  4YJ3 A;  3CB2 A;  5LYJ A;  4PDV A;  4DV6 B;  2CK3 G;  2PYJ A;  2PYL A;  1FJG B;  2EIK C;  4MVZ A;  4FJC C;  3MAQ A;  5EBM C;  1IBK O;  2RCV A;  2AHZ A;  1KQS U;  2IU3 A;  1Q3E A;  2NN4 A;  1SZT A;  4DV0 B;  3DC6 A;  1JPX A;  1AJQ A;  4E2L A;  4KUM A;  1P7G A;  4J80 A;  4J7K A;  2CUG A;  4FM2 A;  3ZRW B;  3CXC U;  4DR2 O;  4B3T B;  1GN2 A;  4J41 A;  3B4S A;  3AG4 B;  3JAR B;  3W7X A;  3FB8 C;  4NXN O;  2C2A A;  2R9I A;  3ASN B;  3BPZ A;  3FAV B;  3ICX A;  3STZ C;  4CC6 A;  3B8M A;  4PI2 A;  2YIB A;  5CA1 B;  5KHJ A;  1VAR A;  1Q7Y W;  2AXT Z;  1D5N A;  3CRQ A;  2ADQ B;  3ABK C;  4LFC O;  2CTR A;  4ZKI A;  4DR5 O;  4B3M O;  3E86 A;  3JCZ A;  3CRM A;  3SGI A;  4JI0 O;  4JI7 B;  4JI4 O;  1N4C A;  4MS2 A;  4O4I B;  1JCH A;  2LW7 A;  5KMG B;  4PV1 B;  3L70 H;  1OHH G;  3DXR A;  1Q8I A;  2CTP A;  3SYQ A;  1ZX3 A;  1Q82 W;  2EIL C;  1CP9 A;  3KCY A;  4X64 O;  5KA6 A;  2YEV B;  4K8X A;  1CXZ B;  1V54 B;  1K7D A;  3EXA A;  1WLE A;  1XMQ O;  4CH5 A;  1DTO A;  1B06 A;  4X8A A;  2NR5 A;  2RNB A;  3SJA C;  3ETQ A;  5IJ0 A;  2ZE8 A;  1IBL B;  2YXY A;  1K4C C;  3GVM A;  4JPR A;  4DUY O;  1XMO O;  5DN6 G;  2QJ1 A;  2R9A A;  1N0J A;  2UXN A;  3H1H H;  1XEQ A;  3IFX A;  3E89 A;  1JJ2 U;  4UCO A;  2UUC B;  2V7Q G;  1VQ7 V;  3N2K A;  4P9P A;  5DED A;  1R1B A;  4Q6G A;  1KU9 A;  2RQ6 A;  5EZY B;  2EX3 A;  3RVZ A;  3JSL A;  4H44 B;  2X0L A;  4UB6 Z;  1NTK H;  5LHG A;  4I55 B;  2WPD G;  4NR1 A;  1F51 A;  5B66 Z;  1K8A W;  3FFQ A;  1KKD A;  4JTC B;  3FB7 C;  4UVC A;  2UUB O;  4WBN B;  2H3O A;  4WFA V;  3OEE G;  1RPO A;  3CCU V;  3JYC A;  4ICG A;  4LFA O;  4HYO A;  5EBL C;  4I4T B;  1VQ4 V;  1VQ6 V;  3ZRW A;  3ABL C;  1GM8 A;  4HBN A;  3CSX A;  1M57 B;  3CCS V;  2EIM C;  3OM3 B;  3JAR A;  2JS3 A;  4ZBM A;  4NVP A;  5LMU O;  3FAV A;  3LNM B;  3CE2 A;  5CA1 A;  1K92 A;  2VQF B;  1PNL A;  5BY1 A;  3CXH F;  4XDJ A;  4DR4 B;  2A0L A;  2A06 H;  3QF7 A;  1S3J A;  3B2E E;  1KD1 W;  3AG4 C;  3JAS B;  1Y67 A;  2P6J A;  1JOY A;  3ASN C;  4O4I A;  3D8C A;  4UUJ C;  2HEP A;  3FB6 C;  5KMG A;  2GTS A;  2AGA A;  5JH7 B;  2ZIO A;  1FXH A;  3UM7 A;  3M99 B;  4FVM A;  4UV9 A;  4PA6 A;  3OMN B;  2DYS B;  2FYU H;  3CCJ V;  1HWY A;  1N0N A;  2ITD C;  1IDS A;  1R3K C;  4X65 O;  1XUQ A;  2ZXW B;  3AK1 A;  2Y69 B;  1CEZ A;  1VF6 A;  3C3S A;  5CN0 A;  4PDL A;  1SES A;  2PUS A;  4I9Q A;  2JIZ G;  5GTI Z;  3K5O A;  2CTW A;  5C93 A;  2EIN C;  1AJN A;  2BTQ B;  1L8D A;  3EHB B;  4LF4 O;  4PEL A;  2ZNI A;  1U96 A;  3VQV A;  3P3P A;  5IE9 A;  4UB8 Z;  5LGN A;  4DR3 B;  1Z5W A;  1G4Y B;  2DWE C;  2RJZ A;  4JAA A;  1WA8 B;  2CH7 B;  2VWK A;  3EVK A;  1VF6 C;  1K9M W;  3RYI B;  3QG5 A;  2YI8 A;  4GX2 A;  3RYF B;  4RUE A;  3RYH B;  5EZY A;  2ITC C;  3LDC A;  1HNX O;  3E8G A;  3CMA V;  2G38 A;  2Q6A A;  1XL6 A;  3ZBH A;  3JD2 A;  4I55 A;  1XHX A;  1HP8 A;  2M6Y A;  2F95 B;  5IJ9 B;  4J9Z B;  2DYR C;  3OW2 U;  3IC9 A;  1GTO A;  4WBN A;  1LR1 A;  1OCZ B;  2ODM A;  4MVU A;  1FXK B;  3WB1 A;  4I4T A;  1Z2G A;  3L74 H;  1ROP A;  5HFM A;  3K0D A;  1HR0 B;  2Q0O C;  1DLB A;  4BW9 A;  3ZX6 A;  4JZG A;  4N21 A;  1JA8 A;  5CB4 B;  2IJJ A;  1XI1 A;  2Y4T A;  3J7A U;  1QLE B;  1OCC C;  4DV4 B;  5BMV A;  1N36 B;  4OPA A;  1HNZ O;  3UQ8 A;  1E1Q G;  3KKY A;  3JAS A;  5B5E Z;  1IX9 A;  3LDE A;  5CMU A;  5LMN O;  3ZED A;  3B77 A;  1A32 A;  3SJC C;  3CPW U;  4PDR A;  2WLL B;  1WJZ A;  1H2G A;  2ZM6 O;  4DV1 B;  4ZI7 B;  5JH7 A;  3TXS A;  1GM7 A;  3TJT A;  3P30 A;  4CS2 A;  2RDC A;  3L75 H;  4BWA A;  1SS3 A;  2V4D A;  2FKX A;  3BA9 A;  5EBW C;  3K08 A;  1I94 O;  2X6C A;  1AI5 A;  2UXC O;  4FZ0 A;  4XDL A;  1Q86 W;  4MVS A;  2HHH O;  3CCR V;  1NS1 A;  3AK3 A;  1R73 A;  3E22 B;  2XAG A;  4GYC B;  1YDX A;  1F4N A;  3THO A;  2BTQ A;  3AK2 A;  2DYS C;  1IVS A;  1PPJ H;  4CH3 A;  1SQV H;  1WA8 A;  2CH7 A;  2Y69 C;  4DR7 B;  5JWP A;  3K3W A;  5LYJ B;  5C8Y A;  1UFI A;  4KHP B;  3H1K H;  1P49 A;  4K3A A;  4JI1 O;  4B3R O;  2XAQ A;  1ORQ C;  4LF5 B;  4H37 A;  3K04 A;  4DV7 B;  3RYI A;  4NTW A;  3RYF A;  3RYH A;  1N34 O;  1BL8 A;  4MVQ A;  2ZE6 A;  2UUA O;  4TOI A;  2WLK A;  3DC5 A;  3CHX A;  4LNU A;  4X1Y B;  4BAY A;  5IYZ B;  4YHH O;  3T1Y B;  1I7F A;  1RSO B;  3TK1 A;  1G1X B;  2LW1 A;  2OIE A;  1P7B A;  2IU0 A;  5IJ9 A;  1YJ9 V;  5L3E A;  5FLX N;  2P90 A;  2XHB A;  1OCR B;  3IAY A;  5LXT A;  1FXK A;  3CRA A;  2YI9 A;  3ZRX A;  4UCS A;  4TWK A;  5F2V O;  2A3Q A;  3CCM V;  2QM7 A;  4O2B B;  4Z1V A;  1Y6X A;  1Q5O A;  2XTA A;  2WLH A;  4G27 B;  5LBQ A;  1EN5 A;  2B1G A;  1EN4 A;  4K0K B;  5CB4 A;  5H9C A;  2V1D A;  1VQ5 V;  2LP7 A;  4DV2 B;  1I0H A;  4LF6 O;  2YS8 A;  3SYP A;  1FXK C;  5BZB A;  1MNG A;  2L6L A;  3EFF K;  4JV5 O;  4R6Z A;  2CE4 A;  2VQE O;  4DRX B;  2KB1 A;  2QWP B;  4YY3 B;  2YXL A;  3A2F A;  3B8N A;  4TV8 B;  2UU9 B;  2F4V O;  1B6Q A;  4JI8 B;  4J42 A;  1EN6 A;  2WLL A;  1XL4 A;  3ZRV A;  1H2M A;  1MAB G;  3RFR A;  1L0N H;  4X1K A;  4AQY B;  3JAW B;  4ZI7 A;  1QLE C;  4WCE V;  2IBZ H;  1QR9 A;  2Q73 A;  3ZHT A;  2PZS A;  1VP7 A;  5IYD O;  3UO3 A;  2JGD B;  1KEC A;  2GBO A;  3ZMT A;  3T4D A;  1HDJ A;  3MHS C;  3GB7 C;  4RQE A;  1YSC A;  2IJH A;  5BR8 O;  2HP8 A;  4X66 B;  3OD4 A;  2QM8 A;  3BCC H;  4XBF A;  1BQ0 A;  1N32 O;  3ZN0 A;  2ILM A;  2HLD G;  4OX9 O;  1MSD A;  3SPG A;  2DQ3 A;  3E22 A;  1K4D C;  4DK1 A;  4ZHQ B;  1YF2 A;  4FLT A;  4DUY B;  4LF8 B;  5BXZ A;  5JJN B;  2QWR B;  4QE9 A;  1XMO B;  3HKB B;  1K97 A;  4ABM A;  2QA4 V;  2EIM B;  4WF9 V;  3OTO B;  1YI2 V;  4O4H B;  1SQG A;  4YJ2 B;  2ZIM A;  1KMI Z;  2NNU A;  2E5L O;  2IW5 A;  2Q68 A;  2YIC A;  3N27 A;  3ASO B;  4GKK B;  2YUA A;  2R72 A;  2PF4 E;  3RT3 C;  4LFB B;  1V9P A;  3E8F A;  5IYZ A;  1S5H C;  4FFB B;  4PD4 F;  4X1Y A;  3X2Q B;  4UXN A;  1RSO A;  1AI7 A;  1XNQ B;  3K5M A;  2ARH A;  4UCV A;  3K59 A;  4FMT A;  3CCE V;  1JQ0 A;  2UUB B;  3CC2 V;  1NVP B;  3OAA G;  2QSA A;  3KZI Z;  3RWR D;  2YIB D;  1Z5V A;  2YIA A;  3S3X A;  2D3O W;  1SQF A;  5DM6 V;  1XNR O;  4UVB A;  2FB5 A;  1M1K W;  4O2B A;  1I5X A;  3E8H A;  3BA8 A;  2HG5 C;  1KB9 F;  3CRC A;  4AIL C;  2W6I G;  3LSU A;  1OCR C;  2EBO A;  4JI3 O;  2BTO A;  4A5U B;  3HPL C;  2Q5Z A;  4IIJ B;  2DQ0 A;  1TAE A;  1K5S A;  3ZMS A;  4DRX A;  1CPY A;  1RM1 B;  4TV8 A;  2EIN B;  4MW3 A;  4JI5 B;  4DR1 O;  1VQM V;  4W4L A;  2LGQ A;  4MT8 A;  1M9N A;  4FPP A;  4LF9 O;  4B3S B;  3JAW A;  2IJK A;  2HJF C;  1YCI A;  4JYA O;  5LGU A;  1HNW O;  4Z2W A;  3OT7 A;  1AR5 A;  4X9Q A;  4MTG A;  1TUB A;  1S76 D;  5LL6 Y;  2EUL A;  4WFB V;  1IBM O;  2JGD A;  2HVJ C;  3APQ A;  1SRY A;  4N23 A;  3TXQ A;  4JI6 O;  4DW0 A;  3CS5 A;  4X62 B;  3QVN A;  5LOV B;  1G8M A;  4X65 B;  3RYC A;  2GHY A;  4X20 A;  3VQW A;  4J11 A;  2DYR B;  1V55 B;  2MW2 B;  2M7W A;  5IWA O;  2IH1 C;  4ZHQ A;  4B7K A;  5CBF A;  3ABU A;  3CJH B;  1R3L C;  4R50 A;  3IC7 A;  4DV3 B;  3HKB A;  4GT1 A;  1LUV A;  3BAB A;  4LP8 A;  4DV6 O;  5H2F Z;  4DV5 B;  4RAI A;  1OV9 A;  1FJG O;  1GO3 F;  1WN7 A;  4O4H A;  1NR7 A;  4YJ2 A;  1Q81 W;  3A8T A;  3VBB A;  4DV0 O;  4LWS B;  1SQB H;  3CRR A;  3HB3 B;  1OCC B;  4TUY B;  3WFV A;  2N04 A;  1ZLZ A;  4FFB A;  2PI4 A;  3W7W A;  4X1I B;  2YDE A;  3DSQ A;  1I08 A;  5LP6 B;  3ZMZ A;  5B1B B;  4R7C A;  5E79 Z;  1K73 W;  2O57 A;  3CEI A;  2Y48 A;  2QM4 A;  4UCT A;  4HZ3 A;  4LBE C;  2WA4 A;  3ASO C;  2Q7G A;  3PJS K;  2HKO A;  2N05 A;  5FNV B;  1I5Y A;  1RFY A;  1EZV H;  4JYB A;  5JVD B;  2ZCE A;  2JEU A;  5BMV B;  4R8C A;  1YHQ V;  3X2Q C;  1EZJ A;  4JI7 O;  3CC7 V;  2HVK C;  1SQQ H;  3K9S A;  2ZQM A;  2H8P C;  3NXS A;  1AI4 A;  2OIG A;  4LF7 B;  3TCU A;  1F7Y A;  4IIJ A;  4UVA A;  5EIB C;  2WLI B;  4YIP A;  1X59 A;  2Y0I A;  3N2G A;  4ZIB A;  1FD9 A;  1PNK A;  3E8B A;  2JGU A;  2XAH A;  2XAS A;  1HNZ B;  3LUT B;  5JJE B;  4Z1M G;  4TV9 B;  4JTA B;  3E2E A;  5K1X A;  3BEH A;  4KL1 A;  3C90 A;  2NLJ C;  4O4J A;  1IBL O;  4BIZ A;  1MMM A;  2CTQ A;  1RM1 C;  1SQX H;  3L72 H;  2Q7E A;  1MA1 A;  5KX5 A;  2AHY A;  4D7T A;  1TGO A;  1DF5 A;  2ZKO A;  3VQX A;  1NU1 H;  5LOV A;  2UUC O;  5LA6 B;  1KKC A;  2QKS A;  5C8Y B;  4NKG B;  2UXC B;  1NZ6 A;  4NXM B;  1FAF A;  1Q6I A;  5EK0 A;  3FYE B;  4ZOL B;  2YC0 A;  5B3S B;  1H2N A;  1SA0 B;  4U7N A;  1NTM H;  3T1H O;  1NH2 B;  1PD3 A;  2OCC B;  3CJH A;  3K06 A;  5GTH Z;  2ADP A;  4LNU B;  2PGG A;  2L35 A;  3W7T A;  1N33 B;  1XIL A;  3L73 H;  3SDL A;  1V55 C;  1GRJ A;  3TGU H;  4B3R B;  2JDI G;  2GDS A;  2UXD B;  3O65 A;  4LWS A;  2UXB O;  1PKX A;  2R9R B;  4JGS A;  5IY5 B;  5LXT B;  3OGC C;  3OFN G;  3JAT B;  1N34 B;  3QNE A;  3L9D A;  4TUY A;  1WPX A;  4UFZ A;  2QWQ B;  1NBM G;  4EEQ A;  1JX9 A;  2YID A;  4X1I A;  3JD4 A;  4ASU G;  2BOB C;  1YEW A;  5LP6 A;  1M5I A;  2VQF O;  4MTX A;  4DR4 O;  3RVY A;  5FNV A;  5GON B;  1IZ3 A;  5JVD A;  1Y76 B;  2EZO A;  4X88 A;  5J2T B;  4JI2 B;  3JD1 A;  1QCE A;  4U3J B;  2GTA A;  2VRZ A;  4QPK A;  5LP6 C;  4I0X B;  5B1B C;  1N8R W;  2ZE5 A;  3FYI B;  3UCS C;  1DF4 A;  2HFE C;  4X1K B;  4CZZ A;  1H2K A;  4FM0 A;  2WLI A;  1GH6 A;  1BSM A;  1VF5 B;  3H1L H;  4MVR A;  1K33 A;  1FPO A;  1SET A;  3FKS G;  4NTX A;  3D3I A;  3ABT A;  1EBO A;  3ZCC A;  3H1J H;  1DGS A;  2MK3 A;  4TV9 A;  3SYC A;  1ENV A;  3QO8 A;  1WAZ A;  2EIJ B;  3OE7 G;  1FKA O;  1AI6 A;  1QNM A;  2Q0A A;  2EJ7 A;  1YTF B;  3C3T A;  3HKD B;  4CH6 A;  5EC1 C;  1UJW B;  1BT8 A;  5EYP B;  4YIO A;  3TET A;  1R3J C;  2X7R B;  1GN3 A;  4QPJ A;  3SJQ C;  2AZ0 A;  4CH4 A;  4FM1 A;  4JYC A;  4DR3 O;  1K5Q A;  4IHJ B;  1M4U A;  4GZR B;  4E4E A;  3U0Z A;  4B08 A;  5FPR A;  1PL4 A;  4DUZ B;  5LA6 A;  3OGI B;  2XT9 A;  3JAM N;  5KHI A;  1N32 B;  2FML A;  5D5Q A;  1GAX A;  4PA9 A;  3BAA A;  2IJI A;  3SJB C;  4JTD B;  4FIP C;  4RO2 A;  4ZOL A;  1FXV A;  2HJD A;  1QHT A;  1WB7 A;  1SA0 A;  2QDO A;  3A0B Z;  4PJ0 Z;  1QBZ A;  1GKF A;  2JEX A;  5J9P C;  4OPH A;  1FFT B;  1O9G A;  1XBL A;  2Q69 A;  4P30 A;  3M8A A;  1JJO A;  2OYQ A;  1H2L A;  3KCX A;  3WG7 B;  1Q6U A;  5EC2 C;  5B3S C;  1IBK B;  1VQO V;  1MSW D;  4QNH B;  3JAT A;  4DYL A;  3D36 A;  4FFK A;  2OCC C;  2JRI A;  2Z3Y A;  3F5T A;  5KUM A;  1HR0 O;  5CA3 A;  4DR2 B;  4FLV A;  1BMF G;  4AHC A;  1M90 W;  5KHK A;  3SPI A;  3B09 A;  4FK5 C;  3ZHQ A;  4NXN B;  1S5L Z;  2QKC A;  4GLX A;  1VQ9 V;  4DV4 O;  5GON A;  5IY5 C;  1RP3 B;  3D36 C;  4WFF A;  1N36 O;  1ZSP A;  4LFC B;  1Y76 A;  4LH7 A;  5AG2 A;  5J2T A;  1SKV A;  1XOU A;  1D2D A;  3SPJ A;  2GSM B;  4DR5 B;  4B3M B;  5IYB O;  4U3J A;  4BR6 A;  1R6N A;  3AG2 B;  5B1N A;  4EKW A;  2P22 C;  4I0X A;  4JI0 B;  1K3E A;  5HFL A;  4JI4 B;  2GV9 A;  1SF9 A;  1QVF U;  3STL C;  4FLU A;  2VS0 A;  2YSU B;  4MVM A;  3T4Z A;  1JFF B;  1H2S B;  1IXM A;  2LFS A;  2CGN A;  4EB6 B;  1TUB B;  2CAZ C;  5GW7 A;  4X64 B;  4JZ2 A;  1F4M A;  2DN9 A;  1WP8 A;  4TQD A;  3OMA B;  1S77 D;  4LC1 A;  4J9Y B;  5IYC O;  1XMQ B;  1BZK A;  3HKD A;  1YTF D;  2ETN A;  3RYC B;  5ITZ B;  4X20 B;  4JAU A;  5EYP A;  2H94 A;  2PI5 A;  2AW9 A;  3RN4 A;  4BW5 A;  4NTY A;  4O4L B;  1BCC H;  2DW4 A;  1WNS A;  1BQZ A;  4IHJ A;  3WU2 Z;  1L0L H;  4JYY A;  3ZMV A;  2A79 B;  2EIJ C;  4DR7 O;  4KHP O;  3BY6 A;  4XDK A;  3BFR A;  2RN9 A;  1VEW A;  1BGY H;  3H01 A;  3OMI B;  4LF5 O;  1R6T A;  1SQP H;  3F5W C;  3CP1 A;  1R3I C;  4CBC A;  1M56 B;  1XHZ A;  2R70 A;  1AP6 A;  5D5P A;  1QR8 A;  2N74 A;  1YJW V;  1SER A;  1AB3 A;  3T1Y O;  2BSK B;  4O2A A;  5CBG A;  1F23 A;  1TVK B;  3T2M A;  2QWN B;  3AG7 A;  5L3G A;  1LUW A;  4GX0 A;  2Q9L A;  3JAL B;  2LFR A;  4J7J A;  3A0R A;  2E3C A;  1BHA A;  4DW1 A;  5CA0 B;  1VQP V;  1H38 A;  4LFA B;  3LNN A;  2JVD A;  2FTK A;  1OJH A;  4K8Z A;  3CCL V;  1SC5 B;  1R6K A;  4K0K O;  2F23 A;  2P67 A;  2ZDI A;  4DXW A;  3U11 A;  4DV2 O;  4WFE A;  3L71 H;  4DR6 O;  5LMU B;  3WG7 C;  4QIW F;  3T1C A; 
#chains in the Genus database with same CATH homology
 2VWJ A;  1QQC A;  4DV4 B;  3BHP A;  3JSN A;  5BMV A;  3N2G B;  1N36 B;  1NT2 B;  4DR6 B;  3UQ8 A;  4JI3 B;  1D5A A;  3JAS A;  4LF7 B;  4IIJ A;  5EIB C;  5JCO A;  1J5E B;  3ZED A;  3SJC C;  3N2G A;  3RGB A;  1WPB A;  4ZIB A;  2JGU A;  2F93 B;  1HNZ B;  4DV1 B;  4ZI7 B;  5JJE B;  1T5E A;  5JH7 A;  4TV9 B;  1JFF A;  4DR1 B;  4O4J B;  4EB6 A;  1FFX A;  5K1P A;  4CS2 A;  1X4T A;  4LF9 B;  4BWA A;  5K1X A;  4KL1 A;  2V4D A;  5JCO C;  4FLX A;  4O4J A;  5KX5 B;  4JYA B;  4PHZ A;  4TQF A;  1HNW B;  1B04 A;  3BA9 A;  5IJ0 B;  2Q7E A;  1IBM B;  5KX5 A;  5ITZ A;  4D7T A;  5KHG A;  1TGO A;  3HKE A;  2P5O A;  4JI6 B;  3VQX A;  5LOV A;  5LA6 B;  3ZS8 C;  3E22 B;  4GYC B;  3THO A;  2BTQ A;  3N2K B;  5C8Y B;  4O4L A;  4CS4 A;  2UXC B;  5JQG A;  4LF4 B;  4NXM B;  4ZOL B;  4CH3 A;  4FLY A;  5J2U B;  4DR7 B;  5FPO A;  1SA0 B;  5C8Y A;  5LYJ B;  5IWA B;  4KHP B;  2JS5 A;  1P49 A;  4GKJ B;  2F1M A;  4LF5 B;  4DV7 B;  4LNU B;  3RYI A;  5J2U A;  2PGG A;  2F66 C;  4YJ3 A;  3CB2 A;  5LYJ A;  3RYF A;  4DV6 B;  3RYH A;  3T1H B;  2PYJ A;  4I50 B;  4TOI A;  2PYL A;  1FJG B;  1N33 B;  1HNX B;  3MAQ A;  3CHX A;  4B3R B;  4LNU A;  4X1Y B;  5IYZ B;  3T1Y B;  1I7F A;  2UXD B;  1Q3E A;  1TVK A;  4DV0 B;  5LXT B;  1TA8 A;  3JAT B;  5IJ9 A;  1N34 B;  4FM2 A;  1Q43 A;  4TUY A;  4UFZ A;  2XHB A;  4EEQ A;  2KKW A;  4B3T B;  3JAL A;  3IAY A;  4X1I A;  5LXT A;  3JAR B;  2YI9 A;  2UXB B;  5CA0 A;  4UCS A;  1YEW A;  5LP6 A;  3VQY A;  3BPZ A;  1M5I A;  3ICX A;  5EIB D;  4CC6 A;  4PI2 A;  2YIB A;  5CA1 B;  5KHJ A;  4O2B B;  1Q5O A;  3HKC B;  5FNV A;  5GON B;  5JVD A;  4K0K B;  5CB4 A;  5J2T B;  3BRC A;  4DV2 B;  4JI2 B;  5KHH A;  4U3J B;  3SGI A;  4JI7 B;  5LP6 C;  4O4I B;  3WB0 A;  4LR3 A;  4DRX B;  2PY5 A;  5KMG B;  4YY3 B;  3K58 A;  2YXL A;  3A2F A;  4TV8 B;  2UU9 B;  4X1K B;  1Q8I A;  4FM0 A;  1M93 A;  3UT5 B;  4JI8 B;  5LMN B;  3RFR A;  3JAK B;  3PN1 A;  4X1K A;  4AQY B;  3JAW B;  4ZI7 A;  1DGS A;  2ZM6 B;  4K8X A;  4TV9 A;  4EFE A;  2PZS A;  4CH5 A;  2Q0A A;  3HKD B;  4CH6 A;  1O9H A;  3SJA C;  3ETQ A;  3SR2 C;  5EYP B;  3U10 A;  5IJ0 A;  4X66 B;  1IBL B;  4CH4 A;  4FM1 A;  1I94 B;  4CS3 A;  4IHJ B;  2QJ1 A;  1M4U A;  2R9A A;  3U0Z A;  2HHH B;  4B08 A;  5FPR A;  4DUZ B;  5LA6 A;  4DK0 A;  4UCO A;  3E22 A;  2UUC B;  4DK1 A;  5KHI A;  4ZHQ B;  1N32 B;  4FLT A;  3N2K A;  4DUY B;  4LF8 B;  1JMK C;  5D5Q A;  5JJN B;  3BAA A;  4Q6G A;  3SJB C;  1XMO B;  1KU9 A;  3HKB B;  4ZOL A;  3K5N A;  2RQ6 A;  1QHT A;  1SA0 A;  3OTO B;  5EZY B;  2EX3 A;  3JSL A;  4O4H B;  1SQG A;  4YJ2 B;  2ZIM A;  4F6R B;  1KMI Z;  4JI1 B;  1ZAU A;  1O9G A;  2ZNJ A;  4I55 B;  4GKK B;  3FFQ A;  2ZIN A;  2R72 A;  4LFB B;  4I50 A;  1JJO A;  2OYQ A;  1V9P A;  2UUA B;  5JJJ B;  5IYZ A;  4X1Y A;  4FFB B;  4WBN B;  1RSO A;  4HNA B;  1XNQ B;  4YHH B;  3K5M A;  1IBK B;  4UCV A;  4I4T B;  3JAT A;  3K59 A;  2UUB B;  4HBN A;  3RWR D;  3CSX A;  4DR2 B;  4FLV A;  3WB2 A;  2YIB D;  1Z5V A;  2YIA A;  3JAR A;  4AHC A;  1SQF A;  4UCR A;  5KHK A;  4NVP A;  4NXN B;  5CA1 A;  4O2B A;  2VQF B;  4GLX A;  3HKC A;  3BA8 A;  5GON A;  4DR4 B;  4AIL C;  4LFC B;  4LH7 A;  5J2T A;  3K5L A;  3QF7 A;  1SKV A;  2BTO A;  4DR5 B;  3B2E E;  4LF6 B;  3JAS B;  4B3M B;  4U3J A;  4IIJ B;  4UCU A;  2P22 C;  4O4I A;  4JI0 B;  4JV5 B;  1TAE A;  4JI4 B;  2GV9 A;  2HEP A;  4DRX A;  5KMG A;  2VQE B;  4TV8 A;  3QTC A;  4FLU A;  4JI5 B;  5JH7 B;  4PI0 A;  3UT5 A;  2F4V B;  1JFF B;  2ZIO A;  1H2S B;  4EB6 B;  4FVM A;  1FFX B;  4B3S B;  1TUB B;  2CAZ C;  3JAK A;  4X64 B;  3JAW A;  2Q7H A;  4TQD A;  1G6U A;  1TUB A;  3K57 A;  1XMQ B;  1VF7 A;  3HKD A;  3RYC B;  5ITZ B;  4X20 B;  3HKE B;  2PUS A;  4I9Q A;  5EYP A;  4X62 B;  3K5O A;  5LOV B;  5BR8 B;  4X65 B;  3RYC A;  2BTQ B;  1L8D A;  4D7S A;  4X20 A;  4O4L B;  2ZNI A;  3VQW A;  1WNS A;  3VQV A;  5JQG B;  4IHJ A;  4DR3 B;  1S5J A;  4OX9 B;  1Z5W A;  4FLZ A;  4CC5 A;  2RJZ A;  2OWO A;  1HW7 A;  3M7M X;  2VWK A;  4ZHQ A;  3OTF A;  4DV3 B;  4FLW A;  3HKB A;  1XHZ A;  2R70 A;  3BAB A;  5D5P A;  4O2A B;  3RYI B;  3QG5 A;  4YJ3 B;  2YI8 A;  4DV5 B;  3RYF B;  1XQ8 A;  3RYH B;  5EZY A;  1WN7 A;  4O4H A;  4YJ2 A;  4F6R A;  4O2A A;  2PTM A;  2E5L B;  4I55 A;  1XHX A;  1TVK B;  2IM9 A;  2F95 B;  5IJ9 B;  4TUY B;  4WBN A;  4FFB A;  3JAL B;  4HNA A;  4X1I B;  2E3C A;  3WB1 A;  4I4T A;  3DSQ A;  5CA0 B;  4LFA B;  5LP6 B;  4L8J A;  3LNN A;  2JVD A;  2QM4 A;  4UCT A;  4K8Z A;  1HR0 B;  2Q7G A;  4BW9 A;  5FNV B;  4LH6 A;  3U11 A;  5JVD B;  2ZCE A;  5CB4 B;  1XNR B;  1XI1 A;  5BMV B;  5LMU B;  4EFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...