2F66C

Structure of the escrt-i endosomal trafficking complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
65
structure length
65
Chain Sequence
SKKYGDIALKKKLEQNTKKLDEESSQLETTTRSIDSADDLDQFIKNYLDIRTQYHLRREKLATWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional organization of the ESCRT-I trafficking complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
molecule keywords Suppressor protein STP22 of temperature-sensitive alpha-fact
total genus 27
structure length 65
sequence length 65
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2f66C00
2P22C 3SJBC 3B2EE 3ICXA 3QG5A 3SJCC 3ZS8C 3QF7A 2JS5A 1SKVA 3SJAC 2F66C 3CSXA 2CAZC 1X4TA 3THOA 1NT2B
chains in the Genus database with same CATH superfamily
2P22C 4TSFG 4CBCA 2WA4A 1ROPA 5CBFA 2Y4UA 4LBEC 2X6AA 5CA0A 4GCZA 1SS3A 1PV0A 4MVOA 4KXRA 4UB6Z 2OYQA 1WP7A 3IFXA 1Q90D 2RMKB 4DR7B 3W7TA 2F66C 5D5QA 2UUAO 2VQFO 1UJWB 4J11A 1A32A 4OPAA 5J2TB 4FM1A 4JI3B 1HNXO 3AEIA 5L3GA 5CA1A 4I9WA 4U7NA 1Q43A 4LFAB 4PV1B 1COWG 5IWAB 1R6TA 1NZ6A 1RSOB 3CCSV 1BE3H 2ZINA 4DK0A 1F51A 4LWSB 4WFEA 1TVKA 2F4VB 1HNWB 5JVDB 2OT5A 2R9IA 4DR3O 1KKDA 5CN0A 5JH7A 4BR6A 4P2ZA 5CA1B 3QTCA 4DV6B 1S72V 2P67A 2WWWA 4X8AA 3GWOA 1WA8A 4FJCC 5IJ0A 4DR6B 3Q4HB 5B5EZ 2W6IG 3T2MA 5B66Z 3BA9A 3UCSC 2UXDB 4DO2A 4LF7B 4K8XA 1IURA 4LF7O 5CA0B 3K0GA 5IYDO 3CMAV 3OMNB 3B8NA 3E8HA 2M6YA 1KD1W 3ZMVA 1VQPV 4IIJB 2IH3C 3CRAA 2GV9A 1W0JG 4UVCA 4YY3O 5AG2A 3OMAB 1XOUA 4LR3A 4GX1A 5E1AC 1O9GA 1L0LH 1VARA 2QTOA 3T1HB 2YIBD 4RAIA 3ZHRA 4JI6O 3DTUB 5JJJB 2ZXWB 3SYPA 3S3XA 2IU3A 3ZHVA 1D2DA 3WB0A 3I56V 3IJ4A 1DLBA 4DYLA 3HB3B 2WLIB 3JAWA 4JF3A 1ORQC 1K4CC 1GK9A 1PP9H 5L3FA 3ABLC 1YXBA 4FVMA 1HNZO 2QM8A 4KP4A 4DR2B 1VQ9V 1CPYA 3L75H 1MOFA 3ZS8C 2QWRB 4IHJB 3CMEV 1NKDA 3CRCA 4HNAA 1LUWA 4I55B 2YDEA 4NVPA 2CH7B 4I7ZB 1RFYA 3LDCA 2VWKA 3CX5F 2CTPA 1YJ9V 1Q82W 3N27A 2PUSA 1SQGA 4JI7B 1EN5A 1N33O 2P6JA 3FB6C 3STZC 2P4VA 1K73W 1FAFA 1OCRB 3ZHUA 3SYOA 2NN4A 3CCQV 3OR6C 3FX7A 3WB2A 3OM3B 1K9MW 5LXTA 1Q8IA 3BCCH 4DUYO 3TXSA 4JI6B 1V55C 3VOUA 4MVRA 3ASNB 1L0NH 4JTCB 1BQ0A 1AP5A 1JJOA 3CCLV 4X1YA 3CS5A 2AGAA 3VQXA 1LR1A 5IJ0B 4PDLA 2Q7EA 1QR9A 5B1AB 1DTOA 4XDLA 2QM4A 1B06A 4KFMA 1S5LZ 3ZBHA 1NJIW 1VQ6V 4TV9A 3A0HZ 3ABUA 4JI0B 2GTAA 2LGQA 4R8CA 5JVDA 4FPPA 2YI9A 2D2CB 4CS3A 3ETEA 2EINB 1R6NA 1SRYA 3FYIB 4X88A 4DW0A 4QIWF 1XMQO 3OEEG 4D7SA 1R73A 2ADQB 4JYCA 1YJNV 1IBLB 1N36O 3OTOB 1V54C 3OUSA 1P4RA 3F5TA 3F7VC 4FZ1A 1IXMA 1VQNV 3QNEA 3DC6A 1XL4A 2DWDC 1HNZB 1TA8A 5J2TA 1PM9A 4FM2A 2ETNA 3HPLC 1GM7A 3VQYA 4N23A 4YIPA 1MA1A 3B8MA 2XTAA 2QWNB 5KHKA 2JVDA 5JCOC 2QA4V 3JALA 4DR6O 1N34O 4J7JA 1IBLO 5A9GA 2K1EA 3IC7A 1FXKC 2OCCC 1MSWD 4PA6A 3BFRA 1PKXA 1K33A 1X59A 4I50A 3CXCU 2JRIA 1N8RW 3STLC 2QWQB 4N21A 2WAMA 4WFHA 2JIZG 3AG1C 2W0XA 2Y48A 1OV9A 2HKOA 5FNVA 5KA5A 4F4LA 4YJ2B 2IW5A 2OIEA 4LF9O 3A2FA 3ZMSA 5J9PC 4MS2A 1E1RG 2RN9A 1ZL8A 4AI8A 4I4TA 4LF4O 5EBWC 3RGBA 3CP1A 4AHCA 3ZJZA 1LUVA 1XREA 1VF6A 3VQVA 2L6LA 1YHQV 1WB8A 1FJGO 2ZE5A 2ATKC 2OTJV 4IIJA 5JQGB 3P3PA 2Z3YA 5C8YB 4KHPO 4GZRB 1D5AA 2WLKA 4LF6B 3DC5A 3A0BZ 3BHPA 1JX9A 4X65O 1EN4A 1ZSPA 1Z5WA 5L3CA 3ZRVA 3T4DA 5IY5B 4YJ3B 1VIBA 3G80A 2DW4A 4PD4F 5KUMA 2YI8A 5JJEB 1Y74A 4A5UB 4ZIBA 4MTXA 5KUKA 2EIKC 3K08A 4O2AB 4FIPC 1SA0B 1OCCC 5LP6B 4DUZO 4U7OA 4LWSA 1ZX3A 2Q69A 1OCOC 3G6BA 3CRRA 4FMTA 2ZQMA 1RSOA 1SZXA 2KSDA 2F1MA 5CBGA 4BIUA 1SQQH 3AG2B 1WNSA 2XOKG 1NS1A 2XNDG 4E4EA 1VF7A 4LF8B 4DV4O 2Q5ZA 2YXHA 3OUFA 1SKVA 4IT5A 2YIBA 1XHZA 2BOBC 3HR0A 5IT9N 1K34A 2JS3A 2XT9A 1K3EA 1Y67A 3E83A 4DV5O 1BL8A 2OCCB 3HKEA 1SF9A 1KB9F 2VQEO 1PL0A 3LSQA 3ASOB 4U3JA 1YI2V 1FXKA 1XUQA 5DECA 2ZXWC 3C90A 2JJ1G 2A79B 1KQSU 4B3TO 1QVFU 3K5OA 3UO3A 2CGNA 4QJFB 1KKCA 2BTQA 1QR8A 3EVKA 1UFIA 3JASB 4MSWC 2CGOA 4NB5A 3AG3B 5KMGB 4LFCO 4LC1A 1FXVA 1IDSA 2C2AA 4LP8A 4WFFA 1N32O 1XEQA 3WG7B 1I7FA 5LYJA 3ZRXA 2PI5A 1G4YB 2WLJA 3WG7C 3PJSK 1GN2A 5L3BA 4WFGA 2PYLA 2E5LB 4X64B 2YEVB 2E3CA 5J2UB 1N4CA 2HJFC 3D3QA 1TUBB 1R3KC 4J9YB 4FK5C 3D3IA 3CE2A 4JI3O 1HNXB 2UUCO 1FXKB 4YHHO 3T1YB 2QM7A 4U3JB 2A7WA 3J80N 4EKWA 1PL4A 4DV1O 2N04A 3ML0A 4G28B 3CCEV 4IYIA 4JV5B 1NQTA 1BCCH 1GH6A 2YS8A 4H33A 2KG7A 3MHHC 3K9SA 1S5JA 1JOYA 3ZRWB 4LF5O 3PN1A 1EN6A 1FPOA 2R70A 1Z5VA 4UCTA 1BSMA 2EIMB 4BWAA 5EYPB 2WA3A 2DYRC 3HKDA 2QWPB 4AQYB 4JI5B 4H0LB 2GBOA 1AP6A 1ZWIC 4IL6Z 1AB3A 3L70H 4NXMO 5CMUA 4H13B 4LF4B 1KUQA 1ZTEA 1GN6A 1VQMV 3SPCA 4JI1B 2CTRA 1DGSA 4MTOA 1KECA 1M57B 2DMXA 1E1QG 3OD4A 4JTDB 4DV2O 3OGIB 4JGSA 2BCCH 4DV5B 2A9HA 3CJHB 5H9CA 3KZIZ 3RBZA 1VQ5V 1K4DC 3K59A 4YJ3A 3DXRA 3CJHA 2M7WA 1JR9A 1YCIA 1M90W 2ITCC 1O9HA 2HR3A 2AHYA 2ILMA 1R3LC 5FPRA 2JEUA 5C8YA 1N36B 2Z0AA 4X89A 5CB4B 4JYBA 4LFAO 3UO2A 3H1JH 5B1BB 1RM1C 2B1IA 1SESA 2EBOA 3SGIA 1XQ8A 2Q0OC 1PD3A 1L1FA 2EIMC 2FYUH 4WFAV 5LHIA 3JSNA 2GDSA 1AJQA 1TUBA 3UKMA 4I9QA 1CEZA 3G67A 5EBMC 1QBZA 3X2QC 1IZ3A 1NTZH 2ZE6A 1B6QA 3BRCA 2Y4TA 3IAYA 5KHIA 4ZBMA 3L71H 4TV8A 5FNVB 5BZBA 1NVPB 4ZOLA 4X65B 1FXHA 5C93A 2DQ0A 5LA6B 1L8DA 3H1IH 4W4LA 4UVBA 1VQOV 3N2GB 2YICA 5KMGA 3QF7A 1VQ7V 4X9QA 1US6A 4B3SO 2XASA 2A06H 3JCZA 4P30A 4TQFA 1IX9A 4ASUG 1YF2A 3MDSA 3TETA 4J42A 3ZCCA 2DOSA 1QQCA 2WSSG 4TWKA 4OGQB 4PDVA 1IBMO 1WP8A 4K8ZA 3ETQA 2HVJC 4QNHB 4DUYB 1N33B 1HWYA 5FLXN 3AG4C 2PZSA 3RYCA 3E89A 4JI8B 3BABA 2IM9A 1N0JA 4DV7O 1NH2B 2QEXV 4O4HA 1AJNA 1WPXA 1EBOA 4LH6A 2VRZA 3QVNA 4DUZB 4CH5A 3WB1A 5B3SC 5DM6V 3CHXA 1YTFD 3ZMZA 4NXNB 3SYAA 1RP3B 3SJBC 3M8AA 3FB5C 1K8AW 2EX3A 4JI4B 1SA0A 1V55B 5EC2C 2AHZA 3QO8A 3RWRD 2H3OA 3AK2A 1KU9A 1BMFG 2V7QG 1Y74B 2LFSA 3OT7A 3JD0A 4EB6A 4DV7B 3R65A 5KX5B 4B7EA 2E76B 1W59A 3UM7A 1DF4A 4R50A 4B08A 1JPXA 5GW7A 3FFQA 5DEDA 1R1BA 5IDJA 1XILA 3LDDA 3ZHQA 4QGPA 2JGUA 1RPRA 3CCRV 3ICXA 4MVSA 2Q4PA 5CA3A 4GKJO 1Q81W 5LXTB 3OGCC 3W7UA 2JS5A 3CB2A 2YIAA 2YUAA 1KC8W 3H9VA 4I4TB 4J7ZA 2GTSA 4LFBB 1QLEC 4G27B 4YJ2A 4DR5O 2KG7B 1SZTA 1Q6IA 5K1PA 3UT5B 2OIGA 4UCRA 1HW7A 4NTWA 3ETDA 2EIKB 4DV6O 1WB7A 5KHGA 4K0KB 3K0DA 1I5XA 3JD2A 4ABMA 2Q0AA 2L35A 1THZA 1JQ0A 3P32A 4ZHQB 2CDYA 2N74A 4I50B 1ZL8B 4O4JB 3AG7A 4LNUB 1GN4A 5J2UA 4IGGA 3CC7V 2YEVA 3LUTB 4IHJA 5B3SB 4L8JA 5EBLC 4NTXA 2JJ2G 3R66A 3L73H 4FFBB 4DRXA 5KLVH 4PI0A 1BGYH 2UXBO 4WFBV 3JAWB 1G6UA 2HG5C 4G2KA 4HAMA 4MTFA 3L9DA 2OTLV 2QE7G 1NH2D 4DR3B 1OCRC 2DYSB 3B09A 1GN3A 2Y69C 2JK5C 1YEWA 3JASA 4UVAA 2B1GA 3BAAA 1QNMA 1MABG 4DW1A 4R7CA 1JA8A 3BEHA 3ETGA 2IBZH 3OTFA 5BMVB 2DJVA 1GTOA 2Q8VA 3HKCB 2QSAA 4DV1B 3FB7C 5F2VO 1YIJV 1GAXA 2UUBB 2UU9B 3KCXA 4K3AA 4UB8Z 3E22B 3IGAC 1QCEA 4ICGA 3RYFA 1R3IC 3LDEA 2WPDG 2UUAB 3D36C 2FMLA 2GUZA 2Q68A 1I0HA 4JI4O 1FS0G 2XAFA 1KBHA 5EZYB 1M9NA 3WFVA 1P7GA 2B9ZA 4HBNA 3T1HO 2F23A 4FZ0A 2DWEC 3C3SA 2ITDC 5E79Z 2ZNIA 3LNMB 3RVYA 4KL1A 1GKFA 3RT3C 1H38A 4JI8O 1ZAUA 3ASOC 2ADPA 4HZ3A 1FFXB 4J10A 1XNRB 1H2LA 5GTHZ 1Q6UA 2Z5UA 5LGUA 2P90A 1AI6A 5B1OA 2W6JG 2ZIOA 3ZN1A 2XUMA 1AR1B 1QVGU 4TV9B 3B77A 4CC5A 1S0VA 2WLMA 1MZFA 4CS4A 4OPHA 5EZYA 5LMNO 5LGTA 1YZBA 2CUGA 1AILA 1QLNA 3LNNA 2HFEC 1Y76A 2ZR3A 2A3QA 2LJ2A 3A8TA 4FFKA 1F23A 4X1KB 2ZE8A 5D5PA 2LGWA 2B5UA 3SR2C 3HKCA 3BPZA 4FLYA 1T5EA 3ABKC 4MVUA 3JAMN 3F7YC 1XHXA 3SYQA 2RCVA 5GONB 3OE7G 1LNQA 1QLEB 4I55A 2EJRA 2EZOA 5IJ9A 4GKKO 3F5WC 1E79G 1Q6HA 3I55V 3SJAC 3K3WA 2ZDIC 2HP8A 1PNKA 4DV4B 4JI5O 1FKAO 2JGDB 1VP7A 5IYCO 1NR7A 2BOCC 2ZE7A 2Y0IA 3CC2V 1XNRO 4JZ2A 1X4TA 4DV2B 5LBQA 2DQ3A 1NVPD 3E86A 3O65A 1NI8A 4JYYA 3M7MX 1OJHA 4DXWA 4QPJA 5IJ9B 2CAZC 4X1IB 3L72H 3JD1A 3J7AU 3H1LH 4MTGA 3GWKC 1BHBA 4K35A 2QGNA 1Q86W 1M56B 2P06A 4BAYA 1PNMA 2H94A 2XAJA 1BS3A 4XDKA 2ZDIA 1H2MA 4JI2B 4YHHB 3B40A 1GM8A 3H01A 4U3FH 2EZPA 1P84F 3JD3A 4UFZA 1XDCA 2ZR2A 2PF4E 5BR8O 3TK1A 5LHHA 2R9AA 4I0XA 3Q4HA 4JYAB 4GX2A 4J41A 2ODMA 5GONA 3FYEB 2QDOA 4GUNA 2MW2B 2OCHA 1VEWA 4X66B 5LL6Y 3K5LA 5LP6C 3J81N 1RPOA 4L87A 4NTYA 2CK3G 2LW7A 3SJCC 3OEHG 1H8HG 1HDJA 5LGNA 1HR0O 1H2SB 1XMOO 3ZHSA 2YXYA 5ITZB 4DR2O 4QE7A 2UXDO 4FLVA 1IBKO 5BR8B 2UU9O 1GRJA 2Q7HA 3K04A 3QO7A 3CCVV 4UUJC 2YSUB 2IJJA 1H2GA 5JH7B 5IY5C 1M93A 1I5YA 2ZM6O 3CCJV 5LMUB 5EIBC 2EJ7A 2JEXA 3L74H 1F4MA 1WLEA 3W7SA 4K0KO 3I5DA 5ITZA 4RWUA 3K06A 4JAUA 2RNBA 3CEIA 3T4ZA 4YXWG 1YVWA 1MZEA 4GKKB 3ZIAG 3C3TA 3FD9A 2RQ6A 3AK3A 1J5EO 1J5EB 1JMKC 1OHHG 1I94O 3APQA 2F43G 4UCOA 4QPKA 2EILB 2UXBB 3OAAG 2R9RB 1ZUQA 3DSQA 2EIJC 2WLHA 3GB7C 4I0XB 2X7RB 4J80A 2PYJA 4JAAA 3RYFB 1WAZA 3K03A 1B3QA 2QWOB 3W7WA 3KCYA 5LOVB 3CSXA 1ENVA 2BTOA 4B3RO 3NR7A 4FFBA 2DYRB 2KB1A 4OXSA 4FLTA 1UPGA 4JAVA 2LW1A 1VMGA 1NR1A 2F95B 2Y0PA 5JJNB 3K79A 1TGOA 3N2KB 1F4NA 1YITV 2HLDG 4O4JA 5IWAO 1GO3F 4FLXA 2UUBO 1KP2A 1KYOF 3ABMC 5L3EA 2HEPA 4PA3A 3N2GA 4CS2A 4UV9A 2HVKC 1W0KG 5A2QN 1OZ0A 2AZ2A 4R6ZA 4B3TB 1JVMA 2XAGA 2XHBA 3CXHF 5LHGA 3RYHB 4NXNO 2JGDA 4PDRA 3A0RA 1Y66A 5IYBO 3QO5A 5CBHA 3B4SA 2CTWA 3EXAA 3BA8A 3JATB 4BIOA 4UCUA 5GTIZ 1EM1A 4MT8A 4CH3A 1S77D 2Q7GA 3ZX6A 4B3MO 1PNLA 4TQDA 4UV8A 3JD4A 4CZZA 1WN7A 1BZKA 1TUEB 3EHBB 4WBNB 2W0FC 4EFBA 4NYKA 4W4KA 4LF6O 4DV3O 4X1KA 1MG1A 4DR7O 2GSMB 2LQTA 4FLUA 1Y76B 2YXLA 4RQEA 1D5NA 5BY1A 2H8PC 3H1HH 1OCZC 3GVMA 3OW2U 1WA8B 4H37A 4QE9A 1XI1A 4RQFA 3SPGA 2DN9A 1SERA 3CYOA 2IJHA 2ZIMA 3VQWA 4EEQA 3SJQC 4B3MB 1AROP 3CCUV 3SPJA 1TVKB 1VQ8V 1RM1B 1AI4A 3TJTA 1MSDA 3MAQA 5TISZ 3U11A 1FFXA 4O2BB 3H1KH 3HKDB 2WLNA 1ZLZA 4D6TH 2HHHO 2PY5A 4RUEA 1VF6C 3JSLA 3VBBA 3X2QB 3NXSA 5IYZA 3UQ8A 3FB8C 4LF8O 4JASA 3JARB 2P5OA 4B3RB 1M57C 4PDMA 5KA6A 1N32B 4O4HB 3ZRWA 1XMOB 2DYSC 2E74B 1F7YA 2GUZB 1SQBH 3RYCB 1BT8A 1AR5A 3TXQA 3BVOA 1DK1A 3RVZA 3ZMTA 3RW0A 3AK1A 4ZI7B 5EIBD 3E22A 4TT3G 3RYIA 3ZHTA 3JAKA 3E2EA 4JI0O 3SDLA 2ZM6B 3OR7C 1B04A 2RDCA 2EULA 4O4LB 5BMVA 1VQ4V 5H5NA 1H2NA 1U96A 3M99B 2P7TC 3E35A 4UCVA 3APOA 1SQXH 4NKGB 2UXCO 3TCUA 1M1KW 2ZT9B 5B1NA 3RN4A 4TUYB 3SPHA 4AQYO 1AI7A 1GMGA 1V9PA 4AILC 1OCOB 2FTKA 4E2LA 4GX0A 2GHYA 3OFNG 4I5SA 2KQXA 2DE0X 2NR5A 1K97A 4PA7A 4LFBO 1XNQB 2F4VO 1DF5A 3SYCA 3ABKB 4DRXB 1Q7YW 4ZKIA 3ZRSA 4TUYA 2VWJA 2FKXA 3AG4B 2BTQB 5KHJA 4MVZA 5KHHA 4FM0A 4LNUA 2VQFB 3ZN0A 3KKYA 2WLLA 1NTKH 1JFFA 3S3WA 4Z1MG 3CWBH 1AI5A 4NXMB 4ZHQA 2UUCB 4H44B 4PA4A 4X20B 4JI2O 4JI7O 5HFLA 4GX5A 4JI1O 3WU2Z 1NTMH 3JAKB 2UXNA 3RYIB 3EFFK 1JJ2U 3LSUA 3HKBB 3HKEB 1IBKB 2XAHA 4JV5O 2K9PA 3UT5A 3P3NA 4TV8B 2Q6AA 4CH6A 1S76D 3FKSG 1HP8A 4P9PA 3D8CA 4LF5B 3AG2C 2VS0A 3OMIB 4WCEV 3MD0A 3FAVA 3KG2A 5H2FZ 1IBMB 4F6RB 4X64O 2UXCB 1EZJA 3ZEDA 5H6RA 1M4UA 4O2BA 5CB4A 2X6CA 4O4IA 1VQLV 3K9AA 4O2AA 2FL4A 4LH7A 4O4IB 1AVMA 4FLZA 3SPIA 4X62B 3E8GA 2RJZA 5H6QA 4B3SB 4BW9A 1YDXA 5KX5A 1P7BA 2E5LO 4EB6B 4F6RA 2OWOA 3FAVB 1OCZB 1OCCB 4HYOA 1XMQB 2YIDA 1Y6XA 2ZNJA 1WPBA 2UXXA 3K5NA 2V1DA 2X6BA 1YSCA 4LF9B 2ZD9A 3CD6V 1W2BU 4Q20A 5B1AC 5EYPA 2IJIA 1KMIZ 2BSKB 1K7DA 1SQVH 2WLLB 2QKCA 1XNQO 3K58A 4BIZA 1Y4MA 4DV0O 4NR1A 4DV0B 3JATA 3THOA 2N05A 3OTOO 2Q9LA 4B7KA 4GKJB 4EFEA 2V4DA 3QG5A 2IU0A 4CH4A 5LMNB 2D3OW 3K5MA 5JCOA 3HKBA 5LYJB 2Y69B 1N34B 1I94B 2Q73A 2QJ1A 2EINC 1V54B 4IYHA 4DR1B 2Q67A 3CRMA 1JFFB 1FJGB 5L3DA 1NBMG 3ABMB 4MW8A 4PELA 2EILC 5FPOA 3IC9A 4BW5A 1M5IA 1VF5B 3ABLB 3O9OA 3CC4V 2X0LA 3B2EE 3K57A 4XDJA 4F6EA 1H2KA 1IVSA 5LMUO 4YY3B 2PGGA 2F93B 2AZ0A 3JALB 1QHTA 1NT2B 1U97A 5LA6A 1P49A 3T1CA 5LOVA 2QR4A 4ZI7A 4ZOLB 5B1BC 1R6KA 1I08A 4UXNA 2EIJB 1AR4A 1CXZB 2LP7A 3D36A 4C7UA 1WJZA 1HR0B 2JDIG 3P30A 4WF9V 4JYAO 3JARA 1K5QA 3LSSA 1AJPA 3MHSC 4O4LA 3U10A 4X62O 5IYZB 2BSKA 4YIOA 4Z1VA 4TOIA 3E8BA 2A0LA 3TGUH 4KHPB 1SQFA 4DV3B 1FYJA 1XL6A 4JTAB 2CE4A 2G38A 1KP3A 5LP6A 2LO1A 2AXTZ 2CTQA 1K92A 4MW3A 2BE3A 3T1YO 4Q6GA 1SC5B 5EC1C 3ASNC 5DN6G 1N0NA 3AG1B 3DXRB 2XAQA 2ARHA 1VQKV 4DR4O 1Z2GA 4LFCB 2ZKOA 4J7KA 1YJWV 3ZMUA 1SQPH 4LCUC 3G71V 5IE9A 4D7TA 3E8FA 1NU1H 1IXBA 4X1YB 4RO2A 4UCSA 4OX9B 4FLWA 1JCHA 2HHHB 4RUFA 5JQGA 2QKAA 4Z2WA 2IJKA 3CCMV 4J9ZB 3G4SV 4MVQA 4WBNA 1PPJH 2QKSA 4GYCB 4XBFA 4GT1A 4MVMA 4PI2A 1K5SA 2P4KA 5HFMA 1GM9A 2HJDA 2LFRA 3RFRA 2NLJC 1Q3EA 3U0ZA 2MK3A 3JYCA 4DR1O 3ABTA 4PHZA 2E75B 5EK0A 1FFTB 2NNUA 5FL7G 1HNWO 3JCUZ 4DR5B 2VQEB 2R72A 3RYHA 2PTMA 1H8EG 1MNGA 1BHAA 2YC0A 1G8MA 1R3JC 1BQZA 1YTFB 2O57A 4PA9A 1Q5OA 4PJ0Z 3CPWU 5KAIZ 3AG3C 2PI4A 1URFA 1G1XB 4X20A 2CH7A 1FD9A 1CP9A 1EZVH 3DGEA 2ZCEA 5K1XA 1SETA 4X1IA 4HNAB 1QU7A 4CC6A 1XBLA 3W7XA 5JWPA 1M56C 4DR4B 4P9OA 4KUMA 2KKWA 4JZGA 5KAFZ 2WLIA 1TAEA 1J95A 1S3JA 2AW9A 4OX9O 4X66O 2IH1C 2QTSA 1MMMA 3BY6A 1S5HC 5BXZA 3CRQA 2FB5A 1EFRG 4DK1A 3G6EV 4JPRA 3N2KA 4GLXA
chains in the Genus database with same CATH topology
2P22C 1N32B 1SKVA 4O4HB 1XMOB 3OTFA 5BMVB 2YIBA 1XHZA 3HKCB 4DV1B 3RYCB 5CA0A 2UUBB 2UU9B 4ZI7B 5EIBD 3E22B 3HKEA 3E22A 2OYQA 3RYFA 4U3JA 3RYIA 3JAKA 4DR7B 2F66C 5D5QA 2ZM6B 2UUAB 1B04A 4O4LB 3K5OA 5BMVA 4FM1A 5J2TB 4JI3B 4UCVA 5EZYB 4HBNA 2BTQA 5CA1A 2ZNIA 4TUYB 1Q43A 3JASB 4LFAB 4KL1A 1V9PA 5KMGB 1ZAUA 5IWAB 4AILC 2ZINA 4DK0A 1FFXB 1XNRB 1I7FA 5LYJA 1XNQB 1TVKA 4DRXB 1HNWB 2F4VB 5JVDB 2ZIOA 4TUYA 2VWJA 2PYLA 4TV9B 5JH7A 2E5LB 4X64B 4CC5A 5CA1B 4CS4A 2BTQB 2E3CA 5KHJA 5KHHA 3QTCA 5J2UB 4FM0A 4LNUA 5EZYA 2VQFB 4DV6B 1TUBB 1JFFA 5IJ0A 1HNXB 4ZHQA 4NXMB 2UUCB 4X20B 3T1YB 4DR6B 3LNNA 3JAKB 4U3JB 3RYIB 3HKBB 3BA9A 3HKEB 1IBKB 2UXDB 4LF7B 4X1KB 4K8XA 4JV5B 5D5PA 5CA0B 3UT5A 4TV8B 3SR2C 3HKCA 3BPZA 4FLYA 4CH6A 4IIJB 1T5EA 1S5JA 2GV9A 3PN1A 4LF5B 1XHXA 5GONB 2R70A 1Z5VA 1IBMB 4F6RB 4LR3A 4UCTA 4I55A 1O9GA 4BWAA 5EYPB 5IJ9A 3T1HB 2UXCB 2YIBD 3SJAC 5JJJB 3HKDA 3ZEDA 4AQYB 1M4UA 4JI5B 4DV4B 4O2BA 3WB0A 5CB4A 4O4IA 3JAWA 4LF4B 4JI1B 1DGSA 4O2AA 4FVMA 1X4TA 4LH7A 4O4IB 4DV2B 4DR2B 4FLZA 4X62B 3ZS8C 4DV5B 4IHJB 2RJZA 4B3SB 3M7MX 4BW9A 5KX5A 4HNAA 5IJ9B 2CAZC 4X1IB 4I55B 3K59A 4EB6B 4YJ3A 4F6RA 4NVPA 2OWOA 1O9HA 2VWKA 1XMQB 5FPRA 2ZNJA 4JI2B 2PUSA 1SQGA 4YHHB 4JI7B 1WPBA 3K5NA 5C8YA 1N36B 4LF9B 5CB4B 4UFZA 2R9AA 3SGIA 1XQ8A 5EYPA 4JYAB 1KMIZ 3WB2A 3JSNA 5GONA 1TUBA 3K58A 4I9QA 4DV0B 5LXTA 4X66B 3JATA 1Q8IA 3BRCA 3THOA 3K5LA 5LP6C 5KHIA 3IAYA 4TV8A 4JI6B 4GKJB 5FNVB 4EFEA 2V4DA 3QG5A 3SJCC 4CH4A 5LMNB 4ZOLA 4X65B 3K5MA 5JCOA 1JJOA 3HKBA 5LYJB 4X1YA 1N34B 1I94B 1H2SB 5LA6B 1L8DA 2QJ1A 3VQXA 5ITZB 3N2GB 5IJ0B 5KMGA 2Q7EA 3QF7A 4DR1B 1JFFB 4FLVA 1FJGB 5BR8B 2QM4A 5FPOA 2Q7HA 1M5IA 5JH7B 4TV9A 3B2EE 4TQFA 3K57A 4JI0B 1M93A 5JVDA 5LMUB 5EIBC 2YI9A 4YY3B 1QQCA 2PGGA 2F93B 3JALB 4CS3A 1QHTA 5ITZA 1NT2B 5LOVA 5LA6A 1P49A 2P5OA 4D7SA 4K8ZA 3ETQA 1IBLB 4DUYB 4ZI7A 1N33B 4ZOLB 4GKKB 3OTOB 2PZSA 3RYCA 2RQ6A 1J5EB 4JI8B 3BABA 1JMKC 2IM9A 1HR0B 4O4HA 4UCOA 1HNZB 1TA8A 2UXBB 3JARA 4LH6A 5J2TA 4O4LA 3U10A 5IYZB 3DSQA 4FM2A 4DUZB 3VQYA 4CH5A 3WB1A 4TOIA 3CHXA 2PYJA 4KHPB 3RYFB 1SQFA 4DV3B 5KHKA 2JVDA 4NXNB 3SJBC 5LOVB 5JCOC 3CSXA 5LP6A 2EX3A 3JALA 1SA0A 4JI4B 2BTOA 4FFBA 3RWRD 4Q6GA 4FLTA 2F95B 5JJNB 1KU9A 1TGOA 3N2KB 4EB6A 4LFCB 4O4JA 4FLXA 4DV7B 4I50A 5KX5B 2HEPA 3N2GA 4CS2A 4D7TA 4B08A 4X1YB 4B3TB 4UCSA 4OX9B 3FFQA 4FLWA 2XHBA 5FNVA 2HHHB 3RYHB 5JQGA 2JGUA 3ICXA 4WBNA 4YJ2B 3BA8A 3JATB 4GYCB 5LXTB 4UCUA 3A2FA 4CH3A 4PI2A 2JS5A 2Q7GA 3CB2A 2YIAA 4I4TA 3RGBA 4AHCA 3RFRA 1Q3EA 3U0ZA 4I4TB 4TQDA 3VQVA 4PHZA 4LFBB 1WN7A 4YJ2A 4WBNB 4IIJA 4DR5B 2VQEB 5JQGB 2R72A 3RYHA 2PTMA 5C8YB 4EFBA 5K1PA 3UT5B 1HW7A 4UCRA 1D5AA 4X1KA 4LF6B 1Q5OA 3BHPA 5KHGA 4FLUA 4K0KB 2YXLA 2Q0AA 1Z5WA 4X20A 4ZHQB 4YJ3B 2ZCEA 4I50B 5K1XA 4X1IA 4O4JB 4HNAB 1XI1A 4LNUB 2YI8A 5JJEB 5J2UA 4CC6A 4IHJA 4DR4B 2ZIMA 3VQWA 4EEQA 4L8JA 4ZIBA 4B3MB 4FFBB 4O2AB 1TVKB 4DRXA 2KKWA 4PI0A 3JAWB 1G6UA 1SA0B 5LP6B 1TAEA 3MAQA 3U11A 1FFXA 4O2BB 3HKDB 4DR3B 1RSOA 2F1MA 2PY5A 3JSLA 1WNSA 4DK1A 1YEWA 3JASA 5IYZA 3N2KA 1VF7A 3UQ8A 3BAAA 4LF8B 3JARB 4GLXA 4B3RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P22 C;  3SJB C;  3B2E E;  3ICX A;  3QG5 A;  3SJC C;  3ZS8 C;  3QF7 A;  2JS5 A;  1SKV A;  3SJA C;  2F66 C;  3CSX A;  2CAZ C;  1X4T A;  3THO A;  1NT2 B; 
#chains in the Genus database with same CATH topology
 2P22 C;  4TSF G;  4CBC A;  2WA4 A;  1ROP A;  5CBF A;  2Y4U A;  4LBE C;  2X6A A;  5CA0 A;  4GCZ A;  1SS3 A;  1PV0 A;  4MVO A;  4KXR A;  4UB6 Z;  2OYQ A;  1WP7 A;  3IFX A;  1Q90 D;  2RMK B;  4DR7 B;  3W7T A;  2F66 C;  5D5Q A;  2UUA O;  2VQF O;  1UJW B;  4J11 A;  1A32 A;  4OPA A;  5J2T B;  4FM1 A;  4JI3 B;  1HNX O;  3AEI A;  5L3G A;  5CA1 A;  4I9W A;  4U7N A;  1Q43 A;  4LFA B;  4PV1 B;  1COW G;  5IWA B;  1R6T A;  1NZ6 A;  1RSO B;  3CCS V;  1BE3 H;  2ZIN A;  4DK0 A;  1F51 A;  4LWS B;  4WFE A;  1TVK A;  2F4V B;  1HNW B;  5JVD B;  2OT5 A;  2R9I A;  4DR3 O;  1KKD A;  5CN0 A;  5JH7 A;  4BR6 A;  4P2Z A;  5CA1 B;  3QTC A;  4DV6 B;  1S72 V;  2P67 A;  2WWW A;  4X8A A;  3GWO A;  1WA8 A;  4FJC C;  5IJ0 A;  4DR6 B;  3Q4H B;  5B5E Z;  2W6I G;  3T2M A;  5B66 Z;  3BA9 A;  3UCS C;  2UXD B;  4DO2 A;  4LF7 B;  4K8X A;  1IUR A;  4LF7 O;  5CA0 B;  3K0G A;  5IYD O;  3CMA V;  3OMN B;  3B8N A;  3E8H A;  2M6Y A;  1KD1 W;  3ZMV A;  1VQP V;  4IIJ B;  2IH3 C;  3CRA A;  2GV9 A;  1W0J G;  4UVC A;  4YY3 O;  5AG2 A;  3OMA B;  1XOU A;  4LR3 A;  4GX1 A;  5E1A C;  1O9G A;  1L0L H;  1VAR A;  2QTO A;  3T1H B;  2YIB D;  4RAI A;  3ZHR A;  4JI6 O;  3DTU B;  5JJJ B;  2ZXW B;  3SYP A;  3S3X A;  2IU3 A;  3ZHV A;  1D2D A;  3WB0 A;  3I56 V;  3IJ4 A;  1DLB A;  4DYL A;  3HB3 B;  2WLI B;  3JAW A;  4JF3 A;  1ORQ C;  1K4C C;  1GK9 A;  1PP9 H;  5L3F A;  3ABL C;  1YXB A;  4FVM A;  1HNZ O;  2QM8 A;  4KP4 A;  4DR2 B;  1VQ9 V;  1CPY A;  3L75 H;  1MOF A;  3ZS8 C;  2QWR B;  4IHJ B;  3CME V;  1NKD A;  3CRC A;  4HNA A;  1LUW A;  4I55 B;  2YDE A;  4NVP A;  2CH7 B;  4I7Z B;  1RFY A;  3LDC A;  2VWK A;  3CX5 F;  2CTP A;  1YJ9 V;  1Q82 W;  3N27 A;  2PUS A;  1SQG A;  4JI7 B;  1EN5 A;  1N33 O;  2P6J A;  3FB6 C;  3STZ C;  2P4V A;  1K73 W;  1FAF A;  1OCR B;  3ZHU A;  3SYO A;  2NN4 A;  3CCQ V;  3OR6 C;  3FX7 A;  3WB2 A;  3OM3 B;  1K9M W;  5LXT A;  1Q8I A;  3BCC H;  4DUY O;  3TXS A;  4JI6 B;  1V55 C;  3VOU A;  4MVR A;  3ASN B;  1L0N H;  4JTC B;  1BQ0 A;  1AP5 A;  1JJO A;  3CCL V;  4X1Y A;  3CS5 A;  2AGA A;  3VQX A;  1LR1 A;  5IJ0 B;  4PDL A;  2Q7E A;  1QR9 A;  5B1A B;  1DTO A;  4XDL A;  2QM4 A;  1B06 A;  4KFM A;  1S5L Z;  3ZBH A;  1NJI W;  1VQ6 V;  4TV9 A;  3A0H Z;  3ABU A;  4JI0 B;  2GTA A;  2LGQ A;  4R8C A;  5JVD A;  4FPP A;  2YI9 A;  2D2C B;  4CS3 A;  3ETE A;  2EIN B;  1R6N A;  1SRY A;  3FYI B;  4X88 A;  4DW0 A;  4QIW F;  1XMQ O;  3OEE G;  4D7S A;  1R73 A;  2ADQ B;  4JYC A;  1YJN V;  1IBL B;  1N36 O;  3OTO B;  1V54 C;  3OUS A;  1P4R A;  3F5T A;  3F7V C;  4FZ1 A;  1IXM A;  1VQN V;  3QNE A;  3DC6 A;  1XL4 A;  2DWD C;  1HNZ B;  1TA8 A;  5J2T A;  1PM9 A;  4FM2 A;  2ETN A;  3HPL C;  1GM7 A;  3VQY A;  4N23 A;  4YIP A;  1MA1 A;  3B8M A;  2XTA A;  2QWN B;  5KHK A;  2JVD A;  5JCO C;  2QA4 V;  3JAL A;  4DR6 O;  1N34 O;  4J7J A;  1IBL O;  5A9G A;  2K1E A;  3IC7 A;  1FXK C;  2OCC C;  1MSW D;  4PA6 A;  3BFR A;  1PKX A;  1K33 A;  1X59 A;  4I50 A;  3CXC U;  2JRI A;  1N8R W;  3STL C;  2QWQ B;  4N21 A;  2WAM A;  4WFH A;  2JIZ G;  3AG1 C;  2W0X A;  2Y48 A;  1OV9 A;  2HKO A;  5FNV A;  5KA5 A;  4F4L A;  4YJ2 B;  2IW5 A;  2OIE A;  4LF9 O;  3A2F A;  3ZMS A;  5J9P C;  4MS2 A;  1E1R G;  2RN9 A;  1ZL8 A;  4AI8 A;  4I4T A;  4LF4 O;  5EBW C;  3RGB A;  3CP1 A;  4AHC A;  3ZJZ A;  1LUV A;  1XRE A;  1VF6 A;  3VQV A;  2L6L A;  1YHQ V;  1WB8 A;  1FJG O;  2ZE5 A;  2ATK C;  2OTJ V;  4IIJ A;  5JQG B;  3P3P A;  2Z3Y A;  5C8Y B;  4KHP O;  4GZR B;  1D5A A;  2WLK A;  4LF6 B;  3DC5 A;  3A0B Z;  3BHP A;  1JX9 A;  4X65 O;  1EN4 A;  1ZSP A;  1Z5W A;  5L3C A;  3ZRV A;  3T4D A;  5IY5 B;  4YJ3 B;  1VIB A;  3G80 A;  2DW4 A;  4PD4 F;  5KUM A;  2YI8 A;  5JJE B;  1Y74 A;  4A5U B;  4ZIB A;  4MTX A;  5KUK A;  2EIK C;  3K08 A;  4O2A B;  4FIP C;  1SA0 B;  1OCC C;  5LP6 B;  4DUZ O;  4U7O A;  4LWS A;  1ZX3 A;  2Q69 A;  1OCO C;  3G6B A;  3CRR A;  4FMT A;  2ZQM A;  1RSO A;  1SZX A;  2KSD A;  2F1M A;  5CBG A;  4BIU A;  1SQQ H;  3AG2 B;  1WNS A;  2XOK G;  1NS1 A;  2XND G;  4E4E A;  1VF7 A;  4LF8 B;  4DV4 O;  2Q5Z A;  2YXH A;  3OUF A;  1SKV A;  4IT5 A;  2YIB A;  1XHZ A;  2BOB C;  3HR0 A;  5IT9 N;  1K34 A;  2JS3 A;  2XT9 A;  1K3E A;  1Y67 A;  3E83 A;  4DV5 O;  1BL8 A;  2OCC B;  3HKE A;  1SF9 A;  1KB9 F;  2VQE O;  1PL0 A;  3LSQ A;  3ASO B;  4U3J A;  1YI2 V;  1FXK A;  1XUQ A;  5DEC A;  2ZXW C;  3C90 A;  2JJ1 G;  2A79 B;  1KQS U;  4B3T O;  1QVF U;  3K5O A;  3UO3 A;  2CGN A;  4QJF B;  1KKC A;  2BTQ A;  1QR8 A;  3EVK A;  1UFI A;  3JAS B;  4MSW C;  2CGO A;  4NB5 A;  3AG3 B;  5KMG B;  4LFC O;  4LC1 A;  1FXV A;  1IDS A;  2C2A A;  4LP8 A;  4WFF A;  1N32 O;  1XEQ A;  3WG7 B;  1I7F A;  5LYJ A;  3ZRX A;  2PI5 A;  1G4Y B;  2WLJ A;  3WG7 C;  3PJS K;  1GN2 A;  5L3B A;  4WFG A;  2PYL A;  2E5L B;  4X64 B;  2YEV B;  2E3C A;  5J2U B;  1N4C A;  2HJF C;  3D3Q A;  1TUB B;  1R3K C;  4J9Y B;  4FK5 C;  3D3I A;  3CE2 A;  4JI3 O;  1HNX B;  2UUC O;  1FXK B;  4YHH O;  3T1Y B;  2QM7 A;  4U3J B;  2A7W A;  3J80 N;  4EKW A;  1PL4 A;  4DV1 O;  2N04 A;  3ML0 A;  4G28 B;  3CCE V;  4IYI A;  4JV5 B;  1NQT A;  1BCC H;  1GH6 A;  2YS8 A;  4H33 A;  2KG7 A;  3MHH C;  3K9S A;  1S5J A;  1JOY A;  3ZRW B;  4LF5 O;  3PN1 A;  1EN6 A;  1FPO A;  2R70 A;  1Z5V A;  4UCT A;  1BSM A;  2EIM B;  4BWA A;  5EYP B;  2WA3 A;  2DYR C;  3HKD A;  2QWP B;  4AQY B;  4JI5 B;  4H0L B;  2GBO A;  1AP6 A;  1ZWI C;  4IL6 Z;  1AB3 A;  3L70 H;  4NXM O;  5CMU A;  4H13 B;  4LF4 B;  1KUQ A;  1ZTE A;  1GN6 A;  1VQM V;  3SPC A;  4JI1 B;  2CTR A;  1DGS A;  4MTO A;  1KEC A;  1M57 B;  2DMX A;  1E1Q G;  3OD4 A;  4JTD B;  4DV2 O;  3OGI B;  4JGS A;  2BCC H;  4DV5 B;  2A9H A;  3CJH B;  5H9C A;  3KZI Z;  3RBZ A;  1VQ5 V;  1K4D C;  3K59 A;  4YJ3 A;  3DXR A;  3CJH A;  2M7W A;  1JR9 A;  1YCI A;  1M90 W;  2ITC C;  1O9H A;  2HR3 A;  2AHY A;  2ILM A;  1R3L C;  5FPR A;  2JEU A;  5C8Y A;  1N36 B;  2Z0A A;  4X89 A;  5CB4 B;  4JYB A;  4LFA O;  3UO2 A;  3H1J H;  5B1B B;  1RM1 C;  2B1I A;  1SES A;  2EBO A;  3SGI A;  1XQ8 A;  2Q0O C;  1PD3 A;  1L1F A;  2EIM C;  2FYU H;  4WFA V;  5LHI A;  3JSN A;  2GDS A;  1AJQ A;  1TUB A;  3UKM A;  4I9Q A;  1CEZ A;  3G67 A;  5EBM C;  1QBZ A;  3X2Q C;  1IZ3 A;  1NTZ H;  2ZE6 A;  1B6Q A;  3BRC A;  2Y4T A;  3IAY A;  5KHI A;  4ZBM A;  3L71 H;  4TV8 A;  5FNV B;  5BZB A;  1NVP B;  4ZOL A;  4X65 B;  1FXH A;  5C93 A;  2DQ0 A;  5LA6 B;  1L8D A;  3H1I H;  4W4L A;  4UVB A;  1VQO V;  3N2G B;  2YIC A;  5KMG A;  3QF7 A;  1VQ7 V;  4X9Q A;  1US6 A;  4B3S O;  2XAS A;  2A06 H;  3JCZ A;  4P30 A;  4TQF A;  1IX9 A;  4ASU G;  1YF2 A;  3MDS A;  3TET A;  4J42 A;  3ZCC A;  2DOS A;  1QQC A;  2WSS G;  4TWK A;  4OGQ B;  4PDV A;  1IBM O;  1WP8 A;  4K8Z A;  3ETQ A;  2HVJ C;  4QNH B;  4DUY B;  1N33 B;  1HWY A;  5FLX N;  3AG4 C;  2PZS A;  3RYC A;  3E89 A;  4JI8 B;  3BAB A;  2IM9 A;  1N0J A;  4DV7 O;  1NH2 B;  2QEX V;  4O4H A;  1AJN A;  1WPX A;  1EBO A;  4LH6 A;  2VRZ A;  3QVN A;  4DUZ B;  4CH5 A;  3WB1 A;  5B3S C;  5DM6 V;  3CHX A;  1YTF D;  3ZMZ A;  4NXN B;  3SYA A;  1RP3 B;  3SJB C;  3M8A A;  3FB5 C;  1K8A W;  2EX3 A;  4JI4 B;  1SA0 A;  1V55 B;  5EC2 C;  2AHZ A;  3QO8 A;  3RWR D;  2H3O A;  3AK2 A;  1KU9 A;  1BMF G;  2V7Q G;  1Y74 B;  2LFS A;  3OT7 A;  3JD0 A;  4EB6 A;  4DV7 B;  3R65 A;  5KX5 B;  4B7E A;  2E76 B;  1W59 A;  3UM7 A;  1DF4 A;  4R50 A;  4B08 A;  1JPX A;  5GW7 A;  3FFQ A;  5DED A;  1R1B A;  5IDJ A;  1XIL A;  3LDD A;  3ZHQ A;  4QGP A;  2JGU A;  1RPR A;  3CCR V;  3ICX A;  4MVS A;  2Q4P A;  5CA3 A;  4GKJ O;  1Q81 W;  5LXT B;  3OGC C;  3W7U A;  2JS5 A;  3CB2 A;  2YIA A;  2YUA A;  1KC8 W;  3H9V A;  4I4T B;  4J7Z A;  2GTS A;  4LFB B;  1QLE C;  4G27 B;  4YJ2 A;  4DR5 O;  2KG7 B;  1SZT A;  1Q6I A;  5K1P A;  3UT5 B;  2OIG A;  4UCR A;  1HW7 A;  4NTW A;  3ETD A;  2EIK B;  4DV6 O;  1WB7 A;  5KHG A;  4K0K B;  3K0D A;  1I5X A;  3JD2 A;  4ABM A;  2Q0A A;  2L35 A;  1THZ A;  1JQ0 A;  3P32 A;  4ZHQ B;  2CDY A;  2N74 A;  4I50 B;  1ZL8 B;  4O4J B;  3AG7 A;  4LNU B;  1GN4 A;  5J2U A;  4IGG A;  3CC7 V;  2YEV A;  3LUT B;  4IHJ A;  5B3S B;  4L8J A;  5EBL C;  4NTX A;  2JJ2 G;  3R66 A;  3L73 H;  4FFB B;  4DRX A;  5KLV H;  4PI0 A;  1BGY H;  2UXB O;  4WFB V;  3JAW B;  1G6U A;  2HG5 C;  4G2K A;  4HAM A;  4MTF A;  3L9D A;  2OTL V;  2QE7 G;  1NH2 D;  4DR3 B;  1OCR C;  2DYS B;  3B09 A;  1GN3 A;  2Y69 C;  2JK5 C;  1YEW A;  3JAS A;  4UVA A;  2B1G A;  3BAA A;  1QNM A;  1MAB G;  4DW1 A;  4R7C A;  1JA8 A;  3BEH A;  3ETG A;  2IBZ H;  3OTF A;  5BMV B;  2DJV A;  1GTO A;  2Q8V A;  3HKC B;  2QSA A;  4DV1 B;  3FB7 C;  5F2V O;  1YIJ V;  1GAX A;  2UUB B;  2UU9 B;  3KCX A;  4K3A A;  4UB8 Z;  3E22 B;  3IGA C;  1QCE A;  4ICG A;  3RYF A;  1R3I C;  3LDE A;  2WPD G;  2UUA B;  3D36 C;  2FML A;  2GUZ A;  2Q68 A;  1I0H A;  4JI4 O;  1FS0 G;  2XAF A;  1KBH A;  5EZY B;  1M9N A;  3WFV A;  1P7G A;  2B9Z A;  4HBN A;  3T1H O;  2F23 A;  4FZ0 A;  2DWE C;  3C3S A;  2ITD C;  5E79 Z;  2ZNI A;  3LNM B;  3RVY A;  4KL1 A;  1GKF A;  3RT3 C;  1H38 A;  4JI8 O;  1ZAU A;  3ASO C;  2ADP A;  4HZ3 A;  1FFX B;  4J10 A;  1XNR B;  1H2L A;  5GTH Z;  1Q6U A;  2Z5U A;  5LGU A;  2P90 A;  1AI6 A;  5B1O A;  2W6J G;  2ZIO A;  3ZN1 A;  2XUM A;  1AR1 B;  1QVG U;  4TV9 B;  3B77 A;  4CC5 A;  1S0V A;  2WLM A;  1MZF A;  4CS4 A;  4OPH A;  5EZY A;  5LMN O;  5LGT A;  1YZB A;  2CUG A;  1AIL A;  1QLN A;  3LNN A;  2HFE C;  1Y76 A;  2ZR3 A;  2A3Q A;  2LJ2 A;  3A8T A;  4FFK A;  1F23 A;  4X1K B;  2ZE8 A;  5D5P A;  2LGW A;  2B5U A;  3SR2 C;  3HKC A;  3BPZ A;  4FLY A;  1T5E A;  3ABK C;  4MVU A;  3JAM N;  3F7Y C;  1XHX A;  3SYQ A;  2RCV A;  5GON B;  3OE7 G;  1LNQ A;  1QLE B;  4I55 A;  2EJR A;  2EZO A;  5IJ9 A;  4GKK O;  3F5W C;  1E79 G;  1Q6H A;  3I55 V;  3SJA C;  3K3W A;  2ZDI C;  2HP8 A;  1PNK A;  4DV4 B;  4JI5 O;  1FKA O;  2JGD B;  1VP7 A;  5IYC O;  1NR7 A;  2BOC C;  2ZE7 A;  2Y0I A;  3CC2 V;  1XNR O;  4JZ2 A;  1X4T A;  4DV2 B;  5LBQ A;  2DQ3 A;  1NVP D;  3E86 A;  3O65 A;  1NI8 A;  4JYY A;  3M7M X;  1OJH A;  4DXW A;  4QPJ A;  5IJ9 B;  2CAZ C;  4X1I B;  3L72 H;  3JD1 A;  3J7A U;  3H1L H;  4MTG A;  3GWK C;  1BHB A;  4K35 A;  2QGN A;  1Q86 W;  1M56 B;  2P06 A;  4BAY A;  1PNM A;  2H94 A;  2XAJ A;  1BS3 A;  4XDK A;  2ZDI A;  1H2M A;  4JI2 B;  4YHH B;  3B40 A;  1GM8 A;  3H01 A;  4U3F H;  2EZP A;  1P84 F;  3JD3 A;  4UFZ A;  1XDC A;  2ZR2 A;  2PF4 E;  5BR8 O;  3TK1 A;  5LHH A;  2R9A A;  4I0X A;  3Q4H A;  4JYA B;  4GX2 A;  4J41 A;  2ODM A;  5GON A;  3FYE B;  2QDO A;  4GUN A;  2MW2 B;  2OCH A;  1VEW A;  4X66 B;  5LL6 Y;  3K5L A;  5LP6 C;  3J81 N;  1RPO A;  4L87 A;  4NTY A;  2CK3 G;  2LW7 A;  3SJC C;  3OEH G;  1H8H G;  1HDJ A;  5LGN A;  1HR0 O;  1H2S B;  1XMO O;  3ZHS A;  2YXY A;  5ITZ B;  4DR2 O;  4QE7 A;  2UXD O;  4FLV A;  1IBK O;  5BR8 B;  2UU9 O;  1GRJ A;  2Q7H A;  3K04 A;  3QO7 A;  3CCV V;  4UUJ C;  2YSU B;  2IJJ A;  1H2G A;  5JH7 B;  5IY5 C;  1M93 A;  1I5Y A;  2ZM6 O;  3CCJ V;  5LMU B;  5EIB C;  2EJ7 A;  2JEX A;  3L74 H;  1F4M A;  1WLE A;  3W7S A;  4K0K O;  3I5D A;  5ITZ A;  4RWU A;  3K06 A;  4JAU A;  2RNB A;  3CEI A;  3T4Z A;  4YXW G;  1YVW A;  1MZE A;  4GKK B;  3ZIA G;  3C3T A;  3FD9 A;  2RQ6 A;  3AK3 A;  1J5E O;  1J5E B;  1JMK C;  1OHH G;  1I94 O;  3APQ A;  2F43 G;  4UCO A;  4QPK A;  2EIL B;  2UXB B;  3OAA G;  2R9R B;  1ZUQ A;  3DSQ A;  2EIJ C;  2WLH A;  3GB7 C;  4I0X B;  2X7R B;  4J80 A;  2PYJ A;  4JAA A;  3RYF B;  1WAZ A;  3K03 A;  1B3Q A;  2QWO B;  3W7W A;  3KCY A;  5LOV B;  3CSX A;  1ENV A;  2BTO A;  4B3R O;  3NR7 A;  4FFB A;  2DYR B;  2KB1 A;  4OXS A;  4FLT A;  1UPG A;  4JAV A;  2LW1 A;  1VMG A;  1NR1 A;  2F95 B;  2Y0P A;  5JJN B;  3K79 A;  1TGO A;  3N2K B;  1F4N A;  1YIT V;  2HLD G;  4O4J A;  5IWA O;  1GO3 F;  4FLX A;  2UUB O;  1KP2 A;  1KYO F;  3ABM C;  5L3E A;  2HEP A;  4PA3 A;  3N2G A;  4CS2 A;  4UV9 A;  2HVK C;  1W0K G;  5A2Q N;  1OZ0 A;  2AZ2 A;  4R6Z A;  4B3T B;  1JVM A;  2XAG A;  2XHB A;  3CXH F;  5LHG A;  3RYH B;  4NXN O;  2JGD A;  4PDR A;  3A0R A;  1Y66 A;  5IYB O;  3QO5 A;  5CBH A;  3B4S A;  2CTW A;  3EXA A;  3BA8 A;  3JAT B;  4BIO A;  4UCU A;  5GTI Z;  1EM1 A;  4MT8 A;  4CH3 A;  1S77 D;  2Q7G A;  3ZX6 A;  4B3M O;  1PNL A;  4TQD A;  4UV8 A;  3JD4 A;  4CZZ A;  1WN7 A;  1BZK A;  1TUE B;  3EHB B;  4WBN B;  2W0F C;  4EFB A;  4NYK A;  4W4K A;  4LF6 O;  4DV3 O;  4X1K A;  1MG1 A;  4DR7 O;  2GSM B;  2LQT A;  4FLU A;  1Y76 B;  2YXL A;  4RQE A;  1D5N A;  5BY1 A;  2H8P C;  3H1H H;  1OCZ C;  3GVM A;  3OW2 U;  1WA8 B;  4H37 A;  4QE9 A;  1XI1 A;  4RQF A;  3SPG A;  2DN9 A;  1SER A;  3CYO A;  2IJH A;  2ZIM A;  3VQW A;  4EEQ A;  3SJQ C;  4B3M B;  1ARO P;  3CCU V;  3SPJ A;  1TVK B;  1VQ8 V;  1RM1 B;  1AI4 A;  3TJT A;  1MSD A;  3MAQ A;  5TIS Z;  3U11 A;  1FFX A;  4O2B B;  3H1K H;  3HKD B;  2WLN A;  1ZLZ A;  4D6T H;  2HHH O;  2PY5 A;  4RUE A;  1VF6 C;  3JSL A;  3VBB A;  3X2Q B;  3NXS A;  5IYZ A;  3UQ8 A;  3FB8 C;  4LF8 O;  4JAS A;  3JAR B;  2P5O A;  4B3R B;  1M57 C;  4PDM A;  5KA6 A;  1N32 B;  4O4H B;  3ZRW A;  1XMO B;  2DYS C;  2E74 B;  1F7Y A;  2GUZ B;  1SQB H;  3RYC B;  1BT8 A;  1AR5 A;  3TXQ A;  3BVO A;  1DK1 A;  3RVZ A;  3ZMT A;  3RW0 A;  3AK1 A;  4ZI7 B;  5EIB D;  3E22 A;  4TT3 G;  3RYI A;  3ZHT A;  3JAK A;  3E2E A;  4JI0 O;  3SDL A;  2ZM6 B;  3OR7 C;  1B04 A;  2RDC A;  2EUL A;  4O4L B;  5BMV A;  1VQ4 V;  5H5N A;  1H2N A;  1U96 A;  3M99 B;  2P7T C;  3E35 A;  4UCV A;  3APO A;  1SQX H;  4NKG B;  2UXC O;  3TCU A;  1M1K W;  2ZT9 B;  5B1N A;  3RN4 A;  4TUY B;  3SPH A;  4AQY O;  1AI7 A;  1GMG A;  1V9P A;  4AIL C;  1OCO B;  2FTK A;  4E2L A;  4GX0 A;  2GHY A;  3OFN G;  4I5S A;  2KQX A;  2DE0 X;  2NR5 A;  1K97 A;  4PA7 A;  4LFB O;  1XNQ B;  2F4V O;  1DF5 A;  3SYC A;  3ABK B;  4DRX B;  1Q7Y W;  4ZKI A;  3ZRS A;  4TUY A;  2VWJ A;  2FKX A;  3AG4 B;  2BTQ B;  5KHJ A;  4MVZ A;  5KHH A;  4FM0 A;  4LNU A;  2VQF B;  3ZN0 A;  3KKY A;  2WLL A;  1NTK H;  1JFF A;  3S3W A;  4Z1M G;  3CWB H;  1AI5 A;  4NXM B;  4ZHQ A;  2UUC B;  4H44 B;  4PA4 A;  4X20 B;  4JI2 O;  4JI7 O;  5HFL A;  4GX5 A;  4JI1 O;  3WU2 Z;  1NTM H;  3JAK B;  2UXN A;  3RYI B;  3EFF K;  1JJ2 U;  3LSU A;  3HKB B;  3HKE B;  1IBK B;  2XAH A;  4JV5 O;  2K9P A;  3UT5 A;  3P3N A;  4TV8 B;  2Q6A A;  4CH6 A;  1S76 D;  3FKS G;  1HP8 A;  4P9P A;  3D8C A;  4LF5 B;  3AG2 C;  2VS0 A;  3OMI B;  4WCE V;  3MD0 A;  3FAV A;  3KG2 A;  5H2F Z;  1IBM B;  4F6R B;  4X64 O;  2UXC B;  1EZJ A;  3ZED A;  5H6R A;  1M4U A;  4O2B A;  5CB4 A;  2X6C A;  4O4I A;  1VQL V;  3K9A A;  4O2A A;  2FL4 A;  4LH7 A;  4O4I B;  1AVM A;  4FLZ A;  3SPI A;  4X62 B;  3E8G A;  2RJZ A;  5H6Q A;  4B3S B;  4BW9 A;  1YDX A;  5KX5 A;  1P7B A;  2E5L O;  4EB6 B;  4F6R A;  2OWO A;  3FAV B;  1OCZ B;  1OCC B;  4HYO A;  1XMQ B;  2YID A;  1Y6X A;  2ZNJ A;  1WPB A;  2UXX A;  3K5N A;  2V1D A;  2X6B A;  1YSC A;  4LF9 B;  2ZD9 A;  3CD6 V;  1W2B U;  4Q20 A;  5B1A C;  5EYP A;  2IJI A;  1KMI Z;  2BSK B;  1K7D A;  1SQV H;  2WLL B;  2QKC A;  1XNQ O;  3K58 A;  4BIZ A;  1Y4M A;  4DV0 O;  4NR1 A;  4DV0 B;  3JAT A;  3THO A;  2N05 A;  3OTO O;  2Q9L A;  4B7K A;  4GKJ B;  4EFE A;  2V4D A;  3QG5 A;  2IU0 A;  4CH4 A;  5LMN B;  2D3O W;  3K5M A;  5JCO A;  3HKB A;  5LYJ B;  2Y69 B;  1N34 B;  1I94 B;  2Q73 A;  2QJ1 A;  2EIN C;  1V54 B;  4IYH A;  4DR1 B;  2Q67 A;  3CRM A;  1JFF B;  1FJG B;  5L3D A;  1NBM G;  3ABM B;  4MW8 A;  4PEL A;  2EIL C;  5FPO A;  3IC9 A;  4BW5 A;  1M5I A;  1VF5 B;  3ABL B;  3O9O A;  3CC4 V;  2X0L A;  3B2E E;  3K57 A;  4XDJ A;  4F6E A;  1H2K A;  1IVS A;  5LMU O;  4YY3 B;  2PGG A;  2F93 B;  2AZ0 A;  3JAL B;  1QHT A;  1NT2 B;  1U97 A;  5LA6 A;  1P49 A;  3T1C A;  5LOV A;  2QR4 A;  4ZI7 A;  4ZOL B;  5B1B C;  1R6K A;  1I08 A;  4UXN A;  2EIJ B;  1AR4 A;  1CXZ B;  2LP7 A;  3D36 A;  4C7U A;  1WJZ A;  1HR0 B;  2JDI G;  3P30 A;  4WF9 V;  4JYA O;  3JAR A;  1K5Q A;  3LSS A;  1AJP A;  3MHS C;  4O4L A;  3U10 A;  4X62 O;  5IYZ B;  2BSK A;  4YIO A;  4Z1V A;  4TOI A;  3E8B A;  2A0L A;  3TGU H;  4KHP B;  1SQF A;  4DV3 B;  1FYJ A;  1XL6 A;  4JTA B;  2CE4 A;  2G38 A;  1KP3 A;  5LP6 A;  2LO1 A;  2AXT Z;  2CTQ A;  1K92 A;  4MW3 A;  2BE3 A;  3T1Y O;  4Q6G A;  1SC5 B;  5EC1 C;  3ASN C;  5DN6 G;  1N0N A;  3AG1 B;  3DXR B;  2XAQ A;  2ARH A;  1VQK V;  4DR4 O;  1Z2G A;  4LFC B;  2ZKO A;  4J7K A;  1YJW V;  3ZMU A;  1SQP H;  4LCU C;  3G71 V;  5IE9 A;  4D7T A;  3E8F A;  1NU1 H;  1IXB A;  4X1Y B;  4RO2 A;  4UCS A;  4OX9 B;  4FLW A;  1JCH A;  2HHH B;  4RUF A;  5JQG A;  2QKA A;  4Z2W A;  2IJK A;  3CCM V;  4J9Z B;  3G4S V;  4MVQ A;  4WBN A;  1PPJ H;  2QKS A;  4GYC B;  4XBF A;  4GT1 A;  4MVM A;  4PI2 A;  1K5S A;  2P4K A;  5HFM A;  1GM9 A;  2HJD A;  2LFR A;  3RFR A;  2NLJ C;  1Q3E A;  3U0Z A;  2MK3 A;  3JYC A;  4DR1 O;  3ABT A;  4PHZ A;  2E75 B;  5EK0 A;  1FFT B;  2NNU A;  5FL7 G;  1HNW O;  3JCU Z;  4DR5 B;  2VQE B;  2R72 A;  3RYH A;  2PTM A;  1H8E G;  1MNG A;  1BHA A;  2YC0 A;  1G8M A;  1R3J C;  1BQZ A;  1YTF B;  2O57 A;  4PA9 A;  1Q5O A;  4PJ0 Z;  3CPW U;  5KAI Z;  3AG3 C;  2PI4 A;  1URF A;  1G1X B;  4X20 A;  2CH7 A;  1FD9 A;  1CP9 A;  1EZV H;  3DGE A;  2ZCE A;  5K1X A;  1SET A;  4X1I A;  4HNA B;  1QU7 A;  4CC6 A;  1XBL A;  3W7X A;  5JWP A;  1M56 C;  4DR4 B;  4P9O A;  4KUM A;  2KKW A;  4JZG A;  5KAF Z;  2WLI A;  1TAE A;  1J95 A;  1S3J A;  2AW9 A;  4OX9 O;  4X66 O;  2IH1 C;  2QTS A;  1MMM A;  3BY6 A;  1S5H C;  5BXZ A;  3CRQ A;  2FB5 A;  1EFR G;  4DK1 A;  3G6E V;  4JPR A;  3N2K A;  4GLX A; 
#chains in the Genus database with same CATH homology
 2P22 C;  1N32 B;  1SKV A;  4O4H B;  1XMO B;  3OTF A;  5BMV B;  2YIB A;  1XHZ A;  3HKC B;  4DV1 B;  3RYC B;  5CA0 A;  2UUB B;  2UU9 B;  4ZI7 B;  5EIB D;  3E22 B;  3HKE A;  3E22 A;  2OYQ A;  3RYF A;  4U3J A;  3RYI A;  3JAK A;  4DR7 B;  2F66 C;  5D5Q A;  2ZM6 B;  2UUA B;  1B04 A;  4O4L B;  3K5O A;  5BMV A;  4FM1 A;  5J2T B;  4JI3 B;  4UCV A;  5EZY B;  4HBN A;  2BTQ A;  5CA1 A;  2ZNI A;  4TUY B;  1Q43 A;  3JAS B;  4LFA B;  4KL1 A;  1V9P A;  5KMG B;  1ZAU A;  5IWA B;  4AIL C;  2ZIN A;  4DK0 A;  1FFX B;  1XNR B;  1I7F A;  5LYJ A;  1XNQ B;  1TVK A;  4DRX B;  1HNW B;  2F4V B;  5JVD B;  2ZIO A;  4TUY A;  2VWJ A;  2PYL A;  4TV9 B;  5JH7 A;  2E5L B;  4X64 B;  4CC5 A;  5CA1 B;  4CS4 A;  2BTQ B;  2E3C A;  5KHJ A;  5KHH A;  3QTC A;  5J2U B;  4FM0 A;  4LNU A;  5EZY A;  2VQF B;  4DV6 B;  1TUB B;  1JFF A;  5IJ0 A;  1HNX B;  4ZHQ A;  4NXM B;  2UUC B;  4X20 B;  3T1Y B;  4DR6 B;  3LNN A;  3JAK B;  4U3J B;  3RYI B;  3HKB B;  3BA9 A;  3HKE B;  1IBK B;  2UXD B;  4LF7 B;  4X1K B;  4K8X A;  4JV5 B;  5D5P A;  5CA0 B;  3UT5 A;  4TV8 B;  3SR2 C;  3HKC A;  3BPZ A;  4FLY A;  4CH6 A;  4IIJ B;  1T5E A;  1S5J A;  2GV9 A;  3PN1 A;  4LF5 B;  1XHX A;  5GON B;  2R70 A;  1Z5V A;  1IBM B;  4F6R B;  4LR3 A;  4UCT A;  4I55 A;  1O9G A;  4BWA A;  5EYP B;  5IJ9 A;  3T1H B;  2UXC B;  2YIB D;  3SJA C;  5JJJ B;  3HKD A;  3ZED A;  4AQY B;  1M4U A;  4JI5 B;  4DV4 B;  4O2B A;  3WB0 A;  5CB4 A;  4O4I A;  3JAW A;  4LF4 B;  4JI1 B;  1DGS A;  4O2A A;  4FVM A;  1X4T A;  4LH7 A;  4O4I B;  4DV2 B;  4DR2 B;  4FLZ A;  4X62 B;  3ZS8 C;  4DV5 B;  4IHJ B;  2RJZ A;  4B3S B;  3M7M X;  4BW9 A;  5KX5 A;  4HNA A;  5IJ9 B;  2CAZ C;  4X1I B;  4I55 B;  3K59 A;  4EB6 B;  4YJ3 A;  4F6R A;  4NVP A;  2OWO A;  1O9H A;  2VWK A;  1XMQ B;  5FPR A;  2ZNJ A;  4JI2 B;  2PUS A;  1SQG A;  4YHH B;  4JI7 B;  1WPB A;  3K5N A;  5C8Y A;  1N36 B;  4LF9 B;  5CB4 B;  4UFZ A;  2R9A A;  3SGI A;  1XQ8 A;  5EYP A;  4JYA B;  1KMI Z;  3WB2 A;  3JSN A;  5GON A;  1TUB A;  3K58 A;  4I9Q A;  4DV0 B;  5LXT A;  4X66 B;  3JAT A;  1Q8I A;  3BRC A;  3THO A;  3K5L A;  5LP6 C;  5KHI A;  3IAY A;  4TV8 A;  4JI6 B;  4GKJ B;  5FNV B;  4EFE A;  2V4D A;  3QG5 A;  3SJC C;  4CH4 A;  5LMN B;  4ZOL A;  4X65 B;  3K5M A;  5JCO A;  1JJO A;  3HKB A;  5LYJ B;  4X1Y A;  1N34 B;  1I94 B;  1H2S B;  5LA6 B;  1L8D A;  2QJ1 A;  3VQX A;  5ITZ B;  3N2G B;  5IJ0 B;  5KMG A;  2Q7E A;  3QF7 A;  4DR1 B;  1JFF B;  4FLV A;  1FJG B;  5BR8 B;  2QM4 A;  5FPO A;  2Q7H A;  1M5I A;  5JH7 B;  4TV9 A;  3B2E E;  4TQF A;  3K57 A;  4JI0 B;  1M93 A;  5JVD A;  5LMU B;  5EIB C;  2YI9 A;  4YY3 B;  1QQC A;  2PGG A;  2F93 B;  3JAL B;  4CS3 A;  1QHT A;  5ITZ A;  1NT2 B;  5LOV A;  5LA6 A;  1P49 A;  2P5O A;  4D7S A;  4K8Z A;  3ETQ A;  1IBL B;  4DUY B;  4ZI7 A;  1N33 B;  4ZOL B;  4GKK B;  3OTO B;  2PZS A;  3RYC A;  2RQ6 A;  1J5E B;  4JI8 B;  3BAB A;  1JMK C;  2IM9 A;  1HR0 B;  4O4H A;  4UCO A;  1HNZ B;  1TA8 A;  2UXB B;  3JAR A;  4LH6 A;  5J2T A;  4O4L A;  3U10 A;  5IYZ B;  3DSQ A;  4FM2 A;  4DUZ B;  3VQY A;  4CH5 A;  3WB1 A;  4TOI A;  3CHX A;  2PYJ A;  4KHP B;  3RYF B;  1SQF A;  4DV3 B;  5KHK A;  2JVD A;  4NXN B;  3SJB C;  5LOV B;  5JCO C;  3CSX A;  5LP6 A;  2EX3 A;  3JAL A;  1SA0 A;  4JI4 B;  2BTO A;  4FFB A;  3RWR D;  4Q6G A;  4FLT A;  2F95 B;  5JJN B;  1KU9 A;  1TGO A;  3N2K B;  4EB6 A;  4LFC B;  4O4J A;  4FLX A;  4DV7 B;  4I50 A;  5KX5 B;  2HEP A;  3N2G A;  4CS2 A;  4D7T A;  4B08 A;  4X1Y B;  4B3T B;  4UCS A;  4OX9 B;  3FFQ A;  4FLW A;  2XHB A;  5FNV A;  2HHH B;  3RYH B;  5JQG A;  2JGU A;  3ICX A;  4WBN A;  4YJ2 B;  3BA8 A;  3JAT B;  4GYC B;  5LXT B;  4UCU A;  3A2F A;  4CH3 A;  4PI2 A;  2JS5 A;  2Q7G A;  3CB2 A;  2YIA A;  4I4T A;  3RGB A;  4AHC A;  3RFR A;  1Q3E A;  3U0Z A;  4I4T B;  4TQD A;  3VQV A;  4PHZ A;  4LFB B;  1WN7 A;  4YJ2 A;  4WBN B;  4IIJ A;  4DR5 B;  2VQE B;  5JQG B;  2R72 A;  3RYH A;  2PTM A;  5C8Y B;  4EFB A;  5K1P A;  3UT5 B;  1HW7 A;  4UCR A;  1D5A A;  4X1K A;  4LF6 B;  1Q5O A;  3BHP A;  5KHG A;  4FLU A;  4K0K B;  2YXL A;  2Q0A A;  1Z5W A;  4X20 A;  4ZHQ B;  4YJ3 B;  2ZCE A;  4I50 B;  5K1X A;  4X1I A;  4O4J B;  4HNA B;  1XI1 A;  4LNU B;  2YI8 A;  5JJE B;  5J2U A;  4CC6 A;  4IHJ A;  4DR4 B;  2ZIM A;  3VQW A;  4EEQ A;  4L8J A;  4ZIB A;  4B3M B;  4FFB B;  4O2A B;  1TVK B;  4DRX A;  2KKW A;  4PI0 A;  3JAW B;  1G6U A;  1SA0 B;  5LP6 B;  1TAE A;  3MAQ A;  3U11 A;  1FFX A;  4O2B B;  3HKD B;  4DR3 B;  1RSO A;  2F1M A;  2PY5 A;  3JSL A;  1WNS A;  4DK1 A;  1YEW A;  3JAS A;  5IYZ A;  3N2K A;  1VF7 A;  3UQ8 A;  3BAA A;  4LF8 B;  3JAR B;  4GLX A;  4B3R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...