2F66C

Structure of the escrt-i endosomal trafficking complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
65
structure length
65
Chain Sequence
SKKYGDIALKKKLEQNTKKLDEESSQLETTTRSIDSADDLDQFIKNYLDIRTQYHLRREKLATWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional organization of the ESCRT-I trafficking complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
molecule keywords Suppressor protein STP22 of temperature-sensitive alpha-fact
total genus 27
structure length 65
sequence length 65
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2f66C00
3THOA 2F66C 3QF7A 3CSXA 2JS5A 3B2EE 1SKVA 1NT2B 2P22C 3SJAC 3SJCC 3QG5A 3ZS8C 1X4TA 3ICXA 3SJBC 2CAZC
chains in the Genus database with same CATH superfamily
4I7ZB 3TXSA 1JMKC 4R6ZA 1WB7A 1Z5VA 2UXNA 4LF4O 4JI4B 4UV8A 4LFAB 2PI5A 1SA0B 1GAXA 1R6NA 1P49A 2P4KA 5FNVB 5DECA 2ILMA 4WFAV 2VQEB 3JSNA 4I50B 4DR7O 1GN2A 3JYCA 5GW7A 1RP3B 1M4UA 4O4IB 1ZX3A 2N74A 4LR3A 1YJWV 3H1LH 4GKKO 3I5DA 2E75B 2KG7A 3AG2C 5L3BA 3MAQA 4NKGB 1G4YB 2VQFB 3WG7B 2BTOA 4JI2O 4U3FH 1S3JA 4JAUA 1AR1B 3K06A 3HKCA 1S5HC 3OMNB 3CP1A 4RQEA 1S76D 4F4LA 3LDEA 4E4EA 2QKCA 1Q86W 2B1GA 4K0KO 4LWSB 5CA1A 3ZJZA 3RBZA 3VQWA 1NT2B 2R9AA 3ZRWB 3VQXA 1AB3A 2X7RB 4TSFG 5EYPA 4DR4O 3C90A 5EC2C 3ZHRA 1WLEA 4YY3O 1URFA 3K58A 2H3OA 4X88A 5EC1C 2CAZC 3ZRWA 1ROPA 2DE0X 4DV7B 4X1KA 2EIKB 3ICXA 5CB4A 2HVJC 3LDDA 2H94A 3WB0A 2ITCC 5IDJA 1SQPH 3M99B 4UVCA 1J5EO 2H8PC 3BPZA 4FM2A 2OIGA 1BCCH 4Q6GA 4DR6O 2BTQA 1OCZB 2ZM6B 3JASB 3MD0A 5GONB 1N0NA 3DTUB 2EULA 1NKDA 3J81N 4F6RA 3CCSV 4X65B 3FKSG 1BHBA 3T1HB 2ZXWC 3SPJA 3I55V 3CS5A 5H9CA 1FD9A 3ZRSA 3CYOA 2LGWA 3DC5A 4G28B 4JF3A 1KB9F 5BXZA 3A0BZ 4TQFA 3CB2A 2QE7G 1SETA 2P6JA 1TGOA 3A8TA 2D3OW 3JAKA 1R3JC 5GONA 2ZR3A 3JALB 2BTQB 5KAIZ 1V55C 3JASA 3SPCA 3FYIB 1M90W 4LF5B 1R6TA 2FB5A 1TUBB 2OCCC 4YJ3B 3LUTB 1LUWA 4O4LA 3UM7A 2XAGA 1KP2A 1Y74A 3JARB 4X62O 1IBMB 2AZ0A 1I7FA 4DYLA 4NVPA 5IJ0A 5B66Z 1WP7A 5BMVB 3CEIA 3CCJV 3JARA 3CC4V 2DYRB 2UUAO 2CH7A 2L6LA 4JZ2A 5B1AB 4EKWA 3JAWB 2YXLA 3N2GA 4G2KA 1R6KA 3AK3A 4DV5B 5LMNB 5KHJA 2XAHA 4X20A 3U10A 1EZVH 1SQGA 5JVDA 2A7WA 3G4SV 2QM7A 1QNMA 2HHHB 3OR6C 3JD0A 4DV2B 2D2CB 4X66B 3AG4B 2VWKA 2M6YA 1BE3H 1XILA 2RN9A 2CTWA 4X64O 2ARHA 1VQ5V 3BEHA 4N21A 1XOUA 5LOVA 1NU1H 2ZM6O 2LFSA 1M57B 1M56C 1I08A 3GWOA 4J7ZA 1K5QA 3LSSA 1F23A 1HNXO 3CC7V 2LP7A 1DLBA 2PY5A 4PDLA 2E76B 1Q8IA 3X2QC 4RWUA 4PDRA 2VQFO 3DXRB 1S72V 1I94B 4YY3B 5KHGA 1EFRG 3OTOO 1KECA 4G27B 1QR8A 4DV6B 3OEEG 3N27A 3D3IA 1HNZO 1VQ8V 2XNDG 4IGGA 4H13B 4CC6A 1PNMA 1KP3A 4W4LA 5B3SB 2CH7B 2XAFA 5IJ9A 1AJQA 2DYSC 2OTLV 2E5LB 1KKDA 4JI0O 4P9PA 2LGQA 3AG3B 4JTCB 2IJJA 1KQSU 1SERA 3D36A 1HNZB 5H5NA 3ZIAG 4X1IA 1GTOA 2UXBB 2ZNIA 2KKWA 3QG5A 1KKCA 3P32A 4CBCA 3B4SA 3SR2C 2PTMA 2WWWA 4JYBA 3T2MA 3E8FA 5AG2A 4MTGA 1VQKV 1AVMA 1V55B 1Q6UA 3SYOA 3BHPA 3ML0A 4LFBB 2CGOA 4LF7O 1WA8B 4I50A 1VIBA 1ZL8B 5KX5A 1SQQH 4O2BA 3CPWU 4JI1O 3K5MA 1US6A 4JI3O 3EHBB 3SJBC 2E5LO 2ZCEA 4LNUA 3W7SA 4DR2B 2DMXA 2GSMB 4PA9A 1JX9A 4IYIA 2QWQB 1ZWIC 3UO2A 5JJNB 1O9HA 2VRZA 2HFEC 3THOA 2UUBB 1F7YA 2Q0AA 5CMUA 3K79A 5KUKA 2UU9O 1SESA 2WLIB 1B3QA 3BA8A 4TWKA 1JCHA 4LF6B 3BY6A 1TVKA 2DQ0A 2IJIA 3QO8A 4PELA 4LBEC 1ZL8A 3OM3B 4I5SA 1QR9A 1HW7A 1AR5A 5H2FZ 1NJIW 1BZKA 1BT8A 2Y69B 3C3SA 4TV8B 2OCCB 3RYFB 4B3TB 4MVOA 4WCEV 3L73H 4NXMO 2X6BA 3CXCU 3OUSA 5LHIA 4UV9A 2QM4A 3ZCCA 1EM1A 2RCVA 4TT3G 1M93A 1Q82W 1KYOF 1XNRO 1QLEC 4NB5A 2X6CA 2YEVA 1B6QA 4GX5A 4LP8A 2A3QA 4MTFA 1YI2V 1N8RW 3CHXA 2F4VB 3U11A 3N2KA 2LFRA 1YJ9V 4MS2A 3G67A 2ZIMA 3AG2B 5FLXN 1VQ6V 2B9ZA 4J7KA 1ZUQA 2P67A 1XNRB 1EN4A 3SYQA 3K5OA 3SPGA 2Q73A 4UXNA 2IBZH 1GKFA 1HNWB 5LP6B 1RPRA 4NTYA 4JI8B 2G38A 5KMGA 4JI5B 1MZFA 1H8HG 2HLDG 3SDLA 2OTJV 2JDIG 1EN6A 2LW7A 2EJ7A 1QBZA 2BSKA 2AZ2A 2V7QG 1H8EG 3O9OA 3HR0A 2JEUA 1H2SB 1E79G 2XAJA 5IE9A 2GDSA 1VQNV 1YXBA 1P7BA 4DUZO 2EZPA 4X1YA 1N34O 2Q9LA 3ETQA 1PNLA 1Y4MA 1RSOB 3CC2V 2BE3A 5LXTA 4DR4B 4XDJA 1Z5WA 1DF5A 3APQA 2C2AA 1N32O 3HB3B 1K34A 4UFZA 1JFFA 2QWPB 1AI5A 2LO1A 4DV0B 4NYKA 2Y69C 4BWAA 3P30A 4DV6O 1R73A 3ZX6A 1U97A 1VF7A 3PJSK 4RUEA 2EINC 4B7KA 3KZIZ 2O57A 3AEIA 5IWAB 4LC1A 3L72H 4AQYB 1GN6A 1VQLV 4U7NA 4I55B 3STLC 4DR5B 1VQOV 4JZGA 1TVKB 4DW0A 5B1AC 1JA8A 3HKEA 3K03A 1N33B 2QTOA 3QO7A 4DR2O 4I9WA 1L0LH 2RMKB 3ABMC 3ZMZA 4OX9B 4JV5O 2ZIOA 1GRJA 4R50A 4UCOA 2JGUA 4X9QA 3OT7A 3RYIB 5KHKA 1R3LC 3LSUA 4WFEA 5JH7B 2FMLA 3AK2A 5BZBA 4K0KB 4IYHA 4EB6B 1GK9A 2ADQB 2Y48A 3FAVB 5H6RA 3SYPA 1FJGO 2QTSA 4H37A 4JI1B 3K57A 2YSUB 4B3MO 4I4TA 2ZKOA 4LFBO 2WLIA 5JCOA 4PV1B 2UUCB 5LHHA 3HKBB 2OYQA 5LMUB 4KHPO 1FFXB 1H2KA 1CXZB 2LJ2A 1AR4A 4MSWC 2KB1A 3RN4A 1JFFB 3EFFK 1K7DA 4FLZA 3ETDA 3EVKA 4JAAA 4GYCB 4QPJA 3ABLC 1J95A 3E22B 2HG5C 5IJ9B 3DSQA 3JD3A 3SYAA 3L9DA 4C7UA 3JATA 5IYDO 1XHXA 4DRXA 2IU0A 5BR8B 4YJ2B 4AHCA 1HNXB 5HFLA 1QLNA 5EZYA 4LH7A 2JRIA 4QNHB 2ZE7A 2N05A 4J10A 1RM1C 2BSKB 3JALA 4I4TB 3PN1A 4X1KB 4FLXA 5EIBC 1JVMA 3CX5F 4O4IA 3CRRA 4UCUA 3FB5C 4WBNA 1COWG 1W0KG 2UXDO 4BIOA 1SC5B 2JIZG 4ZHQB 4LCUC 2PI4A 5GTHZ 1KC8W 2F1MA 2EIKC 2Q68A 1YHQV 1Q6IA 4X1IB 2IH3C 2A0LA 4MVSA 4O2BB 2F4VO 1UFIA 1XDCA 3T1YO 4PA7A 1NTKH 2JJ2G 5EBWC 5IY5C 1NTMH 2WLHA 4A5UB 5CBFA 3R66A 5KHHA 4JI3B 4FMTA 1NR7A 3CRCA 4X1YB 5F2VO 1AI4A 4YJ3A 4JYAB 4TUYB 4CH4A 4DV3B 5B1BC 1Y67A 1VQ7V 1OCOB 1WN7A 1WPXA 3GB7C 4Z2WA 4WFBV 4XBFA 2F66C 5C8YB 4P2ZA 1VF6C 3W7TA 5LXTB 4UCVA 2ZQMA 1K73W 2E3CA 3OW2U 1BQZA 3L70H 1NTZH 5GTIZ 2RJZA 3JD2A 4DV4O 3UQ8A 2AHZA 1SRYA 2VS0A 2NR5A 2Z3YA 3ZRXA 3IC7A 4ZHQA 3F5TA 1VARA 3KG2A 4TOIA 3H01A 3Q4HB 4X20B 4GKKB 5IYZB 4JAVA 1XMQO 3ASNC 2BOCC 2GTAA 1H2MA 4LNUB 3G6EV 4I0XB 4JTDB 3QO5A 5IY5B 2F93B 2QKAA 3CRAA 4JI7B 2IW5A 3K9AA 4JI6O 3ZMTA 2F95B 1M57C 3KCXA 2XAQA 2CK3G 4DUZB 5FPOA 2YIBA 2ZR2A 1H38A 3OMAB 4P30A 5LGNA 5L3EA 1I5YA 4IL6Z 3QVNA 3BVOA 1R3IC 4BIZA 3RT3C 5IJ0B 2E74B 3OE7G 2ZE8A 4HNAB 1ENVA 1Q90D 1IX9A 2B1IA 5J2TB 4FM1A 4U3JB 4ZI7A 1WNSA 4GX1A 2Q69A 2QR4A 3J7AU 1SQXH 2BCCH 2OT5A 5IT9N 1B04A 1D5AA 3E35A 3E89A 3BAAA 4I0XA 1N32B 3T4DA 1YEWA 3R65A 4LF5O 4YHHB 2ZE5A 5BR8O 4DV7O 3ETEA 3BA9A 1FXKC 5EYPB 3T1CA 2V4DA 2FL4A 5K1XA 3D3QA 4O2AB 2EIMC 1R3KC 3MDSA 4MVMA 5KHIA 4HYOA 4K8XA 4UVAA 2W0FC 2FKXA 1M9NA 2IH1C 2DOSA 4BW9A 5L3CA 1YF2A 4KHPB 4HNAA 1AP6A 4JI0B 3WB2A 3RFRA 1ZSPA 2W6JG 2IJKA 1Q5OA 4X89A 3JAMN 2K9PA 3FD9A 4DV3O 1GM7A 4FIPC 4TQDA 1RFYA 1HR0O 2HJDA 1N4CA 3JAWA 2VQEO 2GV9A 2OWOA 4TV8A 3RYHB 3B09A 3UT5B 3AG4C 2WPDG 1M1KW 2ZXWB 3E83A 2JS5A 1AJPA 3MHSC 1JJ2U 3OMIB 3ZBHA 3CRQA 1NS1A 4YIOA 1RSOA 1WP8A 1YJNV 4LH6A 2L35A 1HWYA 2CGNA 4DR7B 1K92A 1BHAA 5B1BB 3G6BA 1P7GA 1FS0G 4LWSA 4DV2O 1L1FA 4BIUA 4KXRA 4CC5A 2ZINA 4GX2A 1BQ0A 2PYJA 1NBMG 1KBHA 5J2UA 3U0ZA 2QA4V 2PZSA 4DV5O 1DGSA 4YXWG 3I56V 1IZ3A 4DK1A 2DQ3A 1OV9A 2W0XA 1PV0A 1AILA 3FX7A 1IBKB 1S0VA 2AXTZ 1LR1A 2CTRA 2UU9B 2UXCB 4DRXB 2HEPA 1PPJH 5CA3A 4UCRA 1W2BU 5KX5B 1I0HA 1I94O 2Z0AA 3QNEA 4DR3O 4FLYA 1BS3A 4JI6B 4GKJB 2P22C 3KKYA 3BABA 1GH6A 2CUGA 4L87A 1E1QG 1IBKO 4NXNB 4QIWF 1IXMA 2DWEC 3A0RA 3NXSA 3W7WA 1QVGU 4KP4A 3D36C 2DYSB 1FFTB 3IGAC 1Y76B 4KL1A 3N2KB 2LW1A 4K8ZA 1SQFA 1LNQA 3LNNA 2P7TC 3BRCA 4LF7B 4DV4B 1GO3F 2M7WA 2JVDA 3RGBA 1WJZA 1CP9A 3FYEB 1F51A 2EIJC 2WAMA 3CMEV 4IT5A 2YDEA 3P3PA 4O4HB 1QLEB 4RO2A 5D5PA 1AP5A 5J9PC 2ZT9B 4QE7A 1YITV 1OCOC 3JATB 1G8MA 3CCUV 3H9VA 4DR5O 2W6IG 2UXBO 3FB7C 4O4HA 5JJJB 3H1IH 3L74H 4GUNA 1DK1A 2HHHO 3SPIA 5K1PA 2YEVB 2FTKA 2BOBC 1DF4A 1BMFG 2NN4A 4EFEA 4JGSA 4PDVA 2JS3A 4GX0A 3W7XA 4J42A 4PI0A 3VQVA 1YCIA 2Q7GA 4FVMA 4KUMA 5LHGA 1SA0A 3IC9A 1CPYA 5CA1B 2XT9A 4YJ2A 3K08A 5CB4B 1WAZA 5EK0A 3AG3C 3IJ4A 4JPRA 1W0JG 4DUYB 1SKVA 2DW4A 2K1EA 3NR7A 3K3WA 1K5SA 3UT5A 2NNUA 1GN4A 3C3TA 4NXMB 2DN9A 1GM9A 3ZHTA 2GHYA 3N2GB 1Q81W 2EJRA 3SGIA 5A9GA 2RDCA 3JCZA 3TXQA 1XHZA 4I55A 1KUQA 2AGAA 2QEXV 2YXHA 3CJHA 2ZDIA 4D7SA 4QJFB 5LL6Y 5IYCO 3K04A 1PNKA 3RVYA 5A2QN 4J9YB 1BSMA 5C93A 3DC6A 2WLNA 1U96A 5DN6G 3AG7A 4GKJO 5JCOC 3STZC 4JI2B 4CH5A 4B3SB 2WLKA 2XASA 1FXKA 4H33A 3RVZA 3HKBA 3B8NA 3ZMSA 3VQYA 4DUYO 2DJVA 4ZKIA 3CCVV 3WB1A 3A2FA 1OJHA 2JEXA 4AILC 3K5NA 3F5WC 3ETGA 3HKDA 4EEQA 2UUCO 4LFCB 1XNQB 1VP7A 1E1RG 1RPOA 2CTPA 1HR0B 1IBMO 4YIPA 4B3MB 1FKAO 2NLJC 3Q4HA 1JJOA 2EX3A 2WLLA 2IM9A 3EXAA 2HJFC 1NH2D 4QPKA 4ZOLA 5B3SC 2Z5UA 4MW3A 1SQVH 4WFHA 5JWPA 4FFKA 1FPOA 2Y4TA 2A06H 3RW0A 1PP9H 1V54B 4MVUA 5H6QA 1RM1B 1XMOB 4OXSA 1A32A 1UPGA 4DXWA 1K8AW 4OGQB 2RQ6A 1Y76A 3OEHG 4NTXA 3SPHA 3OAAG 3L71H 4PD4F 3QF7A 1K97A 3TGUH 2QWOB 3E8BA 1GN3A 4X65O 4BR6A 1Z2GA 1H2LA 4B3RB 5KMGB 2YIBD 1KD1W 2HVKC 1HNWO 4X64B 1Q3EA 5CA0A 3K9SA 2HR3A 4IHJB 2N04A 1TUEB 5B1NA 5EBLC 4IIJA 1IBLB 4J41A 4CH6A 1IXBA 4J80A 2ADPA 4DR3B 5LMNO 4TUYA 1TUBA 3DXRA 4FFBB 1N33O 3LNMB 4O2AA 5ITZB 5HFMA 1XMOO 1N0JA 2ODMA 1K4DC 3E2EA 1TA8A 3OTFA 4LF9O 4LF8O 2EIJB 2DYRC 3VBBA 2QDOA 4JYAO 4CS4A 3HKCB 3ZMUA 4BW5A 1K3EA 5LYJB 3ABMB 4DW1A 4JI7O 5CBGA 2UUAB 1Y66A 5E1AC 5LOVB 5JQGA 2UXDB 3ABLB 1G6UA 1MZEA 1MSDA 4H44B 4CS2A 1PM9A 4FJCC 4I9QA 2CE4A 4FLUA 4B7EA 1QU7A 4WFGA 3D8CA 5KA5A 4JYCA 3RYHA 2WSSG 1K4CC 2DWDC 2KQXA 4O4JA 4J11A 2PUSA 3ZS8C 4PA4A 1XL4A 1JQ0A 4FFBA 1P4RA 1VQPV 1NVPD 5LA6A 2AW9A 1YVWA 1FYJA 4NTWA 4WFFA 3OFNG 2YICA 4ICGA 5J2TA 2Q5ZA 4FPPA 1XBLA 4YHHO 2GTSA 3OR7C 1MG1A 5FPRA 1XREA 1GMGA 1XEQA 1QHTA 4B3TO 3CSXA 4XDLA 2ZD9A 2JGDA 3M7MX 4E2LA 4R8CA 3T4ZA 5FL7G 1FJGB 1S5JA 4ASUG 3ASOB 4ABMA 1L0NH 2PYLA 1VQ4V 1XUQA 4PHZA 1IVSA 3TCUA 2EBOA 2UXXA 1AI7A 3B40A 4HBNA 4W4KA 4L8JA 1D2DA 1P84F 5C8YA 3IAYA 1PL4A 3ZN1A 4AI8A 5LGTA 4HZ3A 4P9OA 3E8GA 3SJCC 4X66O 1K9MW 2A79B 1NH2B 3FFQA 3QTCA 2VWJA 2P90A 2MK3A 5CA0B 1M5IA 5L3DA 3ZEDA 4U7OA 3K5LA 5LYJA 4KFMA 3AG1C 5JVDB 1V9PA 3GWKC 3ZHSA 4UCTA 1XNQO 3JD4A 4LF8B 3CWBH 1Y74B 4LF4B 5FNVA 2XHBA 4PDMA 3M8AA 2IJHA 3AG1B 3O65A 4U3JA 2YI9A 1T5EA 2Y0IA 1CEZA 1JOYA 3ZN0A 3WG7C 3CCMV 2R9IA 2OIEA 5E79Z 3CCQV 4JASA 3F7YC 1R1BA 2FYUH 4CZZA 4O4JB 1NQTA 5L3GA 4WBNB 1Q7YW 1VQMV 2R9RB 1Y6XA 4GT1A 4DV0O 4FLWA 3DGEA 1SS3A 1VF5B 4MW8A 1QCEA 4QGPA 5DM6V 2QJ1A 4MVRA 3TETA 4FK5C 4ZOLB 4UUJC 3WFVA 4K35A 4JI5O 3KCYA 3SJQC 1ZLZA 3JD1A 5EBMC 4LFAO 2X0LA 1YSCA 4FZ0A 2ITDC 1BGYH 1OCCC 4Z1VA 3OUFA 5JH7A 3ABTA 1HP8A 2YIDA 5BY1A 4F6EA 1KU9A 3ZHQA 2QSAA 3RWRD 5EZYB 5JQGB 2Q0OC 4FLTA 2JK5C 1MABG 2YS8A 3CRMA 5IWAO 1N36B 2WLLB 1OCRC 1I5XA 4FM0A 4PA3A 2QGNA 3JSLA 2R70A 2WA3A 3OGIB 1WB8A 1PKXA 4XDKA 1ORQC 3E86A 2XTAA 5IYZA 1EBOA 2WA4A 4LFCO 1SF9A 3K0GA 3CJHB 4DR6B 3L75H 4QE9A 1N36O 3ABUA 2ETNA 2YC0A 3TK1A 1JR9A 2IU3A 1XMQB 1O9GA 1EN5A 4LF9B 3UO3A 1Q6HA 4MT8A 3ZHUA 2Y4UA 4FLVA 4TV9A 2GUZA 3P3NA 1S5LZ 3ABKB 2PGGA 4NR1A 1OHHG 2F43G 4MTXA 1Q43A 2PF4E 3LSQA 1MA1A 3FB8C 2QWRB 3RYIA 3CE2A 4DV1B 2P5OA 1KMIZ 1NR1A 1YDXA 4OPHA 1VEWA 3WU2Z 2EINB 3B8MA 3S3WA 3CMAV 1H2NA 3CCRV 4MVQA 3A0HZ 4B3RO 1AROP 3F7VC 2Q8VA 3ASNB 4JTAB 1TAEA 4PJ0Z 1THZA 1MOFA 4F6RB 5LGUA 1LUVA 3OD4A 5IYBO 4LF6O 4DV1O 1PD3A 3H1JH 2EZOA 4FZ1A 1OCCB 1DTOA 3ZHVA 1MMMA 4H0LB 4OPAA 5LBQA 3OGCC 3SYCA 4TV9B 4OX9O 1VMGA 1YTFD 4ZIBA 1J5EB 2CDYA 3E8HA 3J80N 4IHJA 1FAFA 4JYYA 1FXVA 2X6AA 1XL6A 2EILC 4UVBA 3SJAC 1FXKB 4AQYO 3FB6C 4MVZA 1IBLO 4WF9V 3ASOC 5KA6A 5KLVH 3T1HO 1L8DA 1AJNA 1YIJV 1D5NA 2QWNB 3K59A 1V54C 3B2EE 1FFXA 1OZ0A 4DR1O 5LP6C 2WLMA 5L3FA 3UCSC 3RYFA 3CCLV 4JV5B 1M56B 2P06A 5EIBD 1AI6A 3E22A 1B06A 5KAFZ 4NXNO 4R7CA 1XI1A 3JCUZ 4DO2A 2Q67A 4B3SO 3HKDB 1N34B 3UKMA 2QKSA 2QM8A 4X8AA 2GUZB 4HAMA 3IFXA 2YIAA 3APOA 1VQ9V 2HKOA 2Q4PA 1HDJA 2MW2B 2XUMA 2KG7B 4ZBMA 3CCEV 2JJ1G 5LMUO 2R72A 3JAKB 4UB6Z 1JPXA 3HPLC 2EILB 2Q6AA 3G71V 4EB6A 4EFBA 2GBOA 3ABKC 2WLJA 1F4MA 3H1KH 4D7TA 2B5UA 1WPBA 4J9ZB 3CXHF 5LP6A 4DR1B 3B77A 2Q7HA 5KUMA 4D6TH 4BAYA 4B08A 3VOUA 2P4VA 2A9HA 1YZBA 1ZTEA 2RNBA 3H1HH 4UCSA 3LDCA 1S77D 1VF6A 1NZ6A 1WA8A 3X2QB 3ZRVA 5D5QA 1GM8A 5BMVA 1NVPB 2UUBO 2XOKG 1YTFB 1ZAUA 4CH3A 4N23A 1OCRB 4PA6A 2CTQA 2YUAA 5CBHA 2YI8A 1SQBH 3K0DA 3TJTA 2OCHA 1QQCA 4UB8Z 4GZRB 4JI8O 4DK0A 1XQ8A 2AHYA 1BL8A 4IIJB 4Z1MG 2Y0PA 5JJEB 4X62B 2EIMB 5B1OA 3MHHC 2Q7EA 4GLXA 3T1YB 2ZNJA 3GVMA 3RYCA 1EZJA 4J7JA 1IURA 4GCZA 1FXHA 4O4LB 4RQFA 3HKEB 2JGDB 1G1XB 1H2GA 1MNGA 1SZXA 3RYCB 2F23A 4RUFA 2LQTA 1SZTA 2KSDA 3FAVA 5J2UB 1MSWD 1W59A 1OCZC 1F4NA 3BFRA 3G80A 5DEDA 4MTOA 5ITZA 5B5EZ 4K3AA 2ZE6A 2YXYA 1X4TA 3ZMVA 3AK1A 1NI8A 4CS3A 1K33A 3BCCH 1UJWB 4ZI7B 5TISZ 1IDSA 1QVFU 5CN0A 3CD6V 2ZDIC 4RAIA 1X59A 2ATKC 5LA6B 2V1DA 2HP8A 4JI4O 2UXCO 3OTOB 4Q20A 3S3XA 1PL0A 3W7UA 4PI2A
chains in the Genus database with same CATH topology
3IAYA 2F4VB 3CHXA 1RSOA 4LH6A 3U11A 3N2KA 1JMKC 1Z5VA 2ZIMA 4DR7B 4JI4B 4LFAB 3SJCC 1SA0B 1XNRB 1P49A 5FNVB 3K5OA 3FFQA 3QTCA 4CC5A 2VWJA 2ZINA 1HNWB 5LP6B 5CA0B 1M5IA 2PYJA 2VQEB 3ZEDA 3K5LA 5LYJA 4JI8B 3JSNA 4I50B 5J2UA 3U0ZA 5KMGA 5JVDB 4JI5B 1V9PA 2PZSA 1M4UA 4O4IB 1DGSA 4UCTA 4LR3A 4LF8B 4LF4B 5FNVA 4DK1A 2XHBA 1H2SB 3MAQA 4U3JA 1IBKB 2YI9A 1T5EA 2UU9B 2VQFB 2UXCB 2BTOA 4DRXB 4X1YA 2HEPA 3ETQA 4UCRA 5KX5B 4O4JB 3HKCA 4FLYA 5LXTA 4DR4B 4WBNB 4JI6B 4GKJB 2P22C 3BABA 1Z5WA 4NXNB 4FLWA 4UFZA 1JFFA 2QJ1A 4DV0B 4ZOLB 4BWAA 5CA1A 3VQWA 1NT2B 4KL1A 3N2KB 4K8ZA 1SQFA 2R9AA 3VQXA 1VF7A 3LNNA 5EYPA 3BRCA 4LF7B 4DV4B 5IWAB 4AQYB 2JVDA 3RGBA 3K58A 5JH7A 2CAZC 4I55B 4DR5B 1TVKB 4DV7B 4X1KA 4O4HB 3HKEA 5D5PA 3ICXA 1KU9A 5CB4A 1N33B 3WB0A 3RWRD 5EZYB 5JQGB 3BPZA 4FM2A 4OX9B 4FLTA 2ZIOA 3JATB 1N36B 4Q6GA 2BTQA 2ZM6B 3JASB 5GONB 4FM0A 4UCOA 4O4HA 3JSLA 2R70A 2JGUA 5JJJB 3RYIB 5KHKA 5JH7B 5K1PA 4K0KB 4EB6B 5IYZA 4EFEA 4JI1B 3K57A 4I4TA 4F6RA 4DR6B 4X65B 4PI0A 3VQVA 3T1HB 2Q7GA 5JCOA 1XMQB 4FVMA 1O9GA 4LF9B 2UUCB 1SA0A 3HKBB 5CA1B 2OYQA 5LMUB 1FFXB 4YJ2A 4FLVA 5CB4B 4TV9A 2PGGA 4TQFA 3CB2A 1JFFB 1Q43A 4FLZA 4DUYB 1SKVA 1TGOA 4GYCB 3UT5A 3E22B 3RYIA 3JAKA 5IJ9B 3DSQA 4DV1B 1KMIZ 2P5OA 4NXMB 5GONA 3JATA 3JALB 1XHXA 2BTQB 4DRXA 3JASA 5BR8B 3N2GB 4YJ2B 4AHCA 4LF5B 1HNXB 5EZYA 3SGIA 4LH7A 1TUBB 4YJ3B 1XHZA 4O4LA 4I55A 3JALA 3JARB 4I4TB 1TAEA 4F6RB 3PN1A 4X1KB 4FLXA 5EIBC 4D7SA 4O4IA 1IBMB 4UCUA 4WBNA 1I7FA 4NVPA 5IJ0A 5BMVB 5JCOC 4ZHQB 4TV9B 3JARA 4JI2B 4CH5A 4B3SB 4ZIBA 1J5EB 2F1MA 3JAWB 3HKBA 3VQYA 4IHJA 4X1IB 2YXLA 3WB1A 3N2GA 4O2BB 3A2FA 4DV5B 3SJAC 4AILC 3K5NA 5LMNB 3HKDA 5KHJA 4EEQA 4X20A 3U10A 1SQGA 4LFCB 1XNQB 5JVDA 2HHHB 1HR0B 1L8DA 4B3MB 5KHHA 4JI3B 3K59A 4DV2B 1JJOA 2EX3A 3B2EE 4X66B 2VWKA 2IM9A 4X1YB 1FFXA 4ZOLA 5LP6C 4YJ3A 4JYAB 4TUYB 4CH4A 4DV3B 5LOVA 1WN7A 3RYFA 4JV5B 2F66C 5EIBD 5C8YB 3E22A 2PY5A 5LXTB 1XI1A 4UCVA 1Q8IA 1XMOB 3HKDB 1N34B 2E3CA 1I94B 4YY3B 5KHGA 2RQ6A 2RJZA 3UQ8A 2YIAA 4DV6B 3QF7A 4CC6A 4ZHQA 4TOIA 2R72A 3JAKB 5IJ9A 2E5LB 4X20B 4GKKB 4EB6A 4EFBA 5IYZB 4B3RB 5KMGB 4D7TA 2YIBD 4LNUB 4X64B 1WPBA 1Q3EA 5LP6A 5CA0A 2F93B 4DR1B 1HNZB 2Q7HA 4JI7B 4IHJB 4X1IA 2UXBB 2ZNIA 4B08A 2KKWA 3QG5A 1IBLB 4IIJA 2F95B 4CH6A 4DR3B 4TUYA 1TUBA 4DUZB 4UCSA 5FPOA 3SR2C 4FFBB 2PTMA 4O2AA 2YIBA 5ITZB 5BMVA 5D5QA 1TA8A 3OTFA 4CH3A 1ZAUA 3BHPA 5IJ0B 3HKCB 4CS4A 4HNAB 4LFBB 5LYJB 4I50A 5KX5A 2YI8A 2UUAB 5J2TB 4O2BA 4FM1A 1QQCA 5LOVB 5JQGA 4U3JB 3K5MA 4ZI7A 4DK0A 1WNSA 2UXDB 1XQ8A 1G6UA 4CS2A 4IIJB 3SJBC 4I9QA 1B04A 2ZCEA 1D5AA 5JJEB 4LNUA 4X62B 4FLUA 3BAAA 1N32B 4DR2B 1YEWA 4YHHB 2Q7EA 4GLXA 3T1YB 3BA9A 5EYPB 3RYHA 2ZNJA 4O4JA 2V4DA 5K1XA 2PUSA 5JJNB 1O9HA 3ZS8C 3RYCA 4O2AB 2UUBB 3THOA 4FFBA 2Q0AA 4O4LB 5LA6A 5KHIA 4K8XA 3HKEB 3BA8A 4BW9A 5J2TA 4LF6B 3RYCB 1TVKA 4KHPB 4HNAA 5J2UB 4JI0B 3WB2A 3RFRA 5FPRA 1QHTA 1HW7A 1Q5OA 3CSXA 5ITZA 4TV8B 1X4TA 3RYFB 4B3TB 4CS3A 3M7MX 4TQDA 4ZI7B 3JAWA 1FJGB 2QM4A 1S5JA 2PYLA 2GV9A 2OWOA 4PHZA 5LA6B 4TV8A 1M93A 3RYHB 3OTOB 4HBNA 3UT5B 4L8JA 2JS5A 4PI2A 5C8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3THO A;  2F66 C;  3QF7 A;  3CSX A;  2JS5 A;  3B2E E;  1SKV A;  1NT2 B;  2P22 C;  3SJA C;  3SJC C;  3QG5 A;  3ZS8 C;  1X4T A;  3ICX A;  3SJB C;  2CAZ C; 
#chains in the Genus database with same CATH topology
 4I7Z B;  3TXS A;  1JMK C;  4R6Z A;  1WB7 A;  1Z5V A;  2UXN A;  4LF4 O;  4JI4 B;  4UV8 A;  4LFA B;  2PI5 A;  1SA0 B;  1GAX A;  1R6N A;  1P49 A;  2P4K A;  5FNV B;  5DEC A;  2ILM A;  4WFA V;  2VQE B;  3JSN A;  4I50 B;  4DR7 O;  1GN2 A;  3JYC A;  5GW7 A;  1RP3 B;  1M4U A;  4O4I B;  1ZX3 A;  2N74 A;  4LR3 A;  1YJW V;  3H1L H;  4GKK O;  3I5D A;  2E75 B;  2KG7 A;  3AG2 C;  5L3B A;  3MAQ A;  4NKG B;  1G4Y B;  2VQF B;  3WG7 B;  2BTO A;  4JI2 O;  4U3F H;  1S3J A;  4JAU A;  1AR1 B;  3K06 A;  3HKC A;  1S5H C;  3OMN B;  3CP1 A;  4RQE A;  1S76 D;  4F4L A;  3LDE A;  4E4E A;  2QKC A;  1Q86 W;  2B1G A;  4K0K O;  4LWS B;  5CA1 A;  3ZJZ A;  3RBZ A;  3VQW A;  1NT2 B;  2R9A A;  3ZRW B;  3VQX A;  1AB3 A;  2X7R B;  4TSF G;  5EYP A;  4DR4 O;  3C90 A;  5EC2 C;  3ZHR A;  1WLE A;  4YY3 O;  1URF A;  3K58 A;  2H3O A;  4X88 A;  5EC1 C;  2CAZ C;  3ZRW A;  1ROP A;  2DE0 X;  4DV7 B;  4X1K A;  2EIK B;  3ICX A;  5CB4 A;  2HVJ C;  3LDD A;  2H94 A;  3WB0 A;  2ITC C;  5IDJ A;  1SQP H;  3M99 B;  4UVC A;  1J5E O;  2H8P C;  3BPZ A;  4FM2 A;  2OIG A;  1BCC H;  4Q6G A;  4DR6 O;  2BTQ A;  1OCZ B;  2ZM6 B;  3JAS B;  3MD0 A;  5GON B;  1N0N A;  3DTU B;  2EUL A;  1NKD A;  3J81 N;  4F6R A;  3CCS V;  4X65 B;  3FKS G;  1BHB A;  3T1H B;  2ZXW C;  3SPJ A;  3I55 V;  3CS5 A;  5H9C A;  1FD9 A;  3ZRS A;  3CYO A;  2LGW A;  3DC5 A;  4G28 B;  4JF3 A;  1KB9 F;  5BXZ A;  3A0B Z;  4TQF A;  3CB2 A;  2QE7 G;  1SET A;  2P6J A;  1TGO A;  3A8T A;  2D3O W;  3JAK A;  1R3J C;  5GON A;  2ZR3 A;  3JAL B;  2BTQ B;  5KAI Z;  1V55 C;  3JAS A;  3SPC A;  3FYI B;  1M90 W;  4LF5 B;  1R6T A;  2FB5 A;  1TUB B;  2OCC C;  4YJ3 B;  3LUT B;  1LUW A;  4O4L A;  3UM7 A;  2XAG A;  1KP2 A;  1Y74 A;  3JAR B;  4X62 O;  1IBM B;  2AZ0 A;  1I7F A;  4DYL A;  4NVP A;  5IJ0 A;  5B66 Z;  1WP7 A;  5BMV B;  3CEI A;  3CCJ V;  3JAR A;  3CC4 V;  2DYR B;  2UUA O;  2CH7 A;  2L6L A;  4JZ2 A;  5B1A B;  4EKW A;  3JAW B;  2YXL A;  3N2G A;  4G2K A;  1R6K A;  3AK3 A;  4DV5 B;  5LMN B;  5KHJ A;  2XAH A;  4X20 A;  3U10 A;  1EZV H;  1SQG A;  5JVD A;  2A7W A;  3G4S V;  2QM7 A;  1QNM A;  2HHH B;  3OR6 C;  3JD0 A;  4DV2 B;  2D2C B;  4X66 B;  3AG4 B;  2VWK A;  2M6Y A;  1BE3 H;  1XIL A;  2RN9 A;  2CTW A;  4X64 O;  2ARH A;  1VQ5 V;  3BEH A;  4N21 A;  1XOU A;  5LOV A;  1NU1 H;  2ZM6 O;  2LFS A;  1M57 B;  1M56 C;  1I08 A;  3GWO A;  4J7Z A;  1K5Q A;  3LSS A;  1F23 A;  1HNX O;  3CC7 V;  2LP7 A;  1DLB A;  2PY5 A;  4PDL A;  2E76 B;  1Q8I A;  3X2Q C;  4RWU A;  4PDR A;  2VQF O;  3DXR B;  1S72 V;  1I94 B;  4YY3 B;  5KHG A;  1EFR G;  3OTO O;  1KEC A;  4G27 B;  1QR8 A;  4DV6 B;  3OEE G;  3N27 A;  3D3I A;  1HNZ O;  1VQ8 V;  2XND G;  4IGG A;  4H13 B;  4CC6 A;  1PNM A;  1KP3 A;  4W4L A;  5B3S B;  2CH7 B;  2XAF A;  5IJ9 A;  1AJQ A;  2DYS C;  2OTL V;  2E5L B;  1KKD A;  4JI0 O;  4P9P A;  2LGQ A;  3AG3 B;  4JTC B;  2IJJ A;  1KQS U;  1SER A;  3D36 A;  1HNZ B;  5H5N A;  3ZIA G;  4X1I A;  1GTO A;  2UXB B;  2ZNI A;  2KKW A;  3QG5 A;  1KKC A;  3P32 A;  4CBC A;  3B4S A;  3SR2 C;  2PTM A;  2WWW A;  4JYB A;  3T2M A;  3E8F A;  5AG2 A;  4MTG A;  1VQK V;  1AVM A;  1V55 B;  1Q6U A;  3SYO A;  3BHP A;  3ML0 A;  4LFB B;  2CGO A;  4LF7 O;  1WA8 B;  4I50 A;  1VIB A;  1ZL8 B;  5KX5 A;  1SQQ H;  4O2B A;  3CPW U;  4JI1 O;  3K5M A;  1US6 A;  4JI3 O;  3EHB B;  3SJB C;  2E5L O;  2ZCE A;  4LNU A;  3W7S A;  4DR2 B;  2DMX A;  2GSM B;  4PA9 A;  1JX9 A;  4IYI A;  2QWQ B;  1ZWI C;  3UO2 A;  5JJN B;  1O9H A;  2VRZ A;  2HFE C;  3THO A;  2UUB B;  1F7Y A;  2Q0A A;  5CMU A;  3K79 A;  5KUK A;  2UU9 O;  1SES A;  2WLI B;  1B3Q A;  3BA8 A;  4TWK A;  1JCH A;  4LF6 B;  3BY6 A;  1TVK A;  2DQ0 A;  2IJI A;  3QO8 A;  4PEL A;  4LBE C;  1ZL8 A;  3OM3 B;  4I5S A;  1QR9 A;  1HW7 A;  1AR5 A;  5H2F Z;  1NJI W;  1BZK A;  1BT8 A;  2Y69 B;  3C3S A;  4TV8 B;  2OCC B;  3RYF B;  4B3T B;  4MVO A;  4WCE V;  3L73 H;  4NXM O;  2X6B A;  3CXC U;  3OUS A;  5LHI A;  4UV9 A;  2QM4 A;  3ZCC A;  1EM1 A;  2RCV A;  4TT3 G;  1M93 A;  1Q82 W;  1KYO F;  1XNR O;  1QLE C;  4NB5 A;  2X6C A;  2YEV A;  1B6Q A;  4GX5 A;  4LP8 A;  2A3Q A;  4MTF A;  1YI2 V;  1N8R W;  3CHX A;  2F4V B;  3U11 A;  3N2K A;  2LFR A;  1YJ9 V;  4MS2 A;  3G67 A;  2ZIM A;  3AG2 B;  5FLX N;  1VQ6 V;  2B9Z A;  4J7K A;  1ZUQ A;  2P67 A;  1XNR B;  1EN4 A;  3SYQ A;  3K5O A;  3SPG A;  2Q73 A;  4UXN A;  2IBZ H;  1GKF A;  1HNW B;  5LP6 B;  1RPR A;  4NTY A;  4JI8 B;  2G38 A;  5KMG A;  4JI5 B;  1MZF A;  1H8H G;  2HLD G;  3SDL A;  2OTJ V;  2JDI G;  1EN6 A;  2LW7 A;  2EJ7 A;  1QBZ A;  2BSK A;  2AZ2 A;  2V7Q G;  1H8E G;  3O9O A;  3HR0 A;  2JEU A;  1H2S B;  1E79 G;  2XAJ A;  5IE9 A;  2GDS A;  1VQN V;  1YXB A;  1P7B A;  4DUZ O;  2EZP A;  4X1Y A;  1N34 O;  2Q9L A;  3ETQ A;  1PNL A;  1Y4M A;  1RSO B;  3CC2 V;  2BE3 A;  5LXT A;  4DR4 B;  4XDJ A;  1Z5W A;  1DF5 A;  3APQ A;  2C2A A;  1N32 O;  3HB3 B;  1K34 A;  4UFZ A;  1JFF A;  2QWP B;  1AI5 A;  2LO1 A;  4DV0 B;  4NYK A;  2Y69 C;  4BWA A;  3P30 A;  4DV6 O;  1R73 A;  3ZX6 A;  1U97 A;  1VF7 A;  3PJS K;  4RUE A;  2EIN C;  4B7K A;  3KZI Z;  2O57 A;  3AEI A;  5IWA B;  4LC1 A;  3L72 H;  4AQY B;  1GN6 A;  1VQL V;  4U7N A;  4I55 B;  3STL C;  4DR5 B;  1VQO V;  4JZG A;  1TVK B;  4DW0 A;  5B1A C;  1JA8 A;  3HKE A;  3K03 A;  1N33 B;  2QTO A;  3QO7 A;  4DR2 O;  4I9W A;  1L0L H;  2RMK B;  3ABM C;  3ZMZ A;  4OX9 B;  4JV5 O;  2ZIO A;  1GRJ A;  4R50 A;  4UCO A;  2JGU A;  4X9Q A;  3OT7 A;  3RYI B;  5KHK A;  1R3L C;  3LSU A;  4WFE A;  5JH7 B;  2FML A;  3AK2 A;  5BZB A;  4K0K B;  4IYH A;  4EB6 B;  1GK9 A;  2ADQ B;  2Y48 A;  3FAV B;  5H6R A;  3SYP A;  1FJG O;  2QTS A;  4H37 A;  4JI1 B;  3K57 A;  2YSU B;  4B3M O;  4I4T A;  2ZKO A;  4LFB O;  2WLI A;  5JCO A;  4PV1 B;  2UUC B;  5LHH A;  3HKB B;  2OYQ A;  5LMU B;  4KHP O;  1FFX B;  1H2K A;  1CXZ B;  2LJ2 A;  1AR4 A;  4MSW C;  2KB1 A;  3RN4 A;  1JFF B;  3EFF K;  1K7D A;  4FLZ A;  3ETD A;  3EVK A;  4JAA A;  4GYC B;  4QPJ A;  3ABL C;  1J95 A;  3E22 B;  2HG5 C;  5IJ9 B;  3DSQ A;  3JD3 A;  3SYA A;  3L9D A;  4C7U A;  3JAT A;  5IYD O;  1XHX A;  4DRX A;  2IU0 A;  5BR8 B;  4YJ2 B;  4AHC A;  1HNX B;  5HFL A;  1QLN A;  5EZY A;  4LH7 A;  2JRI A;  4QNH B;  2ZE7 A;  2N05 A;  4J10 A;  1RM1 C;  2BSK B;  3JAL A;  4I4T B;  3PN1 A;  4X1K B;  4FLX A;  5EIB C;  1JVM A;  3CX5 F;  4O4I A;  3CRR A;  4UCU A;  3FB5 C;  4WBN A;  1COW G;  1W0K G;  2UXD O;  4BIO A;  1SC5 B;  2JIZ G;  4ZHQ B;  4LCU C;  2PI4 A;  5GTH Z;  1KC8 W;  2F1M A;  2EIK C;  2Q68 A;  1YHQ V;  1Q6I A;  4X1I B;  2IH3 C;  2A0L A;  4MVS A;  4O2B B;  2F4V O;  1UFI A;  1XDC A;  3T1Y O;  4PA7 A;  1NTK H;  2JJ2 G;  5EBW C;  5IY5 C;  1NTM H;  2WLH A;  4A5U B;  5CBF A;  3R66 A;  5KHH A;  4JI3 B;  4FMT A;  1NR7 A;  3CRC A;  4X1Y B;  5F2V O;  1AI4 A;  4YJ3 A;  4JYA B;  4TUY B;  4CH4 A;  4DV3 B;  5B1B C;  1Y67 A;  1VQ7 V;  1OCO B;  1WN7 A;  1WPX A;  3GB7 C;  4Z2W A;  4WFB V;  4XBF A;  2F66 C;  5C8Y B;  4P2Z A;  1VF6 C;  3W7T A;  5LXT B;  4UCV A;  2ZQM A;  1K73 W;  2E3C A;  3OW2 U;  1BQZ A;  3L70 H;  1NTZ H;  5GTI Z;  2RJZ A;  3JD2 A;  4DV4 O;  3UQ8 A;  2AHZ A;  1SRY A;  2VS0 A;  2NR5 A;  2Z3Y A;  3ZRX A;  3IC7 A;  4ZHQ A;  3F5T A;  1VAR A;  3KG2 A;  4TOI A;  3H01 A;  3Q4H B;  4X20 B;  4GKK B;  5IYZ B;  4JAV A;  1XMQ O;  3ASN C;  2BOC C;  2GTA A;  1H2M A;  4LNU B;  3G6E V;  4I0X B;  4JTD B;  3QO5 A;  5IY5 B;  2F93 B;  2QKA A;  3CRA A;  4JI7 B;  2IW5 A;  3K9A A;  4JI6 O;  3ZMT A;  2F95 B;  1M57 C;  3KCX A;  2XAQ A;  2CK3 G;  4DUZ B;  5FPO A;  2YIB A;  2ZR2 A;  1H38 A;  3OMA B;  4P30 A;  5LGN A;  5L3E A;  1I5Y A;  4IL6 Z;  3QVN A;  3BVO A;  1R3I C;  4BIZ A;  3RT3 C;  5IJ0 B;  2E74 B;  3OE7 G;  2ZE8 A;  4HNA B;  1ENV A;  1Q90 D;  1IX9 A;  2B1I A;  5J2T B;  4FM1 A;  4U3J B;  4ZI7 A;  1WNS A;  4GX1 A;  2Q69 A;  2QR4 A;  3J7A U;  1SQX H;  2BCC H;  2OT5 A;  5IT9 N;  1B04 A;  1D5A A;  3E35 A;  3E89 A;  3BAA A;  4I0X A;  1N32 B;  3T4D A;  1YEW A;  3R65 A;  4LF5 O;  4YHH B;  2ZE5 A;  5BR8 O;  4DV7 O;  3ETE A;  3BA9 A;  1FXK C;  5EYP B;  3T1C A;  2V4D A;  2FL4 A;  5K1X A;  3D3Q A;  4O2A B;  2EIM C;  1R3K C;  3MDS A;  4MVM A;  5KHI A;  4HYO A;  4K8X A;  4UVA A;  2W0F C;  2FKX A;  1M9N A;  2IH1 C;  2DOS A;  4BW9 A;  5L3C A;  1YF2 A;  4KHP B;  4HNA A;  1AP6 A;  4JI0 B;  3WB2 A;  3RFR A;  1ZSP A;  2W6J G;  2IJK A;  1Q5O A;  4X89 A;  3JAM N;  2K9P A;  3FD9 A;  4DV3 O;  1GM7 A;  4FIP C;  4TQD A;  1RFY A;  1HR0 O;  2HJD A;  1N4C A;  3JAW A;  2VQE O;  2GV9 A;  2OWO A;  4TV8 A;  3RYH B;  3B09 A;  3UT5 B;  3AG4 C;  2WPD G;  1M1K W;  2ZXW B;  3E83 A;  2JS5 A;  1AJP A;  3MHS C;  1JJ2 U;  3OMI B;  3ZBH A;  3CRQ A;  1NS1 A;  4YIO A;  1RSO A;  1WP8 A;  1YJN V;  4LH6 A;  2L35 A;  1HWY A;  2CGN A;  4DR7 B;  1K92 A;  1BHA A;  5B1B B;  3G6B A;  1P7G A;  1FS0 G;  4LWS A;  4DV2 O;  1L1F A;  4BIU A;  4KXR A;  4CC5 A;  2ZIN A;  4GX2 A;  1BQ0 A;  2PYJ A;  1NBM G;  1KBH A;  5J2U A;  3U0Z A;  2QA4 V;  2PZS A;  4DV5 O;  1DGS A;  4YXW G;  3I56 V;  1IZ3 A;  4DK1 A;  2DQ3 A;  1OV9 A;  2W0X A;  1PV0 A;  1AIL A;  3FX7 A;  1IBK B;  1S0V A;  2AXT Z;  1LR1 A;  2CTR A;  2UU9 B;  2UXC B;  4DRX B;  2HEP A;  1PPJ H;  5CA3 A;  4UCR A;  1W2B U;  5KX5 B;  1I0H A;  1I94 O;  2Z0A A;  3QNE A;  4DR3 O;  4FLY A;  1BS3 A;  4JI6 B;  4GKJ B;  2P22 C;  3KKY A;  3BAB A;  1GH6 A;  2CUG A;  4L87 A;  1E1Q G;  1IBK O;  4NXN B;  4QIW F;  1IXM A;  2DWE C;  3A0R A;  3NXS A;  3W7W A;  1QVG U;  4KP4 A;  3D36 C;  2DYS B;  1FFT B;  3IGA C;  1Y76 B;  4KL1 A;  3N2K B;  2LW1 A;  4K8Z A;  1SQF A;  1LNQ A;  3LNN A;  2P7T C;  3BRC A;  4LF7 B;  4DV4 B;  1GO3 F;  2M7W A;  2JVD A;  3RGB A;  1WJZ A;  1CP9 A;  3FYE B;  1F51 A;  2EIJ C;  2WAM A;  3CME V;  4IT5 A;  2YDE A;  3P3P A;  4O4H B;  1QLE B;  4RO2 A;  5D5P A;  1AP5 A;  5J9P C;  2ZT9 B;  4QE7 A;  1YIT V;  1OCO C;  3JAT B;  1G8M A;  3CCU V;  3H9V A;  4DR5 O;  2W6I G;  2UXB O;  3FB7 C;  4O4H A;  5JJJ B;  3H1I H;  3L74 H;  4GUN A;  1DK1 A;  2HHH O;  3SPI A;  5K1P A;  2YEV B;  2FTK A;  2BOB C;  1DF4 A;  1BMF G;  2NN4 A;  4EFE A;  4JGS A;  4PDV A;  2JS3 A;  4GX0 A;  3W7X A;  4J42 A;  4PI0 A;  3VQV A;  1YCI A;  2Q7G A;  4FVM A;  4KUM A;  5LHG A;  1SA0 A;  3IC9 A;  1CPY A;  5CA1 B;  2XT9 A;  4YJ2 A;  3K08 A;  5CB4 B;  1WAZ A;  5EK0 A;  3AG3 C;  3IJ4 A;  4JPR A;  1W0J G;  4DUY B;  1SKV A;  2DW4 A;  2K1E A;  3NR7 A;  3K3W A;  1K5S A;  3UT5 A;  2NNU A;  1GN4 A;  3C3T A;  4NXM B;  2DN9 A;  1GM9 A;  3ZHT A;  2GHY A;  3N2G B;  1Q81 W;  2EJR A;  3SGI A;  5A9G A;  2RDC A;  3JCZ A;  3TXQ A;  1XHZ A;  4I55 A;  1KUQ A;  2AGA A;  2QEX V;  2YXH A;  3CJH A;  2ZDI A;  4D7S A;  4QJF B;  5LL6 Y;  5IYC O;  3K04 A;  1PNK A;  3RVY A;  5A2Q N;  4J9Y B;  1BSM A;  5C93 A;  3DC6 A;  2WLN A;  1U96 A;  5DN6 G;  3AG7 A;  4GKJ O;  5JCO C;  3STZ C;  4JI2 B;  4CH5 A;  4B3S B;  2WLK A;  2XAS A;  1FXK A;  4H33 A;  3RVZ A;  3HKB A;  3B8N A;  3ZMS A;  3VQY A;  4DUY O;  2DJV A;  4ZKI A;  3CCV V;  3WB1 A;  3A2F A;  1OJH A;  2JEX A;  4AIL C;  3K5N A;  3F5W C;  3ETG A;  3HKD A;  4EEQ A;  2UUC O;  4LFC B;  1XNQ B;  1VP7 A;  1E1R G;  1RPO A;  2CTP A;  1HR0 B;  1IBM O;  4YIP A;  4B3M B;  1FKA O;  2NLJ C;  3Q4H A;  1JJO A;  2EX3 A;  2WLL A;  2IM9 A;  3EXA A;  2HJF C;  1NH2 D;  4QPK A;  4ZOL A;  5B3S C;  2Z5U A;  4MW3 A;  1SQV H;  4WFH A;  5JWP A;  4FFK A;  1FPO A;  2Y4T A;  2A06 H;  3RW0 A;  1PP9 H;  1V54 B;  4MVU A;  5H6Q A;  1RM1 B;  1XMO B;  4OXS A;  1A32 A;  1UPG A;  4DXW A;  1K8A W;  4OGQ B;  2RQ6 A;  1Y76 A;  3OEH G;  4NTX A;  3SPH A;  3OAA G;  3L71 H;  4PD4 F;  3QF7 A;  1K97 A;  3TGU H;  2QWO B;  3E8B A;  1GN3 A;  4X65 O;  4BR6 A;  1Z2G A;  1H2L A;  4B3R B;  5KMG B;  2YIB D;  1KD1 W;  2HVK C;  1HNW O;  4X64 B;  1Q3E A;  5CA0 A;  3K9S A;  2HR3 A;  4IHJ B;  2N04 A;  1TUE B;  5B1N A;  5EBL C;  4IIJ A;  1IBL B;  4J41 A;  4CH6 A;  1IXB A;  4J80 A;  2ADP A;  4DR3 B;  5LMN O;  4TUY A;  1TUB A;  3DXR A;  4FFB B;  1N33 O;  3LNM B;  4O2A A;  5ITZ B;  5HFM A;  1XMO O;  1N0J A;  2ODM A;  1K4D C;  3E2E A;  1TA8 A;  3OTF A;  4LF9 O;  4LF8 O;  2EIJ B;  2DYR C;  3VBB A;  2QDO A;  4JYA O;  4CS4 A;  3HKC B;  3ZMU A;  4BW5 A;  1K3E A;  5LYJ B;  3ABM B;  4DW1 A;  4JI7 O;  5CBG A;  2UUA B;  1Y66 A;  5E1A C;  5LOV B;  5JQG A;  2UXD B;  3ABL B;  1G6U A;  1MZE A;  1MSD A;  4H44 B;  4CS2 A;  1PM9 A;  4FJC C;  4I9Q A;  2CE4 A;  4FLU A;  4B7E A;  1QU7 A;  4WFG A;  3D8C A;  5KA5 A;  4JYC A;  3RYH A;  2WSS G;  1K4C C;  2DWD C;  2KQX A;  4O4J A;  4J11 A;  2PUS A;  3ZS8 C;  4PA4 A;  1XL4 A;  1JQ0 A;  4FFB A;  1P4R A;  1VQP V;  1NVP D;  5LA6 A;  2AW9 A;  1YVW A;  1FYJ A;  4NTW A;  4WFF A;  3OFN G;  2YIC A;  4ICG A;  5J2T A;  2Q5Z A;  4FPP A;  1XBL A;  4YHH O;  2GTS A;  3OR7 C;  1MG1 A;  5FPR A;  1XRE A;  1GMG A;  1XEQ A;  1QHT A;  4B3T O;  3CSX A;  4XDL A;  2ZD9 A;  2JGD A;  3M7M X;  4E2L A;  4R8C A;  3T4Z A;  5FL7 G;  1FJG B;  1S5J A;  4ASU G;  3ASO B;  4ABM A;  1L0N H;  2PYL A;  1VQ4 V;  1XUQ A;  4PHZ A;  1IVS A;  3TCU A;  2EBO A;  2UXX A;  1AI7 A;  3B40 A;  4HBN A;  4W4K A;  4L8J A;  1D2D A;  1P84 F;  5C8Y A;  3IAY A;  1PL4 A;  3ZN1 A;  4AI8 A;  5LGT A;  4HZ3 A;  4P9O A;  3E8G A;  3SJC C;  4X66 O;  1K9M W;  2A79 B;  1NH2 B;  3FFQ A;  3QTC A;  2VWJ A;  2P90 A;  2MK3 A;  5CA0 B;  1M5I A;  5L3D A;  3ZED A;  4U7O A;  3K5L A;  5LYJ A;  4KFM A;  3AG1 C;  5JVD B;  1V9P A;  3GWK C;  3ZHS A;  4UCT A;  1XNQ O;  3JD4 A;  4LF8 B;  3CWB H;  1Y74 B;  4LF4 B;  5FNV A;  2XHB A;  4PDM A;  3M8A A;  2IJH A;  3AG1 B;  3O65 A;  4U3J A;  2YI9 A;  1T5E A;  2Y0I A;  1CEZ A;  1JOY A;  3ZN0 A;  3WG7 C;  3CCM V;  2R9I A;  2OIE A;  5E79 Z;  3CCQ V;  4JAS A;  3F7Y C;  1R1B A;  2FYU H;  4CZZ A;  4O4J B;  1NQT A;  5L3G A;  4WBN B;  1Q7Y W;  1VQM V;  2R9R B;  1Y6X A;  4GT1 A;  4DV0 O;  4FLW A;  3DGE A;  1SS3 A;  1VF5 B;  4MW8 A;  1QCE A;  4QGP A;  5DM6 V;  2QJ1 A;  4MVR A;  3TET A;  4FK5 C;  4ZOL B;  4UUJ C;  3WFV A;  4K35 A;  4JI5 O;  3KCY A;  3SJQ C;  1ZLZ A;  3JD1 A;  5EBM C;  4LFA O;  2X0L A;  1YSC A;  4FZ0 A;  2ITD C;  1BGY H;  1OCC C;  4Z1V A;  3OUF A;  5JH7 A;  3ABT A;  1HP8 A;  2YID A;  5BY1 A;  4F6E A;  1KU9 A;  3ZHQ A;  2QSA A;  3RWR D;  5EZY B;  5JQG B;  2Q0O C;  4FLT A;  2JK5 C;  1MAB G;  2YS8 A;  3CRM A;  5IWA O;  1N36 B;  2WLL B;  1OCR C;  1I5X A;  4FM0 A;  4PA3 A;  2QGN A;  3JSL A;  2R70 A;  2WA3 A;  3OGI B;  1WB8 A;  1PKX A;  4XDK A;  1ORQ C;  3E86 A;  2XTA A;  5IYZ A;  1EBO A;  2WA4 A;  4LFC O;  1SF9 A;  3K0G A;  3CJH B;  4DR6 B;  3L75 H;  4QE9 A;  1N36 O;  3ABU A;  2ETN A;  2YC0 A;  3TK1 A;  1JR9 A;  2IU3 A;  1XMQ B;  1O9G A;  1EN5 A;  4LF9 B;  3UO3 A;  1Q6H A;  4MT8 A;  3ZHU A;  2Y4U A;  4FLV A;  4TV9 A;  2GUZ A;  3P3N A;  1S5L Z;  3ABK B;  2PGG A;  4NR1 A;  1OHH G;  2F43 G;  4MTX A;  1Q43 A;  2PF4 E;  3LSQ A;  1MA1 A;  3FB8 C;  2QWR B;  3RYI A;  3CE2 A;  4DV1 B;  2P5O A;  1KMI Z;  1NR1 A;  1YDX A;  4OPH A;  1VEW A;  3WU2 Z;  2EIN B;  3B8M A;  3S3W A;  3CMA V;  1H2N A;  3CCR V;  4MVQ A;  3A0H Z;  4B3R O;  1ARO P;  3F7V C;  2Q8V A;  3ASN B;  4JTA B;  1TAE A;  4PJ0 Z;  1THZ A;  1MOF A;  4F6R B;  5LGU A;  1LUV A;  3OD4 A;  5IYB O;  4LF6 O;  4DV1 O;  1PD3 A;  3H1J H;  2EZO A;  4FZ1 A;  1OCC B;  1DTO A;  3ZHV A;  1MMM A;  4H0L B;  4OPA A;  5LBQ A;  3OGC C;  3SYC A;  4TV9 B;  4OX9 O;  1VMG A;  1YTF D;  4ZIB A;  1J5E B;  2CDY A;  3E8H A;  3J80 N;  4IHJ A;  1FAF A;  4JYY A;  1FXV A;  2X6A A;  1XL6 A;  2EIL C;  4UVB A;  3SJA C;  1FXK B;  4AQY O;  3FB6 C;  4MVZ A;  1IBL O;  4WF9 V;  3ASO C;  5KA6 A;  5KLV H;  3T1H O;  1L8D A;  1AJN A;  1YIJ V;  1D5N A;  2QWN B;  3K59 A;  1V54 C;  3B2E E;  1FFX A;  1OZ0 A;  4DR1 O;  5LP6 C;  2WLM A;  5L3F A;  3UCS C;  3RYF A;  3CCL V;  4JV5 B;  1M56 B;  2P06 A;  5EIB D;  1AI6 A;  3E22 A;  1B06 A;  5KAF Z;  4NXN O;  4R7C A;  1XI1 A;  3JCU Z;  4DO2 A;  2Q67 A;  4B3S O;  3HKD B;  1N34 B;  3UKM A;  2QKS A;  2QM8 A;  4X8A A;  2GUZ B;  4HAM A;  3IFX A;  2YIA A;  3APO A;  1VQ9 V;  2HKO A;  2Q4P A;  1HDJ A;  2MW2 B;  2XUM A;  2KG7 B;  4ZBM A;  3CCE V;  2JJ1 G;  5LMU O;  2R72 A;  3JAK B;  4UB6 Z;  1JPX A;  3HPL C;  2EIL B;  2Q6A A;  3G71 V;  4EB6 A;  4EFB A;  2GBO A;  3ABK C;  2WLJ A;  1F4M A;  3H1K H;  4D7T A;  2B5U A;  1WPB A;  4J9Z B;  3CXH F;  5LP6 A;  4DR1 B;  3B77 A;  2Q7H A;  5KUM A;  4D6T H;  4BAY A;  4B08 A;  3VOU A;  2P4V A;  2A9H A;  1YZB A;  1ZTE A;  2RNB A;  3H1H H;  4UCS A;  3LDC A;  1S77 D;  1VF6 A;  1NZ6 A;  1WA8 A;  3X2Q B;  3ZRV A;  5D5Q A;  1GM8 A;  5BMV A;  1NVP B;  2UUB O;  2XOK G;  1YTF B;  1ZAU A;  4CH3 A;  4N23 A;  1OCR B;  4PA6 A;  2CTQ A;  2YUA A;  5CBH A;  2YI8 A;  1SQB H;  3K0D A;  3TJT A;  2OCH A;  1QQC A;  4UB8 Z;  4GZR B;  4JI8 O;  4DK0 A;  1XQ8 A;  2AHY A;  1BL8 A;  4IIJ B;  4Z1M G;  2Y0P A;  5JJE B;  4X62 B;  2EIM B;  5B1O A;  3MHH C;  2Q7E A;  4GLX A;  3T1Y B;  2ZNJ A;  3GVM A;  3RYC A;  1EZJ A;  4J7J A;  1IUR A;  4GCZ A;  1FXH A;  4O4L B;  4RQF A;  3HKE B;  2JGD B;  1G1X B;  1H2G A;  1MNG A;  1SZX A;  3RYC B;  2F23 A;  4RUF A;  2LQT A;  1SZT A;  2KSD A;  3FAV A;  5J2U B;  1MSW D;  1W59 A;  1OCZ C;  1F4N A;  3BFR A;  3G80 A;  5DED A;  4MTO A;  5ITZ A;  5B5E Z;  4K3A A;  2ZE6 A;  2YXY A;  1X4T A;  3ZMV A;  3AK1 A;  1NI8 A;  4CS3 A;  1K33 A;  3BCC H;  1UJW B;  4ZI7 B;  5TIS Z;  1IDS A;  1QVF U;  5CN0 A;  3CD6 V;  2ZDI C;  4RAI A;  1X59 A;  2ATK C;  5LA6 B;  2V1D A;  2HP8 A;  4JI4 O;  2UXC O;  3OTO B;  4Q20 A;  3S3X A;  1PL0 A;  3W7U A;  4PI2 A; 
#chains in the Genus database with same CATH homology
 3IAY A;  2F4V B;  3CHX A;  1RSO A;  4LH6 A;  3U11 A;  3N2K A;  1JMK C;  1Z5V A;  2ZIM A;  4DR7 B;  4JI4 B;  4LFA B;  3SJC C;  1SA0 B;  1XNR B;  1P49 A;  5FNV B;  3K5O A;  3FFQ A;  3QTC A;  4CC5 A;  2VWJ A;  2ZIN A;  1HNW B;  5LP6 B;  5CA0 B;  1M5I A;  2PYJ A;  2VQE B;  3ZED A;  3K5L A;  5LYJ A;  4JI8 B;  3JSN A;  4I50 B;  5J2U A;  3U0Z A;  5KMG A;  5JVD B;  4JI5 B;  1V9P A;  2PZS A;  1M4U A;  4O4I B;  1DGS A;  4UCT A;  4LR3 A;  4LF8 B;  4LF4 B;  5FNV A;  4DK1 A;  2XHB A;  1H2S B;  3MAQ A;  4U3J A;  1IBK B;  2YI9 A;  1T5E A;  2UU9 B;  2VQF B;  2UXC B;  2BTO A;  4DRX B;  4X1Y A;  2HEP A;  3ETQ A;  4UCR A;  5KX5 B;  4O4J B;  3HKC A;  4FLY A;  5LXT A;  4DR4 B;  4WBN B;  4JI6 B;  4GKJ B;  2P22 C;  3BAB A;  1Z5W A;  4NXN B;  4FLW A;  4UFZ A;  1JFF A;  2QJ1 A;  4DV0 B;  4ZOL B;  4BWA A;  5CA1 A;  3VQW A;  1NT2 B;  4KL1 A;  3N2K B;  4K8Z A;  1SQF A;  2R9A A;  3VQX A;  1VF7 A;  3LNN A;  5EYP A;  3BRC A;  4LF7 B;  4DV4 B;  5IWA B;  4AQY B;  2JVD A;  3RGB A;  3K58 A;  5JH7 A;  2CAZ C;  4I55 B;  4DR5 B;  1TVK B;  4DV7 B;  4X1K A;  4O4H B;  3HKE A;  5D5P A;  3ICX A;  1KU9 A;  5CB4 A;  1N33 B;  3WB0 A;  3RWR D;  5EZY B;  5JQG B;  3BPZ A;  4FM2 A;  4OX9 B;  4FLT A;  2ZIO A;  3JAT B;  1N36 B;  4Q6G A;  2BTQ A;  2ZM6 B;  3JAS B;  5GON B;  4FM0 A;  4UCO A;  4O4H A;  3JSL A;  2R70 A;  2JGU A;  5JJJ B;  3RYI B;  5KHK A;  5JH7 B;  5K1P A;  4K0K B;  4EB6 B;  5IYZ A;  4EFE A;  4JI1 B;  3K57 A;  4I4T A;  4F6R A;  4DR6 B;  4X65 B;  4PI0 A;  3VQV A;  3T1H B;  2Q7G A;  5JCO A;  1XMQ B;  4FVM A;  1O9G A;  4LF9 B;  2UUC B;  1SA0 A;  3HKB B;  5CA1 B;  2OYQ A;  5LMU B;  1FFX B;  4YJ2 A;  4FLV A;  5CB4 B;  4TV9 A;  2PGG A;  4TQF A;  3CB2 A;  1JFF B;  1Q43 A;  4FLZ A;  4DUY B;  1SKV A;  1TGO A;  4GYC B;  3UT5 A;  3E22 B;  3RYI A;  3JAK A;  5IJ9 B;  3DSQ A;  4DV1 B;  1KMI Z;  2P5O A;  4NXM B;  5GON A;  3JAT A;  3JAL B;  1XHX A;  2BTQ B;  4DRX A;  3JAS A;  5BR8 B;  3N2G B;  4YJ2 B;  4AHC A;  4LF5 B;  1HNX B;  5EZY A;  3SGI A;  4LH7 A;  1TUB B;  4YJ3 B;  1XHZ A;  4O4L A;  4I55 A;  3JAL A;  3JAR B;  4I4T B;  1TAE A;  4F6R B;  3PN1 A;  4X1K B;  4FLX A;  5EIB C;  4D7S A;  4O4I A;  1IBM B;  4UCU A;  4WBN A;  1I7F A;  4NVP A;  5IJ0 A;  5BMV B;  5JCO C;  4ZHQ B;  4TV9 B;  3JAR A;  4JI2 B;  4CH5 A;  4B3S B;  4ZIB A;  1J5E B;  2F1M A;  3JAW B;  3HKB A;  3VQY A;  4IHJ A;  4X1I B;  2YXL A;  3WB1 A;  3N2G A;  4O2B B;  3A2F A;  4DV5 B;  3SJA C;  4AIL C;  3K5N A;  5LMN B;  3HKD A;  5KHJ A;  4EEQ A;  4X20 A;  3U10 A;  1SQG A;  4LFC B;  1XNQ B;  5JVD A;  2HHH B;  1HR0 B;  1L8D A;  4B3M B;  5KHH A;  4JI3 B;  3K59 A;  4DV2 B;  1JJO A;  2EX3 A;  3B2E E;  4X66 B;  2VWK A;  2IM9 A;  4X1Y B;  1FFX A;  4ZOL A;  5LP6 C;  4YJ3 A;  4JYA B;  4TUY B;  4CH4 A;  4DV3 B;  5LOV A;  1WN7 A;  3RYF A;  4JV5 B;  2F66 C;  5EIB D;  5C8Y B;  3E22 A;  2PY5 A;  5LXT B;  1XI1 A;  4UCV A;  1Q8I A;  1XMO B;  3HKD B;  1N34 B;  2E3C A;  1I94 B;  4YY3 B;  5KHG A;  2RQ6 A;  2RJZ A;  3UQ8 A;  2YIA A;  4DV6 B;  3QF7 A;  4CC6 A;  4ZHQ A;  4TOI A;  2R72 A;  3JAK B;  5IJ9 A;  2E5L B;  4X20 B;  4GKK B;  4EB6 A;  4EFB A;  5IYZ B;  4B3R B;  5KMG B;  4D7T A;  2YIB D;  4LNU B;  4X64 B;  1WPB A;  1Q3E A;  5LP6 A;  5CA0 A;  2F93 B;  4DR1 B;  1HNZ B;  2Q7H A;  4JI7 B;  4IHJ B;  4X1I A;  2UXB B;  2ZNI A;  4B08 A;  2KKW A;  3QG5 A;  1IBL B;  4IIJ A;  2F95 B;  4CH6 A;  4DR3 B;  4TUY A;  1TUB A;  4DUZ B;  4UCS A;  5FPO A;  3SR2 C;  4FFB B;  2PTM A;  4O2A A;  2YIB A;  5ITZ B;  5BMV A;  5D5Q A;  1TA8 A;  3OTF A;  4CH3 A;  1ZAU A;  3BHP A;  5IJ0 B;  3HKC B;  4CS4 A;  4HNA B;  4LFB B;  5LYJ B;  4I50 A;  5KX5 A;  2YI8 A;  2UUA B;  5J2T B;  4O2B A;  4FM1 A;  1QQC A;  5LOV B;  5JQG A;  4U3J B;  3K5M A;  4ZI7 A;  4DK0 A;  1WNS A;  2UXD B;  1XQ8 A;  1G6U A;  4CS2 A;  4IIJ B;  3SJB C;  4I9Q A;  1B04 A;  2ZCE A;  1D5A A;  5JJE B;  4LNU A;  4X62 B;  4FLU A;  3BAA A;  1N32 B;  4DR2 B;  1YEW A;  4YHH B;  2Q7E A;  4GLX A;  3T1Y B;  3BA9 A;  5EYP B;  3RYH A;  2ZNJ A;  4O4J A;  2V4D A;  5K1X A;  2PUS A;  5JJN B;  1O9H A;  3ZS8 C;  3RYC A;  4O2A B;  2UUB B;  3THO A;  4FFB A;  2Q0A A;  4O4L B;  5LA6 A;  5KHI A;  4K8X A;  3HKE B;  3BA8 A;  4BW9 A;  5J2T A;  4LF6 B;  3RYC B;  1TVK A;  4KHP B;  4HNA A;  5J2U B;  4JI0 B;  3WB2 A;  3RFR A;  5FPR A;  1QHT A;  1HW7 A;  1Q5O A;  3CSX A;  5ITZ A;  4TV8 B;  1X4T A;  3RYF B;  4B3T B;  4CS3 A;  3M7M X;  4TQD A;  4ZI7 B;  3JAW A;  1FJG B;  2QM4 A;  1S5J A;  2PYL A;  2GV9 A;  2OWO A;  4PHZ A;  5LA6 B;  4TV8 A;  1M93 A;  3RYH B;  3OTO B;  4HBN A;  3UT5 B;  4L8J A;  2JS5 A;  4PI2 A;  5C8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...